2GZRA

Enterobactin and salmochelin hydrolase iroe
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
265
structure length
242
Chain Sequence
PNIADKGSVFYHFSATSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDDELLKQLSEKTPPVIVAVGYQTNLPFDLNSRAYDYTPAAERKSGGSNNFRQLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWLSSSYFRSYYSASPSLGRGYDALLSRVTAVEPLQFCTKHLAIMEGSAGVLSKIHTTLTILKDKGVNAVFWDFPNLGHGPMFNASFRQALLDISGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords IroE protein
publication title Structural Characterization of Enterobactin Hydrolase IroE.
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 242
sequence length 265
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gzrA00
3DJYA 1S8OA 4LIPD 2ZJ7A 2VJBA 5AK4A 4RNCA 1CFJA 4U2CA 3SC2A 2QM0A 3F8SA 2WUGA 1ORVA 3CCBA 1LPOA 1LPAB 2HA7A 4CCYA 3C45A 1QIMA 3WWOA 4L72A 4XWGA 1W76A 4EY7A 1ODCA 2DHCA 2GYVA 4NZZA 1CUWA 4QA9A 3AIOA 3R3YA 3IUNA 5C7YA 2JGJA 1E89A 1ORWA 3SK0A 4CG3A 4S0XA 4H7IA 4FWBA 1P0IA 4Y2XA 1Q83A 4ROTA 5JADA 2IIVA 2G63A 3BE8A 3DLTA 3H1AA 5JAOA 2BCEA 4F60A 1MNAA 4EY6A 4MEBA 2XUPA 3AINA 3F98A 3S8YA 1CIJA 4QEKA 3OC0A 3ZLUA 1YA4A 3WYDA 4X6YA 1J1IA 4UBJA 1XQXA 2Z3WA 3G9TA 5BV7A 4ZI5A 3O9MA 2XUQA 2DSNA 1G66A 2WFMA 3WWCA 1MN6A 1YB6A 2XQIA 4C4YA 3FNBA 3BF7A 1EXWA 2WUEA 4NS4A 2XQFA 3WIOA 1A7UA 3DOIA 3Q8WA 3VVMA 3W9UA 5FV4A 3HABA 1H2XA 3I2IA 5E4TA 5SYNA 1N5RA 2OCGA 2OLEA 4ITVA 2ORYA 4DNQA 1Y7HA 3F67A 4FKBA 3U0VA 3D2CA 3I2GA 3WI7A 4AMZA 2VF2A 3WL5A 3WIBA 3ICWA 3AIKA 1QOZA 1CUJA 4Y2SA 3KDAA 3ESAA 4X71A 5IVHA 5DYWA 5JZBA 5AI4A 1VXOA 5H3HA 1VXRA 1TK3A 4FFVA 4KE9A 1EA5A 7YASA 4ARAA 4JYMA 4I3FA 2PSHA 5ALLA 2XMDA 2OG1A 1VOTA 4B81A 4RGYA 3ICVA 1FFAA 5CT6A 3H2GA 3PUIA 3D2AA 3LIPA 4Y2UA 1JJFA 1GQRA 3I2FA 1UK6A 4CG1A 4G4GA 2HA4A 2DR0A 1OILA 4FBLA 2AJBA 4Y7DA 2X76A 4EY8A 5JANA 1BROA 4O08A 2B9VA 3C6BA 1MTZA 3ZI7A 5AI9A 2Z5GA 4GXNA 5IH7A 1XQVA 4Q34A 4AO7A 3HI4A 2O7RA 3IDAA 3C43A 2QRUA 1YSCA 3NGMA 3EF3A 5E4YA 3R40A 5AH0A 5LYYA 3G0DA 1ZGBA 1HKHA 4WFJA 3VISA 2C58A 2XMBA 3IUQA 2BUAA 5ALFA 3R3WA 2PU7A 2ACEA 4HXGA 3C6ZA 4GEGA 5DLPA 5ALEA 2XUHA 1CV2A 5AOCA 1SCIA 2JGKA 5LKAA 3OM8A 5C81A 4L9AA 2WIGA 1J07A 2H1IA 4GHWA 4BRSA 5C8XA 1R50A 2WHRA 4RE6A 4CFSA 3JW8A 5LLSA 1FSSA 4B6GA 1AGYA 2OQIA 4CI9A 2HRRA 1XQWA 5CT8A 4BP8A 5CTAA 2ZYIA 4AZ0A 1F8UA 2B4KA 1MT3A 1R9NA 1USWA 3WJ2A 2DQYA 1KEZA 1R9MA 3HRHA 4CIBA 4PO3X 4IO0A 4H0CA 4ZRDA 3FOBA 4A5SA 5AJHA 3T4UA 1X70A 1VLQA 1WPRA 4BTLA 4C88A 2ZJ6A 4Y2VA 4QLOA 1WB4A 5ALNA 4NVRA 1UOQA 2WFLA 3AZPA 4EBBA 1L7QA 5K3EA 4LYEA 1XRQA 4N5HX 5JALA 4DNPA 1XZLA 1CUAA 1R88A 4X93A 1XZEA 3WKBA 5JZSA 1U65A 2RI6A 2C4HA 3EQ9A 3RLIA 2D0DA 3A6ZA 3VJKA 1F0PA 3F96A 3QYJA 4KEAA 1XLUA 5HFNA 3QPAA 2QOEA 5AKKA 4QWMA 2P8SA 4C01A 1CVLA 2WG0A 2XLCA 4KRYA 3F9CA 3LCRA 4X6UA 3CN7A 1O6FA 4GECA 2CBGA 2Y6VA 4EA6A 2OQVA 1TIBA 3QMWA 4JEIA 2HADA 3R3VA 1XLWA 1AX9A 2QT9A 4RE5A 4FFWA 3AZQA 5JIBA 1ZOIA 1EHYA 1AURA 1PJAA 3FLBA 4H77A 4OCZA 1CUHA 1QIKA 1I6WA 3F97A 4OUKX 1NU8A 5K3DA 4X90A 1NU6A 2JGEA 1HPLA 2XMRA 1QO9A 4AO6A 5EIEA 4L3WA 5D7BA 2PSJA 4KRXA 2FJ0A 4BTVA 1QIFA 1FFBA 1LPNA 3V48A 2HA2A 1E3QA 2J4CA 2FX5A 3FYUA 5JAPA 4F21A 5AOAA 1MX1A 4MWTA 1EB9A 1XLVA 1A88A 3D5EA 3C8DA 1R1DA 4H7FA 3MGAA 4J0JA 1D07A 5AKGA 4BC0A 5AK6A 2XUDA 4QZVA 4DSAA 3WK7A 4FOLA 4X00A 3FAKA 1DQYA 1JT2A 3D7RA 1NX9A 5BWCA 2ONCA 5EIHA 2VTVA 4W1QA 2VQ6A 5AP9A 1J2EA 4B7ZA 6YASA 5JAHA 4Y2TA 1LPPA 4GLBA 2WU4A 3O0DA 3MUOA 5EHXA 3G02A 4X97A 4RPCA 5AM2A 1CUCA 4HXFB 5CXUA 4DNOA 3TRDA 1DINA 2GYWA 1PV1A 4OB6A 2PSDA 5JD4A 3ANTA 1Z68A 5FDFA 4ZREA 3A2NA 4I19A 5KREA 4UPDA 5HQ3B 2QMQA 1W75A 3I6YA 3NOXA 4W1RA 2RHTA 5CH8A 5EI5A 4WY8A 2WHPA 4HS9A 5HZGA 4UFOA 1WHSA 3I28A 4L0CA 5D3KA 1DWPA 2GBFA 3WA6A 1CUBA 2OGSA 4BAUA 2HIHA 2JGLA 1JU3A 1GZ7A 3KOOA 4G4JA 2H7XA 5AI6A 2HA0A 1CPYA 3BF8A 3M83A 3LS2A 2BUCA 4QDTA 5IVKA 2WTNA 2H7YA 2WFZA 1GKLA 4K5QA 5DNWA 3OOSA 1ZD2P 3G7NA 1QE3A 1TCAA 3B3QA 3DKRA 1SCQA 1A8QA 2PM8A 1SFRA 4QE3A 5LP1A 3WK6A 3N0TA 4B80A 1MAHA 1E8MA 3D59A 4UFNA 1IMJA 3I6MA 1LLFA 3V1MA 1ZJ5A 1FFDA 2Z8ZA 1VA5A 4JH0A 4UBOA 4AX4A 5K5EA 1YR2A 5T4HA 1ZD5A 1VZ3A 1CUZA 1JJBA 3GBSA 3BIWA 1T2NA 2O2IA 2XI4A 4LXHA 3G0BA 4XJVA 4W1SA 1DX6A 1GQSA 5LZ7A 2ROQA 4H7DA 5AI5A 4B9AA 4J0HA 1HQDA 5IVDA 4YK7A 4J03A 1C7IA 3D2BA 2VA9A 4AQDA 1ETHA 2WILA 2PUHA 5HF8A 4QDUA 1ZI6A 4BZZA 1QIIA 2X8BA 1BRTA 3YASA 5CBKA 3A2MA 3H18A 3BL8A 1VKHA 1CUDA 1UKCA 1XZBA 2UZ0A 4KE6A 5ALJA 1H2WA 4MEAA 2PPLA 5CURA 3C70A 3PDCA 1BN6A 1QO7A 2V97A 4KE7A 4ARBA 2J4FA 3ED1A 4DMFA 3OTQA 3G9ZA 1W1IA 4MXDA 3FSGA 3M3DA 2RAUA 3VKFA 5ALWA 4CCWA 4TVKA 2GZRA 1JMYA 2H9YA 4BDSA 5AI0A 2ACKA 5K3FB 3PUHA 4UUQA 4FNGA 3ZWQA 5AK5A 3O9VA 1LBTA 4Q1VA 1QTRA 1ZGCA 3WK5A 3H2KA 1QFMA 2O2GA 5JARA 1X2EA 3MVEA 3WWDA 1XRRA 4OU4A 1MPXA 4BVJA 4ZXFA 3G9UA 3I1YA 1QLWA 3M82A 4X91A 3OG9A 3C5VA 5AKZA 1EK2A 3V9AA 4EHBA 4DNFA 1K4YA 1DU4A 5ALUA 4FBMA 3QH4A 4GBGA 2XMCA 4JYPA 4QNNA 4QLAA 4ZGBA 5DNUA 4B82A 4AN1A 5CT9A 4Q82A 1UK8A 1CUGA 3FSGD 2WJ6A 3VJLA 5AM1A 5D6OA 5SYMA 1AMNA 3D3NA 5IKXA 1UOOA 4BYMA 5JAUA 2QS9A 4ZWNA 4C87A 1K8QA 2WUDA 2PX6A 2EDCA 2HHAA 4X7BA 4OYYA 4X94A 4BAGA 4OD0A 3DYIA 4OB7A 5IVIA 5CXXA 1YS1X 4EY4A 5JATA 3H2IA 4TPKA 1UFOA 2C5GA 5ALSA 4WJLA 3DKKA 1X2BA 1P0PA 2DQZA 5FXMA 1LGYA 2XB6A 5K3BA 5AO9A 5CW2A 2RGUA 3AJAA 2IITA 3BXPA 4PV7A 1B41A 2HA6A 1UK9A 1DT5A 4F0JA 4OSEA 1THGA 2OPHA 4M0EA 2HM7A 1ISPA 5CH3A 3EIOA 3DYVA 1IUNA 2VATA 1DWQA 1EK1A 4HRXA 3SWWA 1UT6A 4GWLA 1EB8A 4FTWA 2WJ3A 1CUXA 4Q05A 5ALHA 2WFLB 2QUBA 3DNMA 3RM3A 1LBSA 2PSEA 2ZVDA 2XUKA 3B12A 1W4LA 2AJDA 1EX9A 3DL4A 4K6GA 3NWOA 3V1LA 2PL5A 1EDDA 3R41A 3H04A 4KAAA 4U2FA 2DCMA 4J0GA 2AJLI 2JEYA 4FDMA 2V98A 3D0KA 4DIUA 5LZ5A 2WJ4A 1IZ8A 1XFDA 5A7FA 4ETWA 2XUAA 3WK8A 3IIIA 1MAAA 4BC1A 4KR0A 5AKHA 3QBJA 2WG1A 2XUOA 1DX4A 3CCCA 4G8DA 4BE9A 1YB7A 4IHAA 4MYSA 1XRPA 1CUUA 4INZA 5HF6A 3O95A 2AJCA 3I2KA 1FFEA 5ALYA 5AKLA 4PSUA 3VXKA 1AUOA 1QIEA 2PBLA 3HSSA 5ALIA 4UFPA 2OAGA 2ZJFA 4P08A 1T4MA 1GPLA 3BJMA 2VJAA 3PE6A 2OGZA 2JF0A 1G42A 2ZSHA 1Y7IA 4N5IX 2QR5A 2DFPA 2VEOA 3I6ZA 5CMLA 1A8UA 5CT5A 3R3ZA 4X92A 4HZGA 5J3JA 2HU7A 4LXIA 1CQWA 3IURA 3P2MA 2D5LA 2W6CX 4KJXA 2WIDA 3WKCA 3C6XA 3AILA 1GT6A 5ALTA 4G9EA 4BDTA 5EHQA 3C8HA 1EH5A 1E5TA 3G0IA 3QZUA 2WIJA 3EQ8A 5JASA 3WZMA 5LZ4A 2I03A 2G5TA 1XZJA 4PF1A 2W22A 3RKSA 4FLEA 3STUA 5KWIA 2QVBA 2YASA 2WHQA 4UHFA 5ALOA 1L7AA 3KD2A 1TCCA 1U8EA 1CUYA 4M0FA 2JIDA 5A7HA 3WJ1A 3KXPA 1IZ7A 2RONA 1ZIXA 2O7VA 3K2IA 1WHTA 5HF9A 2XUJA 3BIXA 2CKMA 4KACA 4Y2RA 4OYLA 1WB6A 1XZKA 4MQMA 5T4FA 2GYUA 3FYTA 3WWEA 4JUIA 4X3CA 1QONA 1QIJA 1XZDA 1JKMA 4E46A 4PW0A 2NW6A 5ALXA 4G8BA 2IX9A 2XMGA 2EDAA 4Q3KA 1UKBA 1F0NA 3KSRA 1XZCA 2XUGA 1M33A 4U2DA 4YX9A 2K2QB 3BWXA 5K3AA 3QITA 4BP9A 5FRDA 5A7GA 2BGNA 5C8VA 5ALRA 5HF5A 1AKNA 3S2ZA 5HKAA 3PI6A 1AQLA 2XLBA 4BB0A 3RARA 4XX1A 4B0PA 2XT0A 4FNMA 2QJWA 1UKAA 3FWHA 5A2GA 5I8PA 1J06A 4G8CA 1LNSA 1GGVA 5AHXA 1HLGA 1SOMA 3IBTA 4Z49A 1SC9A 1GXSA 3T52A 4EUSA 2B61A 1QJ4A 1HDEA 3STTA 4UHHA 1BU8A 3E1GA 5DYYA 3FBWA 3IB3A 2Y6UA 4A16A 4CG2A 4DSZA 1H22A 1HL7A 3NUZA 3LIIA 3HLKA 4MJ3A 2O2HA 1SCKA 3M81A 5AI8A 5LIPA 1IUPA 4W1PA 1XZMA 1MU0A 4LKOA 2WM2A 1C7JA 1TKRA 2BFNA 5ALZA 1KU0A 2JGMA 2ZYRA 1DWOA 1GPKA 2LIPA 2QJRA 4G9GA 4Y2PA 1XQYA 4KAFA 3HACA 2R11A 2RHWA 2J3QA 3C87A 5AM3A 1DTEA 1JU4A 1ODTC 4BATA 2CJPA 2WTMA 1CLEA 1CUFA 3W2TA 2HFKA 1H23A 1YS2X 5CH5A 4KE8A 4CCYB 1XZFA 4J3JA 5JZ9A 3ESDA 4UHCA 3ZLVA 2YYSA 3IVMA 4WFIA 3A2LA 4X85A 1XZGA 3OURA 3PFBA 4W63A 2VAVA 2Y2UA 4H7KA 4WY5A 4H7HA 1U4NA 1XKTA 4PSDA 3IUJA 4PQEA 3H2HA 3RK4A 1Q0RA 1BEZA 4UBLA 5JD5A 5AKIA 5ISMA 1IUOA 3DD5A 3L1HA 3FVRA 1XZIA 1MO2A 2C0PA 2XQJA 3R3XA 4V2IA 2I3DA 4N8EA 1CUIA 2BGRA 3HC7A 3DS8A 4G5XA 5HK8A 5K3CA 2YH2A 2GBCA 3QM1A 3D4LA 1QFSA 2EEPA 1AC5A 3ZPXA 1WOMA 3WYNA 3UUEA 1YA8A 3G0CA 2BKLA 5HQ3A 3FYUC 3QPCA 2I3ZA 1G5FA 3CN9A 2BJHA 4H7JA 2HRQA 1UZAA 3AUKA 4WCVA 1XZHA 4Y9SA 3KWJA 3SX4A 2C7BA 3WKAA 1LZKA 2ZYSA 5AICA 2XMZA 5EIAA 2H7CA 2XE4A 4PSCA 5KWJA 5I7UA 1O6GA 5HKBA 2Z8XA 2WU3A 4K2AA 3WL7A 4KAJA 1TRHA 1B6GA 1CUVA 1L7RA 2Z3ZA 4LYDA 2XUIA 1EDEA 1K6EA 2CEKA 1VE6A 2VT6A 2WSLA 4FLFA 3QMVA 5ALPA 1EI9A 3QVMA 4B9EA 2WIKA 4IQ4A 2X5XA 1YAHA 3E3AA 4X95A 3W04A 1VA4A 5CT4A 5EHZA 5HFAA 4Q3OA 1U2EA 3K6KA 3ESCA 5KBYA 1VJ5A 5LKRA 3H1BA 2VJCA 5D3ZA 1CQZA 3K9BA 5JYCA 3FLEA 1N8SA 3O4JA 2WIFA 5ALVA 2QXTA 4AXBA 5AM0A 1ODSA 5C8ZA 5BWBA 2CUTA 2G4LA 4U2EA 1QIGA 4J0IA 3N2ZB 1TCBA 2FUKA 4M0MA 5ALMA 3WLAA 4ZV9A 3TEJA 4DMCA 5FUMA 5AK3A 3UUFA 2WQZA 5LZ9A 4W9RA 4MWSA 1W52X 1WB5A 2OCLA 1JMKC 3HJUA 4E14A 2C5FA 2DHEA 1UWCA 5FOQA 1EVQA 5E4JA 4DYHA 2FJPA 2HDWA 1LPSA 1MX5A 4I4CA 3ESBA 3PFCA 3DCNA 2JBWA 3E4DA 1A8SA 4B0OA 4BZWA 2AXEA 4ZV7A 2HA5A 4JNCA 4WDRA 1ZIYA 5FPPA 4QDXA 4OU5A 3GUUA 5DJ5A 5DYTA 1JFRA 5K3FA 1QIHA 4Y2QA 4HAIA 1QGED 3H2JA 3HEAA 4J0CA 3U1TA 1K5PA 1VE7A 3EQ7A 2AJ8A 2PKYX 3PICA 4LHEA 3W06A 3ZLTA 2PUJA 3O4GA 3QPDA 5ALQA 4BCCA 2PSFA 3HXKA 4AZ3A 4AN0A 2OAEA 4PNZA 4UBIA 2QXUA 4DMKA 1WCYA 3G0GA 2PU5A 4EY5A 5JD6A 1E8DA 1DQZA 1ZD4A 1YAJA 3KWFA 1ZI8A 3BJRA 3ZV7A 4OPMA 1BS9A 4FHZA 4G1FA 3VJMA 4HTAA 1XRLA 3STYA 4Y2YA 3W05A 3FCYA 4WDQA 3TJMA 4QDZA 5FKJA 1EVEA 1AZWA 3STXA 3VDXA 4N8DA 4BBZA 3L1JA 5AIAA 5AOBA 1BEEA 1FFCA 2CMFA 4HVTA 2QKYA 2WUFA 2HA3A 4BAZA 3O4IA 4H7EA 3PF8A 2OGTA 4U2BA 3MUNA 3B5EA 2HL6A 2XMQA 4EB0A 1WPXA 3VVLA 3C6YA 4P93A 4QWWA 1OXMA 4TGLA 3GZJA 1H2ZA 3ANSA 4UHBA 1W6RA 1XROA 2PVSA 1EDBA 2BAGA 1P0MA 1ZJ4A 2VAXA 3E0XA 2QUAA 5CRIA 1XKLA 3AFIA 4B83A 2RIPA 1P0QA 5AKJA 5AIBA 1CEXA 1QIDA 4DGQA 3HZOA 4N8SA 1LZLA 4UBNA 4GI1A 3GFFA 1CRLA 3I2JA 2V9ZA 3FLAA 2ZYHA 3LP5A 3Q0TA 2CB9A 2HU5A 3A70A 3O4HA 1F6WA 4F5ZA 4BE4A 3WL6A 1VZ2A 1E8NA 3AIMA 1Q0ZA 3FYUB 3OPMA 1Y37A 1YASA 4AMYA 3WWPA 1TAHA 2C0QA 3WQHA 1R3DA 3I2HA 1WM1A 4IH4A 3V1NA 4WFKA 2CZQA 2OCIA 2HU8A 4FLMA 5HK9A 5FP0A 4BVLA 2VT7A 2ES4A 1C4XA 4H35A 1FJ2A 4UBKA 2OCKA 4UBMA 5AM5A 2XUFA 2V96A 1UXOA 3TGLA 4BVKA 5HCUA 4K6KA 1YCDA 1ZD3A 1THTA 2HFJA 4EZIA 3WKDA 4C4ZA 4X6XA 3DOHA 4NMWA 4UHDA 4U2GA 5ALDA 3HYSA 1JI3A 1LPMA 3JYHA 2GBIA 4XIIA 5LZ8A 2WHPB 4B84A 4KYVA 5DWDA 2XDWA 3WKEA 3PF9A 4G4IA 4E15A 3R3UA 5LZ2A 2QZPA 3L1IA 1ZI9A 4YPVA 4C6HA 1BE0A 1XRMA 1CUEA 5A71A 3BDIA 1H2YA 1QTIA 1MX9A 5EHNA 4E11A 3AZOA 2VJDA 1KU6A 1GKKA 4P9NA 3CXUA 5BOVA 2J3DA 5AKXA 1BCRA 4GW3A 3WMRA 4LXGA 4A23A 1IVYA 4UHEA 3DQZA 3DL7A 3IULA 3EBLA 4DMHA 4AO8A 3H0CA 1R4ZA 5T4BA 3WL8A 1MNQA 4HRYA 4MQLA 2R8BA 1CR6A 1BN7A 1TQHA 1K63A 3I1IA 4J0DA 4QDOA 3H19A 1DT3A 4BCDA 4Y2JA 3FVTA 1RYYA 3GA7A 1N1MA 2YXPX 4XVCA 2B20A 4Q3LA 4B85A 5DTIA 2XMSA 1UOPA 3WK9A 2Q0XA 3DDUA 3H17A 2WLSA 3ILSA 4C4XA 5F4ZA 2OXEA 1RP1A 2Y2VA 5ALKA 3QMMA 1LPBB 3C5WP 5FLKA 4IH1A 4GDMA 4C89A 2BUBA 1MJ5A 2JGFA 1QZ3A 3IUMA 5ALGA 5AKEA 4BRZA 1ACJA 2WG2A 1ZICA 1ACLA 1HBJA 2ECFA 1XZAA 5I9IA 3STVA 2JEZA 1Q84A 5DTJA 4HXEB 2I78A 5YASA 4MYDA 5A6VA 2ZSIA 3WZLA 3IA2A 3BDVA 5EGNA 4BCBA 1G4HA 1PFQA 1BCSA 1OCEA 1GPNA 3X3HA 2GBGA 3WA7A 3GELA 4J7AA 2WKWA 3DEAA 2Y1KA 1N5MA 4IH9A 5T4EA 4J0KA 4AB1A 3GROA 3G9XA 2XQKA 4OB8A 1CUSA 3LLCA 2XQGA 1EINA 4YASA 1UK7A 1JJIA 4DLNA 4H18A 3FCXA 5E2IA 4K6HA 3UMJA 2G5PA 3V1KA 4CIAA 3G8YA 2DHDA 1XRNA 2E3JA 5ESRA 3STWA 5AM4A 5FPQA 5A62A 3WK4A 5AKYA 4DM7A 5EFZA 3R0VA 3JWEA 2GZSA 5DNVA 4P92A 2VSQA 1RWQA 1E66A 2JGIA 4DTCA 4FMPA 3W9BA 4D9JA 2QTBA
chains in the Genus database with same CATH superfamily
3KQSA 3DV0A 2F9MA 3FYCA 2Y4NA 4R1LA 4XDZA 3SIRA 1WP9A 3ZOKA 2ODEA 3C48A 4LIPD 4O1HA 2AK3A 3DEKA 2VK4A 3LOPA 4U4AA 5DN9A 3QIAA 2SNIE 1MCZA 3VH3A 2ZJ7A 4YT4A 4EPWA 1JA1A 1UMKA 2JI8A 3OH8A 1PT5A 3UMMA 3JQ7A 5FOXA 4HJRA 2IRWA 3K1AA 4P7BA 1E9AA 4WW0A 1CFJA 1SCBA 4GL2A 1JKJA 1M2OA 2WAYA 2J9GA 4BKMA 4U2CA 2WU8A 1NSTA 1V3QE 2QT1A 3E7XA 3K0CC 2NOAA 1FLAA 3F8SA 3JSAA 3W5IA 2D74A 2M6LA 5B7QA 5AW3A 1QGZA 1TC1A 3FTQA 3O47A 5FFMA 4REMA 4XH9B 3TAUA 3UFXA 4DLAA 2VSYA 2PO7A 4OHPA 4NCIA 2OHOA 5LU8A 1I24A 3B1WA 2F2TA 1JLRA 2XYGA 5KTMA 5CCXA 1GA4A 1QIMA 1OXXK 4I2VA 4D4LA 2MSCB 4ENRA 2W2NA 3N7TA 2DHCA 1J1ZA 3ZE7A 2FEPA 3C24A 4ZHQF 3QOWA 4HB2A 2DJIA 1EFPB 4NZZA 2VWGA 3X1YA 1CUWA 5I9SA 5KPDA 3LBYA 4BNYA 4BMCA 5A3RA 4G0UA 4QA9A 2C2XA 1Y4ZA 1CVIA 3R3YA 4FFSA 1TKCA 1E7QA 1YZLA 4MQBA 2EJBA 4XX0A 5KAPA 1Z5GA 2D2VA 3A9TA 3GUCA 1OX5A 5T8KA 2ZUTA 2CDRA 1UL1X 4M1YA 1DIGA 3NAZA 1SA0B 5FUVA 2WV7A 4J4TA 1CZRA 1JG3A 2GA8A 3M4JA 3R7AA 3QU9A 1EVIA 4CM1A 1ML4A 4RYLA 5DLEA 3FWZA 3A1DA 1R12A 3KB6A 3NWPA 4FWBA 4ROTA 3ZWCA 2IYTA 1RTTA 3OKFA 3Q8XB 5DWVA 2PQ0A 2QRVB 4Q6BA 4EW1A 1X86B 3LHIA 2EZTA 4IWYA 1R5JA 3F6YA 3KPJA 4H4CA 4A91A 3CXRA 2C42A 3FNIA 1JLHA 2JI6A 3I2YX 2J9YB 3THYA 2ZR7A 4JYZA 1Y4DE 3DLTA 1KJZA 4KPFC 1WLYA 5FTLA 2VXOA 1FMTA 1JYEA 3PKZA 3H1AA 5BPHA 2C9YA 3OE7D 5JSQA 5AOVA 2GETA 4N39A 1XYVA 3MCZA 5JAOA 1UFQA 4BVHA 4EG4A 2E5WA 3ESXA 2YVAA 2NV0A 2OLJA 3U4HA 3WICA 1ZM9A 5I01A 2IXDA 2GFIA 1JL3A 4EY6A 5A4FS 4MEBA 3SPXA 1U2DC 3LP8A 4G5OA 2B1QA 3FTDA 3DKVA 2HDNB 3GMSA 3RYCA 2H1LA 3CBQA 1CIJA 1O8BA 3OC0A 4NJMB 3ETDA 3O1LA 4H08A 3R24A 3P45A 5FBHA 3SC3A 1WV0A 4NBSA 3GEEA 3WYDA 2GCOA 3HUTA 2OV2A 5BV7A 1SXJE 3V7UA 2B3DA 2PKEA 4C0SA 1DKRA 2V5VA 5EE3A 3RK1A 4RKFA 2MINA 5ERGB 2Q3BA 2DWQA 2WFMA 2I6TA 2Y1WA 3GFQA 4C4YA 2XQIA 1B93A 1ISMA 3ANLA 4FVTA 2Q5CA 3AV0B 5I7FA 1CYEA 1EXWA 5AVVA 1U04A 2QM7A 3FTPA 3IQHX 2OMKA 3HB9A 3KK0A 3WS7A 3LVFO 4HLUC 5INTA 3JZDA 1OU4A 3DOIA 4D80A 4E30A 5HM8A 3TKAA 3W9UA 3WNVA 4AECA 3HA7A 5G41A 2EP7A 3N2YA 3ZCRA 3SVLA 3O03A 4EJSB 3HABA 1PNQA 1H2XA 3DFFA 3SHWA 3B7WA 2J7PA 4U7FA 1F2UB 3OJFA 4AKTA 2NYUA 3NVDA 2D1YA 2QD4A 2WICA 4FDAA 1QUEA 3RBAA 2W48A 3IKTA 5E4TA 1Q92A 2PLFA 3V8NA 1T5BA 1A0OA 4GMXA 3QVWA 4KAXA 2FWIA 2OLEA 4M38A 4F4IA 4KPYA 1ABFA 1KO1A 1MR3F 1FL9A 5BYJA 4JT8A 1OIXA 1ZJYA 1RT9A 1L1QA 1XZPA 3A32A 4CM6A 4GKJB 1YACA 1QP8A 1NOJA 1TAGA 5E1OA 3U0VA 4EW3A 4MDHA 3H5WA 2YDXA 2OV8A 1E3WB 4B79A 4CU5A 3D2CA 3KJNA 1UUFA 5IWCA 3D4BA 2VF2A 3DZ8A 4FS3A 3ROQA 3SNHA 4LTNA 5BXYA 1B3RA 3GMDA 1EZ1A 1CUJA 1DQPA 2E4WA 3C1OA 4X71A 3VZSA 4F93B 5IVHA 5TEWA 5IAGA 2NUAA 4RTRA 1ADFA 4EW6A 2Q7XA 3GBPA 4YV7A 1EGAA 5E3HA 2IH2A 3E1KA 1ZW1A 1M1ZA 1GKYA 1BE6A 1TK3A 2WF6A 3EIHA 4RVDA 3ZLBA 4P33A 3NM4A 1TVEA 1QCCA 1X42A 2XEXA 3DVSX 3R9XA 5FBKA 3IVAA 1LW7A 4LJ6A 4YRNA 2A0YA 4K3VA 3W7AA 4ASUA 4BMSA 3OHSX 3ZHYA 5BP7A 5E2BA 2YJGA 2B99A 3RQSA 2Q3FA 1PS0A 5HPYB 1T2FA 1CSEE 1KP2A 1YBAA 3PITA 3VSEA 5GJVC 2OG1A 3OQIB 4L57A 5LOVA 2W00A 3DE1X 2ZZNA 2IBSA 4YI5A 1NP3A 2XNCA 4B81A 3DAPA 4U6SA 1N7JA 3ES9A 4RGYA 3ICVA 5BUSA 3H65A 3PQ4A 1T9GR 4IGIA 1HI9A 1DWUA 2VHQA 2DYKA 2L2QA 3HCDA 3PUIA 3WIUA 3HB1A 4IOMA 3VU1A 4Y2UA 4FS8A 1JJFA 4NJOA 4JUDX 1E1RA 3BFXA 1DC6A 1SOVA 3RW9A 4CEIB 4HDKA 1Z0FA 4MV7A 1UK6A 2WTBA 4CG1A 2FY8A 4UEQA 2DR0A 2QPOA 3TRIA 1P1HA 3FIUA 5EE5B 4HCJA 4FBLA 3PHBE 1E5LA 1MLDA 2LCFA 2WVGA 5EQFA 5L3VA 4AJ4A 1HZJA 1BROA 2JANA 2GUWA 2VJKA 4K9MA 4URYR 4EY8A 3H2SA 1NVFA 5B4UA 3KTAB 4EUHA 2FJUA 3C6BA 4ZU1X 4PXYA 5G4KA 5LBUA 3W2GA 2Q3EA 2WYWA 4Z51A 1BVYF 3L01A 3HFRA 3HV0A 3L9XA 4Q34A 1XNQB 4UEJA 1U98A 1W5FA 2I2CA 3BMCA 3U37A 2HNAA 1ITZA 4I1VA 3OT5A 2YCLA 1LK0A 3NGMA 3GZNB 3WLLA 4LDRA 5FB3A 1QBGA 1K75A 1L6IA 1WSAA 5J4KA 4MUNA 4TKMA 4RPHA 2XMBA 2XNSA 1SQ0A 3BTVA 4FFPA 4M1QA 4C14A 3BGDA 1EFRD 3WLJA 3JWHA 3ACDA 2JIQA 3KPYA 2VPYA 3A0RB 3IAXA 2HCTA 3GEHA 4NEGA 4XB2A 4QQ8A 3OX1A 3SVTA 2PU7A 4KWCA 4MV6A 1J8VA 4YPOA 4PU0A 4FFOA 5CIWA 3ZWYA 4Z2YA 4KQFA 4N4AA 2CUNA 1RJGA 4JBHA 4BFYA 3C8UA 3EWAA 2XNDA 1FEZA 5AOCA 2EFDB 1L5SA 2DM6A 5FOWA 4CMJA 3IODA 1Z8DA 5TPWB 3GU3A 1ZAKA 4D9KA 3OM8A 1O4VA 2VSNA 3G13A 2TS1A 4L9AA 3S1AA 5KU7A 4XD2A 4LF4B 1V3UA 4DN6A 4E6EA 5KEIA 3PQ6A 4RE6A 1P2FA 1RJ9B 2JFUA 3QEMB 4JI6B 4CFSA 3MTJA 2BFFA 4GP9A 2O8BA 4IIDA 4JCCA 3MPOA 2QTGA 5J2TF 5JNSA 3AEZA 4L8YA 4DA4A 1JIVA 1SXIA 3D6JA 3F49S 3EY9A 2PL1A 4HI0E 4B6GA 1IXSB 5GIOE 3B3JA 2PANA 2VLBA 1SC6A 3CW2A 3LVQE 1H9AA 2IWHA 4URXR 3T3OA 1EXMA 2OQIA 1PEDA 3R3JA 5FH9A 1Y34E 3EDMA 2VTEA 4RBNA 3VAZA 1AGPA 2HDOA 2OMEA 4XM2A 4AU1A 4KKVA 2QBYA 2WWHA 3OAAD 3H42B 4E2XA 3MXOA 3BERA 3FOZA 1F8UA 2B4KA 3EPHA 3CT6A 4JA0A 2XYRA 4Q7QA 3L0YA 1LRKA 2WYHA 2X15A 5DX0A 2WZQA 1GCIA 3UPUA 4JI3B 4UTNA 3UWDA 5KIAA 4TSKA 2ZZMA 3SS9X 3BPSA 4EJMA 1AZLA 1RKVA 2DHQA 3RUPA 1G60A 1L5QA 3LW8A 3P9PA 4NAHA 3EZ9A 2XZDA 4IVNA 3Q3EA 1WLSA 2DQYA 1JSRA 1PSDA 1W4BA 1NW7A 3KZKA 1CS0B 2YWJA 3H3JA 4PO3X 2H65A 1FSPA 3FOBA 3B53X 1GSOA 1L7OA 3QY0A 5AJHA 4C0WA 3GZTB 2X0FA 4YS6A 1WIWA 1YWGO 3T5BA 3KEQA 4FKMA 1VLQA 3NBMA 5BURA 1DDIA 2P2NA 3PTLA 1GJRA 2DUMA 4MULA 3B6KA 1CP3A 3ABRB 3U1VA 4C88A 3I32A 3TZQA 4IOLA 2CV0A 2XWBF 2ZVPX 2DWPA 2WR8A 3FCCA 5MN6A 3QLTA 2JLYA 1NNLA 4QGFA 4MUIA 3T3HA 4HDCA 1T3TA 2GH1A 2XDAA 1BNCA 4AZSA 3PQ2A 3OVMA 3DQQA 3PGMA 1WA5A 2Q99A 2R2AA 4LYEA 2PX4A 3IAAA 4N5HX 3VHLB 4RSHA 2NV2B 3HL0A 2IS2A 1D4FA 2YINC 4Z8YA 3MTIA 3EQ2A 2D5BA 1CUAA 1R88A 2GOYA 4RFSB 4QNRA 1II0A 1PUJA 3QU5A 1NYRA 1GGHA 3BBLA 4INAA 3V80A 1FUYB 1XZEA 2V5UA 2RHOA 2HQBA 2W2KB 5IRCD 1UMCA 2ZUUA 5DI3B 3FUCA 1Y4UA 1U65A 1WBBA 4P83A 3SJ7A 3ROMA 3EUAA 1VB3A 1L5VA 1QVAA 2EFGA 3DFZA 2C4HA 2VHCA 3L6EA 3PD1A 5KYUA 2D0DA 1T3ZA 3NLLA 1W88B 2GCIA 3A6ZA 2V6JA 3MELA 3DGEC 1UZLA 3MGCA 3KQWA 4P4SB 3A11A 4RL4A 1M10A 2J3MA 4KEAA 3A26A 2C98A 3DBHB 1D04A 3LVRE 3R6TA 1XLUA 3UGQA 3L0OA 3QLVA 4O8CA 3U60B 3F4KA 5EZQA 3NEAA 2XNJA 1J9GA 4QWMA 3TBFA 1GXSB 1I6KA 1NVXQ 4Q7EA 3S7TA 1EKXA 1FFSA 3F9CA 2YXLA 3LCRA 3V33A 2RKBA 3H1GA 5HKKD 2F8SA 1C80A 1RJWA 1Y6ZA 2VBCA 4X54A 4YEDA 4FM9A 4CWAA 4YNBA 5LSAA 4IJMA 4KBGA 2F7SA 3FGNA 4XJTA 4BMDA 3OOYA 2BY4A 2I2DA 1YR3A 1PS8A 4BGIA 5JOQA 3LTNC 2HZ7A 3VX4A 2P9YA 2Q9UA 3NRBA 2RI1A 3OLVA 5HE8A 3VGPA 3E7FA 4PONA 4EA6A 4DC0A 5KNCH 4JLOA 2OQVA 5BN3A 3KXDA 1RAGA 4JEIA 3PC4A 5BN4B 3L02A 3R3VA 3PRYA 3QV1A 3ZDQA 3BSWA 2J6IA 3BTSA 3BB1A 4L15A 1AS3A 1XLWA 2WOOA 1M1XB 1NW5A 2I3GA 2VP4A 2VRNA 3GGJA 3NQ41 4RE5A 4FFWA 3AZQA 4JBLA 3FPEA 1QGAA 4HWKA 4O5AA 2OZEA 1SXHA 4B4UA 3VR2A 3W8DA 3CZRA 1PJ3A 1XRJA 1X9HA 4LTDA 3W0LB 3V46A 4FMCF 4H1UA 1ZOIA 2NWQA 3WLIA 4M60A 5FWXA 4HRVA 3UOWA 5IT5A 4JUBA 5DBFA 3OE5A 3SJBA 821PA 1DRVA 1QFXA 1T15A 3N53A 4EO7A 6Q21A 4F1WA 2DBRA 3DZJA 4OUKX 3AEUB 2ASEA 3TH5A 2PJDA 1SJ9A 1C7QA 2VZ8A 1X7ZA 2PXCA 2JZNA 2YWDA 3EGCA 1R0KA 2RHBA 3OWXA 4LJ5A 1R8QA 1Y8QA 4M2LA 1HPLA 5JCJA 5LB2A 4ENPA 2H92A 1I4TD 1YDMA 3SKYA 4AO6A 2FMUA 4Q9AA 2BCGY 4R84A 4B33A 1KR5A 3R23A 2GN1A 3Q7TA 1JHZA 2IGTA 4KRXA 5I8ZA 2GM5A 3A9CA 4BVGA 5CFNA 1UP4A 3LA8A 1LPNA 2QDXA 3V48A 2ZRAA 3BQ9A 1E3QA 5B6JA 3MS4A 1N33B 1B3BA 1HV8A 2CKDA 3IBSA 4YLYA 1C7ZA 4CBVA 3BMOB 4OL0A 4EVRA 1YC2A 5CLJA 4DR2B 3PPIA 2F8MA 2YQZA 3SYLA 5JAPA 4F9TA 4RTNA 2WF9A 1SUAA 1XMVA 3OPQA 3OZ7A 4M21A 4DC9A 1CR2A 2CNBA 1A2OA 2EX1A 3M9WA 1L5RA 1RJEA 2VJMB 2BLLA 1OBCA 1RI5A 1XLVA 1FNCA 2D2EA 3GUHA 1PGOA 3WLOA 2NP6A 4MP6A 1Y3IA 4FGZA 4MW1A 4PCVA 3SYMA 4PPGA 1Y1LA 3U26A 1OLUA 3K15A 1O6ZA 2IA5A 3ZIAA 2F59A 1RE1A 2Z2XA 4QZVA 3BOSA 4L5CA 3WK7A 3EGXA 2L18A 4WZBE 1WXQA 1HT3A 3FI0A 2JJ1A 2VH5R 3ZDXB 3O3NB 1QWSA 4XFJA 1DQYA 2XX3A 3CUYA 4D8WA 4RZHA 4UVGA 1MTOA 2HQ1A 3HKBB 4PAGA 2NUPA 5BWCA 2ZROA 4Y0NA 3D4IA 5DM0A 3W6UA 3P27A 1E1QA 1UDBA 1NC1A 2VQ6A 2YJ4A 2IHTA 4NESA 3SQDA 5AP9A 5ITZB 4ER5A 2GFQA 2NZWA 4B7ZA 4LNUA 2QLBA 1O08A 2NTEA 2X3FA 2IS4A 5H16A 4Y2TA 4CCSA 3L1UA 2GZHA 4I9FA 1E6WA 4MDFA 4YR7A 3UXMA 3HHPA 2WU4A 1VYUA 3O0DA 4V0ME 1GYRA 2PQ6A 3F5QA 3QG5A 1ECBA 2GXSA 1X7XA 3UK2A 3H8VA 2FSFA 3I8XA 2ZCVA 4BO4A 4DEXA 1K7XB 2I67A 5KOYA 1YRLA 3OZFA 4RPCA 3WIEA 5AM2A 1CUCA 3U1BA 1E2GA 1BOOA 4OHMA 2ZETA 4X6LA 5L3QB 3MWEA 3RE1A 5IF9A 1RIFA 2GLTA 4NEHB 3I6QA 4OIMA 1P6QA 1MUUA 2GYWA 2E5LB 2IODA 4WOBA 4DDKA 3OCVA 2OOKA 1Z68A 3SXUB 3U3DA 1DCKA 1E18A 1FVXA 2RAFA 1KYWA 1UBKS 3A2NA 2R6DA 4KO1S 4NJEB 4ZREA 4D9GA 5HQ3B 1AHPA 1A9ZA 2EAUA 4H59A 3TQRA 5K8VA 4QUHA 2LCIA 4UTPA 2EP8A 4O2BB 3RBVA 4HDMB 1UM8A 3FNRA 3NOXA 2PEYA 3TUIC 1ZK0A 2OSBA 5CH8A 3R75A 1O95D 2I34A 3PK0A 3OWHA 4Z0HO 3S5JA 1T3HA 3KKEA 3QEOA 4FGUA 5CXQA 4RJKA 3JAWB 4FZ3A 4BFTA 1IY9A 2D7JA 4BJ3A 1WULS 3BFPA 1PTJA 3DL2A 1DWPA 1RSZA 2OCPA 5COQA 4BY9E 4KR2A 3O2SB 2RHRA 5CCEA 1KYIA 3ITNA 1TKAA 4L5BA 1NT4A 2H4YA 3WA6A 2H4FA 5JU6A 3U49A 3IT3A 2X1HA 1RXEA 2HIHA 4KSYA 4AAYA 5P8WA 2VH1A 4JUCA 1JIUA 1WO8A 4JI5B 4C2AA 2PMCA 1YCHA 4ZT6A 3ZS8A 2Q6KA 3ZG6A 4TLCA 3IAM1 3FVQA 4UU1A 1P91A 2BBSA 3KCQA 2BSQA 4HKTA 5AVJA 4GOXA 5G3ZA 1WRBA 1DV1A 4EF5A 2BFDB 2DBVO 2D0PB 2WTNA 2YNMD 2ZAOA 2C97A 1GZ5A 1UEIA 2QWXA 1VCMA 2H7YA 3AK4A 3IIKA 3FOEC 3O3MB 4K5QA 5DNWA 5JJCA 1OMOA 4BFWA 2LZ0A 1A8HA 2VSFA 4W7IA 3RS5A 2GHIA 2ZRJA 5KQGA 1DXQA 3T7KA 4L8LA 2F3TA 3U5TA 1DJNA 2JATA 4JLBA 2C20A 4IS2A 1RBMA 1GR1A 2H08A 3FHLA 3KOXA 3PUYA 5EKTA 2AFRA 3LGXA 4U9HS 4UHKA 2VHWA 1QHHA 2PM8A 5EMNA 2KYRA 3GNSA 1SFRA 4XKJA 4KV9A 3NRCA 5B2EA 3I9V1 4G1MB 2PX8A 4IRMA 1ZGJA 2NU9B 2WRZA 1FRQA 1JDPA 1L9XA 4DLSA 3QTLA 1OT3A 2CD7A 1MAHA 2H8KA 3D59A 5H02A 1R6DA 2JFGA 1GPUA 1IMJA 3I6MA 4UFNA 5J2UA 3FCEA 2QI9C 4WNAB 4V3BA 5H70A 4MHOA 3KALA 1G5QA 4UBOA 4WL0A 1TMYA 3G68A 4AX4A 1CHNA 4JL5A 1WR8A 3DO8A 5A5FA 3PFNA 1YR2A 1SZCA 1U80A 4DSNA 4Z7JA 4YMWA 1VZ3A 2EARA 4EYGA 3V5NA 4A0FA 3PDHA 1ZM7A 4TLBA 3FOFC 1TK9A 4QGGA 4LXHA 1N8KA 1ESCA 2PMBA 3HUUA 5DLDA 1RQNA 4RDXA 1XMQB 3H84A 1J39A 3MIIA 1DADA 4YRAA 2HHJA 4HNUA 4Q03A 2W6ZA 2H31A 1VCIA 1ZKMA 5AI5A 5B5SA 4TYYA 4JOBA 2QQEA 2RC6A 3CZ5A 5C1IA 3EVFA 1BDHA 4TXNA 3ZYZA 5MDHA 2ZATA 2CEAA 3A1SA 3K4HA 2FX2A 4KLNA 4R1PA 1QQ6A 1K06A 2A1UB 1XPUA 3VNRA 2QYOA 1ETHA 3KT6A 1GUAA 1NPYA 1R6UA 1YIOA 1OTXA 2J3JA 1I4LD 2WILA 4XVRA 5HF8A 3MD9A 4OX9B 3VU9A 4D8XA 5M04A 5CBKA 3A2MA 3LCCA 4QG7A 2I6XA 1RHMA 3V7YA 4GKKB 4H4DA 1K86A 4C3UA 1BWSA 4NENB 1YUBA 2YW9A 1SQFA 4ZQFA 1R2QA 3RS2A 3UYKA 2J8ZA 3DZGA 3FF1A 4I5DA 3AM4A 3A3KA 3D4NA 3VZDA 1VFPA 4CF3A 5CDHA 5GZ6A 3VOSA 2GEKA 1SBHA 4JB0A 1KARA 1TGVA 2X7JA 4DUGD 4RZ3A 5TC4A 4Q7LA 3PNMA 4XYBA 3ORHA 3L7OA 4L6CA 1TLTA 4R2LA 3UW1A 3I62A 1CZOA 1EE9A 2GAAA 1YBVA 3QMPA 2ECPA 2NXNA 5LCXA 5A6SB 1KH2A 4MRVA 5CTJA 1WMDA 3MPUA 3IBGA 3R4CA 5HZKA 1P1IA 1A7JA 3K0KA 3PR3A 5F9HA 3G9ZA 1JDUA 1GG5A 4BNKA 4YAIA 5C8DA 2UZ1B 1OYVA 1QM5A 4X8MA 5F9MA 2ASVA 2CV2A 2ZBVA 1ZFNA 5C0OE 3INNA 4UEOA 3CUWA 4YJHB 3RGGA 1AG9A 2VWQA 3D6HA 1NVEA 1IRXA 3ZS9A 3EN0A 1OR8A 2A0FA 4B3DA 3ENZA 5FADA 3AETA 2O2ZA 5A3VA 3G7UA 2UZ4A 1MEJA 1RXYA 1LFDB 4UCFA 5TR9A 3PUHA 4ZOLB 5FI5A 3ZHXA 2C1ZA 2DERA 4FNGA 2ZAIA 1XDDA 1H6DA 2WWFA 3IKVA 5A4DA 5AK5A 1T8PA 5AMXA 3RAJA 3COJA 1LBTA 1TM3E 1Z5PA 4RDHA 1DEKA 2LIVA 2CLIB 2P0EA 4PLVA 3WWYA 1LC0A 4KITB 4DCGA 1X1CA 3WNQA 3FWNA 3AKZA 3VR6D 4CKXA 3IPLA 2ZE7A 1DKMA 4I5GA 4DKJA 2P8JA 3OPYB 2O2GA 4HPWA 4Y98A 5BQPA 3ZLJA 3GZ4A 2GD0A 3C6MA 1UZMA 3MVEA 3NVMB 1XRRA 4BNJA 1G7RA 5CB0A 4DLTA 1ID8A 1TMOA 5IULC 3G9UA 3I1YA 2O0LA 3PFHA 3QEKA 4UZSA 1IONA 2F3SA 2XBLA 5IHXA 3G0OA 4X91A 4RAQA 1RBYA 4E33A 2XDYA 3DP7A 3R7BA 4DF3A 3SSNA 4OX9Y 4LDZA 4WXRA 3TMAA 3UHOA 2BM0A 3JQRA 4MK4A 1ONSA 1V4VA 2FR1A 1WJGA 2HPHA 2V3VA 2ZB3A 1D7OA 2FN4A 1EK2A 4RUKA 4XGIA 4MROA 3LQFA 4JUFA 3TGPA 3A10A 4D6PA 4G3XA 4DNFA 4F2WA 5AW7A 2NN3C 2J3IA 1DDGA 3BGVA 2C2YA 3FYHA 2F1JA 4IJVA 4LGCA 1X7YB 4Q4JB 3NTRA 4RD6A 3WISA 4D02A 5AW1A 3E15A 4FJ2A 5IARA 1DEXA 2XMCA 1X19A 4LAFA 4LDNA 1ONBA 2MYNA 2OB1A 3OEWA 4N3AA 4PR3A 4RQAA 3PJFA 4U3JB 3TXXA 1Y3FE 4EOGA 1T9BA 4Y1EA 4I55A 5ES3A 1RAAA 5CT9A 4FGJA 4LNAA 1YDWA 1FY2A 3S29A 4ZQGA 3G49A 3KR0A 3WLFA 4YV2A 3KQUA 4B44A 2DTDA 1CUGA 1D0IA 4E08A 2I9PA 2WJ6A 2OOSA 3KSMA 2Y4OA 4EARA 5L53A 2O3RA 4BN4A 4UXJA 1GLNA 1PJBA 2YQ4A 5IKEA 5SYMA 4LC0A 4MWDA 1AMNA 3IEMA 1W9HA 3T9AA 4E5NA 1UOOA 1AZTA 4ZZIA 4BYMA 3DAOA 5IZ4A 4JLSA 4DZZA 2QS9A 2KPOA 1OGIA 5JAUA 3NVKI 4PG5A 1E9EA 1ATIA 1PDOA 1GWNA 1WBJB 2XZLA 1V95A 2PX6A 2EDCA 4HVAA 4OQMA 3EAFA 3QWBA 1EFRA 4BEWA 1EFPA 2QENA 1JDJA 4FK8A 5K0LA 1QTQA 1PJ8A 1QV9A 4RF3A 2C2GA 1PJCA 4X94A 3LWNA 2R65A 5LC1A 2JHPA 5TX7A 2BFWA 2P2SA 1M7GA 4TMVA 3WBKA 3EZNA 3FNFA 4AY5A 3ZBUA 5IVIA 2I8AA 2J9FB 2WY2D 1FDVA 4P53A 1GQYA 2PXHA 2VUIB 5DP2A 5IC5A 3RJMA 3OE1A 4YA6A 1E3JA 3H7AA 2R68A 1ZGHA 3LZCA 5H80A 3HYCA 2X3UA 4I1PA 3GDGA 1UFOA 4B17A 4JJIA 4REQA 5C1DA 1XTJA 1GEGA 4OM7A 4F5WA 4HDQB 2C5GA 1F4LA 2H18A 5JS2A 1TQ2A 1NONA 2HPAA 4PQYA 3ZY6A 3DKKA 4NH0A 1X2BA 1N6RA 3V1TC 4CL0A 5EXTA 1NIJA 4KNWA 3IQEA 1YIAA 1LGYA 4EG3A 2W6QA 3ORQA 3GJ3A 4INJA 2XB6A 3VMFA 4MUYA 1FNBA 3F3SA 4NRDA 4NU5A 5JNLA 2CV1A 3OU2A 3TK1A 3CNEA 5I48A 4DR7B 1DE0A 1O0SA 3B8EA 4ACBA 1NAIA 2VUSA 1K5HA 3GD5A 3L0CA 2C4NA 4DRXB 3R5SA 4ZODA 5COAA 3AF1A 2RGWA 4PYLA 3OAAA 1K3TA 4GOJA 4ALMA 1H4QA 4KFCA 4OSEA 1Z6PA 4E5DA 2NZVG 1PIWA 2OPHA 4M0EA 1K89A 2RDMA 2PBZA 1L4MA 3TZ6A 3EIOA 2J5BA 5JI3E 2HAEA 3DYVA 1IUNA 2EFEB 2O6LA 4I99A 5F7XA 3GQBB 3KBBA 3W5AA 4HRXA 2JCBA 3STHA 3ZXSA 4ND8B 3GA5A 4BMXA 2FSVC 4ML3A 4RULA 1HDCA 2NSHA 3KJXA 4UASA 3WGLA 4EI7A 1EB8A 4QD3A 1GPDG 2ZIXA 4EKEA 2FZKA 3OJ0A 4BNZA 1T9GS 1YXMA 2WNSA 1CUXA 2IZ1A 3LT0A 4Q05A 3ZY4A 4I66A 4RTOA 2X2PA 3L5OA 1S2GA 3K09A 2QUBA 3MMZA 4FE7A 4RHEA 3MSXA 4EJSA 3ZGNA 2ICAA 4LYJA 2QSZA 2ZVDA 4XVQA 1F2UA 4LVNA 5K01A 1PHPA 2XUKA 3M6WA 1HDGO 4JKOA 3LX5A 3T0FA 2ADFA 3R7NA 4EH1A 1VL6A 1KO4A 1SVKA 1KFJB 2ODWA 4TTJA 2B1GA 4TQGA 2V5AA 3V1LA 4YP5A 4D3SA 4HADA 5BSGA 2O2CA 1MRSA 2VBFA 4QUKA 5ED4A 1T13A 1C1YA 1RAIA 3G6WA 5KJEA 3CW8X 1WXWA 1IN1A 2F9FA 2PKQP 2CNOA 1ZM4A 2AJLI 2FCAA 2Y1EA 3CUVA 4NBKA 2JEYA 2Q2QA 4FDMA 3LHFA 3ZNOA 5EQJB 1E3WA 1QJCA 3BMNB 1GV0A 1SGWA 1P9NA 1SPXA 1YK0A 2ZCUA 3D0KA 1EM8B 5LLDA 3GLIE 1XI2A 1IOLA 1H1TA 2DT8A 4HEA1 4TWJA 5EGSA 5C5CA 1ISGA 5DBOA 1NUUA 3RBXA 3UICA 1AT1A 1N36B 2PUEA 3BDAA 1QHYA 2X58A 3HUEA 5F2NA 1MZPA 4LE2A 5AKHA 4IIBA 2G1JA 4N47A 2IZ5A 3G1UA 4B6EA 2J0QA 3DT8A 3ONFA 4GBJA 2W2QA 4IUDS 1YB7A 1U7XA 2FOLA 2NYRA 3KFXA 3OX4A 1NE7A 1J33A 1XRPA 3ASYA 1CUUA 4LDJA 1EWTA 4MYSA 5HF6A 3WQSB 4F4UA 3O95A 5BR8B 5B3JA 2ZM5A 4OLAA 1AKYA 1M2FA 1M34B 2LDXA 1WCV1 1OVGA 4HNQA 4ZCSA 1V9LA 3B5JA 1NVAA 3OZDA 4OQPA 4Y1RB 1GU7A 1P1CA 5HKKA 4IICA 3OQIA 2PBLA 1QDEA 4V3CA 4ZVRA 5MFZA 1LTHR 5K0NA 4PNHA 3EZGA 3IHTA 4UEKA 1MENA 1RQ2A 3KAQA 4ZQCB 3QSYA 1DQNA 5B6PA 1V96A 3G85A 3HUFA 3B5IA 4YFVA 5DTEA 1VDMA 1QG0A 1Z5NA 1XHLA 2CBXA 1GPLA 3NVAA 3WL4A 4Q01A 3I09A 5KSYA 2OGZA 4CEIA 1J6UA 1OFUX 3ZZNA 3PCXA 4PZCA 2VCEA 2O5EA 1GL7A 1DKUA 2XW6A 2BJVA 3O2NA 4JYBA 4V0KA 5I7RA 1NN5A 2W11A 2IYXA 4N5IX 5KI6A 4EX7A 5JEEA 2O3JA 3C8ZA 3OTOB 3ET5A 3I6ZA 1A8UA 1BA2A 2J3EA 2VWHA 4L75A 4RCYA 1VE1A 9GPBA 5K8TA 4UD2A 3HBLA 3QEBZ 3KTAA 3BB4A 5BV1A 3R3ZA 1K6JA 5J3JA 3GPDG 2ZIWB 3DAFA 2VRBA 1SNYA 5K45A 3IURA 1FFYA 1N0VC 3A28A 1V3TA 5H8WA 2UZIR 1Q0QA 3E9QA 1ZR2A 1E2HA 1E2NA 3ZZ1A 1W73A 5EMKA 1VG9B 4AY6A 2LV8A 3GEPA 4KJXA 3DWIA 3GZNA 1E2KA 3WKCA 3FETA 3SLKA 3BS4A 4XE5A 3UCEA 1G5IA 1YB4A 4O2BF 3IAHA 1BX1A 4DSUA 4G9EA 5KZMB 5EHQA 3RF7A 2P41A 3GJYA 4JC5A 3CFYA 1E5VA 2D5AA 1NUAA 1EH5A 1FFGA 1M67A 1AHNA 3EARA 3GWGA 3EXEB 3JD4A 4R1QA 1KK2A 3ZBPA 4GC5A 2IV7A 1B43A 2YZ7A 3AR4A 3FPBA 3KEOA 4J1QA 1YI1A 3L41A 4IDAA 3EQ8A 4U7GA 3VU3A 5TMEA 1Z0JA 2JFFA 2L0XA 5BW6B 2UYCA 4N82A 3GRVA 3GJ0A 4XEHA 1BXGB 1U0SY 5IN4A 1YZQA 2ZDGA 4QQRA 4NDAA 2DQKA 4YT8A 3HMKA 5LUBA 2PH1A 3RKSA 4WINA 1BCRB 5TPWA 1WOYA 1NG9A 5KWVA 1ST2A 2J0EA 2QVBA 4YI3A 4J16C 4PBTA 4ARUA 4CEHB 2R8OA 2WHQA 5ALOA 5K0CA 2QMHA 3SYKA 3D0RA 3I42A 1ZDMA 1R00A 1YR1A 4LBVA 4EI2A 4CDRA 4OHOA 5ED0A 1IY2A 2JIDA 1RJ9A 3QEMA 1X0VA 3THXA 3KXPA 1R0RE 1XEXB 1JHQA 1T3LA 4JLVA 5I7VA 2RONA 4EG8A 1ZIXA 3PXDA 1R4MB 2DP4E 1EVZA 4COOA 2H1SA 5C2JB 1FB5A 1S3SA 3K2IA 3LCVB 3NOOA 4CTOA 4ZAYA 1NJ1A 3BIXA 3HJHA 3VSDA 4IKPA 3E5HA 2I9KA 2BMJA 2OBYA 2D8MA 2EWMA 1VJ1A 2ZRHA 4JGGA 1PK7A 4N7BA 2Z6QA 5TS3A 2FB9A 4E12A 1TVMA 4MQMA 5T4FA 3FYTA 1T2VA 2FG5A 3OZWA 1NT2A 3MQ2A 5LJIA 4RMJA 1O5IA 3N2GB 3E2PA 4FDTA 4LHXA 4YQZA 1OFVA 4X3CA 3D6AA 2B9EA 4O25A 5F52A 3M49A 2NXWA 2G76A 1XZDA 4MRAA 3OZVA 2F6RA 1QHEA 5IBPA 2V7GA 4E46A 2NW6A 5I7AA 1Q2XA 3IIJA 1KJJA 4WESB 3GDHA 4A73A 3L4KA 1DJQA 2QLMA 5JSUA 2IX9A 3UYLA 3AP2A 3SZUA 5G0UA 2PZLA 5F1PA 3AFMA 3EEYA 1U8AA 4Q3KA 3W5VA 1EXNA 2HF7A 3ZV5A 3N6XA 2XGOA 2EF1A 1CS0A 3ZIDA 3T3PB 4C2UA 1X8XA 4FZVA 5ETJA 1XZCA 4I5EA 4ZV4A 2X14A 4MARA 3QLJA 4O1MA 4Q1AA 4YTEA 3TOXA 2OC9A 5DCYA 4LZZA 5C37A 3NWJA 1Y81A 4LC1A 4RSMA 4Y9UA 3E9EA 4LQDA 4UU8A 4CT0A 2G4VA 2WB2A 1VL1A 2XJ4A 5L7YA 3RVBA 1W0JD 2I1WA 4JITA 3T7RA 4PC6A 3CZQA 1LU9A 1MW8X 2AE2A 2F1RA 5F64A 1KK1A 2BGNA 2W8BB 3VOTA 3OZGA 1E32A 2BDEA 4PAWA 1AKNA 2O0KA 3DEJA 2OAP1 3D1LA 4UEWA 9ABPA 3T4XA 3NHPA 1M2VB 2PN1A 3MBKA 5ADWA 3H4MA 4LV6A 2XLBA 3FG9A 4JP1A 4XD7D 1KDVA 1MB9A 4D42A 3ZY2A 4WD3A 5EMJA 4INOA 4RFSA 3D3EA 5IXSA 2O59A 1L2TA 4TV9B 2XT0A 2A1IA 1O95A 3H9JA 3IXMA 4TVOA 3A3NA 4FNMA 2W2KA 3IBFA 3R2JA 3UQYS 2PRKA 3ZDYB 3ZWMA 2F3RA 2BT4A 5DI3A 4O6VA 3OPYI 2Y1OA 3UBTA 4KGXA 4FQ8A 3EMBA 1J0XO 3RVMA 4N5LA 5I8PA 1J06A 2AVDA 3HYRA 1Z18A 3SBEA 3ZWNA 4ATNA 3DGFC 4B31A 4BNHA 1W88A 4W7SA 4WNCA 1HT2E 5CVVA 5AHXA 4NE9A 1C2YA 4D6YA 3OQNA 5E7MA 1HEYA 3T94A 3BJIC 3O8OB 5BSKA 3DBHA 1Z83A 2GA9A 1P4GA 4GLFA 4RPGA 3S55A 1NVVQ 1GVNB 3VR3D 2XXJA 1FVHA 1MHTA 1SC9A 3EB9A 1EM6A 3EVDA 1GXSA 1ZN9A 1AY0A 2B61A 3E5RA 1N3BA 2MDTA 3AR5A 2RB4A 4TRMA 3PFKA 4LXTA 5DYYA 1N1EA 3FBWA 4Q15A 1U3WA 2HNKA 3UJPA 2GILA 2NO1A 3MXTA 1KVUA 1ZMBA 1ZQ1A 1SZJG 2ZYAA 3GYGA 3NB0A 3BH6A 3IB3A 4WN3A 1GDTA 2Y6UA 2ZRQA 4Q0MA 5ELLA 2YNMA 2FW6A 2OO5A 1UXIA 1W48A 5CVUA 4FFBA 3USES 3FPGA 3UUWA 4AKHA 2BE9A 3UT5B 2OY0A 3IKLA 1H22A 2G77B 3AQ4A 1N0HA 4JJZA 3NUZA 3TRHA 1PV2A 4MJ3A 5GV7A 3W78A 5AI8A 5LIPA 2ZG6A 5IM5A 3VVCA 3KUDA 1Z6QA 2DF8A 4TQAA 2Q46A 4HUJA 1XZMA 3UK1A 2OFFA 3OZBA 1EVJA 3I83A 4ZZ0A 4UHJA 1JEJA 3A9RA 1QX4A 1WMFA 4BFCA 1ZKDA 5ALZA 1KU0A 3UMBA 3S99A 2ZYRA 1GPKA 3TI9A 1V8PA 1VL2A 3P5BA 4BU0A 4JJKA 1FTNA 4CKWB 1L3BA 4Y2HA 1ADCA 4CFZA 4GFDA 1FYEA 3HCRA 1MH1A 1RAFA 1D8TA 1A3CA 3DZIA 3BH7A 4FN4A 4JVMA 1TZBA 3SI7A 3KTDA 2AG1A 2R11A 2NT4A 3S8MA 1TPZA 2JFOA 2FR8A 2C8LA 2J3QA 1NMYA 4CGZA 3IT1A 2BL4A 4DHEA 1AXGA 1U0LA 2I8CA 3AEUA 1KO8A 3IPAA 3S27A 1YNSA 2DPMA 1IXZA 5PGMA 3DBLB 3PQFA 1FOEB 4L50A 1EQ2A 2GPAA 4V02A 1YL5A 3L93A 4RS3A 4R2MA 1SBIA 4BATA 1CY7A 1PNOA 2WTMA 1FNSA 1OZ0A 2HX1A 3GLRA 4V0RA 3IEPA 4AJLA 4P0QB 1MABB 1UXHA 3ND9A 1H23A 4ITUA 1Q1QA 2OV4A 1NXTA 3L49A 4KQ2A 5DASA 5F35A 4EPVA 4ND6A 4D4IA 3TR0A 3MTDA 3WE7A 1HNZB 1P0FA 4ND1A 4XYGA 1CNMA 1P6XA 4CCYB 5KQLA 1XZFA 2BPOA 3PXEA 5TARA 4FDLA 1KS2A 2Y1CA 2Z5FA 3THRA 5JZ9A 4D79A 1KAQA 2JS7A 6REQA 3ESDA 4Q21A 3A37A 3ZLVA 2YYSA 4HUQB 3CF6R 3ND7A 4PG6A 3Q85A 2ALJA 3LO5A 5LFAA 2CNWD 1XAIA 1H9CA 1MBZA 2JJ2D 4X85A 3GT3A 1F3LA 2BW0A 3OURA 4KW7A 1XXHB 2HCJB 3PFBA 1E7MA 1X1AA 2HC9A 4H7KA 5JS8A 4LY9A 1U3GA 4H7HA 2O8VA 1U4NA 2R7MA 4QRIA 4HB3A 3QVUA 4FI3C 1WCXA 3H2HA 2L19A 2EW2A 3HM2A 4PQEA 4XA8A 2PRYA 4GI3A 2XKAA 4XUCA 3ZGVA 1BEZA 4DUGA 4ZU3A 1SU4A 4Y0VA 2QXYA 1USUA 2GS9A 3WHKA 4DIKA 5KYTA 1X8KA 3EG9B 2P6UA 1DKNA 1JHDA 3CZAA 3WRYA 2GEDA 4DV1B 5I4BA 3WB0A 2WPNA 2AOWA 3HKBA 2HGSA 3SJAA 3M6MD 4DB2A 4I50A 1ZCBA 3AF6A 2V9PA 5H9WA 1TFUA 2KS6A 3DAGA 4G65A 4MH0R 1BA3A 3LLUA 5CR9A 5ITZA 3GVCA 4V2IA 1ND5A 2JW5A 2I3DA 1QCYA 1T9CA 2CUKA 3G2PA 4HWOA 4MYRA 4KQ9A 5IDWA 1YZGA 3BJEA 4Z4GA 1EP9A 2BGRA 3F5MA 3FZYA 5HFJA 3V4SA 1CDEA 2ZJAA 3D6FA 3ZCXA 4B34A 4EVSA 3HHEA 5LMNB 3N59A 2Y1LA 4IQGA 4BMOB 2AR0A 3WG9A 3ZHSA 1AN9A 2PBRA 3PHHA 4G09A 1NHGA 3INGA 3LHKA 2EXXA 4QFCA 4ZCLA 2YH2A 4GPIB 4IIJB 1U3DA 2R6HA 4I1RA 5FJJA 5T6MA 2VQFB 2ZCJA 2J0SA 5TF4A 4MKXA 4XXHA 1QFSA 1MGPA 1P72A 4Z9AA 4CMBA 5L3QA 2FYTA 4QU9A 1A7AA 1Q50A 3QBTA 2QNIA 4U7PB 2Z9DA 5BVGB 2NSLA 5A1TA 4FEEA 3LC0A 3HZHA 5KNLA 3UY4A 4CUKA 3SXUA 4CXMA 3T1HB 2ORED 4HLQB 4RWZA 4NMXB 3WO0A 4E32A 1FW8A 1NNSA 4GRIA 5EMLA 1ZM2A 3SHQA 5HQ3A 2I3ZA 4QVKA 1HE8B 3P0EA 4A5OA 4OLFA 4FXOA 1I3NA 4RFVA 3LX8A 3MRVA 4HDMA 2GD2A 3AUKA 4TTTS 2G17A 1T3SA 1F6BA 1NYQA 2FF7A 2CDAA 1KETA 3VU8A 1VSBA 1P4JA 3EH1A 2FMHA 3JAWA 4DM4A 2OQ2A 1FNDA 1G8AA 5B1HA 1LDNA 1B15A 3SX4A 3CVVA 5BW4A 4HB0A 1IXYA 5E1DA 4PG8A 3AEKB 1J1UA 2F8LA 5LQSA 3QTBA 3MWYW 1D6MA 3ZJVA 1PT6A 2BV3A 1JHPA 3UOGA 3MWLA 2I1QA 5HIMA 1Z37A 1I32A 2IDZA 4M1TA 1GQFA 4MB6A 2BMVA 1YL7A 2QX8A 4WBNF 3K6SB 2W2LD 3ZBQA 1GY8A 3CLSC 3U4GA 1O6GA 1U02A 1RCFA 1UC9A 3AJDA 3EMDA 4UCXA 4UQOA 4X7PA 4AZTA 1S8AA 1M2EA 2Y0CA 1ISHA 2WU3A 4XFDA 1MC8A 4LZJA 1X7GA 1FTYA 3AOEC 4K2AA 4IQ0A 4D8UA 1ZD9A 5CDFE 3DH0A 1LFAA 3AR3A 1G63A 4HF7A 5NLLA 1G8JA 1L7RA 1Y9EA 4PQGA 3PWTA 3FSEA 4PGAA 4Q9JA 2JHFA 4AROA 2BFDA 1N32B 3TTSA 2QAIA 1IHOA 1FU4A 2TRSB 4L27A 1TZCA 3E70C 1K6EA 1ZUWA 2CEKA 4QAQA 2PS9A 1M6YA 5EWJA 2LTAA 3CLTD 5HA5A 3JVDA 2ZT6A 3LX4A 1DJLA 3IE2A 1HH4A 2DE0X 3QMVA 4I46A 5G53C 1MQSA 4C04A 3M89A 3QVTA 4FSXA 4DWOA 5F9FA 4B9EA 1KY3A 1TMKA 2GBLA 1SVUA 2X5XA 4WFQA 3RTDA 4BPRA 2HLHA 2X8AA 4P58A 5KTOA 3I52A 3MAJA 2UU9B 3OTWA 4IIFA 1CWUA 4XDHA 3DT9A 1JECA 4J1TC 3WB2A 2ECKA 1VA4A 1NJSA 5EHZA 3M9XA 5CP8A 4Q3OA 2JLVA 1U2EA 4NFSA 1F2DA 3B78A 4DR5B 4ZCIA 2IFTA 4OQLA 2R8XA 1VJ5A 1EGHA 3VO1A 1LRLA 3HTXA 4MVJM 1WXDA 4WNAA 4U7HA 3TINA 4AJOA 3ESRA 1Z5VA 2B2CA 1TJ3A 2AHRA 4C0KA 2LNDA 4PM4A 5D3ZA 3UATA 4D74A 1CQZA 4NOKA 5KOJB 4LPKA 2PKQO 4ZYWA 5IM4A 1USIA 4IVPA 1U28C 1K8YB 2BBTA 1IN8A 1PT8A 1UJ5A 2DBQA 1ADBA 2G0TA 2G7MC 2Z8YM 2ADOA 4YCJA 2XT6A 3GUVA 3O4JA 1P1KA 2QXTA 1HDXA 1EUCB 1WDMA 2AMYA 2YVQA 3T7TA 4AXBA 1XF9A 1UP7A 2FMFA 1G8PA 3RSFA 1G7SA 4L4XA 1SM4A 5L3RA 3LA6A 1ODSA 4YRSA 1CHDA 5KKCA 1ACMA 1NKSA 1L7EA 3NT5A 2QGZA 4DILA 1QP0A 3ENKA 3GPIA 1DCTA 1SZPA 4HWGA 3AQIA 4UDNA 4CLXA 1QIGA 1B4DA 2L42A 2QTRA 1TA0A 4EPTA 2EJCA 3EPRA 4Y7CA 4M0MA 2A1UA 2EGGA 3E5NA 1PYGA 2FEAA 3VPDA 3W8RA 3WLAA 4DM3A 1X80B 2X2OA 1R66A 2GR9A 2GBPA 3T12A 1II8B 3TEJA 2BTQA 1RE0A 121PA 4G5RA 4DMCA 4UUPA 4A10A 2ECQA 2FLWA 1A95A 1XDWA 2Q2OA 3GGPA 4IEEA 2C92A 1TO1E 4W9RA 2Z98A 4EFDA 2YJNA 2DRIA 4LJ9A 5SY4A 5CLFA 3GJ7A 1QH1B 1TW2A 2P4HX 3WAJA 2DUUA 1WB5A 4A2PA 3LL4A 2MSLA 2BJWA 4F6RB 5C3MA 1EXVA 2IH4A 3H5VA 3AI3A 3TQFA 2BR5A 2KW5A 2OCLA 1DG3A 3NHLA 2HQSA 1RPTA 3F3KA 1UMBB 4E14A 4E88A 2Q5FA 1BTOA 2C5FA 1C41A 1UWCA 2IYZA 4KXXA 3W1WA 3ZI4A 4EHFA 4RHYA 4ZCTA 3NYQA 2R751 4N9QA 4PN7A 1G18A 1R27A 2A5LA 4RQUA 5A6SA 2WMYA 4MUHA 5DGHA 2HDWA 3OICA 2I3BA 2VP3A 3A3PA 3UJ3X 1LPSA 1K3UB 3IUYA 4PS0A 3WLHA 3X0DA 4HMPA 4EKNB 4I4CA 2UZ1A 3ESBA 3WNDA 2Q62A 1P18A 4A2WA 4F3KA 2UYGA 4PSVA 2X4DA 3E4DA 3ZWPA 1XYYA 2W58A 4NBVA 4BECA 3FFTA 3RSZA 2WP8J 1KA9H 2X42A 4OXXA 4POAA 2Q6TA 2FU5C 4JNCA 1JG7A 4WE3A 5DTMA 2ZYDA 4BWGA 4EVQA 2O4CA 2Y1DA 3LBHA 2YUIA 3EIFA 3VX3A 4KRGA 5DJ5A 4AZ0B 4ZOLA 1QIHA 2XTJA 3MWFA 4MKZA 2VDPB 4Y2QA 4DV2B 3DNPA 1JKIA 1J90A 3KFVA 4HHEA 4GSKA 4DCSA 4X24A 2R48A 3RSSA 3U1TA 1B2RA 1H4VB 1XP5A 2WD8A 4C4PA 1A7KA 3PQEA 4DEVA 2GYYA 4MI1A 4EZEA 3OPYA 4HAZA 1XTIA 2WWGA 3SAJA 3GJ6A 3J7AC 2R4TA 5CHYA 3RS3A 4XPIB 3EFOB 4U9IS 2H51A 1BDBA 5JNTA 2CK3D 4G56A 3F74A 3A6PC 1N6NA 2XV1A 1X3SA 1JILA 3O4GA 4Q3AA 1DJOA 3A1FA 5DBEX 4EMBA 2D1QA 2HMAA 4TKLA 3VSAA 1UBUS 1TA9A 2NIPA 4BNFA 2JLSA 4ZYLA 1P1BA 1QB8A 4AN0A 4AZ3A 2JVKA 1TUBB 2JARA 4UBIA 4GP7A 4DMKA 3KQVA 2BKUA 3GCGA 3NT4A 1PDVA 4JXKA 4RM2A 2YKGA 1SBQA 5JZVA 5UKDA 1U11A 4EY5A 4IDQA 2VXBA 2MWMA 1K9VF 3B6MA 2I22A 2FQYA 3FX2A 5JD6A 2JJMA 3DUWA 2WT8A 3TDMA 4KOAA 5CYFA 2JLBA 1X7YA 3E35A 4Q4JA 5EJ7A 1DQZA 2WWVD 4EELA 4C1BA 4OI4A 1OXTA 2IW3A 3MFQA 2G9ZA 3BQMB 4X65B 4TL6A 4U3JA 3E0QA 5ECDA 4OPMA 4WERA 4D2IA 5DH9A 2GN2A 1X7WB 5JSYA 4FHZA 4G1FA 4DZTA 2IS1A 1C0PA 1MRNA 1RNLA 3OPNA 5CW1A 1I6LA 3Q7RA 2PUTA 3W05A 5F7ZA 3E48A 3NBKA 3KHTA 4QYTA 4BQSA 1UJ6A 3ZCQA 2PZFA 4GZ6A 1UPXA 3QY9A 4B2IA 2VDJA 1I30A 4D4JA 2VJYA 3JASA 1OZFA 5IZCC 3MLBA 1XB2A 2GLXA 4OJKA 3W8NA 4DBZA 1EVEA 2JFZA 1Z74A 1AZWA 1CRPA 2D4HA 3ZDAA 2AMFA 4BBZA 1A5ZA 5JDCC 3KJFA 2FR0A 3OIWA 3WQRA 2QQ0A 3DC7A 3OQHA 1XMOB 1FS4A 1VJRA 2CMFA 4PC1A 3URMA 4OF4A 2WUFA 4Q00A 4M1KA 2PMDA 4C20A 2FW7A 2P35A 3ELBA 1WETA 3JQBA 2ZDHA 3F7OA 2X86A 4LSGA 4MCHA 4US1R 5HM6A 3B5EA 3P20A 5KTYA 1EFHA 5BQ5A 1SBCA 5EIBC 1M6VB 1T2EA 3X2SA 3EA0A 4E22A 2V7EA 5CFOA 2WZCA 3F6CA 4PQFA 5EPEA 2DAPA 2H9IA 2R96A 4EB0A 4DKXA 3LRTA 2ZBEA 1JLLB 1R0LA 4OJNA 3SIPA 5I51A 5T6BA 5KB3A 4P93A 1KAOA 1OXMA 4MKHA 1Q7EA 2AXQA 1KDZA 3UJ7A 1PW7A 1OOEA 2JCSA 1XAJA 521PA 4F71A 2BKVA 1KZ9A 1V5FA 3LH5A 1Z8HA 4UHBA 4YJGA 1W6RA 1ABEA 4D97A 1DSSG 1U8ZA 3H2ZA 3Q87B 1PGPA 2CXXA 3BWVA 5IBQA 3ZWOA 3E1SA 2PXAA 3B6IA 5J23A 4AQ7A 4HH3C 4ZO9A 4MA0A 2WE7A 3O38A 1KYZA 1R0XA 1MOPA 2G8LA 3E6AA 4ZQBA 1L4EA 4B2PA 1CY2A 1UPCA 4DA8A 5ICEA 3KEMA 5C1OA 1AD2A 2F4NA 1KZ6A 2PIAA 1ZM3A 1WCIB 1P0QA 5AIBA 4BLRA 3N58A 4DRXA 3BKWA 3D5QA 1TJ5A 2EHJA 4AJ9A 4CETA 3IDSA 5CXSA 1UR5A 2XGMA 2FSHA 1JF8A 1C3XA 1S5PA 2R6GA 3ICCA 3NHMA 3QVVA 5H7XA 3ZNPA 4AUKA 4J3NA 4F3CA 3KE8A 2FSUA 2D4AA 4XFKA 2YC4C 2KJQA 1AUVA 1G2QA 3QNUA 5CEJA 3GQBA 4MUKA 1L5GB 1VYHA 2JFXA 3J80A 5AVRA 3T7JA 2W6MA 3FLAA 3LP5A 4QULA 2YY6A 2P5UA 1E3EA 5AW8A 1Y1QA 5K0TA 1MIOB 1SXJB 3DMPA 4FP9A 1JPJA 1AKUA 4B6RA 4XPZA 3ZNNA 1VZ2A 4CMEC 1CNFA 1E8NA 1SRQA 4OHYA 5CD1A 1O0BA 3UF0A 2VNJA 5AESA 1NP6A 1V8BA 1BMQA 3UJBA 5CUQA 3V4ZA 4QARA 1AMUA 2GWHA 4AJ1A 2FFRA 2QN2A 4N3BA 5H5JA 2BKXA 1W0JA 3WWPA 3K8ZA 5K4AA 3H16A 3C1AA 5FJIA 1OT5A 1TYBE 3WQHA 5BY2A 3V4RA 2X2FA 2VXCA 2YICA 5C46F 4DQVA 1PGNA 2ZUWA 3NXSA 2PUGA 2FWMX 2RGGA 3N3AC 3IVRA 1PFVA 4KX3A 3N74A 1RLOA 2OUKA 4XD7A 3TM4A 2Q4OA 2N46A 3UQZA 3EY4A 3B3AA 1P2DA 1XCOA 3BMNA 4D99A 4P36A 4JX9A 4FLMA 1EM8A 4QOIA 2VZEA 1SHZA 4MW9A 2W93A 5FP0A 4A1FA 5HK9A 5IT9A 1ZHOA 1OXUA 2BMDA 2FOXA 1F8GA 4TN1A 4IQFA 2CY0A 1Q2UA 1Y7LA 2VCHA 3BN3A 3X1KA 1I7SB 1C4XA 2W2XA 4L0DA 4UTVA 1ZOOA 4YAUA 2R3SA 4WECA 3A4NA 1JHUA 3F78A 1IXRC 3FRIA 4O4IF 4UBKA 2HLNA 3BG5A 1QCDA 1CQJB 3I5UA 3LM8A 4RHUA 3H1PA 1Z2OX 2YIVX 2ZIZA 4TZ6A 1SOAA 4WLNA 1X7DA 5JSZA 1L4YA 2XD9A 4J4BA 3ZWWA 1NQTA 1OXKB 1GAWA 3WGNA 3PNBA 3VR3A 1K8XB 1M34A 4CQMD 1YZVA 4HPXB 4K40A 1TMGE 2YDYA 1RHQA 4EA9A 4K6CA 1QGUB 4R3WA 4BVKA 5DN6D 2I4IA 1RADA 4HNRA 3UUGA 3CZPA 4BUJA 4Y1RA 3QX9A 3BHJA 4QEZA 2QX7A 1KZ4A 3CLVA 1TNDA 3RVRA 1WXHA 1I5OA 4N5MA 5BRJA 3E53A 4HGZA 2YFHA 1R0CA 2VPTA 1ZD3A 2LGJA 3Q0IA 3AR6A 3PG5A 2M6KA 3MEQA 3UK6A 3UV7A 3RHTA 3ZJUA 2BTOA 1A9YA 2QMOA 2DETA 2PYZA 3U3MA 3K32A 4M89A 2Y1XA 1R0SA 3OMLA 2YHIA 3LUKA 4J43A 3TQCA 5CB8A 4H17A 5EJ5A 4KXLA 1XHEA 2ZBUA 2PHZA 3BHNA 2Z6AA 1G3MA 3EF1A 4C4ZA 1P5ZB 4PZAA 2RKWA 5T64A 3M1AA 4JN6B 4X6XA 5HP4A 3DOHA 2ZQ5A 3GIWA 4Q9KA 5FI0B 4D3FA 2R6CA 5IU6A 3SICE 2HO4A 4NMWA 3ZCSA 3IPYA 3K9LA 1ZRHA 4URZR 1K27A 4OQDA 1JI3A 3AM3A 2FWRA 3NHZA 1EGMB 2GAOA 3P7MA 5LQMA 1LPMA 1MJHA 4KI7A 4KUEA 3AGPA 2QYSA 5AVQA 3ZQ4A 5LJLA 3QPUA 2SCUB 1P1FA 4QREA 3WGZA 3O4VA 4QKQA 2YR0A 3QUSA 1WHSB 2AEMA 4JLNA 3MS7A 4KYVA 4XUEA 2HMYB 2XDWA 2DWUA 3D64A 4A6DA 3OJOA 5BSRA 1XPRA 4JT9A 1R9JA 1IJEA 2P6MA 3HY4A 3PF9A 4KXWA 3RIHA 3ZH9B 2A9VA 3HKDB 1AKQA 1NY6A 4YO8A 4W4TA 3VPXA 2EG9A 4RSGA 1P2SA 4U7JA 2PGNA 3SZ3A 2YJ3A 3THWA 1VIDA 1KF0A 2VAMA 1DJMA 3L1IA 4P0TA 5D3MB 1JEYB 1FZQA 2VF4X 4NSNA 1ZI9A 1N6KA 1Z4IA 1S0UA 3OQ1A 4NS1A 4JU9A 1XRMA 1ZU5A 2R00C 1XA3A 3G23A 2MSDB 4MO2A 5LP6F 3ONNA 2XWJI 1D6SA 1H2YA 1PZMA 1M7BA 1JXAA 4QXAA 4DXDA 4IEFB 4IW3B 3WGUA 4OHZA 3ZN2A 4CTKA 1XVUA 2BMEA 3ABQB 5CFQA 3CXUA 5KNDA 4EK9A 3N39C 5BW8A 3NWBA 3R5KA 4MVYA 1BXGA 2AFHA 1CKEA 3WBFA 4A8JB 1V35A 5LWHA 2YFKA 1QQTA 1BCRA 2AFIB 3BRSA 1QAQA 2VVTA 4M9CA 1U8CB 1PG2A 2ZAGA 4ISCA 2ZXFA 2CHUA 4X45A 3L3BA 3OP4A 4XLZA 2PUVA 2UYOA 4D0SA 1XDUA 1U6JA 2P67A 1IATA 4BZPA 3IMGA 4GPZA 3CRRA 4UHEA 1JEQB 2CNWA 2FUG1 3DL7A 3PDIB 1YHNA 1Y3CE 2IU4A 4JROA 2JJ2A 2W2TA 4KVAA 4WBXC 5JWHA 4QTXA 1UPAA 1XEXA 3IUBA 4CR7A 1W25A 5JAQA 2WB4A 3OF5A 3E7DA 3TKLA 5B55A 5JMPA 3NP9A 2G1UA 3BC1A 1R4MA 3F2IA 5J47A 3I34X 4FILA 4QX6A 4Y6OA 3F6EX 1MNQA 1Z34A 3QOYA 4JFAA 4DJEC 3OFNA 5DO9A 4MQLA 4IO1A 2R8BA 1CR6A 3TZCA 3Q9LA 5F2OA 2XIQA 4TWZA 1AHIA 4FJ1A 4IOKA 2EG5A 4OREX 5E3IA 4UTRA 3FR8A 1YHYA 5CFZA 3NTLA 2G06A 1GHTA 4X60A 5EXSA 1XVTA 2OLKA 4NONA 1EIWA 4LDPA 5BPFA 5JNVA 1DT3A 3P52A 3SYTA 4JLKA 2JNWA 5LQDA 5TVKA 3JARB 1ND6A 3FVTA 3L8GA 4JAVC 1RWOA 4I3GA 1N2BA 2P3QA 4FEYA 1RYYA 3GA7A 1JVBA 4XVCA 5JZOA 1JXMA 2B20A 4U0KA 4YAWA 3NBZC 1RWWA 4IWXA 1XWIA 1W30A 3A4IA 2J6BA 1B14A 2EF0A 4MO9A 3VNQA 1ZNZA 1B0AA 1FPQA 2IOHA 2XMSA 1W7AA 5GINE 3HEBA 1A98A 3DONA 5I6DA 1AXRA 1TD1A 3AUSA 3O1JC 3DDUA 4WEOA 3K1JA 2PS1A 4Q4HB 4FGSA 1ZUD1 4PLZA 3VAYA 2JGRA 2OZLB 1ESNA 1Q21A 1Y9ZA 1R0ZA 3ENNA 4WHMA 1RMTA 1SG6A 4FMDF 3CNNA 2Y2VA 4Q93A 2ZT8A 3I9KA 1YB2A 5ALKA 3W5DA 1T2CA 1JP7A 2ZUDA 4TXHA 3T1OA 2H4ZA 4MLDA 5HUHA 3JVIA 4GKAA 2GJAA 3MJCA 1M2NA 3LRXA 3VSBA 3CEJA 1QZ3A 1M2VA 1RMQA 1RVV1 3IUMA 3PEUA 4KN9S 3UTDA 1LBEA 3NKFA 3K0HA 1ACJA 3OLXA 1ZBQA 2D3TA 1ZICA 3U3RA 1ACLA 1HBJA 2BP7B 5KNBD 3MLAA 1LRJA 2AKAB 3STVA 1H2EA 4PC3A 1MO4A 1KH1A 4JQCA 3QTTA 4TV9A 4R7GA 2W90A 5GV8A 4TLMB 4I7EA 1E6UA 4IFEA 2F43A 4KV7A 5YASA 3VR6H 4MYDA 3EAQA 1GIAA 4C0JA 4IKEA 4OXQA 4ENWA 3B9RA 1W44A 4KQCA 2P4EA 2OWEA 3MGBA 3SDBA 3ZZ0A 4B8WA 1KJWA 3IA2A 3BDVA 3LJKA 2JJQA 4JIMA 4HEJA 4OHWA 2PZJA 3ONVA 4D1YA 3LQ2A 1OPXA 1VHDA 2B3TA 3QJGA 1VJ0A 3O8OA 1OCEA 5KYXB 2WYVA 4IHJB 3MJFA 3FR7A 2QUIA 3BAZA 4GI5A 3X3HA 1MJGA 2GBGA 2M9MA 3HU1A 3GELA 2W2LA 1T8TA 4NULA 1OXVA 2IKQA 3NEPX 3L8HA 4EA7A 1KEEB 1XVIA 4BMVA 3ADDA 1PR1A 5DNDA 2I7CA 4LC9A 1H2HA 2G07A 1GTVA 1H1LB 2QD1A 3WBJA 3GY0A 2Z9BA 3R5HA 4NY1A 1PWEA 1KOJA 1E2IA 3F6SA 3TZHA 2O8DA 1EINA 4YASA 1UK7A 1JJIA 1ZWLA 1PNTA 4JHLA 2NSDA