2GZRA

Enterobactin and salmochelin hydrolase iroe
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
265
structure length
242
Chain Sequence
PNIADKGSVFYHFSATSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDDELLKQLSEKTPPVIVAVGYQTNLPFDLNSRAYDYTPAAERKSGGSNNFRQLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWLSSSYFRSYYSASPSLGRGYDALLSRVTAVEPLQFCTKHLAIMEGSAGVLSKIHTTLTILKDKGVNAVFWDFPNLGHGPMFNASFRQALLDISGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Enterobactin Hydrolase IroE.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords IroE protein
total genus 84
structure length 242
sequence length 265
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gzrA00
3VVMA 3C6XA 4EBBA 4K6HA 1CLEA 2C0PA 4BB0A 5HK8A 1BE0A 2CMFA 3PE6A 2J3DA 3ESAA 4X85A 1UZAA 4C01A 2R8BA 3D4LA 2XUKA 4HAIA 3BIWA 4ITVA 5FXMA 3LIIA 4AMYA 2O7VA 2HHAA 4G9EA 4G1FA 2XUOA 1ISPA 2WQZA 3CXUA 3E4DA 1A8UA 4FWBA 5C7YA 2J4FA 2NW6A 1G66A 3R3WA 3FVRA 5FUMA 2ZJFA 2XLCA 2YH2A 1BN6A 2Z5GA 5ALOA 3I6ZA 2YASA 3PUIA 1W76A 4YX9A 4J0IA 3ZPXA 2WUFA 1BN7A 4FFVA 5EHNA 3K9BA 3KWFA 4H7JA 5HF8A 5ALKA 5JAOA 1XKTA 4GXNA 1MNAA 4OYLA 1MPXA 1HDEA 2QXUA 4CFSA 2E3JA 1GPLA 2VT6A 3WZLA 2PSHA 4GECA 4LYEA 1SC9A 4Y2XA 3H1BA 3R0VA 5AI4A 1CUZA 5AJHA 4H7DA 3FSGD 2CJPA 4XJVA 2W6CX 4P93A 5HF6A 3K6KA 4KJXA 3BDIA 3PF9A 3NWOA 1MO2A 2ZVDA 1K63A 1XRLA 1THGA 1P0PA 1CFJA 1UK8A 5JALA 3UUEA 4HTAA 3WWDA 2RHWA 4H7KA 2XLBA 3SC2A 1LPBB 5T4HA 4ZRDA 1XZHA 2W22A 2HU7A 1WPXA 4BVLA 3O4HA 3AIOA 4J0DA 4LXGA 5IVDA 2RHTA 3WYNA 2Y6VA 5HKBA 1NX9A 3I2JA 3IULA 1YAJA 1QLWA 4I19A 1QIDA 1C4XA 1TRHA 4DMKA 3TRDA 1WHTA 1QFSA 4L0CA 5FPPA 1XQYA 4Q05A 4Y2TA 3N0TA 3AJAA 4C4YA 5A6VA 2DQZA 2OQIA 4H77A 1XQWA 3Q0TA 1N8SA 4EZIA 2O7RA 2GBIA 2VA9A 2Y6UA 1Q84A 1YR2A 3HABA 4U2EA 3RLIA 3STWA 2AJBA 1IUNA 2WU3A 4W1RA 1Z68A 1ZGCA 4TGLA 4PW0A 4GLBA 2GBFA 1CUJA 3R3XA 3FLBA 3DD5A 2QJRA 1JFRA 3D0KA 1CUDA 3QPCA 4KEAA 4LHEA 1CUUA 3C6YA 5DTIA 4PQEA 4BZWA 1P0QA 3OURA 3MUNA 2LIPA 5ALWA 1OCEA 3IUJA 2WJ3A 3V48A 4G5XA 4X6YA 1ODCA 1MU0A 4FLFA 2J3QA 2RONA 2CZQA 2XMZA 4TPKA 3ESCA 4AN1A 1CUEA 1UKAA 1WB6A 4UFPA 2XUDA 3A2MA 2ZYRA 3EQ9A 3VVLA 4H35A 5ALRA 1YB7A 1WPRA 5JAPA 5SYMA 2QVBA 3GUUA 2XMRA 3WIBA 2XE4A 5JZ9A 1LPAB 3IBTA 3O9VA 5AKHA 2JGFA 4J0KA 1GT6A 4PSDA 1JT2A 1ACJA 5ALSA 2WFLA 5ALDA 3WL8A 3A70A 3P2MA 2WHPB 1SCIA 2RI6A 1ZD4A 1CUFA 5AM1A 1VE6A 3ESBA 3F96A 3F98A 1B6GA 3VISA 3WK7A 1XRNA 1TCAA 2XUQA 1WB5A 2Z3WA 3G7NA 1VA4A 4WJLA 1YS2X 3A2LA 1IZ7A 3MUOA 1ETHA 4UBJA 3N2ZB 2PL5A 5CW2A 2WSLA 2WHQA 2ACKA 5JD4A 3TJMA 4N8EA 2O2GA 2YYSA 4N8SA 4Y2QA 4ZXFA 3LCRA 2CEKA 3KOOA 4DGQA 1XZFA 5ALEA 5HQ3A 5F4ZA 3DKKA 4KE7A 4QDTA 5ALPA 3E1GA 2XQGA 2Z8ZA 3WL7A 2G5PA 1LLFA 3C8HA 4B82A 1XZLA 1JI3A 4LXHA 1Y7IA 2WUDA 4G9GA 3I28A 4G4IA 1GKKA 2HIHA 4EY6A 4DNPA 5IKXA 1N1MA 3ZWQA 5AIAA 4BYMA 4KRYA 3WA6A 1UKBA 1YS1X 3CCBA 1BS9A 2I78A 1G5FA 4ROTA 4BBZA 3B5EA 1AX9A 1DINA 2DHEA 2WLSA 1QO9A 2PUJA 4FKBA 3D3NA 1CVLA 3EBLA 3CN9A 5T4BA 1HKHA 1LZLA 1H22A 1MX1A 3KD2A 1ZJ5A 5JD5A 1DQZA 3DJYA 2XUJA 4A16A 2AJCA 1IMJA 4V2IA 3PF8A 2VJCA 3HACA 1PV1A 3BWXA 1EB8A 1E89A 3IB3A 1WHSA 1KU0A 2OCGA 2HA0A 2DFPA 2ZYSA 3DOIA 4EY5A 1M33A 3DDUA 4CCYA 1UWCA 5HQ3B 1LGYA 1MX9A 4K6GA 1CPYA 2O2HA 3F97A 3IUMA 1H2ZA 3C87A 3I1YA 3QMMA 5K3DA 3ZLUA 5LZ5A 4JNCA 1LPMA 1D07A 1VXOA 4AO7A 1GKLA 4WY8A 2QOEA 4HVTA 3O4GA 2PX6A 4UBKA 3O0DA 1QGED 3U1TA 1ZOIA 2WM2A 3WIOA 1RWQA 3WL5A 2HA3A 3KSRA 1CUBA 1BEZA 3HXKA 2RGUA 3PDCA 2VT7A 3VKFA 4QWWA 4FLEA 5LYYA 4QNNA 5C8ZA 1XRMA 4X97A 2EDCA 1QIEA 2B4KA 5LKRA 4TVKA 4YASA 3CCCA 3I2FA 4W1QA 1QO7A 4BZZA 2VQ6A 4P92A 2XQIA 5ALNA 4DMFA 2ECFA 1DX4A 1LBSA 1RYYA 4QZVA 3AIKA 1BRTA 5JASA 3QITA 5EHZA 5JIBA 2XMDA 3G0DA 3D7RA 1CUIA 1K4YA 4INZA 2XMBA 1X70A 3G9UA 5KWJA 4C4XA 1H2YA 5K3EA 2X5XA 4B83A 4UUQA 1LBTA 2AJDA 4J7AA 4CG2A 5I9IA 3AZQA 4Q1VA 3WQHA 1CQZA 4L3WA 2OGZA 4FBMA 4CCYB 1YAHA 3D2AA 2VEOA 5A7FA 3KWJA 4G8CA 4BP8A 4IO0A 3HRHA 1P0IA 3QVMA 1MN6A 3GA7A 4Y9SA 1MJ5A 4Q3LA 1MAHA 1DWPA 4U2BA 2WJ6A 4FNGA 1X2EA 4G8DA 5A2GA 3DL4A 3FVTA 2DQYA 1TCBA 3HI4A 3BE8A 1QJ4A 5AM5A 3BIXA 3WZMA 5AKGA 1QFMA 3G0CA 2IX9A 1N5RA 1WB4A 5CH8A 5C81A 4EA6A 1VA5A 4IH4A 5LLSA 1FJ2A 3AUKA 5IVKA 5BWBA 3H04A 5AOBA 2QT9A 3JYHA 2WHRA 1VOTA 2D0DA 4DTCA 1VLQA 3FCYA 2XUPA 3W06A 3Q8WA 4KR0A 3LP5A 4DLNA 4UBIA 3DKRA 5AM0A 1GGVA 5ESRA 3T4UA 3BJRA 1GXSA 4MWSA 2AXEA 2GYWA 5T4FA 1VXRA 2BUCA 2QXTA 1I6WA 4A5SA 3W05A 3MVEA 3D5EA 3BF8A 4J3JA 2H7YA 2WIFA 2XMSA 5DNUA 2ONCA 2XMCA 5AKLA 1QIFA 2CB9A 1PFQA 4EY8A 3H2GA 5AM4A 3QPAA 5DTJA 4WFJA 4DYHA 2WIKA 5LZ2A 5ALGA 1VZ3A 3PICA 1JJBA 2Z3ZA 3F8SA 4BAGA 4BVKA 5ALMA 5CT6A 4CI9A 5JD6A 2B61A 1XZMA 4L9AA 3DYIA 3H2HA 4PNZA 1EXWA 2V96A 2HA2A 5ALXA 2QRUA 5AM3A 4RNCA 3R41A 1XLUA 1YB6A 5AK6A 3WK5A 3H1AA 1HLGA 2XI4A 1WOMA 3AILA 1ACLA 2OPHA 4L72A 1CUSA 4X95A 5JZBA 3R3ZA 3IDAA 4DSAA 4AO6A 1EVQA 1EDDA 4BTLA 4JYPA 3WL6A 5EHXA 3OOSA 2GZRA 2EEPA 3SX4A 2XB6A 2JEYA 1R50A 3WYDA 1XZGA 5ALYA 4BC0A 4B81A 1U8EA 3BDVA 4IH9A 1Q83A 1ORVA 4KYVA 1A8SA 1VZ2A 5HCUA 2ROQA 3D2BA 4W1PA 1EHYA 4Y2JA 3BXPA 5CTAA 4OPMA 2I3ZA 1NU8A 3IA2A 4W9RA 1R4ZA 5HFNA 3RARA 3IUNA 1EDBA 2WIDA 1RP1A 4NS4A 1CR6A 1TK3A 2OGSA 4F21A 1ZIXA 1YA4A 1QONA 4LKOA 3A6ZA 1MX5A 5ALFA 2XUGA 4Y2PA 4CG1A 2CUTA 4Z49A 1CIJA 1UFOA 5ISMA 1H2WA 2QR5A 5K3BA 5AOCA 5AI9A 5AKEA 4DNFA 5FPQA 5EHQA 1CV2A 1ZGBA 4NMWA 3I2KA 2G63A 4GW3A 3G0IA 3HYSA 1OXMA 4X90A 4UFOA 4UBMA 1E8NA 4EB0A 1E66A 2JGLA 5A7GA 4KAAA 3PFCA 4FMPA 5CT5A 2JF0A 3EF3A 1N5MA 3O9MA 4E15A 1VE7A 5AKXA 3LS2A 2HA7A 1XRPA 1CUXA 4JYMA 4O08A 5EIHA 2PSJA 1XRQA 1AMNA 1A88A 2X76A 1K8QA 4ZV9A 1Y7HA 1QTIA 3DCNA 4M0MA 4BCDA 1THTA 1IVYA 1Y37A 3C45A 2WIGA 1ZI6A 4UHHA 1R1DA 3WKAA 5CH5A 3LIPA 5JARA 3DQZA 5AK3A 5AK4A 5ALJA 5DYYA 2WIJA 5CMLA 2PU5A 4MYSA 1QOZA 2BGRA 3FWHA 2BAGA 2C0QA 2BUAA 3M81A 1C7JA 4H7HA 4WFIA 4N5IX 3QMVA 2WTMA 2WTNA 4RE6A 1JMYA 4ZWNA 1E5TA 2JGKA 4Q3KA 2C7BA 4J0HA 4MYDA 4C4ZA 3HEAA 4UHEA 3WK8A 4QLAA 1VKHA 1BCSA 1MT3A 2BGNA 2C5FA 4BCCA 2Y1KA 3BJMA 5LZ9A 4ARAA 1W75A 3EQ8A 1EK2A 3W2TA 5D3KA 4K5QA 5FKJA 4YK7A 4PSUA 1LPSA 3DEAA 4PO3X 4H7FA 5KREA 3G0BA 2PPLA 2WFZA 4XX1A 4F60A 3V9AA 4BAUA 4BDSA 5CBKA 3H2KA 4BDTA 1TCCA 3G02A 4G4JA 2XMGA 2HM7A 2HU8A 1W6RA 3H19A 3WLAA 4HRXA 3M82A 4FFWA 4Q3OA 5AK5A 3C5WP 4J0JA 2GYUA 1SFRA 4HRYA 4I4CA 4FOLA 3OC0A 1XROA 1SCQA 5LP1A 1YCDA 2Y2VA 3PUHA 4YPVA 1QTRA 4GBGA 5BV7A 2FJPA 4X3CA 4QE3A 4QWMA 1XQXA 2WG0A 5DJ5A 5HKAA 4QLOA 4KAFA 1KU6A 3FAKA 1ZI8A 5CT8A 4G8BA 4BRSA 1MNQA 5JYCA 3C43A 5CXXA 4B9EA 5JAUA 5EIAA 1GZ7A 1AURA 3HC7A 3QYJA 4HXFB 3ANTA 1U4NA 3R3UA 2GBCA 3ICWA 4NVRA 4LXIA 4WDRA 3FYUC 2JGMA 3C5VA 1FFCA 1F8UA 2WUEA 3D2CA 4BCBA 4PV7A 3PFBA 1UOQA 3C70A 4EY7A 1J07A 2XMQA 2BFNA 1MAAA 4AN0A 2VAVA 4OSEA 4FBLA 1QIKA 1UT6A 3NUZA 2J4CA 4OU4A 1OILA 1H23A 3L1IA 3STYA 3G8YA 5AKJA 4EHBA 6YASA 3O95A 5AP9A 3HLKA 3W9BA 4A23A 4LIPD 1FFAA 2IIVA 4E11A 2PSEA 2HL6A 1AQLA 4UBOA 4WCVA 1CUGA 4UHBA 5ALLA 4B84A 2BUBA 3L1JA 3H2IA 1IZ8A 2PSDA 5HZGA 2QUBA 1UK7A 1A8QA 5IVIA 2WHPA 5AICA 1AUOA 1UOOA 5JATA 4E46A 1DTEA 4ETWA 2VJAA 4H18A 5E2IA 1XKLA 1XRRA 1G4HA 2Z8XA 4W63A 3OPMA 3I6MA 2OCLA 5KBYA 2C4HA 5J3JA 1F0NA 3AIMA 3DNMA 1K5PA 3DLTA 2PKYX 3M3DA 2IITA 4N5HX 5FDFA 4QDOA 4X93A 3B3QA 4UBNA 3U0VA 1CUAA 4JEIA 5DYWA 4MQLA 3RM3A 2XQFA 4QEKA 3SK0A 5AKKA 2JGIA 3F9CA 5D6OA 4AZ3A 4KE6A 4H7EA 1CUYA 1XLWA 1CUWA 1W1IA 2B20A 2C58A 2WG2A 3WKBA 1NU6A 1X2BA 3UMJA 3V1MA 3WJ1A 4GDMA 3RK4A 4DNOA 2HFKA 2XQJA 5K3CA 3WMRA 2WILA 2G4LA 1CRLA 3WK9A 3ESDA 1P0MA 3CN7A 3G0GA 1XQVA 1AKNA 1QIGA 2VJDA 5CH3A 4X00A 1G42A 4UFNA 1HQDA 2OAGA 2RIPA 2B9VA 3KDAA 1GQSA 2GYVA 1AZWA 1L7QA 2I3DA 3GELA 3WA7A 3GROA 1XLVA 1T4MA 4B80A 1QIIA 3DS8A 5EI5A 5HK9A 5AO9A 2QS9A 1EDEA 3UUFA 4X7BA 4XWGA 1DWQA 3MGAA 2V9ZA 2FUKA 1AC5A 2VTVA 2CKMA 5I8PA 4UBLA 4Y2UA 3H17A 2OCIA 1XZEA 3WWCA 5DWDA 4BVJA 3IURA 3STVA 4J0GA 3FYTA 4HZGA 3W04A 4FTWA 4OU5A 4Y2YA 4OB6A 4ZV7A 4MEAA 3STUA 5E4JA 2OQVA 1DT5A 5ALIA 4X91A 2WJ4A 4GWLA 4QDXA 1ZICA 3STXA 4NZZA 4AO8A 5H3HA 2K2QB 5AKYA 4Y2SA 5K5EA 4LYDA 1LZKA 3QMWA 4DMCA 1QIHA 2HADA 2PSFA 4HS9A 2OCKA 2XUFA 1O6FA 4P08A 4CIAA 4MJ3A 1AGYA 4BATA 1A7UA 2VATA 3I6YA 4PSCA 1QZ3A 4X94A 2ES4A 4N8DA 3EQ7A 2ZSHA 2ZYIA 1WM1A 3TGLA 2ORYA 1JJFA 1S8OA 1LPNA 4KE9A 4OD0A 3ED1A 4BTVA 2PVSA 3T52A 1W4LA 3ICVA 2P8SA 4U2FA 2ZYHA 4WDQA 7YASA 2AJLI 1EINA 4BP9A 2WG1A 2Y2UA 2XUIA 3BL8A 2CBGA 2DHDA 3QZUA 1SOMA 5BOVA 3S2ZA 3V1NA 3WKEA 4U2CA 3WWEA 1QIJA 5FRDA 5CXUA 3I2HA 5AIBA 3YASA 3FCXA 2HA4A 5LZ8A 4BC1A 1CQWA 4B0PA 2DHCA 4H7IA 4Q34A 5AHXA 2WUGA 2BKLA 4KRXA 2V98A 3R40A 2OGTA 5AKZA 3JWEA 3DOHA 2YXPX 1XZAA 4ZGBA 4DMHA 4FDMA 2UZ0A 3FLEA 2XQKA 5K3FA 5A62A 3I1IA 3H2JA 3I2IA 3AFIA 2DSNA 4JH0A 2QUAA 5AH0A 3H0CA 4Y7DA 3GZJA 1GPNA 1U65A 5AKIA 5K3FB 3AINA 3RKSA 4AX4A 3QPDA 2HDWA 1LPPA 4JUIA 4FNMA 3AZOA 1J1IA 4IHAA 3VDXA 2HU5A 4U2GA 1F0PA 3V1KA 1XZBA 1GPKA 2H1IA 4MQMA 5E4TA 1GQRA 1DWOA 2WFMA 3OTQA 2XDWA 2HRQA 4KE8A 5IVHA 4FHZA 1YA8A 1UOPA 2R11A 4AB1A 4IH1A 3BF7A 4DIUA 5DYTA 1FSSA 2OG1A 1XZCA 2BJHA 2XUAA 4C89A 2QTBA 5HF5A 3OG9A 4M0FA 1R9NA 2ZJ7A 3KXPA 4F5ZA 4H0CA 4CCWA 3QBJA 2DCMA 5YASA 1ZI9A 3QH4A 3FSGA 4AMZA 2BCEA 1QE3A 3C6ZA 4Y2RA 1KEZA 1JJIA 4U2DA 3B12A 2H7CA 1K6EA 4CIBA 1R9MA 1O6GA 5CT4A 4EUSA 4AXBA 2PUHA 4FLMA 4PF1A 2HRRA 1R88A 3WKCA 4GI1A 4C88A 3FOBA 1EVEA 2VJBA 2DR0A 4GHWA 4B85A 4C6HA 1J2EA 3A2NA 2G5TA 5AOAA 1QIMA 1VJ5A 3WKDA 2JGJA 5KWIA 4BAZA 5FV4A 4XVCA 4C87A 4CG3A 3GBSA 4QDZA 1FFEA 1ZD3A 3WK6A 2QZPA 4DNQA 5CURA 4E14A 2X8BA 4UHCA 4M0EA 5JADA 3TEJA 2GZSA 4AZ0A 3WJ2A 4MEBA 5AI6A 3JW8A 5E4YA 4QA9A 1FFBA 2Q0XA 1E8DA 5ALQA 2HA6A 3DL7A 2D5LA 1EA5A 2HFJA 4X92A 1MTZA 2AJ8A 1U2EA 1UK9A 4I3FA 3G9ZA 4MXDA 1B41A 5CRIA 3WWOA 1IUPA 5ALZA 1SCKA 5DNVA 3L1HA 1BEEA 2WKWA 1UXOA 5K3AA 5FOQA 1CUHA 1Q0RA 5EIEA 5DNWA 1E3QA 1DT3A 1T2NA 3FYUA 1BU8A 1DQYA 1R3DA 1ZD5A 1CUCA 3DYVA 5AI5A 5C8VA 2PU7A 1L7RA 3LLCA 1EI9A 5A7HA 3G9TA 4EY4A 2OXEA 1HPLA 5I7UA 5AM2A 4GEGA 3ILSA 3R3YA 4G4GA 1TKRA 3W9UA 2FX5A 3EIOA 3AZPA 1ODTC 2QM0A 3H18A 5HF9A 3F67A 3O4JA 3GFFA 1C7IA 5D7BA 2OAEA 1XZDA 2ACEA 2RAUA 4KAJA 4BE4A 1HL7A 4W1SA 2O2IA 3M83A 1BCRA 1TQHA 1CUVA 5LZ7A 3ANSA 3PI6A 1DX6A 4RGYA 4X6UA 1ZIYA 1J06A 4MWTA 5LKAA 4IQ4A 2JEZA 1XZJA 4OB7A 1UKCA 4ARBA 4OCZA 3IIIA 1EH5A 2QJWA 3ZI7A 1DU4A 4ZI5A 1LNSA 2C5GA 3IUQA 2H7XA 4OB8A 5D3ZA 3WWPA 5CT9A 5LIPA 3SWWA 4K6KA 5HFAA 3FYUB 1EB9A 4QDUA 1YSCA 4D9JA 1H2XA 3VJKA 5LZ4A 4HXEB 5JZSA 1L7AA 4AQDA 3ZLVA 3HSSA 2VAXA 2XT0A 4F0JA 3G9XA 3R3VA 4X71A 4X6XA 3FBWA 2VSQA 2JBWA 3K2IA 3O4IA 5A71A 2QKYA 4UHDA 1FFDA 1LPOA 2H9YA 2I03A 1PJAA 5T4EA 2VF2A 4J0CA 3OM8A 1EK1A 4RE5A 1TAHA 5AI8A 3FLAA 5EFZA 2HA5A 1JKMA 3HZOA 3ZLTA 5EGNA 5IH7A 5FLKA 1ZJ4A 5DLPA 1CEXA 2WFLB 4ZREA 4K2AA 1WCYA 1XZIA 4OUKX 2JGEA 4DM7A 5AI0A 5ALHA 1ODSA 2JIDA 3IVMA 1XZKA 2GBGA 2V97A 4B6GA 1EX9A 2ZJ6A 2WU4A 1BROA 5JANA 4RPCA 3NOXA 3X3HA 5C8XA 1ZD2P 1JU4A 1ORWA 4WY5A 5ALVA 4OYYA 1Q0ZA 4BE9A 4HXGA 4Q82A 1TIBA 2XUHA 4B0OA 1YASA 3NGMA 3C6BA 5FP0A 3ZV7A 1JMKC 3S8YA 4UPDA 4KACA 3E3AA 4XIIA 3WK4A 2FJ0A 3FNBA 1XFDA 5ALTA 3I2GA 4Y2VA 4B7ZA 1F6WA 4UHFA 3QM1A 4S0XA 3STTA 4J03A 2EDAA 1JU3A 5ALUA 2ZSIA 4WFKA 2OLEA 5SYNA 2PBLA 1IUOA 2QMQA 5JAHA 3D59A 4P9NA 3VJLA 3VJMA 3V1LA 1UK6A 5BWCA 4B9AA 3WI7A 4BRZA 4DSZA 3VXKA 1E8MA 3HJUA 1W52X 3E0XA 1USWA 2PM8A 1HBJA 3C8DA
chains in the Genus database with same CATH superfamily
1CJMA 3MA0A 5CNMA 4IGIA 4YP5A 2QRLA 5JWHA 5K8TA 3TTWA 1SVSA 1SBCA 4TWJA 1GZ5A 4KK4A 5A5GA 1BE0A 1VRVA 2BBWA 3JALA 2LE0A 1NT2A 1U3CA 2Y99A 4TSFD 4LFCB 3W2FA 1NF9A 3LBYA 3LT2A 1ZONA 3PE6A 4NDNE 3ESAA 4G0MA 3F3KA 1UZAA 4L6AA 4R8VA 4X85A 3P9IA 3RB8A 1NJ1A 3P9XA 4C01A 3PR3A 2WNHA 1JIIA 4NE2A 1TM4E 1U1DA 1WL8A 2ZJ3A 1QMGA 4YCNA 1Z28A 4KR6A 3EDYA 3LBNA 4PYRA 4WQMA 4R31A 1JDBC 2JCGA 1L5VA 1TLFA 2AI1A 4RANA 5DP2A 4ZVSA 5AXBA 3T34A 4G9EA 4CEIB 3REOA 4PZDA 3SHVA 1F2TB 4E3WA 5GVRA 2X0JA 3CFYA 1ZCJA 3SX0A 1QH8B 4GUAA 1IK6A 3CXUA 2BTQA 1U5BA 2FHPA 3E4DA 3FDZB 4AJ9A 2YNMC 3CO0S 4H2DA 1Y6FA 1WVIA 4FMCF 4JB0A 5CFQA 2R7KA 2P2GA 4F97A 3ZHCA 5KVQA 3UICA 3UBTA 4RIIA 3GJSA 4ND8B 3WNVA 1YIAA 4EG4A 2OQRA 4HADA 2V8BA 2XLCA 2D7JA 1BN6A 3G2OA 3ZZMA 1A77A 3KHSA 1OU4A 3I6ZA 2H59A 3WLJA 4LZWA 3HFSA 1YHNA 1XWFA 4REOA 3ZV4A 3PC2A 1W76A 4YX9A 1NUAA 5AHOA 1F3OA 3IPLA 3G88A 4P3YA 3SYKA 1M0SA 1P31A 2E21A 4DLYA 1PAUA 1RJ9A 4GR5A 4CG0A 4DLSA 4NXNB 5HF8A 5ALKA 3K1JA 1PJ8A 2NSDA 4XDHA 5ILGA 1XKTA 2Z9DA 4N0EA 4O29A 1KAOA 1W73A 3MJCA 2Q5IA 1QCDA 4OYLA 5CLQA 1WMBA 4AMUA 1T4CA 2HRCA 1KFJB 4M1MA 1ST3A 2BEUB 1U1FA 1FDIA 2OSBA 4R83A 4XB2A 3UMGA 4P4SB 2ETXA 3RWOA 1JIKA 4KB5A 4MUNA 2E3JA 5LIRA 2C2XA 1GPLA 2P4UA 3MRVA 1FRFS 4K46A 1ZVKA 2ID8A 3GG9A 2CHQA 2B30A 4ZAZA 3KUUA 2FFBA 3KU4A 2IHJA 1O95D 1W19A 1X9GA 1CUZA 2WV9A 1PHRA 1T2AA 4H7DA 1ONOA 3FSGD 1GG5A 1Z6XA 4PZAA 3B2EA 3JQGB 4LV6A 1YOBA 1MBZA 3FDFA 2Q27A 2W6CX 4TLDA 3JV7A 4GICA 1LCIA 4YP7A 5LR6A 2DHQA 4CDGA 1T6BY 2ZUSA 4F46A 3LC0A 3FJOA 1QVZA 4UNQA 2Y9MB 3EOBI 3NETA 4R2KA 1Y4AE 4LOHA 2X41A 5DHAA 3RYCB 5EESA 5FULA 4GS5A 4TROA 2ZVDA 3FR8A 2AN5A 4WGGA 1K63A 2ZP1A 1PZEA 3A6JA 3QEMA 5FOWA 2G1JA 3IOEA 1JDUA 1FLVA 1EE1A 3SZGA 1T6XA 1UKYA 2ZI9A 1Z6YA 1PR0A 2ZKLA 3CQ9A 3E2MA 5B1HA 1PKEA 3TWOA 4CR6A 5TMPA 1H93A 1D6MA 3N75A 4DY4A 3GPCA 3ERCA 5DRTA 2O06A 1PJ4A 1ZSVA 3PGVA 3R9IA 3WWDA 1Q57A 4JGIA 4N01A 3O2JA 3ENZA 3GBVA 4XIFA 4AKHA 1RVDA 4J4TA 2FUNB 3FCUB 5ICFA 1LPBB 6GPBA 1SZPA 1Z88A 4ZRDA 1PFUA 3EEQA 4FHGA 4O2AF 5C8YB 1O9HA 2V7EA 4G9BA 1G8AA 3M5PA 1M34A 4JQCA 4YJDA 4F85A 4DV0B 1VHWA 4PIPA 3PUZA 3TH5A 2A5LA 3KE9A 2VTEA 3FOWA 3IEPA 3DV0B 3Q3JB 4HLCA 1KKUA 4PSVA 2G72A 3HFRA 2C4VA 3UAOA 1WZEA 3AIOA 3QXJA 1E9SA 1NJ2A 4D9FA 5IM4A 2P8JA 4RWEA 4LJYA 4G0YA 4ABTA 2FWRA 5IVDA 2VN8A 3WX0A 3X1WA 2C2YA 2QQEA 1I7SB 1XDDA 3W0LB 1E3WB 2P3LA 5I9BA 3PVCA 4UTOA 3QWAA 4DBLE 1KBOA 3INYA 1POXA 4JKOA 3PQ8A 3DNFA 1IDOA 2CF6A 4NNPA 3UB3A 4R01A 5ITZA 4YBRA 1VG1A 2ZAOA 1LFDB 1QCZA 2BFBA 1KF0A 1O3YA 3B78A 2JLSA 2ANCA 4G97A 4YRRA 4ENWA 1TRHA 2GUGA 2V5VA 5BORA 3V55A 1T6ZA 1T0BA 5F4BA 3CEJA 4L0CA 3RV4A 4YMIA 2L69A 5TJ9A 1P5FA 1YC5A 4XPZA 2Z6UA 2R60A 1R37A 1W5TA 1N1EA 3BQ9A 4MCIA 4JY7A 1W48A 3EF1A 1LI4A 2DQZA 3KEGA 3E22A 4L5JA 2XCIA 2FWPA 2NUAA 1X86B 4B7XA 4YMUA 2V7VA 5C35A 5LLTA 1JZSA 4PWZA 4Y0VA 1P9NA 1NT4A 2GVDC 3K0EA 1JXOA 4EZIA 5BUSA 1Y6JA 1D8AA 1R0CA 2H1VA 3ZV6A 2F43B 3TTVA 4QUBA 4ZANA 2O7RA 1KI3A 3GC6A 1SBYA 3K0AB 1KJ9A 2OOSA 3KAKA 1NQOA 5IT5A 2JD2A 3K1YA 5EPOA 1YR2A 1Y9EA 2Z09A 4GO1A 2A86A 1RJ9B 3EFHA 1S2DA 1DUIA 3KYIB 4U39A 2QY6A 4R4JA 5L3ZA 3X2FA 1JR6A 4FUQA 2FI1A 1NIPA 2DPGA 4TT3A 4PLHA 3DOEA 5IWAB 3AEKB 3K0CA 2YR0A 1TYEB 1GCOA 1KK3A 1C30B 2G6BA 2N75A 1ORIA 4RM3A 2B2CA 4CZ2A 2H48A 4P80A 4CEIA 1KRXA 2C4UA 2DU8A 3MD0A 1AS2A 3JPWA 3HRIA 4CV2A 1NTRA 4PZEA 3V6MA 3ORHA 3KR2A 3Q41A 4XD2A 3QEAZ 3QXXA 1FOEB 1G7SA 4C14A 1PZNA 3GW8A 1ZGCA 5KVAA 2I8CA 1I01A 4PLYA 3CRQA 1GQQA 2JIRA 3VR5A 5LFAA 1A9YA 3PGA1 3RYHA 3EQ6A 1C0KA 4L0DA 3DDCA 3DBRB 3IEIA 2CN1A 1U3DA 4GLBA 4M7PA 1WXFA 4KI0A 4D9BA 4CTOA 2VJYA 2VA8A 3R3XA 1E2LA 4TRNA 3FTPA 1ZMRA 4YRBA 3CNHA 4MPTA 4IVRA 1KJJA 2HF2A 3RUPA 1N77A 1HR0B 3N3AC 2CCJA 4MP8A 1Y98A 1SOUA 1CUUA 2PLAA 2ZIZA 3KC2A 2FUCA 1UPTA 2D1RA 3BE6A 1Z8HA 4L8GA 4DA9A 3MAAC 2P40A 1PX0A 5EQTA 1WHTB 2H4XA 4RAOA 2P9QA 3OCVA 2HRDA 2EHDA 1P0QA 4NCNA 4DCNA 3DMFA 3MUNA 4F3CA 3JQ7A 1ZMXA 1NDQA 4MJ7A 5E7JA 3O92A 1FSPA 2LIPA 1XIVA 3AR7A 1XPJA 3IUJA 4O5OA 2WJ3A 2C5EA 3C6MA 2F6RA 2ZYVX 1IM8A 2QTZA 2ZBGA 3N70A 4G5XA 3V48A 4B44A 5HTOA 2NT3A 2RI0A 4KPUB 2IBMA 1ODCA 3OZRA 1OWMA 4URYR 1XBTA 4R1MA 3QE9Y 3RIXA 1WXGA 4FLFA 4RY9A 1X8JA 1WS6A 4K7JA 4EFLA 1AQ6A 2WNIA 1FSGA 1RI1A 1CY2A 2CZQA 2FEKA 2F1KA 1ADGA 2XYPA 3ANNA 4N5MA 4CT5A 4YRGA 2ZR8A 3BWBA 3QUBA 4ND8A 2AIRA 1UOEA 3ETLA 1EVLA 1CUEA 1WB6A 3MTJA 3QUSA 1FUIA 2P91A 4W9NC 5ECYA 3OLZA 4PC1A 4N3NA 3HWSA 3GFRA 1K3FA 1X8LA 1RU3A 3AKZA 3WS7A 1WLSA 4X64B 4E51A 3VR6H 2NZJA 3JQQA 2C97A 5SYAA 4YRMA 4HQOA 2PZGA 4O4JB 2GPBA 2V45A 3HCRA 3WO1A 2YV5A 4BPBA 3PXXA 1WAMA 3GUUA 3AI2A 5JSZA 2FY8A 3RU7A 2QD5A 5TV2A 1OGYA 4HX9A 4L6IA 2XAUA 3MMPA 4M9RA 2XE4A 4CQLA 2I8AA 1XDSA 1WJGA 2V6IA 3ZU4A 4ZTBA 1UPBA 2EJCA 5C9ZA 4PFQA 4S0ZA 4IR7A 4HD8A 3L8DA 2Q3CA 1X94A 4JI3B 1X6VA 4PSAA 3TZKA 3U0BA 4L9WA 3ZJYA 4C0QC 4EI2A 4O2AA 4R1TA 5HKKD 1Q91A 3GT7A 1N8KA 2BOVA 4AW9A 4HQKA 3FBTA 3EVAA 4RZUA 2BFCB 3FM9A 5JS2A 2KPOA 1L7OA 2QD4A 1IHUA 4Q1EA 2PRSA 3U16A 1G98A 2WTBA 4NDAA 3L7OA 3PB3A 4I46A 1T15A 5ALSA 2WFLA 1YZUA 4P98A 5JSYA 4Z2YA 2O8EB 1UMBA 3A70A 1PJTA 2NYUA 4PYNA 3O8OB 3P2MA 1T9HA 1Y8ZA 1N9GB 1OB2A 2MINA 3BK7A 1GU7A 1R7RA 4RFLA 1J8FA 1SCIA 1ZSNA 3JR7A 4GWGA 4A0FA 4YT2A 5JOQA 2FQXA 4RMNA 3FHJA 1RBMA 1QR2A 2NU7B 2WBLC 3QXSA 3KHKA 3DF9A 1N2ZA 1VE6A 3ESBA 3M2PA 4E6EA 4JJGA 3WHKA 2XZOA 3QX9A 2MSLA 4LYHA 4MW5A 1JHXA 2G9RA 3B3FA 2QEQA 3BPSA 4RVNA 1LRKA 3I2YX 2AK2A 1MOPA 2BD0A 1TCAA 4PNHA 2FPLA 2J9RA 2RC5A 3A25A 3FOFC 1LH0A 2G07A 2XTZA 2GRJA 3FVVA 3KQTA 4GF5A 1U8UA 1JLKA 4DR6B 3NYWA 2SCUA 4G1MB 5IK2A 4BQFA 4NBSA 3WAJA 3MUOA 4MW0A 4WCFB 4DXAA 3P97A 3GJ7A 3M5WA 2HIGA 2XH8A 3OIUA 3Q3HA 4FMDB 1XP8A 3MWDA 3V7YA 1KO8A 4BMVA 4HGPA 3VV3A 4EJSC 1F7UA 1E7SA 4ZU6X 3H4IA 4I5IA 4S2EA 1L5LA 2GD6A 4UATA 4C5BA 2N0SA 1A9SA 3GRVA 2O2GA 3K0AA 1H05A 3W5JA 2JFGA 3DGFC 2C4MA 1EZ4A 4RY2A 3KQLA 2CEKA 4NATA 3AEYA 1P1JA 5KUTA 2Q3JA 1XZFA 1IULA 2BMVA 2ZROA 1P1FA 4K9OA 1NJ8A 2DKOA 4KNVA 1HRKA 2YWBA 1DZIA 2Z95A 4MDHA 5ALPA 2C3OA 3L6OO 1VBNA 1TVCA 4RTKA 5EEHA 4E88A 2I5PO 2IYYA 3QW2A 4G81A 1I2BA 4FI3F 4UNSA 3WL7A 1M8PA 1X1DA 1U3TA 2CJFA 1WUYA 4ZCIA 3IMCA 4B82A 4FJ2A 1VJDA 3HI6A 4FBGA 3JQAB 2IRWA 3PJGA 1QP7A 4QSMA 2DPYA 2PXHA 3BZWA 2CJXA 5HDBB 1Y7IA 3PLNA 4WLNA 1M73E 3LXRA 4R2WA 4LC0A 1U9JA 1LB1B 4RA6B 1ZGJA 1KJYA 5KTYA 4HZIA 5B37A 3BCSA 4DAOA 5LQUA 3NTRA 1Y5IA 2QP9X 2NP7A 2NUAB 5ADUS 2QUIA 1KOJA 4MIYA 4UM5A 4NHOA 1QWSA 1SXJD 1N1MA 1T9DA 2FZLA 2Q3EA 2QL6A 2Z4RA 3HDYA 3K16A 3L0PA 4J6FA 5KMGA 4MWGA 5JI3E 4KRYA 4P4GA 1UKBA 4IWYA 2XD4A 1OI4A 4GOMD 4P3XA 4BNMA 4KG7A 2PGLA 2X2EA 3F6SA 5JRDS 1ZJWA 4BQRA 2ZCUA 2ZKIA 1X0XA 4KTTE 1G5FA 4GRDA 4ROTA 3PNPA 2QRKA 4XVHA 1NV9A 5AJXA 5LUAA 4E7OA 4DUYB 5G1NA 1DQRA 4CM8A 4TVSA 4KR7A 1E9EA 1YVUA 3LQYA 1QYVA 1C9MA 1QO9A 2ZIVB 1B42A 1JEDA 3BWYA 3TAUA 3ZNPA 1EXDA 1KQPA 3A6FA 5G3YA 1IIBA 1W25A 1IXSB 4FW8A 1HKHA 4PWYA 3DM9B 5I7AA 4G25A 2JARA 1H22A 1DXOA 3RHTA 3KD2A 1HEIA 1ZJ5A 2X3YA 3PXBA 4EHIA 5JD5A 2PE5A 1PJZA 1K08A 3DJYA 2EFJA 3V9PA 4RUKA 1Z4NA 4YUAA 3DZJA 4A16A 1I7DA 1IMJA 4JBWA 2CF5A 1SXHA 4G26A 3L8CA 2ZT7A 5CNIA 3IQFA 4I50F 3RVQA 3V8VA 1W4BA 3N7AA 3VSCA 1RC8A 3LKDA 2OHHA 2NNLD 4Z3OA 1EFHA 1E89A 3VOBA 2XYGA 3VHRA 2YJ5A 4IOKA 4EAQA 1GADO 3KUCA 1A76A 4GI5A 5EGSA 4DA7A 3ZDQA 4B7CA 2VJMB 3UPUA 4EMTA 5AVOA 1U0NA 4KXQA 2PY6A 1VLLA 3DOIA 1L5NA 4O4HF 4J0FA 3TD2A 1M33A 5B7NA 1AKTA 3DDUA 4EF6A 3UJ8A 1UWCA 1XMQB 4P5DA 1EU1A 2XZPA 3CX6A 3TQCA 4OJQA 1QUFA 2WTEA 5BR7A 3MIZA 1NHWA 1CPYA 4DHEA 4HN9A 5F73A 3SYLA 2VH5R 1VYTA 4TKMA 3TN7A 1OBFO 3SZRA 3HXPA 2FSVC 1QYIA 1GL9B 4X1KA 3WMXA 1ZOPA 3NEPX 3C87A 3I1YA 3CVYA 3I72A 2PJUA 4AS3A 1IEQA 1G1AA 1OD6A 2OO7A 1KJIA 2LZ0A 1RAFA 2VDWA 3ADDA 4LDAA 2IS4A 3CWQA 3CNLA 3FPKA 1IB0A 5KYXB 2UUBB 3UN1A 3WRYC 3C1OA 4M54A 3PI7A 1YBMA 3ZY6A 1J0CA 4WINA 2XGOA 3KTAA 4S35A 3B6MA 3PXGA 3E1KA 4IIJB 4OHBA 3U1TA 4YPOA 2FPOA 2ZPTX 2XTJA 3EGVA 3C7AA 4C76A 5CIQA 4Z9AA 4LOJA 1A98A 4UVGA 2ZBDA 4G5RA 1E2HA 4IDOA 2Y1DA 4A0RA 5REQA 1TOAA 5F12A 3VKFA 2VQEB 5JXHA 4FLEA 5LYYA 2FF7A 3HSYA 5HJEA 3SS9X 4CNBA 4J7UA 2CNWD 3RUFA 5IZCA 2QRMA 4MDFA 1M76A 2PKQP 1OB5A 2ZU6A 3QUCA 2VDVE 4FZ5A 4X97A 2GN6A 2C2GA 1KKLA 1QIEA 4NBTA 1LY1A 3C6KA 3GN1A 1Z3IX 2EF0A 3CCCA 5JVDB 3BC1A 3GRKA 3ZEAA 5KYYA 1SU4A 1CC1S 4QXPA 3PD7A 1J1UA 3OLWA 4FB5A 1KNQA 3GZNB 2GERA 3OCZA 2DTEA 4CNQA 4S1VA 1P1CA 3IR6A 5IDVA 1VHTA 3LBFA 3DR5A 5ALNA 3I5UA 1ONPA 2AA3A 2XCUA 3EQ2A 2B6NA 2I71A 3IT1A 2A9OA 4QZVA 1EFVA 1JXMA 3S6JA 1G20B 1BRTA 4OX9Y 1CY6A 2GX6A 2KBFA 4RIHA 1UBLS 2VDRB 4HJXA 3SXUB 5LP6A 2YOHA 3G0DA 3P9PA 1GGEA 3OJ0A 1U7HA 1QRTA 1CUIA 4Y9RA 1G8SA 2X4GA 3EW9A 2Y68A 3WBFA 3KQUA 5KCMA 4WK6A 2J07A 2CMDA 4C4XA 4O4JA 5JNRA 2B69A 3F0TA 2AXNA 3ROXA 5HHTA 4B83A 3CT4A 4ZDJA 3RGGA 2JFUA 2WWXA 3VH1A 1C1XB 1RXUA 1M2WA 2FEWB 2VL7A 1XTZA 2SBTA 1V11B 1OWLA 1RQ2A 2XSZA 3L4BA 1CJKC 3U80A 3C7DB 4YV0A 2YIVX 3WNDA 3KR0A 5FQOA 4ER3A 1P1IA 2DT8A 4J7AA 2NN3C 3Q6IA 3CUTA 5INTA 3L4JA 3VTKA 1YMQA 4D9HA 1UZLA 1ZA1A 2QMOA 3LHSA 3QEKA 3EEIA 3I0ZA 2OGZA 3KVYA 4OG2A 4CCYB 3IAEA 4HCJA 1IOLA 1J33A 1EQUA 3GMSA 4X1OA 4YDRA 1T6YA 4AULA 2XBMA 3COZA 1UPXA 1FTYA 4BRWA 4BP8A 4HRVA 2GM5A 3GX1A 4FYIA 1ECFA 4ZT6A 4CKCB 1TGVA 3ECCA 1F2DA 1FQWA 1VSUA 1P0IA 2LCIA 3VNSA 1GLVA 3KYBA 1VDMA 3H1FA 2R5NA 1KIAA 3BMOB 1TMYA 2Y05A 1FB5A 4Y9SA 2V1UA 1T8YA 1P4AA 1YB5A 2FYTA 3BQNB 3INNA 4LYJA 4R1NA 3SF0A 3T38A 2O8BB 4DSNA 2YV3A 1E5DA 3HL0A 4FYHA 3X44A 1DG1G 1N9GA 4V0ME 5ERGB 1BGVA 1MC8A 1T0JB 3ZD7A 3L84A 3LGSA 1DWPA 2WA1A 4Y1EA 3A0RB 3ZOKA 4RZ2A 4TXLA 4JOCA 1BWRA 3N87A 5GWXA 3VYRB 2AXQA 1VPWA 2FE4A 4ND3A 4AIIA 1CETA 1Z7BA 4I3HA 1JL3A 3NJ4A 4QYIB 3OUUA 2Q0HA 1E63A 3C8MA 4WERA 4ZT7A 2Z9BA 1HE3A 3BE8A 1QJ4A 3QU7A 2G8LA 4JP2A 1L1FA 4ZCRA 5AM5A 1X0VA 2I4NA 4RDHA 3AUJB 1A96A 3L7CA 4J9UE 4I3GA 5EUCA 3FNFA 2CL6X 4WOCA 4YP6A 3HH8A 1JR4A 2ILTA 2HV9A 4L5BA 4U5XA 4QTXA 5IEJA 2AKAB 1K9VF 1FFSA 2UVPB 2W6PA 1S2LA 2I34A 3G5LA 1U0BB 1EUDB 3CMCO 2QT0A 5DXAA 4ZVTA 4EA6A 1KC3A 5BNIA 1YNOA 1VA5A 3FPEA 4W9NA 1JEJA 3SC2B 4Q6WA 1VPTA 1ABEA 2BEJA 3IIKA 4MLDA 5DI3B 1NKTA 1II9A 3HCFA 2NXEA 4NZYA 5IVKA 5BWBA 3MPUA 3OZEA 5TEWA 4Q1FA 5EJ5A 4O2RA 1JTEA 4FOTA 1YS4A 3JYHA 4O1IA 1RM4A 4MUFA 2Z2KA 4P3NA 1ONBA 3U3OA 3FLMA 2BMJA 1VLQA 3DB2A 3RRBA 4BGDA 3ZQKA 2C5BA 2OFOA 2EJWA 1SUIA 3LP5A 4IEEA 5FUVA 2WKQA 3QVWA 4E2WA 2VPQA 3AOEC 4A26A 2HJHA 1LSOA 3DKRA 1OAAA 3RKRA 3ZDEA 1VHDA 3P4XA 1GGVA 2ZS8A 3FUWA 2E5WA 4S1PA 1GA6A 2RHHA 3B6JA 3F5SA 1MV8A 4D97A 3DB1A 3OFNA 3Q7IA 2AWOA 1X7DA 1Q0UA 4WUTA 1VLHA 2FX3A 2QSUA 1Y8CA 3RLFA 4KO4S 1L6IA 3TG2A 4UZFA 2VPXA 1C2TA 3ZS9A 2QXTA 3KNZA 4NIMA 1I6WA 4EG3A 4ZAGA 2FMXA 2QUJA 4NWIA 3SXUA 2C5LA 3BULA 3OIVA 1LKZA 2VJNA 5FWYA 2O48X 4MR7A 2JCYA 3DTVA 4RKRA 1E9FA 3A1CA 1F1JA 2HCBA 3WIVA 3ZHRA 1R0SA 4BFTA 1RHMA 2WIFA 3LHDA 3UV3A 5AW6A 4UXHA 2ONJA 3DZIA 1Z0UA 5IW8A 3DZGA 1GNRA 5DI9A 4ARVA 5I7VA 2XMCA 3EGWA 5AKLA 4EX6A 1JVNA 1QIFA 8LDHA 5ILOA 4FE4A 4RF4A 5C1DA 3P9QA 1BCSB 1ZUHA 4HN4B 4YXWD 1Z18A 3Q6NA 4MAAA 4IHKA 4MEJA 2NU6B 3DT8A 4PLCA 1I33A 4QELA 2DWQA 5AM4A 1U0GA 1RYMA 3ZXUB 5HWSA 2G9VA 2PDAA 4LMAA 3SYMA 5BMVF 1Z5ZA 4DLKA 4U2KA 4I1OA 1T43A 1GR1A 2OHOA 4PRLA 3QLUA 4ALIA 2EW2A 4BIIA 2XXAB 2WB2A 1GTRA 4BV8A 2CUKA 2YZNA 3PC3A 3BH0A 3VHLB 2YOGA 2I6SA 1KH2A 1A72A 1JJBA 1Z4QA 1XHFA 3DBHB 3F8SA 4BAGA 2VJQA 4ZI2A 4F93B 3SBEA 3KZVA 4JN6B 1YDGA 4YRQA 2I7DA 3TL2A 3IR5A 4NQZA 2AUMA 4IJMA 4PC6A 4BFXA 4M1TA 4K3VA 4U0JA 5CT6A 2B61A 1S0UA 3SX2A 4BZPA 2EGUA 2X8LA 3O82A 4V0SA 2UZ1A 1B4DA 2AQIA 1XZMA 2ZWMA 4B2LA 3LUAA 2Q6IA 1AHPA 3DYIA 4LHYA 2L82A 3ZY2A 2OE2A 2L2QA 2WM8A 3H2HA 2Q2QA 3IESA 3AF3A 4KMOA 4TV8F 1L7NA 1V3QE 3GLHB 2UZ4A 4OYRA 2HA2A 3B3GA 2PMCA 2VNIA 4UULA 2F55A 3EXG2 5F9FA 4RNCA 3R41A 3ZBQA 2A9QA 3FWZA 3H5RA 4J2HA 5JS6A 1KFEB 2NXCA 3RUCA 4XDYA 3H1AA 1TA0A 4DTIA 2ONZA 4JYZA 1YJ8A 3TMKA 1Y9JA 4C0WA 3G79A 3W5AA 4DJFC 1GNVA 2ZR0A 3OU2A 1ADCA 3DXYA 4OJNA 5F1PA 2BF4A 1AGRA 3QEJA 4WXRA 2BGLA 3QIAA 3S7TA 3C4QA 4CQNA 3BMCA 1A4IA 3I4FA 3H6KA 3QKWA 5K0LA 3WXBA 4X1KB 1MGOA 1J39A 5HIIA 2O1XA 2PGIA 3LL7A 1OLXA 4NYJR 4J3NA 5IUJC 1QFJA 3NR2A 3CU5A 5B53A 2D5BA 4DSAA 2XT6A 3R7NA 2FPUA 1EVQA 3O3OB 3W5IA 3KKEA 3H05A 3TFQA 2BH9A 4LJLA 3UAVA 2R4QA 3COSA 4RHYA 1Q1AA 5MN4A 3EH1A 4UTPA 5A0TA 5EHXA 1L5SA 2P2ZA 2EEPA 2Q9BA 2FN8A 3SX4A 5AVUA 3OTOB 1ST2A 2L19A 3WYDA 4TTJA 1KDZA 4WD3A 1ISIA 2CV2A 3ZVKA 2CNOA 2QZJA 2ZI4A 1SVNA 1U8EA 4IH9A 1K98A 3R9XB 2WWYA 2HMYB 3U44A 1TX4B 3EPPA 1MUUA 3BSWA 3EDQA 3AR5A 3DKIA 4L5YA 2E7ZA 3E1SA 3BREA 1VZ2A 3T94A 2ONYA 3I9MA 2V59A 4W8OA 3LT1A 3GCZA 1A4UA 4NE7A 1RQRA 2Y3IA 4ZCPA 3SEQA 5K01A 4Y2GA 3D2BA 4PO9A 4W1PA 2RCYA 3O3NB 1ZAYA 1JPJA 1R66A 2GNPA 3BXPA 4OPMA 5KU1A 2AG1A 1MB4A 1GUAA 1NU8A 1VKRA 1HE2A 2G88A 3DDSA 3RARA 1X39A 1ZEJA 2J5BA 2RKWA 3GWZA 4N12A 1H9BA 3E7PA 4WN3A 4XOUA 4CRWB 3HYRA 2FN7A 3N6VA 1MRSA 1MJGM 1DQPA 4IFIA 1TK3A 2P35A 1IQPA 2ZJBA 3SYNA 1EM8B 4Q47A 5H68A 2NVOA 2HN9A 1HT2E 4DQ0A 3ZHYA 3BMQA 5BUZA 4JX8A 4LKOA 2HCJB 4RGQA 2PRYA 3A6ZA 1ODLA 3IVXA 1E2FA 1GRQA 2Q5QA 2O0LA 3OECA 1F06A 1FC0A 4IP0A 4JZKA 5EE0A 3NNDA 5B2FA 3KPUA 4I1VA 2A4MA 4Y2PA 4CG1A 2ADMA 4ZZ0A 2CUTA 4NZOA 1I0ZA 4ZPJA 1Z4JA 1UFOA 5FBVB 1D3AA 2YVKA 4E5VA 1Y9DA 4YHBA 2QR5A 4UM8B 5AOCA 2O6LA 2WPDD 3FB4A 3R3HA 4L75A 1LC0A 3VZRA 3KKQA 5FPQA 4TYQA 1Y42X 1PW5A 2LW7A 3F7OA 4ZQCB 4W5OA 1CYDA 2J45A 1PEAA 4CJXA 3FPHA 5LDDC 1NM5C 2IEIA 5DX1A 4GOKA 5FWXA 5JECA 3NT5A 3G0OA 4QX6A 4E5SA 3V8RA 4AFNA 4OFZA 4NNOA 4AROA 4PEVA 4BX3A 2DZDA 1XTUA 1G7RA 1E8NA 2YYYA 4EB0A 2Z8YA 5A5DA 3I9FA 1P74A 3EEOA 2WLTA 3GP3A 4NAUA 4EB8A 2FMHA 2JGLA 2P2SA 3ZCRA 2PD6A 3RU9A 3ZQJA 2ZAMA 3AWDA 3FNHA 4XJXA 5KNLA 2JS7A 1KJZA 3HV0A 5JNSA 4FMPA 3BOSA 1TVEA 4C22A 1SBNE 3WHLA 1U3VA 7MDHA 4RK5A 3D02A 5EE3A 5TNXA 4OHMA 2CFIA 2OKCA 4NF2A 1SUFA 3OOEA 4NFHA 3ZIUA 4RWZA 2IXFA 1T5HX 4Y1RB 5CLLA 5AKXA 2FZ4A 4G0ZA 3COJA 2J0SA 3B2NA 1XNJA 4JD5A 1H5QA 3PD0A 3R1IA 4N6NA 4BJ3A 1VHQA 2XVAA 3D5QA 4O08A 1P5HA 4J2OA 4ZI3A 2V8OA 3FY4A 4ZZ2A 5LXTB 3RFFA 5CA1F 1RXCA 1C8LA 2OMEA 3DPIA 1RAAA 1X3LA 3LNCA 4OHCA 3NV7A 2AD1A 1IY9A 1FBNA 1NULA 3G6WA 3MEQA 2NPFA 2UU9B 2FMUA 1X13A 2X76A 4HAYA 3R5JA 3D8NA 4XCVA 3V2HA 3WWZA 1Y7HA 3W5SA 4RTLA 4AY2A 1IL0A 4OL9A 4GZ6A 3IKLA 3KX2A 4HB3A 2FPGA 2UZIR 3SY8A 2YJ3A 5GMOA 5L6MB 1J2RA 1VKOA 2P3QA 4GM4A 4IZ6A 4NONA 3UKOA 1IVYA 2PZLA 3QU4A 4YA6A 1YCFA 2B2NA 3WAKA 1KMIY 2X9NA 3UV7A 4AD8A 2WIGA 1ZI6A 4M1SA 3CZMA 1GIAA 2VPIA 5AW4A 5IUNC 1R1DA 3R23A 4CCAA 1OTHA 1R0WA 3PE3A 4FFDA 4G5QA 3V8NA 1X7HA 4WA7A 5F2NA 1SC4A 2VH1A 2G70A 1LNQA 2H16A 1Z13A 2IUSA 3JPYA 4HDRB 3EJ6A 5EZYF 3WBKA 4BFYA 1GTJ1 3DQZA 1VP9A 3D8HA 4KLNA 1NVVR 3KALA 3DMYA 2W2NA 2PT5A 5ALJA 2JLQA 5EYPB 4TS3A 1JIJA 4PTZA 3QU5A 3U62A 3TSWA 2C3PA 3ZGZA 1QOZA 2R8PA 3K4HA 4HWPA 3SKYA 1QNFA 1T36A 2CLCX 1ZM3A 1YS6A 4WEOA 2A30A 1Q7EA 3AKDA 4PCAA 4RQTA 2EV9A 3G2LA 4UE6A 5LQSA 3D6TB 4ZEVA 1ZK4A 4BFWA 1BKSB 2WOJA 1E98A 3LHKA 5IYZA 1GRVA 5CBPA 1BVYF 1C9YA 1I1OA 3T1HB 4AZ3B 1P0CA 1HSZA 1JAXA 2ATVA 3O3MB 1XC7A 5J2UB 1F60A 2PUWA 1GPDG 1OKKD 4FR5A 5DHUA 4CU5A 1A97A 5LU8A 2BMWA 2V7BA 4RE6A 5LQMA 5LQRA 2R1VB 1ECCA 1E2EA 1A50B 1HFKA 2EKLA 2JGKA 3KXLA 3L77A 2RHGB 3W79A 1YBAA 1JPVA 1LJUA 4LBYA 5CUQA 1RKBA 3U7EB 5ESXA 4B3GA 1H1TA 3IC5A 3MT9A 4ZVRA 4UHEA 1B14A 5F3DA 3R6DA 2CLHB 5CB4F 4ZOLB 1IG3A 1P9RA 3MMNA 5FTJA 1BCSA 1XU9A 3DO5A 3A3YA 4ZCQA 1MT3A 1W0JA 4X1YA 1LSJA 1P4JA 3QLVA 4PFSA 5H4HA 1PG5A 3DBHA 3T1VA 4OK5A 4G23A 1UDCA 1ZRMA 1JYEA 3RK1A 2C5FA 2HLPA 2HJWA 4TRRA 3MT8A 4BCCA 2QVZX 4MHSA 2Q2WA 4XAQA 3Q98A 2QE7D 1O5TA 2QQGA 3BJMA 2UVQA 4LE1A 4WLUA 4B5KA 1TD1A 4IRXA 5LZ9A 4PZ9A 4ARAA 4RVDA 3LGAA 4MR7B 1NBME 3UFXB 5DK6A 4G63A 5CEFA 5BYBA 1U3WA 1SQ6A 3U6KA 1EK2A 3FDJA 1EFCA 4PQRA 2WWHA 3GH1A 2XNSA 3IV9A 1W6UA 3L7BA 4IQ0A 1F12A 2C4NA 2V9PA 3A05A 3K2QA 4RADA 4J4HA 1MH1A 1WTCA 1TAUA 1NVDA 3DO8A 3T7KA 4ATNA 3RSCA 1JX6A 5C5IA 3K09A 3L7JA 1NI4B 2HSDA 4JR0A 3VDMA 4Z7JA 2GUWA 4LGVA 1WY5A 4OI2A 4XRRA 3MGCA 4QXRA 4MS1A 3DEAA 3REQA 4JKYA 4Q12A 5BW8A 5HPYB 1VDZA 3UF0A 1W4CA 3DC2A 4IDDA 4WIAA 2CVZA 2V6JA 2GGSA 5D5PA 2HLDD 2GOYA 1UANA 1YXMA 1HM5A 1EVYA 2F9LA 2JZCA 3L93A 2BI4A 2Q21A 3VI4B 4I0WB 3DMHA 4YXFA 3NBZC 3S5UA 3MJTA 4YALA 3G0BA 3RABA 1JKFA 3BFKA 3BYZA 2WFZA 4F60A 1BXRA 1ZNXA 4UASA 4BAUA 4RS4A 3TLEA 4Z5XA 4RDXA 3LO5A 5CLIA 3RYFA 5C5CA 3EIEA 1KORA 3H2KA 1PL0A 2C8VA 3NHJA 5CBKA 5K0GA 1SXJE 4HFNA 5DM60 3HO1A 1H94A 3G02A 4BHTA 2Q8PA 2HSWA 2XMGA 2MCFA 3MBIA 3GOHA 3EAQA 2HM7A 1YFJA 2B4RO 5BV1A 2YWHA 4PHGA 3IVRA 4JT4A 2YY7A 3WLAA 3GEMA 1XDUA 3W6UA 4R8SA 3LCJA 5AK5A 1NBIA 1D6NA 1L3CA 4TKVB 1VMKA 1UKZA 3K0BA 3K9QO 3OX3A 3HHEA 4OAOA 5L40A 1SFRA 4I4CA 3EXIB 1NLMA 1Z3CA 2ZB2A 3S68A 3OC0A 4HLDA 1VKNA 5J2UA 1N2HA 1OAKA 1TQDA 3HKCB 2YV2A 4QIHA 4YXWA 1E2UA 1PCXA 3I9JA 3VR4A 1JQKA 2X1LA 1ONNA 1PQWA 1Z4MA 3GGSA 4DLLA 1FXWF 3V4RA 4KNYA 3PUHA 4H0FA 1M0WA 3A1FA 3ZHBA 4ZGWA 3LOUA 1FFXA 3KPJA 5C4IA 5DGIA 4ZYYA 3P1JA 3FZQA 4GXRA 4GBGA 5BV7A 3GLGB 1K2VN 3Q5DA 4BBPA 4CKBB 5IT0A 3Q9SA 2G8NA 2C7PA 3EE6A 4JKIA 4C4TA 1RIIA 4BNIA 4F91B 4QWMA 1Y3HA 3D7KA 1HEYA 1SJ9A 1X92A 2YWJA 3SR4A 5IPFA 5DJ5A 1V71A 3MFYA 3NDRA 4LNUB 4N7BA 1YULA 4QLOA 2O19A 1N5IA 1JJ7A 3QVTA 5AWFC 2RK6A 1K88A 1E1CB 3EVDA 2AX3A 3I37X 3SLGA 2XCRB 4BRSA 2PH5A 2Y8EA 3UXEA 2GVZC 1YQQA 4UARA 1RMQA 2G1KA 5CXXA 2GVNA 4DA8A 2HKIA 3G1UA 4V0RA 2V7QA 2YHIA 1IWPB 1G6KA 2IHNA 5L51A 4P53A 4ENSA 4MICA 5KS2A 5KTRA 1CEEA 1OH5A 1SMKA 1S3FA 1H3NA 2ZUFA 1U04A 4MVWA 2WZCA 2VYQA 3MT0A 4QUJA 3KQNA 3JYNA 3DMRA 4OFBA 2BCGY 3EWNA 5HUJA 2UZ3A 1W1WA 1VIDA 4UAGA 2ECQA 4WOKA 8GPBA 2C7VA 2RH4A 2OILA 4WDRA 4OP1A 4MUXA 2JGMA 5BW5A 2YQZA 3VR2D 1YTUA 2ZLBA 2BIFA 3HY6A 1OZ0A 4EA9A 5KJ1A 1GFZA 2GA8A 5PGMA 3D2CA 4LJAA 2P78A 2MR6A 1NQWA 1T26A 5FB3A 1YA6A 5FO1A 1D2MA 5FF9A 2PQ2A 3PFBA 4I5EA 4BWFB 2ECPA 4LRWA 4BJ6A 5KNBH 4BFCA 1KQNA 2N47A 1YOVA 4MX8A 1H8EA 2C2BA 4URFA 4CPDA 4R2LA 2BM1A 1UOQA 3C70A 4EY7A 1IRIA 1SCAA 1KGSA 1NZJA 3RIMA 4TV9B 1V2GA 1VI5A 4LY6A 3OF5A 1IWBB 3E9EA 4HBGA 2UVPA 1QM5A 2WTXA 2IYLD 4OSEA 1OH6A 4MIKA 2PZ8A 2XR1A 3FIUA 1UT6A 1A5SB 2ECOA 4UZSA 2PCLA 1VGRA 1S01A 4DABA 2NP6A 4RCZA 1H23A 3L1IA 4XFDA 5F2KA 4G2NA 2W2OA 1O57A 3RHSA 4B4KA 2C7GA 2FDRA 4MGIR 1SQ0A 1UWLA 1E79D 3NCTA 2W2LD 3DEIA 3G8YA 2RHLA 3C24A 3ELDA 3L02A 3E8XA 5CYOA 5AKJA 4CM9D 2SHKA 1EFTA 3FMVA 4DYDA 2IL1A 3AB8A 3DQPA 3NC0C 4BFSA 3BAFA 1N5KA 3BIFA 3OZWA 5CX1A 2W2TA 4LIPD 3W9BA 4ASUD 1TU4A 1GLNA 1FFAA 1JYFA 2VHCA 1YJQA 3NQ41 1G6Q1 1BWSA 4MVJH 1CP2A 4RFSA 2HL6A 3FGOA 2H1HA 4NBUA 4PCVA 2GS9A 3PL1A 4ZHQF 4WCVA 1Q0QA 1CUGA 4UHBA 4M38A 2PXCA 1KMCA 4LXYA 2V65A 3MRSA 1LRLA 4A2QA 4CLRA 1LBIA 1FRQA 4B6PA 4DLRA 3ZHVA 1VG8A 1F8FA 4CUJA 4Z4CA 1PUIA 3S55A 4C06A 2HHCA 3DDWA 2F8LA 1UK7A 3WFJA 2W71A 4ECAA 7GPBA 4IG9A 3UC9A 1P5JA 2WHPA 3O2SB 4I9HA 5AICA 2Q41A 4U9IS 4CMIB 3O84A 5E6RB 2WJWA 3LLUA 2F1RA 3L0BA 4RHCA 4B74A 3REQB 1Y4UA 1NR5A 4FDLA 4E46A 3NIWA 1XVTA 3HNOA 4RYLA 3FIJA 2VJAA 4H18A 4ETWA 5E2IA 3QIVA 5BP7A 3AVYA 1TYAE 1PZMA 1T1IA 4NK4A 3WGYA 4YWJA 1HZZA 2F9MA 2Z8XA 4LVCA 2PJRA 1J2UA 3OPMA 5I7EA 2OCLA 3PEFA 4AJKA 3AIMA 1RWMA 2Q6OA 2VF4X 3B3AA 3DNMA 3CLTC 2W6NA 4TMWA 4XTRA 1R0XA 1ZGHA 1YS9A 2PKYX 4I5DA 4YJ2A 1GLGA 5EKTA 1JDPA 3ZDBA 2ZE6A 1JE0A 4C6RA 3WGIA 2D2IA 4FINA 4QDOA 4TL6A 2FPKA 3E15A 4M0UA 4X93A 2EF1A 3ZZUA 3M7IA 3U44B 4ZCLA 1XJCA 3AFGA 4Q4HA 1CUAA 3CMMA 4TMZA 4UNIA 3UXHA 4BKQA 1QVVA 1U2DC 3QKTA 1B8VA 3FGZA 3RM3A 5CDSA 4X1YB 2YHSA 5AKKA 3MQ4A 5D6OA 4GPZA 4UOQA 4AZ3A 5BR4A 5CFLA 4H7EA 3AH8A 5M7EA 1AQYA 1RHRA 2BKAA 4QOEA 2PUGA 1GILA 2GXSA 1OWPA 1SIOA 2WSIA 3DEZA 3G68A 3RS4A 1IAQA 4I6JA 2C58A 1HURA 3OE4A 3ZGNA 3SLKA 4B3XA 4FHCA 2C29D 1NMYA 3FWNA 3OH8A 1R27A 3F8TA 2X3FA 3RK4A 3HN7A 4QYWA 2Y9PB 2QLTA 6AT1A 3WL3A 3GUVA 2QBYA 5K3CA 3NUGA 4JLSA 2R7AA 2FFJA 1KC1A 1V8FA 3VZDA 2IBSA 1YGPA 3DW3X 3LPLA 1FFYA 4ZVLA 3WK9A 1Q95A 2QI9C 3I32A 2HYIC 1XCOA 5FFNA 3PD1A 5WRFA 3BRWD 3H7AA 5FNVA 1G1MA 3QELA 5IAAA 3KKMA 4FOSA 4NEGA 1ZCBA 1PWEA 5SY9A 4GG1A 3FFBA 2O50A 4KN6A 1DKRA 1NOIA 3OM9A 4FEAA 4RD2A 4BQOA 5B6IA 3SHWA 1G42A 4BBAA 4M53A 1EFDN 4EG7A 2GPJA 3NTXA 2OAGA 4B46A 1NN5A 2B9VA 3ZE2B 1C0EA 1CU1A 3KDAA 2B5VA 2H3EA 3LXXA 3I0MA 3A28A 3NHUA 4WCFC 4YRCA 2QAIA 1L7QA 4DB4A 2QRNA 1PJRA 2CMGA 4QQNA 3W5CA 5CA1B 4KDCA 2DRIA 3KB8A 2ZVPX 1EX6A 3PXEA 3KB1A 5B1DA 3HBMA 2QX7A 2XKJE 3QY0A 4N49A 3AHCA 3F7MA 1AS0A 5HK9A 2ZJAA 5FH9A 2RHJA 4CEJA 3TXAA 1ICIA 1QKIA 5HQTA 3UUFA 1E59A 3EASA 4IM7A 1PR5A 1VJCA 4X7BA 4XJSA 1DWQA 4XLZA 1UC4B 2X6TA 3DTYA 2ZJ4A 4RELA 4H6WA 3QJ5A 5CM9C 3UJAA 2BKEA 4ENVA 4ID9A 3PSAA 3TB4A 4N40A 5CR9A 4CIDA 4YCCA 4LJKA 2UUOA 4DZZA 4YMTA 1UFRA 2WSMA 2OCIA 2HWUA 3QE2A 5AUNB 3WOHA 2HUPA 4KIGA 1UM8A 4JR1A 4WKCA 2JH9A 4M88A 4ACAA 4S05A 3EXG1 1KI4A 3FYTA 5L6LB 2WJVA 3NH9A 4HZGA 3KK0A 2B34A 2BSXA 2FEXA 4GLJA 4FTWA 5B2EA 1RLOA 1T5IA 1TU3A 3WAGA 4EG0A 2EJTA 2XVMA 4Y2YA 4LGMA 1WOYA 4ZV7A 4WLFA 1TCUA 5E4JA 4Q7QA 5FJJA 2ZETA 3MNFA 3TUJC 3TFOA 3N2GB 2GNAA 2E82A 1PVVA 1E7MA 1CP3A 1E2KA 1Z4KA 3M6LA 4WZZA 1U2DA 2OT3B 2WWGA 2P4HX 1JLLB 1ZICA 2MYTA 5DIFA 4V1CA 2UUCB 5FWXB 2P6RA 2GHTA 4AO8A 1YZ3A 4DB2A 2AEFA 2K2QB 4P0QB 1GGMA 4NY1A 3BGWA 5CB4A 2MHCA 5HA5A 5DV9A 3E7FA 2HPZA 2D06A 1A9XB 1LZKA 2ZBRA 3E3LA 1F2VA 3DE6X 3OHMA 2PSFA 4U3JB 2BFBB 3QENA 1SVWA 1SVKA 4E13A 3UENA 4HC4A 3MTIA 1M9NA 2NU9A 4EHDA 2C2ZA 5JSKA 4H3VA 5EQFA 3VSBA 3NPAA 4AWXA 3RBVA 4C0BA 2Y4OA 2OHGA 5FBQB 3B36A 1D2NA 1W93A 2JGAA 3I6YA 4A73A 3DMGA 3BWEA 3ADKA 1CD5A 1FDVA 2NXJA 2SKDA 1FYVA 3BKWA 4PSCA 3RUIA 5JBIA 1ATIA 1KHHA 1C7RA 1QZ3A 2I2WA 1GZ3A 1OIVA 2WYHA 4D9NA 2WU1A 4MRAA 3I6QA 1WMDA 5G4KA 3HCDA 2ZYIA 3ZH2A 3TCNA 3TGLA 1D1PA 3DE4X 5HCIA 3ZW9A 4G24A 1JI0A 3RWBA 4KGZA 3ENQA 5CFNA 1O97D 4MW1A 2RJOA 3JYPA 4GPD1 2CNNA 1RPJA 1YD7A 3DFMA 1E2DA 4U1RA 1CJBA 1EFLA 3JWHA 4U8GA 5ER9A 1AKUA 5LM3A 2QW1A 2VIIA 4DR1B 4CHGA 4EKEA 1WEKA 2X0FA 4GMGA 3IBYA 1DIHA 3COWA 1KWKA 5BMOA 2DKNA 2HK8A 2I6TA 2R7MA 1SOVA 1AMUA 1XZ8A 1LC3A 5C32A 4QOFA 4BRUA 7YASA 4R1SA 2AJLI 1EINA 3GFBA 1GNQA 2A67A 1IM2A 1WU7A 2Y2UA 2YINC 1C3OB 1ILEA 1J0AA 1J0EA 5K0TA 1NJ5A 1KSGA 5BOVA 5KPDA 2W98A 4WECA 3WKEA 3AHFA 2IA5A 2GNOA 3BZBA 3T7SA 1MFPA 4FJ1A 4HKTA 4LUCA 1ZHHA 1KI6B 3GJ0A 3G49A 4AZTA 1TC2A 3WWEA 3M6XA 4EI8A 2CHUA 1AM4D 4UM9D 4RA9A 3HO8A 1JE1A 1VCIA 4HZUA 2MSKA 3KOMA 3L1KA 1S3GA 5BSMA 1OQAA 3Q7EA 5CXUA 3HDTA 4O1MA 3NAQA 4FQ5A 5E6UA 2X5KO 1DBWA 1XCGB 4AG3A 5ICEA 1WV0A 2VQFB 2XDQA 4PZPA 5JSFA 1UJ2A 4AP5A 3DAPA 3W2EA 1TUEA 1YDFA 4KQMA 4BC1A 2Q50A 4F45A 3U4QA 1ZIOA 1I4EB 3OUZA 2DHCA 2LR0A 2W00A 1ZXBA 4H7IA 4Q34A 3QVOA 2ZUEA 5AHXA 3O38A 1GDDA 2IODA 4WA8A 4D56A 1G63A 3ZW8A 4E4YA 1Z39A 1QLJA 1E58A 2WUGA 4CGYA 4D43A 2GXQA 2OCPA 2V98A 1W30A 3I58A 2PKQO 1U2RA 3JRWA 3P94A 2V4UA 2IU0A 5JS1A 3E81A 4OMCA 2B92A 4N0DA 1QRRA 4PHCA 3ICCA 4IAOA 4RGBA 5LDGA 3WL4A 4DMHA 2O5EA 3ZU2A 3CWCA 3F73A 2O8CA 1XALA 2Q1YA 1UAYA 5LNK1 5AJTA 1IOVA 1QCYA 2XKAA 4WMLA 3CUUA 5A05A 1M1NA 3B70A 5JFTA 1OXKB 5DEIA 3S5JA 4ZEWA 5E9AA 1FS5A 2GWHA 1P33A 1TJNA 4F11A 5JNTA 5AH0A 4R3UC 3RU3A 5FT9A 1GPNA 3H11A 3WADA 2HCRA 3HKCA 5HRUA 1DGQA 1EE9A 2X13A 3KSDO 3K0HA 5EN4A 5FWYB 2HHLA 5K3FB 2BFPA 4CT0A 3LNTA 1BU5A 1RAHA 3QPDA 3TW8A 1M10A 2HDWA 1R12A 3MQFA 2C82A 4OGWA 3A9CA 2PPVA 2Q4DA 1Q0HA 2VHQA 4KMRA 3AZOA 1CZUA 4URZR 3VGPA 3VDXA 1H0HA 3GFGA 2BEWA 3DPSA 1F0PA 3NBKA 2QRHA 3KUXA 4YRTA 4RM2A 4IZHA 4L5AA 5AXCA 2Y66A 1GPKA 1H9CA 5H70A 4JGBA 1TTPB 3TQRA 1EFKA 4B7AA 3AG5A 4QU9A 1GWNA 1QB8A 2BT4A 3ACDA 4EW6A 4DANA 4KYTA 1E0DA 1BD3A 2GI4A 4HEA6 4ZQBA 3OTQA 1N33B 2XX3A 1HFEL 3U37A 3UJHA 3DG9A 4IV0A 3VU0A 5DCYA 2HRQA 4KE8A 3P0IA 4Q4HB 4XASA 5CCEA 4FHZA 2I2AA 4OXRA 3I12A 3MTAA 3UVEA 3BF7A 3CLSC 4HAXA 1FSSA 3RRNA 1FVHA 1EFAA 1QHHB 3IE2A 1KQGA 3T7TA 1C8VB 3FOZA 3PQCA 1IM5A 1MIOA 4KYUA 2XUAA 4IMPA 5KJEA 2QTBA 3M4YA 5HF5A 2C9BA 1Y3DE 2VHEA 3C1UA 3DE5X 3OJCA 3RBZA 3RO7A 1RHQA 2ZJ7A 1ACMA 5IEBA 2RAVA 4NU6A 3TW8B 1Z06A 3HRKA 3UG7A 1OBVA 2KM1A 3NNSA 3R6LA 2VKQA 1JHMA 2R8RA 4LY3A 1T1RA 1EM6A 1N75A 1DO0A 1Y1SA 3FJ1A 3QBJA 4TZKA 1SCJA 3TD9A 4J1NA 3LLSA 2FPGB 3TEFA 3D4PA 3FSGA 5AW3A 2IU6A 4IIEA 1I5RA 1UDRA 2YFKA 4YDQA 1O6CA 5A9SB 2HNKA 4P5EA 2RD2A 1S5PA 5JNLA 4EG1A 3RCBA 4CM4B 5AW7A 3C15C 1O08A 1Q12A 1CLUA 2B35A 1HV8A 4P2GA 1NSTA 2W2XA 2WB4A 3CC8A 2H7CA 4YAWA 3VPBA 2PD3A 4OATA 4DJEC 1K6EA 4LMBA 1D9ZA 2NVWA 3N76A 5TDHA 4EKIA 3I45A 4I4TF 5EJEA 3JR3A 2PGDA 1VCNA 3HDJA 4FZ3A 3EF0A 3M8KA 4AXBA 1BA3A 1B0PA 3B1FA 3A7EA 3H8SA 1XNQB 1M72A 3AFHA 2IYAA 4HGQA 1QKJA 3QV2A 5CA1A 3B1ZA 4ZPXA 5A02A 1AA6A 2OVBA 3QVGB 3FOBA 3U61B 3PFNA 3GUCA 3DTVB 3U13A 2VJBA 2QVYX 3PWKA 5FA5A 1LVHA 4D96A 4DGSA 2JGRA 3LDFA 4Q18A 4TLMB 4C29A 3BXFA 3MWEB 2GEUA 5JUWA 3NFYA 1Z4LA 3FMPB 2PBRA 3A2NA 4BFZA 4WKPA 2G5TA 2VRCD 4IJVA 3R20A 4D45A 3EDMA 1U02A 4HDQB 2BM0A 4KZPA 2O5CA 3WLNA 2HQ1A 4HNGA 1UJCA 4DEXA 5I9LA 3TXYA 3ADCA 2I7XA 2XXJA 3R8XA 4OHOA 3BMCB 3KYDB 1SU7A 4JVSB 3ZTYA 5CB4B 1KARA 5I5GA 3H0KA 4BAZA 3K6JA 3HR7A 4XVCA 4MPRA 3RGWS 2UYQA 2MR5A 3I9V6 1CZLA 3KO8A 3P0JA 2GK7A 2D0PB 4CG3A 3T9BA 4QG7A 1P1BA 4HYTA 4OXQA 2UUAB 3LRXA 1A7AA 3QG5A 4M1YA 4WCDA 4FDUA 5AVXA 3EVCA 5JS7A 2BDEA 2CFOA 3A7DA 3GEPA 4KGXA 4ARUA 5DYGA 4CQJA 2CNLA 4F8EA 2ZU0C 5EHIA 4BLPA 3F6RA 3RSOA 1MT0A 4QARA 2C8JA 4R8LA 1RHKA 5TS2A 3PYXA 4M0EA 4YUZA 4CW7A 4LOIA 2CHGA 3TUZC 4DNXA 1XDGA 1KK0A 4MQFB 4XXHA 4FOPA 2HYDA 1UKEA 4J16C 3EHDA 4MEBA 4EMSA 4B34A 2P9ZA 2GQ0A 2FSPA 3FSEA 4JSTA 5AI6A 4TV9A 3MLBA 4LYFA 4RXUA 4QA9A 5DULA 3RC7A 3FNRA 4Q3NA 1FFBA 3VR3A 3AR6A 1G2QA 3LPDA 1EX1A 4C6TA 1YV9A 3LSTA 4MR9B 4IJWA 1O4WA 2ZULA 3W2HA 1BJRE 3FFAA 3DL7A 3OFND 1XEWX 4EEXA 2R65A 2HXGA 2YQ5A 4Y7CA 4X92A 1LNZA 3T7IA 2AJ8A 4S3MA 3BGSA 3AFMA 3ASYA 521PA 1MRZA 2FW8A 3AR8A 3DV2A 2CLLB 5CGZA 4AMGA 2YRWA 3G9ZA 1RXYA 3NKFA 5HTKA 4BIMA 1EUYA 1K7FB 1U8YA 3H7IA 5C80A 1MA3A 4PZZA 3EXHA 1Z0IA 2R87A 1PF7E 4TZTA 4LZZA 1E0AA 5DCWA 1DAFA 1JTFA 5DBFA 5EHGA 3DMTA 3HWWA 1NN3A 1WV1A 2D2VA 2V6FA 3CUVA 5JE8A 3TW6A 4EHKA 1U63A 5AFSA 1UXOA 5DWQA 2EFHB 3ENVA 4BLVA 4CMKA 4RZ3A 4EHFA 3FKSD 3KR9A 5JY6A 2D74A 1NW5A 3BMOA 2IDMA 4BX0A 1SWWA 2JD0A 3UT6A 3MCAA 1O6ZA 2YHBA 3DUFB 1CUHA 1G18A 3PHLA 4TTSA 1OREA 1ORRA 4ZTUB 2JNWA 4D8TA 3EDCA 1W1UA 2CGEA 4DLUA 5CVCA 1DT3A 4F8JA 1NUTA 2FN9A 4YJ2F 5ARDA 3P5BA 4ZO4A 3JWGA 4C4OA 2HCTA 2BE9A 1UEXC 3LX8A 4RJKA 5C8VA 2PU7A 1L7RA 2VHUA 3VKGA 4KVAA 4DOMA 3KPVA 3QPWA 3KJHA 4ZDKA 4OIMA 2G5GX 2R2GA 4RPIA 4ES6A 3D6UA 3EZYA 1J56A 1TO1E 1Z0DA 5KJFA 3GLGE 1RRGA 4E1VA 1FTQA 2HIAA 4GEGA 1SHUX 5D51S 4EIWA 4WADA 3R3YA 2QN2A 4IFBA 2EKBA 2XZTA 1OI2A 4YJ2B 1RYBA 5CAEB 4CXMA 1EWVA 2CEAA 1XF1A 1SC1A 4ZAYA 3KPYA 2VDWB 3NTUA 1FJHA 1O94D 3TZLA 1CDEA 4BVAA 3M6UA 4JK3A 3K15A 1BSVA 3OF2A 4FIZA 1A8IA 4L9RA 4RD0A 1XAGA 4WXHA 2P90A 1Z7GA 3JZFA 3MW8A 4GGMX 3IUBA 4AJPA 3RYIB 4CIXA 4XLLA 3MCZA 4I50B 2ZWVA 1SBTA 3GFFA 4PGGA 4QYSA 1C7IA 1F17A 1GZSA 1TFUA 3FRIA 4WNAB 1M8GA 2ACEA 2RAUA 4PNEA 2IEYA 4G0VA 3QVKA 4FYJA 3PBKA 3M2TA 4MUJA 1K3TA 2A9PA 3D8UA 4M55A 5DKFA 3BL6A 5IMBA 5J4YA 1PK8A 2CSXA 4W1SA 2NMVA 3MD9A 3THXB 4HAZA 1DAEA 1WHSB 2B98A 4HB0A 2NU9B 2IXTA 3QW4B 3ZEIA 2FHSA 3ORQA 5KYYB 4Q02A 3AW9A 4LDZA 4D44A 1QGZA 4HAUA 4JB2A 4G5FA 4MV3A 2PRJA 3H5LA 2AW3A 3PI6A 3TPCA 3ACBA 3OE1A 4TUYA 3VSAA 3VFDA 3TAXA 4M1WA 3F8WA 2XCSB 1ZIYA 4MKGA 4Q03A 1MB0A 1QVWA 4OQZA 2Q4RA 4BN5A 2IPAB 2ZBVA 2JFWA 5DHFA 4MUKA 3UMVA 1UFVA 4EVSA 4IQ4A 5BPHA 5EXTA 1NNSA 3AUAA 3UAGA 3RSLA 5CG1A 1NKVA 2CC2A 4V0QA 5KYNA 1I9GA 3KSAC 4KMMA 5B4UA 2Q8QA 3BIJA 3TZEA 1IZ9A 4KU4A 2QP3A 3N7UA 1O9GA 3EZGA 3GAZA 13PKA 3CUWA 3HL4A 4TKUA 3FJYA 1I94B 1SEVA 1XZJA 4OB7A 1GP2A 1OTYA 2YJZA 4UM7A 5DGDA 4ARBA 1Q3HA 2IE0A 4BWYA 2NTJA 1FTWA 1GAQA 1H9AA 2J1LA 2QAGC 4MWBA 1SG9A 4XX0A 4C30A 1XYVA 2BZ0A 4NFSA 3A6HA 3KOUA 4KLAA 2QPAA 4MS3B 4ZOLF 3T1TA 1DU4A 1MKYA 4CFZA 1J70A 4MIEA 2X0NA 1P6XA 3IUQA 1ISFA 4V38A 3WICA 3WV4A 4IEFB 3ELUA 3ZWBA 2GHQA 3AGPA 3DT6A 4KUHA 1KVTA 3NIGB 3TPFA 4OVKA 1PN3A 1POWA 1AHNA 3MSXA 4M21A 5DBEX 3T12A 3MRTA 4FS3A 3LQFA 2AL7A 4K6KA 2H4FA 4V02A 5HFAA 3FYUB 2QAGB 3LSYA 2FP4A 2GXAA 4TS1A 1LS1A 3OSZA 4D9JA 2HIMA 3HBAA 4CLDA 5KQMA 4IICA 1XNHA 3N8DA 1H2XA 1UC5B 1QP8A 2DFKB 4BEVA 3PDIA 3IT3A 4MK4A 2YZKA 3USES 3JD4A 1SD2A 5BT9A 3NTQA 3DVSX 4Y0NA 5JZSA 2X4IA 2A59A 3PIRA 3FWKA 3HSSA 5E7IA 3ZLVA 5HM6A 2XT0A 3BTSA 4KO1S 1XPOA 3ZCXA 1DARA 1E2QA 2EFEB 2HK9A 3ROZA 2YZ7A 3LUGA 1J90A 5GGYA 1QX4A 1T3HA 1E7WA 4JXKA 4PBSA 4QODA 3RG2A 4OHYA 2WHXA 3E48A 2JBWA 1E62A 3A1DA 3JASA 4YIKA 4RTOA 3MRXA 2OK8A 3SF8A 4CT4B 1CTQA 2OHVA 4EW3A 2ODWA 3G13A 1V6SA 3K0FA 4XX0B 5CLHA 3TD6A 2P9HA 5EZYB 3UK7A 4CHTA 2QVLA 1ZD8A 4ZAFA 2HREA 5JI2E 5LMZA 1NBAA 2VF8A 1FF9A 5DHSA 3RS8A 1C7EA 4H6PA 1FMLA 1MO3A 4NJEB 1EYZA 3A9RA 3HU2A 4FFPA 1GITA 4J0CA 5K3OA 4B3SB 5IBRA 4FD2A 5BSWA 2I6GA 1G8GA 1G3RA 1W2GA 1OV4A 1JLMA 3QVVA 3A9UA 2VDJA 2F3QA 1FXWA 1KFKB 2JATA 2YCBA 3D8BA 1L3IA 4N0MA 4IIUA 1Z7EA 3PPXA 4JODA 2ADOA 3HVIA 1HDOA 1K6XA 2FP3A 3SU8A 1F0KA 4FMBB 1VG0B 2QL9A 2QX9A 3KYJB 5FLKA 1MQSA 3S2GA 1QK5A 1FUUA 3O4RA 2ZXUA 4CN8A 2JD1A 3DHEA 2JCBA 3N05A 4D1YA 3N74A 4HDMA 2IYVA 4ZREA 1IN8A 4I99A 3ABRB 1YL7A 4S12A 1GPYA 1TADA 3OWXA 2ATIA 2ODBA 2J3MA 3DONA 3FETA 2IX3A 4Y6GB 3B9RA 4GX5A 4MYCA 4B33A 2JLXA 3V8EA 2AG6A 3A9VA 4KN9S 1VRWA 1E79A 2VSYA 3CNEA 5H1YA 3PYMA 2C3MA 1MW9X 1P7ZA 1TEXA 2D2XA 5IBPA 2GBGA 2V97A 4C7KA 4WESB 4B6GA 2IOFK 1S02A 2QIPA 3U4DA 2ZJ6A 3T4PA 4KQIA 4XFKA 3DLHA 5JANA 1KAGA 2H11A 3GGGA 4UD2A 4F1JA 5GJWC 1VP3A 2WV7A 1OKKA 2FSVA 2E87A 5ALVA 3C85A 2V0CA 3O9ZA 2D54A 2PNFA 2YFHA 3OX4A 1O2DA 3QVSA 3LUFA 5I7SA 3SJCA 5EWMB 2VQDA 1WKBA 3KQHA 2AMYA 3EGEA 1HETA 1PR6A 5CFZA 1COWA 1E0SA 1TO6A 2CVFA 1JMKC 4F38A 4HDMB 1JSCA 1RPAA 4WN9B 5F7XA 5JLJA 2CDAA 1GSAA 2EYQA 1OGJA 1YFLA 1KYTA 4EX7A 4GYKA 3O5AA 1XXHA 3OT1A 4I2NA 4IDNA 3FNBA 3UQZA 1GTMA 3Q3VA 2WU8A 1GNLA 4CV3A 5BSFA 3OLYA 1GNSA 1G8JA 4EL5A