2A4MA

Structure of trprs ii bound to atp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
331
structure length
331
Chain Sequence
ARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGMYTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Tryptophanyl-tRNA Synthetase II from Deinococcus radiodurans Bound to ATP and Tryptophan: Insight into subunit cooperativity and domain motions linked to catalysis
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Ligase
molecule keywords Tryptophanyl-tRNA synthetase II
total genus 111
structure length 331
sequence length 331
chains with identical sequence B, C
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2a4mA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a4mA01
2A88A 4GU5A 4MW6A 1O0BA 4DDKA 2RE8A 4PBTA 3SZGA 1KH1A 1TYDE 5LLTA 2D5BA 1WY5A 3TZEA 1PG0A 1EUYA 4K0RA 3SYTA 4EG5A 4MW9A 2AKEA 5IJXA 2ZUEA 3ZGZA 5TGTA 3G6KA 2YY5A 1U7DA 4UZFA 3IMEA 3RK1A 4ZT6A 2A4MA 2JAXA 4OUDB 4G5FA 2OV4A 1N2IA 1EFPB 3FH0A 2VTBB 1M8FA 3P0JA 3UY4A 3GMIA 3C8ZA 4MUIA 2HMAA 2GOYA 4ARCA 1NYLA 2ZUFA 2JA2A 2HGZA 3IUBA 3SP1A 3AFHA 1MOPA 3U1VA 1YIAA 4MW1A 1R6UA 1KKUA 4MWEA 3HZRA 2PFSA 4ND7A 1J21A 1MB2A 1H3FA 2BYTA 1JEEA 3TZLA 3CLRD 2JANA 3CVVA 4MW0A 1F9AA 1WXIA 5DEOA 1IFXA 4R0NA 4AQ7A 4EG1A 3ND7A 5FO0A 3ZJUA 3HL4A 1MB9A 1M83A 2CYCA 3TQIA 2QUHA 2QUIA 2DR2A 4XSVA 1WXHA 1N2OA 1EFVB 4CDMA 3JXEA 4EG3A 4XFDA 1R6XA 2J08A 2GKSA 4QREA 4KR7A 3KT3A 4NX2A 4ZT5A 2A1UA 3I05A 4KKVA 2E0IA 4JZYA 4MUNA 3SEQA 1I6KA 1T6YA 2IP1A 4F3RA 2YXNA 3DLAA 1QQTA 1YUNA 4TS1A 2O8VA 3RK0A 1Q15A 2AZXA 5KCMA 2J4DA 5J5AA 1G59A 1K92A 3CLSC 1FFYA 1IQUA 4HK4A 4AS1A 3DO8A 1K4KA 3CLUC 3MLAA 4MULA 1N3LA 3IDFA 1X6VA 3INNA 3CLTC 1JILA 1QJCA 2DERA 1KQPA 4NAUA 1J09A 1T6XA 4WNYA 3ND6A 3IOCA 1U0BB 1O96A 4S1OA 1G8FA 1PFVA 4MQ6A 1A8HA 3CA8A 1NUTA 4MVWA 1SURA 1FYDA 3D6UA 2QUKA 3AIIA 3TNJA 1COZA 2XRZA 1TYBE 3H05A 2CT8A 1KAMA 3PRHA 2CUZA 3IVGA 4XFJA 3AKZA 1GAXA 4MLPA 1RQGA 4L2IA 4ZCTA 5J58A 2CV1A 4EG7A 1F7VA 1NURA 3KT8A 1O97C 1G8HA 5K0SA 4I6JA 2PZBA 1N2EA 3CVYA 3GUZA 3PNVA 3ILVA 1TYAE 3CVWA 1IQRA 3A04A 3QE4A 4MUJA 3H9CA 2BTEA 1XJQA 2PIDA 3MUEA 3TS1A 3KT0A 3IODA 2DETA 4DDHA 3SZ3A 5J59A 4CQNA 1Y42X 2ZP1A 3N05A 2NZ2A 5FNZA 4ZT7A 4EG8A 4H3SA 1WZ2A 3COZA 2PXHA 3COVA 1WXGA 1IRXA 4E1AA 1KORA 5EKDA 2C5SA 3ZJTA 3SDBA 2J09A 1Q77A 2R5WA 3CLSD 3ND5A 1IHOA 4G5YA 3HV0A 1I2DA 5LM3A 2CFOA 5H16A 3CVUA 3CLTD 5DK4A 1EJ2A 2YWBA 4FZJA 1J1UA 5JBNA 1GTSA 2WQ7A 1N2HA 2A84A 1JEDA 1M8KA 4MAFA 1HYBA 3FWKA 4I6GA 1O0CA 2PZ8A 1BS2A 4ZCPA 4MVCA 2WSIA 3IMCA 3FG9A 1CT9A 2Z09A 3X1MA 3S3TA 1R6TA 4JFAA 5TEVA 2Z08A 3CR8A 4G6ZA 3QTTA 3GLVA 1Q11A 1YUMA 1JZQA 3DV2A 3RBAA 2QJOA 1ZH0A 1N75A 3DPIA 2QTMA 1OWLA 4EG4A 2YWCA 1OWPA 4MWCA 3P0IA 1ZH6A 1WXEA 3PNBA 3UC5A 1N78A 3KT6A 2A1TS 3HFJA 1QTQA 5F23A 4P2BA 2D54A 2GM3A 3IH5A 1QNFA 1EE1A 1MRZA 1JZSA 4YMIA 3A2KA 2QTNA 3M5WA 2E18A 3H99A 2EJCA 3Q12A 1KAQA 4KPUB 1TQ8A 2CYBA 1O94C 1U3DA 1WXFA 3CLUD 1QU2A 1OBCA 3P52A 1G8GA 1XNJA 1JIKA 3HMQA 4MUKA 2PZAA 2NSYA 1U3CA 5TEWA 3COWA 4KR6A 3FDXA 1QRTA 1F7UA 3IOBA 1P7PA 5K0TA 4JXZA 1JIIA 4YBRA 3LOQA 2RD2A 1M8JA 1T9GR 2V0CA 2X0KA 4MUHA 2WB2A 4RUKA 1TFUA 1IH8A 3TQOA 2E89A 3IVCA 1QRUA 3D6VA 1LW7A 1QU3A 1TYCA 4MWBA 2DUMA 1KH3A 3LE8A 4ZCQA 4MVXA 1MBZA 4K03A 1NZJA 3IMGA 2A1TR 1OWMA 1H3NA 3F3MA 2IJGX 3OTWA 4PBRA 4JYZA 3H9BA 4DJAA 5FO1A 2X1LA 2QUJA 1T9GS 1V8FA 3A4IA 4OUDA 4ZT4A 3FHJA 1PG2A 1WJGA 3X1KA 3Q10A 1VBNA 1EUQA 3Q4GA 1NUUA 4UZEA 3IVXA 3HGMA 3A05A 3FETA 1NUPA 4PBSA 2OQ2A 4MUEA 3AL0C 3FI0A 1VBMA 1OWOA 1OWNA 4EGAA 1N1DA 1NUSA 4R2MA 2QTRA 3K32A 4CT0A 2A1UB 3IOEA 1K97A 4J75A 3CLRC 1D2RA 1I6LA 4Q93A 2A86A 4KR9A 4BWVA 3UK2A 3RFFA 1O94D 1V47A 3X1JA 2H2AA 1O5TA 3VGJA 1VLHA 4YP6A 1J1ZA 3CVXA 4L2IB 3IUEA 4Q16A 3P0HA 1O96B 1ZUNA 2X3FA 1N2JA 4DLPA 5LFAA 2TS1A 5KHAA 5H7XA 1TEZA 2X1MA 1U7XA 4NZPA 4HJRA 4ZT2A 3FIUA 4EF6A 3H97A 1T6ZA 1WQ3A 3N9IA 1NI5A 3ZIUA 4F4HA 2VXOA 1JIJA 4QBTA 1O95D 2Z3VA 2AG6A 5KWVA 1N2BA 3RHSA 2CYAA 4OJMX 1M1ZA 2D13A 4ND6A 1OD6A 1GN8A 2CV0A 5DB4A 3G59A 1KR2A 1EFPA 3FNRA 4NATA 4DE5A 2VTBA 4MUGA 2QJTA 1XNGA 2B7LA 1JECA 1IQ0A 4MW7A 4RPIA 4ZCRA 4R2LA 1ZJWA 1VL2A 5DASA 1ULHA 3COYA 3FY4A 4MW4A 1OBHA 1PFUA 1UFVA 4PY2A 4QRDA 3L93A 4DDMA 5HG0A 1JHDA 4MWDA 1KQNA 1ILEA 3ELBA 3K9WA 1MAUA 1PFYA 2O5RA 1J70A 3ZJVA 1J20A 1PFWA 3AG5A 3ZXSA 3VRHA 4GRIA 2V0GA 1WKBA 2PG3A 1YULA 1EFVA 2A7XA 2E21A 1N77A 4CDNA 4HPWA 4JXXA 2I1LA 1NUQA 3KFLA 3L92A 1LI5A 3MMXA 4I6EA 4MW2A 1NP7A 4YP5A 3N8HA 4J76A 1LI7A 4U8HA 4A91A 3UMVA 3NBAA 3VU8A 2WQ6A 2DEUA 5AHWA 1GPMA 1H1TA 2J5BA 2IELA 2G36A 1F4LA 3G5AA 2DPLA 1KQOA 3NBKA 4HJXA 1M8PA 4ZT3A 1QRSA 3OP1A 5TS2A 1KP3A 1XNHA 2DLCX 1JGTA 1MAWA 1O95C 4MW5A 1KP2A 3AG6A 5BNZA 4U63A 1S4MA 4ARIA 2HZ7A 3SEZA 5HUHA 4U7JA 3PXUA 1JMVA 4X0EA 3RJZA 2EL7A 4YP7A 4EG6A 1K4MA 1YI8A 3QTBA 1EXDA 4KPUA 3ISJA 1M8GA 2XRYA 4MVYA 4NAHA 1MC1A 3PNYA 4EFKA 2J07A 1KH2A 1IVSA 3FOCA 1WOYA 2CSXA 1GTRA 1NSYA 3NV7A 1H3EA 1DNPA 2H29A 5IHXA 5HUJA 1I6MA 1VBKA 1X8XA 3E27A 1N2GA 3ZUGA 1GLNA 3N2YA 1GZUA 3MLBA 1MJHA 1WQ4A 2CV2A 4NDAA 2DXIA 1O6BA 1B6TA 3UOWA 1YIDA 3LCJA 4MUFA 4WSOA 4ZCSA 3MXTA 3ZXIA 1O97D 3BL5A 1Q19A 2QJFA 4DNXA
chains in the Genus database with same CATH superfamily
1QDEA 3FTCA 5EFZA 4C30A 1EAYA 1TB4A 2OCXA 3GPIA 1XRQA 3MWFA 1LFAA 4ALLA 3VHQA 4CQMA 1II8B 1R15A 2JGRA 2NUPA 2PYIA 3RAGA 4DC0A 1HRDA 1JPNA 3K16A 3FWHA 4WOCA 2CXPA 3GT4A 2N0SA 2C9YA 1CDDA 4MW9A 2ONJA 2Q5EA 4QZVA 2EBHX 3PFBA 1XQWA 2XB2A 3EQ6A 5EXPA 3B6EA 4X65B 3OQJA 4UMDA 4CL8A 2OY0A 1A8IA 1FVFA 5K01A 3KJNA 5LZ5A 4EUNA 4UHDA 1D6MA 1MO5A 1NT4A 3UMSA 1TYEB 3IP5A 4Z1OA 3OAAA 3CH6A 3SSNA 2X3YA 3K72B 5JFGA 4O5AA 3TW4A 4DLVA 4DJFC 4EHAA 5AIAA 4RTLA 4CEJB 3DLIA 2X13A 1M6WA 1R0CA 1ISGA 3T7AA 2JA2A 3ENZA 2GKGA 2XUDA 1TM5E 4DRZA 1L5RA 4RAQA 4TWBA 4FM9A 4YLGA 3MIZA 1H9BA 3U1VA 1QE0A 1PZHA 1KKUA 1GA4A 4TUYB 1I30A 2ZSEA 5AVUA 4AY4A 1PR3A 2BJWA 2IRWA 2E4VA 3KCQA 2O0JA 2PFSA 1N32B 4ZXPA 4BYMA 1KU6A 3C70A 2X8JA 1DT3A 2CHVA 3CB4A 3EIQA 5ESXA 3DE4X 1T2DA 3EIEA 1MNQA 2P9CA 4BFSA 3TUZC 4DARA 1R9GA 4IXMA 2FA9A 5A4IS 1A77A 2FP3A 3OG9A 4JWTA 2WJJA 3GR6A 4YREA 4DT1B 4IVPA 4YJ3F 1ECLA 1WLYA 1Z2DA 2ILVA 1P9LA 3AERA 3THRA 5A4DA 1FTGA 1LTHR 3IEXA 5AUNB 5FO0A 2Q3DA 1N36B 1ABFA 3ZJUA 5IF3A 3QW4B 3H8WA 3O5AA 3GD5A 3TQIA 1ZSYA 3JVEA 1OX4A 2H1IA 4O5OA 4E0BA 3AQ4A 1LBHA 2OPHA 2PK3A 1QQ7A 3KJHA 4IP0A 1ISFA 4QLOA 4C0WA 3JV7A 3OFVA 1W9HA 2XT0A 3KUXA 2WSLA 1VSVA 2EX1A 4KR7A 1ZMTA 4MROA 2BZGA 2VUSA 3JQ7B 3M6WA 2PVSA 4RPKA 5D6OA 2GCNA 4KKVA 2ZJFA 5CNJA 4A6DA 4CU5A 4EAQA 1CX9B 2I65A 2EU8A 3D3NA 4B2IA 2ASEA 4WXEA 5EJEA 4WKOA 1S3GA 3D6AA 5H0IA 4R6WA 1HKUA 4RFLA 5KZMB 1X13A 5LXTA 3EZNA 5D85A 1G98A 2A59A 2C98A 3ANNA 3VSAA 4ZI5A 4FZVA 4DMGA 2ECKA 4WXRA 4CG0A 1E9DA 2GHTA 4MITA 1LF5A 1R0KA 2Z8YM 2HCJB 3ICWA 3PNLA 3PYXA 4M0FA 2AQKA 1ZW1A 4NEQA 4EA6A 4HPXB 1XAJA 3KOUA 2WJZB 2ZVDA 4L6CA 4V3BA 4Y7CA 1VYUA 3DO8A 2B2NA 5IDYA 3UCEA 3IKVA 3U48A 3C3JA 3I92A 3ZY4A 3KL2A 3CLUC 3PQ3A 3IP8A 1A9YA 3OQIA 3FTEA 3EISA 3RLIA 5AUPB 5HZKA 2E85A 3JZAA 1EFRD 2P8JA 1XF1A 2WINI 3QJYA 4PWZA 5AKIA 4GEGA 4YWHA 1DKUA 1K8XB 1K7YA 2XI4A 4F46A 5JVDB 2QAGA 4JI4B 2X5NA 2YWXA 3QI7A 1YL5A 1T6XA 3AETA 1EX6A 1T0BA 4WNYA 4YJ2A 4RE5A 3TVDA 4CW7A 2BMWA 2ZBGA 4KQ6A 3BMXA 1E5XA 1JFFB 4HUJA 3CINA 3U4IA 1JT2A 1OHHA 2G08A 4R9UC 3U5TA 3VJLA 3WLJA 1ISJA 4EW6A 1QFYA 1N9ZA 1NDUA 4R2IA 3VR6H 2RBEA 1SK8A 3HYCA 3A3YA 1XDUA 2CMGA 4KSBA 1DCKA 3GEBA 1BD4A 4B7ZA 4LOKA 1YB7A 1RYNA 3KR2A 1J9GA 1SXJA 2JLBA 4UD2A 2WKWA 3VFDA 1NXXA 3F9IA 1CQPA 3ZTTA 4QNNA 1FSPA 3IDOA 4MV0A 3NCTA 3EVTA 3WL3A 2OXFA 4NVRA 4RAOA 2IDZA 1AM4D 1UOPA 2R7AA 5K0SA 2FPRA 3JQ6A 4JJ8A 4M53A 2PZBA 5T6BA 4E03A 2XHEA 1NIPA 1PD1A 3ILVA 4KIJA 3BRCA 2VAMA 4LXGA 4PW0A 1RYZA 1SCKA 1NBME 5AKLA 3QE4A 4UW9A 1AVTA 3K4PA 1I3KA 5DCLA 5FI3A 1QHHB 3U49A 1UEXC 1BN6A 2WY2D 4D41A 3ZWXA 2SKEA 1HKHA 2VDNB 2VNIA 1FP6A 4MDHA 4RVOA 4V2UA 1XEXA 2VJQA 4XARA 4CKCA 4EYGA 3DVQX 1VHLA 1Z47A 4XWKA 3FYUC 2IIQA 2GD2A 2IVZA 1TA9A 1XHLA 4PZPA 2Y4OA 1MTZA 2A6PA 1CHNA 3AFIA 3KYBA 2XB8A 2O8DB 2C0PA 2RCNA 3MNFA 3O3NB 4N6GA 5EHNA 1UPTA 2JH9A 1WXGA 4U5QA 1ZIXA 2YIVX 2AOVA 1AZWA 3EZ2A 1JLLB 3FPFA 1IM5A 2X42A 1ZGGA 4N9QA 5FD8A 3TI7A 1WB5A 2I71A 4Q48A 5I9IA 3U4HA 3ZDFA 3Q41A 1NDQA 5G53C 1RXWA 2VTDA 2HPZA 5AKZA 5F73A 3UKOA 2HNAA 4RDXA 1RACA 3P4YA 1HNWB 1AF4A 4RNDB 1G4UR 4LOIA 4AZ0A 3PF8A 3TE6A 3AWDA 4Y6PA 3VSCA 5IF9A 2PEZA 4Y2SA 5DNCA 1N4DA 1IZ8A 3UANA 5LQUA 5JSZA 2PKEA 2Z6VA 4E11A 4P7JA 4O8ZA 3GQVA 2YXLA 3LC1O 3OFJA 4ZJZA 1G21A 3AW9A 3HVJA 4B5LA 1XO1A 1XD2B 1HDGO 4Z4FA 2VS1A 1AUVA 4KFSA 4TLAA 2ZM5A 1BQ4A 1M0SA 1OVGA 2N75A 2WWGA 3LY5A 4OP3A 4KQCA 1A9XB 1I32A 3QPVA 4V0OA 3IMCA 1ZM9A 3HFRA 3N86A 4XQGA 1MDBA 3R7WA 1GKIA 4AO8A 3F0TA 1XTVA 1KU0A 1XF9A 3M34A 4PSUA 2X0EA 1BWSA 1JQAA 1SKYB 2Z08A 4EW3A 2OM6A 4OTZA 2Y92A 2ZJOA 3STWA 1GPAA 2GEJA 4LFBB 3JTEA 4WD3A 1D4OA 5I8ZA 4BAGA 3KJZA 1LQ2A 2WVJA 3LCCA 1OX4B 1E5VA 4RBNA 3H19A 3RU3A 8ABPA 4NU8X 4R7GA 3UMJA 3PWKA 2O3JA 3TZ6A 4NH0A 3IO3A 4Q05A 4WN3A 2D2FA 1A82A 3GAAA 4KLRA 1NE7A 4OHKA 1U9IC 1E3WB 3T06B 3P9IA 5ALUA 3F3SA 1SOUA 4TS3A 3Q2OA 1F2UA 2I76A 1QZTA 1QTIA 4IIUA 1U0TA 4LTMA 4J1NA 4RJKA 3HCPA 2EBWA 4AYWA 2JFZA 2FOLA 2H1FA 3HA2A 3OESA 3N5KA 4JSRA 4MOWA 4H08A 4MWTA 4JYAB 2R6CA 1UZAA 1NXOA 3IV9A 3E3MA 2CBZA 1FDWA 4YFYA 2CNWA 3WL4A 2FCRA 1NW3A 4N0EA 3PGXA 5K6TA 1B8PA 1YKFA 2H52A 3T5TA 1Y4SA 3NVAA 2R4UA 1JQ3A 2DSNA 2UYOA 1NP3A 4BMOB 4RJTA 3L6BA 4ISCA 5GP1A 4TTAA 1JI0A 4NS1A 5TEWA 3NO4A 2GXUA 4JBHA 2VUTA 4TTVA 3UNXA 1TO2E 3FCOA 5EQDA 2PMEA 1U8UA 3B12A 3F5MA 1XZ8A 1P4AA 3CZ4A 4MP3A 5ELXA 3S5UA 3KQOA 4MJLA 1TJ4A 5FTKA 2O8BA 4QQNA 5L51A 3CN7A 1KSFX 4QOIA 3BK1A 3GELA 2I67A 1NDHA 4IDPA 3V00A 1LLQA 3W6UA 1EG7A 1RRPA 1FY2A 3JQ9A 3FFAA 4HYTA 1CR4A 2JBHA 3BDAA 4R40A 2I1WA 2R8RA 4TL9A 3HABA 2DUMA 4WBXC 2PQ6A 3A0UA 5B37A 5I45A 1G19A 1XQVA 2OO5A 2X77A 4LXTA 1B16A 1WX1A 3WK4A 5FBQB 2WIGA 3N1UA 1AY0A 3IHLA 1NYTA 1U2EA 3M4YA 4QQKA 4UNSA 3ZHQA 3FRJA 1H4SA 1JQEA 2HJHA 3H9BA 3U7QB 4JYZA 3PXCX 4X8HA 3RTDA 5CLGA 1QP8A 2QUJA 4LHSA 4D4MA 3AI2A 3VO2A 2JBAB 3PXAA 1Q84A 5AW0A 2K4MA 1S1MA 1W85A 1Z16A 5F7ZA 3ZNNA 3OOSA 3VVLA 4BKUA 5A3QA 4YUVA 1VG1A 3EZFA 2EL9A 2HLPA 4GZ5A 4YI5A 3AF2A 3IVXA 3A2LA 4ZPXA 4IMPA 3ICPA 1Z83A 3RREA 3O1LA 2BTQA 4PBSA 2MINB 5G0SA 4D9CA 1DIGA 4ZGWA 4L7VA 2XTNA 3P19A 2GM5A 2Z95A 4MCIA 4WZZA 5HE9A 1TZKA 4IL5A 4V39A 4A10A 4AF8A 3R7FA 2YMQA 3TTSA 4YAKA 3PXBA 2PSFA 1F4PA 2COEA 3ZX4A 4NIMA 4CF5A 5MHTA 3CMCO 1HWYA 3GROA 1I6LA 1BE0A 1ZD9A 2F3TA 2LPMA 4X6UA 5AXDA 3KWJA 3O75A 5FOSA 4DV6B 2XMSA 4DA7A 2AR9A 1FFDA 4PO9A 3D1JA 4NMXB 4K6FA 4BBZA 3ORYA 1RYFA 1V47A 5F5XA 1TUEA 5KJ1A 4PIMA 1LWOA 2ETXA 2HXGA 2VDMB 2MYNA 2ZRDA 2ZJ0A 5DKFA 5FUBA 2OR3A 3A06A 1UDRA 3IUEA 3YASA 1AN0A 1R12A 1G5RA 1XA0A 3WV5A 1JR4A 4MR9A 3QEOA 3E2PA 4LF9B 1W49A 3JAKA 4EABA 3OOJA 2FN3A 2JJ1D 1GPNA 2C2XA 2JS7A 2X1MA 1GD1O 3BWEA 3PLNA 2ZGVA 4WOKA 4ZT2A 1H42A 2VPXA 4HQ0A 5L3SB 4PAMA 1NBEA 3VTZA 4YPVA 4LYHA 2FZWA 1HFJA 1LGYA 1WQ3A 2QIPA 4MIEA 4AUNA 4HX5A 3B9QA 5HRAA 3UMYA 4QBTA 1QPZA 3ADOA 1O95D 3FYUB 4UE6A 4YC7A 5KBYA 5LDHA 3E9CA 1WULS 3HCWA 3TLGA 4U7GA 1QIFA 3WRWA 3L77A 1VJ1A 1UDBA 4PHFA 5H59A 5L3ZA 2GK3A 4XI9A 3QYJA 2R1UA 4FK8A 4KWHA 3AKEA 5EYPB 1RP1A 1Q1AA 2VDRB 1ZBQA 4YAUA 3JATA 3DLPX 3EGVA 2WAXA 1Q50A 1QE5A 2NAPA 3E4CA 4KIUA 4ZVPA 3WFJA 2R1VB 3RASA 4KH0A 1BDHA 4KJZA 2VCHA 2BFDA 1YQ9A 1KZ4A 2IYUA 4RD1A 3VPGA 5JTTA 3WK8A 3BZWA 1P61B 2IBMA 1ZJ4A 3PS9A 4UUNA 2DBZA 4WFQA 4PYRA 5E2IA 3TLYA 1NMXA 5JZ9A 4LEIA 1IU9A 2V1XA 4YRCA 4QRDA 2DM6A 1TTTA 1E6KA 5EMMA 3EIOA 4ARBA 4BB9A 2FWRA 4OMUA 4Q9KA 3H1EA 5IBQA 3BIJA 3TNLA 3I2YX 4O08A 5B3KA 1XJCA 2V96A 4IIVA 4JITA 2V65A 4RK7A 4ZDWA 1TQ2A 3GEDA 4RCZA 5CDSA 1PFWA 4EPYA 1CJVC 2IW3A 3LC2O 2YUTA 4IDHA 1Z37A 2ZCJA 3MYYA 4F9FA 2PMKA 1CRZA 4EI8A 4MAAA 3H11A 3ZNOA 1EIZA 1PJ3A 3DULA 3LCUA 1IBLB 1NP6A 1V11B 2R5NA 2P68A 3EIUA 1Z5VA 2Z3WA 4AZ3B 2WQZA 2OMKA 1S2NA 3FYCA 4FSXA 5IU6A 2JCBA 1HE5A 1MGPA 3MMXA 3NC4A 3AZQA 2QV0A 4QFMA 2XYHA 1V1JA 3QFHA 5K8IA 4J76A 3VPXA 1K0FA 2H9IA 1Q0PA 2ZRIA 5DTRA 3GLGB 3EJ6A 4JOQA 1J8YF 4Y1FA 1T8RA 1G7CA 1ZNZA 1FRZA 1RD4A 1GXSA 2IXAA 2QZSA 3GLHE 3KZMA 4GE3A 4X3PA 1B6GA 3COSA 3T5BA 3G5AA 1RMYA 4CRWB 1EGMB 1IZ9A 2HV8A 2Q5LA 4EF5A 2B4KA 1QRSA 3O8RA 4I36A 5KKAA 2BWJA 1SWWA 1TA0A 1S9DA 3WP1B 1ODCA 1VL6A 1Q7GA 3UPUA 3D2CA 2YVUA 2ODNA 1AUOA 1NNUA 4B6OA 1Y6QA 5BNZA 2EGUA 2FDXA 3V97A 4AO6A 5AVQA 2GUGA 4QJBA 4Q1DA 1US8B 3R44A 3VZSA 3GEEA 4P0TA 1MA3A 4N7RA 1OTYA 2BKVA 3JQCA 4COOA 5GZ3A 1N7HA 4D26A 2O8DA 4E2ZA 1E7QA 1EP1B 3TFWA 2C2HA 1YZYA 2EJBA 1XCGB 3AI3A 2C58A 4ZALA 4JEIA 5LBTA 2IV7A 4IIYA 1X42A 3OZSA 3GJ4A 4GYWA 1ZRMA 1UZMA 1JDSA 2C3MA 4C1BA 4G1CA 4WZAB 1X7ZB 3B1XA 3L1IA 1CIVA 3A4YA 1YZ3A 5FP0A 4DCJA 1PK7A 1ZVJA 2XYVA 4JODA 3UHOA 3WQHA 1HMYA 2OBLA 4OCZA 2QB5A 3E1GA 1NULA 4UTOA 2DECA 5FPHA 4D9JA 1T9ZA 1ZY2A 3LLUA 2UYYA 6PFKA 1OJ7A 5LU8A 2WMYA 1E89A 1ML4A 1FJ2A 1QR2A 2NU7A 1QHEA 2TYSB 2Y6UA 2CL0X 2G1KA 2Q99A 3MEQA 4P5PA 3SC4A 3PV0A 1NRWA 1SKQA 3ONNA 4IJUA 4RLHA 2P9BA 2CLIB 1JAZA 2OXCA 5JCXA 1IB0A 2B1JA 2QP9X 4TMYA 3QGMA 1DG9A 1KVSA 2POQX 4D9HA 4QNRA 1AV7A 5C5EA 1FOEB 4LYEA 4ZZ2A 1OI7A 2I4MA 3IIKA 3DL4A 3W8EA 1YGYA 3I9NA 3N6VA 4RPCA 1GY8A 4M8SA 4Z3OA 3E7XA 2O19A 1EMDA 1O6BA 3D59A 4WT7A 1N9GA 1DAOA 3D7RA 3HPQA 1HGXA 4IDCA 4LYAA 4QJ4A 5IS2A 2WZBA 4K9DA 4D9GA 3LZ6A 3MG9A 4BNWA 2CNOA 4KN9S 4QG3A 4OBBA 2YZGA 3UWSA 2EX4A 3K2EA 1L1QA 3PTAA 3JD1A 2C95A 3DTVD 3PRJA 7REQB 4BQQA 4DSZA 4LJKA 4NXMB 3MW8A 1KH1A 4RL6A 3GFOA 3PUXA 3NIFB 3HFGA 5DGXA 3A4MA 4ZKEA 2J48A 2IDKA 5DDIP 2Q6IA 2PSEA 5IT4A 2PRKA 1RBQA 4GGMX 1L4EA 4D9EA 3ZGZA 4A8JC 2YY5A 3L1UA 3L79A 3ZW7A 3JQFA 4DCVA 1TA4A 2O5VA 5ISMA 2PBZA 4PPYA 1SXQA 5TSDA 2RMKA 2O6LA 5EHQA 2OHIA 3O2JA 1MJFA 1NM5C 3ROZA 3GP8A 4CFSA 4YR7A 5HIKA 4B76A 1N5IA 2O8EB 2ZVQX 3HDQA 4TV9A 1XDZA 2J87A 5FTNA 3E23A 4NOKA 4H60A 1ARZA 3HYNA 3TTWA 4KO8A 4DEYA 4UHHA 2FSVC 4TYNA 1C0IA 5J2UA 1IM8A 3AFHA 1CQJA 3SQDA 4P4LA 4XD7D 3SYMA 1DQZA 4FGKA 1GV0A 4CR7A 4WRRA 1KERA 4F0JA 1YTLA 2I3ZA 1P91A 2I8LA 3HK2A 2GD0A 5ULLA 4N65A 2QQFA 1TJNA 2ZW9A 1RXIA 1R6DA 3FFWA 1PVDA 2J0VA 1POWA 3WHIA 2JANA 3Q7SA 1WABA 2Y27A 5K0CA 1ZGCA 1UWKA 1UK9A 2HWYA 2OGZA 4FFWA 4CPDA 4EHLA 2HLDD 1YKSA 4ENWA 5C8YF 1K5DA 3K2QA 1HDIA 1NF9A 1MVLA 3FA2A 3O8OB 2PGJA 3GQBA 3HLTA 3O4GA 5C5DA 2GZSA 4CMCA 4BNMA 4CF7A 2GCOA 5KKNB 4ND3A 2GHIA 2JW5A 4QWWA 2DH5A 1TU0A 5I7SA 5U1PA 3N8GA 4F9GA 3U7QA 3NRJA 1AKNA 1P81A 3I2HA 2BPOA 4IHKA 2H4HA 3AM1A 2V6FA 3E03A 3V2GA 4F3NA 3QBTA 5KQPA 3JVVA 4M9XA 1ZOIA 4NTZA 5IBPA 3SQOA 5IDQA 4ZOEA 1A8UA 2JD0A 2BW0A 3ELYA 4EBBA 1QQ6A 2NM0A 4G1VA 1Q95A 3DLAA 1YC2A 3E58A 1BHJA 3HKDA 4ZOLF 3E9DA 4JU8A 3W4JA 3L0PA 1YR9A 2HWWA 3AJAA 3FLBA 3KG2A 5DYYA 1N6PA 2B2CA 3REQA 1UC8A 2QE6A 4WVFA 4AY5A 2AZXA 4ZZ3A 1YXMA 2PVCA 3HEBA 2ZETA 1FNDA 3WLRA 4EHJA 1S1CA 1Z17A 2H2HA 2ZRNA 1Q7RA 3DOUA 3PC2A 4ZHQA 4KITB 1SM4A 1ZU4A 3U09A 3E18A 1NFFA 3REQB 1QQBA 3DNPA 5EXSA 1JMYA 1BE8A 1YJQA 1ODSA 3B3GA 1BXRA 1JKMA 4QPCA 2QLMA 1HEYA 4HNAB 3C6MA 1GU1A 1A9ZA 1DG1G 2QPTA 1LZLA 3NAMA 4OJNA 1RMTA 2QTTA 3ESCA 3D31A 4Y98A 4UBNA 3V2HA 4RGQA 3OU7A 1ZNQO 1Y8RB 1PJ2A 4C0LA 4GMDA 2A57A 2QN7A 3R6TA 4II7A 2P1RA 1TVKA 4RGBA 1SC3A 4RX1A 3MB5A 3OMWA 3EZYA 3RS8A 1AU9A 3L7LA 1M2VA 4Q7MB 3AKYA 4BFZA 5JU6A 4MQ6A 1CY0A 3PGLA 1I5EA 2AMFA 2ZWOA 4IXDA 1N5LA 1ONBA 4R54A 4S1VA 3GD7A 3I9MA 4DHWA 1DSSG 2W6OA 3AI7A 2UYHA 1QG6A 2AQIA 2GPAA 3GRRA 2O8BB 1GEGA 1NI4B 2HSGA 4QBIA 1HYGA 2JIRA 1NJGA 4FQ7A 1LPOA 4CTMA 1TYBE 1G5IA 4G1MB 3H05A 4DMRA 3K9FC 4PG5A 1CG6A 2P4SA 2AR7A 1UM8A 3OPXA 3INRA 4DIDA 5C7YA 4GEKA 2PV0A 3WGZA 3KJFA 5CCBA 3L7OA 3RRXA 3IPAA 3RC8A 3CVYA 1RYBA 1G9XA 4BGVA 3X43A 3CYFA 3ASYA 4GKBA 5ITZA 1KEUA 1V5FA 4IMRA 3A04A 4JBIA 3VA7A 3SSOA 4B9EA 5JEDA 4NBWA 3VR5A 2XNSA 4F38A 2PIDA 1CVLA 1SKBA 1QIHA 5CB4A 1TEVA 4JXJA 3M5PA 1MQAA 1QHYA 5I7AA 3RVQA 1M5RA 3EDMA 2XVXA 4B5KA 3D02A 4Q6WA 2R8EA 2PAFA 4PG7A 3SXUA 2WF6A 2PXHA 4HAUA 4HVCA 3NXKA 1RQNA 4JI8B 4PCUA 5DW3A 1R6AA 5CW1A 2Z2ZA 4MVJP 1FX0A 1K3FA 5EAIA 3R7SA 1NLYA 2XUKA 4YAGA 3EXG2 4G23A 1NKVA 1SOAA 1GNPA 3E53A 4P7BA 4R5MA 3FNFA 3BD6A 3LU1A 4FD3A 2AA3A 4RMGA 5EMJA 1O8BA 4JP2A 3GLTA 2HBQA 2O0LA 2JIMA 1PJQA 3OC6A 3R7WB 4D3FA 1ZONA 2VJDA 2MYUA 1HUQA 4NICA 2MHCA 4BB6A 1Y7HA 2ENWA 1M8KA 1UMCB 1Y34E 4NI5A 4ZYUA 2PGOA 3GT0A 3TRKA 5KNBD 4BJ6A 4TVSA 2OUKA 4HTFB 3SCZA 3U7FB 4F4UA 1G20B 3FLEA 1R74A 4O0LA 1T91A 5DPMA 4TSFA 3TTVA 3X1MA 2C61A 3NHZA 1QR6A 3KRTA 4YP0A 1TAGA 3DM9B 3KTDA 1QC5A 1UBNA 4W5JA 2W2PA 3OM1A 4IIJA 1G2QA 2O6HA 4BB0A 1PJRA 1ZD2P 1WRBA 1M33A 2AI1A 5L3VA 1P3DA 4US0R 2OK7A 3BQNB 1ZGZA 3AR5A 3DPIA 3WYGA 1L0BA 4LYGA 4O6VA 3LWBA 4BB5A 1PL6A 3BMOA 4IIJB 3CS3A 3WI7A 1M6NA 3G9QA 2WIDA 1SXJB 1KO7A 1ZH6A 1P6XA 4KDFA 5H3CA 1GFZA 5IK2D 2ID4A 4QBFA 3W8FA 2J3HA 2BF7A 2IT1A 2IUSA 3MAJA 1SMKA 3UJ6A 3B52X 4COKA 3OT1B 2FP4A 4KPFC 4DLNA 4JLBA 1C8KA 2DBYA 4CKCB 2DBQA 2H1WA 4J0CA 4QODA 5LP6B 4ZAXA 2V7BA 4YMIA 1JEJA 2YWEA 3OPYI 1M1YB 3VI4B 2Y0PA 3RBVA 1KAQA 2P4UA 3CC8A 3H2ZA 4IRXA 5JSHA 3T4XA 2F17A 5BWMA 2AC7A 4GECA 1XNJA 4I8XA 2F3RA 2IXTA 2B4RO 1YJ8A 2YMLA 4BTVA 1EE2A 3LIIA 2H4FA 3CN9A 1P72A 2Z5VA 4PVDA 3PF9A 3I9V6 4O4JB 4QE3A 3FDXA 1X9GA 2A78A 4PG8A 3HG7A 1FFXB 1RCTE 1P0FA 3BBLA 3JQBC 3O1JC 2KLHA 2QLFA 4EX7A 4G4GA 3BD7A 3WGMA 3HO6A 1PV4A 4IYRA 3PD7A 2XTAA 2F1JA 3GWZA 5K0FA 1U98A 2ECOA 4BBAA 2O2EA 3JQAA 4GKVA 4CF6A 4CDRA 5I4IA 5ARDA 2YJNA 2E82A 1KZ6A 3K15A 1N6HA 2AMLA 5EE9A 5C2JB 3EN0A 1LLDA 4PO8A 1KJJA 10MHA 1XJ5A 1YK1A 1ZHFA 4AC9A 1ZW6A 1M76A 4K03A 1US8A 1GPLA 4U2CA 1V7QA 3B51X 1MT0A 1E7RA 4LDAA 1IB6A 4EWLA 5BMOA 2AS0A 4L28A 3PIRA 3JR7A 3IDSA 3MOGA 4RZUA 1L5NA 4CN8A 1D2HA 3KO8A 4HMOA 4GGOA 5DTJA 1JR2A 4BKRA 1A5BB 2W6CX 3VOSA 4XCXA 3K0FA 3K94A 4DCOA 3GF4A 1DPFA 3AMVA 1JFLA 3OLQA 1UC9A 3RT7A 3NU1A 1NLUA 4YP1A 3W6ZA 2WSMA 1XTTA 1CQIA 3WRXA 1IN1A 3OE4A 2YFQA 1BZYA 4HQLA 3QHQA 4MQFA 4D4KA 4IHJB 1BRTA 4IIXA 1RC8A 2J5KA 5F51A 2ADFA 2CXQA 4X95A 1XTBA 5CB4B 5A3JA 1BEZA 3WRYC 4HDAA 1NVXQ 1KZ9A 1ZH8A 2B34A 3IT0A 1AURA 1XVLA 1H0RA 2HCRA 2IHYA 4HWGA 3PTZA 5HTKA 4BKQA 2J7KA 2W6PA 1GL9B 2A0UA 5CYOA 1VB5A 1KFBB 2JFPA 2C20A 3B78A 4IW3B 4L9RA 1A9RA 1TVEA 4ZI7A 3EYWA 5AM0A 2JVKA 3PEVA 3U26A 4K1XA 5BYJA 4XEHA 1ABBA 1T5LA 3K96A 3SE7A 1QO0A 3K9QO 4C0XA 4DLPA 3ZLUA 1GU7A 4G24A 3Q3GE 2ZRFA 4C1NA 2JLSA 3CIFA 3CJQA 4BOYA 1FP4A 3KQSA 3NP7A 5DISB 3GCGA 4C88A 2ZYRA 4A73A 4PN3A 5CM2Z 4Z1MA 3S2EA 2H5IA 2H48A 2J67A 1XRNA 2RDMA 1NI5A 4PC2A 2FJ0A 2JFGA 5CYPA 3VZCA 4RY8A 4B84A 4EB8A 1K8ZB 2JI8A 2JI6A 1EZ4A 4RJJA 5JD5A 4GKJB 1Y8QB 2V4UA 4TWZA 5B6IA 2OHJA 1U5BA 2WJYA 4P4NA 2GTIA 4ALJA 4ZK2A 1ZNYA 1UIRA 4GOXA 4NV3A 5HCNA 4H3KB 1N6OA 4G8DA 3VKVA 5JISA 1MIOA 3FTFA 5K0NA 3FCCA 2R8OA 4BASA 2BDEA 4DW8A 1O8CA 1Z2CA 2P6UA 5DB4A 3Q3HA 2IVFA 2FJUA 2Z4TA 1O94A 2FUNB 4G37A 1YQQA 2DVMA 5G41A 3RADC 4LJRA 3NM5A 4TN5A 1I9GA 3N2KB 1K7XB 2V54A 1JJ7A 1QX3A 4IUCS 3V4PB 5DNWA 2X4IA 3VPHA 3WGGA 3P9XA 5E7MA 4JMPA 5I9BA 4P32A 4E70A 2VXYA 1LLUA 2LP4Y 5GTDA 3GU3A 3OQNA 4E1BA 5A0TA 2AD1A 5FF9A 1KQNA 4R8VA 4PG6A 1GUAA 1I4DD 2BKAA 2YICA 4FYYA 3F6RA 4QDKA 3KZXA 4DMCA 5SY9A 4N5HX 5KTTA 3TD6A 3OECA 5L40A 3AUKA 1HLGA 1REQA 1AIPA 1CQJB 2DGDA 1RI4A 4X54A 2H1OA 3VPCA 5FAKA 4OAQA 2JRCA 4R9RA 4H31A 1Z39A 4RANA 1WKCA 4X8MA 4X61A 1JKXA 5CIWA 3O0TA 3O1IC 5JWHA 1PR0A 3B3JA 3MB8A 4PFSA 3EX7C 3FWNA 4JBNA 5KQLA 3SR3A 4HMQA 2W2LA 1J1IA 2DKOA 1E9SA 2I1LA 4MW2A 1ZESA 4TKVB 3FF4A 3PNKA 3JWHA 1VMEA 4IVQA 3VR6A 3MTGA 5IJWA 1GGMA 1NFRA 1U7PA 2KW5A 3A6EA 3D81A 3S8YA 2OG1A 1E0DA 2PKYX 3N2KA 4KSCA 3BQ9A 1Z5PA 4LBWA 3HWSA 2FV8A 4QEKA 3ETGA 2Q0SA 3OY7A 4NOLA 5K3DA 1K3TA 1MENA 1ODLA 3RUAA 4Y2UA 1NBAA 4FOPA 3FFXA 2DY0A 3PUWA 3KR9A 1HSZA 2K7FA 4TX1A 4NCXA 3SQXA 4ZN6A 3B5IA 1WMFA 2HYDA 1RLOA 5E7JA 1SCBA 3G1WA 3IQHX 2GA9A 1S6YA 1TT7A 2ZBVA 1D03A 1YOVA 2CJWA 5AJXA 1OA1A 4U7JA 1GJRA 1IJBA 1U2TA 2X7JA 2QLJA 2PYDA 4JLMA 4YONB 5JD3A 5K4GA 4Z4IA 1RJ9B 2AXPA 3CJTA 5KVQA 1GILA 1T9BA 1EU1A 4FDUA 3W2EA 4ZYLA 3H5NA 3FMFA 3PHIA 2AYZA 3E70C 4FJ1A 4OHOA 3ZHSA 3QE9Y 1GTL1 4B3IA 2PWZA 3AJ9A 3CNHA 3U0BA 3I72A 3H1AA 1RPAA 4RIIA 3NFYA 4B71A 1CUZA 4TQAA 2J59A 4TMVA 5BY2A 1PGJA 3NRBA 4GXTA 3RT9A 3PNYA 5EUBA 1I9CA 3S70A 2FGJA 5IN5A 3URKA 1AF7A 4E33A 1A2QA 2FETA 3K0FB 4PLPA 5GOZA 2X86A 2CBXA 2TMGA 2G67A 2OV1A 3T54A 4HQOA 3EULA 5LA6B 1DG3A 2QMHA 4GPIB 4MICA 4AX8A 5IHXA 1DCMA 1VE3A 4NZZA 4JR2A 5FLEX 1N2GA 2R6DA 3HKEA 5JR3A 3HP4A 3JU3A 5FOVA 1GZUA 3TAHA 3B1KA 1IEXA 4F96A 3DZGA 3AINA 1EVEA 2NACA 4ID9A 4KE7A 1SBIA 2BRUA 4OGLA 4FLEA 1HYQA 3NHAA 2V98A 3HVKA 1YCFA 4WAUA 5KVSA 1R4MA 5JXIA 5DJ5A 2HSEA 4FMDB 4X84A 1Y1TA 4WCVA 1RAAA 2WK1A 2CHEA 3DT9A 1PGOA 3LCJA 1BCRB 3NAGA 1X70A 3V4VB 1BVRA 4C3OB 4Y6SA 2OD9A 4MQBA 3ZVMA 3IULA 1U63A 2ZIXA 1E7YA 2A88A 3L18A 3NBQA 1PFQA 4HDKA 4LRSB 5AJVB 3CIOA 3EQ2A 2EVWX 4M1WA 4BIMA 2JL1A 2HRRA 3SZGA 1YVPA 1H5UA 3IUJA 5SY6A 3Q0IA 1TZCA 4K2HA 3TZQA 4Z0TA 4LYYA 4F11A 3ZLBA 1JKFA 3QX7A 2ZUEA 1JQBA 5J5CA 2I2DA 4H0FA 3ZOKA 1OF1A 2A8YA 5AT1A 2WIBA 2PSHA 2FVXA 1VE1A 2YZ7A 1SB9A 3PFWO 4W4TA 2QTHA 3PE4A 1IQPA 2A4MA 4G01B 2DPXA 2JF0A 5M2QA 3GMSA 2R44A 2NO1A 3CCBA 1D4AA 4DR2B 4YCBA 2VTBB 3D7SA 4EKEA 4F2WA 2QZJA 1XX6A 3RYCB 1H6CA 4ARCA 2FP4B 1BOOA 2OILA 3HXPA 1DZ3A 2PSDA 3DVSX 3FAKA 3K0KA 1I7NA 2HGZA 1NVFA 3PKJA 4BCDA 3RKUA 3KLOA 1MOPA 2ZRHA 5FWAA 3V1TC 1A88A 1DTSA 1A0OA 3ILYA 3PENA 4M7OA 3NDBB 1XJWA 2J3MA 2NTVA 2ZJ8A 1HL7A 4G36A 1K9SA 4O4JA 4C0AC 4XH9B 1EHCA 3HZRA 4DA6A 1DQSA 1FQJA 1SUDA 3DCYA 4L5AA 4L5CA 4OD0A 1ZINA 2D59A 1LLCA 4NF2A 2B8JA 2YDYA 3NTUA 2J30A 4GSYA 5CHEA 3K1AA 3BH0A 4NECA 4RABA 1FS6A 1M6EX 2CDRA 2EFEB 3IX7A 3OEYA 1AK1A 2LW7A 4RTJA 2ZIGA 5I47A 3DH0A 3G3EA 1GTVA 2VP6A 3QNWA 4Q3LA 4INZA 3V34A 5IRCD 2XNKA 2IF0A 4Q3NA 3RS9A 1VHJA 4Z9AA 2QT9A 3DLHA 4BZXA 4K46A 5BRJA 3QLVC 1Q0SA 4MPJA 4XX1A 3NDRA 1JEOA 4B3JA 2OCDA 1XD8A 3STUA 3ZX5A 4O25A 4XGNA 5I5GA 3I76A 1EA5A 3A6DA 4QREA 2VHCA 2XNJA 3AETB 1M66A 1CQWA 1YTUA 4YUZA 4ZHSA 1P39A 4WLFA 3I28A 4F3TA 3BFJA 4ITUA 3CKKA 4QYMA 3B3QA 3QP9A 5H83A 3PITA 3PEFA 2JASA 2P3SA 3WGHA 1WCWA 1ZK4A 2VC2B 4ER3A 3WBKA 5JXGA 2ETVA 2QSUA 3CUVA 3OI7A 2DFKB 4LA4A 1FX0B 2IGBA 5I9LA 1NQWA 2XY4A 2OTCA 3PHLA 4LIPD 2IPOA 5D6NA 3VC3A 2XT6A 4B4WA 4DBZA 5BQFA 2NYAA 4I3GA 3SBDA 1XTRA 4OJQA 4YECA 1N92A 2XDAA 3RABA 2NSDA 1Z2EA 3SC2A 1Q74A 1GKKA 2VHJA 2V74B 1HLDA 3U3JA 1NC3A 4GWLA 4X64B 2NMVA 3INNA 3TIFA 1X6VA 1BVUA 1YA4A 2PJDA 3A7EA 4RD0A 3R9IA 3O47A 4KQHA 2WTUA 2R8YA 2CXSA 4GC9A 2C3UA 1EJBA 1R00A 1ML3A 1KI2A 3TZKA 1NAHA 4WFKA 4YRGA 1Q1ZA 1KEWA 5CDUA 5ITZB 3TTXA 1O96A 4Q1EA 4DMKA 5AW1A 3FTNA 5EZ6B 1DAMA 1JU3A 3HA5A 2P3QA 3I04A 4I4IA 4IQGA 4KVAA 1ONNA 1D09A 1KAHA 1N2CA 1RI1A 1R3UA 2P8SA 3ESBA 4EK9A 1SH7A 4XWOA 1Q16A 1KQFA 1KMMA 1PUJA 3ELWA 3A4VA 2X5KO 4BVJA 4OL0A 3TLCA 3W2HA 4EM6A 2JFQA 1O58A 2YX1A 4MYUA 4MR7A 1P4HA 2I87A 3KPYA 1NRJB 1CD5A 2VBIA 3UAXA 4EJ2A 2HADA 3I0MA 3L4KA 1I33A 3PRHA 1OV4A 1QV6A 3U3OA 4YUXA 5K8JB 5T64A 1AHPA 3P9CA 2I0FA 4WASA 4GF5A 5JG7A 3VOTA 4G8CA 3CPHA 5HQJA 1EB9A 6YASA 1DC4A 3AUFA 3KT8A 2FAXA 3LZCA 4MI3A 4B33A 4FWTA 3ETCA 4HLNA 2ZTUA 5A5DA 3QFCA 3GUZA 2V6GA 2IQ5A 3PNVA 2XYGA 3D3QA 1XXHB 2HDWA 3UMCA 1IQRA 4RNCA 1LV8A 4EGSA 5TARA 3GFBA 2C4UA 3NORA 4CCYA 3WJ1A 3C41J 3I01A 4BLQA 5KX5B 5K3FB 3Q85A 1THTA 3K9LA 4EI9A 1SD5A 2L18A 2AJCA 3BRWA 2FPUA 1P75A 4MPTA 5EIFA 1P7CA 1PR9A 3LT5A 4A1OA 2NZVG 2IF2A 5AJHA 1CNFA 3GXBA 3O8BA 3S1SA 3T5CA 4H0CA 5FJIA 1H6BA 2UUOA 3MC1A 4RQBA 5KS2A 4ZVKA 1ZZEA 1KMHB 3DJYA 2HBYA 3KVOA 5CA1B 3ZJTA 5FTWA 3ZTWA 5LUBA 4FWIB 3CLSD 3QLUC 5COBA 2FLVA 2AKYA 3RKSA 2BJHA 1JYFA 1I2DA 1D8AA 2IEZA 2W43A 4A15A 3L6OO 4QWMA 2ASVA 4I1IA 3P2MA 2QDKA 3QRWA 3QUSA 2C3OA 3U4MA 2BC9A 1PDVA 3Q0TA 1E2UA 5H16A 4TLCA 5KSWB 4IGKA 3ZK9A 5AKEA 3NHJA 2AZDA 2KBFA 4Z9XA 1EIWA 1NVUQ 5EP3A 5CJJA 1TZMA 4B3CA 1PZXA 4YRZA 5HEKA 1VPTA 1EVIA 2I7DA 2Q3CA 3F98A 3F3YA 2Q49A 3DDUA 2WQ7A 4QDUA 4BVFA 4UM7A 1BXRB 2CEAA 4B3DA 1OBVA 4JGBA 4Y1RA 4XLZA 4Z7JA 2TMDA 1PWYE 3WGQA 5J43A 5HKAA 1XQ1A 1FP4B 2UYGA 2P2YA 2IHJA 1F2UB 2ZU0C 6GPBA 4YRPA 4LMPA 1ZXLA 2H18A 1CJCA 3SY8A 3QX9A 4B2PA 4RIFA 4RORA 1NLFA 4KHZA 1JE1A 4CBVA 3D7KA 1II0A 2RARA 3R40A 1Z38A 4DSNA 4P9NA 5B4TA 3ZU2A 3MA0A 2BGRA 1S8OA 4LGMA 2DBRA 4Q01A 4LPKA 1JAHA 4ZANA 2VT3A 5C7OO 4D25A 4HC4A 1XRMA 4XJSA 4HNTA 4U3JA 3UATA 3UC5A 2R87A 3VU3A 4XVUA 1NQTA 1H2BA 3KPVA 4W5NA 4G1EB 2JJQA 1I0ZA 1J24A 5FI0B 1Z5UA 3SQLA 1BG6A 2FEXA 4P2BA 4RF5A 4A3SA 4BNTA 4FW8A 4FTWA 4BVBA 4DLTA 2C4HA 4PRLA 2CJXA 4QTUB 4JMLA 3ITNA 2O7RA 1QP0A 2KSQA 1SUEA 5JY6A 4TMZA 1MH1A 3V7FA 4E13A 2CL5A 3C3WA 1FL9A 1PSDA 1RQ2A 1BTOA 3TAXA 1WUYA 1EP3B 1X1BA 3DJFA 3IILA 5BN5B 3TX6A 3QKIA 2PZLA 1Q0HA 5IHPA 1UBKS 1A9OA 2P35A 3KOXA 3ONEA 2A9VA 4GZLA 2I6SA 2ZRBA 1FFAA 1JG3A 4I2VA 1JIQA 4DMMA 4YX9A 3IVMA 2QTWB 4D4GA 3UYKA 1ZUWA 4MUKA 2VZ9A 3DTTA 1EFDN 2PT7A 3CZCA 2GYYA 1MH9A 1N2CB 3I58A 4ABYA 1NY5A 1IEWA 3LBAA 5HHTA 3DXFA 4TKLA 1ISHA 1N25A 4W9RA 3W5AA 4RM2A 4QOHA 1W6RA 1NUHA 5IZCA 2DQKA 1CULC 1YS6A 4NPCA 4UCWA 2V3WA 4E3ZA 4RZXA 5BN3B 4IM7A 3RBZA 1SIUA 3IB3A 4MVJA 2O54A 4TTQA 4IDGA 4AWBA 1UJNA 2BFEA 1T4GA 1ZYUA 1PLLA 1CQZA 5K6RA 4XRGA 4X94A 3TIVA 1EZZA 4TYMA 3T41A 4KP7A 5AXAA 1SVUA 4J0QA 1E6LA 2NU6A 1D7AA 5E3IA 2WWYA 4FOLA 2ZJ6A 3BB3A 1L4UA 4JT4A 3HE3A 4WZ6A 4F9TA 4LKRA 3D5QA 1IZYA 2Q4BA 2PUWA 2XPCA 5E4YA 3R6LA 3R41A 1RRMA 3M8KA 1Q92A 2EF0A 3QXHA 5AVSA 1OBOA 1OY1A 3HRHA 2HMVA 3UG6A 3VTFA 1YA8A 5EXXA 5BV7A 3FHJA 4XVQA 1J5XA 1PJSA 4IIEA 2BEVA 4K9MA 4AZWA 5L7WA 3ZBUA 4IH4A 2A0YA 5JCJD 3GBPA 3GDOA 3KUCA 2EF1A 2RKOA 5EE1A 1GLGA 1L7PA 5IDXA 1LJ8A 2I4RA 2P0AA 3CW8X 1VBMA 3NPMA 2XEDA 4C21A 1IEQA 4UATA 1V6AA 2QSJA 4C9BA 4CT0A 1SIWA 1Z5OA 1QHHA 3FPLA 1M6VA 1NN0A 1JEYA 1GN9A 2F48A 4I55F 3NYIA 4LVOA 1HURA 4D6YA 4ZOCA 5H81A 4YV7A 5FLKA 5B3JC 2LCIA 4ZTZB 1R88A 3EOAI 1T2EA 2IY8A 2WUFA 4DPLA 3TIXB 3TAUA 3R4VA 3NYQA 5T4FA 4DQVA 4LQ4A 1ZAYA 4YT5A 1QP7A 2H2AA 3VGJA 3IPCA 2XXJA 3NTVA 5BOVA 4PNPA 2VTVA 2ST1A 3CVXA 3V7UA 4ZQCB 3GFSA 4RJIA 2J33A 4C6SA 3UC9A 1SVMA 3VZBA 5FUVA 1L5VA 4CMHA 3A3PA 1AQJA 1C7IA 5EEHA 1Z7WA 3T94A 4BO0A 5K03A 4UDOA 6AT1A 5AOCA 1TXGA 2ZSKA 4TQUS 4UPDA 4CI9A 2WZDA 5KTNA 5KTSA 4RSGA 1SY7A 5FRDA 4C5BA 2DKNA 1E2NA 2BMJA 4HX2A 1R9NA 4EQZA 4Z1MD 2H1CA 4KRXA 5L7TA 2B4TO 1BQEA 1S8AA 4UDXX 5G3ZA 3UK7A 4O8CA 5KSYA 3FJOA 1D2EA 1OPRA 4KQGA 1E3JA 4N3AA 3SICE 4ESHA 3KKEA 2Z2XA 1HE4A 2FE4A 2A35A 3CGWA 1ZWLA 2IPLA 2PIAA 1P8AA 1WM1A 3LFTA 4JQSA 4X7RA 3RU9A 1M1YE 1Z06A 5LQJA 5DNYB 4TV8F 4QUEA 3Q8MA 1F20A 3W6NA 1M2WA 2BFMA 4PFQA 2B78A 3OPYB 4TMFA 1NWCA 3EIHA 1N7JA 1YDGA 2C3PA 4QG7A 1KRXA 1BKSB 3M9LA 3OO0A 2NU8A 3TW0A 5DASA 2ZRLA 4UTXA 1JJIA 1J56A 4M89A 4P7FA 2ZBEA 2LD4A 4KO4S 3O0DA 4EUFA 2VZ0A 4G0YA 1YZKA 2XMZA 2NPFA 4ABTA 3C7KA 1AGPA 5KYTA 3CF4A 1I2AA 2ANCA 2VRBA 4OKIA 3O9VA 1M1NA 5K2OA 3D3JA 3Q15C 1MU0A 3DOOA 2HDOA 5F12A 2FQQA 2YV4A 3JATB 3V8QA 2GBFA 1J33A 2JIPA 3MUOA 4JJFA 3TW6A 5B12A 1ZHOA 2D74A 1X8JA 3HN7A 1E3DA 3BUSA 3F7TA 3ANTA 1YULA 2CNNA 2MDTA 2QYTA 2FK8A 1NLMA 2NO4A 4L16A 5HYVA 1GFIA 4HGQA 2FW0A 1RBMA 1N77A 4CDNA 2B9VA 4M36A 4HB2A 5JDIA 4WDRA 3UBMA 4RVCA 2GXSA 1YHYA 3N8KA 2J31A 1BKYA 3L92A 4FT4A 1STOA 3AERB 3T9DA 5H9VA 1D1TA 2NV6A 4FOSA 4N3BA 1AKTA 2JI7A 3A11A 3ZLVA 1E3TA 1EK6A 1JV2B 4K3UA 3M33A 4JWKA 3PX3A 4QATA 3HQ4O 3I9V1 3IIEA 1OC4A 1IY2A 1PT9A 3PC4A 1UM9B 4M46A 4NNOA 5DM1A 1FVOA 4ZTBA 4YPOA 5JASA 5C3UA 1E2HA 1DAKA 2NZXA 3EEBA 5AVVA 1VG0B 4Y2GA 3V8MA 2IHKA 3HY3A 2DHDA 3KJEA 3IFSA 1EK1A 3IOMA 4AMBA 1ZCFA 2PZGA 1W88A 4C7KA 3TQRA 4F2GA 4DWOA 2WJPA 1BRMA 1R5JA 2H5LA 4YAJA 1ZI9A 3HO8A 1WDWB 3GPCA 4X6LA 4RZSA 1QOPB 1FJHA 3U4GA 3QPWA 3CFYA 3LVQE 1CJSA 5ENZA 3OJWA 4NENA 5EXEA 3RJZA 4DLBA 5T6MA 1E94E 1VHDA 5EHIA 1YBHA 1ND5A 2QVCA 1FZQA 2XMBA 4Y3UA 3R7LA 2RB5A 2DPGA 2C42A 3OJOA 3TIGA 2ZE6A 3UAWA 4WK2B 4K40A 1CR1A 3AEKA 2V8OA 1ZK3A 3DZBA 3LZDA 4KR2A 1SCUB 2XRYA 3GPBA 2IYPA 2KE5A 4UZSA 4Y9SA 4MWGA 1C8VB 5AD1A 3EIXA 2ADOA 4CTKA 2EFJA 1X7DA 1Y1KE 3G17A 4UUAA 2FN8A 5ICCA 2VT6A 2VAXA 3ENVA 4DQ0A 5J23A 2SKDA 3L3BA 2L0XA 2DT8A 2Q2WA 1OH5A 5HUJA 2GGSA 1ISIA 3GCZA 1GLNA 2BP7B 1OW3B 4HFMA 2HYIC 3PQ5A 2C8JA 2HQBA 5LQSA 2JLYA 1JF8A 3IAUA 3R5TA 2IL1A 1UXHA 4MK4A 3TCNA 1XMXA 2YCBA 1QK3A 2YIDA 1KR5A 1WXQA 4OATA 1XALA 2XVZA 4YUAA 2ZATA 3ZXIA 1HI9A 1YBVA 3WK6A 2G5TA 3D1VA 4L9SA 1M5TA 1YZVA 3JQAD 1SXHA 1K3UB 1GPH1 3QW2A 1QPGA 1OZAA 3QE3A 2MSDB 3OPVA 1KFCB 4N7BA 1TJYA 2EZ9A 2FPKA 5ILQA 4EFMA 3QKUA 3ZWAA 2D5BA 3TZEA 2CFCA 4MKRA 5IJ9A 3TZBA 2AKEA 2HK7A 3A14A 1QS0A 5IJXA 1I4TD 1YASA 3WY9A 2OKCA 4CJXA 5K0GA 4DV7B 2ZQYA 5CFNA 3UWMA 1VB3A 4ER5A 2P30A 3T9CA 1PR5A 4P58A 1E9AA 2PH3A 3D6HA 4IDFA 3ULKA 4RKRA 3NIDB 4AN4A 4ENUA 4U9IS 2GILA 4WMLA 1DC3A 3PHHA 3T7RA 4AUMA 4KODA 2ZYHA 3SC6A 3VAZA 2IX9A 2IHUA 2W0MA 1D2GA 1DTWA 2FRXA 3FH0A 3KKPA 3NEJA 4NR0A 4WXHA 4YWJA 5HE8A 1FXWF 3GMIA 4KQXA 2PUJA 4IGAA 5HQ3B 2VPIA 5JC8A 4YAFA 5IEBA 3EZXA 3GJQA 1UOOA 3KLMX 4KYIB 3W78A 4XX0B 1PX2A 3O4RA 1VTKA 2XNCA 2V1UA 3NTQA 4I4TB 4OHBA 4LHZA 3LNCA 5CVCA 1HZZA 5K3CA 2KYRA 4KOAA 2C4KA 2CFIA 2FWPA 4B45A 3N39C 3ZJ4A 3VR5D 4ROTA 2PLNA 1Z0JA 3IMFA 1DCTA 2H4WA 3NAZA 1Z6YA 4DLSA 1EBUA 5KTOA 4RA6B 3FPHA 3OLWA 4XJVA 1KWGA 3PG5A 2CUKA 3BIXA 4WLUA 4AZVA 5BR1A 1Y89A 1V96A 3MYRA 4DM3A 2O5EA 5FUQA 1IFXA 4R0NA 3GGOA 4Z6KA 1Z2OX 3WHPA 1YJCA 4FNMA 4PRYA 2E2WA 1WOMA 2NV2B 2C2ZA 3E9EA 4U6QA 3V1LA 4EJSA 1GHTA 2GUWA 3TZCA 5KYNA 3RGGA 1N8KA 4HAXA 4K5QA 4XSVA 1BMTA 1QHFA 4P4UA 4YQYA 1ZMBA 2BFOA 1B2LA 4FMCF 4G0PA 1JHPA 3WYEA 5KQGA 3ZE1B 1QTRA 4ZU1X 1YCDA 4Y30A 1G63A 1KK3A 1SPBS 1R6XA 1KF0A 3KYCB 4EX6A 3FVWA 3W04A 1JKJA 4F6RA 2C7GA 4RTNA 4ZVSA 4ZFNA 5ALWA 5T3UA 3V2IA 3DAHA 2Q3MA 2WU1A 4KE8A 4QTTB 4UHJA 4F85A 2IP1A 4FCCA 1UKVY 2QYOA 2Z3ZA 4ZEVA 1TKCA 3GPDG 1FBNA 3IKJA 2JH8A 2IZ6A 3PZRA 1WP4A 3GJ5A 3MWDB 4XB2A 5KCMA 1JQDA 1KQGA 1V7PC 2B8TA 3CG0A 3OQPA 1GNVA 4YDHB 1YAHA 4NBTA 5TR9A 2OCPA 1ZEMA 1U7TA 4BMNA 2NAFA 2VYCA 4CEHB 1JPUA 5EFOA 1EDDA 1K4KA 3FMPB 4IIFA 4O4IB 5IFLA 5CIQA 4JUFA 1JTVA 1YNSA 4N0PA 1T25A 4EH1A 4WXYB 5PNTA 1EFTA 3B13B 2O7SA 1KI7A 5AWFC 4L8YA 1OAOC 4KXMA 3HCEA 5JSZB 5HQTA 1KWKA 1VKRA 1Z0KA 1O03A 1HE1C 4TXHA 5GM1A 4EJMA 3TLKA 5JMOA 1OYWA 2I66A 3GYGA 3LF1A 3Q3EA 3W6PA 3IAAA 1KZHA 4GNRA 2WABA 4WHMA 1FYDA 2XGJA 4QPNA 4NMLA 5IBRA 4JC5A 1ZXBA 1GV1A 1D2NA 1R27A 1AHHA 2PZFA 3NASA 4RF2A 3RSZA 4QJ5A 3UH0A 3BG5A 1OC2A 1Q6YA 1COZA 2ACEA 1DC6A 2Z0MA 4GOMD 2ORED 5JLAA 8OHMA 1BDBA 4F91B 2PLWA 4R8KA 3F6CA 1JHUA 4XFJA 5FUMA 3KXDA 1G3QA 3UJPA 3FYSA 1QG4A 4KO3S 3HKCB 4JROA 1MAHA 1TIPA 1FYVA 2K6GA 3GEPA 1EGHA 4KBYA 1DLJA 1GZDA 3C8MA 2YFHA 3Q7TA 2CVFA 3OVMA 5ALDA 5JADA 4YV0A 3LNTA 1GQSA 2WPDA 1WLSA 1OSNA 2D7JA 5IM4F 3MUFA 3WA6A 3ZZNA 4INOA 5AVJA 1ZI6A 2HJ9A 3CPEA 3E5NA 1FLAA 1KO4A 2BBOA 5BUSA 2I4TA 4H7PA 5TQ2A 1C3OA 2QD1A 3NALA 4F1KA 3K2BA 4KR3A 2OZPA 1GGEA 1X2BA 2J3LA 2W6QA 3SYRA 2WJAA 1UXOA 1RC1A 1LNZA 2IZ5A 3OP4A 4CUZA 3DCNA 3RSFA 2CVOA 5DGCA 2HPHA 2I5PO 5EKDA 1NMYA 3R6WA 5JS2A 2HR1A 4N76A 3C3BA 3ORQA 4BNFA 4G5YA 3DE2X 2IW1A 3T8YA 1PGNA 4JLAA 4PNHA 1X7XA 4EEZA 4XA8A 1PR2A 3HR8A 4AKIA 2PXXA 2YUIA 4POAA 3TEJA 4X1OA 3CVUA 1XEWY 2G1JA 1C80A 2P3OA 4CV3A 1XLVA 1YD7A 4UVGA 2DC1A 2HB6A 1FS5A 2Q5FA 3F3KA 4QDOA 1RKXA 1KXZA 3EA0A 3P9SA 5DBOA 3MGGA 1J1UA 2CLFB 3PVZA 4Z7NB 4JI6B 4HADA 3T4PA 1SVOA 3FWKA 5JVDF 2ZE7A 3EEFA 4MUMA 4KNYA 2IV3A 4BNIA 3BXPA 2BGKA 2FMUA 5CFRA 1LDYA 1P0QA 2R25B 4QJ3A 5L3SA 1B3BA 1JLRA 2J6HA 1ODTC 1P5JA 1LRJA 1CF4A 1X8LA 3C24A 4I46A 1DV2A 4J9VA 4XDYA 2OXTA 3CR8A 3RIMA 2WG1A 1M2GA 5DOVA 2QGNA 5A4AA 2VQDA 4XR4A 2AG8A 4BKOA 3V4RA 4BU1A 3ESXA 4EHIA 5JSUA 3D5TA 1RJWA 3H83A 4MB2A 4MMXB 4YXWA 2QSYA 2PD6A 2EP7A 2WD8A 2EEZA 2Q5HA 4YDRA 1L5KA 3AVXA 2E9SA 3JASA 4K6MA 3CNQS 3W2IA 4P7KA 1WXEA 2Q6LA 4FGLA 1I2MA 4E94A 4BQRA 2OVFA 2DYKA 2VDLB 2HSDA 3STYA 3WNDA 3PFKA 1PLJA 1SBCA 2WU8A 4N12A 2Y99A 2XF8A 2JAWA 5EWJB 1RPZA 2GM3A 5HPYB 1H6AA 4M0UA 2A9KA 4LZNA 4B8YA 4C2UA 1SHZA 2CLEB 1H2RS 2AC4A 1JHYA 2WU3A 3K5PA 2H5EA 3KWMA 1UKAA 4WKBA 1L5GB 1IJKA 4YCAA 5ALQA 1LNQA 4H2DA 4MRMA 4MR8A 3VR2D 2G4LA 4KMRA 2WA2A 2BH9A 4RK4A 1KJZA 5FA5A 3T3DA 1KEVA 2WG0A 2R6R1 4I5GA 1W85B 5A0FA 3QXGA 4LXXA 3V3KA 3KCNA 4IFIA 1TE2A 4LGVA 4EY5A 2EQ5A 5L4NA 1EUZA 2V03A 5BSEA 4B3SB 2X8JB 5ARBA 4OA5A 4H7JA 2GN9A 3HWWA 4L22A 1G8AA 2OMEA 4BQOA 3KK0A 1YE5A 3RRNA 1P80A 4LGCA 2O3UA 4PTYA 1WW3A 1L8XA 4KN5A 5JYDA 1N0UA 4KMOA 1Y9ZA 1NC1A 3OCWA 4UD6A 2CCJA 1U1CA 5DLDA 2GK6A 3RS2A 4AY3A 2BFFA 1L9XA 3ZWYA 2C7PA 4FE7A 2SNIE 3MQFA 1L7AA 4UBJA 5E9QA 4JUAA 5DRTA 3I83A 1SZJG 3GUCA 2ZREA 4QGAA 1X7WA 2P3LA 1ORRA 1DFIA 1VE6A 3GYBA 1BDJA 3GQBB 4HGPA 2P9EA 3WGTA 3PCTA 4JKYA 1MRNA 1Z7YA 2C9BA 2H9YA 3B9BA 3LT1A 1TD9A 4NS4A 5AW3A 3D3EA 1JMKC 3AR2A 4GO1A 3IMGA 1DAEA 3M2TA 3ZEIA 4XPZA 5TMDA 1OWMA 4L8VA 4RVSA 4H7EA 2REBA 4BGUA 8MHTA 2ZANA 1KOJA 2VZLA 2YBDA 2B9EA 4C22A 1H1LB 2X1LA 1MVNA 2WB4A 2ES4A 1LI4A 2W2XA 4EQ6A 1NX9A 1T4BA 2BDTA 1PQUA 2BSAA 3HJRA 4OSOA 3EC1A 1PG2A 3THWA 2AZTA 1BDIA 1NSTA 3VH2A 5BT8A 4BIIA 1KP9A 1FYFA 5FQOA 3GJTA 2P90A 2ZR8A 3PICA 4C3ZA 3ZIAA 5EG5A 2Y8EA 1XZJA 5KNLA 3Q72A 4IBOA 2OGSA 3FI0A 2WFLA 1OE0A 4RY2A 2A14A 4G5GA 2AOUA 4C4ZA 4BN5A 4EGAA 2O07A 4XYLA 4Q02A 2OHVA 4TV9B 1CKEA 4QL3A 1G66A 3UMGA 5KVCA 5DIZA 1T36B 3EFBA 4AS3A 4FHDA 4RDIA 2ZJAA 2Q6KA 2F4NA 3S0JA 3MTJA 3I3OA 4UUOA 3PR2B 4R8RA 2H2DA 3URMA 3UIEA 2HRZA 2EATA 1E1MA 5M5BA 5JATA 3TTYA 4RIEA 4CCAA 2ODPA 3X1JA 2NXWA 5LD2B 4FLMA 4OQYA 3ZHTA 4MHTA 2H1LA 2Q4RA 1KPHA 2QQEA 5E9AA 1F51E 2IHBA 2O3RA 3FMIA 2VSQA 4B4OA 3PI6A 5LPNA 1ZVVA 4ATNA 1AH2A 1F0YA 1LSSA 1CTQA 3L07A 1O96B 3KYJB 1Y7TA 2EWWA 1XYGA 1MUUA 2RHJA 4B74A 4YV2A 1KK1A 3QNUA 3RV3A 2YW2A 2Z2KA 2ZRAA 5BQXA 1R5OA 4JLOA 1PT8A 1Y3BE 2Y2UA 4YAEA 1UBCA 5IJZA 1NJ5A 1L5HB 3T7TA 3TFOA 1DX6A 3UMMA 4Z8YA 1NJ8A 2Z2JA 5CB8A 3G2LA 2C8VA 3SC2B 1C1DB 1UWCA 2DBVO 4IWNA 3D4BA 1DJMA 3KQPA 2G71A 4HWRA 2W70A 4CG1A 1XELA 4QEDA 4KRFA 2VRCA 2WNIA 5BR8B 2XQFA 1N5MA 1ETHA 1Z0SA 3D6FA 4B9AA 2Q62A 2A3RA 3O91A 4IZOA 5DP1A 4R5HA 5KVVA 1QLJA 3G9XA 1G5FA 5CLQA 5ALPA 1JECA 3GRPA 3KSDO 1YHNA 1UBMS 5M04A 5AI8A 1SOVA 4NDZA 1DZIA 1ZJWA 4IXNA 2HO4A 2CSUA 1NG1A 2ZRCA 1Y5MA 1WSDA 2L2QA 5DHRA 1QGUB 3T7JA 1JA0A 4L74A 3EFOA 3WE7A 3GFGA 2W8BA 5LD2C 2FZ5A 2UYCA 2O5RA 3O2QB 1IOWA 3ESRA 5LKRA 4EMTA 3H9EO 1J20A 1VBFA 4MUBA 5HF6A 3TLBA 3TQTA 2REXB 5F1KA 4RLQA 2EJUA 2CLHB 4QLBA 4EY4A 1XTIA 3HY6A 3ADBA 1SVIA 5K45A 3T95A 1G0NA 2J3DA 3FNHA 4GKAA 3WP0A 4R98A 1DJLA 1EUCB 2G0TA 2GDJA 3KQQA 5EMLA 3VPFA 3B7WA 5JAUA 4RM3A 1CP3A 2WF5A 3FOFC 5CVEA 5LVAA 1GNQA 1OREA 1XTJA 3UK6A 4C01A 4DNPA 2J3KA 2JGDA 1ZN2A 2QR5A 4GPTA 3GOHA 4JQCA 2WDPA 4X60A 3K9CA 4H6WA 4LV6A 2O14A 3B1FA 3BOSA 3H2SA 3O7WA 4IHJF 1TKAA 4EHDA 3EVDA 4UFNA 1Y1RA 4Z9BA 6LDHA 4IKEA 3UT0A 3NBKA 4DV0B 3AHIA 3F7OA 1M8PA 3R9XB 2ZJ7A 4F5DA 1JHOA 3ZV3A 4BLSA 2UZ1A 1ICEA 1QYRA 1BX0A 1O95C 1Q0RA 4B0OA 1CDZA 3O2NA 3HEMA 4PHHA 3DFMA 2I34A 3MT0A 4RS3A 4ACAA 1F6DA 3PPVA 5CXQA 5LJLA 5CT5A 1N2SA 3TDMA 2GBCA 3I2FA 5JOQA 1XRRA 1XK6A 3PYMA 1RDFA 1Q3KA 1RQ7A 1X1EA 2MSEB 2PBLA 4PGHA 5EMKA 3AEZA 4TVOA 3IALA 3HLKA 4ND4A 1H8HA 3N8NA 1JP7A 3HKBA 4OQPA 3AFGA 5F5NA 5KDOA 4KB5A 5A9RA 3E7WA 4XYMA 1USGA 3PRYA 4QUIA 2NXJA 4KGXA 2CLOB 2VP5A 3CRQA 3IS3A 3KU4A 4OK5A 4RD2A 1GT6A 5DNDA 3ZYZA 1M8GA 3AXSA 2Q3HA 3BEDA 4PZ0A 721PA 2BMEA 4XLTA 3KPWA 4NAHA 1XU9A 1U7HA 4IVRA 1ZN9A 4Q4AA 4N47A 2JI9A 2QTVA 3AEQA 3OT5A 3AEXA 5LNK6 4N3CA 3ZGYA 4ERXA 3FD8A 4KLCA 2WJ4A 4S3MA 3U2QA 2DSTA 2XD9A 5JDIC 1O2DA 5KTPA 2YRXA 2F3UA 2R8BA 2NZUG 1U0EA 1I6MA 2HRCA 3EGIA 3DWIA 3FBWA 3DOCA 3MERA 3VH1A 1NXWA 1YS1X 5JLJA 2ZUVA 1CRPA 4LBYA 4BXOB 3O2SB 1MJHA 1CF9A 1J0AA 1Q44A 3NX4A 5DN6A 5KWSA 1S0UA 3WRYA 3A32A 3KHSA 4Q3AA 5CLHA 3L7MA 2G07A 3WLTA 3ZUPA 2WJ6A 3O6VA 2Z58A 3MELA 3WQRA 5B5SA 2QJFA 4DNXA 4N40A 1W96A 1KIMA 3QVKA 4HZUA 4MW6A 1YQUA 1G0OA 4W5WA 5AW4A 1K68A 3G8BA 1AO0A 4DR1B 3KXLA 3VO1A 3GG9A 3WJAA 3VPDA 4Q1FA 1ACMA 3FNEA 3DLTA 1TTHA 3ENQA 4CMAA 5KWEA 4TUYA 1ZA2A 2WT9A 3OH8A 3IPXA 1ZK1A 4QJIA 1FMCA 4WBNA 8ADHA 2ZB7A 4ZRNA 2VPZA 5K05A 2HA0A 1IN8A 1DB3A 1TMOA 2RBKA 1JDVA 4PYNA 4QYIB 3RR2A 1MW9X 2F62A 3RJMA 3WHKA 3THYA 1PD0A 3LQ4A 1PS9A 3AF1A 1PNQA 1WY7A 1DMRA 3FI9A 2Q7XA 2CLLB 1P9WA 4OMCA 3QUQA 2GZ2A 3STXA 3ZDAA 3D3WB 2BHTA 2OV4A 2QTFA 2AC2A 2OK8A 2VEDA 2YCLA 3EVZA 4ARZB 2DU8A 5MDHA 1V41E 2ECQA 3AR9A 5LDGA 1UUFA 3H04A 4Y6OA 3TVTA 3VGPA 1DWQA 3I9LA 4H6PA 1V16B 2X2FA 2IP2A 1VC2A 4HDRB 4NABA 1MCZA 1QH1A 1XMVA 3OIUA 1UPCA 5FIUA 1QG2A 4XB6B 4FN5A 3EQ9A 4TMKA 1JXAA 4GI7A 5AFSA 5DF1A 3USES 2QN9A 1Y4DE 2H00A 1RYYA 3LKBA 4LRWA 3EXHB 3RUFA 3BWCA 4BLUA 2H0RA 4JIGA 4RHTA 3R8XA 4LZWA 4FCWA 1XCBA 2VQSA 3UJAA 2YZMA 1P1RA 1F9AA 3LHFA 4J0FA 4LDJA 1KSHA 2HNBA 2EKZA 3PRKE 1TK3A 3W9SA 4AJPA 4EG1A 5BWCA 4B3TB 1MAAA 1REQB 2OO3A 3CONA 4GG1A 4HZGA 1WNFA 4WEQA 4F8EA 3HYTA 3EUEA 2OZLA 3BF7A 3KIPA 4WTOA 1TM7E 2REQA 4TYQA 5JHGB 1SXJD 1WCV1 2HU7A 5DX0A 1W5SA 2AN4A 4PGGA 4N5LA 4QRHA 1R18A 1KDRA 2CB0A 1YJBA 2NZ8A 3IHWA 4PCVA 4TZ0A 1VMDA 3AHHA 3OZFA 4G41A 4Y2PA 1NOJA 2BR3A 4P36A 5JV5A 3AFMA 3IP6A 4ZU3A 3ZHOA 3NV9A 2ZS7A 4UM8B 1X74A 4DV1B 1ID1A 4HB3A 3C1UA 4XWYA 2OZVA 2A9FA 2DUNA 2FRVA 2O9JA 4JZYA 4R1UA 2OSBA 2QVBA 1CUFA 4QUDA 3K1JA 3DR5A 3F6SA 3TRDA 5BNTA 5E1OA 1KYQA 4G8JA 1OAKA 1YL7A 1QYWA 1TUBA 3EBOA 2ZIUB 2AMJA 4BWGA 1EFRA 2N47A 2OQIA 1T5IA 1UADA 4FU0A 4LHEA 3A6PC 1QQ5A 5FA8A 4CU2A 5JZVA 1ZUIA 4HK4A 1MORA 4FFBA 3Q87B 4G0ZA 4MSUA 5C1IA 1N4AA 4AS1A 3VHRA 3I8XA 3UV6A 4BJ1A 4B7AA 1E66A 1R8JA 1N3LA 1VIYA 3IDFA 1CZRA 4X1IB 4ICIA 3NC0C 3T3NA 1PR4A 4G0UA 1YWGO 2J0EA 1M1XB 2O1XA 4MKIA 2VDPB 1GIAA 4BQNA 2AE2A 2DERA 1SHKA 4HUQA 4E2WA 4MUAA 3H6HA 5AVTA 4JSYA 2JVJA 4YPFA 1R5NA 1G8FA 3H87A 4JNCA 1MV8A 3A1DA 4HF7A 4PF1A 8LDHA 1XU7A 3LP8A 2X23A 1G8JA 2GWRA 2IE0A 3ZYCA 5LZ7A 1YZTA 3N3AC 3QNMA 4DY6A 3F2IA 5JDCC 2AJBA 1EFUA 2GBLA 2J6CA 3AHFA 1YZLA 4YCSA 1YDEA 1KNQA 3GZNA 4B43A 4P0QB 1ZUD1 2F9LA 2PRSA 4TMTA 3GJYA 5BYAA 1FIUA 1G8HA 1QZXA 1U6KA 4DGQA 3KPJA 3IV7A 4ESEA 4DRXB 1G21B 2VN8A 3OZUA 1MX1A 3PXEA 3WWOA 1F3OA 1VXRA 1T13A 1MJ5A 3EEIA 3SBEA 4Z2AA 1NU8A 4DB4A 3AUYA 1J00A 2YL2A 2E1RA 1OOEA 2F67A 2PGDA 3L5OA 2JA1A 2P6OA 4ZD6A 1CIPA 1Y37A 4LI0A 3PDCA 4NNJA 1OUMA 5IC6A 5JMWA 2DETA 1TTQB 1W2WB 3EZ6A 3AC0A 3V1YA 2B61A 2RIPA 5A02A 2EEPA 2OXIA 5FQNA 2HTFA 4WIAA 4PZZA 1R2QA 5JNVA 2DWOA 2FSHA 5B7GA 2EC5A 3II6X 3R0XA 4FBMA 5DMXA 3KSUA 1MG5A 1Y5NA 4I81A 4J6EA 1T9CA 4NK4A 4NONA 4D99A 3AUAA 4CIWA 3PQ8A 4KAFA 2ZI4A 1F2TB 4FONA 1E2QA 1XPOA 2RH8A 3T38A 2LDXA 4OJTA 3CVJA 4V0NA 3WAKA 2PEYA 3T1HB 1M2OB 3QWHA 1GZHB 3CLTD 4GQIA 3R7NA 1UPBA 4I3FA 1OIVA 1FUIA 2QMQA 3KB2A 1C3LA 2Q29A 2QRVA 3H5RA 4JVLA 4PZEA 3SJAA 2OORA 1MMFB 1RXYA 1U8CB 3P96A 4ER0A 4W82A 1A04A 2HEIA 5JS8A 2AUNA 2I29A 1EVKA 4DSOA 5A4JA 1TTPB 1KYZA 4RYLA 3U3MA 1WHTA 5CH5A 1EEHA 1NR1A 5IKEA 2PKXA 3SOPA 1PJAA 3BS4A 4AROA 1J6UA 4Q1VA 4UJ3A 3SNHA 1ABEA 4AMZA 3C6BA 4JUDX 1MRSA 2NPIA 5ICMA 1CUXA 1V5EA 2SCUB 3O9ZA 3A36A 2IIBA 2OCGA 2B8NA 2KHZA 2QRLA 2VAVA 1A7JA 4FS8A 4PLGA 4EW1A 1HDYA 1L7EA 2AQ8A 3MPOA 2VDKB 3IJRA 3QU9A 3IEMA 1CJKC 1A7AA 3LKDA 2ATVA 4DWJA 4G97A 4IIBA 3MQ2A 2JJYA 4EZBA 3V6LA 2VF8A 4YJ2B 1JWBB 4IDNA 2QHXA 3HFJA 1DDOA 2X76A 4KBGA 5AP9A 4G09A 3SK0A 5EHZA 3E9QA 2JCYA 2BUBA 3LL4A 2VHTA 5DW0A 2IYVA 4YRRA 1E61A 3IH5A 4G0MA 4JR1A 1Y9EA 3AUSA 4P84A 3ZWBA 1CEEA 2IYNA 3HR7A 1TCAA 1R37A 2E18A 4NESA 5I7FA 2ZRJA 4INJA 4AY6A 1Q0ZA 1U2DC 1YBFA 4GUAA 3L7NA 2JNWA 4CM9D 5CH3A 4IGIA 3WMEA 1TQ8A 2Q07A 4UU8A 1APBA 3DVLA 1WXFA 2VT7A 4I8IA 1W2HA 1JIKA 2IZ1A 3OA2A 1V9CA 2PZAA 1DTEA 3AWIA 3PDIA 3Q1KA 4RENA 2H85A 2FSFA 3FWZA 1PP4A 3S7ZA 2HLNA 4XIJA 1OZGA 2CFSA 5KDDA 1RE0A 1YJ5A 2J8ZA 3TSZA 2CWDA 3F6PA 4JH0A 5FADA 4UPVA 4XIYA 4X63A 2WYWA 4WN9B 2O20A 2C7BA 2C31A 3AR3A 3L46A 4LJ5A 4YCJA 3ROEA 2QYSA 4KR0A 2D1TA 3VBEA 2I80A 3SJBA 1NXSA 5CD1A 4CTOA 2FZVA 5CDHA 1H69A 1N6IA 1QE3A 3NW9A 1NVVR 1P9OA 5GIOE 1UEIA 4GPEA 4OYYA 5EJ6A 3IAM1 3RUIA 4QAJA 4N39A 3TL6A 3FE2A 1HR0B 3SFTA 1RKBA 1XLTA 3O8QA 1IBCA 3UYLA 1TAHA 2I3AA 2IJGX 1RYEA 3G0CA 4QD3A 4FDTA 1SA0B 2CXUA 3VNQA 4OUKX 5KU7A 4LY3A 1WU7A 4LJYA 1JDTA 2DT5A 3EDYA 1V4VA 3WXMA 5DHPA 1F0PA 3IXLA 4PQGA 5LQMA 1V3UA 2W2QA 4J6FA 3WV4A 4L6IA 4LSWA 4R2JA 1RNLA 1T0JB 5JH7A 1E2GA 4CIVA 1ES9A 1SC4A 2FUKA 3Q10A 4QYIA 1X7HA 2V5VA 2VSNA 3LPAA 4NFYA 4NU5A 1ATIA 3WYNA 4EGFA 1O9GA 1GDHA 1Z5ZA 2FPGA 2NYUA 1Y6JA 2PTHA 1THZA 4CM7A 5K8CA 2RK3A 5C4IA 4MUEA 5AM3A 5LL6P 1NF8A 3ETEA 3JALB 2QIOA 1T4DA 2XWBF 3OZAA 4KXVA 4QDXA 5AKYA 3K2IA 4XPIB 3VSBA 2JJMA 1BE1A 3WL6A 3RDPA 4RTRA 4G89A 1LBSA 4CLRB 1WETA 1CCWA 2A1UB 2AQHA 3AGQA 2IZZA 4LTNA 4LWPA 3S2ZA 1NVGA 3LW7A 4NYJQ 1SA0A 4ZVVA 4FFDA 3D9QX 4Q93A 3TFQA 3JAWB 1E9BA 4QLAA 2FFJA 1ECCA 4ND1A 1EQUA 1Q1BA 2PRJA 1PJBA 1O5TA 2YV3A 3I2KA 5BV2P 1Z8NA 2GFHA 3BGDA 4RHYA 3B1VA 3GA0A 4D79A 1H94A 1EWRA 5EUCA 2VHWA 4R51A 1N2JA 5TNXA 1K66A 5AK3A 1J7KA 4NULA 3H86A 4URZR 5FL7D 5AI6A 2NUAB 3LSTA 3NBMA 2JLQA 2JIBA 3P2YA 4N7MA 4WY2A 2YHBA 1PZMA 5DSZA 1CRWG 3SZRA 5KYKA 1Z5GA 3GRKA 2YJ5A 1EZ1A 1RHJA 2KI5A 2HHLA 1PRYA 2WI8A 1TEXA 1G6HA 3KZVA 4O4JF 3OO1A 5GZ6A 5UKDA 1WNTA 5D7BA 3ZH2A 3GPLA 1V1MA 3F46A 1IHPA 3ZN2A 2ODAA 3OJFA 1JR3D 4A4DA 1U0LA 2Z3VA 2X0JA 3CZPA 2ET6A 3HUUA