2A4MA

Structure of trprs ii bound to atp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
331
structure length
331
Chain Sequence
ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase II
publication title Structures of Tryptophanyl-tRNA Synthetase II from Deinococcus radiodurans Bound to ATP and Tryptophan: Insight into subunit cooperativity and domain motions linked to catalysis
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
total genus 111
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2a4mA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a4mA01
3IUEA 2CYBA 1PFVA 3CLUD 2J07A 3NV7A 3ZJUA 3F3MA 3D6UA 3TZLA 1JEEA 4ND7A 5TEVA 1U0BB 3IODA 2Z08A 4MUEA 4YMIA 3IMCA 1NI5A 3X1JA 1IQ0A 1T6ZA 1F7VA 2DETA 1H3NA 1K4KA 2PFSA 3NBKA 2X1MA 4X0EA 2QJFA 3DV2A 3CLRC 4EG7A 2NSYA 1YI8A 1O0BA 3P0JA 1XNHA 1GZUA 3COWA 4AQ7A 2RE8A 4PY2A 1KH1A 2QUJA 3H05A 1O96A 3QE4A 1BS2A 1H3FA 1ULHA 3TZEA 5IJXA 4MWCA 1Q15A 2IELA 1QQTA 1ZJWA 2JANA 3AG5A 4MVCA 1EFVA 4ZT2A 1M8GA 1TYCA 2VTBB 5IHXA 4ZCSA 4BWVA 2DR2A 4CT0A 4U63A 1N2GA 4JXZA 2JAXA 1M8KA 3H9BA 4QRDA 2AZXA 1JZQA 1EUYA 1NUPA 3CVVA 2E0IA 1KAMA 5HUJA 3GLVA 2IP1A 3ZUGA 2PZ8A 3L92A 3K32A 3LCJA 3ZXIA 1YIDA 1N2EA 4NZPA 3CLSD 3VGJA 1QRUA 1H1TA 1O96B 1T6XA 3HFJA 3HZRA 4QBTA 3CVWA 4DDKA 4NATA 2PIDA 3AG6A 2YXNA 3G6KA 2J5BA 2QUKA 3SEQA 3TNJA 3ZJVA 4ZCPA 2CSXA 1JMVA 4QREA 1JHDA 3CLTD 4WSOA 1B6TA 4YP6A 3SDBA 3P0HA 1NUQA 4EG4A 2RD2A 4MVXA 5KCMA 1WXIA 2V0GA 3U1VA 1O6BA 1O95C 3FG9A 4ZT6A 5KHAA 1F7UA 1PFYA 2CT8A 3UOWA 4CQNA 3COYA 1OWPA 5LLTA 2O8VA 4J75A 3IH5A 2XRYA 2HMAA 1M8PA 1NUSA 4J76A 4CDNA 1IQRA 3MLBA 4MQ6A 2XRZA 1M83A 1NURA 1XNGA 1OWNA 4I6GA 3FY4A 1R6XA 2CV1A 3X1MA 4RPIA 3UK2A 4MW5A 1MAUA 4G6ZA 3CVXA 4P2BA 2DXIA 2A84A 4DDMA 3ELBA 4Q16A 1I6KA 3HV0A 2TS1A 3RK0A 3DO8A 4GRIA 1T6YA 4U8HA 2DLCX 3IMEA 1QU3A 1N78A 2QUIA 1WJGA 5HUHA 4NAUA 4G5YA 2PG3A 1WQ4A 3FHJA 2PZAA 2H29A 3CR8A 1WXGA 4ZT4A 2CYAA 4GU5A 4UZEA 1A8HA 1YIAA 2QTNA 4K03A 4JFAA 2QTRA 1EE1A 2X1LA 4I6EA 3M5WA 3OTWA 4MUFA 4DE5A 1IRXA 3N9IA 3K9WA 1YULA 4MWEA 2OQ2A 1D2RA 3H99A 1EUQA 1VLHA 1K92A 5J5AA 5TEWA 4MW4A 3PNYA 4EF6A 3AKZA 1I6LA 1EXDA 3D6VA 4NAHA 3AIIA 4DNXA 1TYAE 3IVCA 1IHOA 1WY5A 4H3SA 2IJGX 4MW0A 3A2KA 1T9GS 4U7JA 3G59A 5DB4A 3UY4A 5EKDA 4MUGA 5JBNA 3ND5A 5LFAA 3L93A 1KH3A 3IVXA 5FO0A 3QTTA 2CV2A 5K0TA 1M8FA 4MW6A 2DEUA 1MRZA 3CLUC 4NX2A 1NUTA 2D5BA 2WQ7A 5DEOA 1TYDE 1N2HA 1O97D 3SZGA 1MBZA 1KAQA 4TS1A 1V47A 1K97A 1COZA 4I6JA 5HG0A 4KR9A 3LOQA 2E89A 2V0CA 2HZ7A 1NSYA 1G8HA 3ZXSA 3X1KA 2ZUEA 1WXHA 1TYBE 3TS1A 2DUMA 2HGZA 2BYTA 2I1LA 1IQUA 1GTRA 3SP1A 1QU2A 5H16A 3KT0A 5DK4A 2YWBA 1TEZA 1N1DA 1LI5A 1I6MA 1N2OA 4ZT3A 4HPWA 5AHWA 3TQOA 4OUDA 4YP7A 1J70A 5K0SA 3RK1A 4PBSA 2QTMA 2EJCA 1EFVB 1O94D 1ZH6A 3A4IA 3QTBA 4JZYA 1OBHA 1K4MA 3IOCA 1ZUNA 4MUKA 2QJTA 4G5FA 1LW7A 4MW7A 1Q77A 3RBAA 1NYLA 1TFUA 2EL7A 1JIKA 2D54A 3CLSC 3FDXA 1M1ZA 3FNRA 2CV0A 1VBKA 4ZT7A 2A88A 4AS1A 2BTEA 1VBMA 3ZJTA 3VU8A 2R5WA 1LI7A 2C5SA 3IMGA 2Z09A 1QJCA 2Z3VA 4ZCTA 4OUDB 5KWVA 2PZBA 1KP3A 3CLTC 3ZIUA 1KR2A 4DLPA 2A86A 2CYCA 1HYBA 1OWMA 1OWOA 1U3CA 2QUHA 1N2JA 4KR6A 4KR7A 2E18A 1J21A 4Q93A 1KORA 3FOCA 1J1UA 1MC1A 4JYZA 4F3RA 2X3FA 1GAXA 1IH8A 1S4MA 1JECA 4CDMA 2H2AA 5BNZA 3KFLA 3FWKA 2VXOA 2OV4A 1IFXA 4EG5A 3AL0C 1MJHA 4MW2A 1CT9A 3GUZA 1GPMA 3INNA 4L2IA 3IOBA 1Y42X 4S1OA 1KP2A 1R6TA 1QRTA 3OP1A 2ZP1A 1U7DA 3PXUA 4DJAA 4PBTA 3KT3A 4EG8A 4R0NA 3ILVA 3KT8A 3CLRD 4R2MA 3RJZA 5TS2A 1OBCA 3FIUA 3P0IA 4UZFA 1X8XA 3N8HA 2JA2A 1O0CA 2X0KA 3IDFA 4R2LA 3Q12A 1V8FA 1KH2A 3P52A 1WZ2A 3Q4GA 3TQIA 3DPIA 2A1TR 4YP5A 3GMIA 5F23A 1N77A 2A7XA 5J59A 3FETA 3LE8A 1JIJA 3RHSA 1Q19A 4KKVA 3UMVA 4ZCRA 3DLAA 4L2IB 3FH0A 2AG6A 3AFHA 3CVYA 2A4MA 2D13A 1XNJA 3IUBA 3PRHA 1WKBA 1WXFA 1MB9A 1GN8A 1FFYA 1PFWA 3MLAA 3VRHA 4ND6A 2A1UA 1JILA 5FNZA 3A04A 3COVA 4EFKA 2YY5A 3SEZA 1VL2A 1PFUA 4FZJA 2G36A 4MUHA 4EG1A 1NUUA 3H9CA 3HGMA 1J20A 4MUJA 4MAFA 1G59A 3ZGZA 1T9GR 4ZCQA 1KQPA 3Q10A 2CUZA 1GTSA 4MLPA 2CFOA 4MWDA 1ZH0A 1F4LA 2DPLA 4WNYA 3S3TA 1ILEA 4MULA 1O97C 1FYDA 4YBRA 1H3EA 1EJ2A 1Q11A 2QJOA 2B7LA 3KT6A 3A05A 4HK4A 1O95D 1KQNA 1SURA 5FO1A 2PXHA 4HJRA 2O5RA 2WQ6A 2DERA 1EFPA 1MOPA 1JIIA 4MW9A 3ND7A 3UC5A 2A1UB 5J58A 3MUEA 1YUNA 1NZJA 4EG6A 1WQ3A 4EG3A 1JEDA 1OD6A 1O5TA 2NZ2A 4XFDA 2GOYA 2AKEA 4MVWA 1N75A 1J09A 3IVGA 1QTQA 2ZUFA 1GLNA 3H97A 1OWLA 3RFFA 4DDHA 4KPUA 1VBNA 4PBRA 1QRSA 1O94C 1R6UA 4MUIA 3MMXA 2WB2A 4ARIA 4E1AA 4K0RA 3COZA 1PG2A 3PNVA 1X6VA 4F4HA 3ISJA 4RUKA 1QNFA 4HJXA 1EFPB 2WSIA 1WXEA 5LM3A 3CVUA 2J08A 1KQOA 4NDAA 4XSVA 5H7XA 1P7PA 1G8FA 1N2BA 1YUMA 4XFJA 3JXEA 1UFVA 5TGTA 3FI0A 1G8GA 1IVSA 4JXXA 3PNBA 4A91A 4MUNA 1U7XA 3HL4A 1MAWA 2A1TS 3IOEA 1RQGA 3ND6A 3CA8A 4EGAA 4KPUB 3E27A 1N3LA 2J09A 3MXTA 4MWBA 1N2IA 3C8ZA 3NBAA 1WOYA 2J4DA 2YWCA 1U3DA 1F9AA 2GM3A 3N2YA 3BL5A 4ZT5A 1TQ8A 4MVYA 1DNPA 1JGTA 1J1ZA 5DASA 4MW1A 1PG0A 3I05A 3HMQA 1MB2A 1I2DA 1NP7A 3SZ3A 4ARCA 1JZSA 1KKUA 3N05A 3G5AA 2VTBA 1XJQA 2E21A 1M8JA 2GKSA 3SYTA 4OJMX
chains in the Genus database with same CATH superfamily
2WM3A 3IUEA 5LQSA 4IIGA 3E1KA 4RXMA 4PCAA 4EELA 1A27A 2K7FA 2MHCA 3PX3A 3AWDA 4Q00A 3KYCB 2OOSA 2YVKA 1KQGA 3B1WA 1GFSA 1E7RA 1BEZA 4MVJI 4DGQA 3G9ZA 1LK5A 4DXAA 4V0RA 1KIAA 2VTEA 4B5LA 4BKMA 3RS4A 1JJAA 3KLNA 5JNRA 1Y7IA 3TKYA 3EIWA 2OCXA 3JQ7B 1OGJA 1K4KA 2HI0A 1R0YA 1SBQA 3PTLA 3QYJA 4U2EA 5ALYA 3SIPA 1M10A 2I2CA 2QJFA 5EZYB 3KOOA 3PBKA 4KGDA 3WOHA 3EXG1 1Y3CE 3I9FA 3PE3A 1IUOA 3OU7A 4P3XA 1B0AA 2R5NA 4H3VA 4IKPA 3CIFA 5EERA 4D42A 2C84A 4JDUA 1ZJJA 3KOUA 4MO9A 3OZXA 3GNLA 2CFTA 3PJGA 2RKOA 4OO3A 4QFDA 5E2AA 5ULLA 3RV3A 3BCSA 4X91A 3TIGA 1C0EA 2OA0A 3SC4A 3F6CA 1F6BA 1C0LA 2CXSA 2DULA 3CR7A 1TYCA 3GGCA 4FIZA 4OQYA 1XZ8A 1H65A 3HG7A 3P2KA 4IFIA 2QI9C 4JVSB 4A8JC 3TI7A 2R6GA 4CMIA 2GYVA 4HQKA 4F5EA 3GQVA 1YR8A 4CIVA 2WP0A 3W0LB 3QVGA 5T7BA 3NEYA 2GASA 3BWBA 5G1PA 2IH2A 3N2GA 4LIPD 1P75A 3SXJA 3HU3A 1BD4A 1JZQA 1ULAA 1UZNA 1Q12A 3EUWA 2QYHA 5E2IA 4YDQA 2E0IA 1TECE 3MB5A 1ZD5A 3PNOA 4G23A 4IZ6A 2IXDA 2G4LA 3CS3A 4WACA 3EG9B 4TKMA 1B3RA 4JT9A 1U8ZA 1E92A 1FXUA 2H1CA 4L4SA 5IM4A 4NARA 3A25A 3WK6A 4J9VA 3NJ4A 4A0SA 1PZNA 3AQ4A 3ZKWB 1YNSA 4Q4JB 2MSNA 1X7XA 5C3UA 5TJHA 1YIDA 1S01A 4CTMA 3QVKA 1P8JA 1UBCA 2FW7A 2GAIA 1QTNA 4C88A 4UHHA 1KSFX 3ROKA 2SHKA 3HFJA 3NHPA 1C1XB 1ZNQO 3HS3A 2PK3A 3CX3A 2H7YA 5EINA 4IGKA 4EGQA 4F0JA 1XQ6A 5BNTA 1LC0A 3EIUA 4LOKA 3RS8A 1OFHA 1SJ9A 1WSAA 2JHCA 3CLHA 3O4IA 4IHJF 2P9JA 4B48A 4C4OA 1VPEA 5EKSA 4Y9TA 3HRKA 3LVBA 4F60A 3HKCA 3G6KA 3QXHA 3I32A 2HQOA 5KSPA 1WIWA 5B3JA 1Z08A 1DTEA 3K73O 1K4YA 4O0MA 4QYMA 3TNJA 4L5CA 3EPPA 5CT6A 1E6KA 4BE4A 5IG2A 1UQUA 1R8YA 2PKRA 2ZYSA 4WSOA 1NSFA 4ZODA 4EF4A 3AINA 1LXCA 2FLVA 2Q1YA 1UDAA 3C8DA 4WFKA 4RL4A 2RD2A 2AR7A 3K4PA 3L8ZA 3VYTB 2XADA 3K5WA 2DHCA 3REFA 1GQSA 5KMGA 1RM5A 4OIMA 5FF9A 4BMDA 5HVNA 2A8YA 3LHDA 4K8RB 1I7DA 4CQNA 1I1QB 2ZZMA 4BCCA 3WGUA 2WTNA 1FTWA 3WWEA 1BXZA 3H4IA 4LX0A 1W5AA 1KVTA 2R79A 3KQQA 5C9ZA 4MPRA 4AY4A 5ABPA 1UMDB 2I6GA 2RGAA 3ZD8A 1M2KA 3EJWA 1FQWA 4F86A 3GRKA 3PK0A 4F84A 1C2YA 3T9CA 3AOEA 1RLTA 4YRNA 2DVMA 5F1KA 3EMBA 5CP8A 1R27A 3E35A 2BN4A 2ZYWX 3EPRA 3FNFA 3OG9A 4Q16A 3GLFA 1A4RA 1VMAA 2AXPA 2DWUA 3UQZA 3MTDA 3BK7A 2NSDA 2OFXA 3AOGA 2DQKA 3KKEA 2GEJA 4HFJA 2HR1A 4MS4A 3G2HA 5DKFA 4OQXA 1O6GA 5FI0B 4BX2A 3CWQA 5CVTA 1ACJA 4AWXA 1DCMA 4BB5A 4LQ4A 1DWOA 4HAWA 1Y1TA 2OZLA 4ZVTA 2DF8A 4RMNA 4ZAVA 2FGKA 4G5YA 1WXQA 3L7AA 2OLJA 4H59A 3H83A 4CFYA 4YXWD 4YECA 2XOEA 3V8EA 2PH1A 4EMSA 1WB6A 2WLTA 3KC2A 4W5QA 5TQ0B 5FEMA 1YIAA 1LD3A 1X1RA 3AR3A 4IINA 5CLLA 5JJBA 1E1DA 5EHGA 4YMGA 1MRNA 4FDLA 1FXSA 4F71A 4XLLA 1IRXA 3ZBTA 1FTNA 1HL7A 4POAA 4BP1A 5EJ6A 1JDPA 2QUBA 2DR0A 4XGQA 3TVTA 3H99A 3QVTA 1CRPA 4GVXA 5KTMA 1CUVA 3L8DA 3Q40A 1EFRD 1E3DA 1FX0B 2BFPA 4O59O 4Z4FA 1JZTA 4MQBA 5GMOA 4HQFA 4V0MA 1A9XB 2ASEA 4OHOA 3R1IA 2AS0A 5F9FA 4AJ1A 1JVNA 5AESA 4PZZA 2IDMA 3D4LA 1EVLA 4MNTA 5DK6A 1E2MA 2IYNA 3DEZA 4F06A 5ELLA 4M55A 2IYWA 4URXR 4KHPB 1W4ZA 2C5HA 2HLHA 2YV5A 3FLMA 1YONA 2H2GA 2W98A 2IS6A 1SUCA 2YIDA 3B9PA 2WV9A 4O4JB 4JP3A 4MV6A 5A9SA 5C31A 5C7LO 4GOKA 1HYHA 3BYZA 3E4DA 4OM8A 3H19A 5SYMA 3C3PA 3P94A 4YA6A 5B1YA 1V11A 2R6HA 5HA5A 4MWZA 4MVJM 2D5CA 3BMQB 2EWWA 1UXIA 4NXMB 4TQGA 1GPH1 5EZ5A 4PIPA 3QFSA 1G8PA 1OTXA 2AJDA 3EDRA 3AHJA 5HW0A 3DZHA 2XYQA 2ACKA 3NBQA 3BJZA 2JFXA 3ORFA 1MV8A 4I1UA 1Z0SA 4BNJA 5I9NA 3VMMA 4HNHA 3QE0A 2AFHB 1DC4A 1EP1B 3AB7A 4BJHB 3NVDA 3GGSA 4CKCA 3BGWA 3HH8A 4JQSA 4TN5A 1QXSA 5E9AA 3UTDA 4UHJA 1T4BA 1QH1B 2HA5A 3EFEA 4WUVA 2G04A 2VAVA 4E5SA 1GGKA 3L6BA 1K6IA 1MMFB 1UDRA 1N8TA 2ZWOA 3L7MA 3BQMB 3P9SA 1TJ5A 4YN3A 4YJ2A 5J23A 1U98A 3FLBA 3KQYA 2GEUA 4P7JA 1RYEA 4ZXFA 4CJXA 4P3NA 1VHJA 1QK5A 5T4FA 5E8RA 3TQTA 5I01A 1P2DA 2OWDA 3OC6A 4ZMRA 4NLLA 2IPLA 4O2RA 4FE7A 3C5CA 4DA6A 4V1CB 1A7KA 1UEXC 1WHTA 2OT3B 5I7RA 4BWYA 3M4ZA 1KJNA 2XB9A 3C1TA 4B46A 1X7HA 3E7FA 5LZ5A 4BU1A 1XZHA 4KB5A 2CK3D 4UE2A 3NC1C 2OZEA 4B87A 1WSBA 3GDGA 1G4AE 1T1IA 5D51S 2EIXA 3DOFA 2BL4A 4RZXA 5IKXA 1ZUNA 3ODGA 2NXWA 3DFKA 2WU0A 4DLAA 1FYXA 3HCNA 4A2CA 4CVNA 2AOUA 2PJRA 2VAMA 4WECA 5P8WA 4F2GA 5EGNA 2WJIA 1PSWA 1ZSVA 2GCEA 1KETA 2D54A 5TVKA 4CR7A 4C30A 3BBLA 5JZ9A 2EZTA 1OI2A 1VYHA 3Q9SA 2F90A 4KO1S 3D02A 5DW3A 4ESEA 2QD2A 2QLTA 3HVUA 3N0RA 4QIHA 4BX8A 4L0QA 3IEVA 3VYUB 1YR3A 1RQ7A 1DKQA 3IPLA 4HD8A 4EHDA 4ZYVA 4ROTA 1MZPA 4BQIA 2ERYA 3PITA 5CNJA 3S99A 4WDRA 1F5SA 2XD9A 1DV1A 1FBTA 4XDGA 3EC7A 1KRHA 5LIRA 1JR6A 3I83A 4OHBA 3OT5A 5KWVA 2L42A 1RWKA 4OKIA 4DARA 5HZMA 3CLTC 3QUCA 4XB1A 1KR2A 4AMZA 1OW3B 3INYA 2QN9A 3LKDA 4FYWA 4O2AA 3TIFA 3WNQA 1W52X 3BHMA 5AK4A 4D56A 1YASA 4G97A 3CNLA 2NN3C 4Q93A 3Q0TA 1IBLB 2YRFA 2ZVPX 2VDQB 1IDN1 1U4OA 1M75A 3G3EA 3IEKA 3ENQA 4QFMA 3SGLA 2XNDD 4DYVA 2J0SA 4PFQA 2EGUA 1YE5A 3K35A 4RJIA 2X3UA 5FA8A 2PGAA 1V4BA 3VKWA 3UJBA 1XVLA 2X22A 1ZK1A 2QSUA 4DIBA 2GTIA 1G0NA 2W2NA 3HZOA 1OX4A 2O7VA 3CJTA 2RIPA 3BMCB 3BQ9A 3DEAA 3JRXA 1JSLA 2PZLA 3LPCA 4Q66C 3SE0A 1NNEA 2OHXA 1LWNA 3LVRE 1MF7A 2AEFA 1XOIA 3KHKA 3AERA 1KO1A 3G49A 4HDNA 1G9SA 2XDYA 2PYZA 2W71A 3ASVA 4N8EA 1NAHA 5EQDA 1V4VA 4RGYA 2HV8A 1YA6A 3O4GA 1P33A 3L7YA 4YRCA 1NSTA 3BFXA 2ZBGA 1BKDR 1B1CA 2ATVA 5DSZA 1S9HA 2NO1A 3E58A 1KZ6A 3TSCA 1JDZA 3R3SA 4UZFA 2LD4A 2WJHA 4M9RA 3MJVA 2JA2A 3Q0EA 1PVVA 3FDJA 4HQ6A 1ST3A 2GLUA 4O08A 2G1PA 1EFUA 1XRMA 3G5MA 2H7CA 4N65A 1SD1A 2DPYA 3TQIA 2GBCA 4ISBA 2WM2A 1S2OA 4KI7A 2P9YA 5B6IA 3PEUA 1LLDA 1KTIA 1VE9A 4LZJA 3V8NA 3DMRA 2TMYA 4BNFA 2RGGA 5JAMA 1DSSG 1NVWQ 2QMYA 4A10A 5M2QA 4BMYA 1ZVMA 3MOGA 3ZVMA 2OHHA 5AW4A 3Q6NA 3ADPA 4BQRA 3E9ZA 4IOKA 2IU4A 2V54A 2JFBA 5A6SA 4RTRA 3LC0A 3W4JA 1P7WA 2VJKA 3I01A 2A4MA 1O6ZA 4MOWA 4JI1B 4B35A 3TE6A 4ETMA 4L85A 4QRHA 1E5QA 3VPGA 3O2JA 4FCWA 3N2KB 3B3GA 2JDIA 4KWEA 4AG5A 4AUNA 3WNZA 4OIFA 3C1OA 3MWDA 5TSDA 1L7EA 2C9OA 2H06A 3BL6A 4NH4A 1N8NA 1I80A 1H0HA 2CZQA 3O1HB 3A04A 4K9OA 2OCIA 4Y2PA 4ER3A 1AQUA 1KMQA 3H2KA 3JZMA 4H60A 3ESBA 5DBEX 3GROA 1Y4ZA 2XE8A 3NBZC 3WKDA 1EXWA 4R40A 3R7BA 4DNQA 1Y9JA 4EHJA 3HGMA 4F8EA 4ONEA 4KDEA 3RC9A 3JS5A 3B6JA 3QXCA 5HBRA 2PXAA 1BGVA 1JHYA 2X8JA 5EA2A 4N5NA 1PJZA 4CM4B 1RJEA 2ZI4A 5A4IS 2V1UA 1KARA 3EF3A 5D6NA 4D43A 4FEEA 3CEAA 4PLPA 5DZSA 5FD8A 2O8BB 2IZ7A 1Q1ZA 4HBZA 3HJCA 2ZUBA 4FHCA 1MP0A 4TTJA 3RNLA 1S9DA 2FKAA 5BN1A 4BIIA 3AR7A 2RB4A 2QJOA 1UMBB 1CR6A 1PJSA 5FL7A 4DMLA 3ZZNA 4QEDA 3VQTA 5TPWA 1U0TA 2HBRA 4HB2A 5GV8A 3F5MA 4BKUA 4WW0A 4ALNA 1P5ZB 1C1HA 2YXPX 4R4JA 1XF1A 5G0WA 5AM5A 1CR4A 4CNQA 2YASA 3PL5A 4CLOB 4CQLB 1MOPA 3KAJA 1VB3A 5TIIA 4CU2A 1OZAA 3A6ZA 2ZEJA 1T34A 2C82A 1NP3A 1GOTA 1AQIA 3LBFA 2QIOA 5EXXA 5HMLA 1L1EA 5HSGA 4HGNA 3ZBPA 2A3NA 3AU8A 3PXAA 1DJOA 2I78A 2ZRPA 1Y3IA 1NOKA 2BY4A 3IVGA 3REOA 1V8OA 3EQ6A 2XUJA 5FNVB 1ICIA 3D2CA 3E8SA 4BPRA 5FKJA 5AK6A 2O1SA 3N2NA 3ELWA 5L3QB 2YWJA 1TJ4A 3BQNB 3I42A 4M3NA 4AO6A 3AVTA 4ERNA 5A03A 3B9RA 3DHVA 2AN3A 3ABQB 4IP0A 5FTMA 1E1RD 4E1AA 1Z25A 1KBOA 4MPDA 1Z13A 2TMGA 2V3CC 2NP6A 1PG2A 3HKEA 1FMCA 2FDRA 5IEBA 2AXEA 2XUOA 3B3JA 5DVZA 2E9SA 4EPTA 3ETCA 4L0CA 2DWQA 2Y77A 4YAOA 3K1YA 1MEEA 2ODTX 5FLEX 1C50A 1M2HA 2D1SA 2Z4RA 4OQNA 2V9CA 3FF1A 5AT1A 1XLUA 2PAAA 3W90A 2Q5OA 4UZSA 2GERA 4CKWA 3S70A 1APBA 3ZDAA 1Z06A 2BLLA 4FHFA 4BN0A 2J08A 2I6SA 5ALIA 2VHWA 2R0QC 4DAOA 5FI5A 3PX7A 1K88A 2DTDA 1UFVA 2B2CA 3R2JA 4IDOA 3V80A 4GFDA 3X44A 1JEOA 4IF6A 5JQGF 1GY8A 3WB9A 3PHBE 2VDMB 4K9PA 4MUNA 2BH9A 4LBWA 1E1QA 3SQLA 2GBFA 1WCYA 2C94A 1U1CA 1CLUA 4NWIA 5BSTA 1AOXA 1Q0QA 1PGNA 5D2CA 1DIAA 1GXSB 4CF4A 4FZ5A 1OFTA 5K1ZA 1M2JA 3N8NA 1YVPA 3ZGXA 4JYMA 3ZHRA 1QHGA 1O2DA 1YCGA 2C99A 2YCLA 3NW9A 2ZYVX 5A0TA 3BD7A 3WGNA 3UXEA 4XYEA 1BWQA 3NRJA 1MB2A 1K0UA 2IKQA 3PS9A 2XNHA 3QW2A 5LWHA 1YCDA 4FN4A 1S8AA 4LTMA 3N05A 4S2UA 3AF3A 3ZHYA 1T4CB 5U1PA 2W42A 4TVKA 2HBYA 1SZPA 1LPPA 1BN7A 1L5ZA 2IU0A 1HY3A 3EXFB 1E4EA 2Q0HA 4AT1A 2QW8A 2IHTA 1WE2A 2PNFA 1ZWLA 3RF6A 1FQKA 1JEEA 1G21A 1IBSA 1PQUA 2OVBA 4BO5A 4JMLA 1NVXQ 1SCUA 1WV0A 1S2IA 4PANA 3D0RA 3CBGA 3OPYB 2B4KA 3EQZA 4UHDA 4FDVA 5ES3A 2GCIA 4ZJZA 1XZAA 3VJRA 1JHPA 1YI8A 3RO7A 3VU3A 1GZUA 5IUNC 1T9KA 3TLMA 4PY2A 4J29A 5KTRA 2QD4A 5F4BA 4BVLA 1EWYA 1DU4A 1UR5A 2JFYA 3KWJA 4ETIA 5JCOC 2CXUA 1ODTC 1HFEL 3NAZA 2O2CA 4IAOA 4ZVRA 4YT2A 3BIFA 1KAHA 4HX9A 4ZYLA 5E7IA 1YS2X 4PAWA 3ZCXA 4ZYTA 2APJA 2NUTB 1MEOA 4LEIA 2RBKA 3FTFA 2A0KA 3I6BA 4NPHA 4ZAXA 4B3RB 3CVOA 1IHPA 1LS6A 3PFGA 5BWNA 2NM0A 1DUSA 3UANA 5C4MA 4OLAA 3TZCA 1VJTA 4EENA 2RHMA 4A0HA 2DR2A 3KKQA 4KDCA 4P33A 1R9JA 1Y6ZA 4LWQA 1RYDA 3ROXA 2V6GA 3TQCA 4CT0A 3M6WA 3LECA 1GV1A 1M8KA 4QA9A 5TS3A 3S29A 3H17A 1LLFA 3RLFA 4MLZA 1YE3A 3ZQJA 5AYVA 1PX0A 4FZVA 4R51A 3AKDA 3R3HA 1UFOA 2IU3A 1BYUA 1YB4A 3O3MB 2DCMA 1V8PA 3P20A 1I4OA 5JCOA 3BWYA 2G67A 2QPOA 3V2GA 5JMOA 1M2VB 2GK3A 4RVHA 4C9BA 1KU6A 1RWPA 1U6KA 2Z56A 5TQ2A 4D3ZA 1HBJA 1HWYA 2B7BA 4RL6A 5I6DA 5LKRA 4FS8A 3O74A 2ZJ6A 3W1EA 1ZXXA 4IH1A 1J49A 2AHRA 4YRBA 5A62A 2OD9A 3EMDA 1OMOA 4IEFB 1F20A 5EJ2A 1K9VF 4C4XA 4B4WA 3HZRA 1P3JA 4S3MA 4DQVA 1QF9A 2OHIA 3DWIA 4C0HA 2REQA 3VNBA 5EHXA 5L7TA 4I99A 2PO7A 4ZK6A 1ACLA 4TROA 1BXRB 4BFXA 3VZBA 1YC5A 4CLXA 2AGVA 4JCCA 4AZ3B 2FK8A 3QWHA 3CLVA 2CN1A 2JAQA 5HGXA 2QRUA 3QJGA 3FGOA 4D74A 2IQIA 1WMDA 4TYYA 1JMVA 1EDEA 1Q5PA 4G81A 5BN5B 1XTKA 5K0ZA 1OZGA 4FX5A 2GF9A 1NUAA 4LSGA 2GD1O 1M2OB 4PYIA 3TVYA 1SHLA 4UNQA 3EEQA 4AXBA 4BHTA 4U0KA 3R5JA 1IK4A 2UVPB 1JJVA 1CY0A 2QE6A 3EZ7A 2BF4A 4B2YA 1B3BA 2KB0A 2VDRB 1VJDA 4CUJA 2QNBA 5JFOA 3PUJA 1OXBB 4TS9A 3FGZA 3UJ8A 4E88A 5C8DA 3LO8A 3MCVA 2FEXA 3KPJA 2ZZNA 3AMVA 4I0WB 3IP7A 2R1VA 4A26A 4OXKA 2FPXA 4O3MA 1NOIA 2ZYIA 3HP7A 1ZWKA 3MT9A 2EFEB 4I6GA 2YQ5A 4PCLA 3OHMA 4P0TA 4F11A 1E7YA 2PX5A 3CGWA 3R44A 4ALIA 3UJHA 2VF4X 3JY6A 5H59A 4UTRA 3ADCA 3UAZA 1X39A 2G09A 2JFQA 1LK0A 2FI1A 3GY0A 3D5QA 2Z4SA 4RK1A 1RQPA 2MMCA 2XTNA 1F60A 5AXDA 5A4JA 5THKA 3F9IA 3RT1A 1B6SA 1VHQA 3ASZA 3I23A 5FBKA 1T6YA 4YO7A 4P08A 4EH1A 5KAMA 4CEHB 5WRFA 1V1MA 4GMGA 4BATA 2C7RA 3OM9A 4U7WA 2BF7A 3MOIA 1SCQA 4XGRA 3WK8A 1TVKA 2PVCA 1Q3HA 1E77A 4YROA 1ODCA 2VBIA 4RE6A 2HA7A 4DUYB 1VLMA 3MMSA 3V1TC 1YBMA 1VXOA 2G5CA 3DBLA 1CRQA 4YMWA 3FHJA 3O9ZA 3QGMA 1WXGA 4FILA 2O6LA 2CYAA 4LFBB 3NCTA 2D4HA 3QYPA 1OOEA 3H5VA 4B3FX 2DH6A 3OT1A 1OH7A 4I6EA 3QMWA 5G3YA 2PSHA 4RORA 3RBXA 1SU7A 1S2GA 2WYUA 4JVNA 3MJEA 4DYDA 1TAHA 3VNQA 1YULA 4JYCA 1BXGA 1NI4B 5MFPA 4II3A 5JR3A 3G89A 4GYWA 4Z4GA 5B3LA 1ZXLA 5IARA 4GI1A 3VPXA 3FTCA 1FJHA 1L4UA 5FPHA 1OGYA 4IGIA 2UXDB 1M67A 1XMSA 1EFKA 4BZPA 3AIIA 1DWUA 3I6YA 1XZFA 3JQ8B 3K96A 2FCAA 3OX3A 2BFCB 2MIIA 5ETJA 5TDHA 2O59A 3BICA 5ICGA 2RONA 2IJGX 3R3YA 2ZJBA 1T5LA 4YJGA 3L8EA 2OZVA 4UNSA 3O94A 3RVRA 2V6FA 2UUBB 4ZO6A 4COKA 3E3AA 2OTCA 2FPMA 3OWOA 1SD2A 1IN7A 2VP9A 2VYVA 3NAQA 5I45A 3AUAA 3BMOA 1XKXA 3KZMA 4S0XA 1G5RA 1KH3A 2NSHA 1FXWF 3P97A 5ER9A 2NACA 4LVCA 1E5DA 4BUCA 1C7ZA 3W9UA 3I2KA 1OXUA 1TW3A 4W7SA 3VVMA 4JEIA 3LCVB 2MYNA 3UWSA 2D7CA 5TX7A 5KNCD 4EYKA 5B3AA 3K31A 1XU4A 2DFPA 2DLNA 3ESRA 4D0GA 2Y92A 4Z49A 5JOQA 3AHGA 2WJ6A 4LNUA 4H7IA 5AHRA 4KX3A 1KKLA 5DP2A 3CB2A 5JRDS 5JNVA 9LDTA 1RACA 1KY2A 1SK8A 1II0A 1V47A 1SCJA 4UC0A 4EJ0A 2JGDB 1RZRD 1RXIA 3RQIA 4K6FA 4INPA 5JATA 2MJLA 3SNKA 1ZCJA 2YFKA 1EDBA 5JUWA 1N7HA 4ECAA 2X0NA 2FETA 4PQEA 3SSNA 2GHIA 2P2NA 3ROZA 1WCIA 2OBXA 3L0CA 3T3EA 1LDMA 1EGHA 1ZOSA 2G9QA 4KSCA 4QQKA 4YRRA 3X1KA 1TYBE 1KJWA 3EXHB 4ZU3A 5HIMA 4P9NA 3Q9LA 5ALNA 1VMDA 3OZIA 3KT0A 2GILA 3NUZA 1K7CA 3U5TA 4CL0A 2FEAA 4E12A 2A0WA 1NNLA 1G3IA 1X19A 1THZA 4HPWA 1YMQA 1Z6YA 3HJHA 3OCWA 1FDIA 3HZHA 2P41A 1UWVA 3O8RA 1J0XO 1Y3FE 2QTMA 4J1NA 2HHAA 3R5TA 2R7AA 3QTBA 4WKNA 4MIKA 3EIXA 2OD2A 3QLJA 1AUOA 3IC5A 1OBHA 1J9GA 1K4MA 2P91A 4I2NA 1XRPA 4QYWA 1YWGO 1E5TA 3G0BA 2W4IA 3QMMA 3HM9A 1PR2A 3HO6A 2V6MA 2NPOA 5KNBH 4A15A 2Z2KA 4ZQFA 4RPCA 1XTIA 2BEVA 4RM3A 3AXTA 3VKGA 4MW7A 1XDDA 1ADJA 3PQ6A 3A31A 1AK9A 1NVFA 4IJKA 2GZAA 3QNMA 1PJQA 4US1R 3RVLA 2PYIA 3FUCA 1U94A 3GEHA 5AUNB 2EX4A 4OEHA 3C48A 1TUBA 1XVIA 3OE7A 3G1WA 5ALTA 1OA0A 1VG1A 2Z30A 3WHPA 4JV5B 2YBDA 1VCHA 3DMNA 4ZA2A 3RU3A 2HMSA 4AS1A 1BEEA 1ML3A 2NUBA 3CKLA 3GHYA 2R5WA 4U9UA 1X8JA 3MPUA 3RTEA 5HCIA 3ZWOA 4R81A 5TC4A 4H08A 4OI4A 1IXKA 1QIEA 3D4IA 4RFLA 1W35A 2Z09A 3DV0A 4RNDB 3VSAA 1XCLA 2AYYA 3F4LA 4H7KA 4BFLA 3WWCA 3HUTA 1ZA2A 3I6MA 2GAFA 3PE4A 4FR2A 3H8WA 3ETLA 3NNDA 1B73A 4MLCA 3SZLA 1T2UA 2YOFA 2MSKA 3K71B 1BRTA 1E2DA 5TJ9A 4WQMA 3V3KA 5CCXA 1N34B 5LDDC 4HZUA 5LIPA 4F21A 3BFPA 4YACA 1JHRA 4MQEA 2V6BA 2QGFA 3E1GA 4I4TB 1PT8A 2FFHA 1VL0A 2Y1FA 2ODEA 4Z54A 4CE6A 4MQ4A 4DWJA 2QZ9A 4HADA 2XVZA 2FW9A 4AMVA 1BMTA 3AY0A 5ESRA 4BBJA 5BNZA 4LF9B 1F5NA 3FUVA 2FP3A 4G0XA 5FP0A 2GPSA 2P2YA 1DQRA 3P26A 1O94A 1K68A 1M1XB 1AKTA 2QN3A 4MW2A 3AL0C 2QL5A 3HJBA 1YZKA 4J90A 2VNKA 3LSTA 3EC1A 2W0SA 4OHYA 3MJHA 5EIEA 4MB0A 4J7UA 1JHQA 4P4SA 3AESB 3GMDA 1ZO8A 2PRJA 3OCVA 3Q7SA 2GTPA 1OYOA 2I4IA 3LA6A 4J6EA 4C6TB 1TA9A 5M7EA 2C59A 1IJBA 2X0RA 1WZUA 1XJWA 7REQB 2R97A 2LV8A 3CPSA 4MAAA 4MJXA 5AR1A 1P6XA 4B4DA 4TSKA 1X38A 2NQTA 3BERA 5HJEA 2UAGA 4WKBA 2BGTA 5LL6P 1XALA 1HK7A 1XAJA 2H1WA 4NV1A 4WFIA 4OHFA 2ODQA 1ULUA 4IJMA 2SCUB 1VOTA 2JK1A 3JAMA 5EJAA 1KH2A 1MZVA 4LRQA 2WJJA 4PFJA 2ORVA 1Q0ZA 3VHXA 1T9BA 1N6HA 1QE5A 1Y1LA 4K7JA 4JQOA 3OEEA 3TN7A 4LJSA 3UMGA 3UPDA 3C6MA 4A92A 1YRLA 2QTHA 2I9PA 1LUAA 4LXUA 3R7NA 1VHLA 3O1JC 4IIHA 4LHXA 1SZDA 2VRCA 3HCEA 2XYHA 3D1JA 2B4YA 3QENA 2QYOA 1XJCA 1Q19A 4KKVA 4OJQA 3EBPA 2J5XA 4A8JA 3PXEA 1KGSA 1PT9A 2HWWA 3DLAA 4HPJB 1PBTA 4DF3A 5LDHA 4EW3A 2FFQA 5FOTA 1N2CE 1XXHE 1Z7YA 1ZIOA 1X7ZA 4O2LA 1U7TA 4C3ZA 4EO7A 3INGA 3OQMA 4IHAA 3ZX4A 1HG1A 2QHXA 3QEMA 1GN8A 2N75A 3VAYA 3A3PA 2W0MA 2FPGA 3O7MA 4LRYA 3PQ4A 1CETA 2VQ6A 2XY4A 4L8LA 3WSWA 5AVTA 1NT4A 2HXSA 3IV6A 5FUWA 4EVSA 4YWHA 1K7YA 4TVSA 2FWJA 1H2FA 2VYQA 5HJ5A 1DKRA 2P90A 3S5UA 4QO8A 1G59A 1PT6A 4R6WA 4EECA 1Z4KA 2CUZA 1BE1A 1UAAA 1V16B 3GZNA 3KB1A 2JJ2D 3HFGA 2DHQA 3DF9A 3L0IB 3PCXA 4MULA 1MJNA 2PDAA 1K66A 3AIMA 4M38A 1G2IA 3SPXA 4M1EA 3TWOA 4YBRA 4Z4EA 1RTTA 1PR4A 3TRDA 2G71A 1NYQA 3VFDA 5L3SA 3V4LA 3EGXA 2W2KB 4P4TA 4HT3B 1KOGA 3KJGA 2OD7A 4FFSA 1WMSA 1T9ZA 3PQ2A 1L2TA 5TF4A 3K6SA 1CUXA 3TMKA 1MB3A 2PSDA 3JYNA 4PNPA 4Y6RA 2QP3A 2AX3A 2GBGA 3ZJ5A 5I3CA 1JB9A 1Y4SA 3PD1A 4RY0A 4HUQA 2ECFA 3L5KA 2XB8A 3RS3A 3IKTA 4ARVA 4JLOA 4R2WA 1C9DB 3W6ZA 3DD1A 1U3UA 2J4CA 1J2YA 2GOYA 4MS1A 3JCZA 2XB2A 2F1JA 3P9CA 1SVNA 5KTTA 3DBRB 4DIMA 4E5DA 3DTTA 1GZHB 1U7PA 2BONA 3L8HA 1D2EA 5THXA 2VUIB 1QLJA 4DDHA 3E81A 1BN6A 2R8YA 1JRLA 4DWWA 3PGA1 1QPZA 1Q50A 3C6QA 3X1DA 4C4YA 4YRAA 5DLDA 2D2VA 1RHQA 4ARIA 1O8BA 3S5JA 4IMRA 3EEBA 2Y1KA 2Q3JA 1UXJA 2IYSA 3CKMA 3N39C 3UQYS 1BNCA 5FI1B 2M1ZA 3WNVA 2J9FA 1SQGA 2RGUA 3LBIA 2CL6X 2O0JA 2JF0A 2Y93A 3C3JA 3B1KA 2QVGA 5D1HA 2GCOB 3SC2A 2A9QA 3R6DA 1QMGA 2Q3BA 1EFPB 1KMMA 3TOVA 4IDQA 5DBGA 3VI4B 1I2CA 1TT5B 1XVVA 1RT9A 3RU2A 4LSZA 3ZD9A 3EGOA 1WXEA 1L7VC 3KYCA 2H1FA 4HMOA 4HGYA 3VPSA 3CUYA 2A3RA 1M54A 3NIDB 2QAIA 5F12A 5D7NA 1IEQA 3HGTA 5CFRA 4KQXA 3JVVA 2WU3A 2E87A 3T5DA 4RDXA 2W00A 3CE9A 3RTBA 3FHTA 1T8TA 5LBTA 3QPBA 3PUHA 3ETGA 1PF7E 4BNWA 4I7EA 5CA1A 1E79D 1RC0A 2E85A 3GNSA 3DMPA 1RQGA 2TECE 4KVFA 1RU3A 1P0IA 4KPUB 4LMRA 4MWBA 2JASA 4IS2A 4ZN6A 4JJ6A 2BKLA 3T9EA 3EH1A 4RKEA 4RDCA 1JX6A 4OYYA 1BX1A 2ECQA 3FPGA 3H2YA 5F3RA 4BYGA 3GLUA 2OYRA 3DTVB 3LX8A 3ANYB 1NR5A 5CK4A 1I2DA 2Z3ZA 1OBVA 5B1HA 1EVQA 4HTAA 2WJYA 5LPNA 1A96A 1R6VA 1XC7A 2CLKB 4IXTA 2CL5A 1GCAA 4LSWA 4M0CA 3U7QA 5KVAA 2OPBA 1TDJA 5A3SA 5TY0A 3LK7A 4OU5A 4IL5A 1QHNA 2H63A 1FDUA 5IC6A 1A4IA 1NG1A 1I13A 4C2TA 1NF9A 4CRWB 3TZLA 4NJMA 4PC2A 1U6IA 2O1EA 4DLBA 2WYOA 3BMNB 5KPDA 1E9FA 3Q8KA 1U0BB 4ME6A 1WDMA 4FBGA 1IMJA 2QD5A 4QPCA 3KQHA 3HEMA 3IVMA 4TUYF 4C4TA 4EHIA 1IQ0A 3EG9A 2O2XA 2CD9A 4MR9B 3DVRX 2ISQA 1V2GA 5D8DA 1H3NA 5JD4A 4NBLA 1DEKA 3ZKWA 3IAFA 2YFYA 3K1TA 4CMJA 3HKDB 2ZQZA 2CXTA 5B12A 2CF5A 2BUAA 1V7PC 2E6UX 5C46F 2FOLA 2IYXA 4FYJA 4QUDA 4EUSA 4LJKA 2QMEA 3M33A 4G0PA 4WE3A 4BTVA 4O1HA 4ZEVA 3A4LA 2IELA 4I1OA 3QPVA 1ZGZA 4AO7A 7YASA 5HTOA 2C57A 2WYWA 1L4NA 2W6PA 3NHBA 4QOSA 1PEKE 3S2YA 3ZV7A 2IYUA 2UYOA 3IQHX 4B3DA 4ZCSA 4E5MA 4MYUA 1T2DA 4U63A 3SS8A 3WMRA 3ZCVA 2J3LA 4R31A 2OZKA 5LCXA 1ZN9A 3RFVA 1QCCA 3BB1A 5FBLB 2GN4A 5BPFA 1OI3A 2W70A 4TSFA 4Q47A 4DS3A 3VXKA 2XEXA 1YZGA 1USKA 5IFLA 1ZOLA 2C1XA 2PZ8A 3GIWA 3L92A 5BNWA 2PUCA 3N58A 4N9WA 3PUZA 2WTEA 2G63A 5JZVA 2Q7DA 3FE2A 4UNRA 4FYXA 1H4QA 3IKJA 4D0NA 4E13A 1OTHA 2P3QA 4X97A 2OM6A 2SKCA 3VGJA 1UMDA 1GQOA 3EUAA 2ZJZA 2ZWAA 3II6X 4OBWA 4PZYA 4Q9HA 4X5OA 3UTCA 4MJLA 2WHRA 5KKNB 2JIZA 3R3WA 4TL7A 5DNVA 1VKOA 2XCOA 4AROA 3IBFA 1EB9A 5KPJA 1DJNA 1DO0A 1S8FA 4DQXA 4YGXB 1AZSC 1P3DA 5CB6A 1O1YA 3FKSD 3Q0IA 2PN1A 3V1LA 4BX3A 4YJHB 5TMEA 3LBHA 1EIZA 1CUGA 1RIIA 1SD5A 1WO8A 2MINB 2RJNA 2ZE6A 3DYVA 4WXMA 3DFMA 3TLXA 1N6NA 1KYYA 3V97A 1TTTA 2JL1A 1H23A 2VP0A 2AW3A 4RY8A 2PNJA 4UNPA 1P0QA 5H0IA 1YFLA 4DV7B 2CDAA 2O3JA 5BWBA 2GAAA 2AE2A 4Y1RB 5K0NA 2GXAA 1PR3A 4GOXA 1JSRA 1ZVJA 3URKA 3WLTA 1W30A 1BOFA 5A71A 3RRYA 3M6VA 1UKYA 1X1SA 2V4MA 2ORED 1OWNA 4LKRA 4KQ9A 3VSCA 3QMPA 2CV1A 3MWEB 3U26A 1MUUA 2Q5HA 4FYIA 1ZMBA 1DI0A 1I10A 2M9MA 5DYNA 5ECGC 2B4AA 4D6PA 2XDQB 5JY1A 1GEGA 3M6AA 2PMCA 2A84A 2XXAB 1BW9B 2NYAA 5AVZA 1A9XA 3JYLA 2TS1A 1ZD4A 3GLFE 3RKUA 1T3GA 2QTBA 1BDHA 3MOSA 3K5HA 3R0VA 4JEUA 3ZWPA 2ZPAA 3U44B 1BSVA 5L53A 3EULA 2VJAA 3PFCA 1UKEA 2B35A 4GOMD 1JDSA 4FOOA 4O4JA 5CCBA 4KH1A 4KXMA 1BRMA 1WD5A 4MV9A 3SG0A 2R6ZA 4MB2A 4YONB 3OLQA 2FQQA 3AM4A 3I4CA 5JT1A 2ORIA 4Q24A 4CT4B 1DL5A 4DLKA 4XQCA 2CVHA 4ZZIA 5AVWA 1LNQA 1AE1A 1UAGA 3GEBA 5JNSA 3ANTA 1NM5C 3DNPA 5TMBA 4EB0A 3I64A 3UCFA 1QONA 1FFXB 4OBEA 2X1LA 3QKWA 3TTWA 1NUHA 4DE5A 2VBCA 2XCIA 4Z9YA 2ROQA 2WFMA 3B9BA 1JEYB 1VP9A 5I9SA 3N9IA 4RKRA 3IQDB 3PVZA 1TM2A 2AFHA 3PGXA 1YJXA 3ACCA 1FUUA 1VLHA 4M8SA 5TEWA 3AKZA 3OWXA 3HFSA 4UVEA 3USES 2H48A 4PF1A 2J0QA 4YCJA 4Q18A 2BHRA 4NY1A 2AUTA 5EUMA 2JLUA 1TYAE 1QH1A 4ZVLA 2I7VA 1BVRA 4HWGA 3R0XA 4HNSA 4V0ME 4KGVA 4PVDA 5I4BA 4C78A 1Z6GA 5HNKA 3C6XA 2XZOA 3HYTA 1LTQA 1RHUA 3D8UA 5DWQA 4IJUA 1NM5A 5AKJA 2YTZA 4ZYWA 4GICA 1GAQA 2ZS9A 3JD3A 3L93A 1M6EX 5ELMA 3T1TA 3A4MA 4B6FA 4XJSA 2JGIA 2B36A 3ZU5A 3KAQA 4HAIA 1ZOOA 2CNLA 2NU7B 3M4XA 2COKA 4EFNA 4V1CA 1NBIA 2WSBA 3NCHA 3ZNQA 1QIHA 1EWQA 3RSQA 1JQEA 1IN8A 2VSQA 3BIJA 1GG2A 4KQCA 5T67A 3PZRA 3LDFA 2GRUA 3IRVA 1Y1RA 4MGYR 5H3LA 1ZM7A 4F3NA 4RQUA 5KWJA 3ZE6A 1YQDA 3IUQA 2G25A 1N2HA 1B2LA 3QBTA 3R7AA 2HK7A 2W83A 5KSOA 3P9IA 4IOJA 2W8BB 1JDVA 4H6WA 4OH7A 3VMFA 1UJ2A 4N76A 1PVOA 4JENA 4JFRA 1NOJA 3O95A 3VBCA 1T29A 1TGYA 2ZRQA 2EFDB 1AGYA 2FWNA 2P4QA 1ODJA 3AVQA 2HTFA 5E4FA 1GU7A 1L5LA 1EWKA 1ZAYA 2J9RA 1DIHA 2YN0A 2NPFA 1ORTA 3O8QA 3IAAA 4KQWA 1PYDA 1WXHA 1YJCA 1ZS9A 2WWGA 1A3CA 1T9AA 1DG9A 2Q2QA 5A9TA 4AYTA 3A9UA 1P8AA 3OZFA 1A9SA 3S2FA 3V4OA 3PP8A 2ZXFA 2W2LA 3OTOB 1RLMA 1E9EA 2JGJA 1S89A 4ND5A 3OUUA 1RKVA 2VAPA 3SSMA 3ZK9A 1N1DA 1U3WA 2FWMX 4N7RA 5IJ0B 4UAVA 1XRNA 3KVOA 3PHJA 1KEEB 1TKCA 3AVUA 5GJCA 1KSGA 2NZ8A 1G5TA 1NRWA 2EJCA 3U37A 1LLQA 4KRYA 4EYSA 4HNTA 4EKDA 4JZYA 1H85A 1ETHA 2WHYA 4YP9A 4HWTA 5CIQA 7ABPA 1T26A 4IXWA 1G6OA 1VDMA 4TXMA 1D09A 3UC9A 4ZMBA 3G2IA 2A14A 2AK3A 4B44A 1G98A 2R68A 4OGFA 1DELA 2WSMA 2AVDA 4CM1A 1EMDA 5AXBA 3ZY2A 4N0QA 2DAPA 4X60A 4CN9A 3K9FC 3CN9A 4GDFA 4RD1A 3IBYA 3MEQA 1EVKA 2NMVA 1I3LA 5AIAA 4ZEOA 3RT7A 2QUZA 3CH7A 3CLSC 3T9DA 2QTGA 3T95A 4R98A 1P61B 1KDRA 1U2GC 3BKXA 1GSOA 1R9MA 3BMCA 4IZOA 3QKRB 1UZLA 3Q3EA 3E0QA 3MWYW 3VDQA 4NCAA 2AI3A 3DE6X 3NUQA 2AOXA 4DG5A 1ZD2P 2KQUA 5H70A 4DHEA 2JGNA 2QPLA 1D2HA 4DFDA 3RAEC 3LZDA 1WVMA 2A9JA 1K7FB 2I2AA 4UUPA 4D9MA 5KREA 3SR4A 5M5BA 5KQPA 2QSJA 4LF6B 3HCBA 1KEVA 4MMZB 4CG3A 3P5SA 2YNMD 2VDLB 5ALXA 4TM7A 1JWBB 1ZN8A 4HQNA 3IT1A 5SZHB 2XXBA 4GUDA 3TEJA 4IICA 4A5OA 1TEHA 1HNXB 2IIBA 2PMKA 5AUPB 3HO8A 4WKGA 2UZIR 3TTXA 2XYRA 4DBLC 4L8VA 2Y1XA 5CD9A 1VPWA 2H2AA 3AP2A 1M0TA 2PUJA 2Z5GA 4B4VA 1VI6A 2B0JA 2FSUA 4E22A 1N7IA 3U4AA 4Q3NA 2R2AA 2EARA 2RHDA 3EVEA 4CG1A 2X1HA 4JJGA 3GUZA 4BFUA 2ZPTX 2QLLA 1RYYA 1L4GA 2A9RA 3QJ5A 4PSCA 4IZIA 1BFKA 1JH8A 2K2WA 3D4PA 4FGKA 1V5EA 4DT1A 2VCEA 3N2KA 2HZBA 1CNFA 4R05A 4GYYA 4GX2A 2P4SA 4WOJA 1PG5A 2JAPA 4FYKA 4DOMA 2J0UB 3V3TA 2Q0XA 1RWBA 5GIOE 4WFQA 1L5KA 4PC1A 3U1BA 3E3LA 2V65A 4RCYA 3T38A 4X93A 5LQRA 3TLJA 5B1IA 4ZIRB 5DXJA 4UCXA 2GXQA 2ZSIA 421PA 2PBFA 2NADA 1V8DA 4WPGA 3TLYA 5FTLA 1K2VN 3K5IA 3K09C 1YCHA 4FE4A 1GGEA 2VI5A 1I94B 5GJBA 2VJOA 3Q12A 1KC1A 4JR1A 4HRYA 2MDTA 3JQFA 4OK6A 3SICE 3ZVKA 1T4GA 2E5FA 3SJBA 3T99A 4CM4A 1CP3A 2HPAA 2VDPB 2IY9A 4MSUA 1NFFA 1IXRC 2IYOA 1JHAA 1WD7A 2PSFA 2O8BA 1DARA 3NVKI 4L9AA 3N76A 4HEJA 4F72A 3OBIA 1JXQA 2W2PA 2BWJA 3O8LA 3WGYA 2ZJOA 4DV4B 4PO3X 3LQ1A 1UMBA 1YVEI 3FH0A 4NYIQ 4A27A 4AZSA 3AVXA 4JYAB 1YB6A 5E9QA 1OUMA 1MH9A 3AUYA 2QQEA 1HUQA 3SI7A 1ECGA 2BVNA 1H9CA 3PRHA 4HSGA 4CLOA 3EFHA 4X3OA 3ZGYA 1WXFA 4CQLA 1RAFA 5A4KA 2BI4A 4BVAA 3EAGA 1PFWA 2B8NA 4M1WA 2FFJA 5EIWA 3WGMA 3VC2A 4QAJA 1NJFA 3T1VA 1NY6A 5HRAA 1P0MA 4AQYB 1BXKA 3HDTA 2J32A 2NOAA 3KNZA 2J6BA 4YTEA 3CEHA 1XK7A 2G36A 3KKKA 1X86B 1QKIA 1V5GA 5L6LB 4B80A 2R8RA 3V55A 1E89A 1JAZA 1IJEA 2FG6C 1XR3A 2VPPA 5AOCA 4B6JA 1EINA 3PFHA 4IO0A 3FBTA 2JI4A 2O7QA 4QSMA 3VYSB 1NX9A 1UBNA 3Q2KA 3OE4A 4N03A 1OC2A 4X7PA 4G1BA 5IXJA 5LVAA 2J9YB 4X3PA 4XSGA 1PFGA 1HOXA 3LZ6A 3T12A 3JZDA 3OCCA 1GKIA 2DFKB 4HZGA 2BEJA 1OBFO 4NNOA 2CNWD 5FUMA 2D3WA 1U2EA 4JOCA 2WJZB 1H4TA 3ABSB 4EKGA 5EP3A 1O95D 5LU9A 2VP4A 1W2GA 4OQFA 2IY7A 2WY2D 3SY8A 3G2NA 3NHSA 3GLQA 1ZISA 2EJTA 4LHWA 4KMMA 1IUPA 1DC6A 2R62A 4MW9A 1VPTA 4TWBA 3HQ4O 1E6EA 3BRCA 4X20B 2E4WA 2A9KA 1YUNA 3M6MD 1FJ2A 1YT5A 4PQRA 4LHZA 4QE3A 1HDGO 1IG0A 1TCBA 4RK6A 1K8YB 4X8MA 1JSXA 4DRZA 2JFZA 4N8SA 4EA7A 5JROA 3ILYA 2XUPA 3C98A 2BCGY 3OF5A 1HX7A 2PS3A 2FP4B 2VNHA 3MN1A 2P1ZA 4ERXA 4M0DA 3U4MA 1AF4A 1QF6A 5JV5A 5L7WA 2EV9A 2C88A 3ED1A 4ZYZA 4EHAA 4TTQA 5KVCA 3NMUF 3HP4A 4LDJA 3KQWA 1Z2PX 4ENTA 2WF7A 2IQ5A 1GXSA 1LRKA 2B34A 2X9NA 3A10A 3HRIA 4RAOA 4EFKA 5EHZA 3ASYA 2TRSB 3PGVA 5LWQA 4PZLA 2GLXA 3CUWA 3H8JA 3OKPA 1JLLB 3THWB 1TO1E 2FE4A 3CQ9A 5C5CA 4F3TA 4D9JA 1ZGGA 1NVDA 3EGIA 3R0QA 4MRRA 4OMFG 4I2VA 5COQA 4YC7A 4KCGA 4YNBA 3FVQA 2WILA 2DUJA 1T15A 1GNSA 2OCLA 3IRUA 3QSYA 1EJ0A 3A6GA 5DYIA 3K5PA 1T4CA 4JLAA 3KLMX 5J1SB 1GPAA 3CF4A 1ODFA 3EXFA 1FRVA 1TMOA 4MICA 3CH6A 1H6CA 2JLZA 2YN4A 3IX7A 3PGLA 4QFBA 2H18A 1CG6A 3CW2A 4ND2A 1CUYA 3AF6A 3SHFA 2Z43A 3ME5A 1PL0A 3NYRA 2QYTA 8LDHA 3TR5A 13PKA 4JT2A 3EXAA 4OSOA 4YJDA 1A9TA 1ANKA 3OPYA 1GG8A 2YC4C 1SCNE 3L6OO 1AQLA 2AQIA 5EKTA 1MAWA 1LBEA 2QVCA 1QOPB 3OLCX 2YC2C 3IOEA 3ROFA 4BQSA 2I80A 4M6WB 2JCGA 2XWQA 2A6PA 2VH2A 4FFRA 4L3WA 3NYWA 1V71A 2WAMA 4UUNA 4F6RB 5JMTA 2HHHB 2J4DA 5ICFA 1U3DA 1RCFA 3BL5A 3MMNA 4LK2A 4GSKA 3QM1A 2R8OA 4RACA 4DQUA 1NC1A 4CKZA 1UEJA 1D4OA 3L4BA 4XCVA 2WAXA 1PG0A 3SAJA 3PCRB 2NUTA 3TGPA 1T2AA 5A4MS 4F96A 3LQKA 2PMWB 1X1EA 2C8KA 2V7TA 3I1JA 4QBHA 1RHMA 1KI1A 1R00A 3R3VA 8ATCA 4ENSA 1CV2A 3PF9A 8ABPA 3IAEA 2PFGA 1KP9A 2JW5A 3VTAA 3PDIB 2O0KA 2XSZD 3AF0A 3NHZA 1IZZA 1UADA 1WPQA 5AP9A 1FRZA 3L41A 3KLBA 4ND7A 2HEIA 3PSHA 4LV5B 2YW2A 1F51E 2IYYA 3NWOA 2CFRA 2QMZA 2Q5FA 3PJFA 4YMIA 3RFUA 2D0OB 4JJ7A 2A5GA 4OLHA 2C7PA 3TW6A 3K9QO 1U9JA 4F92B 1M2VA 3QSGA 3W7VA 3NBKA 1L6RA 1MJGM 1QLHA 4YASA 2R87A 4INJA 4ZGBA 3GLIE 1HQYE 4PGMA 3NTOA 3DC7A 1Z2OX 1O54A 2QTFA 1QIJA 4RGVA 3RSOA 3G5TA 3X2FA 4JROA 5L95A 3WFIA 4BGVA 1KAOA 4LZLA 3WP1B 1S2DA 3H1AA 1XHEA 4Q05A 5F51A 4KDFA 1IVNA 3MELA 1X92A 2X0FA 1FTYA 3L79A 1JVSA 1QQTA 4YCAA 1AXRA 3V4PB 2YY6A 1BXRA 4A8TA 1M33A 4M88A 4X6UA 4YRIA 4AZ3A 5HDBB 4L9SA 1DCTA 1MO4A 3LW7A 4C4PA 2IZZA 3H84A 3AUUA 4GECA 2KJQA 5BN5A 1GFIA 4COOA 2GD0A 2GNOA 2P9HA 1H8ED 1Z3IX 4DNFA 1IEVA 1M2OA 4FVTA 2FEKA 5EP4A 1EUYA 3UBMA 4EPVA 4A03A 3S2SA 5LD2B 2UVPA 2Z98A 4V0QA 1I01A 3UT0A 2BFBA 3BIXA 3H0EA 4JS0A 2BV3A 3LF2A 1BD3A 2X0JA 4LNHA 4B76A 1PT7A 4ZALA 1WSWA 4IJWA 4PNHA 5TQJA 1WF3A 2CJXA 2DFVA 1V37A 1VPLA 5BMVF 1ESMA 5EWJB 2NO5A 1JPJA 4XR9A 1PJLA 2NU6B 2WDPA 3CSSA 2F59A 2JHPA 1PR5A 3FBWA 3N70A 3W78A 1QRUA 4H1WA 1E8MA 2I76A 1SBIA 1BA3A 1ENPA 3S8MA 2QY6A 1V9SA 4BU0A 1OZHA 2EJWA 3A70A 3TF5A 4FMCF 2YJGA 1L4FA 1VDZA 4CV2A 4DADA 5J5VA 5AKXA 3A26A 1BVHA 1T2EA 2HCFA 1FRNA 1AUVA 1E3LA 2ZQ5A 4UCQA 4CEHA 2H4HA 3UWPA 2X8LA 3L0OA 3PWSA 3HLYA 3MS7A 4KXUA 5AM4A 3P4XA 4YP6A 5T6MA 4JI2B 1DIRA 2A5DA 2ODAA 2OXEA 2XQVA 4C2UA 1NUQA 4DVJA 2AC7A 4AN1A 1KO7A 4BO1A 4XOIA 3DL2A 2IHJA 3COYA 1GA6A 3QX7A 5CFMA 2TYSB 3NOXA 3MHPA 1CY1A 2N42A 3AT1A 1KGDA 4LG1A 3V4RA 1I1OA 4P86A 1GNLA 4G25A 3NC4A 1ZITA 3W2HA 1Q20A 4DMKA 4F1JA 3KKMA 4RHEA 3LDHA 3H0KA 4Z0HO 3UJ6A 4P7FA 1XNGA 2TMDA 2PANA 3ZZMA 3DOUA 5DV9A 1PZFA 3B6MA 1NI4A 3GAAA 4INZA 1DDIA 1P62B 1W6RA 5KC9A 1W2WB 2FMFA 4HAUA 3X1MA 4ZKDA 3PSAA 3CZ5A 1AMOA 1CJVC 1MAUA 4P2BA 1RMTA 3H5LA 4YRZA 1L5QA 1QHSA 2PAFA 1BFUA 3O47A 4H7EA 3JQ8A 5EE1A 1DPFA 4KO2S 1E0JA 4B3BA 4F7WA 1BAPA 2GR9A 3B38A 3N0XA 2J9GA 4AUEA 1F2UB 4U5QA 5FJIA 1XCOA 3TTUA 5KQSA 3ENZA 3NHMA 2D1TA 3IUPA 8ADHA 4M9QA 2HSZA 4MHSA 3T5MA 1KY5A 4NAUA 3R41A 2YINC 1G41A 3EXHC 3N5KA 3LI2A 4GU5A 2GB4A 1MB0A 3G8CA 1W0KD 4RF3A 2BSQA 1GZDA 3FDFA 1QCZA 1YRQA 2E4VA 4OFXA 3P19A 3W9BA 4W8GA 1Q57A 1CZRA 5AI4A 3CHYA 4HATA 1TPZA 1OH6A 1W48A 3S2EA 1NDUA 3LWDA 2ERXA 5EMMA 1ZIPA 4ML3A 5AW2A 1QIFA 2JGDA 5GZ1A 2G28A 5FH9A 2ZDGA 4QBIA 3G6WA 1W2HA 3T1OA 4ER0A 5T5QA 1J23A 3LQQA 5AUQA 5B1SA 3L8GA 5MHTA 3GLKA 3KU4A 4FFPA 1K9SA 5CNKA 5F9MA 3M5CA 2H5JA 4GPD1 5FBRB 4HH4A 3C14C 4U6NA 1PYGA 1GRQA 4DQKA 3EXHA 4NOKA 1KNQA 5BYAA 1JAHA 2FZCA 1MVOA 4Z2AA 1GKLA 3IV7A 3ETNA 3ZWMA 5LFAA 3DL7A 4X54A 3R74A 3K16A 1KE2A 1NN5A 4G65A 3R5KA 3RUFA 2BFEB 4HAXA 3QA3E 3Q7EA 5LQMA 1N6RA 3VAZA 2E5WA 3I2IA 4X00A 1K6XA 4YRTA 2XMPA 3TL2A 2VPWA 1M8FA 2XKJE 2ZIUB 3DE4X 3QUAA 3PD0A 4MW6A 4QL3A 2AFRA 3PWTA 4JDPA 3TLKA 2H2DA 2R4TA 3E9EA 2C5FA 1E3IA 5FTNA 1YBAA 1DP4A 5L4LA 2CFIA 3NGXA 5DHAA 4QPDA 2Q7XA 3H18A 1DC7A 1V7ZA 4I36A 3AIOA 2P75A 4IMPA 1X74A 2GPJA 1TCAA 4DABA 4E0BA 1QFYA 4X62B 3EZGA 3IV9A 2ZUUA 5C32A 4HWKA 2QPTA 1CF4A 2R1ZA 1FDSA 4LXIA 4AQDA 3OESA 1CUZA 3JZFA 3L0ZA 4DJDC 2LIVA 2CLMB 2NSLA 2GO7A 3E5NA 5L40A 4DHWA 1D4ZA 4J7XA 4I1IA 5EESA 3T7RA 2JI8A 3HUEA 3TEMA 2DUMA 1GUAA 3TNDA 3ICPA 3IP6A 2HGZA 1WEHA 2QEQA 3GFVA 2G8NA 4DSUA 3ETJA 5CW2A 3SZMA 2WUDA 1UAYA 3S0JA 3Q98A 1Q1GA 3P27A 4OI2A 2OFPA 1L5SA 1UODA 4R1QA 3W9YA 1UC5B 3JYQA 3D7NA 2XMBA 3TQOA 4WJZA 1VJ5A 4II2A 2FZ4A 2YJNA 4NMHA 2R44A 4NG5A 3ZBUA 1JG6A 2WHXA 3USZA 4AJLA 4V02A 1YR1A 4E7OA 2Y6VA 3N28A 3GX1A 5CA0B 1TVEA 3RTCA 3K70D 2CL7X 3HBAA 2IU6A 2VS1A 3MTGA 4I4TA 2QJTA 1IZ8A 1T9DA 2CLOB 4I1SA 5I8ZA 2EG5A 1UDWA 2ZOSA 4Y2SA 4HBGA 4QGAA 2ICAA 4WJKB 4AI6A 1OHHA 2HA0A 1LV8A 1RKQA 1X7YB 2VYND 3GGDA 3OZUA 5C3MA 5C1BA 3HE3A 3BRWD 4LY9A 1ISMA 5JVDB 4MEJA 5JS1A 2P9ZA 1OLSB 2R11A 3OD1A 5DH9A 4TGLA 4JL8A 3SJAA 4A4DA 3KAPA 1W96A 3IB6A 1CNEA 2HMTA 3EZ9A 4YV2A 3AESA 2ONZA 2HU7A 3EWNA 4GF5A 3IQWA 2E6KA 1P91A 1DDGA 1YNOA 2KWIA 4HH3C 4P53A 1FUEA 3LYAA 2VHYA 1RAIA 2OXRA 3QBJA 2FN7A 4GWKA 4KV9A 4RDIA 2RK4A 1XZJA 3N8KA 1CJTC 2F43B 2V8OA 3ZI4A 4QT0A 4BQFA 4E2FA 7REQA 3U1TA 3HLTA 2PZBA 3OM8A 1KP3A 5BRJA 3ANNA 1S0UA 1T9CA 3B7PA 1A82A 2PGJA 2EFCB 2VL7A 1PZEA 4N7JA 5C1PA 3EQ9A 2JH9A 2PJUA 1AQYA 4F1WA 1CPYA 3ZDBA 3ZHXA 1N2JA 3SQWA 2SCUA 3ITDA 3I2YX 1KQ3A 1SIBE 5C5IA 3SDSA 1QDLB 4Q3LA 4FNMA 3B1JA 4I8IA 3OFSA 3JQAB 1H2AS 3N0VA 3ROGA 4CDMA 2W6IA 2W8ZA 2WMYA 2BCJQ 2XHEA 5FQNA 4Q9IA 1RM0A 2ZVQX 1Z6TA 5CH8A 5IM5A 1VB5A 2ZCVA 2L0XA 1ECBA 2O50A 1BX3A 4HLQB 1F8FA 1K6EA 1NIJA 4CMEC 5DI3B 2NTEA 2Q6LA 4J0QA 5IZCA 1A95A 2CXPA 2F1IA 1PT5A 2H4FA 3RUHA 4MP3A 1G5PA 4OB8A 1U7DA 3PPXA 2ZAOA 3JQPA 1M6YA 3UG7A 4Q9KA 4JSRA 5AKYA 2QQ5A 4R0NA 4URUR 3HXTA 2QRHA 5CT9A 4S0ZA 1EEXB 1M72A 3DE0X 4GPEA 1W36B 2C5LA 1L8XA 5K2MA 3RJZA 2JRLA 1H4VB 2C7VA 4XH9B 2ID7A 2JHGA 3TNLA 5KQRA 1P31A 5A5VA 1O0CA 2QZZA 3GVHA 3TD2A 2CMFA 4O5AA 1CZUA 3PC4A 1GG5A 4C4ZA 5ECDA 4J4BA 1SIOA 2VXCA 3TAHA 1V16A 5F23A 1EWVA 4OAPA 2RFLA 1Y7LA 5J59A 4DMRA 1QHFA 1XZIA 3QVWA 4NMWA 5AHOA 3VV3A 2Z9BA 3OZWA 5KJFA 2B20A 1IB6A 2NT3A 4XKJA 2AYZA 2OG2A 1FJXA 1RWOA 2HWUA 4E6EA 1RZVA 5KX5B 1N92A 2OHVA 2W2KA 2FDXA 1MGPA 4EKIA 4TVOA 4N18A 1YL6A 3K1ZA 3QEKA 3V1MA 2ZK7A 4FM9A 5F7XA 1GNRA 1H2YA 5HGJA 3IUBA 3HGQA 2AJBA 4PZAA 2FN3A 4HFRA 2WWFA 4UM9D 4U0JA 3D0OA 3O8OB 4AECA 1J99A 1GP2A 2JLAA 2O1XA 1J5PA 1P2BA 4H7JA 4N5LA 3ZE9A 3ZK8A 1FK8A 2ZROA 1FCJA 1RCTE 1AMNA 2X9VA 2ISCA 4NBWA 4ER5A 4MTLA 3MCUA 2Y1CA 3A7DA 4M83A 4XSHA 1F8UA 1EK0A 2GJKA 3AILA 3OEHD 4X6LA 1LJ8A 3A1DA 2UZAA 3EQ7A 1VL2A 2VEDA 3TINA 4B4KA 4BAUA 1AV7A 4YI3A 3P0RA 2PMFA 2UYGA 4P3YA 3P9ZA 1URPA 4R71A 3DBRA 3OFNA 3RVPA 5SICE 2EKLA 2OENG 3F5SA 1VI5A 2GZ1A 4LYHA 3KOZA 5FXMA 1JR4A 4ARSA 2R7NA 2BOVA 4MWDA 2JFPA 1JUDA 2VHTA 1G63A 4WOBA 4UU1A 1CB7A 1R4NB 5KI6A 3ZWYA 2NQ8A 2V4ZA 5CJ2A 1OIVA 1NXXA 1A77A 3QHQA 2WSLA 5AQEA 5HE9A 1VRVA 2OG1A 3GEEA 3ZTWA 2GCOA 1Y7HA 2P9FA 2DC1A 2XWBF 3C5HA 3QOYA 4LRSB 4MUXA 5JAZA 4MV8A 2WHEA 1EFPA 2BHNA 3KYDA 3T35A 3SYRA 5BVGB 1TT5A 1JXOA 1IRIA 2BC9A 4QUKA 4WZAB 4EHBA 5JYDA 3BD8A 4CHGA 2FQYA 1ZZEA 4ND3A 5J58A 4RBNA 1U63A 3B53X 5CX4A 3QXJA 3BXXA 3ZV4A 3SHQA 3NO4A 2B4TO 1K08A 4NPAA 4AW9A 2PMBA 3LBAA 4LOLA 4EITA 2M98A 4QVIA 2CVZA 3N8GA 3W3AH 4C5AA 4BGDA 3L0PA 3A6JA 4TVBA 1FNDA 1RKBA 5KB3A 1RXVA 1R4ZA 2QI9F 2QRQA 4LJYA 4C3UA 5KBYA 4KPUA 2NZVG 2WT9A 4UW9A 4AS2A 2JCYA 5ALDA 1RBQA 1VGRA 1W19A 2GD2A 5JCXA 9MHTA 4G5QA 1OKKD 1RP1A 3K9HA 2AMLA 3WHKA 3DTVA 4DV1B 1CTQA 4I1RA 5IRCD 3V6MA 3IOMA 3G8DA 1L4HA 2GF0A 2UZ0A 2ZG6A 4K8OA 1DC5A 4RWEA 3OX2A 2AMVA 4MV3A 2QZSA 4EO4A 1P2TA 1EVZA 1KI9A 5CHEA 2Q4DA 1QS0B 2GNAA 1P5JA 3MW8A 4PYRA 1V0JA 1OAOC 4EYGA 1SXJD 3ESYA 3PTZA 1JG2A 4H9GA 1B4DA 1YHNA 1IVYA 5EJGA 4ARAA 1HE5A 4XYLA 2MSLA 3B8HA 3QVSA 4OJKA 3FCYA 1IC6A 3LW8A 5EG5A 3BMNA 5E0KB 4L6CA 2FUNB 1PZHA 4LX8A 1JL3A 5TGTA 2O9JA 4IDHA 5T4BA 3PC6A 4C87A 1RADA 2IEZA 3A37A 1IVSA 5LSAA 3W8NA 4CKXA 4EAQA 4NAVA 1P17A 2QNIA 4MR9A 3O0DA 1U7XA 4ZRDA 1ZW1A 5E1BA 4A91A 4B34A 3WLPA 4EHLA 4EMUA 3V7UA 1L1QA 4RTPA 2IK8A 2R3SA 4JBXA 2IXBA 3AUJB 5AI5A 4LWZA 5DN6A 3HKDA 3V1UA 4MDEA 3Q9NA 3RKRA 3E18A 4TTSA 1OAOA 1ZJ6A 1LQTA 1VSBA 2YFHA 1GYRA 3B9QA 3ZIAA 4BEWA 2BJVA 4IYJA 4QJBA 1TQ8A 3NHWA 3W7BA 3T7TA 3OCZA 1JGTA 1TKBA 5JLJA 4NXNB 4TXJA 3TQSA 3FVTA 3I05A 1FUYB 4TKLA 2KI5A 3U3RA 5GQSA 2ONJA 1LEHA 2VJMB 1IJFA 1DEHA 4F8JA 3TIXB 2C77A 5HTKA 3MFYA 3FSGD 5EC8A 5CVDA 1SBHA 3ZVRA 4RTNA 4W5OA 1OB2A 2GKSA 3AM5A 4OHPA 1WXWA 3U40A 4IV0A 4ALKA 1UBUS 3HCCA 3QOXA 4G8DA 1KK1A 2H5EA 4HWPA 5BSMA 3WFJA 1PWHA 3L84A 3ZBQA 4CLRB 3UUGA 3ZZ1A 3PPWA 1PUIA 4YUAA 1Q44A 1UMKA 2M6RA 2W2QA 1I9CA 4UPVA 2EU8A 5B30A 3OCJA 2G0AA 2BBWA 2JZCA 3EVFA 3HBJA 3U80A 3A2NA 5D7BA 5BV2P 2Q4BA 2R1UA 4O4IF 1X9IA 1I30A 4DRXB 1EGVB 1AK2A 4BQOA 2CCKA 3KUKA 1LPSA 1CDEA 2HPVA 1Z07A 2N3ZA 3LXRA 3F7TA 1BGXT 4HQLA 4GP7A 4TWIA 1T8UA 2HJHA 2X5JO 4NCBA 2VCYA 1ADCA 1DC3A 3OO0A 1GCIA 1BS2A 1J2EA 1Z0JA 4B0OA 2ES4A 1RXYA 4J16C 5G3ZA 4CCAA 3RS9A 5IJXA 4JVMA 1TIBA 2AD5A 3E2PA 4GNRA 1I7QB 1CXZA 1Q15A 1W46A 3V2IA 2UKDA 4N54A 5E6SA 1ORVA 4E03A 4TLDA 1OB5A 4CGZA 1A1VA 1J5XA 3LUDA 3KQNA 4KPFC 3CWCA 3ZJYA 2WJWA 4M22A 2EWMA 3TLAA 4QM7A 4NHOA 2Q4OA 2JVJA 2CLDX 2I3ZA 2MINA 1EPUA 4WBXC 5L3RA 4PG8A 1JJ7A 3OHSX 4QRDA 5IAAA 3AUSA 1B0UA 5TQVA 4LQLA 1QB7A 5DYTA 2Q45A 4YRPA 5FCDA 6CHYA 1KFCB 3NGLA 3CVVA 2DX7A 1NRJB 3BM5A 1L9XA 4FQ5A 1AKWA 2XUFA 1V25A 1HNWB 2P0EA 4GO1A 1J0CA 4J16A 2YHIB 3D0QA 2IEYA 2XODA 4Q9LA 4Y1RA 4YMUA 2PUAA 3QY0A 4KRGA 1ORWA 2QX8A 3HVHA 1GGMA 3B52X 4UQLA 4B8WA 2IYLD 4UVHA 4Y2XA 3DZBA 3LO5A 5T41A 4HRVA 3AR8A 4FFLA 4FYVA 4IWYA 4CL3A 2OUKA 4EI9A 3MWEA 4KQ1A 3IOYA 3L6CA 4ILEA 4XQGA 2JRCA 3OPMA 1FVOA 4HRXA 4PHHA 1E98A 4KWIA 2C0CA 4YJ2F 2PX3A 3IHTA 4B6QA 2XXAA 4C04A 4Z1MD 1BW9A 3W9SA 3TSZA 3ZQUA 4ZEMA 4RF2A 1SG9A 1G5IA 1RBYA 2ZREA 3KCQA 4GMFA 1QLWA 3DR5A 3G79A 4XX0B 2M6KA 3EWSA 3TFQA 3U44A 2HBQA 2ZTMA 1CUHA 3RQSA 3RVSA 3H3JA 4DA8A 2AG8A 4KODA 2IOFK 2NU8B 4K1XA 4EZEA 4F93B 3VKHA 5HZHA 2NNLD 2NVUB 2YWGA 3C39A 4ITRC 4DA4A 4HLUA 2WUWE 2PGNA 3ON5A 2XVXA 4MUYA 5KHAA 2RG7A 5TVGA 2K5UA 4DDUA 1Z68A 5IN4A 2AJLI 2GWHA 3WL6A 4B2LA 1KKMA 1RXUA 3PYLA 3SJZA 1KBZA 3VOAA 4U1RA 5BR7A 4DV3B 5D3KA 2O52A 1NBOA 3ED5A 4D2IA 3M7IA 4D57A 3MQ2A 4NYJQ 4O4HB 3QWIA 2M1XA 5AWFC 1JEYA 3LXXA 5HZKA 3FJYA 3NU1A 1P2VA 4UUQA 1K63A 5HKKD 3USCS 1G18A 1C81A 1OU4A 4P84A 3C74A 2EKQA 3I6QA 2ZUWA 4WBNB 3CRMA 5AW6A 2XLCA 3I01M 1IUNA 2CDRA 3EF1A 4I3GA 1NWHA 4RPKA 5ADHA 3EPJA 4JP8A 4AKIA 3DO8A 1JNXX 4RZ3A 1TM1E 2BT4A 1IEXA 4WDQA 3U7FB 3VHRA 1MDBA 2CHVA 2DLCX 1KAEA 2HHCA 3GLHB 4RADA 1EHCA 5EPOA 2EATA 4Q7KA 1ESEA 2BM9A 1KPHA 2NU7A 3S7ZA 3ZX5A 5EUCA 3HA5A 3WBKA 2X42A 1I32A 5H4GA 4PXYA 1SBZA 2EIHA 3CR8A 2OPHA 1S4QA 1YR6A 5A4FS 5KSZA 4RF5A 1A8HA 1G8SA 4JKIA 4OP3A 2QTNA 1GTL1 1PNOA 3CWZA 4BUJA 1J33A 2VK1A 3K0AB 3T4EA 3VTKA 4BMPB 3M5WA 1UH5A 2VA8A 2ENUA 3QK7A 3LT4A 5JO0A 3RVOA 3MBIA 2CJPA 1IHXA 3ZHUA 2W8BA 3F2IA 3B5JA 2HSEA 2OQ2A 3LC7O 3GU3A 1KEKA 1DRVA 4F56A 1WCV1 2AFHE 4FQ8A 1HTBA 1KAGA 1DLJA 2Y1EA 3PNYA 4TV9F 5CT4A 2EVWX 1YDFA 2P5SA 5CB0A 4JC0A 2RJ3A 2GN1A 3V8BA 2WOOA 2UU9B 1FXWA 3RUIA 3STVA 5FOVA 3U0BA 4UXJA 4MW0A 1TM4E 1K7XB 1V7CA 4U7JA 2PFKA 1SZJG 1L5NA 1RR6A 3RSGA 3TL6A 2FZKA 3GFFA 4PX5A 4GOLD 4Q1CA 2HQBA 3M0EA 4FGZA 5COAA 1VYTA 4R1SA 2OL4A 1OI4A 3TTSA 4XOUA 2EEPA 2IP4A 4NMLA 5H3HA 2QP4A 1V5FA 2O14A 2X13A 5IJ0A 4KKXB 1SOMA 5DNCA 4KPYA 1JBKA 1E1CA 1K7SN 4Q7JB 3UGQA 3U4IA 3D4OA 4KO4S 1KEEA 3SQNA 1DXQA 3CEMA 4OV6B 1FPMA 5B5SA 4C7OB 2DP4E 2QD3A 4DLZA 4XVUA 1M7HA 5JSKA 1JJIA 3U61B 2Z04A 4K88A 4WJLA 1B8PA 1R50A 5TE9A 3F96A 1PEYA 3WADA 2YDYA 5EXTA 3OZAA 5CJJA 1A7JA 4RPGA 4UHBA 1RVV1 2G70A 1JBQA 3EXEB 1PYOA 5T57A 2HNKA 3LK6A 3J81A 3IAUA 2PJDA 2WPDA 1T6NA 1K89A 1IN5A 3DNMA 1CUCA 3GLRA 4M53A 2RH8A 5CDFA 4JBYA 1R6AA 4JJ8A 3Q15C 2V0CA 2WUFA 1VHDA 4CIDA 1J00A 2J46A 4TTPA 1PGQA 1FFAA 4BY9E 2QDXA 2AA3A 1J1IA 2QE7D 3QKRA 3MAAC 4BQPA 1SOVA 1PVDA 3WQHA 3TLZA 2IYZA 5J47A 5C4GB 1EGQA 3PFBA 1QYXA 2BGIA 1KDYA 3UV7A 4X3CA 1VIVA 3WBFA 3IR7A 4DLXA 3KEQA 4MYCA 3TTYA 4A2PA 1XBTA 3GJXC 4DAEA 3L7DA 2I8AA 4TMKA 4P36A 1FYWA 1RMQA 4W82A 3O92A 2JH8A 3RS5A 2BR4A 1AJEA 3NHJA 1EFVB 3QPAA 5HRUA 3VVLA 2B9VA 3NWEA 2WM9B 3ZW7A 5IVDA 3SS7X 1XXHB 6REQB 5JXIA 3VPFA 1E2IA 5MDHA 3QXXA 1RPZA 4M1OA 2XOXA 1U9YA 3BD6A 4BMVA 1CS0B 4NMMA 5JARA 2H85A 5CMLA 1GVHA 1NBMA 1T1RA 1EHYA 1Q77A 1Y6QA 3S2IA 2XEDA 1U8TA 2QB5A 2Z5VA 2XCUA 5DJ5A 1Y3HA 3GJ3A 3B36A 3KWLA 4XTCS 2OXTA 1A9OA 1D1SA 2R8PA 2ZITA 4KQGA 2QXYA 4UM5A 3RREA 2CJWB 3MRXA 5GPBA 4D1YA 5CBPA 1VBKA 2VUUA 4E46A 2GN0A 2QN2A 1ZCAA 1KPGA 2A88A 4YR9A 5HZGA 3NDBB 2VBFA 3CW8X 3OFJA 4QGFA 3MTBA 4V0KA 1EUDA 3DOHA 1VL6A 2PWPA 5DW0A 3A1NA 3GYGA 4KWTA 2JLXA 1B8OA 2J6IA 2VSOA 2YS6A 3KQOA 2PVSA 2QTVB 4MI6A 1FPQA 4CKBB 1BDIA 4CQMD 3PXXA 2CMDA 5AVYA 4ZCTA 4PVCA 1HEUA 1ODKA 5JCPA 4BMNA 1MT0A 3E9QA 5ER6A 4GKKB 1XVUA 4ZIRA 3Q7PA 5DGHA 2QUHA 3JQDA 4C0JA 1U2ZA 4REQB 4DZRA 5EE0A 4EZBA 4BO6A 1L8OA 4CL8A 5JS7A 3JQQA 4M9CA 3DPUA 2I7CA 4LQCA 4UDXX 4BZWA 2QRVB 3KD3A 2QRPA 2Z2YA 2HF8A 2O5VA 2CXNA 3CNQS 5AKHA 3F78A 1UIRA 4GAEA 5ERGB 4PWZA 2HW8A 5DGTA 4G4SO 1WU8A 3DOCA 1NVKA 3DCNA 3DZIA 3NGMA 1RAAA 3C8HA 3I9NA 3AUKA 4C3VA 1X80B 1WMEA 3GAZA 1GR1A 3GVIA 1E32A 4GOOD 4IEEA 4QULA 1WL8A 1ZVKA 1IOLA 1UPTA 1JPVA 3TZQA 1QRTA 2VZ0A 2YXLA 5CGZA 3ZWNA 3PQ7A 1MDFA 3L1JA 2JAOA 5AHXA 3GCZA 1Z0UA 2HHLA 1E8NA 3CLRD 3DBHA 2SECE 3DQQA 4IUYA 3WAKA 2X8BA 5B58T 4R2MA 5HCUA 4DBLE 3QU7A 5MN4A 3BB3A 3FNGA 1QZTA 1JIQA 1X8XA 3THXB 3GFPA 2X2FA 5ALLA 2FAXA 4OXYA 4LJ7A 3TUJC 3W04A 3KM0A 3ZCPA 4BLTA 4P4NA 5JH7F 4BQNA 5B2EA 2YN2A 1DBVO 2YXBA 1SWWA 2C3PA 5HS6A 5KOHB 2IV2X 2RG1A 4GHWA 4ZGWA 2QDKA 3RTDA 3AEQB 2IWHA 1YRAA 1FA9A 3NRBA 4BJ5A 1OFVA 4BFCA 4TKVB 2QT9A 3FETA 3DQPA 3OO1A 3I34X 3IQFA 4M9ZA 3H1FA 4MYTA 3W1WA 1DKLA 3OLXA 2PKQO 1T2VA 1DJQA 2H3EA 4QSHA 4B0PA 5KNBD 1T0PA 2AG6A 1AQJA 2QZPA 3I1YA 3LRPA 1ZFNA 4BV2A 4LECA