2A4MA

Structure of trprs ii bound to atp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
331
structure length
331
Chain Sequence
ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase II
publication title Structures of Tryptophanyl-tRNA Synthetase II from Deinococcus radiodurans Bound to ATP and Tryptophan: Insight into subunit cooperativity and domain motions linked to catalysis
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
total genus 111
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2a4mA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a4mA01
1ZH6A 4JYZA 1T6ZA 1ZJWA 3ZIUA 1JEDA 1KP3A 2CYAA 2H29A 1CT9A 1JGTA 3TNJA 4ARCA 4U7JA 1KQOA 4I6JA 1GN8A 1EFVA 1H3NA 1D2RA 1JEEA 1WY5A 1H1TA 1IVSA 1KH3A 1QTQA 1T6XA 3HL4A 4MW5A 1EUYA 1O95C 4NAHA 4MWDA 2B7LA 3ZJVA 4YP5A 4DNXA 1EE1A 3FOCA 2QUJA 2YY5A 3CVWA 4MUNA 1MB2A 1JZQA 1MRZA 1FFYA 4YMIA 4DLPA 1WQ4A 1M8KA 1LI7A 3COYA 2J07A 2HGZA 4MVCA 2PZAA 4HJRA 1PFYA 4OUDA 1QNFA 1OWNA 4EG5A 1R6TA 1KH2A 1QRTA 2GM3A 2WSIA 3IVCA 3OP1A 4EG6A 4HPWA 3OTWA 1QJCA 2EJCA 4NZPA 2QTMA 1NUUA 4MUFA 3X1JA 3ZGZA 2JAXA 1IQ0A 2V0CA 2CV1A 2PXHA 2H2AA 3LE8A 3SEQA 3ZUGA 4MVYA 3AG5A 1O0CA 4ND7A 3FG9A 1J09A 4NX2A 2PZBA 1WKBA 3P0IA 2A1TS 4EF6A 1QU2A 1MOPA 1JZSA 5TGTA 4K0RA 4P2BA 3TS1A 3AFHA 4MW9A 1JIIA 4CDNA 4S1OA 2A4MA 4FZJA 3FWKA 2NSYA 4PBTA 4MW0A 1NP7A 1QU3A 1YIAA 1NSYA 3RHSA 4J76A 4UZEA 3JXEA 2A1UB 3DV2A 3SP1A 1KAQA 5DASA 2QJOA 1IRXA 1KQPA 2QUHA 1TFUA 3ILVA 1TYAE 4Q16A 1WOYA 2TS1A 2D5BA 1G59A 1IHOA 3E27A 4NDAA 3F3MA 2QUKA 2QUIA 3ZXIA 1BS2A 4G6ZA 1OWOA 1Y42X 4MWEA 4ZT4A 1M8JA 2IP1A 1NUTA 3UC5A 1IFXA 1G8HA 2JA2A 2RD2A 1IQRA 3A04A 4ZT6A 1NUPA 1EFVB 1M1ZA 4EG3A 2J5BA 3L93A 4EFKA 4EG1A 5IJXA 1O96A 1O0BA 3COWA 2G36A 1O95D 2A86A 4X0EA 3GUZA 3IUBA 1F7VA 4ZT3A 1NI5A 1U0BB 5TEVA 5HUJA 4CQNA 2DR2A 4XSVA 4BWVA 2VTBA 4QREA 1QQTA 4OUDB 2VXOA 3BL5A 1R6UA 1Q15A 3MXTA 2ZP1A 1TQ8A 2C5SA 1WJGA 2CUZA 5EKDA 1JECA 3GLVA 4JZYA 1WZ2A 3RBAA 2RE8A 4MVXA 1PG2A 2HMAA 2CYCA 3UY4A 2X1LA 1M8PA 3HFJA 4MUJA 2PG3A 4MW7A 2QJTA 3TZLA 2HZ7A 3TQIA 3I05A 2XRYA 2E0IA 1OWLA 3ELBA 5FO0A 1O94C 4ZCTA 1NZJA 3CLRC 3ZJTA 5BNZA 1R6XA 4DE5A 1MB9A 3FNRA 4ZCSA 4DDMA 1OWPA 4XFJA 2PIDA 4OJMX 1N2HA 4ZCRA 1J21A 2J08A 3IOCA 5K0SA 3QTTA 1O97C 1NURA 1N2OA 4ARIA 4GRIA 1NYLA 4PBRA 1S4MA 4R2LA 4JFAA 1KQNA 4MLPA 3AL0C 1WXFA 5DK4A 1K97A 4RPIA 5HG0A 3KFLA 3MMXA 1F7UA 4ZCQA 2AG6A 1A8HA 2Z3VA 4KPUA 2A7XA 2Z09A 4MWBA 1O96B 1YI8A 1TYCA 5K0TA 1U7DA 1IH8A 1PG0A 2OV4A 4J75A 5LM3A 1EUQA 1N75A 4R0NA 3IVGA 2R5WA 3TQOA 1OBHA 1NUSA 4KKVA 2X3FA 1F9AA 1MJHA 1U7XA 3QE4A 2VTBB 1P7PA 4MW1A 1K92A 3UK2A 2AZXA 1LI5A 3GMIA 1I6MA 1YUMA 3SZ3A 3IOBA 1T6YA 2X0KA 1QRSA 3ZXSA 3DO8A 1HYBA 3CVVA 3A2KA 3D6VA 1X8XA 1J20A 3MLAA 2DUMA 3ND6A 3RFFA 1WXEA 3IDFA 4CT0A 4MUHA 4EG8A 1OBCA 4F4HA 2E18A 1Q19A 2EL7A 3G5AA 4QBTA 4G5YA 5TS2A 3PRHA 3CLSC 5LFAA 1GTRA 3HGMA 3SEZA 2PZ8A 1MC1A 3LOQA 1TEZA 1EJ2A 1SURA 1Q11A 3KT3A 2V0GA 1N2GA 4YP7A 3N9IA 3RK0A 3CA8A 4U63A 3Q12A 1O94D 3UOWA 2D54A 1PFUA 3G59A 3PNVA 3SDBA 2ZUEA 3CLRD 3SYTA 4R2MA 2DPLA 1QRUA 3HMQA 4NATA 3ND5A 3ND7A 1G8FA 2GKSA 2QTNA 1N77A 2AKEA 2DLCX 1O5TA 1UFVA 3COZA 1YULA 1JHDA 3VU8A 1TYBE 3P0JA 1O97D 4MUEA 4MW2A 1J70A 4RUKA 3CVYA 4L2IA 1LW7A 3SZGA 4YBRA 1YUNA 3CVUA 1VBNA 4PBSA 1IQUA 4NAUA 3PNYA 4U8HA 4TS1A 3NBAA 3IOEA 5HUHA 4DJAA 3IMEA 5H7XA 1N78A 3VRHA 3FI0A 1GLNA 4KPUB 3X1KA 1Q77A 1K4MA 5J59A 3H9CA 1WXIA 3G6KA 2Z08A 1TYDE 3TZEA 4H3SA 4ND6A 4KR9A 2QTRA 2JANA 2OQ2A 4MW4A 3C8ZA 1XNGA 1EXDA 1KR2A 1F4LA 4WSOA 2YWBA 4ZCPA 1PFWA 1ZUNA 3COVA 2YWCA 3AKZA 3N8HA 1NUQA 2IELA 2O8VA 5J58A 1V8FA 3RK1A 4I6GA 1KAMA 4DDHA 4E1AA 4EGAA 1X6VA 3MUEA 3UMVA 2WB2A 2X1MA 4EG4A 2WQ7A 2O5RA 4MQ6A 4KR6A 1M8FA 1N1DA 2BYTA 3H99A 1OD6A 4ZT2A 4Q93A 3CLSD 4MUKA 4QRDA 5KWVA 2CSXA 2WQ6A 2CV0A 1H3FA 1KKUA 2A1TR 3NV7A 1ZH0A 1GAXA 3KT8A 2J09A 1EFPA 3CLTC 1OWMA 5F23A 3HV0A 3CR8A 1U3CA 5J5AA 1N3LA 3L92A 3Q10A 1N2EA 4MWCA 4WNYA 2IJGX 3IMCA 2BTEA 1T9GR 4JXZA 1V47A 2QJFA 4PY2A 3CLUC 3FY4A 1KP2A 3A05A 1I6KA 3IH5A 4MW6A 2DEUA 1FYDA 1ULHA 5DB4A 2DERA 3M5WA 4AQ7A 1N2JA 4GU5A 5FNZA 3H05A 2NZ2A 3CVXA 1PFVA 4L2IB 3KT0A 2A84A 2E21A 3FH0A 3K9WA 5JBNA 4CDMA 5LLTA 1JIJA 2CYBA 3VGJA 3DLAA 4MVWA 2CT8A 3FETA 4MAFA 3HZRA 3KT6A 1U3DA 3IVXA 3PNBA 3FHJA 4MULA 1H3EA 2XRZA 5AHWA 1MAWA 2YXNA 1T9GS 3IODA 4AS1A 3AG6A 3AIIA 2ZUFA 3N2YA 1RQGA 4I6EA 1WXHA 1KH1A 3PXUA 2D13A 1JILA 3FDXA 3NBKA 3Q4GA 4MUGA 1M83A 1I6LA 1XJQA 1XNHA 1GTSA 3ZJUA 3LCJA 1XNJA 5FO1A 4K03A 1K4KA 5DEOA 2CFOA 3K32A 3DPIA 3INNA 5KHAA 3RJZA 4DDKA 4ZT5A 1N2IA 2DXIA 4G5FA 3P52A 1WXGA 1VLHA 2CV2A 5KCMA 4UZFA 3H9BA 4HK4A 3S3TA 1VL2A 4EG7A 1MAUA 1M8GA 3P0HA 1EFPB 1VBKA 3X1MA 4KR7A 3CLTD 3N05A 2PFSA 2I1LA 1WQ3A 1YIDA 3IMGA 1N2BA 2DETA 1I2DA 4MUIA 4ZT7A 4HJXA 3MLBA 1GPMA 1MBZA 1B6TA 1VBMA 1O6BA 3CLUD 5H16A 1COZA 3U1VA 2GOYA 3D6UA 4A91A 4YP6A 2A1UA 3IUEA 3FIUA 2E89A 5IHXA 2A88A 3ISJA 1KORA 1J1ZA 2J4DA 1ILEA 4XFDA 3QTBA 4F3RA 1DNPA 1GZUA 3A4IA 1JIKA 1J1UA 1JMVA 1G8GA 3H97A 4JXXA 5TEWA
chains in the Genus database with same CATH superfamily
3BMQB 4HDSB 4LHZA 4FKMA 1UMCA 1PJQA 5L6MB 1XUOA 2ADOA 1WDMA 4PCLA 3ZX5A 6GPBA 4NMMA 2AUTA 4MCIA 2JLYA 3WKAA 4MUBA 1PF7E 3AP2A 5TS3A 4IF4A 2VXCA 1RVDA 1TL7C 4ZV9A 4KQXA 3CF4G 3KLPX 4C0HA 4DLNA 4PPQA 3OKPA 3PZBA 1FDWA 3T54A 3NVDA 4YACA 3CNNA 1U7WA 1G6KA 4YPOA 1LBQA 3HL4A 4BRWA 1UBTS 1EUYA 2OK8A 2PPLA 1A82A 3K2IA 1ZESA 3JQGB 4B6GA 4WBNA 1HGXA 1QH8B 3DOUA 3EWNA 5BQFA 1WBDA 1KBOA 4GR5A 4UQLA 3BAZA 3IQIX 1IZZA 1KJYA 1TF5A 5IK2A 4YMVA 1MA0A 5CHYA 1P2SA 1KY3A 4YB8A 5LQJA 4YMIA 3VKFA 2GFIA 2I6QA 2WAXA 4P3PA 3ROTA 1GA4A 2RJNA 4AMBA 4EKGA 2VC2B 2OO5C 1Z2NX 2I6GA 1FJXA 3LGXA 1DXOA 4WJKB 1NLYA 4G8CA 4A0HA 2EBUA 4EG6A 2NTNA 1T35A 4BVJA 2OXEA 2KLBA 5M04A 1Q22A 1OJLA 1N6IA 1TIPA 1JIVA 3WGGA 3IB6A 1KOGA 2JAXA 3KKEA 2AX4A 4HNVA 4DMGA 3A6DA 2SECE 2O8FB 4MZDA 3EUFA 2PXHA 1H6DA 2JI7A 4LJKA 3RU9A 3SEQA 2CCGA 2DJIA 4FJ2A 3X1ZA 5ER9A 3T0IA 4MYTA 2GN6A 5C52B 4MQFB 1F2UA 4EHKA 1EGMB 3IQXA 2ECOA 2CXQA 3F6CA 4NCKA 1GNLA 2ASEA 5F9FA 3AHCA 3PQEA 4CIYA 3KSRA 3NETA 2XB4A 3NFRA 3TS1A 3WMWA 4Z3KA 2RC5A 4AC9A 4HWOA 5GV7A 5BNTA 1PS9A 4OQ4A 4FTWA 4BTVA 2JCSA 4EY3A 4C0XA 2CCKA 3KHTA 2GCPA 1M2JA 4KJZA 4R8KA 3GARA 4XIGS 4KLCA 4RTJA 3LQ2A 4X93A 2RHJA 4RSRA 4DCJA 3JQGA 3LSTA 3EZFA 1QHSA 1C9NA 2PRJA 2Y1KA 3QU4A 4HDRA 4WZZA 4ZV4A 4TV8F 3LKZA 3TGWA 4P33A 4DDWA 1RHMA 1YQDA 4J16C 5L7WA 2XPCA 5LSAA 1JKJB 4CG0A 2W6JA 5E1BA 4PRZA 4UTZA 3DCIA 4YAEA 3X2EA 4CR6A 2G9ZA 1UKYA 1XWWA 3HPRA 1ZFNA 3F3MA 4E7PA 4D5EA 2QUIA 2FZVA 2NU7A 4RVUA 2DFLA 2CVHA 2Z2IA 1OBVA 3KB8A 4B7XA 3KZKA 1YGYA 4R6WA 2E5WA 2VSYA 2FZKA 4GZ5A 3PEWA 1G8HA 2BEVA 2OCAA 1E4YA 1NP6A 4Q6WA 4RANA 3QKUA 5KYUA 5LXTF 2H7YA 2CNLA 2P6NA 3IJRA 4RWZA 3I52A 4OM7A 1T0JB 2GF2A 4MKIA 4DG8A 3WL7A 3K0FB 2A86A 1CUVA 2LVBA 2XTJA 4X0EA 2C2BA 2IS6A 1V6CA 3Q5GA 4DIFA 4Y3UA 5BV1A 1QF6A 4DV6B 1FSGA 1HQYE 3AEKB 3MTAA 1GAQA 4JYAB 4QA9A 1HL7A 4BPBA 5C8DA 2WM8A 2VAPA 1NG1A 3A6JA 3MRSA 5EYPA 2CLSA 3NCHA 1PR0A 1ZDMA 3H84A 4KNVA 5JRJA 1PZGA 3QPDA 1LVHA 2VHQA 4Q9DA 4PR0A 4QQNA 3H5AA 1OHHD 1XF9A 3AVOA 3OLQA 1LV8A 3OOYA 2P5UA 2VHXA 3NTVA 1DCTA 1EUCB 1JJAA 4AN0A 3WJ1A 2O2SA 3OOEA 3V7WA 1TU3A 4RTLA 1UP6A 4WY2A 3VR0A 4QGGA 5DZSA 2XRFA 3M9XA 4LYAA 5DP1A 4F4DA 1SWWA 2QR3A 2CKDA 3SS7X 1TLFA 3SSAA 2JB9A 5BQXA 1YZ3A 1C3EA 3F7MA 3MT0A 2WU0A 2FWJA 4XSGA 5FAXA 5CH5A 1ZA2A 2OR3A 1ATIA 5LB2A 4Y6LA 1C0IA 3UY4A 4MYSA 3WK6A 3AV3A 1M8PA 3EMBA 4FGZA 3HA5A 1JJIA 5GQSA 5K3DA 3QJ5A 3U6KA 3K94A 1M6HA 1ZI8A 2VBFA 3K92A 4KU4A 1H4TA 4WBNF 4NBRA 2Q1SA 4AICA 1GZ4A 2XRYA 2Y2VA 4QPNA 3S8MA 1L8XA 1PWHA 3L0SA 1QAQA 2Y1OA 1XEWY 3PQ4A 2BR5A 4QGFA 4Z0HO 1APBA 3R9WA 3PKIA 1KJWA 3KUXA 4O02B 4ZZ2A 4BO3A 5C7IO 3OFND 4AJ4A 1FUYB 5I7FA 3QXSA 4DE5A 2HSJA 1TAUA 2VK1A 1GSIA 3I1FA 5I51A 1YACA 2D0PB 4XFJA 3TM4A 3UQZA 4ESOA 2QTZA 1VE6A 1IWPB 2KYRA 4QVGA 5H4HA 3A58B 1PV4A 1YK1A 4FHEA 1OAKA 2O14A 1FSPA 5TPZA 3UXMA 2WWIA 4N39A 4RJTA 1M34B 1M1YA 1A7JA 3TQSA 1U1DA 2HLHA 3DLTA 1EUCA 4D02A 4FNGA 1EHCA 1FRZA 1PCXA 4JIMA 3UZUA 3TFOA 1KQNA 6NULA 2JIBA 3QVSA 3OMLA 5ESXA 2HJHA 4DHWA 4V1CA 1JALA 1SIOA 2XT9A 4KVAA 1MW9X 2UKDA 4K1LA 3DFFA 2P9BA 2AG6A 2WT4A 3HA7A 4XPZA 4EMTA 1DCMA 4YCLA 1DKNA 1TI7A 2P9GA 5E9AA 4OMCA 1GILA 1O96B 5C34B 5F78A 2AN1A 1JDVA 3GIWA 2WQZA 1QHHA 2IZOA 1U7DA 3HKBA 4Y9DA 2Q5IA 5FR1A 2HBZA 4BP3A 4OUKX 5I9TA 3V4LA 4E5UA 3DXZA 3NFYA 2OFFA 2B8EA 1P2UA 1GV0A 4ME6A 4YMWA 4UOEA 2Z1MA 1NMZA 4C6SA 2P4QA 2O4CA 1JG6A 4MRVA 3T35A 4ZI3A 3GGOA 4EO9A 2YJ5A 3H6KA 3ZU4A 3SBXA 2V3VA 3IO3A 3AJEA 4G0NA 3TJZA 4PFQA 3BGIA 3HXTA 5CIWA 2XQJA 2AEFA 3ONWA 5DLYA 2OLKA 3DDHA 4L0CA 3QYAA 4I8IA 4ZAGA 1P5HA 2I0FA 1EVYA 2YWFA 3CVVA 4QT4A 2BGGA 3LLVA 1MX9A 4UEKA 3ZU3A 2RHTA 5H4GA 4B4UA 4UCXA 1Y1PA 3C48A 2X8AA 5CFOA 2AC4A 3I01M 3RAGA 4L4SA 3I32A 2WUFA 4AIRA 4EFMA 1WSBA 2ZR0A 3K30A 4EK9A 5JR3A 2XDYA 1A9QA 5H70A 4IDCA 4TTAA 3FM9A 5B1EA 1X92A 3INTA 3OZEA 4V0NA 2X7HA 2DAPA 3BBPA 2WNHA 3LLMA 1LC3A 2V03A 1XHFA 1Z2OX 1M0TA 4MLCA 2MSCB 2WHEA 1RMQA 3R2JA 1KWKA 2D1SA 1UJBA 2WJGA 1P4GA 3ME5A 2NPOA 3L84A 4OJYA 3EBOA 3WLTA 1NBMA 3A0RB 1PNRA 4X41A 2Q4RA 1UJ4A 2HKIA 1XGKA 3OQBA 1BSVA 5E2IA 3VM6A 4B81A 4QELA 2X7XA 4CLRB 1JR6A 2LTAA 1I14A 2QS9A 1O94D 2JAUA 2ZPUA 4HDKA 4OHXA 4W1PA 4JQYA 1PT9A 4KLAA 4FFPA 4R2MA 5FOXA 2VJMB 2VRBA 4YCJA 5IWCA 1C1XA 1C29B 3PWSA 2GKSA 1H1DA 3DW1X 4BJ1A 3JAKA 3RUFA 1MDFA 1GQOA 3UUFA 5HUQA 3RSHA 4DHEA 1P2TA 1JBEA 2JJ2D 3RYIB 1T34A 4CQJA 4LDPA 5KWEA 2X41A 2XZLA 3G6WA 3G79A 1PEAA 3I4FA 1UKCA 2I7TA 1CZHA 3RM3A 1WB5A 3DOOA 2C8LA 2O8CB 1MQSA 4RW0A 1H2FA 3U3OA 5ETJA 3VU9B 3R7SA 2EP5A 5HW0A 2DZDA 4QJ3A 1G60A 1GUBA 1UBRS 1R64A 5A2GA 1TTHA 1XHEA 4L5AA 1ZIPA 1M10A 1XQ9A 2ATCA 1Z17A 1E9SA 3RRFA 2EU8A 1WCXA 2OY0A 1Q14A 2QR5A 2VJCA 2CHQA 1ORRA 4PAOA 2NYRA 1GUZA 1H1LA 3OMWA 5F9HA 1W48A 1HM5A 4HFMA 1MO2A 4IJ5A 1R5JA 1E2HA 3TL3A 2X13A 4NENB 3T8YA 4IIYA 1Y6FA 3RVDA 1EDBA 1ZM4A 4XJTA 3T1YB 2NQTA 2YWBA 3FHOA 3QU9A 4GICA 4OHKA 3H6GA 1B0AA 3VAZA 3JPYA 2Q6VA 3JZDA 1JHOA 1TKRA 1AXGA 2HQRA 1WSWA 1T8RA 1V9LA 3I5UA 4W8GA 3OF5A 3S99A 4RY0A 2VJMA 1NIPA 1J42A 1A8PA 1YB6A 4RY8A 4OXNA 3ABZA 4NWIA 4O4HB 3UMVA 1DRKA 5JALA 5L3SB 1MXFA 4PTYA 4DNFA 3H99A 3LCRA 4HNAB 2O7SA 5AXDA 2QTAA 1XJ0A 5B1SA 2WTNA 1NQ5A 3RYIA 4D26A 1UM9B 2HHJA 3T1HB 2Y6UA 1QH0A 3AU8A 3MCAA 4D9EA 5A5DA 2DQZA 3C8UA 1Z5OA 3AF4A 3MOSA 4CMBA 4PU0A 3UWPA 4AS2A 5KHOC 3OM8A 2FJUA 3EDRA 1HE1C 1J23A 5LP1A 2EATA 1EFPA 4GOOD 5TMBA 4WKGA 3U9TA 1BYIA 1QC5A 2EYUA 1Y3DE 2Z6UA 4WAUA 3LFTA 3V32A 2EZUA 1KEVA 1NP3A 3GLUA 2NXWA 3GGDA 4I4LA 2P3OA 3S27A 4KQ2A 1PDOA 3BHMA 4PYRA 2BN4A 4RQBA 1H23A 3E9CA 1JDZA 4NV0A 4MGHA 1GL6A 1T2AA 2V96A 2GAIA 4TLAA 5FFFA 5B1DA 4IW3B 2ZTMA 3VV2A 1Z5GA 4BB9A 4EVQA 5FYDA 1A76A 1NW8A 4X20B 1TPZA 1XD8A 2REOA 2XJ9A 4OG2A 5HQ3B 2I4MA 4GLLA 3D7LA 3MJDA 1VCIA 3RSSA 2XKAA 4Z9FA 1QOQB 2CXRA 2ZITA 1XC7A 2HTEA 1XDDA 2A84A 5D6NA 4EYQA 2JJQA 1VE3A 2O2XA 4G41A 4DLAA 1AXEA 1KJIA 1KO1A 3L6EA 4NICA 3CNHA 4TKUA 1QE0A 3K2EA 4KK4A 4MVWA 4YMUA 3N2LA 1ISRA 3GJ0A 5GTDA 3FPKA 3LO5A 3NOXA 4O4HA 4R1LA 2VT2A 4XGQA 1TMKA 4X1IB 4Y2QA 5GVRA 1DBVO 3B9RA 3VZRA 4GKBA 3W2HA 1YTUA 3HXMA 1AKTA 4IX9A 4YROA 1KC3A 4KIUA 4LJ6A 4L4XA 4D42A 2QTCA 3BEOA 1G5QA 4RWEA 3UOAB 3NPAA 4D5GA 2OHHA 5CFMA 1NJFA 2V7QA 2Y9MB 4RESA 4DUGD 4F12A 3PRKE 4B9EA 1UMBA 4ZYUA 1L7BA 1U2SA 5AI4A 1ZEJA 1QK5A 2YJGA 3OETA 2PRSA 3TRKA 1H9CA 2OD2A 4U3JA 2JFPA 4YGYA 5BN1A 1GTSA 3LCJA 5AKGA 1T8PA 4QM6A 3GHHA 3THRA 2I4RA 1H9BA 1OZHA 2NO1A 4LV5B 4XX1A 4AXBA 3DPIA 3LC1O 4JLBA 3ZTYA 1E63A 1KS2A 3IUNA 2X23A 2PPVA 5T57A 3ABSB 3FZNA 3F5FA 1P2DA 4DLTA 4EMBA 4DPKA 1NY5A 2AFRA 3ROKA 5JROA 1PGNA 3N8KA 1X1AA 2RI0A 2C8JA 4CGZA 1VHLA 1JTVA 3MM4A 4MLDA 3W77A 5TF0A 4PYIA 4LHWA 4ZCIA 3KQNA 1EWQA 1PR6A 1EB8A 1WF6A 5JEDA 4KZPA 4I9FA 4OU5A 1S89A 3E81A 4ZPJA 3I30X 3HWX1 3BSWA 1YVUA 2XEDA 3NJ4A 3WE7A 3ZY2A 1YCHA 3H4IA 2H07A 4FMDF 3IMGA 3N0TA 3VPBA 1MQ8B 5EPOA 3ZEIA 1U5BA 3GV0A 3EY9A 1I51A 2BMJA 3L06A 2QF7A 4UPEA 1T4GA 5SY4A 4CE6A 5AI9A 1Z73A 1Y8QA 1XQVA 2G08A 1U1EA 4PLCA 2X58A 3W4JA 2E48A 3BDIA 5HZHA 1QV7A 4IEFB 1UDXA 3T0FA 3KJIA 2H8GA 2P8SA 4G1UC 4LECA 4YDSA 3IUEA 2NU8B 1ZHOA 2BFPA 1SUBA 3RTGA 4BNZA 5D1HA 4ZQGA 1EJBA 2IOFK 4YVFA 2N47A 3A9RA 4TKMA 1KORA 3RV3A 4YDQA 1CQJA 3GUCA 1VHTA 3AJRA 3TZQA 1TZMA 3CZMA 4Q4DA 3NORA 4DMRA 5EIWA 2IXGA 1JMVA 4KE6A 2RH5A 2P2YA 3GJ3A 4LYFA 5F35A 1OX5A 3Q6NA 1XLTA 4KN8A 1HLPA 1FMTA 3WQBA 1ZJWA 1Z39A 1REQA 4LOJA 3R74A 3ZIUA 1WBBA 3CF6R 4F71A 1D0IA 3CHYA 3LMKA 4QWWA 5HMLA 1E77A 5GINE 1WPQA 1GGKA 3QFCA 1DJOA 3ID6C 2HLDD 2R751 2PMKA 1KHTA 2ZIAA 3U0BA 3A3OA 1D2RA 3AVPA 4OK6A 2O1XA 3AKDA 2X1HA 2QQ0A 3A28A 1MH1A 1TFRA 4S2EA 3SFZA 1KH3A 4XX0A 2PL5A 1QTQA 1SHTX 3KJEA 2NXJA 3NWPA 3S2FA 4NAHA 3FCEA 3HEAA 1BU8A 2FE4A 4UOZA 4UQOA 5JS8A 1C0EA 2ZWPA 4N01A 3DVQX 1OY1A 3IKMB 4FWIB 4AJNA 2YY7A 1NWCA 3BSYA 3UNXA 3GLIA 2IRWA 4Z53A 3PEVA 5JYDA 3UAGA 2Y4NA 2AJBA 3RRZA 1SCAA 3DFIA 4Q4CA 4RABA 3D1VA 1EKXA 1PFYA 1R4MA 1I24A 3PFKA 4KTTE 1YVPA 1YZLA 2J9GA 4KYVA 1C4OA 1EG7A 2CL0X 1YDFA 2JHFA 3KYDB 4DSNA 1YR2A 1DQSA 5IYZB 2OO7A 4LKRA 1BCRA 4HL6A 1V8DA 3B70A 4FCTA 4MKRA 1M0WA 4R4JA 4UBIA 3HABA 4YT4A 5A4IS 2W6OA 4BO6A 4BMXA 2XNDD 4LTNA 1L2TA 2AFIB 4O4HF 1E7SA 4C7JA 1M2VA 3E61A 4HAOA 4R6XA 3JARB 2F64A 5DLDA 3ZX4A 4BVEA 5BN4A 4JELA 1RWOA 1OYYA 4IMPA 4Q1CA 2DBVO 4Y2GA 5E2BA 4KHPB 1GU0A 3JX9A 2R48A 3K9CA 821PA 1NW3A 3LZCA 2YXEA 4CMIB 3KEMA 5ARCA 4M76B 4CL0A 5HZMA 4TVOA 2M98A 2FPGA 2C4KA 3HS3A 4K6CA 3IT0A 3VKGA 2QNRA 3ZOKA 4HDMB 4LJAA 1BS1A 1VKJA 1RZUA 1S8AA 2OP1A 2QAJA 1ZSYA 4PC2A 3BF8A 2A58A 1V25A 3PKJA 1V7CA 2LW7A 5CT9A 4BFCA 5MFZA 4GSLA 4GMKA 1YIAA 5B7NA 1OT3A 1YOVB 2A78A 4DBVO 4TUYB 4WRRA 4HXEB 3OCJA 3R6WA 1KAQA 3IOMA 4FI3F 3RASA 1FEZA 3DMYA 2HF9A 4JLPA 3OWXA 4A5SA 2WWWA 3DCJA 3IPAA 2NVUA 4FYYA 4BMOB 2JH8A 3Q3IA 1IHOA 1NNUA 1RSZA 3WLEA 3P9RA 4UBMA 4OLBA 3HL0A 3DMNA 1U7HA 1TCAA 3MBKA 1AMNA 1M8JA 3S6JA 3PIIA 3KQPA 1HX7A 1IFXA 3OLXA 1YL7A 4M1MA 1RJWA 5BSVA 2FHSA 2PX2A 3Q7RA 4BE9A 1EFVB 4IYJA 4MIEA 3P9SA 2PCLA 1XL1A 5K6AA 3PLNA 5JARA 3T7AA 1X1CA 3HB4X 5B2FA 5IJXA 4J29A 1SEVA 1SULA 2AWOA 1C8LA 2V6BA 2WJZB 1CZNA 2E4VA 3G8BA 1G66A 3R76A 1R4NA 1CQIB 4IQ0A 2GI4A 4MYDA 5K03A 4B7ZA 2EWWA 4JOBA 1I01A 3LW7A 1VJ1A 5K8UA 2AI1A 4YRNA 2I7DA 3UVEA 2P6PA 2JFQA 5AM1A 3VC1A 5JH7B 4EW1A 1CUHA 1TCUA 3V55A 1VHJA 3ZK7A 1SVLA 3MCZA 1YOVA 3QNUA 4N7RA 4TPKA 4ESVA 2WOJA 4FT2A 4GAEA 1TQ8A 4X6XA 2AR7A 3IO5A 1MIOA 1SXJB 4L4YA 4I1VA 1BDIA 1ZCJA 4DT1B 5EKDA 4TWZA 3DYIA 1UXJA 3EVCA 1X8KA 5ALNA 3FBWA 3HCWA 5KYWA 5MDHA 4W8HA 2VF4X 2V54A 4HTFB 2P2ZA 4EF5A 5K45A 1R6BX 2P6OA 2CYCA 5CVEA 5GOTA 2OLEA 1TK3A 3HFJA 3D2LA 3LUHA 4XGIA 1JDJA 2RI6A 1JA0A 4N0DA 4W9NC 4GOMD 2XZPA 3TX6A 4O4JA 4C22A 4RDIA 1QO9A 4I2NA 4TLBA 1U1FA 2BHLA 5E0KB 4S05A 3IPCA 3I05A 1B15A 4MCHA 2W22A 3R0IA 4D0GA 1Y7TA 1IN5A 3FKSD 3MRVA 5AW7A 1I33A 2RHDA 4C7OA 4GSYA 2JJ1D 2QYHA 2FYTA 4M8IA 1HFKA 4EKEA 3H8JA 5LQAA 5IJZA 2W00A 2IGBA 2VSOA 1P7VA 3OT5A 4W6QA 3ZY6A 3W6NA 3BE4A 1N5DA 1Q57A 3GFBA 2VHEA 3NGLA 3P7MA 4IIUA 4J7UA 1U0TA 1L1FA 4YPFA 1X7WB 3I1JA 2G9QA 3PFIA 5EIXA 3C5WP 1QHYA 2PV7A 1FBTA 4L5BA 1R8YA 2H4FA 3UIEA 2QN3A 3C6XA 3UN1A 4B3DA 2BDUA 3CJQA 1L7AA 3CUUA 5FWXB 5JY6A 5JH7A 1KA9H 1W29A 1XEXA 3QUAA 4KUEA 1BMFA 1LGYA 3AL3A 4DB2A 4XI9A 2VUSA 3B1WA 2HMSA 3UCFA 5C37A 2QX4A 4RPIA 5C5IA 1KZ7B 3JW8A 1WXDA 1J33A 3CE9A 1SXJA 1GGMA 2WKQA 4E5YA 4O3FA 4D9JA 3ZDBA 3QRWA 4FWTA 2PCJA 3OLZA 3ZY5A 1Z6YA 2EIHA 4HTFA 5IC6A 2RG1A 2D1RA 1PG0A 3SQOA 4Z4IA 5JAMA 3TI7A 3ISTA 4LJ5A 1KZYC 2JBAA 1IL0A 3KLNA 4GLBA 5DP2A 2BM8A 1USIA 2WKSA 4GYJA 1VKNA 3RVRA 2OC9A 2F3SA 2X8WA 3E9NA 1PK8A 2IY8A 2QV0A 1CC1S 1X80A 1R66A 2FTKE 4WHMA 1AM4D 4X6UA 2BD0A 1E58A 2ZETA 3QFSA 1U8ZA 1NLMA 5TR9A 4ZJUA 2R6ZA 1BTOA 4B7UA 4LAFA 4YRSA 1YBHA 4ZVRA 3BL8A 3HB5X 1U4OA 1ZCZA 1G41A 4I5FA 2B5VA 3F47A 3P4XA 4NCXA 4CTKA 4JUCA 3CBGA 3ZXSA 4CM7A 1U0GA 4LJ7A 1O7JA 4CDGA 5P8WA 3ND6A 2W6IA 2CDRA 5IYZF 3Q15C 3GJZA 1WXEA 4NK5A 4XTCS 5DHUA 2G5GX 4RIGA 2DUUA 5K4AA 1J99A 4HUJA 4Q24A 1RW4A 4AG3A 4IDAA 4AWAA 5EJ5A 2YKGA 4I2VA 3HADA 3LTEA 2COEA 2QI9C 5EGSA 3KZXA 4FOSA 3TMKA 5JNWA 4O1IA 3QF4B 1JE0A 1X3SA 1ZXLA 1NBWB 4HNSA 4EA6A 1YUBA 3CWQA 2XOXA 5LOVB 1ND6A 2VNKA 5F4ZA 2C2ZA 4N5DA 3OI7A 1TXGA 3UJPA 3IPRA 3SSOA 1IEXA 2GVNA 3GGGA 3TZCA 4DRXB 1GCIA 1S9HA 2CFRA 1J2TA 5K8IA 4ARAA 3A3KA 5THQA 2I2CA 3FZGA 1WV1A 3A6KA 3RIYA 5CD1A 4Y1FA 1H2HA 1PFUA 1JTFA 3SN6A 3QBTA 5IFLA 4YREA 1JVSA 1U7OA 2B7BA 3WNZA 4F93B 3U9LA 3A4MA 2CB9A 3EVZA 4AF6A 5JAOA 3O2JA 4ITVA 5LLSA 4J2HA 2AKEA 2DLCX 4ZJPA 2B83A 2G4CA 2C54A 1HTTA 3BAFA 4NL4H 4I9HA 4GQIA 3PNOA 3WRXC 2ORIA 1V26A 2XA1A 5FTNA 5KCZA 1QDLB 4JB0A 4LQLA 4C78A 3ADKA 3T7KA 1RRKA 2ZBPA 2UXDB 2VH1A 1CUXA 1U2GA 5CU7A 4NAUA 1CE8A 1UK7A 3GOQA 5JWHA 3I6IA 3NBAA 4JOSA 4PPNA 1XZHA 2R7NA 3BDAA 5H7XA 4F38A 3G2MA 3DBHB 2D1YA 3W5HA 4C0WA 4M0DA 1FQOA 2XQIA 2OMKA 3OSZA 4RNCA 5K0EA 4BFTA 1E1NA 3QEBZ 4YAWA 4ZOQI 4CIWA 4GDFA 2J7KA 2P62A 2UVPA 3I39X 1ISIA 5DH9A 2GD0A 4GHWA 5KNCH 4ENQA 1DEKA 2LUOA 2PDAA 3QLVA 4K9QA 5FP0A 3W8FA 5K5EA 3QF4A 3RBZA 1OE0A 1SBHA 2JIOA 4YCDA 4OQFA 1SVWA 3AUSA 3MD0A 3C3BA 1KR2A 2AEMA 1T8UA 1FRNA 2G83A 2JZOA 2VP4A 3DKVA 2AA3A 3F0TA 3OE5A 3R0ZA 4KWTA 4N3GA 5AESA 4ZCPA 3WTCA 5DM70 1RPZA 4F5ZA 5DNEA 2UZ3A 2Y67A 1JG4A 4GGMX 4LWQA 3MGGA 3TTYA 4G9EA 1KGDA 4J6EA 3U44A 4MITA 2BCEA 2J32A 5KJFA 2AMYA 5J58A 1DPGA 5JH7F 3RFCA 2I6TA 2WA1A 3L0YA 1AQYA 5IZCA 1NVTA 2PUAA 3TSOA 3HJTA 2ZUUA 5E4YA 3ZBUA 1I3MA 5HVNA 4GE0A 3FZQA 2IBSA 3UH0A 2REQB 2H85A 3IELA 3IQHX 2VDMB 3TVTA 3PNPA 3CLSD 1R3DA 3HLTA 4QRDA 1GO2A 4O2BB 1NDQA 2C4VA 5SYNA 2GBCA 1BZYA 1KYWA 1RQLA 5TY0A 2HZBA 4HNUA 4KODA 4KDCA 2H63A 3WGLA 2IW3A 3M6UA 3PHBE 4WKNA 2WABA 4GMHA 3GRPA 1JR4A 3P27A 3OE7D 1NN5A 3VNAA 3ZCPA 3CRRA 3BC1A 1T25A 5K3FB 1UPXA 1CUGA 3F7TA 4KR0A 4E4RA 1FX0A 2DSTA 2HEIA 4EB6B 2A67A 4CF7A 1B2LA 3A6EA 4PY2A 1RWMA 5HKOA 2H11A 3KK0A 2J3IA 3A05A 2M32A 3KHSA 3IBTA 3P2OA 4PLWA 5ALOA 4DUZB 3HJHA 1G0OA 2Q3EA 4JGBA 1DAEA 3QIVA 1R8SA 1B42A 2XBMA 2NUAA 5HBRA 4RVOA 1GKYA 1PFGA 5FWYA 3QFHA 4RPHA 1OXXK 1CY7A 1RXYA 2HV9A 3H05A 4W7SA 5H3HA 3OO0A 2P9TA 3PXDA 4YJ3A 3IAS1 4EPXA 1U3UA 1TC2A 1RHJA 2Z8YM 3PWKA 3CRZA 4GMFA 1I36A 1V3QE 3ESDA 4HDOB 4XJSA 1I0LA 1RQ2A 1YWGO 2UVDA 5TXGA 4E5DA 1QBGA 4YJGA 1VE1A 3AVQA 3VGJA 1QK4A 4QYWA 4B75A 2QVXX 3RWBA 2OWEA 3BTOA 4WL0A 2JL1A 5CAEA 3G68A 2D2EA 4GLFA 1CVIA 1T5HX 2IEZA 4D4KA 2PSFA 3N2KA 3T5AA 5P21A 5G4KA 2D7JA 1MT0A 2LBPA 2REQA 3I0MA 3HVJA 4L5IA 5A5GA 5MN5A 4LMBA 2VCEA 2OAP1 1ZLXA 1OGIA 2VJOA 1H85A 3PXAA 5JXJA 3L7KA 3GK3A 5I3CA 3AG6A 3DEJA 3EISA 3THOA 3F7OA 2E1PA 3N2YA 1N2ZA 2DH5A 4N6GA 3RS2A 2X5OA 1HY3A 3CUYA 2QZ9A 3DMFA 5D51S 2AOXA 1WG8A 3FDXA 5CEEA 1K27A 1A9TA 2FXVA 5JAZA 3IBYA 2J3KA 2Z9DA 5K3FA 1KBZA 3OC6A 3OEHA 3ZJUA 4I55A 4WY5A 3HXPA 4Q12A 4S1TA 5G40A 3EPJA 4MDFA 2PFKA 1GPWB 3T7IA 5EP2A 1WLYA 1FY2A 2AVNA 2FEAA 4LHYA 3MTEA 4KBYA 4M60A 3RJZA 4BTLA 3GFTA 1DBPA 1MAVA 1IPHA 4ENRA 1I94B 2DCMA 1RXEA 4UVHA 4Q48A 4MYRA 4BMZA 4CL8A 1IVYA 3PITA 1WXGA 3IEIA 2ZTUA 2XEXA 3JRXA 4Q1DA 2O2GA 5D7NA 2ZI9A 4CWAA 2Q5LA 1E79D 3NYQA 3STTA 4NZMA 4PGFA 5LWHA 1AKMA 1BHJA 2GJAA 3PQ7A 3G8YA 4L9RA 3WK5A 2CUNA 4DNOA 4B4VA 1NQXA 3OCYA 1HT3A 1SBIA 1ULUA 1NBIA 5DIZA 3HYSA 3AUJB 2R8XA 5CVDA 3W5SA 4EGCB 4WNCA 5DWDA 3W9UA 3KNZA 1VSBA 5DJ5A 3R3HA 4C76A 3UWDA 1SXPA 2GXAA 1AKYA 1VZ2A 4MUIA 4UNNA 4CR7A 3MLBA 4PNPA 4EVIA 1WEKA 2A33A 3JCZA 1DAOA 4ALMA 3IQFA 3GX1A 5B7QA 5DIFA 5ALIA 4R51A 5HTKA 1COZA 1BDBA 4O0LA 2PGXA 1FNMA 1R8JA 3C6MA 3E3MA 1OT5A 4KMRA 1AN9A 3SDZA 1D1TA 4G84A 3HXQA 4QT0A 2Q2VA 4N76A 4P54A 5F1KA 3MWYW 1AHIA 3CLVA 1O6FA 4L76A 2R97A 2OG2A 1C9EA 4X5OA 1QCDA 4KYUA 3ONNA 3TI9A 3ZDZB 2QLFA 3JD0A 3L1KA 3SZOA 2WPDA 1QKIA 3DJFA 1CD5A 4KVGA 2YR0A 1G4UR 5EPUA 3H97A 3M4XA 3B52X 5REQA 3OEEA 2WSBA 3P96A 5A5VA 4GO1A 2ZTVA 2P5TB 3NWJA 1Y3AA 3EYWA 4GD3Q 4XQ9A 3X43A 1YGPA 4CMJA 1MPTA 4Q7EA 3R7LA 3WWEA 5CFPA 3L5KA 3M81A 3KLBA 4B8WA 2YVLA 4Q9AA 1GDTA 5IAEA 3LHSA 2OHFA 2LDXA 4IZOA 1YJBA 2O54A 3B7WA 1FF9A 1Z2CA 5H02A 1JEEA 1XU4A 5FD8A 3O4VA 1WY5A 1WUTA 3WYDA 5JZ9A 4TYQA 4YP9A 1YC2A 2VJNA 5JY1A 3WI7A 3K8ZA 3GEGA 4ZYWA 2GO1A 5KPJA 1NJGA 2Z6QA 1SBNE 4WECA 3HDVA 2B82A 4YJ2B 5IJ0B 4P6VF 5EVCA 4UASA 3TDNA 4ML3A 1DV2A 1EMDA 4AJ9A 3CVWA 3RR2A 3WGJA 2YV4A 1D5CA 1E6EA 2AQKA 3G1UA 4JJ8A 3UANA 3E7XA 1VL6A 1DKPA 2JJYA 4JQOA 2QENA 3NTUA 1M8KA 1NM5A 1G64A 5JS2A 2A92A 2PZAA 5CM8B 4ZMRA 4OUDA 1USUA 5DX8A 4TVKA 2FWPA 5BV2P 2WPNA 3LHIA 1E2NA 4FFSA 3U4HA 4URHA 3K09C 4IINA 4P5DA 3RODA 3VTFA 1NW4A 3LGSA 4KLZA 3O8RA 2IDJA 3ZYCA 3OTWA 1RJ9A 1G7SA 4NFSA 3Q2IA 4Y9SA 4UDYX 3HO1A 2XF8A 1OILA 2UYYA 4BO5A 3AM1A 1JLHA 4QARA 3RKSA 3R7FA 5DWQA 2QN8A 1AB6A 3D8SA 3F46A 4MVYA 3ZUGA 3J80A 2PXCA 3FG9A 3BWVA 5HKKA 1R1DA 4WADA 3Q9SA 1WSDA 4UNPA 1HT0A 4P92A 1HNNA 1R16A 2FMUA 3GCZA 4P2BA 5ER6A 2QW1A 4NE9A 1VB3A 5E6SB 4S1OA 1XSEA 3DEYX 2W70A 4WXMA 4C4SA 4D80A 1XTQA 3FWKA 3GMDA 3HUFA 2NSYA 2AFIE 3HLYA 4D3DA 1Z5UA 3OTQA 3RT1A 3ETJA 1WZNA 1FP4A 4YUZA 4MGEA 3B13B 1RAIA 2M6SA 2VHJA 1PS0A 5DU2A 1G8SA 5HIMA 1C80A 1JYSA 2V7PA 4I55F 5AOAA 1K9VF 2C0CA 1CQPA 2I7XA 4RORA 2VH5R 3Q8XB 1K9SA 1Z5NA 2ZIFA 2Q07A 1IYZA 3VX4A 2G6TA 2WC1A 4N8SA 5T7BA 4H4EA 3B1ZA 1XMIA 5FUMA 2FDRA 1YO6A 4JN6B 1Y9JA 1MB0A 3GUHA 4S04A 2B37A 2V5UA 4PLPA 2ZIVB 1UAYA 2C8KA 4KQMA 3FWPA 4KK3A 4ARBA 4EI2A 4TSKA 1Y42X 4ZT4A 4TTRA 3V2IA 4NU8X 3BIXA 4XCVA 3KWFA 4BCBA 5B6JA 1PJAA 3HB1A 1C9JA 2G9VA 3U80A 5CIQA 3KOMA 3JTEA 5D3ZA 3U48A 4UUMA 3LFUA 2P4HX 2EJBA 3NALA 1H2AS 1KFCB 2FU5C 3BCHA 3PXCX 3QITA 4AK9A 4F8EA 4PZ0A 1QKJA 2VXYA 4R5HA 2L18A 4Q3DA 5UKDA 3FYCA 3JYOA 4L08A 4QUGA 1G21A 3QX7A 4JI0B 2WFZA 4B84A 4JP2A 1EB9A 1BEUB 1WHTA 4FZRA 1B6GA 1PEYA 2WDPA 1T8YA 4KR6A 5A7FA 4L07A 4D4HA 2EZ8A 1DKOA 3KZVA 3PGJA 1X38A 1XTIA 2P2DA 4C4XA 1EGQA 2VDPB 1GY8A 3HKDB 4Z8YA 5EWMB 2GYVA 4OPMA 1UPAA 3HCEA 2HJWA 3ITDA 4RTMA 3PF8A 3QX9A 2LIVA 1MJGA 4GNRA 4JI5B 3ZHVA 6Q21A 2WSLA 4CETA 5CLHA 3R0QA 4Q9KA 2BW0A 1XRLA 1H6AA 1LJ8A 5HF9A 3ZNPA 2YVUA 3CN7A 4KVZA 1HZZC 3S68A 4Q7MB 1S1MA 3O47A 4MVJI 5AXCA 1I3KA 5K0GA 3HHEA 2HPHA 1OLUA 1VJCA 4FKBA 3C1UA 2CUZA 2OAQ1 1Z0UA 5HXAA 1U8FO 3N0XA 4BNYA 4M1EA 1ZR2A 4KDRA 2CLLB 2P5SA 2WOOA 5C1IA 2BMAA 3TBHA 4PC6A 1CLUA 1QG2A 3C87A 3HI4A 3A6ZA 3G1TA 3RJTA 2ASVA 1B8UA 5BN3B 1YV9A 4NU6A 1E96A 1FFCA 5JSUA 3PX7A 4RS4A 2VJDA 3RS4A 2PUTA 3GJ4A 3AYXB 2ZRHA 3A1DA 1LZKA 4R2JA 2V59A 1XTBA 3RSOA 3OA2A 5AW6A 2HO5A 4GQBA 3E2MA 3OF3A 4TXLA 2W6JD 2QY6A 1GNQA 4RY9A 2QM7A 3EVEA 4W5OA 3E15A 1OWLA 1P17A 4H3KB 4MPJA 4ZVMA 3RGWS 1Y5NA 2QV7A 2ZB4A 3E9EA 3IIIA 4FCWA 5CM2Z 3LL7A 4M9CA 4DIUA 1FLAA 3MWKA 1N7IA 3EIWA 4US0R 4AMZA 4DQ0A 1T2VA 1Z0DA 3H9UA 1CJUC 3ZY3A 4YLYA 2NW6A 2YRFA 3LXRA 4QHYA 1UPFA 3C3AA 1MC5A 4TQAA 4GR4A 5FBQB 4DCSA 5K2MA 1LSJA 1MJFA 4HX2A 1VG1A 5BSRA 4US2R 1Z6PA 3PPXA 4WZBA 1VBFA 5AUPB 3FR7A 1RRGA 3HKDA 1QR6A 1OC4A 5EMNA 1RWPA 3D1JA 1A7KA 4Y0VA 3ZHSA 1B14A 4BGEA 3AB8A 4A3SA 4B46A 1ULTA 2WIKA 1IOWA 1GZVA 2BGMA 3V46A 4ZYYA 5EIBD 5HKAA 1B23P 3ETNA 3WMEA 4MR8A 1ZQ1A 5SV2A 3WG9A 2NUPB 3LNTA 1J9GA 1JQAA 2JI4A 1M0EA 4MLPA 3FTPA 3D64A 5DK4A 5FWDA 1R0RE 1RKXA 3DDWA 1JUDA 1Z8DA 4NJMB 1XJ5A 3MMXA 1VYHA 4JK3A 1A4RA 1V35A 1DO2A 3FGNA 3ZKWA 3UPUA 4RK7A 4E5VA 1QLWA 2VPPA 2XA9A 2Y93A 3CJTA 4G3XA 4K9OA 1AA9A 4LI0A 4QE3A 5CXXA 2ZSAA 4JY7A 3ROPA 2FR1A 2VHVA 4YRBA 5IZ4A 2XSZD 2OV4A 2MYTA 4LRSB 3RYHA 1EUQA 4XWYA 2CXTA 5HE9A 1HPLA 5GVSA 2ZAOA 2PD6A 1G6Q1 3ES9A 4OAOA 2LDBA 3VGPA 4PPYA 4FP9A 4CM6A 1IQPA 1FYFA 1DOHA 3NXSA 2Y8EA 4I4TA 4IJQA 2JIMA 4YJ2F 1GUFA 4MGKR 1F9AA 3HVRA 3SICE 2CLMB 1Y1QA 3S4YA 2TMKA 2AZXA 1FFWA 4GPZA 1QAMA 3T5DA 4B80A 4CL3A 2C8VA 1BWPA 4HWKA 4TL8A 4NCAA 1WCIA 3MGKA 3HWSA 2I2FA 4EY5A 2ZSDA 1SELA 1QGDA 3P26A 2NVOA 4DCMA 2OL4A 1AX9A 3UT5B 3FRIA 2Z6AA 4BNUA 4BYMA 5K7SA 5JUWA 3IOYA 2NO0A 3MWDA 4MV8A 3AUUA 4WUVA 2AW5A 5CW2A 5EZQA 5ED4A 4EYGA 5JNRA 3ET4A 4F1KA 1G8YA 4PX2A 1E4VA 3B6JA 4H18A 1CY4A 1QGUB 4QEDA 3VTAA 4TKVB 4XPIA 4E22A 3BMOB 1KVQA 5D2CA 4JP3A 1Z0JA 2PQ0A 1ZM9A 2WF9A 3MTDA 5BVGA 2DWPA 1S2LA 3HGMA 5CVVA 1LDEA 3WLRA 4J16A 4WEQA 1TEZA 5CYPA 5AXAA 4BNDB 1SHLA 2C97A 1P0IA 2GO7A 2QXYA 4PO9A 5KYNA 1SB8A 4R1UA 4F6LA 1DZ3A 1FYXA 3G3EA 5ES3A 5TPZD 3Q3GE 2C4TA 1C7ZA 4WXYB 1NXQA 1W1UA 4OJKA 1GZ6A 3OPNA 1ADCA 3CLRD 3CTMA 5JAPA 4EJ6A 3QVOA 5LN1A 1M6WA 1Z37A 3RU7A 3RD5A 4AD8A 2AUNA 4ALKA 4BKRA 4E12A 3G2IA 2PX0A 1I80A 1SRQA 4IVNA 4YRTA 5JD4A 1EXVA 1J0CA 4WOPA 2VDWA 1P74A 2DBZA 5HFNA 3ZWCA 2EKDA 1BEZA 1UFVA 1HYEA 3HRKA 3ZCRA 4JCCA 3Q6MA 2AZ4A 2L17A 2DQYA 3H83A 3U3ZA 5AVVA 3ABOB 2A2ZA 5E4TA 2X5KO 3WIOA 4ETMA 1C1DB 4LNAA 4MYUA 2PMFA 3LC7O 3CEMA 1UWLA 2H6EA 3W9BA 1GOTA 1OPRA 1JPNA 2BBTA 3H3XA 1TEHA 4S2UA 3L01A 1CEQA 4AVYA 1QLJA 2C95A 1RQXA 2HHAA 2I2XB 2IUYA 1P77A 1ZVVA 2PQ2A 2X4LA 3VSAA 3TDKA 2D7DA 3WLIA 4H17A 1L4NA 3U3XA 4KREA 3A6FA 1OREA 3G6KA 2ZRPA 1P62B 5DVZA 2FPIA 3ZTWA 2ZJOA 1FP2A 5SYAA 2KJQA 3C6ZA 4ID3A 4WA8A 3DO6A 4JDPA 2P2CA 4DSZA 2UUOA 1GTL1 1UEJA 5LZ5A 2W83A 1DEHA 5LQNA 2IHVA 1MHTA 4GM0A 3WA7A 2ZI5A 1ZICA 4XQ0A 2V1XA 2QQFA 2ZYTX 2VJPA 1S5PA 3ZHZA 1LB1B 4QTYA 3PJDA 3ENQA 1S96A 4YXWA 4XIJA 1QQ6A 4Q4HA 3WNCA 3CR7A 3WGKA 3P9CA 3I5AA 4F5DA 4A0SA 4HXYA 2W6NA 1L5SA 3P20A 3TD6A 2PRIA 3A1WA 7YASA 2K7ZA 3LXMA 4Z6KA 4JBHA 4G8DA 1VHQA 3OZTA 1AO0A 4XWTA 4WE3A 4PXSA 4EGAA 4Y8VA 2B30A 1NBMD 1G3UA 3FPSA 3G9TA 2O48X 2WM9B 2HYDA 1EDDA 2YWRA 4KZKA 4WCVA 3WYCA 2C9CA 2N75A 4PGGA 1ENOA 5FOVA 5TT1A 3NHLA 3TR0A 3WBJA 4AFNA 2DF8A 2GUWA 4ZT2A 3ZOZA 5J3JA 3I6MA 4MUKA 3EW7A 3N39C 3HY6A 4F3NA 5LDHA 3KEOA 3S1AA 1P7ZA 1CDOA 2OLJA 1ZJJA 4WNAB 4BX3A 1PSDA 4M1ZA 2OD7A 2A1TR 4MHOA 5G0WA 4D79A 5B5SA 2GCOB 2LCFA 1ZH0A 3NATA 4DWWA 2J09A 4EYOA 4TTQA 3E2PA 5CXSA 2IS2A 1NBOA 3DDCA 1N3LA 4WERA 1E0DA 3FPFA 1N2EA 3BXHA 2B0JA 3I04M 1QHFA 5FF9A 3QE0A 2VCHA 2FWIA 1Z0IA 1LPNA 5EP3A 2RGDA 2LZ0A 1P80A 4OFWA 4RTQA 3REFA 3ROQA 4BFXA 3Q3CA 5DNWA 4BBJA 2Z56A 2BMWA 4HBZA 3VTZA 2H0AA 3C6YA 1FXWA 1N25A 2Y05A 4JENA 1J2EA 3P2YA 1HYHA 3TAXA 1SOWA 2C2GA 5KDDA 4QFMA 3DWEX 2ZIGA 3OCZA 2VNIA 4B31A 3I4LA 2PUGA 5TMDA 5BW8A 3AJDA 1IZ8A 4BUZA 4A6PA 3DWFA 2SBTA 4NS1A 2AK2A 4J3JA 2VSQA 1BMQA 1UK6A 1NT4A 1FC0A 3GB9A 3LY8A 2XADA 2FMIA 4D6YA 4MQLA 2XYRA 4AROA 2ODPA 4BN5A 4PHTA 4DMUB 1THZA 1DKMA 2YQ4A 5ALPA 3K1JA 1Z7YA 2FPMA 3E3AA 3T4UA 2IYPA 2YJNA 1PQUA 3DF7A 2FMFA 4LMRA 1YZQA 4OXKA 2P1DA 3HCOA 4RVGA 4XIFA 3DBIA 2AS0A 2WG0A 3AIIA 4D46A 1KKLA 2D8MA 1MO6A 3KJGA 3WK9A 3ZV5A 2J3HA 2WV9A 4I1OA 4I7EA 4RDCA 1U0HC 3CF2A 1ORVA 2C03A 2VYQA 3GP3A 3PQFA 3QVTA 2I9PA 3A36A 2IH2A 2A0WA 3Q4GA 4J1SA 5T6MA 3JAMA 2W4IA 4JOQA 2FWBA 3Q9UA 2EFJA 1LVGA 2OWDA 3HUUA 2QYSA 3PA6A 1YDEA 2IYQA 1PR2A 3KVRA 3WRVA 3ZHOA 1RWXA 2C1EA 4AZ0B 4FGWA 1KFEB 2YC4C 2MINB 3Q7SA 4R40A 3UJAA 3LIPA 4DA9A 1LH0A 1U99A 2HTFA 2V7TA 5F33A 3ZQ4A 4A2WA 4L6IA 5HR5A 2P9FA 5E6UA 2DXIA 4D8WA 4NC9A 3MGBA 4QAQA 3WFZA 3UAYA 3NKLA 3OJOA 3R7WA 3ZBPA 4BXOB 2GAAA 2BEWB 4GX5A 1PZXA 3TSWA 4CCYB 1R9JA 3ORRA 2RGRA 1L7EA 4GMDA 1PTKA 1AF7A 2O57A 1XJWA 3KUCA 3MMSA 3PLRA 2E3JA 4JUIA 5BYAA 3IP7A 3DP9A 4S35A 2JC3A 1RRPA 3AU9A 3WB9A 1T9KA 1DB3A 3LKVA 1XELA 4FM9A 4P0PB 1Y7LA 1A9RA 2CNKA 5IXSA 4LRUA 2IEBA 3LYUA 3PC4A 5ALLA 5KMGB 4QFBA 4O33A 5TQJA 2HU7A 2PFSA 2ROQA 1JMYA 4D43A 4QXQA 1MN6A 1I2DA 2Y77A 2IPLA 5H5JA 4EP1A 4C2UA 2ZJ6A 1EVIA 1P7YA 1A4XA 5JXGA 2CZQA 5DNUA 2HXYA 1S2IA 2QRPA 4NBKA 1JRLA 3BFJA 2QNBA 2OM6A 3LUDA 4IDHA 4AYWA 4J0QA 2ZZKA 1Y5IA 1QYCA 3H2ZA 4FHFA 3QW4B 3NYIA 1M2OB 1P4HA 3KE8A 3WZ2A 1JA1A 3U13A 1UADA 3PP8A 4N3NA 2ZE6A 3LT1A 4FEAA 4D9BA 1SBTA 2HD4A 1J1ZA 3R41A 2HF8A 1GSOA 1MVLA 2MYNA 1RPAA 2BEUA 3SBOA 3X3HA 4DPLA 4EMSA 1MZPA 4BQRA 3CPJB 4LWPA 4MA0A 2DULA 2EQ5A 2DJ5A 2C3UA 4HAYA 3RWMB 3VV3A 3W7VA 5TEWA 1IM2A 1OB2A 1EA7A 1XTRA 1NF3A 4B6RA 2MINA 3JQQA 1L5HB 4BAUA 2ZRIA 5BUZA 3MMZA 4KCGA 2PUDA 2FPPA 4UMEA 2P9EA 4Z1OA 5I48A 3I6QA 1PNTA 3BSSA 3QUSA 1TLLA 3GGPA 5AKZA 5LQMA 4Y2UA 1KU6A 2I5PO 2HIHA 4YRCA 1EM8B 3HNRA 3I0ZA 2XXBA 3OCXA 4H3HB 4J1NA 4NEHB 1JBQA 3KHUA 5BW4A 2B34A 2JAOA 1DMRA 2ZSJA 4QAJA 4I19A 1V16B 1J90A 2C5AA 5ADWA 2P91A 3LFHA 5DXFA 1Z68A 4MWDA 3IKTA 2GDJA 5AOVA 4XUCA 3IAXA 3BVPA 2CMHA 4MQMA 2I3AA 1KZGB 3RS8A 5K4GA 1N9ZA 4MUNA 2ZRJA 5C31A 4A8PA 3L7YA 2P30A 4A5OA 5IAAA 1FXWF 4DLPA 1X9GA 3HTXA 1I9GA 4B8YA 4HN2A 4ZOCA 3CEHA 3IT2A 4H7EA 4B6QA 2G0AA 3MOIA 2JHGA 2GAJA 4U02A 1YD7A 1JDUA 4H1VA 1V39A 3CX7A 3H11A 1TTPB 2HSGA 1GKLA 2OZLA 3W9SA 5JD6A 4NE2A 3ZNQA 1Z26A 1E4EA 1OLSB 2IIPA 5LDGA 3RAFC 1BA3A 2HY7A 1YK0A 5KOJA 2OILA 1TAQA 3A3PA 3ML1A 2N3ZA 4UBLA 4EQ6B 3F5MA 4GW3A 2YIDA 1ZSVA 5IBRA 3UMSA 1FJGB 1O1YA 2F43B 3IERA 2XWBF 2A0UA 1QS0B 3ZW7A 2OV1A 1E6MA 3NDIA 1D2GA 4FONA 1NDHA 5K8CA 2JPDA 1IONA 1U90A 3OZCA 3Q0IA 1JLRA 4G5OA 1L5HA 4KVFA 3DOEA 1ZD9A 1DC7A 2EXXA 2Q5EA 3TNFA 1A27A 3BFVA 1KMIY 4A27A 1SRRA 2EFCB 3T1VA 4F9GA 1NA5A 4FNMA 5BWBA 1ZNXA 3GWGA 4KN6A 3QHAA 5B12A 3V1UA 1UOOA 1F2VA 3DLHA 1AK2A 3K1TA 1QXSA 3PR2B 3NM4A 3ZU2A 1GPAA 2JW5A 3KDPA 2J6CA 1A8IA 1DX9A 2FW9A 2GAFA 3ER6A 1RXSA 2CHGA 4YJFB 4C21A 4ZQFA 3GEHA 5JXWA 4EW3A 1ZKDA 1H8HA 1TFUA 3KR0A 1IIBA 1VL8A 4Y30A 4DBLE 4C08A 4ZZ0A 5IANA 3JWIA 2DVMA 7MDHA 2ZUWA 5KOIA 4GBED 2BGLA 5EZYA 1XA0A 3OIFA 4XYEA 4EJSC 1NC3A 4ZU3A 4CFZA 1BS2A 4TRRA 4TZKA 4JJFA 2CNNA 3B38A 1RQ7A 3KKZA 4G63A 4JBYA 4MWEA 3RC9A 2PKEA 2EF1A 1Y1SA 2W9XA 3A9TA 3QU7A 4E09A 1WU8A 2ZJ4A 4ZAWA 1P91A 1X9IA 2CHUA 1NW5A 1NUPA 2ODWA 2X6QA 2YMLA 4PQEA 4X3PA 3OMXA 4RLHA 1M1ZA 2UYOA 5A3QA 2I9KA 3TBKA 2J5BA 2BZSA 4LJYA 3SM9A 4OP3A 2PLFA 3LDAA 3RBXA 3UW1A 1ECLA 1W5TA 3LUKA 3PFHA 4JYCA 4KAJA 4JOCA 1KO8A 5DXJA 4HB0A 2DU8A 4JX8A 5FJJA 4ITUA 4BGVA 4Z9XA 2ZDGA 3BMCA 2VF5X 3NHRA 3RLFA 3L7AA 4ZIRB 1Z0KA 5CDTA 5ALEA 2IPOA 3EH1A 4EPWA 4ZVSA 1A4IA 3FOBA 4DR5B 5TEVA 3E0QA 2KBFA 4QUJA 3WDSA 3NCTA 1OYOA 3RKUA 4AJIA 4ZYXA 1AQ6A 4KXYA 4LN1A 4P34A 2VYVA 2KPOA 4G65A 3SR3A 1M75A 1WCYA 5BT8A 3FWHA 2XDWA 3PR1A 3N5KA 4H0NA 4IQFA 4UMDA 3UJHA 4N54A 3AW9A 3KU1A 4JAVC 1XZKA 3H04A 3V8BA 3A1EA 5JCOA 2A7QA 3ZV3A 3DMRA 5IG2A 4YR9A 2J5QA 2EKZA 1XZQA 3I2KA 4GX0A 3SCZA 3ZE7A 2PS1A 4A0RA 3EBPA 3IAEA 4XTRA 2K6GA 5C8YA 3GLVA 1Y4UA 4B2PA 5I7OA 2A1IA 2JKZA 4JZYA 3ZWOA 4XD7A 2HA0A 4AG5A 1VIDA 2IDMA 2JLSA 3TTXA 2VZ0A 4MVXA 3T3OA 2DLNA 3AFGA 1BQEA 4JJIA 1EVKA 3N07A 1Z38A 3BH7A 1NT2A 4IV0A 3W8NA 4IH9A 2MOKA 4B3TB 3KQOA 4C2TA 2ZEJA 3MWEA 2OZKA 4CQLB 2GUGA 3GMSA 3UJ3X 5KC9A 2YFYA 1DBRA 4DJDC 1CUDA 2E0IA 3ASUA 3IILA 1KDRA 3JVUA 5DGTA 3RT7A 1ONBA 1I13A 5H9VA 1W76A 5EEHA 1L8AA 1L7XA 4HB4A 3SJCA 2YQ5A 3ZHTA 3ACDA 4B3RB 4Y0AA 4TYPA 2HB6A 1AU9A 4M86A 2FCAA 4ARZB 4P82A 1GCOA 5I9BA 4PLHA 4F8YA 2RMKA 2H2FA 2H5JA 2R3SA 3L7OA 4KKXB 4HP8A 4JB2A 1OA1A 3PV0A 3GH3A 3PEEA 2XMCA 1M5UA 2EEPA 4OJMX 3GVXA 3OZBA 4OHYA 2E55A 6LDHA 1CFZA 2CNDA 2BE9A 3LUBA 3C7DB 5IDQA 4IDDA 2J08A 3TLGB 2GCGA 3H0EA 1MFPA 1SKYB 2Q6LA 3DHEA 4U4AA 5J2UB 4DR3B 3ZDDA 3WAKA 3L6UA 1SQ6A 2QMHA 2F3TA 2UYQA 5TJ9A 2JVJA 5BO5A 5LQSA 4LOAA 1G4AE 1HI9A 4LRYA 4YAIA 2WHXA 1Y7HA 3ESZA 1E7WA 2LD4A 4URWR 1QR2A 1YMUA 5HIIA 3ENZA 1QGYA 1B00A 1XFDA 2FSIA 2X5JO 3L0OA 4OHFA 3F97A 3KXKA 2HQBA 3WL8A 4B5LA 3IULA 5KSWB 1KQFA 4E2YA 3FAZA 4RSGA 4FN5A 1XMVA 4BNWA 4J43A 3ZWYA 1GGEA 3H1BA 4IDGA 1G291 4P5EA 5T8KA 1DTWB 3U1TA 4C6HA 3WKDA 1JSXA 5H80A 2YJ3A 1JWBB 1CP3A 1GHTA 5KNCA 4E30A 5ITWA 1R3UA 2PGNA 3O95A 2QOEA 2F3RA 4IVQA 3QG1A 3NDJA 4QDOA 2GPJA 4M6WA 4O8CA 3N1UA 3H5WA 4PFKA 2IYWA 4CQLA 1GRQA 1ZMTA 4CDRA 1V9SA 5CBKA 5HSGA 1OZ0A 2PZMA 4YYEA 1UMDA 2QIOA 4RYLA 2B1GA 5DLPA 2B3DA 3QE4A 2AFHE 3K1AB 1KMHA 3OFKA 1OMOA 4INOA 4IDPA 4MW1A 1F48A 1AMOA 1NJ8A 3UK2A 2OQRA 4R8RA 3TB4A 1TUGA 1QB7A 1TQ4A 3CV3A 4A6XA 1BCSA 1G1MA 5EZYF 1SHJA 1QLHA 1UPBA 4NVRA 1JEQA 3EMVA 5KWIA 3ZHQA 4KUGA 5COAA 1FFSA 3L7DA 3KYCB 4Q9JA 1VPWA 1X8XA 1RFGE 1J20A 4EVSA 1EXNA 1US8B 5L95A 4NNJA 1S3IA 3M6LA 5A7HA 4QGBA 3RFFA 2PMCA 1GWNA 2ZVQX 5G0TA 3TLGA 3L02A 1MTZA 3KPUA 1TM4E 3S7ZA 3UTDA 4O2LA 5AICA 4D0NA 5FWNA 3ORYA 1ZJ6A 3EGWA 1K06A 2PWYA 4R3WA 2X0FA 1FFAA 1JHUA 3K0BA 2Z83A 3JRWA 2VP3A 2YOGA 5F3RA 3N58A 5JMTA 1N6LA 2O8BB 4IKOA 4WK0B 3WJ7A 3CZQA 2WG1A 3R3UA 3AOEC 4BLWA 4DOMA 1AZTA 1MC1A 3LOQA 2QP3A 5EQFA 1Y81A 2FX5A 1Q11A 5DTIA 1KJ8A 2RSLA 4U7HA 1QTRA 5F7OA 2EFEB 5FLXA 2Q8QA 1T4CB 2I22A 4MRPA 1CEXA 2ZSKA 4HAZA 3UYLA 3N6VA 3ZD9A 4JMPA 1SKQA 1T5TA 2V97A 4HATA 4L95C 1ZJ5A 3H6HA 1U0EA 4GM1A 5K3CA 4HQRA 2BKUA 1FS4A 3U2QA 3WOVA 2RHGB 4C89A 3VKHA 1FSSA 1C3JA 1TCCA 4CKEB 5FQNA 1KYYA 1SXJD 2H1IA 3LTNC 1N77A 2VLIA 2F7SA 1LFAA 2E6UX 3FHCB 3L7JA 4BP1A 1N32B 3HKEB 1XV5A 3QWAA 1U65A 5JWOA 4GF5A 5AJTA 2JJMA 4N40A 5HRUA 4BCCA 4RMIA 4PANA 4RVCA 5HX7A 2FPUA 5A9SA 2DQKA 2RC6A 2IYZA 3BEDA 1IQUA 4PBSA 2ZGVA 3GD7A 3I37X 4QSMA 1NXWA 2OT3B 2ODEA 4NSNA 3Q3JB 2IEDA 3LUFA 5JNLA 1YHNA 4DJAA 4RQUA 4MRAA 4F4IA 1N78A 2AN9A 1ECBA 3M4ZA 2H1WA 4ON9A 3DZHA 4G0VA 5GM1A 3X1KA 3JWPA 2ZZNA 1G5PA 3LUPA 1Y6RA 5HCUA 3DNPA 5HP4A 2BHTA 3JAWB 5TE9A 2V7UA 3Q98A 2HPVA 5LMUB 3T9BA 2PJZA 2O2CA 4FW8A 4G4IA 3SM3A 3NC1C 5BPHA 3AOGA 4R84A 5K1ZA 3WQSB 3A9SA 4D8XA 1VA4A 4EZEA 3OZDA 3LLCA 4FGKA 1QQ5A 1VLMA 4BMVA 2W6ID 1D1PA 3FYHA 3PRYA 4Z4HA 1F4LA 1BD3A 2A5LA 3JATB 1PFWA 2NU6A 1WNTA 2XYHA 3JWEA 4AF8A 3G13A 3KXDA 4RJ2A 2X8LA 3OLYA 1NZDA 4WCDA 4KXUA 1FRFS 5EESA 4LNUB 3LQ1A 8ADHA 1MO3A 1CUSA 4Q3EA 3OQNA 1KJJA 5BQ5A 1L5QA 1N0VC 3RRMA 2CDNA 1OX4B 4CM4B 4C07A 1A2KC 2IF2A 3GLKA 3IXLA 4ZO8A 2W2OA 3E70C 2FW8A 1N4AA 1K8ZB 2CDBA 1QUEA 2BCJQ 4OTZA 4Q01A 1OD6A 4R16A 3VSEA 4N0MA 3QE9Y 1T0BA 1T1JA 3LF1A 4BLRA 4DG5A 4AKIA 2R25B 4B3JA 4NNPA 4D4GA 5GONB 3L6BA 5IBCA 2G8LA 2NNWB 2NAFA 5IU6A 1MXHA 3VMMA 1E5TA 1L4BA 4E5MA 1X42A 4RKWA 2RCYA 5C53B 2XDQA 4IIJA 1U3CA 3EZ9A 1E2PA 1JW9B 1M66A 4BY9E 4P86A 2Q5HA 5I7HA 3P9ZA 1F5SA 1THGA 1J7JA 3A25A 4U5QA 1U98A 1MOSA 4QGAA 1P9RA 2CLKB 5EJFA 1ISGA 4L4UA 4W1QA 4WPGA 2XODA 3LQFA 3NWBA 1I6KA 1E5DA 1HDZA 2A9JA 1VQ1A 1E2MA 1QANA 2YBDA 4BLUA 1NLZA 1WMDA 1YBFA 4UM9B 3QEAZ 4C87A 1SM4A 3FI9A 4N18A 4Z7QB 3FJYA 4HAUA 1RWQA 3DDSA 1FTGA 4H7FA 3HUTA 2PZEA 1L5FA 2Z43A 5J2UF 3OWOA 4A6DA 2CFCA 2I7CA 3JALA 2BEKA 2CXSA 3D7KA 1KI6B 3DLAA 1NXXA 2AYYA 4DYDA 4MUAA 2O59A 3WXBA 1QIIA 1SXGA 2WTXA 4G5QA 4YRQA 4F56A 2WHYA 1U2RA 3IE2A 3VH2A 2VNSA 2VPTA 2IYSA 4MS4B 5FPPA 5CB4A 2XZDA 1KRWA 2YWEA 4G0QA 3FOAA 4LC0A 2J9ZB 5AI6A 3F67A 5JCZA 2J45A 2ZWAA 3T5PA 2XT6A 3EVAA 2ODQA 2AN3A 4QYIB 4E11A 5ICGA 3L04A 1R27A 4C06A 3IB3A 1QYRA 2GZRA 2X9NA 2QQGA 4H16A 2VT6A 2Y0PA 3BCUA 1DIRA 1RYZA 1XA4A 3HSYA 2ZB3A 1QHXA 3AF3A 3K4HA 1IHDA 2X0IA 3ASZA 1TYZA 3PEUA 2GTPA 1FRQA 4OHZA 3V1LA 2MR6A 5BVHA 3CZ5A 4OYYA 5FKJA 1K08A 1PKXA 3OECA 2UZ4A 1KFJB 5HF6A 1U1CA 4NXMB 1GXSB 4G4SO 2WJ3A 2BFCB 3CSDA 5C4IA 3VH4A 1E9DA 5LYJB 1H05A 4CEJB 1IZ7A 5K8LA 2HIMA 1H0SA 5DEOA 4A6EA 4ENTA 3D8RA 2ZZMA 3R9XB 2IOYA 2EG9A 4JKYA 1I1HA 1CRQA 3MPOA 1U8XX 4GKVA 1Y5MA 3A7EA 5GM2A 4DRZA 5ITZB 1EYZA 2JLRA 2GK6A 2I8CA 2O2YA 3QW2A 2BFFB 3PC7A 4M46A 5YASA 3T12A 4E2FA 1JXMA 4M3NA 4EF4A 2WUEA 3GBSA 3V00A 1Q1ZA 4HK4A 4ZOLB 3S3TA 3EQZA 4DV0B 1GZ7A 2ATVA 2IY9A 3H19A 1PUIA 2E4XA 4ZV7A 1R5OA 1C81A 1T9DA 2Y71A 4EW6A 3GP8A 3HN6A 2K7FA 1D1QA 1M6NA 3RRNA 2NV6A 3WRXA 2O7QA 3C74A 3ND8A 1OAAA 4MS4A 1W46A 2VJKA 3PC8A 2H18A 3HNOA 1GPMA 2XW6A 3B1XA 4K87A 1LDBA 2JIRA 3VSCA 1QCCA 1RP1A 1URPA 2Z2YA 5AI5A 2QLTA 5FDFA 1YZHA 1EM6A 1O6BA 1YKGA 3DM9B 4DN6A 4E70A 4WCFC 1R10A 1U1IA 1DPFA 3PDIB 4CCWA 3FIUA 5IMSA 1IAQA 3DMDA 2QM3A 1VG9B 3D2AA 2Z4SA 3OTIA 5JCJA 3EIUA 3KOYA 3PPVA 5B37A 1GZUA 3KTAB 3LF2A 1JIKA 1VLZA 1SCUA 3DH0A 3UAWA 3LDHA 3CQ9A 5FPYA 3ZHCA 1N7GA 2RJOA 4V0LA 3O0TA 2BFCA 3TGLA 3O4RA 4Z7OB 1FFHA 3FZEA 3D6HA 3KWJA 4ZI5A 2A9PA 1NVVR 4F4UA 3SQMA 5ITVA 3R9XA 2UXCB 3E3OA 3WWYA 1G2OA 4ARCA 3RUIA 3ZQUA 3CKYA 1J0EA 3KP1A 4I6JA 1P4SA 4C7VA 1YR6A 1XCOA 4NYIQ 3KVVA 4Z4QA 3VBEA 4IIJF 3V8VA 1ACMA 4QWMA 3ER9A 1E1YA 3N0WA 1GTZA 1IHYA 3OEHD 4CIVA 3CNOA 5EJ6A 5TSDA 3VO8A 5I4BA 4G0WA 3WGMA 4HRXA 2JAWA 4NCNA 2H2GA 3D5QA 4I4IA 2B7LA 3DXFA 3K0CC 3TRFA 1DBIA 3ZJVA 2K2QB 5ECDA 3WK8A 2I2BA 1JZQA 4FXPA 2RB5A 2NACA 2PTGA 2VVTA 5AVSA 5KAMA 3ZBTA 1ORTA 1JX6A 3M1LA 3L1IA 2OVFA 1JLKA 4MS1A 2I7VA 3RROA 1GGJA 3W2EA 2E5LB 1NJ6A 1PIWA 2M2IA 4MVJE 5ELMA 4MVCA 4LFAB 2X9VA 3F7NA 1T2DA 2VPXA 5J9FA 4IG4A 5BYBA 1K5PA 621PA 5I4IA 2C94A 1NBME 1F0PA 2P3SA 5KPDA 4HPWA 3CZRA 1EFDN 8OHMA 3SI7A 2ZS7A 4ND4A 4BVGA 4J90A 1F2TA 2Z3WA 2JK1A 4TXMA 2OYCA 4P4TA 3ZWNA 4F3KA 3JZMA 1Q0TA 3NV9A 5MN4A 2EBWA 4XVCA 2X15A 1EESA 2JS7A 3WLPA 2R1UA 5CB4F 1IXYA 3LUGA 5BP7A 1QNLA 3L0DA 1MO4A 1XDBA 3OBIA 3O8LA 1JYFA 1KRXA 1QX3A 2FG7C 5E8JA 1GU1A 3ICWA 3R6TA 3D0KA 4MV4A 4MICA 2PKQO 4ZOEA 1EQUA 2WPDD 2QJRA 3HU3A 4QBIA 2WMOB 4KX5A 1EIWA 3OEED 1G3RA 2O5CA 1TO2E 3VPGA 1VSTA 4R8VA 1Z15A 4OIFA 2D1FA 1GTVA 2QI9F 1JQ5A 3SP1A 4Y2HA 3TW6A 1QDEA 5IABA 5TVKA 2QJOA 1JJBA 1G7CA 3ZY4A 2GH1A 3LDUA 3A3YA 3H8VA 4Q4JB 3KV1A 5IF9A 4DA7A 4PO8A 4CZ2A 5AIBA 5AM5A 3T1NA 4JI4B 1RU3A 2D5BA 2JFBA 3HYNA 2GPYA 1SJ9A 2Q62A 3E27A 1FSFA 3H9QA 3PT5A 4I0WB 4HNTA 1MABB 3ZXIA 2PQ6A 1DQPA 1OWOA 4BPRA 4X94A 4MK4A 2P5YA 3D2CA 2C2KA 3ILXA 3DLPX 1J07A 5TT0A 4FMBB 1CW2B 3D3JA 3A04A 4GI2A 2P65A 2HC9A 1XZDA 1ZO8A 1XZ8A 1B8NA 3E9QA 1XFAA 3IHLA 4H27A 5IJAA 2EOAA 2HF2A 2X7JA 5LD2C 2VJAA 1D4FA 1SU4A 4YJHB 2ISQA 4KG7A 2G36A 1GNVA 1S7GA 1AUVA 4RNDB 4MPRA 3CG4A 4CEIB 4D9HA 3U4QA 2X2OA 4MS3B 1P81A 1KP9A 1PNVA 5CFNA 1EUDB 4LDNA 3LUAA 4UPDA 5F64A 3DAHA 3NT5A 2HK8A 3E8SA 4EQZA 5DEIA 2NUTB 5HUJA 1LPSA 2QRQA 3TEFA 4AW9A 2QMOA 4MR7B 4D41A 2HA5A 3R5SA 4D56A 1FDVA 1LRKA 1U8CB 3AHEA 1MEEA 4LGVA 4PZUA 3VAYA 2VTBA 4F9TA 4E5NA 2XR1A 2F90A 1B93A 1AGRA 2YUIA 1H2WA 1NXPA 1X1TA 4QEZA 5G3YA 4ZD6A 5HKKD 3TRHA 4IQ8A 3BULA 1X1RA 5JFOA 2CBGA 1D2CA 2OXRA 2P6RA 4HH0A 5DN6A 5DTQA 3VHXB 2CD9A 4JI1B 4AWBA 1K7XB 2BFOA 2RB4A 2G1PA 1Q20A 2H0RA 4BV9A 1XK7A 3RC8A 1AT1A 5AKIA 1YBVA 2ZYWX 1C3VA 1PR1A 3K8YA 4FN4A 4CT4B 1MABA 3JVDA 2R5NA 4IIBA 3TX2A 4AI6A 1HQDA 1Z2PX 3LG2A 5HIJA 2VRNA 1ZRNA 1RI1A 3TLCA 4BHTA 3KDAA 1Z7EA 1OVGA 3N6RA 3B3FA 4HQKA 4OB6A 3WZLA 4ZOLF 1IN1A 2P67A 5JFTA 2HQ1A 4ARVA 3L1VA 2FMXA 3I2IA 1ZMXA 2FPKA 4Y2JA 4DZTA 5CFQA 2PUWA 1K5DA 1KIMA 1HLDA 2EGUA 2GRUA 3AJAA 4ZAXA 3PXGA 1U02A 3LV8A 1JHQA 4MZXA 1Z88A 1IIRA 2VP6A 2PGAA 5KOHA 2IVFA 3BXZA 5DHPA 1SOAA 1W9HA 2DPMA 5LZ9A 2RIRA 2W8BB 4ENVA 1U7UA 2ZYSA 2J0UA 2IDZA 3A6PC 1EUDA 3MCTA 4I81A 4N5NA 5DNAA 3IPYA 4AUMA 4FB4A 2WKRA 3BD6A 1KEZA 2JJ8A 2C0QA 1WU7A 2ZJ3A 3TUZC 2DCUA 3USZA 3WO0A 3TGPA 2HJSA 2P9QA 1Y1KE 3K15A 5T4FA 3DE7X 4B6JA 3BXOA 4HRAA 4M53A 2C7OA 4C4AA 5WRFA 4ZZIA 1T36B 3EOZA 4B5KA 1TA0A 2C00A 3KQYA 1V48A 2BFWA 2BZ0A 1WXFA 4QBFA 5KKCA 3UJ7A 1BQ3A 1H5UA 1NNEA 1IPFA 1U2PA 5I4KA 3PCRB 2CC2A 4IGEA 1G7RA 3UPDA 4LXYA 2FEWB 1P2VA 1NUAA 3SXPA 3NIGB 1CHDA 2GETA 3NYWA 3T41A 3LVRE 5I01A 5LL6P 3S5UA 1ZH8A 2C5HA 2QT9A 1ZNYA 3EF1A 3OKAA 1KC1A 1SIUA 4NEGA 3ZH2A 3VO1A 1M6VB 1T2EA 3WHKA 4J0FA 1Q83A 3TD2A 3UAXA 3X1WA 4EMUA 1HRKA 4R0NA 4QTZA 3OY7A 3KQUA 2FUEA 3MINB 2FF7A 3NHPA 3QMWA 4G23A 4MA4A 5DW3A 1UZMA 5JRZA 3UGTA 1E59A 5DNVA 2ZQ5A 2W37A 4TQUS 3O8DA 4OBXA 4WESA 2BV3A 2ZS8A 2UYCA 5E1DA 1VI5A 4ACBA 3VJRA 4N3AA 4U2CA 5M5BA 1L5OA 1K8RA 1KI4A 2FH5B 2X6RA 4L9AA 5EP1A 1C9DB 1TZCA 2OFXA 3WS7A 4CTMA 1VG8A 4EYKA 1QOPB 4B3IA 3A1FA 2W2LA 1E9RA 3WWCA 3GNQA 2H2WA 4CM5A 1C30A 1F2DA 4LZNA 5K51A 2HJVA 1IUPA 4TRNA 3A2KA 2AEJA 2BRUC 4JT8A 3OJFA 5J5VA 1BU5A 1OX6A 1V8ZA 2Y1WA 2WRZA 4PONA 4QJ5A 3IDFA 2REBA 4CMEC 3ERCA 2BM1A 4Y7CA 1LFDB 5JVDB 3PPWA 2EL7A 2OGSA 4IDNA 3SY8A 1BROA 1Z5PA 5DULA 3CZPA 4P08A 2PUBA 1T36A 4R2WA 1XXHE 4KXXA 3NT2A 1Z6ZA 2Q4OA 1IJEA 2PNJA 4LEIA 1UBFA 2B1JA 5FIUA 4GWGA 1SURA 5A4DA 3KT3A 2JRCA 5EHZA 1FNNA 1N2GA 1RMTA 3WGQA 1N4DA 2H1VA 3TMAA 2WM2A 3N9IA 1PKEA 2Y1DA 5CNKA 4PAGA 2XE8A 5CVUA 1I2CA 2JH3A 1GSHA 5C32A 4LE1A 2D54A 221PA 3UOWA 2PX3A 2HLPA 2ACVA 3DG9A 2D5LA 2I3ZA 5EE5B 4ENUA 3OO1A 3HMQA 1HSZA 3O91A 5LNK1 4PG5A 4AP9A 1RRVA 3W3AH 4E2ZA 2FEKA 4MPPA 3ZCSA 1T5BA 4UCQA 1N6NA 4BRUA 1W35A 3P4UA 4FLEA 5HF8A 1TVKA 4H7PA 4B73A 1J9EA 1P1IA 1Z6GA 2J3EA 3I73A 3O8QB 4QOHA 5HIKA 1L6IA 1OV6A 1DKQA 2ALJA 5E95A 2B4QA 5ECGC 3QWFA 4ZDKA 1DT3A 3ANSA 2MU1A 1J70A 4KO2S 4MW2A 4OXXA 4K9KA 3SZGA 1SC9A 4GEGA 3PWZA 4GVXA 4JB8A 1NJ2A 4V39A 3X1YA 1BE1A 421PA 3SF8A 2CBZA 1SO8A 2DH6A 1EP3B 2MTBA 3HA3A 4OHOA 4M1YA 4TGLA 4XCXA 1ZMRA 4P35A 2O3JA 3GLIE 3EG9A 4JX9A 4A0QA 1IXKA 1RXVA 3O9MA 2EP8A 2AHOA 4J4HA 4PG4A 3J81k 2VK8A 4L5JA 3LAWA 3ANXA 4UHHA 4MB2A 1V11B 1DFIA 5E9WA 2APJA 3WNDA 3GH1A 1V2GA 2C9ZA 3K4QA 3QMPA 3ZXYA 1JKFA 3EXHC 2Q49A 2OQ2A 6REQA 1SUAA 2NIPA 4TRMA 4B44A 2LCIA 4PW0A 1Q7TA 1ZISA 1LK5A 1Y3HA 1T24A 4H1HA 4NONA 4C6RA 4OBEA 3CMCO 5K20A 2A6PA 2QRZA 1XLWA 3ADBA 3X44A 4Q1FA 3KELA 1SG0A 4O2AA 2RGWA 3LA8A 1ACJA 3H13A 3N8HA 1LDNA 3OM1A 4IVPA 3STYA 5ALXA 2QHXA 4Y9UA 4ZFNA 2GBFA 4MJLA 1W7AA 4B3SB 1GPYA 2W48A 3PQ2A 1VOTA 4MEBA 3EBLA 4EJFA 2VDLB 1CVRA 3UB2A 2Q4BA 4IJWA 2AI3A 5LQDA 1HT1E 2YMPA 4D0LB 2OKCA 2VRCA 5K0CA 1JIQA 1Q1BA 2RHCA 3E22A 3AESA 3VPDA 3PVCA 5K01A 5KNBH 3FCUB 3OTHA 1R50A 4FHZA 1XVTA 3O8QA 4I3FA 3GPBA 4NXNB 2IYXA 3B9QA 3TYXA 1YQUA 4Q93A 3AUKA 2NT4A 1H69A 4W5HA 2G25A