2GZRA

Enterobactin and salmochelin hydrolase iroe
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
265
structure length
242
Chain Sequence
PNIADKGSVFYHFSATSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDDELLKQLSEKTPPVIVAVGYQTNLPFDLNSRAYDYTPAAERKSGGSNNFRQLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWLSSSYFRSYYSASPSLGRGYDALLSRVTAVEPLQFCTKHLAIMEGSAGVLSKIHTTLTILKDKGVNAVFWDFPNLGHGPMFNASFRQALLDISGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Enterobactin Hydrolase IroE.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords IroE protein
total genus 84
structure length 242
sequence length 265
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gzrA00
3WK9A 1TKRA 5AKLA 4DMKA 1QIEA 4OU5A 4EY5A 3N2ZB 1CQWA 1DX6A 4BDSA 2XLCA 3ZI7A 2Z8XA 1VZ3A 5CH5A 2HA4A 2H7YA 5FKJA 1C4XA 2HDWA 5KWIA 4DNPA 1IUPA 3ICVA 4N5HX 3L1IA 1DT5A 4UHFA 4Y2TA 3Q0TA 3D5EA 3LCRA 1MO2A 1CV2A 1EDEA 2PL5A 1AURA 2VJBA 5JD5A 1SCKA 1XZFA 5ALVA 1WM1A 2Z3ZA 3BWXA 4C01A 3H1AA 3RKSA 2JGMA 5HCUA 2J3QA 4H7FA 5FXMA 2WIJA 3QVMA 5AOAA 1R4ZA 5T4FA 5DTJA 5A71A 3DKKA 4RGYA 5DTIA 4X92A 4Y2XA 1MX5A 2PSDA 2ZYHA 4OU4A 4W9RA 1H2XA 5IVDA 1OXMA 5KWJA 5AOCA 4G4IA 4N5IX 4NMWA 3DS8A 3ESDA 4WY5A 4Y2PA 4H18A 3QMWA 4BP8A 5LZ7A 2BUAA 3HSSA 4QLOA 5DNVA 3SWWA 4B81A 1QTIA 3H19A 3A70A 1XZLA 3ZWQA 3IB3A 1CPYA 5ALDA 5FP0A 4J7AA 2HRQA 2C0QA 4UBLA 4AMYA 4XX1A 3UMJA 5LZ8A 1B41A 1CUZA 4EBBA 4AMZA 3KXPA 5J3JA 5ALMA 4FTWA 1QO7A 1IVYA 1ORVA 3CCBA 5EHQA 1O6GA 1P0IA 3ZPXA 3IDAA 2PUHA 2Z8ZA 4UHHA 3K2IA 1SCQA 2WUFA 4FKBA 4XJVA 5AM3A 1CFJA 3I6MA 5EHXA 3JWEA 1QONA 4G4JA 4X7BA 2VQ6A 3PFCA 3KSRA 2XT0A 1LNSA 5BWCA 3R0VA 5IVHA 4AN0A 3PFBA 4DNOA 3FWHA 4FLMA 3GROA 4HRYA 1R1DA 2FUKA 1LBTA 2XLBA 4ROTA 4K6GA 2PM8A 4W1QA 5AM1A 6YASA 2XUAA 2O7VA 4HRXA 4DLNA 4K5QA 2GYUA 4F5ZA 4I3FA 3A2NA 4W1RA 1ODSA 3R41A 3WIOA 4J0JA 2W6CX 4Y2QA 1DTEA 1ZD3A 4UHDA 2PU5A 5DYTA 3H2JA 4A5SA 5CXUA 5JD4A 2CKMA 3SK0A 2ZYSA 4CCYA 4LXIA 5A7GA 2PSFA 4L72A 2QT9A 4JEIA 4HTAA 1SOMA 4LXHA 5EIEA 4ZI5A 1K63A 3BIWA 1BE0A 4KAAA 1XROA 2EEPA 5E4YA 4BC0A 3SC2A 1NU8A 2ZSIA 4F21A 5HKAA 4AXBA 5LP1A 5LYYA 4HS9A 4Q34A 1QZ3A 2X5XA 4FBMA 1ACJA 3OTQA 3GELA 3AILA 1VJ5A 4C4YA 4BAUA 2BKLA 2WFLA 4N8DA 2ZYIA 2O2IA 2I3DA 3CXUA 5HQ3B 2DFPA 2XDWA 3G9ZA 3B3QA 4J3JA 2GBCA 4L3WA 4M0FA 5AM5A 4EB0A 4UFNA 2C5GA 4X6UA 4X91A 3TEJA 4HZGA 1UKAA 5IVIA 1XLVA 3V9AA 1XZHA 1CUSA 4KE8A 3G0GA 3T4UA 2Y1KA 3W04A 3F98A 2CBGA 2R11A 3G9UA 5IKXA 3H0CA 3AZQA 3GZJA 4W1PA 5LZ4A 1XKLA 3CCCA 3VVLA 3W06A 1Q83A 4IH4A 5HFNA 5I7UA 2WUGA 1GPNA 1UOPA 1X2EA 1QOZA 3G02A 4QWWA 5ALYA 3WA7A 1XLUA 1XZJA 5AI9A 5CT6A 1CUAA 2WILA 3O0DA 3WJ1A 5JD6A 5CW2A 3YASA 4UHBA 5ALOA 3K9BA 2ORYA 2QOEA 2WFMA 5AKXA 3S8YA 3G0DA 2HA6A 2Y6UA 3BE8A 4CG1A 1CR6A 4X6XA 2XQJA 3R3VA 2WHQA 3WJ2A 2ACKA 3R3XA 4FLFA 3WKBA 1YASA 3DLTA 4JNCA 3O4HA 3OOSA 5AI5A 1H2WA 1DWQA 4RE5A 1HKHA 4WFIA 3I1IA 3WKAA 2OGTA 1GPKA 1KU0A 4QDOA 4Y2SA 1VZ2A 1WHTA 3T52A 1ZGCA 2QMQA 4PSCA 1EDBA 2VEOA 1RYYA 4LXGA 3C5VA 4M0EA 4H35A 5ALQA 2ZJFA 2DR0A 2VT6A 1QIDA 1XZDA 1CRLA 5CMLA 1EB9A 4AQDA 4H7EA 5JZBA 3STWA 3D2BA 1EH5A 3MVEA 5DJ5A 1G42A 3DNMA 4EA6A 5K3DA 1F6WA 5JIBA 2WQZA 2HA0A 5T4HA 1IZ7A 3M83A 4N8SA 4NVRA 2WKWA 5ALPA 3RLIA 3F8SA 2DQYA 1XKTA 3ANTA 4B85A 5CTAA 2XMBA 4LIPD 1UWCA 5JATA 4WFJA 3V1NA 1W1IA 3RK4A 1E3QA 2XMCA 1UZAA 2HA2A 2C0PA 1FFAA 2BUBA 5AP9A 3WK4A 4P93A 5A7FA 1EDDA 4A23A 2QVBA 3P2MA 1XZIA 4YASA 5D7BA 5FPQA 4Y2RA 5BOVA 2QXTA 4FMPA 5ALRA 4UFOA 3ESAA 1UT6A 5AIAA 1YS2X 5CH8A 5AK4A 4BVKA 5AI0A 2WIGA 3WK5A 1ZI8A 5E4JA 1A8SA 2OG1A 3WQHA 2OGSA 3WWEA 5EFZA 1E66A 2E3JA 3D2CA 3AZOA 3QYJA 1UK6A 4Y7DA 5C8VA 2OCLA 1T4MA 1UK9A 1JMYA 1CUGA 1P0MA 2FJ0A 3AJAA 4BVJA 3STYA 1AX9A 3LLCA 4BZZA 2RI6A 4UFPA 1AMNA 3ZLTA 3VXKA 2QM0A 1GPLA 4UBMA 2XUKA 2G63A 4MXDA 4DMCA 2CEKA 1IUNA 3WZLA 1VE6A 1CUWA 1VA4A 1FFEA 5CT4A 2JGIA 2XUHA 5AK6A 1YA8A 5SYNA 4BE9A 4ZV9A 1WB4A 4MYSA 2BGRA 1G4HA 3DQZA 4I4CA 4M0MA 5EGNA 1MJ5A 5LZ5A 2OCIA 4QE3A 1QFSA 4L9AA 3FAKA 2WU3A 2R8BA 1C7JA 3WYNA 1HQDA 3NGMA 3O4GA 3QMVA 1E8NA 3HACA 2QZPA 3H04A 1XQWA 2Z3WA 4DMFA 4QWMA 3K6KA 4FOLA 2ROQA 4CI9A 2PSJA 4XWGA 3HI4A 3QMMA 4ZRDA 5K3FA 3WKCA 4AO7A 2BFNA 2ES4A 2B20A 4NZZA 3HEAA 3WL5A 2XUGA 1LPOA 1Y7IA 4HAIA 5D3KA 2HA5A 4AN1A 5BWBA 2H7CA 3FYTA 2XQGA 4FDMA 4MJ3A 5AKZA 4JYPA 3C6BA 5AKYA 3BF7A 4W1SA 4OB6A 4RE6A 1XRMA 4U2BA 4E15A 1WPRA 1N8SA 2QRUA 2XMZA 3AIKA 2UZ0A 4B0PA 1TCAA 1CUHA 5KREA 5HKBA 3BJMA 5AKGA 3C43A 1PV1A 4J0HA 1B6GA 3C6XA 1ZIYA 2CUTA 3ESCA 1THGA 1BEEA 1C7IA 2JIDA 4Y9SA 1QGED 4KACA 3WL6A 2QUAA 3WL8A 1EI9A 2WG0A 4X97A 3EF3A 4PF1A 1GKKA 5HF9A 5K3BA 4J0GA 3M82A 2B4KA 4IH1A 4PSUA 4G9EA 2RHWA 4EY4A 5JADA 3NUZA 3B5EA 4J0KA 5ALUA 3KDAA 4CIAA 3M81A 4P92A 2HL6A 5AI4A 1WB6A 1ZICA 4JUIA 5ALIA 2QS9A 5AIBA 2OAGA 1QIKA 2YYSA 1QIGA 4OYLA 4AO8A 5IH7A 3I6YA 3QM1A 5CT9A 1Q0ZA 1XQVA 1LPBB 3WLAA 4QDXA 1A7UA 4ETWA 5JARA 3G0IA 4BRZA 3PDCA 4HVTA 1CUFA 4P08A 5A2GA 1JMKC 4LYDA 1MNQA 1MT3A 1EVQA 4UBIA 3F9CA 4KE9A 5AKEA 5JYCA 3G9TA 1VA5A 3B12A 4BVLA 1DU4A 4Z49A 3TRDA 2AJBA 5H3HA 4G8BA 1K6EA 4QDUA 3HXKA 4ZV7A 3W9UA 3IULA 4OB7A 1DX4A 3VKFA 3STXA 2H7XA 3Q8WA 1BN6A 5ALHA 1OILA 5EHNA 1JU3A 1X70A 3QZUA 3O95A 3V1KA 1LLFA 4BC1A 3BDVA 1MTZA 2JEZA 2XQIA 4Q3LA 4C4ZA 3CN9A 4W63A 1EINA 1TK3A 2B61A 4GW3A 3QPDA 1LBSA 1USWA 2HFJA 2XUDA 5AICA 5CBKA 1CUDA 3WMRA 4G5XA 1BROA 1J1IA 3FOBA 3WK7A 4X94A 1Z68A 4GHWA 2J4FA 2C7BA 2V97A 1CUXA 5ALJA 4LKOA 4B80A 3F97A 4E11A 2FX5A 3VJMA 3I6ZA 1ETHA 4BTVA 2DCMA 1XZBA 1ZJ4A 2OXEA 2DSNA 1TIBA 4E14A 4RPCA 3DKRA 1IZ8A 2PKYX 2H9YA 4U2EA 4AZ0A 2WHRA 3DCNA 4ZREA 3R3YA 3CN7A 1HDEA 2XUJA 3FYUB 2BAGA 1FFBA 5D3ZA 1W4LA 4AO6A 1MU0A 1XRLA 4C4XA 2IX9A 1WOMA 1BCSA 3WA6A 1R9NA 3H2GA 5BV7A 3I2IA 4JYMA 1LZKA 4BP9A 4GECA 4DNQA 2XMRA 2GBGA 2XUIA 3FCYA 3I2HA 2Y2VA 1H22A 4O08A 3KD2A 3R40A 5AK5A 2CB9A 1ZGBA 4U2CA 3L1HA 4MEBA 1K8QA 3ZLUA 2G4LA 2OAEA 2JF0A 2XUQA 1G5FA 1W75A 3BJRA 1UOOA 5CRIA 4JH0A 2WJ3A 4BYMA 2X76A 3ILSA 1EX9A 1DWPA 3AZPA 1UXOA 4B83A 1THTA 2VF2A 3W05A 1H23A 2HU5A 4PQEA 4PNZA 5LZ2A 5JZ9A 1SC9A 3IUQA 1ODCA 2WSLA 5D6OA 1YCDA 1UOQA 3V48A 1FFDA 4J0IA 5C8XA 4KAFA 5JZSA 1W76A 1XZGA 4AZ3A 5DYYA 1XRNA 2HU7A 5JALA 2CMFA 3HLKA 3EIOA 1PJAA 5ALXA 4BB0A 4BTLA 2WFZA 1E8DA 1RWQA 2VJDA 2VAXA 2O2HA 4WJLA 1ACLA 2IITA 2RAUA 1GQRA 3OM8A 4XVCA 4GI1A 3I2JA 4U2DA 1YR2A 3D7RA 4L0CA 3H18A 5JASA 2C5FA 3FLEA 4DNFA 4B84A 2QTBA 3C45A 4EY8A 1UK7A 4WY8A 3I1YA 3QITA 4IQ4A 2XQFA 3AIOA 3OURA 2PSHA 4FFWA 4FNGA 5I8PA 4KE6A 3FVTA 5JANA 4IH9A 3UUEA 5DLPA 1CQZA 4G8DA 5AK3A 5AKIA 1JJFA 3L1JA 1UKBA 1QO9A 1VXRA 2DHCA 3JW8A 4OUKX 4QZVA 2WFLB 4INZA 3ANSA 2HIHA 5HF6A 1XQYA 4DTCA 4X6YA 3EQ8A 1DWOA 2Z5GA 4E46A 1K4YA 4ITVA 4H7DA 3M3DA 1L7QA 1L7AA 1QIMA 4H7HA 4MWSA 4MYDA 3G8YA 1ZD5A 2XMQA 4K6HA 2PVSA 4LHEA 4C6HA 2D5LA 2LIPA 1AQLA 2HM7A 2WIDA 4XIIA 5DWDA 4WDRA 3AUKA 3FSGD 1FFCA 3X3HA 3ZLVA 4MEAA 5AJHA 1AZWA 1J06A 1TAHA 3TJMA 3I2GA 2GYWA 2QUBA 5AKKA 3A2MA 3OG9A 5FOQA 2WUEA 2GBFA 3FVRA 4HXFB 1YSCA 1WPXA 4X95A 2I03A 3DL4A 2EDCA 5ISMA 3W2TA 4WDQA 5AM0A 3LIIA 1CUVA 3HABA 3DDUA 3PF9A 5EHZA 4YPVA 3RM3A 4UHEA 1GKLA 5A62A 3KWJA 5DNUA 2HADA 3FYUC 3IUNA 2VAVA 2WUDA 1N5MA 3IIIA 5E4TA 3SX4A 1YB6A 1XZKA 5E2IA 3C6ZA 3G0CA 2H1IA 1MX1A 2G5PA 2CZQA 1N5RA 4C89A 2GYVA 1AGYA 5HFAA 1XZAA 4OSEA 3DOIA 1R88A 1L7RA 1BCRA 1H2YA 1CUCA 4A16A 5C81A 3FSGA 2HA7A 4J0DA 3DJYA 3IUMA 5A6VA 3C6YA 3BL8A 1QLWA 3STUA 4Y2VA 1T2NA 1JU4A 1VXOA 2Y6VA 1BRTA 5JAHA 3WKDA 1KU6A 1LPMA 4QLAA 2AJLI 3PUHA 1MNAA 1CVLA 2ECFA 4CCWA 2WM2A 4Q3OA 1JI3A 4F0JA 3PI6A 2VATA 3S2ZA 1ZD4A 3W9BA 2XMGA 2BCEA 3V1LA 2JGJA 2YH2A 1LPPA 3GUUA 5ALNA 4BCDA 4TPKA 2WIKA 1EA5A 2RIPA 5ALLA 3C5WP 5AOBA 3FNBA 4EUSA 4C87A 3FCXA 1XRPA 3VJLA 7YASA 3VJKA 1EK1A 4BAGA 3WI7A 3G9XA 2XE4A 2RGUA 1LZLA 2ACEA 4UBJA 2WTNA 2VJAA 4HXGA 4YX9A 3TGLA 2X8BA 2C4HA 2I78A 3NOXA 3AIMA 4PV7A 2VTVA 3D59A 1LPSA 2BJHA 2RHTA 1YAJA 5FUMA 2JBWA 4BE4A 2WIFA 2JGKA 1QJ4A 4X90A 1H2ZA 1ZD2P 2JGEA 1A8QA 3C87A 1F0NA 5FV4A 1BU8A 4QDZA 5FPPA 4FHZA 4G8CA 5CURA 3PF8A 1XRQA 2PSEA 5ALTA 5C7YA 3FYUA 1VLQA 1P0PA 4F60A 5K3AA 1QFMA 1UK8A 1ZIXA 4B7ZA 1A8UA 1W6RA 4QNNA 3KOOA 2RONA 2Q0XA 1D07A 1XFDA 5K3CA 3E0XA 3PICA 4UUQA 5AM4A 4I19A 3H17A 5K3EA 2DQZA 1Y37A 3QPAA 2WG2A 1U4NA 4FBLA 2WTMA 3STVA 4GEGA 4UPDA 3A6ZA 2DHEA 4P9NA 1GT6A 4GXNA 5JAUA 2J3DA 5JAOA 5LKRA 4Q1VA 4TVKA 5AHXA 1TQHA 1CIJA 3H2IA 4H7IA 3V1MA 4IO0A 2DHDA 3C8DA 4EY7A 3F67A 2P8SA 1MX9A 1SCIA 3H1BA 3LIPA 4AX4A 3ESBA 4B9EA 1O6FA 3IUJA 1ZI9A 5FLKA 3H2KA 1MAHA 1ORWA 1UFOA 4FFVA 3HYSA 5CT5A 5ESRA 4K6KA 2PU7A 4FLEA 3WK8A 5HZGA 2WJ4A 1QIHA 2YXPX 3D4LA 2XMDA 5EIHA 4DMHA 1R3DA 1DT3A 1F0PA 4BCCA 2JGFA 4MWTA 2OGZA 2B9VA 2QR5A 3HJUA 1G66A 3FLBA 2WJ6A 3MGAA 2XB6A 2AJCA 1QIFA 2WG1A 3WKEA 1CUJA 4WCVA 5AH0A 1NU6A 2CJPA 3D0KA 3HZOA 2K2QB 1XQXA 1J2EA 3BF8A 3WK6A 1ISPA 3F96A 1IUOA 3OPMA 4KRXA 1E89A 4H77A 4DIUA 3WWCA 4DSAA 2PX6A 5SYMA 1QE3A 5AO9A 1GGVA 1GZ7A 1WHSA 3DD5A 5FDFA 5FRDA 4EHBA 4BDTA 4EY6A 2IIVA 2XMSA 5AKHA 2OQVA 4KAJA 1TRHA 3HC7A 1UKCA 2QJRA 2ZJ7A 1M33A 4Q3KA 3STTA 4KR0A 5AKJA 4BCBA 4X85A 3LP5A 3C8HA 1RP1A 3DYVA 1LPAB 4UBOA 4QEKA 1E8MA 4ZGBA 5KBYA 3PE6A 1PFQA 2ZVDA 4ZWNA 3UUFA 3RARA 1Y7HA 4C88A 2BUCA 1E5TA 3DOHA 3N0TA 4FNMA 4V2IA 1ZOIA 3MUNA 2O7RA 4UHCA 3EBLA 4CG3A 4B6GA 1R9MA 5HK8A 3D3NA 1XZMA 1FJ2A 1XRRA 3PUIA 4KYVA 3BDIA 1AC5A 3GFFA 1F8UA 5ALEA 4Q05A 2HFKA 2VA9A 4D9JA 2I3ZA 3QH4A 1XZCA 5LKAA 2ZJ6A 3FLAA 1LPNA 3O4JA 3C70A 4PO3X 1U8EA 1HBJA 2OLEA 4MQMA 4BATA 1DINA 2J4CA 1X2BA 4NS4A 1SFRA 2XUOA 4GLBA 1CLEA 4U2GA 1DQZA 3O9MA 2AJ8A 5ALSA 4DM7A 2OCGA 3EQ7A 3BIXA 4BAZA 1BS9A 3IURA 3WYDA 3GBSA 1ZJ5A 1LGYA 1Q84A 1JJBA 1OCEA 1JFRA 5ALWA 3O9VA 5ALGA 3JYHA 4K2AA 3HRHA 5DNWA 3BXPA 2YASA 1HPLA 5ALKA 4Y2UA 2GBIA 4S0XA 5AI6A 4ZXFA 2WHPB 2C58A 2GZSA 2WLSA 4U2FA 1K5PA 1JKMA 2FJPA 3IVMA 4BZWA 5HK9A 3WWDA 4DGQA 4G9GA 2V96A 4OCZA 1CUBA 5EI5A 4KRYA 2OQIA 1FSSA 4LYEA 1J07A 3MUOA 1YAHA 3G7NA 4CFSA 3QBJA 4KJXA 1MN6A 4X93A 2PUJA 4QDTA 1ODTC 3LS2A 5T4BA 5I9IA 3DEAA 3GA7A 1GXSA 4PSDA 4DYHA 4TGLA 1TCBA 4FWBA 2WU4A 3FBWA 1CUYA 2OPHA 1MPXA 4KE7A 4B82A 2Y2UA 3WWPA 3IBTA 3QPCA 5EIAA 4CCYB 2XUPA 3H2HA 2VT7A 4J03A 1YB7A 5DYWA 1WB5A 4UBNA 1AUOA 1DQYA 4GBGA 3A2LA 1XLWA 3AFIA 2OCKA 4BBZA 5LLSA 2NW6A 4OYYA 2W22A 1EK2A 1VE7A 1EB8A 1VKHA 1AKNA 4CIBA 1TCCA 4MQLA 2HHAA 1JT2A 4IHAA 5CH3A 2D0DA 3KWFA 1HL7A 2BGNA 5CXXA 1YS1X 2JGLA 2ZYRA 4H7JA 3ZV7A 2V9ZA 1U2EA 1R50A 1P0QA 1JJIA 4ARAA 5ALZA 5HQ3A 4OB8A 3NWOA 2V98A 2AXEA 5LZ9A 4HXEB 3D2AA 1MAAA 4GWLA 3U1TA 5CT8A 1QIJA 4Y2YA 5HF8A 4PW0A 5K3FB 1EXWA 5ALFA 4X71A 2VSQA 1S8OA 3U0VA 4B9AA 2JEYA 3ICWA 5YASA 4OPMA 1Q0RA 1BN7A 2QXUA 4RNCA 5LIPA 2PBLA 3G0BA 5AI8A 1A88A 2PPLA 3O4IA 4DSZA 1CEXA 2EDAA 2GZRA 3VISA 2WHPA 5F4ZA 3WL7A 1KEZA 4CG2A 5C8ZA 3DYIA 3I2FA 2XI4A 2XUFA 2QJWA 4OD0A 1BEZA 3I2KA 1QTRA 2ZSHA 5K5EA 2ONCA 1XZEA 1U65A 1CUUA 4Y2JA 1CUIA 3E4DA 1ZI6A 2G5TA 5JAPA 3VVMA 3DL7A 2O2GA 4B0OA 2XQKA 2HA3A 3R3WA 1HLGA 1WCYA 2AJDA 1EHYA 2HU8A 3ED1A 3WZMA 4X00A 3IA2A 4G1FA 4J0CA 4ARBA 4H7KA 1NX9A 1I6WA 4AB1A 5A7HA 4UBKA 1YA4A 5IVKA 3AINA 4WFKA 3WIBA 4QA9A 5T4EA 1N1MA 3R3ZA 4YK7A 1GQSA 3E1GA 4G4GA 4BRSA 3E3AA 5HF5A 2HRRA 3OC0A 4Q82A 1EVEA 4H0CA 4EZIA 3I28A 4N8EA 3R3UA 1CUEA 4X3CA 2QKYA 3VDXA 4KEAA 1IMJA 4GDMA 3EQ9A 3WWOA 1QIIA 2VJCA 1VOTA 1W52X 5AM2A
chains in the Genus database with same CATH superfamily
4LQ4A 1YJXA 4M86A 1KA9H 3DDZX 3GJ6A 1L5ZA 4JEMA 3WK9A 4EM6A 3RTEA 1X39A 5KAPA 3AO0B 4AF6A 5BWOA 2HZBA 3E1KA 2NU9A 4HGRA 4RKEA 2P7HA 1G20A 2Z9DA 1BHJA 4Y67A 1DX6A 2OXRA 2QQFA 3UAYA 4FNOA 2Z1DA 2XLCA 4OHRA 3ZI7A 4RU1A 5CH5A 1VZ3A 2H7YA 2HF2A 5FKJA 1KK0A 3V8PA 1FQJA 5CLHA 4L76A 2NU8A 5BSWA 4N41A 3RJ9A 3ICVA 4U4AA 2QVXX 4MARA 1DT5A 4UHFA 3LSTA 1JAHA 1YDFA 3CPJB 3Q0TA 3PXGA 3D5EA 1R12A 1P5ZB 3E8SA 5FUBA 4YRFA 4D5GA 4RX1A 5F9MA 1V5GA 3VO1A 4UUOA 3WR5A 3O8LA 4DY6A 3IJRA 3QV2A 4GQAA 4J8PA 3QEMB 4WFQA 3UM9A 3D43A 1ZFNA 2QW1A 3P2YA 5HMMA 2LVBA 3LOPA 3C4JA 1PS0A 4IHKA 1U1CA 5GPBA 3W77A 5IUKC 3IP3A 1AURA 4P83A 3RS0A 3ZU3A 2AQIA 3GXOA 4RADA 4PEVA 3KVOA 4UULA 4Q9IA 4CEJA 3SIXA 5ALVA 1SA0B 1RJWA 1WM1A 1T4GA 1TZBA 2PKRA 3AI2A 3BXXA 5FD8A 2MYNA 4EARA 4ZO4A 1AMUA 4E5NA 1YQTA 4J2OA 1ZNWA 2XWSA 5HCUA 5CD9A 2J3QA 2V4UA 2FX2A 4H7FA 4ZHQF 5GINE 4KH1A 4QYXA 2FXVA 4QBFA 4AJIA 3JR3A 4QEZA 3PTLA 4M7RA 3A9TA 2RG7A 3RS4A 3SF0A 1WMBA 5DTJA 4FEAA 2YS6A 5JSZB 1RWWA 1UUFA 5K2OA 1C81A 1V43A 5E2AA 5CFRA 2R7MA 5G4LA 4BPRA 2ORIA 2R751 2REXB 5SV2A 2ZYHA 2I7DA 3H8SA 3P0EA 2FSVC 4W9RA 5IVDA 2OMKA 3AB7A 5KWJA 1A9TA 5IJ9B 1M2JA 2BGMA 4G4IA 4C14A 4F4JA 5KYGA 2H8GA 1LKZA 4IOKA 3H0EA 1XCGB 3D4PA 1NDHA 2AW5A 3ILHA 2P2SA 3LQ2A 1NBOA 4WY5A 2NQ8A 2X8JA 5AHOA 4BN4A 4TVSA 3DJFA 4OXIA 3VRHA 4M1OA 4UXHA 2IDZA 3LC1O 5I7FA 1O97C 2BUAA 3NCTA 1MOZA 4Q9AA 2PMCA 1M2EA 2XDAA 2WA1A 1D0IA 3F7OA 1YDEA 3R5SA 2LCFA 4B81A 2ZRNA 1KFBB 1JKIA 4QJBA 3PQDA 5DRTA 2P35A 2B83A 3K2QA 3ZWQA 4KR6A 2C7GA 3SZOA 4EK9A 2FEPA 2XGSA 4PXSA 4J7AA 3DEZA 5FP0A 3TFQA 1SC4A 5D5PA 3TVDA 2HRQA 3TJZA 4UBLA 3SYNA 5AXAA 1APBA 5LZ8A 4BGUA 1JLSA 1QGAA 2AFHA 1V1MA 3SC4A 3TH5A 2I9PA 4FT2A 4IV0A 3PDIA 4D0RA 3AYXB 4BNGA 1U7XA 3T7IA 3HY4A 3UHPA 1SVWA 2G71A 3MINB 1TPZA 2GAOA 3DPIA 3OEWA 1IE3A 2GUWA 3PB3A 4GZ6A 5HS6A 4C04A 4GMHA 1WCXA 2QVCA 4FTWA 1E7MA 1E2BA 2GK7A 4YJ3A 2EG9A 1TT5A 4HADA 3PSAA 4FUQA 1P0IA 1KQNA 4YPFA 2W8ZA 4R3WA 2VPWA 3ZCTA 1FDVA 1K5HA 1NYTA 2C2HA 1YU6A 4FX5A 1SIUA 4K9OA 4W5HA 5F2OA 3FIUA 2AI2A 3K2IA 5ERXA 1FDWA 3FB4A 3QYPA 2WUFA 5EUBA 5A5FA 1EX7A 4OP1A 3HGTA 3EF1A 2OD9A 5FPYA 4GI5A 4AXXA 1M1NB 4XYGA 4HVLA 5HX7A 4OF4A 3OKPA 1Y9EA 2BFDB 5G1NA 1WUTA 4O33A 5ES4B 1L5HA 2H6EA 3AEZA 1XJCA 2UVDA 3V6LA 4NATA 2WQ7A 1JEYA 1JKJB 1RM4A 3K31A 2CNWA 1KI4A 2W2KB 4PFKA 1H0KA 3KSRA 4BB5A 2XT0A 4QODA 5MGNA 1N9ZA 4A0QA 1J8DA 3JQBA 3BXGA 1IHDA 1I4DD 1E5XA 2X1VA 2B5VA 1OLXB 2CJXA 4RTPA 1DDOA 4YAOA 5K01A 3HCCA 3RSOA 4JDUA 2IYUA 1WW2A 1QKKA 3DTVB 5DMHA 4FZRA 1XTTA 2DT5A 3UGKA 2ZUDA 4AN0A 3Q3JB 4RSHA 1X15A 1VE1A 3ZW9A 1GVNB 3B52X 3PDJA 1NNEA 3E5NA 1AV6A 4WNAB 2RHLA 2FUKA 3B2EA 1MMFB 4KXWA 3TDNA 1C0EA 3ZQKA 3LF1A 1HLPA 4HB3A 3DE3X 1JG2A 5ESDA 5G3ZA 2JLWA 3L0YA 2FWAA 4MROA 1LI4A 3DULA 2LKCA 5AM1A 4B7UA 6YASA 3TUIC 2IHUA 2REOA 4KDFA 1GNPA 2BSXA 3L0CA 4Q4HA 3LUCA 2MSDB 1FJXA 3MXTA 3QA9A 4HRXA 4QAQA 2AG8A 4LE1A 1AO0A 3AVYA 3LECA 4N7MA 3NPAA 4DLUA 4X9XA 4AFNA 1QRRA 4JLMA 121PA 2GYUA 3UHOA 4I3FA 5FOSA 4HDQB 1WKCA 1ODSA 4NBUA 2BH9A 1R8XA 1A69A 4DIKA 1KEWA 1PGPA 1Q92A 3ZBUA 4NY1A 2W6CX 5IBRA 1T8SA 4JLOA 3EXIB 1DTEA 4OV6B 4OAQA 4PGGA 1VG1A 3QY0A 5BWMA 5LMZA 3SMVA 3TOSA 3WP0A 2OQRA 3N2IA 4N3BA 2JZNA 4U63A 5HTOA 3K70D 2IX3A 2PYIA 2HGZA 4NCHA 2R65A 1XR3A 3E9RA 4MICA 1JN0A 4FFOA 4QSHA 4A5SA 5CXUA 6GPBA 4TQ9A 4HAVA 4I7EA 2X8WA 4QRHA 3V8MA 2RAPA 2AMLA 2IF2A 4NWIA 2GFQA 2CKMA 5EZ6B 5FFMA 3C8MA 4FB5A 2A5YB 2O5RA 5HRCA 1Z07A 3CZCA 1ZJWA 1ZYUA 3GHYA 4FVTA 4ZVSA 3F2IA 1Y1LA 5IP5A 5GGXA 1IN8A 5DWVA 4EW6A 1Y3BE 1Q14A 1NI4B 2EBUA 4JP5A 3KAJA 1DQRA 3TAXA 4UTVA 4YHHB 2UZ4A 1EZ4A 2A33A 2QT9A 4H9GA 1BW9A 2YYYA 4PQYA 1GJRA 1AN9A 2C84A 4JVSB 4LC0A 4B43A 1I7DA 4DIOA 3DMYA 4QXQA 2ZZNA 1KMIY 4LXHA 4R6WA 1FA9A 3R9XB 3R9WA 4GU5A 4OQZA 1K63A 2NTNA 3NGXA 4KAAA 5CFPA 5FWNA 3U6BA 4TWJA 1XROA 4BO9A 1KAMA 2XA9A 2CVHA 4UPEA 4XPZA 2E7ZA 5E4YA 2GCNA 4OXYA 4EATA 3W7VA 3NXKA 3UPUA 4JOBA 1P2FA 1WW3A 1HWYA 5HKAA 2BELA 4PPFA 5LYYA 2WM8A 2GBPA 1OFIA 1WCWA 1XZPA 4HS9A 4J7UA 9MHTA 1QZ3A 1VKRA 2CW5A 3R7FA 3ZCUA 4RTSA 4EFNA 1C1HA 3REQB 1H94A 2J9YB 5EP2A 1ACJA 1WG8A 3WTBA 4KG7A 4FYIA 1E4YA 1IB6A 4GWKA 4UDYX 3QOFA 4ZO7A 3AR2A 3A06A 4UQOA 4CMAA 1WZ2A 1NMEA 2O2YA 4F3RA 1XQ6A 1M34E 5DXAA 3N8KA 1SM4A 2WF7A 4N8DA 4IIDA 3CSUA 3I09A 2B1RA 2ZYIA 3LL7A 1QH8A 4JP1A 3OMWA 3STHA 2O2IA 5L6MB 2OBNA 2BRUC 4QDJA 1BQEA 1ENPA 1O94D 5BOSA 1B1AA 3Q87B 2I3DA 2VHCA 4O4LB 2EAUA 4E30A 2HNKA 2DFPA 3G9ZA 4HWOA 3B3QA 4X20A 1ZZEA 4YMTA 2QR3A 2PMBA 2YHIB 1J09A 1UDXA 2FLWA 2GBCA 1M76A 3CX8A 3MRTA 5DLDA 3ZY2A 2A0WA 3UJNA 2Q3CA 4K03A 3H6KA 4HVCA 1BRMA 3PJFA 4EB0A 4A15A 2QVLA 3C3MA 5H4HA 2X1MA 1CS0A 2X7HA 3ZLJA 2R25B 5FTJA 4B79A 2Y1DA 3SHQA 4X6UA 4X91A 4HZGA 5C4IA 3AF0A 4WNYA 4AG6A 3V9AA 1ML3A 3EEIA 3G1UA 5BNTA 2R6CA 3HPQA 1WVGA 4NEGA 1RIIA 4A8TA 2WKPA 2VF5X 1QC5A 1PSDA 1E2HA 2P4SA 2Y1KA 3DWEX 3TGWA 3W04A 3VDNB 4C43A 4NQRA 4PG7A 1AQ6A 4DV0B 3IXMA 3PJEA 4Z7QB 5IKXA 3H0CA 1KJ9A 1Z06A 1GZ5A 2GGSA 3FDIA 2VK4A 2ZRFA 2O3RA 2B8JA 1FNDA 2VCHA 2HBYA 3QE9Y 2PGLA 2HK8A 2WFAA 2BGLA 1P6QA 1X3SA 3FWPA 2FG5A 2HO4A 2ZKIA 3H1GA 3KT6A 4W6QA 4B76A 4XIJA 1Z9BA 2CLMB 4RBNA 5EE9A 3ZVNA 1A98A 3KPVA 2J3MA 4JI6B 3PNVA 5ALYA 1Z4MA 4F04A 2JVKA 1H8EA 1XLUA 5KZMB 3AG6A 3ZDEA 3DW3X 5AI9A 2FFQA 1CUAA 4CODB 1QCZA 1HDIA 1HOXA 1VL0A 3O0DA 5DTMA 3BGSA 3EY9A 2D7CA 3O7MA 2DFLA 4XSVA 5L4LA 1JECA 4ZVOA 2OBMA 2OXTA 1Q22A 2F8LA 2Z2IA 3C48A 2J3JA 2WZCA 3HRIA 4AJ2A 3K9BA 1T34A 3EXG1 3QELA 1NG9A 2BKUA 3BWCA 5B6JA 5IASA 2QOEA 2WF9A 2D2FA 2WFMA 5DH9A 5BPHA 4NH4A 1NNSA 3FNEA 4GVXA 2BKXA 4LZAA 5DYNA 3NG1A 5TARA 1EAMA 1CY7A 3S8YA 1MZPA 1YJ5A 2KB0A 2WWIA 3OVMA 5E8RA 3VNSA 5DN6A 3TG8A 4B3MB 1A5BB 2Z1MA 4CG1A 1XG5A 1CR6A 3FE2A 3NYQA 2RH9B 3F6YA 2H8KA 4YACA 2XQJA 2J0UA 2I7VA 2AEEA 4TM8A 1N1GA 4FW9A 4DLPA 3LZCA 3L01A 4ZVKA 3V8BA 2OB1A 2GDJA 1HNZB 4ND1A 4K87A 5CCBA 1YASA 3DF7A 3T12A 2CK3D 3VR5A 3F73A 5EJ2A 3WYGA 3MMNA 4GGMX 3HHEA 2WOJA 2AWNA 3A1VA 4KQHA 4R8LA 1NRXA 5CYPA 5TS2A 1SQSA 2HTEA 3OOSA 4GM0A 1CYEA 2A0FA 4KWEA 2R8RA 5AI5A 3TBHA 4JJIA 3NAMA 1G5QA 4EUHA 2H2WA 4RE5A 2WQ6A 3VNBA 1AZTA 3KYCA 3NIDB 3SZLA 4WFIA 4WCFC 3WKAA 1TI7A 3SE7A 3NW9A 4R0MA 2G1PA 3V8RA 2PRKA 2O5CA 1KJJA 2JFQA 4RIHA 4RHYA 4Y2SA 3AWIA 3AVWA 3EZ2A 2GAIA 1SJ9A 4US0R 1SXPA 3DDWA 2JCSA 4TKUB 5J9FA 1HNWB 1JR6A 3KQYA 5EKTA 3HFSA 3K72B 3T52A 3W2HA 2H48A 5FPKA 4AKSA 2FX3A 3GLKA 5D3MB 1NG1A 1BGXT 4FFMA 2Q3BA 5CEJA 1Z8NA 1EDBA 2I8AA 4QD3A 3BULA 1X77A 3BGWA 3FW1A 4DUZB 4K9MA 3I9FA 1PL8A 3IOEA 2J8ZA 4M0EA 3MSCA 1C8BA 3QVGB 4RJIA 5ALQA 1IN5A 2OCXA 3ODGA 4YWJA 3SBOA 4JDPA 3A11A 3ZWKA 4GRAA 5L3QB 2HBQA 3AOEA 1OVGA 2Z2ZA 4ZMBA 1OGIA 2VTKA 3HG7A 5CMLA 5B57C 2UUCB 1E69A 4Z8XA 1FMLA 1W85B 1E64A 1XC7A 1QS0B 1KKLA 2H0RA 2X2PA 2C9OA 2ZREA 5F64A 3SU8A 5ABPA 3D2BA 1DPGA 1U0TA 3AI3A 1XP5A 1DMRA 2AEFA 3AHDA 3CZ4A 3DV0B 3CUSA 4PHFA 4WZZA 3GLFA 3SXUB 3HB1A 3MAGA 2VH1A 3OAAD 4P31A 4TTJA 1IB0A 4UKDA 4C5BA 1JHDA 4JLDA 4NE2A 1F6WA 5CJJA 5FH9A 2VKQA 3AERA 3FPKA 3NEPX 2APJA 3NHRA 4TN5A 4ZQFA 5HS4A 2WQZA 4BN0A 3OFND 1ID8A 4YGXB 1SXIA 2VKTA 4MITA 1A9QA 1AB6A 4MVWA 4RJJA 3QVTA 1E2MA 3UA3A 2VF4X 2H00A 5FWXA 2DQYA 3TRHA 3IP5A 1GP2A 4B85A 5CTAA 4EF4A 3AHCA 3B85A 2I8LA 3PHHA 3IEXA 3GGGA 4LIPD 1P5HA 4MQ6A 2DBYA 1ZU4A 3ZD7A 3PFWO 4BWGA 1A1SA 2V45A 5B4TA 2Y1WA 1IMOA 4LNUB 4WFJA 2XZPA 5J4LA 2YBDA 3IPXA 4OYHA 2FVXA 5L3RA 3R7NA 5EVJA 1YDMA 4EO9A 5A4JA 5CG1A 4HWKA 4EJSC 4NXMB 1IN7A 1YDWA 2NU7A 3Q3CA 4IIVA 4R2LA 1FFAA 4IF4A 4NE7A 3ZWXA 2GVZC 3VTFA 5JTTA 3BMXA 3K0AA 4Y1RA 3UXHA 4JJ4A 4O4IA 5DXFA 4CG0A 4OQDA 2R8PA 4ZYYA 1EDDA 3R5XA 1QP7A 1OPXA 5ADUS 2H08A 3QE2A 1LVUA 3OCJA 5AUQA 1OKKA 3AHIA 3BN3A 3T5GA 3PX2A 4PLZA 1Z4LA 1XTSA 5DLQC 3K0SA 2ACWA 2H2HA 1XZIA 3MW8A 1G4AE 2VDPB 3BWBA 3NO4A 5D7BA 3TI9A 4EO4A 2X8LA 5GVSA 4Y2RA 1Q7CA 4TV9A 1T5HX 1UAYA 1I80A 4W99A 4V1CA 2CVZA 2HXGA 1JSRA 4P33A 4UFOA 4B4OA 1L5OA 1B93A 5E9QA 1PL0A 2RAFA 4ZOAA 5K7SA 4Z2AA 3PWSA 3NJ4A 4DMGA 3ESAA 1UT6A 4BMOB 3JRNA 5A0FA 1DJOA 1PD0A 2EFHB 2OR3A 2VDWB 2G5CA 2CJYA 1D2MA 3CM0A 3NIGB 4K6OA 4BX2A 2PY6A 4OXQA 2D2EA 4K0RA 3QKSA 3UAZA 4D82A 2UYHA 1NRWA 2ZFUA 2UVQA 4MYUA 3TNFA 2MIIA 2VL7A 3OOJA 5DM1A 2WIGA 1YMQA 3AK4A 4G86A 5KNBA 2ZBDA 1CERA 5SZIA 4D43A 2QTNA 4NU0A 1NT2A 1ZI8A 3G9QA 5IM5A 4L27A 2GZ2A 2PGJA 2I4OA 1A8SA 5FUQA 2DZDA 1UKZA 1T8PA 2IQ5A 2OGSA 4DQDA 5A04A 1I1QB 2SBTA 2XCIA 1JDNA 4L22A 3O3OB 1RIFA 2FF7A 1USIA 3ESRA 3S8EA 2J3LA 3TFOA 4KFCA 5JHGB 3KE8A 1E7WA 1T0UA 1LRJA 2IPXA 1ADJA 4Y1FA 1HH4A 2Z8YM 2OBFA 1PFWA 4XLTA 3A6PC 2VXCA 4E2FA 3ZDXB 4MWGA 1DBWA 5MFPA 2VZEA 4AZSA 1J0AA 3QYJA 2ZJ3A 4Y6GB 5ADVA 2ZUCA 1H2BA 2HAEA 2OCLA 2Q62A 2NP7A 1XYVA 4NBRA 5KSZA 3LT0A 1ICIA 3IAS1 3MJVA 5C51B 2YZMA 1RQ7A 1WP9A 2IYRA 4UU0A 4H3SA 3AW9A 3KVNA 1P0MA 3RSLA 2FJ0A 3AJAA 4A6PA 3SQWA 2LE0A 5G40A 1M2HA 5HEKA 4TTTS 1RBYA 3AOEC 4ZAVA 3CVWA 4YTEA 3PVCA 4PPNA 1MH9A 1SOVA 3CR8A 3GFSA 3S2UA 1UJ6A 2BI7A 3OE5A 3LE8A 4H60A 3PUWA 2QE6A 4D8WA 1A9XB 1YK1A 2K6GA 3N76A 4UFPA 5IJWA 3VXKA 5EIBD 1N7IA 1GA1A 4EHIA 3M49A 2QM0A 1ZAYA 3SVLA 4L07A 5LBIA 2PWPA 4LVUA 3AVVA 1EUCB 1U8AA 1X0XA 2CUNA 4QO8A 1XDGA 4XM2A 3HUFA 5IDWA 2XCLA 4UOZA 4I2NA 1XEWX 2CEKA 2P27A 1IUNA 1Z5PA 3H4TA 3TCNA 4XYBA 2J4DA 1I13A 1DS6A 3PZRA 3M5PA 4HDMB 4IF6A 1A2BA 1GNLA 3NHFA 5FORA 3T1NA 3AJEA 1QPZA 2IBMA 3HGMA 2JGIA 3UT5B 3V4OA 1GCGA 1N0HA 2BFFB 4TL6A 2VQSA 2X5JO 1ZY2A 3W0LB 3AKEA 3CRVA 3FWZA 4ZV9A 3P96A 3MTIA 1BJKA 1KYQA 1RU3A 3WMXA 3FCEA 5I9NA 4ZHQA 4GMDA 5FBLB 2PLFA 3RF6A 1RWXA 4LGCA 3EEBA 4FFNA 5EGNA 3Q5EA 4FFSA 2BFOA 2WKSA 3K2BA 3Q6MA 2OCIA 1CCWA 4HQRA 1QFSA 5LZ5A 3U31A 2RGRA 3EGCA 3L8YA 3THXA 1RAEA 3OZXA 1TZMA 3ZDRA 1RQ2A 1W36B 3N8NA 2BD0A 2P69A 2BEJA 1C7JA 4OI1A 4DA4A 1UAAA 1Q74A 4U5QA 5CIQA 5B2ZA 5E8JA 1C1DB 3Q85A 3EEQA 2FP4A 5FI0B 3KKZA 1KH3A 3O4GA 2L17A 1D1SA 4MWDA 4UNPA 3NFYA 4G0QA 1HYQA 4BNYA 3PFIA 4Q7QA 1VG9B 4A03A 2Z3WA 3E3LA 4QWMA 1GNVA 3ZS9A 1KDPA 1VJ1A 3IP6A 3HZZA 4FZ5A 5B2EA 4CI9A 4KYTA 3ENNA 1DV1A 4XWWA 4GMKA 2QJTA 3IT3A 4ZAZA 5JH7A 3BBLA 1V8OA 4NU8X 4UE6A 5FYQA 3HI4A 2C5LA 1AOXA 4GM1A 2M6LA 2UVPB 4BXOA 4EPVA 4HEA1 1M74A 1YS4A 1ZK3A 4EVRA 1LVHA 5JTUA 2QMYA 3PXCX 3GEGA 5DVZA 2QRQA 3LF2A 2ZATA 3AFHA 3KHSA 4ZRDA 4ZZ1A 4Y6OA 3I01A 5K3FA 3RC7A 4YY3B 1NLMA 3CUWA 1GDTA 2BEVB 1ENOA 2O57A 2X7XA 5C4MA 3DVQX 3O03A 1GGMA 4ML3A 2F17A 4R9VA 3NONA 4CGZA 3SEZA 3QEOA 4NZZA 3ZTYA 4BBJA 1WPGA 4O2AA 4CMGA 2F3SA 4LZOA 1XVUA 3MWEB 1CQIB 4P0QB 3AJ8A 4KO2S 4YCJA 2CUKA 3BAZA 4IZ6A 4WOCA 2PG3A 2VNSA 3TM5A 4CL2A 1IL0A 4Q3NA 1UC9A 4FDMA 1I2BA 2Q7XA 2WB4A 3IODA 2Z2XA 5FBWB 3LXMA 3L41A 1TQ6A 4UDOA 2A5DA 2P2YA 2CCJA 3GCXA 3DZFA 1WSBA 5JW6A 1PR3A 4INJA 1Z12A 4WMLA 4YQFA 3IQZA 3UO8B 2B8TA 4E15A 3EHEA 3KFVA 3P2IA 4PO1A 1N8SA 1AA6A 1FP7A 1M7HA 1NVBA 1SXJD 1Z8FA 4V3BA 4D0NA 4UOEA 2BP7B 1XDBA 1F3LA 3LQKA 4EG1A 5J63A 4BWYA 1VQ1A 2UZ0A 4JQZA 4IIXA 4KGDA 1KZGB 4KIFA 3MG9A 4IUCS 1Y8RB 4F1JA 1P75A 3ZOZA 2JLQA 3S2GA 4EX7A 3DTTA 5FJJA 1S2NA 1NIPA 3NEJA 1YFZA 5CU7A 4DIMA 1M10A 1KFJB 1YQUA 3IUEA 4TZTA 4ALLA 2ZPUA 4J0HA 3ZWOA 4E4YA 3UHAA 4IDEA 4S1NA 1G9XA 1NM5A 3ET4A 1CP2A 221PA 1ZIYA 1XU4A 3IT0A 3LCCA 1UFVA 2CUTA 3PDHA 4RHCA 4S2UA 2F67A 1ECGA 1C7IA 2PBRA 1NJ2A 3OTHA 4Y9SA 3RAFC 5AXDA 3WL6A 1EFTA 4BECA 2YZ2A 3EF3A 4WLFA 3SG0A 4DV1B 4G0YA 4MKHA 5AK0A 1RXVA 3RYIA 2Y67A 3E9ZA 3J80A 2BGJA 4NCKA 3IT1A 1G8JA 5D00A 3GOHA 1L7OA 4EY4A 3QE3A 4DCJA 4IZIA 4MAFA 4ALKA 3LU1A 1EGAA 1GN9A 3D6UA 3OOWA 5A4MS 2PRZA 3V55A 4LSWA 1H1LA 5ALUA 1TK2A 4QUDA 4N03A 3TW4A 3UKJA 1P0FA 5EIBC 2OFXA 5DHPA 2GK6A 6REQB 1KEEB 3M81A 4I3GA 1M72A 2WJIA 4P92A 1PGOA 3VUFA 5BYKA 1BX1A 3L7JA 2R66A 1HG1A 2HL6A 3H1EA 3LHIA 1WB6A 5AI4A 1R5OA 3SIWA 1HDYA 1RQGA 2B1IA 1N0IA 1NV9A 2QS9A 1ZHOA 2XPCA 1XEWY 4CLXA 4F91B 4KX3A 4OYLA 4CMIB 4B5KA 2PD6A 3EA5A 4AO8A 4E08A 1WE2A 5EIFA 1BW9B 3KP1A 1Z37A 3LYUA 2WK1A 5DM0A 1P1FA 2ZTVA 4GZLA 4NBWA 3ABOB 4LYHA 1F8YA 2WE7A 5PGMA 2Z83A 1GFSA 4B4DA 4DXDA 3GGPA 1CRZA 4XGQA 3TPCA 2Q5JA 2WTXA 5ERYA 1AXEA 3WNVA 4W8GA 5JARA 2WHEA 1MA0A 4BRZA 4C4AA 2I87A 2GCOB 2ZJ5A 3OE4A 3V7FA 3R6WA 4OBEA 1RWOA 1Y0BA 1K75A 3C41J 3HXPA 4HVTA 1CUFA 1INLA 1E0JA 4NFHA 5IAGA 4HDNA 4LXTA 1XAHA 1JMKC 1Y80A 1JH8A 1MNQA 2BHSA 3U3MA 1EVQA 4WVLA 4LHXA 1UWLA 2IEDA 1YD7A 5C7IO 1XPJA 3WQSB 4TLDA 3LRPA 5AKEA 3FYSA 4ILEA 4MULA 3GJ7A 3EH1A 3LKZA 4HTFA 8OHMA 1E4VA 3ROKA 2OFPA 1EQUA 3HA5A 1L4LA 4JVMA 3G9TA 5K6TA 1T9AA 1XPOA 3B12A 3ZD9A 4ZCIA 1SPXA 2YWDA 3KWMA 4X45A 4AWXA 4DQXA 1IC6A 2J7KA 1G3QA 1DU4A 1YV9A 4HQFA 1ZNZA 2JFPA 4IY1A 5H3HA 4G8BA 1K6EA 2O1XA 3QXCA 4R2KA 3U3OA 3GRCA 2WOOA 1NP6A 3MJTA 1QH9A 3A6DA 2LTAA 1NDQA 5BQ3A 4RK7A 2GASA 2VRBA 1FK8A 3CYFA 4HX9A 2O8CB 3PR1A 5LNK1 2IVFA 4UHJA 3ZZ1A 4EYKA 4YUAA 1EUDA 1SBYA 5IAKA 4CETA 4LI0A 1TYDE 1Z16A 2J5XA 3KBOA 4C7VA 621PA 1FNSA 2EW8A 4DTIA 3N8DA 2NU9B 2I0FA 3OCUA 3ZQUA 4G26A 4RHEA 4OL0A 5EWMB 1PVDA 1ZUD1 3ONNA 1NAHA 1X70A 3PHLA 3ZNNA 5THKA 4YCSA 2QRHA 3QZUA 5EL0A 4YRSA 1F5SA 3PVZA 1PJ4A 1SRQA 2WHYA 3WB1A 1O97D 2JANA 1V4VA 2CLLB 3TKAA 2NU8B 4BC1A 1T4CB 3HVRA 4Q4CA 4JYBA 1RJFA 1KYXA 2LR0A 2BE7A 2JEZA 2XKKA 3UK0A 1OXXK 3VX3A 4Q01A 5ER6A 1R00A 4RPJA 1J39A 1TK3A 4UM9B 5CLIA 2RHJA 1BHSA 3JQFC 2IEAA 1T91A 2W6IA 2XUDA 2EGUA 5KKAA 3RUFA 1I33A 1SCUA 3P71T 3ZBPA 3LH5A 1QHSA 5F33A 1BROA 5ED0A 3DYBA 3T1QA 1ILWA 3KUUA 1Z68A 1CJVC 1K5DA 2IHZA 1PT6A 4S3MA 3RSQA 1FY2A 3U39A 3I62A 1GKYA 2J4FA 2YY5A 3A1SA 1W7AA 4J43A 1ND6A 2FUG1 2QWXA 4GG1A 4S35A 4CL0A 5CLJA 4E11A 1ADYA 1Z3CA 4N6NA 2REBA 3OZEA 1UDRA 2M6KA 4MPPA 4K9LA 4RZXA 5CDFA 1LV8A 4AMVA 4BNXA 1QTNA 4HDKA 3I6ZA 4WADA 2OXCA 4C0LA 1J4AA 1HX7A 3G2HA 2FEKA 3ISTA 3RFXA 1XZBA 2FMIA 1HE8B 1M2VB 1L4GA 1V5WA 2YCBA 3EVBA 5SZHB 2ZB8A 5I9TA 1ITZA 5KI6A 1DKRA 3O5AA 4FILA 2JAHA 1O5TA 3TOVA 4EDHA 2BSQA 3TUZC 1TO6A 3WMFA 1TIBA 3IAXA 2BY4A 1H5UA 4E14A 2QJOA 2JS7A 4DILA 5C37A 2A92A 2C3MA 3CIOA 4G6ZA 4FFDA 3U4MA 3ETLA 5I8ZA 4CHGA 2ERYA 2XUZA 3VR2A 2PKYX 2VHYA 1JYFA 1Z5GA 2XR1A 4IJVA 3OPYB 2JAPA 1D2EA 3ESYA 2VNJA 1UBJS 2EX1A 3T5PA 3TO5A 5CB0A 2QL7A 3QSYA 4REMA 3A37A 2CYAA 3U9SA 4E5YA 5HW0A 3CNBA 4R1SA 3EGXA 3FMVA 1A77A 3IVAA 1KEKA 1RRMA 4Q12A 3V33A 3O47A 2YJ4A 4ZEMA 4UQLA 4FOPA 1DOZA 1NUAA 1RXCA 4G36A 5MN4A 1DV2A 3MOGA 1ZVQA 3R3YA 4FEGA 2FRXA 2GEUA 3GGJA 5D87A 3ZXXA 1H9CA 4KFTA 5IEJA 4G0MA 4INAA 2EFCB 4FKZA 3PR2B 4U9IS 4FWIB 2F3TA 2FW1A 1WUJS 2Y92A 4M9RA 3U60B 2WMNB 2Y68A 3CR3C 1WOMA 4TT3D 2E4XA 4Z0PA 2P9QA 3LUPA 3LLSA 5IHXA 1KMHA 5I45A 2Q6KA 1WSWA 4G07A 4Y8VA 1KXZA 1Z35A 1K8XB 3BXEA 3OC6A 4QVKA 3WV5A 3NFRA 4RA6B 3I2IA 4R9NA 4DBZA 3NKFA 1U9YA 3PYMA 1L7MA 1YJAA 3GDFA 2REQB 1UXIA 4KXFB 1EE9A 2XMRA 4NV0A 1OLSA 5HBRA 3BA1A 3EFBA 5MFZA 4MDFA 2OKCA 2XXAA 1D09A 1B4DA 1JDJA 3RUDA 1H22A 1B14A 2AW3A 2Q3LA 3SGLA 2IYFA 4C7OA 5K6AA 1PLLA 3R40A 5L3QA 3UYLA 3P9QA 1QH0A 1YCGA 1E2GA 3I37X 4HSGA 1Y1KE 1GUBA 1ZGBA 1TD9A 3LQQA 2PEZA 3IJPA 2Q1YA 4Q47A 1R8YA 4BQEA 4XYLA 4O0LA 5CBPB 1PR0A 2Y4OA 3DEFA 4KQGA 3UB4A 1BZYA 2G4LA 3SHVA 2C29D 1QZUA 3VAYA 4CUKA 1LWOA 3KXLA 1C1YA 1WAMA 4LF9B 1RW4A 2XUQA 3QU4A 4N5MA 2WDPA 1WCV1 5KQSA 3MPOA 4LQDA 1JG4A 5CRIA 3CLHA 1FNMA 2CEAA 3FLMA 1L5LA 1T43A 3VH2A 4URXR 2R79A 4UM7A 4RHUA 3WICA 3D5QA 3ZI0A 5IULC 3KT8A 3IKTA 3OPXA 3B3GA 3ZHYA 3FUVA 5AVKA 1Y3CE 3D1LA 5DHQA 3TYXA 5JSQA 5K8CA 3IEUA 2OAQ1 4JQYA 1I24A 3QLVA 4YI3A 3HYNA 4FQ8A 3DBOB 4PNZA 3ZZNA 3V7UA 1DRWA 1SC9A 2E85A 3IUQA 4RF4A 4Q1FA 1KVRA 3THRA 6LDHA 1CW2B 2C98A 4R16A 1GYPA 3BILA 4KQ6A 1OWOA 3OI7A 3CTMA 5DM70 2X3UA 4L7VA 3CLUD 1PVOA 5KNCD 5D6OA 1SO8A 3ZWBA 2Z43A 1FTQA 4CF7A 3LD9A 3M1LA 3T7RA 2PMWB 1JQEA 4F38A 1HTWA 1QOQB 1ZLYA 4AF8A 2HK6A 2PXHA 1YJQA 1W76A 2WRZA 3CEHA 4FMCF 4IDCA 4RFSA 3RSGA 3ANYB 3DQQA 3PT9A 1UAGA 2FGJA 2NAPA 4IGIA 1VIMA 3G17A 4RIGA 3COPA 4PLGA 3H75A 1U7HA 2HU7A 5TXGA 4X24A 1BXGB 1M1YA 4Y1RB 2XTJA 3EIOA 4B40A 1XF9A 2PMDA 4LZLA 1PJAA 4LXQA 4BB0A 3TXAA 5BSFA 2O06A 2YY6A 5H3CA 3JWJA 5BYJA 4EP1A 1E9RA 2TS1A 2WC1A 3A4VA 3BTOA 4H16A 1AKRA 2PH1A 3RRFA 4E94A 3R9KA 2PL1A 3F6EX 4DRXB 1QTQA 4Q24A 4FGJA 2R8ZA 2ZBGA 1HG0A 4QLBA 4RD3A 3EDOA 1V3VA 4Q16A 3DFMA 4BJHB 5KOYA 3FOZA 4WINA 2RAUA 4MUEA 2V54A 2O8DB 1J22A 2EG5A 3HI6A 4KZPA 1E3DA 3PIIA 2VDWA 4GZ3A 3M6UA 1HEYA 4F7DA 1GQOA 1V16A 2QX9A 1OX6A 1HQKA 3C3CA 5L53A 5EE0A 1XMSA 2BEWB 3OP1A 4KQKA 3GK3A 3H18A 1EE1A 3TR5A 1PQYA 2C5FA 4FYJA 3UMYA 1QF6A 2LKDA 5IZCA 3S0JA 3EYAA 3MZ0A 1GVHA 5FADA 1FTNA 1GFZA 3DXYA 1BFKA 1QFJA 1Z8DA 1WO8A 2QTBA 3DC7A 3I32A 4KB5A 2DUNA 1KO4A 5AJYA 3VYSB 4BKQA 2EU8A 4WY8A 5EJ4A 5HIKA 2OBLA 3UWMA 2RDMA 3EOZA 3O83A 2BC9A 3WISA 2QPLA 1CRQA 2FDXA 1M67A 2NG1A 4MW0A 1S3GA 2Q6LA 3QBEA 3TW8B 4DLSA 4QICA 1Z6GA 3VNVA 2ZEJA 1UFQA 1L7XA 3CKLA 4GPBA 3UK7A 3WL4A 4W8OA 1QORA 4QG3A 1GRRA 4U7GA 1GAJA 1ZKDA 3GRVA 1QCYA 4MINA 1NKVA 5KYWB 4DXAA 3TTUA 4D99A 1EP3B 4NG5A 3AR5A 5KWVA 1FU7A 4TZKA 3C6MA 1LI7A 1BVYF 3MJEA 4MW7A 3S3TA 5DX0A 5JANA 2NTEA 3W8RA 3I72A 4GYJA 3UUEA 4NONA 3C4VA 5DLPA 4UCWA 3BMQA 4CQJA 1XCOA 3BIFA 1XZQA 4PLPA 4I8DA 3RYTC 3MT9A 1JJFA 1DBRA 2H1HA 2XIQA 1KMNA 1NP3A 3L1JA 3WNZA 1Z5NA 4OA8A 2YFHA 2D1SA 4YJGA 3LYAA 3RD5A 3TLGA 1JFTA 5B4UA 3KALA 2QQEA 4TKVB 3ZWVA 4Z9BA 5I7VA 3M4ZA 5JDCA 1MV8A 1WKVA 4AS1A 2FF5A 3MS4A 2JH8A 4MP3A 1D2NA 2FE1A 5DYGA 5BN1A 2KW5A 4OUKX 3QFHA 2KI5A 3JD0A 1HDOA 1B8UA 2C2WA 4GOJA 4LJ9A 3SMQA 5I7HA 5EMKA 3RV4A 1WZUA 1U31A 4A26A 3ANSA 4MYHA 3EISA 2VWGA 1H3FA 1SUAA 3A14A 3N7TA 4WBNF 5HZKA 1URPA 1V96A 1XQYA 4NAHA 1VC2A 5L4SA 4X6YA 2RJOA 1JKXA 2Z5GA 4CN9A 3E61A 4IJQA 3D1VA 4J4HA 4E46A 1X6VA 1S96A 2Q28A 3ONVA 3WRXC 3FDZB 1FPQA 2INGX 2G80A 1XTIA 1D4FA 2A4KA 4EPRA 1L7AA 2FR0A 1AY0A 3G8YA 4DR2B 3O1LA 3ZWCA 3E84A 1EVYA 4K6HA 4P86A 4I6EA 5DBIA 4EKGA 4HCJA 2P0EA 2E55A 3KLBA 2ZT8A 4LHEA 4EUEA 3PRKE 2D5LA 2EATA 3LC7O 2YMMA 2OY0A 3PSHA 3ITNA 1DHRA 2LIPA 4G0PA 1FTGA 4ZQIA 1RTTA 2DQSA 3PGA1 1DWUA 2GYYA 3CFYA 2HM7A 3OLYA 4PYLA 2GBLA 3B9QA 3GY0A 2OZLB 1SIWA 4WA7A 1D4ZA 3A4MA 2HJWA 1U0SY 3SX0A 4FDLA 2QRVA 4AM8A 3DQPA 4XYMA 4E1BA 4F45A 4ZN6A 4XDGA 4MEAA 3ITKA 3OIWA 2OYCA 3R7DA 3TQRA 3E7PA 1J06A 2PZ8A 4FYVA 4TYMA 4GE3A 1D7OA 4QARA 2WD8A 2WSYB 2WYIA 3HUUA 5GM1A 3RI3A 4B3HA 5BR1A 2WUEA 2GBFA 1QG2A 3B1JA 1G7RA 3E05A 4LHSA 2I7CA 4HXFB 2XOKA 3BBPA 1CJBA 1JB9A 4XIYA 4RXMA 4ZRNA 5E9JA 3DL4A 3L07A 4LS3A 3RV3A 3BHIA 3ZJ5A 3QFFA 4WDQA 2LPMA 4NNJA 1CT9A 5B58C 3RYFA 1IM2A 3ZWNA 3GVIA 2AMJA 2FUG6 3L7OA 3HABA 3WLPA 5KYXB 1GFIA 2B8NA 3DDUA 1KOLA 3BQNB 2ZJ0A 1HRKA 4L2IA 2H29A 3KOZA 1EUYA 1R6VA 4EENA 3RFCA 3LPCA 1V48A 1OH5A 5ENZA 2XNHA 4DLBA 1JIQA 2BZSA 2G25A 3SSAA 2GZMA 3RNLA 3PC2A 5DU2A 2DERA 1JHVA 2QF7A 2HV8A 3M2TA 2BCJQ 3EVFA 2BVNA 2J0UB 3UCEA 3C4QA 2WSSD 3FYUC 2D8AA 7REQA 2J0VA 1GT91 1TEHA 3N53A 1OI4A 3B78A 1O9HA 2FEOA 4OGWA 4EYQA 4WZ6A 4V2UA 4A82A 4IVQA 1I6LA 4HH0A 3NHZA 1JBEA 4CZ2A 2EKZA 1XZKA 2VSYA 3MJCA 3GDHA 4F3TA 5INTA 1LD3A 4MUGA 1L7VC 3U7IA 1DZ3A 2EJVA 2Q27A 2H1IA 1QAMA 4OVKA 2G5PA 3GUZA 3VSBA 1S2LA 5JR3A 1SOUA 2GOYA 3ZBTA 3P9KA 2GYVA 1M6HA 5CTJA 4JC5A 5F1YA 5B7NA 1DB3A 1OR8A 4MV0A 4WA8A 4TKLA 1AGYA 1BDJA 1X19A 3ORYA 1BWSA 2XYQA 3Q3VA 3KYCB 2DBRA 4HWRA 5EMNA 4ZGGA 1SEPA 2BEUA 3AIIA 1B76A 2M2IA 4OSEA 4QT0A 4XCQA 4JLUA 2DKFA 2F43A 4ZK2A 1F4LA 1SCBA 1BCRA 1H2YA 1VLLA 2A9VA 3N8GA 1RC8A 1CUCA 5IAJA 4DLWA 1SUFA 4L6CA 5C81A 2AYYA 3FSGA 3X1YA 4J0DA 4UAUA 2ZWMA 5FA5A 3DJYA 3IUMA 2Q0QA 4Q3CA 1F9EA 4O63O 4DLTA 1JILA 3GQBA 5A6VA 5KOIA 3T7DA 2VJLA 3IL2A 3O6VA 3A1NA 3QFCA 4LBZA 3OCXA 4FR2A 3PHCA 3WO1A 1JLHA 1K7FB 2DUUA 1IONA 1JEJA 1B0ZA 4D8YA 3A1TA 2BBSA 1R3UA 1T2NA 1JHAA 1U0OC 5JPIA 5EA2A 3V1TC 3AM4A 4ETIA 1VXOA 1BRTA 3U49A 1EFPA 3QQ5A 2RBKA 2ZWVA 1SQ0A 2YWRA 2B4QA 2D5BA 1VKOA 2C9YA 2GN9A 2CXQA 3IBFA 4G5GA 4HO1X 1X1DA 4D9CA 2JCVA 5CFMA 1O96A 4B7XA 1MRSA 4BFTA 1W85A 1U02A 2PD3A 1T8YA 3BE5A 3OHSX 4LYJA 4X1IA 2GAFA 5FFFA 2QD5A 1X7YA 2C2MA 3K94A 2JGDB 2QQ5A 4BVFA 1XAIA 4UAVA 2XITA 5J1TB 4BVAA 1FSFA 3S2ZA 1XBTA 1JQBA 2H1OA 1N2HA 4BNKA 5KINB 1N34B 2YZGA 4FBGA 2C92A 4JUCA 2GKSA 2AG5A 1KQFA 3O73A 3VI4B 3V1LA 4BO1A 3IE2A 3LVFO 3DFIA 5ITZB 3GUUA 3VR6H 1NFQA 1AHPA 5H5JA 3OU7A 3AI1A 2PD4A 1PLJA 1GSIA 4TPKA 2QD2A 4UTXA 1QYRA 3GAZA 1JWAB 1FC0A 2VBFA 4CW7A 2EFEB 1DFGA 2AC7A 5JQGA 3ZIAD 3ILYA 4RD4A 4AQYB 1P1CA 1NVMB 2CXTA 3H5LA 4UEKA 2ZSFA 1KPGA 2YWHA 3EASA 3UV7A 1N36B 3KB8A 1VE5A 4B4WA 1MJHA 2GM9A 5J23A 5THXA 3ZR4B 2A78A 4BUJA 1U04A 1O95D 3CVUA 2M98A 5REQA 3KQKA 4BVBA 1O58A 1ORTA 1OT5A 2BMEA 4A8JC 1DARA 3IP8A 3LFUA 4HNRA 1VBMA 4K9SA 1BDIA 2ESRA 3BB4A 3G9XA 2EZ9A 4Q4AB 1POWA 4YT4A 4NCJA 4G0ZA 4URUR 3K4PA 2GDZA 4I9GA 1NR5A 4GLLA 2BI8A 2G1KA 1XPUA 4MW6A 1ZGZA 3E0QA 5AWFC 1UZLA 3DUWA 3DWFA 3NC0C 4FCTA 2ARKA 3CS3A 2GETA 4GGPA 4JAVC 2C4HA 3TGLA 4W5QA 1XPRA 4I1PA 2I78A 1CULC 2VPPA 4OBBA 4LJRA 5A5DA 1OFUX 5FBHA 2ID9A 2BFWA 4GVLA 3OO1A 3GF4A 2ZUEA 3MGCA 4PV7A 4HC4A 4URZR 1A8IA 1JFSA 4UVEA 3T3MB 3UOWA 2BJHA 2HPHA 5JQGF 4MOWA 2GJKA 3BWYA 4X60A 2ZR9A 4PS1A 5A5GA 4B6FA 1KE1A 4I1IA 2RHTA 1KMQA 3FN4A 4RCVA 5TE9A 5FUMA 1S01A 1M2OB 2XNCA 1YOVA 1NONA 1L9XA 1USVA 1YQDA 5TEVA 3ESXA 3KQQA 3CF6R 4H1TA 4J4TA 3ROPA 1GKIA 1NUQA 1PS9A 4TWIA 4YCAA 2AN9A 4B34A 1DC8A 4QUBA 1GZUA 1H2ZA 4EF5A 3LSYA 4NARA 1A8QA 1ZNYA 1EK6A 3D54D 3MC1A 4LY0A 1VL5A 1KWKA 3H16A 4B32A 5DGIA 4EGAA 3MQ2A 1I3OA 3U4CA 1LUAA 1BU8A 1IVNA 1PFGA 2H4YA 1EXVA 1YRYE 2WWHA 4ZCMA 1KAEA 1R6DA 1N2IA 4KRGA 2E1RA 3S8MA 4LECA 3CVYA 1Y6GA 2Z2YA 7MHTA 3RROA 2NVUB 1P2DA 3OTWA 2VHVA 1EIWA 4EHJA 1NQOA 2ZVJA 2ZRBA 4ITUA 3LW7A 3N2GB 1UP7A 3PF8A 2Z8YA 4D3XA 1TJPB 5C7YA 1ODFA 3FYUA 2B1QA 3NDBB 1LDNA 1Q2UA 4RCZA 4TUYA 5AVJA 1TEVA 3UA4A 4BP1A 1PJCA 4EB8A 3R23A 4CIXA 4A2QA 2V5VA 5BPFA 5AVRA 3MS2A 2ODQA 3D8BA 1QGUB 3ZHRA 1E9SA 1ZIXA 2A9JA 2XECA 2NPOA 3FDJA 1PGQA 1RXEA 5JDIA 1W9MA 1A8UA 4MVJD 1AUXA 1W6RA 1ZL2A 3KFLA 4QNNA 1PNRA 3ZGZA 2J3KA 1WB9A 1U0GA 5JSYA 3FG9A 2KBEA 4B3RB 3E9EA 4LDZA 2XWPA 1SVNA 3DFFA 4GSLA 4P4SA 3OT1B 2Y05A 4ILKA 4YS6A 4DLKA 3VJRA 3ZCXA 4UUQA 4RORA 3GPBA 1DIGA 4MGYR 2LW7A 4L6IA 1TVKB 1F8GA 1Z33A 4RZIA 5IBPA 5EERA 1U5AA 2F9LA 2EOAA 2DQZA 5K3EA 2CWWA 1YO6A 3U7JA 4X8LA 2AOWA 2WG2A 4Z5XA 1A9XA 3LQYA 1B1CA 1Z6QA 5JWOA 3JAMA 1M34B 4KBGA 1JSCA 3S44A 3STVA 4EPXA 3GAAA 4K9NA 2IY7A 4IOLA 5LD2C 1T3SA 1T3GA 2CHGA 2IYVA 3QTTA 5DO9A 3UKOA 1DNPA 3CJTA 3HUEA 2B2XA 5JAUA 2X9VA 1DBPA 3LMKA 3FTNA 4UNQA 2F7SA 3ZVLA 5KDOA 2FZGA 2MU1A 3NV7A 1SKMA 1OHHA 3F6CA 3V46A 4TZ0A 4DIDA 2PWAA 3ZU6A 4Q1VA 2P8JA 3PQ2A 3UY4A 1TQHA 1ZIOA 3F4KA 1ADFA 1CIJA 1V7ZA 3VM6A 1ECJA 1P1BA 4H7IA 3ZDYB 3V1MA 2ICAA 3EGXB 4CXMA 5HNKA 1XGKA 2XGGA 2W2VA 4Q3EA 3WHIA 4EY7A 4RTMA 4ZVPA 2ZRHA 2ZWOA 3N1UA 4P4LA 1DP4A 4JT8A 5CVDA 5CX1A 1SVSA 2A57A 5L6LB 5CB4B 2B35A 3LIPA 4LOAA 2W2XA 4AX4A 4EGFA 3ESBA 3LT2A 3MOSA 3OZUA 1TW2A 2ISQA 7ADHA 5FLKA 3H2KA 3BTSA 3E15A 1HE2A 3I53A 2NO6A 2X9LA 3NVMB 3OHMA 2DAPA 3O82A 2IXDA 2Q0HA 1L4YA 3HYSA 4O4JB 1FNNA 3H5WA 3M7IA 4K6KA 2QVYX 5JBNA 3N0XA 3WK8A 1TX4B 3AI7A 1AQNA 3QVXA 3WWYA 3L7MA 1K7EB 2YWBA 5KHAA 1S2OA 1XWWA 3CZ5A 4C6SA 1B42A 1JG3A 3FYDA 2VOEA 2WJ4A 4LRTB 5F1OA 3UCXA 1SH7A 3UMBA 3GUVA 2E82A 3LDFA 3RUCA 2B7BA 2XTAA 5TX7A 5T7BA 3NBMA 1AKVA 3DVAB 1TF2A 4LXXA 3D4LA 2PRJA 3FGNA 4M4SA 5JMPA 4Z9AA 5AQ1A 4ARIA 1NHGA 2XGOA 1J9ZA 5B37A 1PCXA 1EVKA 1AF7A 2V1UA 4DEVA 4OHWA 1F0PA 3O9ZA 3DOUA 1E59A 3HU1A 4WH0A 2JGFA 3RJMA 3A1EA 1KFCB 3V32A 3NVDA 2L19A 3W79A 1IWOA 2YXDA 3GJ3A 2QR5A 4YMUA 1DKNA 3EPPA 4DCPA 1OV4A 5JO9A 1EBFA 2WJ6A 4S1VA 1O7JA 2QG6A 2QLLA 3DV9A 1M0EA 1R4NA 4BKOA 1QIFA 3OX2A 3OZVA 1CUJA 1ZISA 1OFTA 5AH0A 1DDIA 5GY7A 3ZZMA 2NYRA 2Q3JA 3HZOA 4QL3A 2DEUA 3CJRA 3WYAA 2K2QB 3WK6A 5JCPA 1JR3A 3W2GA 1G20B 2BF7A 4L9WA 4MQBA 5KCMA 3TKYA 2DYKA 2AVDA 4UJ5A 2HRDA 5EZYB 4AUNA 5EYPB 3NYIA 2IGTA 2QLJA 5JXHA 3C1OA 3OPMA 2FWJA 2MINB 1G55A 3UAXA 1BKYA 4EW2A 2NSJA 1T9GS 3C5HA 4LC1A 1P2SA 2FR8C 2PQ2A 1VSTA 5A0TA 3JWHA 1OI3A 1U1EA 4LK3A 5K99A 1YRQA 1L7BA 1RQRA 1E2DA 5TQ2B 3W8NA 1DQNA 2IGBA 1IOLA 4JJAA 1JQAA 3EPLA 3IT2A 5LQSA 5SYMA 1AXRA 2JBAA 2JLCA 2ZI3A 3LWDA 3GWGA 3VHLB 4NYIR 1F1BA 5E95A 1J8YF 3QI2A 1N6OA 2O8FA 4L3VA 1FUUA 5BQOA 3ET5A 1JEEA 5LMCA 1OXBB 1VYHA 2FEAA 3KX2A 5I3CA 1O9GA 3HY6A 1SKAA 3JQ6A 5EKDA 1PNQA 1T5BA 1DAKA 3OT4A 1ES9A 3VZRA 3JVIA 1G8FA 3TAUA 4OHKA 3QU7A 4KWTA 4QQNA 5JJCA 1CZLA 2AB0A 1LNQA 2JCXA 2X15A 3BD8A 3OZWA 4M8KA 3MLEA 3GA5A 5TT1A 1CF9A 2J7PA 3LHKA 1HSZA 2FE4A 5FB3A 2CFSA 1LK0A 2GILA 5DSTA 4PC7A 4Q7MB 1C3OB 1HA3A 4FDUA 4KAJA 4K86A 1TRHA 5A5VA 4GKVA 3HC7A 4MI9A 4Z4GA 1EG2A 4TKMA 2ZM6B 4Q3KA 5F35A 1NVXQ 5D6NA 4DMLA 3PQEA 1C9NA 1E99A 2G70A 1BJRE 3IDZA 4M76B 4Z4QA 3IAFA 3IOYA 2YOHA 1MB4A 2R97A 2EZ8A 4KR2A 1V16B 3QUTA 5HG0A 4D42A 3QP9A 4AULA 3I5AA 4ZRMA 2Q8PA 2X5KO 4UBOA 2UYGA 3DF9A 3A4IA 1H2RS 4QUHA 3GV0A 1TE2A 1E8MA 6REQA 3WLOA 2HPAA 4ZCPA 4IPTA 3PU6A 3JQQA 3VU3A 1PFQA 4PAQA 3P9SA 3TLXA 5EP1A 1MOSA 4E5MA 1CYDA 1YVEI 4EPTA 4V0LA 2V6BA 2X8JB 3UUFA 2FCAA 1Y7HA 2WMOB 2O3JA 1FRVA 3AUUA 3CZ9A 4CKXA 5F7XA 5DI3B 2BM9A 3EIWA 3MTAA 4KH0A 1P9LA 1CE8B 4KK3A 4N01A 5AVUA 2NMVA 1B23P 4RLFA 2VAWA 1I3NA 2AHOA 3QUQA 3ZWPA 1GSOA 4ZYUA 2C04A 1OOEA 2L18A 3DCJA 5EE5B 1LX6A 2H1CA 3RU7A 5HUQA 1KDVA 5KTSA 3A9WA 1L4EA 5KYWA 4E1VA 1N2EA 3RU2A 5E1DA 2II6A 3DMNA 4R51A 3EGWA 1K8RA 2COEA 5A6SA 5I48A 5UKDA 1T5IA 2FPIA 3H0KA 2FN7A 4WN9A 2VYNA 1FS5A 1RJGA 2I2AA 4QQRA 4CV0A 1Z2EA 2ZCJA 3U7EB 3R5HA 4MVJI 4RESA 1NVAA 2EARA 2QAIA 4Q05A 2VA9A 4FC7A 4KYIB 3NWJA 3EEYA 1TO1E 2VPXA 2I3ZA 5T3YA 2EERA 2HCJB 3AJ9A 1XZCA 2FUEA 4LJSA 2XCOA 1B8OA 3OX3A 5H02A 4AY3A 1LQUA 3JTEA 3KZKA 1VHQA 3L8GA 4FGKA 3FB1A 1F5NA 2O8NA 2C9BA 3FI0A 3O4JA 4PO3X 3KTAA 1O0CA 1THZA 2Q4DA 3ETCA 4MQMA 4WEOA 4BATA 3ER9A 3QHAA 1AG9A 1DINA 1YUNA 3LFHA 4NS4A 5BV0A 1NAIA 2TMYA 2XUOA 4ACBA 4NENA 4IDAA 4MCAA 1KL7A 2JW5A 1DIRA 4YP0A 2HMTA 4NV1A 1GZDA 4QBTA 3GPDG 2J30A 3O9MA 1KYTA 1QHEA 1DEOA 4I14A 3JD1A 4WASA 3DOCA 3IOBA 2OCGA 4B8WA 4CQLB 3EXIA 4WPGA 4P3OA 4QU9A 3BIXA 3TTWA 4BAZA 3EX7C 1FP1D 3IURA 3ZU5A 1AQJA 1CZUA 1I0LA 1P9RA 2D0IA 1KVQA 4F9TA 3BB1A 4PZYA 4I1SA 2E9SA 3GBSA 1ZJ5A 4AECA 5KKNB 2ZE7A 1I2MA 1KK1A 2VHEA 4UUAA 1VMDA 3KL2A 1YZ3A 1JJBA 3T9BA 2PUCA 2CSXA 2IYTA 4BMZA 1A4RA 1JFRA 2ABWA 3LNTA 4MV8A 5ALWA 3ZE2B 3HJTA 1JDBC 4IXWA 4K1LA 1OGJA 2CBZA 3CG4A 1XDSA 2OZLA 1XDZA 2HMUA 5CLGA 3HRHA 4ESVA 4CM8B 2I6FA 2ZCUA 1U99A 2YASA 3DDNA 1YJBA 3GMSA 2RH4A 4HEJA 5KJCA 2GBIA 1YC2A 1NI4A 3VYTB 3ASVA 5CPFA 3ZVRA 1QDEA 2RGEA 2QSYA 5AI6A 1QQ5A 3WADA 4C0AC 4NCBA 2WM3A 1DC5A 4CKEB 1FRZA 4U2FA 1K5PA 3IPLA 3EZ9A 3FTQA 1JKMA 4B87A 4RWZA 1P2GA 2P3QA 3K4HA 3B6IA 3ELBA 1W1UA 2VK1A 2VSFA 1RS0A 4FGZA 4XARA 4AURA 5DHSA 3IVMA 4FYKA 2CK3A 3KV3O 5JEDA 2H1RA 1DRVA 2NN3C 4LVNA 4M0CA 1VSBA 1MEOA 4KIWA 1BWQA 4X62B 3HP1A 4YO7A 4A6EA 3M9XA 4JVLA 1KK2A 4I0WB 1CD5A 2AXPA 4JEUA 3TAHA 3EQZA 2A0KA 4OCZA 4EW1A 5I5EA 2Q5FA 3WHLA 2B98A 4MTCA 5KJ6A 4L2IB 2P0AA 2FPLA 4YCCA 3Q9NA 4NZNA 3WLTA 3DBHB 2PKXA 3HKCB 1N77A 3VZDA 2JLAA 4ZARA 2CYBA 1OASA 4F9GA 3BPSA 1PJBA 5B64A 2DJIA 4CLDA 1C50A 4K46A 4RK1A 5KJEA 3TQOA 2I9KA 5LM3A 4CFSA 5AW4A 3PPVA 2VTEA 1MN6A 4MK4A 4PIMA 2ZS9A 1Z7YA 2XH8A 5KEIA 3DMTC 4G5FA 1HLDA 1NKSA 2FKAA 4PSDA 2ZUFA 4PRLA 1QUFA 2NVWA 3BX1A 2YC2C 1T9BA 1TCBA 2UZIR 1XU9A 3FBWA 1ABBA 2KHZA 1CUYA 2QUJA 3M9WA 4NQZA 4ND5A 2ZK7A 5A03A 4JSTA 3LFTA 2W6MA 1N5OX 2NZUG 4W5JA 1T8RA 5EIAA 2P9GA 4Q1AA 1BGVA 3MJHA 4JEHA 1E32A 4PE5B 2Z5LA 4F56A 4J03A 1YB7A 5DYWA 1WB5A 1ZG3A 4A7PA 2ZULA 3GD7A 5B53A 3HB5X 1FBTA 3KUDA 3RIHA 1ILEA 1XLWA 1TZJA 1ZSYA 5SYAA 3O1IC 3RAJA 3EA4A 1UQUA 4DV5B 5E1BA 3GRYA 4S24A 2FA9A 2QVGA 4JL6A 3C74A 2IY8A 1D6NA 3CMCO 1Z2DA 4KUHA 4RK5A 1Z08A 4OQMA 1VCNA 1A7JA 3WLFA 4DLXA 2Y1EA 2Q3MA 1EB8A 3I45A 4OXXA 4XA8A 4CDRA 4UXIA 1TUGA 4EEKA 1F0YA 4WKCA 3CRRA 4GYKA 4OAPA 2G9UA 5EZYF 3RG8A 1LRLA 3COSA 1BA3A 4OFWA 3ES9A 2OXIA 2VG8A 1E1QA 1RSZA 3EIEA 5HKLA 4G1VA 4L4YA 2J45A 4N39A 3WLQA 2ASVA 1XD9A 4F4FA 2EL7A 3A1WA 2C4NA 2AFRA 5CH3A 1QOPB 2IHNA 3VDMA 1P4HA 3N8HA 1EDZA 3KWFA 1HL7A 1ZQ1A 1Z62A 2BGNA 2IA5A 1QRUA 2YFYA 3A04A 3A32A 3FR8A 5I8WA 3A4NA 4C3OB 2C3OA 1ZJYA 4F2GA 3GHHA 4HQOA 5K0GA 5J1SB 2P7IA 3FWNA 1R50A 4KZKA 3WLHA 1TYAE 1PK9A 2HK7A 2C2OA 3AY7A 3O8CA 3A25A 5TDHA 5ALZA 4J07A 1ZJZA 1P17A 3BFXA 3QU5A 4FE3A 4XR9A 2AXEA 4J2TA 1Z39A 4YEDA 3KB2A 3CWCA 5BRNA 4X64B 5LWQA 3GLFE 1KZ4A 1MAAA 4GWLA 3EH2A 1HY3A 4JP2A 2BF4A 4UEOA 2CLSA 4O3FA 5DNEA 5ICSA 3HO8A 1JAXA 4LVOA 1SKQA 3DE4X 3KKMA 3GN2A 4OK5A 3I12A 4ZT4A 4AICA 1I2CA 2BCGY 1UXJA 3OEHD 1PV4A 4YR7A 2VSQA 3WBBA 4KN8A 3V97A 3QENA 2Q07A 4CV1A 4JY7A 1CBUA 5KX5A 2Y1CA 5CA1F 3DDHA 1XO1A 1WEHA 1VPDA 3B1YA 4OEHA 5FNVF 2XX3A 3TZQA 3J7TA 3LVRE 4HR7A 3LGXA 3N75A 1K68A 1QC5B 5BP7A 5GZ6A 5IT9A 4BFUA 5CVJA 3C7TA 4M99A 4HEQA 1ONNA 5G4KA 1EJ0A 1BN7A 2A1UB 2QXUA 4RNCA 2PBLA 3A6GA 3IHLA 3G0BA 1CJKC 1EP9A 1CRWG 1OFVA 1N4AA 3UVEA 4LI3X 2A8YA 2AZDA 3W5HA 3ZHSA 2NSYA 2P90A 3PJDA 1K7YA 3PQ3A 2B94A 421PA 5I7EA 2ZXEA 3OM0A 2BKVA 2WHPA 2GFHA 3WL7A 4Q4AA 4CG2A 5AUNB 2EYUA 3E6AA 1N92A 4LSZA 2WYVA 4OY3A 3ZXIA 4P98A 5AW0A 3VQTA 4CM1A 2MR6A 3O84A 2XI4A 4A73A 4TKUA 3K70C 3CH7A 5JCOA 2AH5A 5DV9A 5E3HA 1YBHA 5DW0A 3MTDA 5A3RA 1JQJC 4BFCA 3TLJA 1NJSA 1XT6A 3GUCA 2O54A 1N5IA 3L7IA 3MGGA 1QTRA 1TM5E 5DNAA 3C7KA 2COKA 5AVYA 4TTPA 5ARDA 1ZCFA 4H31A 2Z1NA 1NJ8A 3PDUA 2I4LA 2ILVA 3PNBA 1U65A 3JQ9C 4NX2A 4MV1A 5TPWA 1M2OA 2H5JA 2VWHA 5MDHA 3ZGOA 5FAXA 1ZI6A 2JRLA 1R4MB 4MR9A 3INYA 1G64A 4M1QA 3VVMA 2HA3A 1UODA 1NJFA 1T26A 5FUYA 1BE8A 1E7QA 3REFA 3U5ZB 1YB4A 1OH6A 1ZC4A 3D8HA 1NSTA 2ZB3A 3T5TA 1WCYA 4EVSA 4HPJB 2DTXA 2F1JA 4Y30A 1FJHA 5E6UA 2AKEA 3ED1A 1AM4D 3WZMA 1QHYA 4CUJA 5KCZA 2WJHA 2GD2A 3SPXA 4ARBA 1LJ8A 1IN1A 2I4IA 1P7PA 3R0IA 4ZYLA 3QLJA 4OGGA 1DOAA 2JKZA 3JRWA 4H7KA 1I6WA 4U7PB 4UU1A 4F2PA 4S2EA 1TQ4A 2G77B 4EPWA 3VBCA 4DZTA 5KQLA 2Z30A 2V7UA 3HA7A 3HBMA 1AUVA 4HK4A 5A7HA 4R1PA 3UMVA 2C94A 3WNBA 5KTYA 1CNMA 3BGDA 3BQ9A 1N6HA 1YA4A 3MWDB 3MTQA 2CXRA 1QMGA 2GS9A 3GLIA 1XP8A 4BB6A 4A6DA 4P3YA 1TUIA 1QPBA 1SRRA 1KNXA