2A4MA

Structure of trprs ii bound to atp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
331
structure length
331
Chain Sequence
b'ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase II
publication title Structures of Tryptophanyl-tRNA Synthetase II from Deinococcus radiodurans Bound to ATP and Tryptophan: Insight into subunit cooperativity and domain motions linked to catalysis
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
total genus 111
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2a4mA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a4mA01
4KPUA 1JEDA 3IODA 1M83A 1NP7A 4F3RA 2ZP1A 3H97A 4YP7A 1H3EA 2Z3VA 1RQGA 3P0JA 3U1VA 1WY5A 2R5WA 1O94D 2CUZA 1X8XA 1T6XA 1IFXA 1MAWA 1U3CA 2J4DA 2A1TR 5KHAA 4MW6A 4OUDA 2IJGX 1O96A 2NZ2A 4U63A 3SYTA 2PFSA 1J09A 3FETA 1H1TA 4PY2A 2WB2A 3X1MA 1OWLA 1VBKA 1Y42X 3UK2A 1PFVA 2VTBA 2DETA 1LI7A 4MUFA 4MW4A 1IQ0A 5H16A 3CLUD 2A4MA 1EFPB 1QQTA 1R6XA 1WXGA 2EJCA 1XNJA 5F23A 1K4MA 2GM3A 3MLAA 1M8JA 1MRZA 2CV2A 2OQ2A 3OP1A 5K0SA 3FIUA 3KT3A 1IH8A 2AZXA 1JILA 1UFVA 1ILEA 1GAXA 4JFAA 3IMEA 3IMCA 4MVYA 3GLVA 1N75A 4I6EA 4EG3A 1X6VA 4DLPA 1M8PA 3PRHA 4QRDA 3ZGZA 4EFKA 2G36A 4TS1A 4ZCRA 1U3DA 1LI5A 4FZJA 1ZUNA 3RFFA 2QUKA 4MULA 1WQ3A 4MW5A 3COYA 2GKSA 1CT9A 4MWCA 3TZLA 4EG6A 3H99A 4EG4A 1O0BA 1WQ4A 1MBZA 2A1UA 3F3MA 1U7DA 1ZH6A 3PNVA 1NURA 4MWBA 3N2YA 4PBRA 4EGAA 1TYBE 4CDMA 2CYAA 2YWBA 3MMXA 2CYBA 3FNRA 5BNZA 2QUHA 3AG5A 1F7UA 4KR9A 4OJMX 5TEVA 4AS1A 4L2IB 3DV2A 4XSVA 5HG0A 2Z08A 4MVXA 2JA2A 1F4LA 1KAMA 1MAUA 1QJCA 2H29A 1EUQA 1NI5A 1N2OA 3ELBA 2H2AA 3CA8A 2BTEA 1EFVB 3ZXIA 4NX2A 1IQRA 3HL4A 3FHJA 1K97A 4MW7A 5DEOA 1R6UA 1T6ZA 1KP2A 1O97C 1YIAA 1B6TA 4EG5A 4MW2A 5DB4A 5HUJA 3IUBA 1EUYA 3CLRC 4DDKA 1VBNA 2V0CA 1M1ZA 2X0KA 2A88A 1ZJWA 4MUKA 4HPWA 4MWDA 3NV7A 1EE1A 4MUGA 1WXIA 1TYDE 1NSYA 1PFUA 3HZRA 3A4IA 1MJHA 4NDAA 5TGTA 1EXDA 1OWPA 2PZAA 3HMQA 2X1MA 3CVWA 2QJTA 1YUMA 3FWKA 3NBAA 3L93A 1N3LA 3VGJA 4MUJA 5KWVA 4ZCQA 3UOWA 2AG6A 1GZUA 3DLAA 3CLSC 1KORA 4CQNA 1J21A 1MC1A 4HJRA 2GOYA 2PG3A 3H9CA 3FI0A 2HMAA 1DNPA 3Q4GA 1NUSA 4KKVA 5TS2A 4BWVA 4EF6A 4ZT2A 1A8HA 1FFYA 3ZXSA 2WQ6A 3Q12A 5KCMA 3CVVA 1SURA 2WQ7A 2A86A 4ZCSA 2VXOA 1JMVA 2E18A 3AG6A 4PBTA 2QUIA 4GU5A 1T6YA 4K03A 3TZEA 2J08A 2WSIA 1O94C 3N8HA 2JAXA 1TYCA 3GUZA 4ZT4A 1NUUA 1YIDA 1JECA 1F9AA 3AFHA 3CLTD 4ARIA 1M8GA 1NUQA 3COZA 1N2GA 2C5SA 2XRZA 3IDFA 1IHOA 1IQUA 3A2KA 3KT8A 1N77A 3FY4A 3P0HA 1M8KA 1WZ2A 1R6TA 4PBSA 4ND7A 1TQ8A 1P7PA 1YULA 1FYDA 1EJ2A 2TS1A 1T9GS 3GMIA 3AKZA 3HV0A 3FH0A 3N9IA 3ILVA 3MUEA 3RBAA 1ZH0A 2DR2A 5J58A 4YBRA 4DJAA 4YP6A 1IRXA 4MQ6A 1Q19A 2NSYA 2OV4A 5LLTA 1KQNA 4JXXA 1O6BA 3KT0A 1JEEA 1O95D 1VL2A 1O0CA 4MVWA 1H3NA 1F7VA 3VU8A 2DEUA 2QTRA 3P0IA 3OTWA 3ND5A 2A7XA 3IOCA 1MOPA 4HK4A 4HJXA 1Q15A 3C8ZA 4R0NA 3RHSA 3IVCA 2E21A 1XJQA 1G59A 5IJXA 3LE8A 4MW0A 2A1TS 3Q10A 2DLCX 1IVSA 2E89A 2J09A 3H9BA 1N1DA 1QRSA 2CFOA 3FDXA 1JZSA 4MUEA 2D5BA 3LOQA 3G6KA 1MB2A 4NAHA 3IOEA 2DXIA 3G5AA 4WNYA 1N2IA 1XNGA 1QRTA 1GN8A 1N2HA 1XNHA 4DNXA 4Q93A 4A91A 1HYBA 3PXUA 2RE8A 2E0IA 5LM3A 3ZJTA 1TEZA 4E1AA 3JXEA 4AQ7A 4ZT3A 1K4KA 3HFJA 1N78A 1OWNA 4UZEA 1K92A 2X1LA 3NBKA 1G8GA 3QTBA 3TQOA 4U7JA 3RK0A 1QU2A 3CLRD 3MXTA 2ZUEA 1V47A 4G6ZA 4MAFA 4J75A 2CT8A 2YWCA 3X1JA 2RD2A 1I6KA 1KP3A 4KPUB 1QU3A 4ND6A 2I1LA 4XFDA 3HGMA 4MW1A 1COZA 2DPLA 2HZ7A 4MLPA 1KQOA 1O5TA 4L2IA 3SZ3A 4KR6A 2ZUFA 4OUDB 3AIIA 1O96B 3M5WA 2AKEA 1T9GR 3I05A 2DUMA 2QTMA 4R2MA 3X1KA 1EFVA 4YP5A 1PG2A 3CLSD 1Q77A 1OWMA 2J5BA 3ZUGA 3D6VA 4R2LA 2V0GA 1JZQA 1QTQA 2VTBB 3IOBA 1BS2A 3AL0C 1OBCA 2Z09A 4EG1A 1VLHA 4CT0A 4GRIA 3L92A 3DO8A 3TS1A 1GLNA 3IMGA 5TEWA 3CR8A 1M8FA 3A04A 1OD6A 4F4HA 1J70A 1KKUA 3IH5A 3IVGA 2QTNA 1I2DA 3G59A 1JIKA 5AHWA 1I6LA 2YXNA 2PZ8A 2QJOA 3SZGA 2EL7A 3IUEA 3FOCA 3KT6A 5FO0A 4S1OA 4MUIA 4MUNA 3CVUA 3TQIA 1KR2A 2J07A 2O5RA 3ND6A 5K0TA 1VBMA 2CV1A 4K0RA 3SEZA 3UY4A 4I6GA 1NUPA 1PFYA 5JBNA 4DDMA 1N2BA 4DDHA 1NZJA 4NATA 3CLUC 5IHXA 4J76A 1KH1A 3VRHA 3UMVA 1J1ZA 1WXHA 4ZT7A 1WJGA 2A1UB 1PG0A 3BL5A 2X3FA 1JIJA 3CLTC 5FO1A 3K32A 1NUTA 1EFPA 1G8FA 2DERA 2JANA 3ND7A 4MWEA 5J59A 1YI8A 1Q11A 3INNA 2IELA 4UZFA 4EG8A 1H3FA 1GPMA 1KH2A 3CVYA 3PNBA 3DPIA 1LW7A 2CSXA 5EKDA 4P2BA 4NAUA 1WKBA 2QUJA 1GTSA 2A84A 4MW9A 5J5AA 4ZCPA 3RK1A 1MB9A 2YY5A 4RUKA 1TFUA 3D6UA 4NZPA 3ZJUA 1KQPA 1O95C 2PIDA 4XFJA 3SEQA 1QRUA 4JXZA 3UC5A 1G8HA 3H05A 3PNYA 1U7XA 4I6JA 4ZT6A 3SP1A 5DK4A 2XRYA 1N2JA 1J1UA 5H7XA 3QE4A 1WXFA 3TNJA 1O97D 1NYLA 4CDNA 3IVXA 4U8HA 1OBHA 2CYCA 2BYTA 3FG9A 1WOYA 2D54A 3CVXA 4MVCA 2QJFA 4RPIA 3ZJVA 3ZIUA 4EG7A 1N2EA 3N05A 1TYAE 2O8VA 5DASA 1D2RA 3COVA 1V8FA 3COWA 2D13A 3K9WA 1S4MA 3A05A 1OWOA 3E27A 4JZYA 1I6MA 1GTRA 4WSOA 1J20A 1JHDA 4G5YA 1JGTA 5LFAA 2B7LA 4DE5A 4QBTA 4X0EA 3MLBA 5FNZA 1U0BB 3RJZA 4Q16A 4JYZA 3ISJA 3LCJA 2IP1A 1JIIA 4H3SA 4YMIA 2CV0A 5HUHA 2PZBA 3P52A 1KH3A 4MUHA 3KFLA 4ZT5A 2PXHA 4QREA 1WXEA 4ARCA 4KR7A 1PFWA 1YUNA 3QTTA 3SDBA 3S3TA 4ZCTA 2HGZA 4G5FA 1QNFA 1ULHA 1KAQA
chains in the Genus database with same CATH superfamily
4CV3A 5KOHB 4NK4A 2XCIA 3ZZMA 4IVQA 1ADCA 4HLUC 4GEKA 1NONA 2D8AA 2ZP1A 2A0YA 1QPGA 2ZITA 3PD7A 4UM7A 3K6JA 5EJIA 3WLEA 4Q00A 1H3EA 1P0QA 3FLBA 5DIZA 4EUSA 5ICMA 3CSSA 3AHIA 4DCGA 3U7GA 3ZWKA 1JPJA 1BIFA 2BUCA 4I4CA 5BV1A 3N3AC 5BQ3A 1ZKMA 2WF5A 2H4WA 5FQNA 3WKDA 2H08A 3I04M 4PLCA 3A4VA 4OUDA 1BKSB 2GUGA 2IY8A 3I30X 3PEEA 4FS8A 4JJKA 3HQ4O 3SBOA 3ZKAA 4BUZA 3FI9A 4FIZA 4YJ2A 4YY3B 2PVSA 3BMCA 5HYVA 3K5IA 1E2QA 1BDHA 4IXDA 1PBNA 2VK1A 4G86A 3OQJA 4B44A 4DY4A 5MF6A 1H1TA 3MQ2A 4P98A 2YJ3A 1TYZA 3NBUA 4LE2A 2P6RA 1JEAA 1FP7A 1BXGA 1X1AA 2EF1A 2V8BA 1P72A 2WSSD 4KMMA 3JYHA 5B57C 3ZGLA 1NVBA 1SFRA 1ZK0A 4RSMA 1IU9A 1E9DA 1ECFA 4Z4EA 2D5IA 1IDOA 4D96A 4RWEA 4TL8A 1H8ED 3HWX1 4IUDS 3V4OA 4Z53A 2R96A 2FW1A 4GYWA 4HWRA 3AFGA 5E7IA 4E14A 3H1EA 3ZU2A 4DBLC 4U7TB 2A5LA 4GH5A 2ZJ2A 4BNDB 1ZRMA 5HF9A 1CZHA 2KQUA 1E1CB 4M7WA 4DR5B 1MRZA 2G0NA 2NN3C 3R1IA 3IUQA 2ZM6B 2R8EA 5G0SA 3UB2A 4GGMX 4A5OA 4WERA 2HDWA 1A2OA 3OF3A 4F1KA 4W5QA 3SQMA 4IM7A 1UM8A 5C7IO 4I4NA 1EQ2A 5BV2P 2N46A 2O2DA 2ZI5A 3DBOB 2BKEA 2YQ5A 1CZKA 5F3RA 2C4TA 4GX5A 4MHTA 2K7FA 1K1EA 2BVNA 1WEHA 4PW0A 4KR0A 3OMLA 5BVHA 4RIFA 5ICSA 1U9ZA 2WFMA 2OD9A 3AJAA 4G67A 2B0JA 4PO8A 1NDUA 4L6AA 4ZI2A 4QM6A 3W8DA 4B7XA 3C6QA 4TSRA 2P4SA 2JJQA 5T4BA 1LDEA 1M2OB 4Q02A 3VU0A 2AMLA 4UAVA 3G0HA 2ZSIA 1OYWA 3LQQA 1I4TD 1G21A 3E7WA 4LJ7A 5ELLA 2MT9A 2PX3A 3QUQA 4ZZ2A 2GKSA 3H1FA 5KYXB 4MX8A 3V1KA 1RP1A 1QDLB 3W78A 3A4MA 3PKIA 4JJIA 3A70A 5H3LA 3WIVA 1UXGA 4UEJA 1JNYA 2BGTA 5CFOA 3L84A 5A4DA 3USES 1ZR2A 3N2YA 2EG9A 2PWAA 3F5SA 4IIBA 1YVUA 2A6PA 4ALLA 3R9XA 1VGQA 4JVLA 5C0OE 1DO2A 3ZC3A 1WQ1R 4G89A 1TYBE 1V9CA 4N65A 4AFNA 3C3PA 1I5RA 3GDOA 3B9QA 5KVAA 1P73A 2J5RA 3D0OA 5DO9A 3KOWA 4ZANA 1UDWA 1A1VA 2P7IA 1G42A 1IIBA 2JH3A 2MSKA 3O3MB 4Z8YA 5EP2A 5BNZA 3T3PB 4B7ZA 4BAGA 5IDQA 4KG7A 2P6PA 1EPUA 2BTQB 2PO5A 4Y9RA 1U0GA 4ZOLF 1OLSA 3OHSX 4UXIA 1GDTA 4EENA 3GJSA 1NPYA 3TUIC 3ONVA 1GPNA 2WILA 2FN4A 4L8WB 4FX2A 1U63A 1OLXA 1ONBA 2WG2A 3AJ9A 2XRFA 2ZIWB 5JTTA 3OJ0A 1F8XA 2OK8A 2OO7A 5B7GA 3KX2A 3CNBA 2FPGB 1OFVA 3BOSA 1KE1A 3FHJA 1KPHA 2BMVA 1K97A 1I4DD 3KTAB 4RD0A 4M0CA 2IXEA 3GJ5A 4H7IA 1D1PA 4HZUA 3PNPA 4OFBA 3Q6NA 4QOJA 1J5XA 2C9BA 3C3JA 2GVZC 3K5PA 4IWYA 2PZJA 2C4MA 3DZKA 4LBZA 4OK5A 4RADA 5BN5A 3LDHA 5MFZA 3CLRC 3EDYA 1N7JA 1M54A 2BWJA 4EBFA 3WLHA 2VCHA 2QENA 4GLFA 5ILOA 1RRGA 2GM5A 2UZ1A 2XYHA 4LZAA 1TOAA 1PSZA 1A4RA 3QRWA 3M89A 3GJ6A 3ODPA 1N6LA 1U3VA 2EHJA 2ACKA 4LI0A 4JC4A 3TZQA 4X54A 2APJA 2BGGA 2ZPTX 1FS6A 1T1RA 4OGFA 1YQXA 1NDQA 3OM8A 4R8SA 4C0WA 1O9BA 1L6RA 1U80A 2GBLA 3IP8A 1H93A 4W6ZA 4J7UA 2R6CA 4NDAA 1RD4A 1E9SA 1WAMA 4IL5A 3TWOA 4C14A 1Q0TA 4UBIA 4BY9E 3PFWO 1UWVA 4WNIA 1OXMA 2GTIA 1I2CA 5TMBA 1UZNA 2H8GA 1W4ZA 3HCBA 1G8KA 1Z6YA 2WK1A 2A0FA 2WWXA 3QXXA 5LNK6 1ZOIA 5E95A 3K0AB 2RI0A 1NQ5A 4ZHQA 3A58B 3GAAA 4ZCQA 2X7HA 5FFMA 4DCMA 3THSA 1MEJA 4FFWA 3IBCA 3WMRA 5F77A 4KXLA 3WRXA 3QVVA 3LIPA 2GOYA 1T4GA 1DCTA 1V11B 2Q50A 2Q2WA 3DBRA 3QWHA 4MYTA 1R0ZA 1OI3A 4FGUA 5KJEA 3KOOA 2PNFA 4KQJA 5TQ2A 1A77A 4PYNA 5K6RA 5L95A 5AFSA 2BFCA 4YJKA 1Y9DA 1OFIA 3HRHA 4B3DA 1AUOA 1PWYE 2PKQO 2WQ7A 2WPDD 3FTDA 3PBKA 3PIIA 2XW6A 4LF5B 1JG4A 3GJ7A 1FTYA 3BJZA 5K8TA 4LGCA 3ER9A 4K9PA 4AWXA 5TPZA 3WNDA 5BW5A 5ICGA 3ICQB 5K3DA 3IEUA 4IUCS 4A6XA 1EK0A 3N7AA 3R23A 4YR7A 3N8HA 3SN6A 1Y6GA 4N1AA 2HAEA 3HSKA 4AJEA 4GLOA 3MF4A 4ARUA 4JEHA 4U4AA 4R01A 1TRHA 2ZI4A 2J31A 4PLZA 3ZY2A 4Q4HB 4JBHA 1HTWA 4KXYA 4UC0A 5CJJA 5F5LA 3TDNA 2LBPA 4GPIB 4DCCA 1I4EB 4F9GA 3PXBA 4TN5A 2OAGA 4D56A 3T1QA 1CUGA 3DZ8A 4B0OA 3GBVA 4F84A 4HDKA 2BELA 1ENZA 2GLTA 3QELB 4PCUA 1ORWA 1ZW6A 1P1FA 4L3VA 1R6TA 5ESXA 2PJRA 1VE9A 2JFVA 4H17A 4FFVA 1TQ8A 4WKBA 1JU4A 3WWCA 1BKYA 2I4OA 3P2EA 4UNPA 1R18A 4WKPA 1FDSA 1SEPA 3A8TA 4Z99A 3O38A 3KR9A 4L5AA 2AQ8A 4OQXA 5B1YA 4MVJF 3OOYA 2A9VA 2UVDA 2CLCX 3K1TA 4YP6A 2PVPA 2QR5A 4KBFA 2O0KA 2Q7OE 1SAYA 1GKLA 1IUNA 3WICA 1O0CA 4CL2A 3AM1A 4PG7A 4BFUA 3TD9A 1P19A 3DMDA 4LC1A 4B5KA 3RYCA 4P7FA 2QTHA 1MU0A 3BZUA 5JNTA 3FM9A 4GBED 2PK3A 1E6LA 4KZKA 4IO1A 4CR8A 4DYDA 2GAAA 1Z0IA 1RQRA 2HBRA 2Y77A 4EF4A 1TZKA 2FZ5A 4N47A 1EM6A 1KQGA 2Q5FA 1RBQA 1RRCA 1Z6ZA 4JUBA 4LC9A 1Z4JA 3BXFA 3P71T 3TL6A 1L7OA 5HKKD 5YASA 3BJRA 2D7CA 3ENZA 3VR6D 3NH6A 4AF7A 1C41A 1M72A 2GK7A 2WFLA 1V4NA 3LWDA 2IXAA 2JGMA 2VG8A 5AI9A 2UUAB 4PX3A 1OZHA 1UZAA 5EWMA 4LX8A 1H4TA 2BBSA 3LSYA 4YECA 2GB4A 3P7MA 3FLEA 1F3OA 4R9UC 1ZGBA 3TSCA 2OXCA 1KYVA 2SICE 2ZRNA 5FCDA 4IHJA 1UMBA 1ZYUA 2C7RA 4CODB 3CLHA 3MT9A 1HWYA 3CX7A 2ZTMA 3JXEA 3H6GA 3I01A 4AZ0A 2CNWD 1G20E 1ODSA 1TM2A 2ZJ0A 5CG1A 4OATA 2Y4NA 4UZEA 1OI4A 1QJ4A 4D3FA 1P17A 5B1IA 4KO3S 2WICA 3EXG1 1A9TA 1RNLA 3LNCA 3AF4A 4BJ3A 4ZQBA 4FFBB 1XELA 2RGGA 1HPLA 3TLEA 3HDJA 2Q49A 2D59A 2ZWPA 1GL6A 2I3BA 5E6UB 1GZSA 2XZDA 1XXLA 1OXXK 3EGEA 5FJJA 2P1DA 4ASUA 4HDSA 1RJDA 3KYBA 4FR2A 2V5VA 3LOUA 2W6ZA 3HY4A 3I76A 2H2DA 3JQ7B 3IUSA 4IIGA 4WWHA 1L5FA 1N25A 4F04A 5EIXA 4DM3A 1E89A 4QECA 3H2ZA 4P7BA 5AXAA 1D2EA 1DOHA 1KGDA 2OHFA 3K5HA 2HPHA 5BMVF 3L0OA 4KYTA 5JHHB 4XLTA 3EA0A 4CLXA 3EZ2A 3GBPA 4PIVA 4P0TA 1AGXA 4FR0A 3TAXA 1D4ZA 1N4DA 1PU2A 1JR3A 3A6GA 1PV4A 3EX7C 4I14A 3KOYA 3A1FA 1JL3A 1F9EA 4GR4A 1PIWA 1V8PA 2A7QA 2V1XA 1A2KC 1RIIA 3A9WA 3KEQA 4Y2QA 4YALA 3ZCUA 5JZVA 1AKMA 1FFXB 4FMPA 4D8XA 3AFNA 4YPOA 3RG2A 2Q46A 5FHQA 1ILWA 2WQZA 3EVBA 3IIEA 3KAKA 2F9FA 2GPJA 2V6IA 3AO0B 4QYSA 3RUFA 3WHLA 5FBHA 3RPEA 1K75A 4FKBA 2ZYIA 3KOUA 5H0IA 3K9FC 5BQFA 2VJNA 4R1NA 3TH5A 4I1UA 1RZUA 1J70A 1KKUA 2VZEA 3IVGA 4YJ3F 5G1OA 3T06B 1WUJS 4PCVA 4B3XA 1UBRS 5ER9A 2YC4C 1I6LA 2PZ8A 1JJBA 1GGEA 4OI1A 3SM9A 3IUEA 3USZA 4ZYWA 1EKXA 1U5AA 2DT5A 1TXGA 3C8MA 5IAOA 1AKYA 1XGKA 2IY9A 2VOEA 2ZR8A 3LRXA 1S2NA 4YJDA 1U8CB 3RIEA 1W36C 4RDCA 1WVMA 2O3JA 2C4HA 3IJEB 4JCCA 1HX7A 2XF2A 4LHEA 4WGGA 3LTNC 2CV1A 1MC5A 5FV4A 3RKUA 1J8MF 4B09A 4DDTA 1D6MA 3R0XA 2IQIA 3OEHA 3ZD6A 1LKZA 2O9JA 4YMVA 4YUVA 2ZYVX 3HP1A 3COPA 2FP4B 2I7CA 5JBNA 3U6KA 3FOFC 5KHOC 4YDRA 4RFLA 4NP6A 3ZHZA 2NZ8A 4DDHA 3R7NA 4X6LA 3RTDA 4Q7KA 1QRDA 2Y0EA 2NYRA 1UINA 3T4PA 2YWHA 3NU1A 2IXFA 4DSNA 4EH1A 3ML1A 1QCZA 3HJNA 1M2JA 5EIEA 4EQ6A 5J4HA 1Q0RA 3QUBA 5FO1A 2JLXA 4PZZA 2QX7A 3MWEB 3GRCA 2ICAA 3INNA 5F2OA 3WGZA 1XQWA 2ZBVA 3BS4A 2JLCA 1FXWA 3W5VA 5BRAA 1LA2A 4DCVA 3HH8A 3WGOA 1XNQB 3L0PA 2G77B 4LHVA 4LTNA 3AMVA 2O8FA 5JAZA 2BGUA 1GZHB 3S2YA 1S2DA 4EB6B 1SOMA 1DHTA 3SE7A 4FJ0A 1Z9BA 4MROA 3O8NA 2AXPA 3T5AA 1OAKA 5C3MA 1I3CA 4S1TA 4ALKA 5BWBA 4MW9A 5C1BA 2QAGB 5LD2B 4CXMA 3IQGX 1UBOS 2D7DA 4M21A 1SUDA 3OJEA 1GL7A 4H6VA 4HSGA 5CT6A 1VSTA 4GI7A 3HB9A 2Z58A 4CN9A 2F3SA 2JAPA 1Y0BA 4D9HA 1VG1A 5J4LA 2FYTA 2RK4A 5HDQA 3SEQA 3ZQ4A 1XO1A 4HGYA 1G8HA 2ZSUA 3ILYA 5F4BA 3COSA 2ZTUA 3AX6A 4HEHA 1GAWA 3ZDRA 5F51A 4ZCIA 5BV8A 4OI0A 3S8MA 1ZMBA 5FAXA 2C92A 4BCCA 1QM5A 3LP8A 4RH1A 2M6SA 1UF9A 2P2GA 3GOHA 1K6JA 5E4FA 3K30A 2QQEA 5IKEA 4RVGA 4DM4A 2OP1A 3HE3A 2G7ZA 3UT5B 4FD3A 4REQA 4LYFA 2JGEA 2X0EA 3DM5A 4FCTA 1YQUA 4P32A 3K20A 3O21A 3OKCA 1WZEA 1MXFA 2WF8A 3L07A 4Y2YA 3VNRA 1NW7A 3LUAA 3PUWA 3WGQA 4I8XA 2GPTA 1V8FA 1FBNA 2KMLA 3LUCA 1J90A 4CU2A 1PCXA 1U4SA 1XLUA 3IUNA 2Q4OA 2HO5A 1J25A 3DDUA 1C7QA 1L1FA 3ROMA 1J20A 1F4VA 3AEXA 1JHDA 4LHSA 4OH1A 3RG8A 4BFXA 3DAYA 2NOAA 4HB0A 3MMZA 3I6ZA 3USCS 5LWHA 1C9MA 3V8RA 4ER7A 5IS2A 3HEBA 1Z68A 4M1YA 4EJSC 2CK3A 3R5TA 4J1TA 4EPXA 2ETVA 1DUVG 3E9YA 3RB8A 2WP8J 3RGGA 2YIMA 3VVCA 3K3PA 4J0FA 5A4IS 2XD9A 2FPUA 3KFXA 4XXHA 2G7MC 2IDJA 5ALTA 1XROA 2H06A 2WUWE 1TU3A 3FCEA 2WMOB 1F6BA 2PUTA 3EXEA 3SDBA 4UUAA 2PUBA 2AC2A 3A3OA 3RAPR 4L9RA 4PLVA 1AU9A 3QMVA 2ASEA 4LPSA 1NNI1 4C2TA 3HBMA 3K7EA 3T7TA 2B34A 2AMJA 1ZM9A 1M83A 1W48A 3B89A 3I0ZA 4M8IA 4O2AF 1VM6A 2IZ1A 2ZUSA 4TMTA 4EY5A 4YX9A 1TA9A 3CBGA 3RU3A 1EB9A 3BSWA 2ZXFA 2ZBPA 1BWQA 2CHQA 5EIOA 4KV7A 3RFTA 1R15A 1T6XA 1V7ZA 3PP8A 2CWDA 1WX1A 2FLWA 4UE2A 4LMAA 2OSVA 3OOSA 2HSZA 4W63A 3TJRA 2JKYA 5I4CA 2XNDD 2XQVA 3LBIA 3LQ1A 2CXTA 3OCJA 4N5HX 4HVTA 5C35A 2G72A 2XMGA 3HR7A 3COJA 5I7EA 1IC6A 5BSFA 1T2EA 1A9XB 1SWVA 1QMPA 2F3UA 2HHJA 4KQMA 1BDBA 1H0KA 4YNBA 4BZWA 5J40A 2VRNA 4P3YA 1ZG3A 2GWHA 1PJQA 2Z1DA 3D8HA 3NWPA 4Q3EA 5FI1B 1OWLA 3FZEA 3OLQA 4J6EA 2VDVE 3HZHA 1JPUA 1QUEA 1B42A 1RYMA 2I6XA 3WIUA 2OHGA 1Q0LA 1QP8A 4AZ3A 2Y2UA 4MW4A 4PANA 4D3YA 3QHQA 3KLMX 1FTQA 1V9LA 1A8UA 1E96A 1RLJA 1SVUA 3EGXB 1YQGA 1YRQA 2Q4RA 2FZ4A 2ZE5A 1GZ6A 3EC7A 4OL0A 5IP5A 3QOYA 2I66A 3W90A 3CCBA 1UEXC 3VPCA 1A5ZA 3D2BA 2FE1A 1RQLA 3WZ2A 2D1YA 2C8JA 1OOEA 2PRKA 2Z30A 3MJFA 2VNHA 1KJ8A 1DMRA 3C15C 3VNQA 5C9ZA 1XXHA 2HM7A 4M9UA 3DJYA 5F1OA 3D3QA 4D7AA 3E03A 1TC1A 1A3CA 1TX4B 1G0OA 1KPGA 3Q1KA 1U2EA 1IH8A 4KOEC 3B20A 3TXAA 1Z4KA 4JJAA 2BCJQ 2FPXA 2XLBA 2RGYA 4LKOA 3WXBA 4E2FA 1XHEA 5COQA 1GAXA 1EXVA 3RADC 3DDWA 4ZO4A 3D3WB 4N0PA 1P2DA 1N75A 1Z0DA 3AY7A 4L4YA 5U4QA 2E4XA 1FFSA 3KZOA 4BVKA 1CQZA 1U2GC 1YJ5A 2Y1CA 5JZBA 1EIWA 4AY2A 1WCIA 4JOSA 4QBKA 2G36A 1QO9A 1JQ3A 1U4OA 5FPHA 2RARA 1ISPA 2FQWA 2YRXA 3LUFA 4N03A 2P11A 4CMCA 3FFBA 2H1RA 3ZZ0A 1SXIA 3C7AA 1N36B 4HNAB 4XX0B 3E9MA 4EEKA 5IM5A 5CITA 3FPJA 4RXMA 1L8QA 1Z8FA 2CMDA 5LZ4A 2DKFA 2V1UA 5GJCA 2A8YA 3QJYA 2P41A 4ESHA 2AZ4A 3OC0A 3ZNQA 3FVQA 5HIKA 3EDOA 2WZDA 3F3MA 3HFGA 1FDOA 5DSXA 5JECA 3OMXA 5BSEA 2AYXA 3P2MA 1J8VA 4TL7A 3V8VA 5ENVA 1R5NA 1VIYA 1WABA 5ESRA 1USVA 4YQFA 4GXNA 3Q98A 1TGVA 1Z3CA 2IYNA 1ESEA 4MYCA 4ZARA 3NH9A 3T99A 4JQZA 1DKQA 3KHUA 5D1NA 3SXUB 3SM3A 3CEJA 4NZYA 1DB3A 3FCSB 3KEGA 4PHCA 4OJMX 1L4KA 2ZAMA 1ZIPA 3EEIA 4F45A 2X8JA 4J7CA 1LB1B 2EWWA 3PDUA 4L0MA 1S8AA 4GX0A 5AW3A 3CFYA 1DWOA 3P9ZA 4PZUA 1VLQA 2DQSA 5AVRA 2QTAA 1ZOLA 3VM6A 1U9IC 1IEWA 2PLNA 3AEQA 1P1KA 4NX2A 2UZ3A 4UOQA 4KQ2A 4B76A 4EYOA 1GZ5A 2IU3A 5ALMA 2PZMA 3CZMA 1T0HB 2W43A 2ZJ3A 3PFKA 4YI3A 4F9TA 5CVUA 5EKUA 4LIPD 1JDJA 3VPGA 4LSMA 3WMFA 4C0LA 2HPZA 3TW6A 4C1BA 1JFLA 3FOZA 3IV6A 5EWJA 2P9CA 2IK8A 4QGAA 5CDFE 1QIGA 3NEAA 1HE4A 5BQXA 5KNLA 4A6PA 4HPWA 2AJBA 5FTNA 2W48A 3KPYA 3T5TA 2J0UB 3A6PC 5EE3A 2GYYA 3UWPA 1TYDE 3PPWA 2OZEA 1IUKA 2ZROA 5JZSA 2OY0A 3DAHA 1KMNA 1MJHA 1KYYA 1U0NA 3L0BA 1Z12A 3SOZA 1SUAA 2QROA 2JGKA 4WZAE 5J2UF 2H5JA 1CY2A 4GRDA 1E1RA 2ZXEA 2D4HA 3E84A 5IN4A 1HT2E 3A10A 4U0JA 2NTEA 1VRVA 4F8EA 1W5SA 1QSGA 5LP6F 1IY2A 2AJTA 4DKJA 1MP0A 1F6DA 2CCKA 1CUAA 3E6AA 10MHA 4JVOA 5IVHA 1A8SA 1E79D 3PC4A 4ODIA 1KVUA 1S2LA 4KXFB 5IBRA 4AP6A 1KORA 3CYFA 3IA2A 1G3QA 1GT91 4ZI5A 1AMNA 1WU8A 1EP3B 5KC8A 4TUYA 1G8JA 4BQEA 2YR0A 3IHKA 4CM8B 5CLJA 3SIXA 2G71A 2HMAA 4UCWA 4YWJA 1ATIA 3OY2A 2UKDA 4Z9XA 3O8RA 4DQVA 4RLSA 1UMCB 1Z7WA 3ZXSA 5JPDA 1OB2A 2YH2A 1BN6A 1TYEB 1ZM3A 3QKRB 1PJBA 4YAUA 2H2WA 5JQGF 5CB4A 3WWEA 1SCUA 2BEWA 1MV5A 5JE8A 1GCUA 3WDMA 4H4DA 2HK8A 1HKUA 1DMSA 3UF0A 2FPIB 3SF8A 1D09A 3ZY4A 5EQJB 3AILA 2H00A 1T36A 1PFKA 2BUBA 3CF4A 4R71A 5KKCA 2R1VA 3V8QA 5C5DA 3COZA 4YVFA 3C4VA 2IXDA 4WFQA 5EIHA 3N76A 3CKMA 4KNVA 5KYVA 2O2EA 1CIPA 2P4HX 2W2LD 3KE9A 3SZOA 3A2KA 3KQHA 2BEKA 4G0VA 3PC7A 5CM2Z 3P0HA 4LK2A 4XASA 1SCNE 3BWXA 2RFLA 5IZCA 2YASA 4PBSA 4NMXB 3S70A 4CLOA 3TGPA 4KEAA 3ZGOA 2XI4A 1DBIA 3NYWA 1J7KA 1ZD8A 4FVTA 4CHTA 4C01A 3AKZA 4LZWA 4IH9A 1HMPA 1CV2A 2PLWA 1PTKA 2CLIB 3ITNA 4W4TA 1V5FA 4NYIR 3AUSA 4X1IB 3UK0A 2CNNA 4LY9A 3AVOA 3TAUA 2P9EA 3F67A 2EC5A 1QDEA 2UZ0A 3D8TA 4FNGA 1WW2A 4CRWB 5I7WA 3F5MA 4MQLA 4HG2A 3WYBA 1EX1A 2M1XA 5EINA 1FLDA 1OQAA 4FDAA 4LRSB 1NC3A 4R7TA 3I92A 4RGVA 5LQUA 2DEUA 2VLBA 4FSXA 3RSLA 2ZWIA 3OPYB 1A7UA 4LMRA 4UHHA 2B5OA 1E2GA 2BEVA 1JHOA 1V6CA 2EKQA 4XYMA 4CMHA 2SBTA 1U0OC 1K3FA 1XMJA 2QD5A 4GOXA 4YAEA 3HWWA 1QK5A 3V8MA 1ZLXA 3HFSA 1DDIA 5FA6A 1DO0A 5EPOA 4P4UA 1T29A 1VLZA 3EEOA 2BFEA 3BWCA 2QE6A 5K03A 2Q5OA 5G02A 4Z3KA 4GBMA 2YYAA 2VZ9A 4CF6A 5FQOA 3RIXA 2NTJA 3PEVA 4EM6A 5BT8A 1FUUA 4U2FA 2N42A 3UJ7A 2OOSA 5BMOA 2ZJOA 1YU6A 3N87A 1YJBA 3IOEA 3OZAA 4M0EA 4N3GA 1Y9ZA 5T5QA 2GUWA 3NR2A 2FCAA 4LYYA 3TIXB 4HN4B 4LZPA 1XUOA 3LLVA 4WZBE 3LXRA 1C3EA 4Q93A 1PK7A 1CF9A 1TJ4A 2IEYA 1GV1A 2IX9A 2ZE6A 2G1AA 3LC0A 3LYLA 4G0YA 4F96A 2XAUA 4WVFA 1WY7A 5CRIA 4GP6A 4H7PA 1Y7TA 3Q7TA 4GF5A 1MABB 1ZXLA 1GU1A 4RD3A 3ABIA 4P2GA 2QUAA 5C46F 1AQIA 4NOKA 3RTEA 3GK3A 1RXUA 5J5VA 3OU7A 4MP6A 4E88A 3D02A 1EVZA 4L74A 3PEUA 1V47A 2ZUEA 2OUIA 4C9BA 1MMFB 1Y5IA 3MJRA 2MYNA 3V48A 4AO8A 3KKZA 1FF9A 2POQX 4K9DA 2QP4A 4OQYA 3HGMA 4INAA 4REMA 3HKCA 3PJFA 4RY8A 4OVKA 3HR8A 2JFWA 1KYQA 1R0LA 4YMWA 4FDUA 3ZXUB 3HKBB 1PQPA 3AUTA 2QVZX 4PEVA 3NP7A 2QF7A 4QOSA 1NXVA 2Y4OA 1CUHA 1V4VA 4JAVC 4MJ3A 2AF3C 2I1QA 1XCBA 3QE2A 5IYZB 2RK3A 3NETA 5K99A 2JFNA 2WT4A 4Q3BA 1W34A 3A1DA 3WYEA 2E3JA 3SJ7A 2Q45A 1DPFA 5B1EA 2FEPA 2JKZA 4R2MA 4D5GA 1IN6A 1WUHS 4O8ZA 4Z7NB 3TQCA 3PDCA 1Q1AA 1FZQA 1DG3A 1GXSB 2JASA 3F0TA 1S02A 3KSZO 5CPFA 4O29A 3AEUB 2Z8YM 4XH9B 3H8JA 2WFZA 3UBMA 3R0IA 3RD5A 1CXZA 3DR5A 1EK5A 3IOBA 1TM5E 5GZ3A 5L40A 3EAGA 4M8SA 3LK7A 4DG5A 4INPA 4WK0B 4DRXB 3D6MA 1P1CA 1DJOA 2AFIA 2B61A 2GBLC 3M6AA 3QVJA 2I6TA 2IOQA 5B30A 5J23A 3I8OA 1KNQA 2ODBA 4XX1A 3AR9A 3NX4A 4HQNA 3AM3A 1BD4A 1KDYA 1MG5A 3AP2A 1FU4A 4OQQA 2CNBA 1W5TA 4LOIA 3IPAA 3U3KA 2OG1A 5CYFA 1OXBB 3VNAA 4NCBA 3ZIDA 3LZDA 1CP2A 2PRYA 4BNXA 4F9FA 4TYNA 2REXB 1PLLA 2YXNA 1A9QA 1LJUA 1XTVA 3BFXA 3VHRA 5CA1B 2G5GX 3OQBA 2XZOA 2H11A 4E21A 2RGNA 3OE5A 3WRXC 3H75A 4OHOA 3CVUA 3I73A 1GA4A 3VFDA 1GYRA 2PWBA 3S7TA 2ZBDA 6CHYA 3EBOA 3G0BA 4J49A 4LECA 2AK2A 4GBJA 1YZ3A 1RZRD 2P9TA 2I2CA 3EG5A 2I1VB 1TAGA 4MEBA 4I6GA 1V16A 3QHAA 4LRXA 5CBKA 2NVUA 2B4AA 5FBLB 2O3QA 3EIFA 4BMOB 2DCUA 1P6UA 2I4LA 1BGXT 4Y30A 1DRUA 4JL6A 5E4JA 2FK8A 5HCUA 3GT7A 2IV2X 3C3EA 2D3TA 3IFSA 4MAAA 5K3BA 4ABTA 3CGWA 3HPRA 3ZHYA 4IS2A 1G55A 4KPGA 4M2LA 5FLKA 3LVRE 4AJ4A 1PG0A 1M34B 4KE8A 1JPNA 3Q72A 1SNYA 3FSGA 3GLHE 1YBMA 3MJDA 2EFEB 4JP2A 3GLIE 4H6XA 3O8OA 1TLFA 4BO3A 4IUBS 4D4IA 1G9XA 1E66A 1NVDA 4M76B 3T7EA 4ARSA 3PYXA 1J0XO 1ZZEA 4MLZA 4BMCA 5IVPA 4V02A 5TV2A 2Q5QA 5BUCA 4ZWNA 3FOWA 3H0CA 1QIJA 4IFTA 4UHEA 2AFHE 3QK7A 1XTUA 4HDMB 3HCEA 5AIAA 1QNLA 2KSQA 3ND9A 3UK6A 3DZHA 4A0FA 2HCTA 5AM2A 4JCOA 1ZJ5A 3QWFA 1OGJA 3KSAC 1G2QA 2W6NA 3UJPA 2GN6A 5ALGA 1D9ZA 3FMPB 4GNRA 5AKKA 1BQ3A 4ZCPA 4BFWA 4O25A 3KV1A 4C7MA 1YASA 2D5LA 3DB2A 3KUCA 1NVTA 1D2HA 1TB4A 1Z18A 2JIMA 1G8YA 1MIOA 1OH8A 1GU7A 3CJQA 4GXRA 1EUZA 1K0UA 3V32A 2NO7A 1CY1A 2PIDA 1WMDA 3O4FA 5KPJA 2HL6A 2ZUTA 2VNJA 3C3CA 4DXAA 4E32A 1GUAA 1OUMA 1J5PA 2GD1O 2H1VA 4R69A 1XIVA 1LH0A 3JZIA 5EI5A 4ZJUA 2BV3A 4CBVA 3S5JA 1V35A 1DC5A 2JDIA 2FWRA 3L1IA 1WXFA 3OPQA 4UDYX 5CW2A 3TNJA 1TO2E 2IOYA 4GMDA 3UANA 3WOHA 4Z0PA 4FJ2A 3KQUA 1W7AA 3PFBA 2X13A 3KB8A 3AJEA 1N6RA 1SKUA 4FSHA 1E5QA 1AURA 4WY5A 1W59A 2XNSA 3FCYA 2BYTA 1UBSB 4X95A 4TQ9A 4RH0A 1N9ZA 1R5OA 3ISTA 1KMHB 2GGSA 4W7IA 4B8YA 2XA1A 2W2KA 1R6AA 3WIDA 5CA0B 4O63O 3CZQA 3X1WA 5J1SB 4URVR 5EHIA 1GVHA 3E27A 3MCTA 4TKVA 4F6LA 1ST3A 1KK0A 1P80A 3CW9A 5D5QA 1EK1A 1Z2OX 1OVGA 1VPDA 2B1IA 2SKDA 4L57A 4LJLA 2JI8A 3ENKA 3OQHA 4WFJA 1U65A 1X7WB 1V45E 3AY6A 3NDJA 1KK2A 2O50A 3DQQA 4E2YA 3CR7A 3ORHA 3OJCA 1XLWA 1JJAA 4R1TA 4ZGGA 4TT8A 3P5BA 1R4MB 4KX3A 3MILA 2IEZA 4K6GA 1KEVA 2V7XA 3OTIA 2QX8A 3PQCA 3Q0IA 4CFYA 3LHSA 1K8ZB 1HT1E 1PWHA 4G0QA 1CLEA 4EGQA 3E5HA 2FQ1A 4X1YA 4HPJB 2YJ4A 5F52A 2DU8A 1NJ2A 1O4WA 4RANA 2YJGA 3OSZA 3G9XA 5J2TF 1F0KA 1MV8A 1KI9A 4MV8A 2GD0A 4WY8A 2XMCA 4D9MA 2CFSA 5ITVA 4U5QA 1KEKA 3F98A 2OGUA 3B2QA 4F3RA 1KFJB 3FDFA 3DOOA 3EA4A 2P0YA 4AUNA 1NIJA 5I01A 3EUWA 1GL9B 3WTBA 4IRXA 1KYTA 1ZX1A 1G8AA 2HNBA 3WGNA 4E03A 2IBSA 1XZLA 1RRKA 1XRPA 4L9WA 5FOUA 4IIUA 2JBAA 2PX2A 4TXLA 4BZZA 2TRSB 4Y6GB 4D79A 3I8SA 3T9FA 1T2FA 2R48A 3UQZA 2XA2A 1WSBA 1J7JA 1I7PA 1MJGA 1YAHA 3K9CA 5TXGA 1DS6A 2II6A 2AE2A 1M76A 4C3VA 4HDCA 1JEQB 4KCGA 5J43A 1N3BA 3SYTA 3W8EA 2VJLA 3VI3B 3UJCA 4RCZA 4ML3A 2HC9A 2JFPA 3FKJA 4U2GA 4NCIA 2QOEA 5AKJA 4RPKA 3T7RA 5BY2A 1XZPA 3U9TA 1E7SA 1BSVA 2IEDA 3I83A 5AJVB 2YZNA 5FOQA 4G85A 3SBDA 4JOQA 5F7JA 3ROKA 3BREA 5JNUA 5T6BA 1RKVA 3RC9A 3VSBA 4QELA 1JVSA 1RYNA 1OGIA 2C54A 3N2EA 4C0SA 2NO1A 3L7NA 4OQMA 1YBHA 2HRZA 1BCSB 1J2YA 1D1SA 1ZNQO 4Z54A 2C9ZA 2F8SA 1ZH4A 4O5OA 1YQDA 3CGGA 2YMPA 4ZOLA 1A9OA 1OW3B 2F1OA 1RXVA 5TR9A 3NOOA 1CG6A 2GPNA 3BXHA 4KRGA 1UKZA 1NKVA 3AR7A 1ESMA 1BOFA 2Q6IA 3QWAA 4KDEA 4QDKA 3N75A 4TMVA 1ISIA 2Z2KA 3SEAA 2RAVA 1QQ6A 1C3VA 821PA 1TQDA 3BWYA 5HFJA 2REOA 3MCUA 1VBFA 2CLDX 5IASA 2E4UA 1ACMA 3PRHA 2WD9A 2IHUA 4I55F 4MI3A 3B9BA 2EW8A 3UHOA 4YIHA 2JF0A 3FLMA 3PL5A 4OV6B 1HRKA 4UFNA 4Q9IA 3PHLA 4LMBA 4HNVA 2WY2D 5E6RB 3PCRB 4DRYA 6NULA 5K0CA 2IWRA 2O3RA 1AF7A 2D1RA 2O20A 1ZU4A 2VH2A 2W58A 2YYYA 3KJHA 4IJ6A 1ADYA 1ML4A 3DB1A 3N39C 5KYYB 2O7QA 1YMUA 3RTCA 3KPVA 2HLDD 4IJKA 3TZLA 1M66A 2VDWB 5ALOA 4JUIA 4DQ0A 2HQSA 4UREA 4EUEA 4IMIB 1GQSA 2K5UA 4JSYA 1A4XA 1Y82A 2HY7A 4L5CA 4UZSA 5TJ9A 4B6GA 1C81A 1J06A 1STOA 4BU1A 1RRVA 3GPCA 4WBNB 2JAOA 2CDCA 3IKLA 1H05A 3GD5A 2ARKA 1XX6A 3RU9A 3JQPA 1NXPA 1PF7E 4YMHA 1CR1A 4P84A 4RLQA 1BXRB 3U4CA 5K45A 1E1QA 2IGTA 4O4LB 4O4JF 4WXHA 3WWPA 5DP1A 1EGVB 1ZONA 3OQIA 4A8PA 3T1YB 1EJ0A 2JW5A 3AH8A 2ZSKA 3KEFA 1W4AA 4CM4A 1LLDA 4AS1A 1ECLA 3L4SO 3F4LA 4Q7EA 1VCHA 1EJBA 4K9KA 1EX9A 3VISA 5JVDB 4KSBA 3CPEA 3VBEA 3VJMA 2JBHA 1L5VA 4CKCB 1F4LA 3KQMA 4LJ6A 2VHZA 4WACA 2XEDA 5KI6A 4LDJA 3NGMA 1Z35A 4KWCA 4G63A 4ES6A 2A5DA 2P67A 2XE7A 3CA8A 2I4IA 2GHRA 1CZUA 5JRZA 3ZH2A 2JHAA 4DC1A 1RU3A 2OV3A 4XW2A 5MN5A 4CUJA 1H2WA 4J3NA 3QI7A 5SYAA 1UJ4A 1WE2A 1NWHA 1TKAA 2PX8A 4RF3A 5FI5A 4CG0A 2E4AA 2AZMA 3GGOA 3QUTA 3H87A 3IAM1 4ME6A 1TIPA 1VQ1A 3IUBA 4LV6A 4QFCA 1AZSC 5L3QA 1F38A 4PRZA 2H5LA 2RGBA 3GQBA 2VZ8A 3JQBA 2V0CA 4D97A 1XRRA 2K6GA 1I94B 1RABA 1VXRA 3MD9A 1SUSA 2BHRA 4TTAA 3ZWDA 2FV8A 4BBJA 4QSMA 5BR1A 4II7A 1QFZA 4C0HA 2WF6A 3CT6A 5LOVB 4LISA 4R40A 3TD2A 4ZQGA 1OE0A 3GJXC 2D0IA 2NNWB 4Q82A 2VHXA 5HGJA 1EFUA 2VSQA 1S6YA 3K2BA 4HB2A 4J1TC 3S2GA 2AB0A 4W6QA 4ENVA 3VQTA 2BCEA 1NQOA 2P35A 3IA7A 4L4UA 4DEVA 1CHNA 2UUPA 2F62A 1EXMA 4M4SA 4AZVA 1UK7A 3FWKA 1NKTA 4QUDA 1WVIA 2C9OA 2OB2A 4GGPA 5JMWA 3FNQA 2QP3A 3ZI4A 4MRNA 1NVVQ 4MDHA 1JQLB 2I99A 4WNAB 1Q1NA 3TPCA 1I2BA 3IEIA 3N5CA 3UMBA 3L7DA 5BW6B 4CM5A 1EUDB 5DYTA 2F4VB 5I7AA 1E5XA 2PSSA 5AUOB 1Y6RA 1U0LA 3BH6A 1FFYA 4DA8A 3MWLA 5BSRA 3B78A 1SVWA 2RGWA 1XD2A 1PO7A 2BMAA 3N6RA 5KCMA 1QRAA 2XYGA 3ZDYB 1KVTA 1O03A 1H23A 3AEKB 3L43A 3H6HA 3I1IA 1K7EB 2BTOA 1IJEA 2AW3A 3AG6A 3MBKA 3N8KA 4PBTA 2EVWX 3E8SA 2QUIA 1X39A 3G8AA 1ZGGA 5IAJA 5IVIA 3V7YA 3HUUA 2O8EA 2DFNA 1OXSC 3TRDA 4U7DA 3ZIAD 4KBGA 1QYCA 2WKPA 1AQ6A 2XDQA 4ZT4A 3KZ1E 4F5YA 1FVFA 1NUUA 3AFHA 4HDRA 4BC0A 3UUGA 1QG2A 5JLJA 4EVSA 2KBEA 3R9WA 2JCBA 3GFVA 1JJVA 1ZA1A 1BMFD 2YX1A 3BX1A 3K2EA 1BJTA 3JD4A 4X24A 3HCDA 5HIIA 3W5CA 1D8TA 2L18A 4XGQA 4EB0A 4PQEA 2FMFA 3OFNA 3QUCA 1F2TA 4YB8A 1EJ2A 2TS1A 3Q88A 5SY9A 3I1JA 5TE9A 3R75A 1FYFA 1S8NA 4AG5A 4EZIA 1GTVA 1X92A 2OG2A 3H2SA 1ZD2P 3L8EA 3SQDA 4ISBA 4R83A 1M0TA 1MO5A 4U9HS 2Z6UA 2AQIA 4HATA 1A5BB 2V7QD 4EY8A 2KLHA 2C2BA 2IUYA 2OXFA 4BMZA 2PBZA 1W94A 3C8UA 4K8RB 3W5AA 2J5XA 3D4NA 3DMRA 5L7TA 3I28A 3KWJA 3MJEA 4G9BA 2WLSA 4MRAA 3CVOA 3VR5H 4O2LA 3RYTC 1JLLA 2CXQA 4FDLA 4EHFA 2A35A 3LF1A 3TDKA 5EL0A 2FMIA 1E3MA 5EJMA 4ZEWA 1BXKA 5PGMA 1HC7A 1LFDB 4KIUA 4CMIA 3B70A 3IQEA 3ZBTA 5BMVA 2E21A 1GNQA 1QAOA 2XODA 2YS6A 4X65B 1QVAA 1SKYB 3ZX5A 2YV5A 2ORYA 1VI2A 3DMGA 4WQMA 2W6MA 4M8NE 4PPFA 4KYUA 4RFVA 3AWIA 1THMA 3CURA 2RAPA 4LJ5A 3FDXA 3DNFA 4LNUA 1FX0A 5EE0A 2KWIA 4MUEA 3BXEA 1EFKA 1I1NA 2HD4A 3M3PA 4QM7A 1DAFA 4PPYA 3G5AA 1ECCA 2R8PA 3R0QA 1SC1A 4DABA 2IVZA 2X7JA 1K7CA 4PPNA 3A6EA 4F7WA 4GECA 4HYYA 1IONA 4OP3A 4Q5IA 3RSHA 1AHHA 2LW7A 1D07A 2E4WA 2WTNA 5FP0A 3T4XA 5GZ1A 1P81A 1PL0A 2DPYA 1GPLA 3B8HA 4AQ7A 1XF1A 2B25A 2GN0A 2IZ0A 1N78A 3O92A 2QG4A 1E77A 1I5OA 3CN7A 1WW8A 1M2FA 2FTKE 2O3UA 5IUNC 5IXJA 4RTJA 1E4EA 3LY8A 5CU7A 5BQOA 3TQOA 5BUQA 2V45A 1SVNA 3HMKA 4TWAA 1XD9A 3G9UA 4RK1A 4C6HA 1N6NA 4Z2YA 4DLSA 3SCZA 3GFQA 3NAGA 2DTEA 1WBJB 4IYJA 4PNPA 1GGNA 1YHYA 3JATA 3GI1A 4LSWA 4WY2A 3H4MA 4DIEA 3QPVA 3B13B 5B7QA 3UHPA 1B41A 3GVPA 4RZUA 3VPHA 2MSEB 3MVEA 1Z7BA 4L2IA 2QZZA 1KPIA 2OWDA 4BLVA 3LKDA 3OOEA 5DH9A 4DHWA 2GDJA 3M2TA 4CHGA 3AIIA 4EMUA 1I2AA 2BSAA 2J3QA 3W2HA 1JG6A 3KL4A 1PUIA 4OQLA 1AT1A 1Y6QA 4MLCA 4TRRA 1FRVA 4DCJA 5BSGA 2IDMA 1XCJA 4I36A 3O26A 2YNMD 2P78A 4Q3NA 1M1YA 1KZYC 3WGLA 1T0UA 1EVIA 4N5NA 1CRLA 4PO1A 5IJWA 2NV0A 4V3BA 4QE3A 4FSDA 4EGFA 4HNRA 3UFXB 3HJRA 2PMDA 4BQSA 3HB4X 5CD9A 4YS6A 3WADA 1ZO8A 1XTTA 2OLEA 4CM3A 2OCGA 5KZMB 2PU5A 4P31A 1R4NB 4IMPA 7AT1A 3HDVA 4GRAA 4DA4A 1YU9A 4BLWA 1PJ3A 2N1BA 4FMCB 3BE5A 4B3HA 4R51A 2YQZA 4Q9HA 3WGTA 1P3Y1 3HB7A 5LR6A 1CQIB 1Z5OA 3H1BA 3SNHA 3W34A 4DQUA 2WU8A 2XNKA 4GOND 4A0SA 1WETA 2VT6A 1GRVA 4S2EA 5EXTA 1HL3A 4A16A 4QKQA 2P69A 2DPGA 3SZGA 3EPKA 1UP6A 4BTVA 5K2MA 4AKSA 3ADBA 2HF9A 5ECWA 5FUXA 4PG8A 1ZQ1A 5L3SA 3UXYA 4ND8B 5EZ5A 4JX8A 3M6WA 4POOA 4WT7A 2FK7A 3DFMA 1GTL1 4BMYA 4PNEA 2OGSA 2BGNA 3EFOA 2PGLA 1BEUB 4K0RA 1IQPA 2QV0A 2IYXA 3LOPA 4WCFA 5TLSA 3BULA 3GDFA 1LD3A 1LDMA 4CKZA 3FW1A 3IUJA 5KYTA 2YV2A 4LZLA 4OYRA 4YWHA 4E12A 3FLAA 5JSFA 3AGQA 3KBOA 5IBCA 2GAJA 3RVBA 3RYHB 2OSBA 3GN2A 5T3UA 2ZYRA 3HJTA 4E2XA 1GPJA 2PZGA 1U0RA 4QLBA 1BHO1 3CLUC 5FH9A 2RHLA 4Q18A 2QX4A 1P8JA 4US1R 3N1UA 4P22A 1E1NA 2RHHA 2DWUA 4OQEA 3UMVA 4MUMA 2HWYA 3DW3X 5K51A 3CWZA 1TU0A 2AD1A 4R9SA 4DCUA 1YS7A 3KYCA 3PC3A 3ZV7A 4RA9A 3QE9Y 1D2AA 5IZCC 2BEUA 2QG9A 1A9RA 2JI6A 1JAYA 3BKWA 3OUUA 2QUZA 5D2CA 4Q4JB 3B6JA 5IW8A 3SR0A 5CXQA 1G3UA 4QAJA 1FQWA 4PQYA 4OP1A 1LW7A 3CU5A 1NASA 3THXB 1U5BB 2XUGA 3CUTA 3M9WA 4NC9A 3UPUA 4ZK6A 1ZJZA 3GO4A 4UPDA 2QUJA 1GTSA 2L82A 4FHCA 3CZCA 1SUIA 1ITZA 1Y3HA 1OU4A 2JFXA 2ZVQX 1UKYA 3FYTA 3GEDA 4LBVA 4MPRA 1NY6A 2VJMA 1ZWKA 2VZ0A 4TV8A 2FF7A 3RABA 5EE1A 1OA1A 4CPDA 5K3CA 4WL0A 1KBZA 1NJ6A 4GM4A 1LV7A 2IYRA 2QN8A 4Q4AA 3ZVNA 3X1YA 3S68A 1RLIA 1UIMA 1ZESA 4G2TA 3WB1A 4D3XA 3IAEA 3LL4A 3QG1A 4I6JA 2Y6VA 4EPTA 5IMSA 3PJRA 3PTAA 3K0KA 1JLRA 2FOXA 5H7XA 3T1NA 5B7NA 3MINA 5MDHA 1Q21A 3E9QA 4B3RB 4UNQA 5KYYA 4DV5B 4RD6A 1P4JA 1XQXA 3OLYA 3NI2A 4XQGA 1W0JD 2PGDA 1XZAA 1OBHA 1Z06A 1VIAA 2WT8A 3D2LA 3EXIB 2X3UA 1QVRA 2YICA 4PZAA 2D54A 3IR5A 4PZDA 4B9AA 4D9JA 1GLVA 2CFIA 3EIXA 3ETEA 4NF2A 4OSOA 1HDYA 1U3UA 5JWOA 1TYAE 1VDMA 4L50A 5DASA 1D6JA 4BLPA 2XB4A 2EZ4A 1Y9AA 3COVA 3IILA 5J3JA 4ZI3A 3ZVLA 3EPLA 1SOAA 3AI7A 4UBKA 4B4KA 2HN9A 3T7SA 4Y2XA 5KSOA 4PN3A 4FYYA 3RNOA 4WLFA 4UQOA 3P0EA 1KJYA 3QX7A 2QN7A 3O03A 4WOCA 3U3JA 3QVGB 3PD1A 4ENTA 3EIOA 4L8VA 3CINA 4Q1EA 1D0VA 1YB1A 2WR8A 1QXSA 2FZVA 4G26A 3RJZA 4NCNA 4BEWA 1DO8A 1ELOA 4PLYA 3MWDA 5TQ0A 3SFZA 4MAMA 3EAFA 3CLKA 5T4HA 2ODEA 1ZHFA 1GQOA 2W93A 2ZYHA 3GJ0A 4QREA 2X0JA 1X8KA 4F4IA 2OB1A 2ODQA 2A0XA 3GJ8A 4IO0A 4YQEA 2QZ4A 1QK3A 4Q19A 2ZPUA 1QGED 1CDDA 2C7VA 1QOZA 3AR4A 1BO6A 2B3DA 1YI1A 2IXTA 3QFTA 4FI3F 3HS3A 3B9PA 4QATA 4UMEA 2DP4E 3IDAA 3LV8A 4DV2B 3SBEA 2XTNA 4C4XA 1JR3E 3BM5A 5IAKA 2GM9A 3ZOZA 5DRTA 3TZ6A 5KOJA 2Z5VA 2VBGA 3E1GA 4GLJA 3VI4B 3G79A 2AEJA 1I10A 1JKJA 4HT3B 2Z3VA 2X58A 3WIBA 3P0JA 4ZPJA 4YRKA 3UT6A 1AK9A 3WGJA 1PGQA 1ZY2A 5BRNA 2JRLA 3NHMA 3E4DA 5F2KA 5EXPA 4P0PB 2A9KA 3IEKA 2HMSA 3GB9A 4TM7A 4FQ7A 2PY6A 4C20A 4BEBA 2O4CA 3EJWA 1S01A 2WF7A 4HDNA 4U00A 2O2IA 3KXLA 3L7KA 4B4WA 5IT9A 1VLVA 1F8GA 1NI4B 2HCBA 4GQAA 2G1JA 4KQWA 2ZIFA 1DBWA 3JPYA 2M9MA 3UAOA 3FNBA 3TIIA 3WNQA 1P0CA 1CQJB 2Q4DA 2IDZA 1MVOA 2ZIVB 5KJ6A 2XOKA 3LT5A 5CT5A 3VMFA 2GCOA 4Q1DA 4MUFA 4I2VA 4P4SA 4UBLA 2H59A 4W7SA 2ID8A 1IQ0A 1QFYA 4P4NA 3KQTA 4F8JA 1MHTA 4EYKA 5AK5A 3DXZA 1SXGA 2FUKA 2HK6A 2H51A 2B1JA 2IUFA 2RGNC 5DKFA 3R8XA 4RKFA 5HIAA 4J7XA 4AQYB 5EXXA 1XAJA 3FF1A 2XB8A 4FBMA 4UHFA 5DYGA 4DLYA 1G66A 3MLAA 3K6SB 3V4SA 5T57A 4KUGA 2P68A 2LKCA 1ZL0A 5K4GA 1DVRA 2O1XA 2QD4A 1FS5A 2VUSA 3OQNA 4D9GA 1V8DA 2FPPA 1NBEA 2DBZA 3DEHA 5H4GA 3W4KA 3L1VA 4TS9A 2WKRA 3G7UA 4IJMA 1X9HA 4ZODA 2P2DA 2BBTA 2JIZD 1R4AA 3P26A 5I7UA 1AKNA 2Q5CA 3X2FA 2VQFB 3IMCA 2YIDA 4Z4CA 4DL9A 4Z8XA 2XNJA 4EG3A 3SZRA 1ZJYA 4FEYA 3EVGA 5CP8A 4ZRMA 4OQ4A 1KJIA 3BRWA 1ZGAA 3LKVA 4I50F 3MC1A 4QXAA 5EKXA 3UEOA 3JARB 5AH0A 3ZU6A 1Q57A 3U4DA 1ZCFA 2C3MA 2EDAA 5ALJA 2PGNA 3BIOA 5E4YA 1VCMA 1ZRSA 4TM8A 1P5ZB 1NBOA 4DV0B 1R16A 3TIGA 5C80A 1BVRA 3K09A 4ZXPA 3WOVA 1K5HA 1IPHA 3I37X 3EFHA 2ODPA 1SUPA 2E48A 3D8BA 4BTLA 3GNQA 3FYDA 2JGFA 4KO2S 4AP9A 3KUKA 3OKPA 3M9XA 3JALB 4ZAGA 4LCEA 1XZHA 1XZ8A 2AI2A 4Y9SA 4A0HA 3C85A 3JASB 1MGPA 4Y2SA 5EQFA 1FRFS 4MWBA 4P5PA 3SHTA 3V8BA 4N7RA 4YONB 2IRWA 3GROA 2PUCA 2ZOSA 3ZWXA 1JQAA 5J2UA 3GZTB 3QV1A 1K06A 4E2ZA 1RSZA 3JQ9A 1AVTA 4H7EA 3L5KA 2C5AA 4B79A 3ETJA 1KSJA 2EF0A 3F7OA 4E0BA 2GSDA 5LP6A 3R40A 4TZ0A 3T3IA 4GWLA 5K1ZA 3WRYA 3A7EA 3QW2A 3D5QA 4OHKA 5TEVA 4AM8A 4YV2A 2ZYSA 2Q6OA 5DLQC 1QPZA 2AXNA 4IYRA 1M6YA 3TOSA 1GUDA 3IP3A 4MOWA 4QUGA 1TM7E 2BGMA 2XCUA 2GBGA 3RVNA 1YCFA 2J8ZA 4H7KA 3MRVA 4C6TA 5HS4A 4O33A 4WCDA 2QM8A 5AUNB 4CETA 1UBJS 1GUFA 2MINA 3ABRB 3DLPX 4DUGA 4BATA 2ZT6A 3AHDA 2PD3A 5K8LA 1IQRA 2BFDA 3AUAA 1T43A 3HL4A 4N6NA 1RI4A 1U6JA 3TDMA 3UGQA 2BHTA 2RC5A 3RVPA 4NOJA 1XU4A 2IXBA 1B3BA 1NG1A 3GMDA 2DOKA 3LQYA 5H59A 1JVNA 2QTLA 3SC4A 2NYAA 2Z5FA 5F76A 4E5KA 4YASA 2C42A 4YH1A 3ZV3A 5ADWA 1DCKA 3IE0A 3BDVA 3Q5DA 3UWMA 4M9CA 5H68A 1QP0A 4XDYA 4MJ7A 4G9EA 1Q5PA 4Z7QB 4KU4A 1DG9A 4RXUA 1XJ0A 4G81A 2WYUA 1ESNA 2QZSA 3FBGA 5IDYA 3H65A 4EMSA 2AR0A 5A4FS 2B9EA 1AC5A 4Q1CA 4RTMA 5DBFA 2W7TA 1H2EA 1NT2A 1RI3A 5EHGA 1B3RA 1NULA 2OHJA 5DHSA 3A37A 4HKTA 3WJAA 3IJRA 2YUIA 3DTVA 5FUBA 3G02A 5LQSA 1A95A 4ECAA 2C3PA 4E5UA 1RVV1 1U02A 1JFSA 4BNGA 3ZK7A 3CLSC 3OECA 3O1LA 4RO0A 5B2FA 1FYWA 3ONNA 3D6TB 5AHRA 2VLIA 4IDPA 2O48X 4K28A 1DNPA 4YPVA 1S8OA 4US2R 4JI7B 3IIMA 5L3VA 2Z3WA 2GRUA 2DWOA 2DSNA 5FJIA 4RACA 1Z88A 4JI8B 3F6BX 1CZLA 2QLBA 1YZVA 2GILA 3VR2A 4J03A 1TM1E 4L95C 4A8JB 4YDHB 2BFBA 2VXOA 2YOHA 5GONA 4X20A 4QYIB 3TTWA 1FU7A 2EKDA 3JRXA 3JWIA 4Z9BA 4GDFA 1D0IA 4GKVA 5D3QA 1U0SY 3HO1A 1J8DA 2QNIA 2GMWA 3D7RA 1X19A 3FF4A 3R20A 3AINA 4XM0A 1YIDA 1C5KA 1TD9A 1ISFA 1X7XA 1DKUA 5K8CA 1YBVA 2HRCA 2IYWA 4FGJA 2C5SA 3M4NA 5BQPA 5JC8A 2CLMB 1IQUA 1K63A 2DUJA 3NJ4A 3WBFA 1N77A 2CNLA 3T3DA 4QPPA 1A76A 4Y0NA 1NU6A 3O0TA 4YXWD 2AZDA 1QKJA 3HKDA 3WLFA 3D5TA 2PKEA 2L0XA 1P74A 1FNBA 1L4FA 5E9WA 5LZ5A 1E3QA 4EI7A 2WYHA 3W1WA 5KYWB 1TF7A 2B69A 3UATA 1HLFA 1JHYA 1TO1E 3IDQA 4YYZA 4DV1B 3TEJA 1XXHE 2PX6A 3RBAA 1GR1A 5FWDA 2UXCB 4PXYA 2UYOA 3G8DA 3C3WA 1Q19A 1Q7CA 3IAAA 2F3PA 5LB4A 4MITA 4IDHA 4DM7A 5TQVA 4EHBA 3R3UA 1EDZA 4MVWA 1JQBA 2DE0X 1DJMA 2ADMA 1H66A 5AKZA 2P65A 3HA7A 4OFZA 3I2GA 1E7QA 1O95A 3KKPA 3P2YA 4M3NA 1NN5A 3H1TA 2XT9A 1R5BA 5FXMA 3P4XA 1N0HA 1D5WA 5LQCA 5DI3B 4HAOA 3I8XA 4E31A 3MERA 2PS3A 3DYIA 4RF4A 2BISA 4M36A 4AN0A 3U7QB 2ZB8A 1YI0A 3VC1A 3ZDDA 1VJCA 2N75A 3LVFO 3P19A 5CIQA 2IHJA 3WYDA 5KX5A 2Y3IA 4XQCA 2YWEA 4F21A 3GFFA 4KR2A 3FPCA 1E6KA 3UC9A 4I4IA 4Z49A 3NVMB 1OYVA 3I23A 4BQQA 4LVUA 2FX3A 2OEPA 1A96A 3NQ41 2XGGA 2ZRQA 4A0GA 1QONA 1C8KA 4ZALA 3AB7A 1DKPA 3I45A 1QRTA 1RPTA 2OESA 2YW9A 2ZEJA 2ZAOA 4Y1EA 5EMMA 3SJUA 3ZGVA 1Y7HA 4A91A 1W5EA 2OBLA 1S7CA 2CHFA 3ZQKA 1QHHA 1YS2X 1D2GA 3KKLA 1MAAA 2C82A 2J0QA 1OTHA 1T5HX 1JKIA 1W4LA 2ZUBA 3DZFA 3E2IA 2ZI3A 3JW8A 2B6HA 5CFMA 3ESQA 2VPQA 2ZDGA 1BS1A 2B94A 2GCNA 5KNDD 3BE4A 2CVQA 1SXPA 1XI2A 3HVUA 3WZMA 1E9FA 1L0BA 1N8TA 4M22A 2VAVA 3C7KA 3CB2A 5BWCA 4IUYA 4ASUD 5L6MB 5L7WA 5HW0A 3E70C 4AG3A 2Z1MA 3R5FA 4QOEA 3R5XA 4XR4A 1R12A 2YZ7A 2Q5HA 1REQB 4BJHB 5G1PA 2PJDA 4QYMA 4P33A 3FYUB 4MIOA 3AR5A 3FCXA 3C74A 2HZ7A 2ZR0A 5HM8A 4R41A 3FFAA 5KTMA 4JT4A 1A82A 5HJ2A 1ZLYA 4LSGA 3ZDXB 1U81A 1XWIA 5KJCA 2WHRA 1XJ5A 2XUJA 2UYQA 4B81A 1RR6A 1T0PA 1HE3A 1YR8A 1PK9A 3ASUA 4V0OA 3DE0X 4N8EA 1AF4A 2X9QA 3CRW1 3L8ZA 4I46A 3U17A 3FJOA 1CY0A 1SO8A 1JDPA 2WEKA 1SMKA 4MR8B 3UB4A 3ULKA 2UUOA 4IXWA 3WTCA 4B4DA 3I05A 1QK4A 1HYQA 1K86A 2FEAA 2QTMA 3JQBC 2YS7A 3KQOA 4LWOA 4QC2A 2Q7DA 3FOEC 3WGVA 4QDZA 4W5RA 4NVRA 3K70D 3ZUGA 1Z4IA 3QIVA 1YK1A 5ALVA 1Y3CE 1FPQA 2VAWA 5I9MA 1RAEA 1GG2A 5CH8A 1ZCBA 1UT8A 121PA 1QX4A 3FSRA 5A0FA 2FWAA 3HHEA 3RTBA 5JSQA 4L27A 1WHSB 4BLRA 3C45A 3K9HA 3SHQA 3JQ8B 1I36A 3L0DA 4HLQB 4RMIA 4DLVA 1GZDA 2FJPA 3B3JA 4ZAWA 3GNSA 1RRFA 5TT1A 3SVZA 4ZI7B 1SC3A 4YRPA 1L7QA 1HT0A 1Q2XA 4ZCLA 2XBMA 2ACVA 1M8FA 2OBYA 4OSPA 3SF0A 2GM4A 3EZXA 1ZD3A 4JP5A 5DWVA 4NBSA 1KJZA 4XA8A 4B34A 3UAWA 1JHZA 3KOMA 1HZJA 3MTBA 4GOLD 5AXBA 4YUAA 2QMEA 3GARA 1P2VA 1SVSA 1I4OA 5FUYA 4IH4A 4AROA 1K3UB 1F2UB 1AZTA 2QSYA 1U99A 3WLQA 4B73A 3TQIA 4DJJA 1QLJA 2AC7A 1J0BA 3PC2A 3BK2A 4FFOA 4MIKA 5CUQA 4O2BB 5K0TA 3ACBA 3IIJA 4KMOA 3K9NA 3Q7RA 2HIHA 3QUAA 4FGLA 4QRIA 5CB6A 1NW9B 1HTBA 3BSFA 4IMJB 4N18A 1EK2A 5FNVF 4EEZA 2R97A 5DNEA 4YV0A 1SBYA 1PFYA 3AR8A 4B6EA 4Y2HA 3K35A 4NNPA 1L2TA 5K0GA 1WP4A 2NXJA 1L4MA 3X43A 5LZ9A 3OCCA 2I3DA 2Q2VA 4KXQA 4IIDA 4LQ4A 5HRUA 3QKUA 1WJGA 1KFBB 2P7HA 4KFUA 4ED9A 1DIRA 1WDMA 4V0RA 1QHSA 1QFSA 3ZR4B 1PT9A 2HHAA 2B2NA 1RIFA 3VVBA 1UBCA 3TTTA 4AJ2A 3OZTA 1ISSA 1X14A 3EE6A 4YO8A 4C0AC 4D6XA 2GZAA 4GFDA 3V80A 5KEIA 2JCVA 2HHLA 2C04A 4JL5A 2Z2JA 2BFOA 3VAYA 3KU4A 1CD5A 4G5GA 4YT2A 2G4VA 1VL0A 3KCQA 2ATIA 1JAZA 4M6WA 5L51A 1M67A 4FD2A 4H7FA 2BGKA 4U7FA 4CIVA 5E3IA 1GNVA 3BD7A 2ZE8A 3TLCA 3SVTA 3OPNA 2YY5A 4N5DA 2NVWA 3ADKA 2QSZA 5K0LA 4AMBA 5LVAA 4J16A 2CVPA 4YP1A 2FZEA 1G5IA 2OE2A 1LF5A 5CNIA 3R7WB 2BGIA 3BD6A 1GL3A 2MSNA 3IKVA 4L4ZA 4R9RA 3F9IA 1Z2CA 1WHTA 5FL3A 4W1PA 4O4HA 4XRGA 1RI2A 1A71A 3DLTA 1DUIA 1F06A 3BCRA 3GZNA 2B36A 1N1GA 2IP4A 3KAPA 1MPXA 3L7MA 4RF2A 4ARVA 2BM1A 1KOGA 1SELA 5T41A 1J1UA 2XPCA 2H54A 1KKLA 3DUWA 3P5SA 2FDCA 2Z95A 1P7YA 2EFGA 4L9SA 3IVXA 3FSJX 3OIUA 4FWBA 4XM1A 1ISHA 4OAOA 4IHQA 1T1GA 3T0GA 1QIMA 3ZJVA 2QJFA 1CE8A 1V39A 2WZQA 2EBFX 4YGXB 4B9EA 4BB0A 2ZJ5A 3IQIX 4F11A 2FQYA 3RV4A 2ID7A 4BVLA 3LNTA 1D2RA 2AN1A 5C51B 1CY6A 1M5TA 2D13A 3KJQA 3A31A 5ELMA 1IJBA 1Q74A 5AI4A 2W2VA 1PTJA 3P8ZA 1FFCA 1OWOA 1P29A 3VPFA 2WT9A 2ETXA 1G8MA 3O2SB 1Z5ZA 4ILEA 4WSOA 4FE7A 1EHIA 5AJWA 3ZCXA 4AMZA 2CXRA 1VMEA 1MD9A 1TIKA 2DFLA 4KN5A 5JZ9A 2A3RA 3CX3A 1U3FA 4P93A 4M1MA 2B7LA 4W5OA 3GUCA 3CRNA 2BRUA 4MRMB 2W6JA 3HN7A 3F96A 4G0OA 5KSZA 1EP9A 3M70A 4JYZA 2V4ZA 4Q3KA 1JIIA 5EHZA 3EEYA 4TZ6A 1WOMA 4LQDA 2CV0A 2QRGA 1AMOA 1WL8A 3NCTA 5DNWA 3L6RA 3Q8LA 2VHCA 4MS1B 4FCVA 4MV6A 4AY3A 1JQJC 3N07A 1JTFA 2HA2A 2X5NA 1ZIOA 3BERA 4FPXA 4POAA 1N9GB 1IN1A 4D4LA 3EW9A 3GT4A 4WXPA 2JJ2A 1QOPB 2ECOA 5AD1A 3ZEAA 2QG6A 1PUXA 3A9SA 4A26A 2P3LA 3ZDQA 1CRPA 1BJKA 4WTOA 2RGUA 2J33A 2WHPB 3K1AB 1P4AA 5TARA 4ZQEA 3PI7A 2NU6B 3W9BA 1A97A 3HDTA 1BDMA 4EL5A 3F6EX 3MBIA 4LEIA 5HKOA 5GINE 1U3CA 2J4DA 4KKXB 1LEHA 4G5XA 1J49A 3CX4A 1WSWA 2AFIE 2WVGA 2EQBA 1KDPA 1LWOA 3THYA 1U4NA 1L4HA 1NOIA 3Q5GA 4F4JA 5CDSA 2NZ2A 5HJEA 1GNPA 1YD7A 4S04A 3R0JA 1ODTC 2FY8A 2PFSA 1QIFA 1KIAA 2PZFA 3C16C 3BXOA 2RCNA 1W4BA 5ETJA 4JX9A 1AS2A 1YAJA 2HLHA 3IUPA 4H7JA 1EQAA 3EXHA 1VBKA 1D9XA 3UK2A 1PFVA 2VTBA 2R11A 4IDFA 3UAVA 2DY1A 2G67A 3WYAA 1LI7A 2CF5A 1CNEA 1H6CA 1WV0A 2WAYA 3MSCA 2G70A 1Y6ZA 3BEOA 1Z8NA 3WJ1A 5B3KA 4G97A 4O4JA 3TI7A 1C0KA 1CS0B 2BL4A 2ENWA 3QW4B 2WV9A 4MQFB 3RFCA 5F23A 4YTEA 3S6JA 3EQ8A 2I8LA 5FR1A 1XC7A 2NNLD 4KQXA 3UJDA 5FAKA 5H1YA 2ZT8A 3L18A 4WBXC 1U8UA 2G83A 4WCFC 4JB2A 4B46A 3RC1A 5EQDA 1SVIA 3EF3A 3HYSA 2B7CA 1EEXB 3VJLA 3IPLA 3HWRA 4BMDA 3DP7A 1IM5A 1XPUA 4M0DA 1ACJA 1VGRA 1ONPA 3WL5A 2Q6KA 4RC9A 3RTAA 4AMVA 4BIMA 1Y3FE 3HSSA 3RIHA 3UPDA 2HQRA 4OHCA 5JNLA 4MI6A 2X6RA 4Z4GA 1Y1QA 2ZSHA 3A32A 4ZRDA 1XLTA 2HJGA 3D54D 3S0JA 3DKRA 4KJZA 3Q1LA 4H6PA 5HEKA 3QOWA 2GEKA 5EUMA 4FZJA 1LZKA 3Q6MA 4R2HA 1ZUNA 3DOIA 3BC1A 1WQ3A 4D9CA 2PMCA 4IDQA 3ESZA 3JYQA 4RZHA 4YT8A 2UVPA 3N2KB 1ODJA 1P1RA 5I7FA 5JISA 4L5YA 1KAGA 2ROQA 1P91A 3A11A 4M89A 421PA 1SZPA 2UUCB 3DP9A 4DLRA 4R1MA 1F0NA 1PSDA 2I4RA 3KPJA 1KTIA 4NZZA 5AYVA 3EWAA 2HNKA 3MYYA 5JD4A 1E0AA 3MWJA 5CGZA 1QH0A 1C1DA 2GHIA 4E15A 4X6YA 1Q92A 5LMUB 1XMXA 5IVKA 1JIVA 4X84A 5EIFA 1SVMA 3DPSA 1U2PA 1QYWA 3AGPA 3TNYA 4DLZA 3UPTA 5JCOA 3QMMA 4HTFB 1FJHA 4G0XA 4L9AA 3L8GA 1Z0AA 2H1CA 3OBIA 2OO3A 4I1IA 1JHPA 3FPEA 4MJLA 4R1UA 3D7KA 3FRIA 4QUKA 4F38A 2QP9X 3MLEA 4IFBA 5DV9A 2P6UA 3UTCA 4H1WA 5KPDA 2IS1A 2F00A 2MSCB 2QN2A 3RS9A 3I61A 3U31A 2EX4A 1MJGM 1Y9JA 2DAPA 2H2AA 2OL4A 2R1TA 2PDAA 3D6FA 1JIXA 3ELBA 1ZICA 3OAAA 4MTCA 2BTEA 2FRVA 2V4MA 1TD1A 3G5MA 1ONNA 2Y76A 3KE8A 4MW7A 4F4DA 3DTNA 5G2OA 3HXMA 3V1TC 4AJOA 2HU2A 1M2HA 2C61A 3FPLA 3R41A 4ZYUA 4MMZB 2WKWA 3OA2A 2AIRA 3NIBA 3ROGA 2QX6A 1EUYA 5HCNA 3BXPA 3A9UA 1QVVA 2H7YA 3GEEA 1OH6A 5FI0B 5BXQC 4FW8A 2OZLA 2X23A 3EXFA 4I4TF 1EWYA 3OCZA 1GSIA 5JCJA 2YVAA 5C8VA 4PRYA 4DIKA 2F1RA 2B5VA 1W88B 2YHAA 1SBZA 3MHPA 3UOGA 2NUTB 4EKNB 5E2IA 2ZUWA 1E3TA 1PFUA 2GYWA 3CW2A 4X1OA 1PDOA 1GAJA 2E55A 3FX2A 2B1QA 1K6IA 2W83A 3GAMA 5HDBB 2H57A 3Q0TA 3ZI0A 2D00A 1NKSA 2LKDA 2QLFA 4XTCS 5IJ0B 4BN4A 4FHEA 4QT0A 2Y1EA 4R05A 4UPVA 4KNWA 1A69A 2CUKA 3JAWA 1CRZA 4KQ9A 2W70A 3UT0A 1FYVA 3EOAI 3PX7A 2PLFA 2HT1A 3T3OA 4MUJA 2KLBA 5DGTA 3DLBA 2VXYA 3KZCA 1NA5A 3U56A 3QE0A 5CURA 1IY0A 2GRAA 1X1TA 3G82C 4C89A 3SWWA 3U4QB 2ZBRA 3VDXA 1KMQA 4ZT2A 1G7CA 4TSFA 2C95A 3IO3A 2WIDA 5CT4A 3U49A 4XYLA 1MAHA 4JWKA 4CKEB 3SFVA 2ISCA 2C00A 4Y18A 1PSWA 3CH6A 4ENSA 1M2VB 4MSUA 2HU5A 2QMZA 2QTZA 3C6XA 4GU5A 3LVBA 2HA6A 4NH4A 3AOGA 3DZBA 4GHWA 4XPIB 1PKEA 3EEFA 5IT4A 2NIPA 3QJGA 4M7RA 4B85A 5ER6A 1Z2NX 3K9LA 3E9CA 3CEMA 2ZB7A 3TCXB 3V4VB 5TJHA 2V9CA 5TB5A 1M8GA 5EERA 3Q40A 1T4CB 3FDIA 3GLFA 1Q84A 1X1EA 3QLVA 2XRZA 3C8DA 4JJ8A 1FCJA 1CUYA 1OXVA 2Q4EA 3CNEA 3H84A 2XVZA 4IMRA 3HL0A 4K6MA 4OLJA 4ZVRA 1XKQA 1K8XB 2WD7A 2X4DA 3HZZA 3UO8B 3WHIA 5JD6A 1CUBA 2H4FA 4RK4A 1ZA2A 5GY7A 2ADOA 1OBFO 1P7PA 3KK0A 1G9SA 4CW7A 5A4KA 4AF8A 1RAIA 2FKAA 3GLRA 3NAQA 3O8QA 4KMSA 4NV1A 3MUEA 2YHIB 2AX3A 1TW3A 2HWWA 1EU1A 3E3MA 1G6KA 5EWLA 3W7BA 4QTYA 5JYBA 5DNVA 3IYLW 4JA2A 3LFTA 4JVMA 1TZ2A 1BWSA 1T2UA 4WASA 2OD2A 3WV5A 1SQ6A 4E13A 1O6BA 3E15A 4NJEA 6ADHA 2ZZNA 1FYEA 3E3LA 3NYRA 3ZBQA 3E81A 3GR6A 4UFOA 1W76A 1ZGCA 4YAJA 4AP5A 2WJYA 1Q91A 2NXNA 4D25A 4FMBB 1CSEE 4WUVA 4EUNA 4FW9A 1QGUA 4UEKA 2VJBA 3KJFA 5JCXA 1ZUHA 2BDTA 2B4KA 2RAUA 3SG0A 5AQ1A 4HJXA 3VJRA 4YJ3B 5HMMA 5AR1A 5SZHB 1GV0A 4ZO8A 1UWLA 1OC4A 1RI5A 2GVNA 2XSZA 5IAEA 521PA 4EX6A 1W2WB 5MGNA 3DKIA 3KXIA 3LPCA 1TCUA 1QLHA 1E2LA 2NO9A 5IJXA 4BRWA 1I7DA 3HGQA 3OPMA 1P7VA 2VDJA 2EJWA 2POCA 3C3BA 1S2IA 3EG9A 3TRFA 3BIFA 5DTRA 1ULZA 4CQMA 2Z6QA 3NW9A 1DQSA 3K09C 3OD5A 2VK4A 4Z1MD 4OJNA 3PA6A 4PLGA 2IHZA 5FKJA 2YC2C 4BASA 1MB2A 2GASA 1GZ7A 2NUBA 2LV8A 2RHRA 4NONA 1PGJA 2PT7A 4TXJA 3BHNA 4Q66C 4JNKA 3U7FB 1SUCA 4YRZA 1HYBA 3CZ4A 5C8YB 2PQ2A 2PUFA 4RNDB 5REQB 1ULUA 1YB5A 5E1MA 4IQ4A 3R7WA 2BFFB 1N6PA 5AVTA 3HFJA 3SHOA 3JQ9C 3VSEA 3QTBA 2W6QA 3R0ZA 1TC2A 3B1FA 4K9LA 4DQXA 2CB0A 1HBJA 1QIHA 2R6DA 3LUPA 5LP6C 3RK0A 3WRYC 2XYVA 2VATA 1SWWA 1XN1A 8GPBA 2PSFA 4K2HA 5HJ5A 3W6NA 3WAKA 4E51A 3LHFA 4RJIA 4J75A 4ESEA 3X1JA 1IZYA 2PE5A 1TUBB 3RSOA 2V7VA 1SA0B 1JFFA 2I1LA 2O59A 2O8BA 3K0BA 3U4AA 2R2GA 3LCVB 4DCPA 4LJAA 3STVA 4BVBA 2VPXA 3W3AD 1KE2A 4GI5A 1Q3TA 1P2SA 5DYIA 5TPWB 3NWEA 4XIJA 2B82A 2PUHA 3C7DB 3UG6A 4A23A 3AVUA 2JS7A 1JZTA 3EQ9A 4GIBA 3U4IA 2FHSA 1E2MA 4J0CA 4UNNA 2DSTA 2ONCA 4E07A 3DE4X 1EFAA 3RUHA 1H65A 3OJFA 1XMQB 1OAAA 4L4RA 1F14A 2QLLA 3AZQA 3KHTA 1Z07A 4QLAA 3ZDEA 4XEHA 1ENOA 2O05A 4FOTA 4DHEA 3RREA 2X0DA 2EZ8A 1FMJA 4Q3LA 4C0QC 5JXGA 3GPBA 3S1LA 4ENQA 3NBZC 1NP3A 3KQLA 3FBWA 5JAQA 3U5TA 1C9NA 3AV3A 4PG4A 3EK2A 3G2LA 3HABA 4U5XA 4RTOA 4H1TA 2GK6A 2IYAA 4FXOA 3ZHUA 5HOEA 1SC9A 1JLKA 1Y3DE 1UKAA 1IG3A 1IY9A 4CT0A 3ZS9A 2XKKA 4TV9F 1KYXA 3JQAA 4YJHB 4B3TB 1T91A 3DDZX 2OCYC 4Y2PA 4BMPB 5TEWA 3CR8A 3S2UA 5DN6A 3A6KA 3A04A 1J97A 2PSDA 4PO9A 1CUZA 3PIRA 3TE6A 2E37A 2QTNA 3R24A 5NLLA 1QYRA 2IPOA 1N1MA 3CONA 3WWZA 3D0KA 1GAQA 1WDTA 2HREA 3H3JA 1E5DA 1MQ8B 4MIEA 3H5NA 3LYHA 4HVLA 5JARA 2PSEA 1T5BA 2A33A 2O54A 3KVVA 1HDIA 1B16A 3L02A 2WHQA 4TXMA 3RWMB 3UAZA 3QFCA 4H27A 4I19A