1JEYB

Crystal structure of the ku heterodimer bound to dna
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
540
structure length
530
Chain Sequence
b'NKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*TP*TP*TP*TP*TP*AP*GP*TP*TP*TP*AP*TP*TP*GP*GP*G
molecule tags Dna binding protein/dna
source organism Homo sapiens
publication title Structure of the Ku heterodimer bound to DNA and its implications for double-strand break repair.
pubmed doi rcsb
total genus 136
structure length 530
sequence length 540
ec nomenclature
pdb deposition date 2001-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02735 Ku Ku70/Ku80 beta-barrel domain
B PF03731 Ku_N Ku70/Ku80 N-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1600.10 Mainly Alpha Orthogonal Bundle Ku70; Chain: A; domain 4 Ku70; Chain: A; domain 4 1jeyB03
2.40.290.10 Mainly Beta Beta Barrel Ku70; Chain: A; Domain 2 Ku70; Chain: A; Domain 2 1jeyB02
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1jeyB01
3VI3B 1IDN1 2ODQA 2VDMB 4A0QA 1ZOOA 1DGQA 3ZDXB 1FE8A 1XUOA 2M32A 4C2AA 1JLMA 2VDKB 1Q0PA 1AOXA 3TW0A 5BV8A 2I6SA 4NENB 1U0OC 2XWJI 1DZIA 1TYEB 5KYNA 4O02B 4UM8B 3ZDYB 1AO3A 2I6QA 4JDUA 1U0NA 1ZOPA 4M76B 3ZE2B 4WK2B 3EGDA 3F78A 3EH1A 5KYYA 4F1KA 1BHQ1 2NUTA 1RRKA 3F74A 3ZE0B 5KYUA 3K6SB 3T3MB 1IDOA 5E6SB 2NUPA 3N2NA 4IHKA 3VI4B 1YVRA 3TCXB 3NIFB 3PPVA 4MMZB 3EG9A 5E6RB 3K71B 1T0PA 4Z7OB 3V4VB 2NVOA 4HQKA 3EGXB 3TVYA 1ATZA 4DMUB 2NUPB 4MMYB 1BHO1 3PPXA 5E6SA 2I91A 5HDBB 2B2XA 3Q3GE 1ZONA 2XGGA 1PT6A 4MMXB 1QC5A 3EFOB 4CN8A 1M1XB 3EGDB 1MQ8B 4UM9D 3FCUB 3IJEB 1RS0A 3QA3E 3BN3A 3EFOA 1QC5B 4C29A 3HI6A 3EOAI 1YVPA 1PD0A 4G1MB 1M2VB 3BQNB 3BQMB 2VDLB 5HJ2A 4Z7NB 3PPWA 4NENA 3EGXA 3NIGB 1MJNA 4IXDA 4WFQA 2ODPA 2VDOB 3ZE1B 3EG9B 2X5NA 5E6RA 1LFAA 4WK4B 1SHUX 5LN1A 1IJBA 1MF7A 1PCXA 1M2OA 2RT5A 1JEQA 3TXAA 1RTKA 2VDQB 3M6FA 3V4PB 4Z7QB 1N3YA 5KYUB 3FCSB 1OAKA 3E2MA 2NUTB 5KYWA 2VDPB 3K6SA 1N9ZA 3EH2A 5KYYB 3HXQA 1MQAA 1JEYA 1OW1A 1RD4A 2VDNB 4FX5A 5HGJA 3RAGA 1JV2B 2WW8A 1AUQA 4HQFA 1FNSA 3NIDB 3ZDZB 4UM9B 1SHTX 2QTVA 1CK4A 2O7NA 3T3PB 2ICAA 1XDGA 4HQNA 5ES4B 4G1EB 5E6UA 1CQPA 1SQ0A 2VC2B 4F1JA 4XW2A 2XWBF 1V7PC 4IGIA 1M2VA 3K72B 4PN7A 5E6UB 4HQLA 3ZQKA 4WK0B 3IBSA 1QCYA 5KYXB 1MQ9A 2WINI 3GXBA 3EOBI 4CN9A 1IJKA 1PD1A 4BJ3A 2ADFA 1UEXC 1M10A 3PPYA 4WJKB 2VDRB 1JEYB 1U8CB 1L5GB 5KYXA 2IUEA 1MHPA 1XDDA 1M1UA 3HXOA 5KYWB 4HQOA 1T6BY 4C2BA 4CNBA 4NEHB 1JEQB 1NA5A
chains in the Genus database with same CATH superfamily
1GZ7A 2ASEA 1LBHA 2CCKA 4TQGA 2QVLA 4YAFA 3N70A 3NPAA 4XCXA 5I5EA 3FGZA 4K9KA 5D6OA 3ED1A 4TQ9A 4RIGA 4ER6A 3IEXA 3OIYA 3TL2A 1RXSA 4PONA 5K6RA 1RKXA 1XEXB 5KOYA 3T3OA 1U9IA 4N0EA 1YS1X 3P9QA 5J5VA 1BVRA 1NXXA 4P4TA 5KSWB 1VIDA 3H7IA 4KMOA 3U3MA 1DEAA 5JQGA 2IF0A 1AKVA 2WJJA 3JQGA 5FTJA 5IAOA 2D4HA 4O8CA 5K0GA 3NB0A 4R16A 4W5JA 4BV8A 3SJ7A 1K2VN 4DNPA 4C5AA 4B76A 1FSSA 1VBFA 1Z16A 2X3YA 3WLEA 5DM4A 4BNDB 3SE0A 3JQCA 1OU4A 1VL5A 3C5EA 5CEFA 1T91A 3ZVNA 2GHTA 1Q21A 1QTIA 3EFEA 2VAPA 3E15A 3DLHA 2XT9A 3K2BA 1X92A 1XCPA 2IEAA 1T0PA 3UANA 1ORHA 3O1IC 3KSZO 3P97A 4L9AA 4K7JA 5KCMA 4W63A 1JAYA 1KNQA 3P5SA 5BSTA 2IKQA 2PS0A 3V4ZA 3I32A 1VLMA 4GOKA 4ILEA 3MW8A 1TM1E 2DHCA 4WCVA 4F8JA 4HO1X 3AUXA 4UTVA 3MS2A 1UKBA 4Q9AA 4F3NA 2PD4A 3TZCA 5JXHA 1YU9A 3MTAA 2JKVA 1YJXA 1DCFA 2E5FA 2RFLA 2X6RA 3IAHA 3NHKA 4S1PA 3JARA 3P0HA 1YKSA 1YV9A 3P1JA 4J49A 5CBPB 3ER8A 2Y1OA 2IEGA 3LDUA 2VJMB 2ERXA 1YOVA 1UANA 3O82A 4Z4FA 1C7FA 4BZWA 4BZQA 3DP9A 1XQXA 3HL0A 3GYBA 3WGNA 4CDMA 1N5LA 1JEEA 3KFVA 5FJIA 3IPAA 3U56A 5KDDA 4L72A 3AVXA 3AYZB 5JNRA 3CIOA 5FCDA 4DNQA 3EH2A 3V2IA 4X6UA 3EBPA 1U65A 1NUHA 5J2TA 3E1KA 3IHLA 1KYXA 1N2SA 1OLUA 1JQEA 4LXHA 4DSZA 4QYWA 1H2HA 2WM3A 5LMNB 1TYCA 4JI4B 3LFUA 1GUFA 3TB4A 5HZKA 4BP9A 2CXNA 3QELB 3SU8A 1OR8A 2INGX 4L85A 1DEKA 1G4UR 2AR9A 3LUCA 3T3PB 2V5AA 4BNYA 2FPLA 3IR7A 5EJAA 3W1WA 1LWOA 1WXIA 2O0MA 1NOKA 4M54A 4K03A 1AKQA 4Q4JA 3WV5A 4OP1A 1FRNA 4R9RA 3UJ8A 5BUQA 1ZN2A 1P0MA 2NZYA 4RVNA 2GQ0A 3MB5A 1K88A 4ZPJA 5EIXA 6CHYA 1YK1A 4Y2JA 2WVHA 2HIHA 2OAGA 2YR0A 2W6IA 3CUWA 5I9MA 3IUJA 2F55A 1FTSA 4RD3A 3UW3A 3ZV5A 1HQYE 4KJZA 4M22A 1KARA 4FINA 2D4AA 5BYBA 4KIUA 5BQFA 3EXHC 3WS7A 1WVMA 4HDKB 3IT1A 4MW5A 2XLBA 3NLLA 1HYBA 1TM4E 3GMSA 4TYPA 5EHIA 2P75A 2ERYA 5JWHA 3F4LA 1V1RA 3QEKA 5DGCA 1SVLA 2ZWAA 1PSDA 2RH9B 2ZJ0A 1T4DA 2P35A 3K30A 3DFZA 3K9LA 3NNDA 4QPZA 4X93A 4ALMA 5B3LA 2PRIA 2J7KA 5CPFA 5HUQA 2BR5A 5CB4F 3Q10A 5HKKD 3U13A 3A4MA 1Z5OA 1FDVA 3HXTA 3BEOA 1KDRA 3LZCA 3Q3CA 1Z4IA 1C3LA 4FWIB 4G24A 4M9RA 3ZJUA 3UAYA 1I0LA 2P3QA 5EIEA 2HRZA 5HFAA 3L8HA 3I8SA 5LNK6 2ZAOA 4U0KA 1IIBA 4RJIA 1PNRA 3I6MA 4KB5A 3HUDA 2IELA 4PPQA 4LZOA 3NM5A 2FH5B 4D74A 2J1LA 4IDDA 4PYNA 2PYZA 1Z0ZA 1HT0A 3QUCA 4OUDB 1RLMA 5EMMA 2YS6A 3V4SA 1SD1A 4BNMA 4CCAA 4JI0B 2XEDA 3IDSA 4A5OA 1IEXA 4YPFA 2YV1A 3KLPX 4BLTA 5ELXA 3S3TA 4Z4GA 3CKKA 1T4CA 5CM2Z 5F76A 1KAHA 1O87A 2PN1A 3AM3A 1M6VA 1FXWA 2TECE 2YUIA 3E05A 3KB8A 1EDEA 4KPGA 4XSHA 1SWVA 3SICE 4EY5A 1GZSA 4DMKA 4CLOB 2LKCA 1A96A 2G7MC 4OHYA 1JBEA 4DCPA 5LDHA 1QP7A 2VJAA 4J0GA 2WIGA 4UM9D 3RTAA 1WS6A 1F7VA 5F5LA 4FYWA 2WUVA 3ZHOA 2C0QA 2MMGA 4DMFA 3LCRA 3QJ5A 2YMLA 1IY0A 5U4QA 2JVKA 3TVDA 2G28A 2ZWOA 4J0EA 3LVRE 4M2LA 3BQMB 4N7RA 4GI5A 2NT4A 1FTWA 1ZBQA 1FP2A 2ZUUA 4JQZA 3LWDA 4KR9A 3AEQB 4M87A 3VBCA 4G63A 1EHCA 1A4XA 4NV3A 5DNAA 2XUFA 1SB9A 3GWZA 5DWQA 3RPEA 2RBGA 5HEKA 5JY1A 2QLMA 1UBMS 3DQPA 2YJ4A 4K81B 4P4SB 1EYZA 4WOJA 3A3NA 1QBGA 2ZKIA 3CKMA 1EIWA 3RAJA 2O0HA 1DKPA 1SOVA 1P45A 4ZV9A 2IBSA 3T52A 2ST1A 4DLZA 3OC6A 3DSRA 4IV0A 2P0YA 4FVTA 1PT8A 3IVXA 5JH7B 1IZ9A 2JFPA 4UUNA 5GJWC 2GYUA 1XXHB 4F2PA 5JRDS 4C7VA 3PGLA 4K86A 4L6CA 3IL2A 1PF7E 2VPIA 1TVKB 4TL7A 4IH4A 4LZZA 1J2EA 1NX9A 1VGQA 3FWPA 1EXDA 3FSJX 4KU4A 5TE9A 1R6AA 1XN1A 1Y8AA 4IMRA 1L4UA 3B7PA 2B99A 4LHVA 4U6SA 1CFJA 2HMVA 4XUEA 5K0ZA 2NUAB 1V6AA 2DUJA 3VPAA 4DREA 3WLJA 4F5ZA 1JAIA 1KO5A 2HKIA 1ZQ1A 3A3PA 3K9GA 3KTAA 5F1KA 5G02A 1GPJA 1ZIYA 1QIGA 2CFCA 2LGJA 3DEAA 2QAJA 1IY1A 1WHTB 3D7NA 4M37A 4MVWA 4TN1A 1LPBB 4DJAA 3QRWA 3SQWA 5JYBA 1GOTA 3IOCA 1NRWA 1C9DB 1CFZA 1XALA 1KEKA 2V97A 2GYWA 5JNWA 1J99A 4JXZA 3CWQA 3RVDA 1EFKA 3DPIA 4RIFA 3RHFA 2FRVA 1P2BA 4A1FA 3E7WA 2DR3A 2I4LA 4MIYA 2ID4A 1L5QA 3H42B 5DTJA 1XIVA 1ZK3A 2HA4A 3R9KA 4A0FA 3L18A 1RYFA 4GHWA 5EYPA 5KNCD 1PQYA 2WJWA 3IP6A 5KTPA 3UJDA 2GLXA 1GKIA 2HGZA 1DG3A 2V7VA 1PHPA 1E5TA 1R37A 1O6ZA 1DARA 4L50A 1J0AA 3OE7D 3G8BA 1BEZA 3MAAC 2AB0A 2H17A 4NCNA 3ZQUA 3AKYA 1ENOA 3G23A 1KU6A 3HKBA 3T95A 5E3JA 1J0EA 1SHLA 1WDTA 4DTIA 5EUBA 3HDHA 3R40A 2XGSA 1NBOA 2QUHA 3I1FA 2DBVO 2G82A 1TFUA 2R6GA 3ORQA 4FP9A 4MQEB 4MPPA 3OZVA 4OXXA 4W5WA 3DAHA 1NRXA 5AVOA 4NG4A 1DC8A 1TJ5A 4CLOA 3ADCA 1IK6A 1K3UB 1D1TA 1L4FA 2FRDA 4LC1A 4D45A 5BV7A 5M5BA 3GEMA 1LVGA 1V5GA 1OH5A 1AZSC 3FTEA 1GGNA 5MGBA 1ZW6A 2DX7A 3H9BA 4D42A 4OSEA 1Y0BA 2GHIA 2IW1A 4KPUA 2J7PD 3CH7A 3WQSB 2QD3A 3FB4A 3OEHD 1MH9A 2C1EA 1HFKA 3B60A 1W6UA 2AXEA 2H0RA 2VNKA 1RLUA 2R47A 4HDOB 3KZVA 3O84A 1RQPA 4K8RB 3NHSA 4TV8A 1WMFA 2WT4A 4BAUA 1RI1A 4COOA 1J90A 2IYEA 1G8YA 3PFCA 4HWSA 4IIEA 4PXYA 1CUVA 2HU5A 1V6CA 2IIQA 3L8MA 4XGKA 2FR1A 1CE8A 3DZ8A 1R66A 3LC2O 1FQJA 4N6OA 4TYMA 2PH5A 3FPBA 1M8FA 3SXJA 3OZDA 5GQSA 4EBFA 4EG3A 4L5CA 2H4ZA 2D0DA 3RT7A 3DKVA 5K6AA 1CF4A 3F98A 4BQEA 1IZ0A 2I9KA 2QBYB 1RTTA 3DD1A 2BGTA 1XVAA 2OORA 3A14A 2LUOA 1NW5A 1Z0JA 3F97A 3IBFA 2ATXA 1UOQA 2GETA 5CLIA 3UK2A 3T3EA 3R3HA 4B3HA 1K89A 3RU7A 1KR5A 3FUVA 5BMVB 4MJLA 3F8WA 5AT1A 4RZ3A 2EKZA 2WYHA 1SUSA 1SVIA 4CKWB 5A3QA 4M46A 2OBMA 3DLBA 1GPKA 5JCXA 1JEYA 1NUUA 2P6MA 2EFCB 3H1TA 3TTSA 4MYHA 5KSZA 1Y81A 1RLIA 3B7WA 2E5WA 3B9PA 1YR9A 4OK5A 4FKBA 3CPHA 1OHHD 2E0IA 2OR3A 4MUKA 4H17A 5FBKA 4QJIA 4B9AA 4J8PA 1JR6A 3WNZA 2F1KA 4YACA 2B4KA 3FI0A 5HTOA 3AGPA 1YJAA 3AH8A 3KXPA 3QLVA 3F5SA 1OJLA 4Q6WA 1G41A 1L1FA 3ZJ4A 2QQFA 1JHVA 3LM8A 1XRJA 3NHYA 5UKDA 1RIFA 5DX1A 4F3TA 2HOQA 2ZJZA 3JY6A 5HIAA 4RELA 3X2EA 4WQMA 3A04A 5A9SB 5FFFA 5L9AA 4N0PA 4JX9A 5CJJA 1ZNWA 2ZYTX 2VHYA 3L8CA 1JDTA 1L6IA 1YOBA 4NE2A 3RS2A 3KCNA 1ZOIA 1QGUA 1U7HA 1Z82A 3S2UA 5DLDA 4KX5A 5IPFA 2FZGA 2GHQA 3UCXA 4BCBA 4GDFA 4IOKA 2ZVDA 3IMCA 1GHTA 3T5BA 2HLHA 3P27A 2A3NA 4QXPA 4BIIA 2VDWA 3TBFA 3UK0A 3CEAA 1J06A 3T6KA 1SPXA 4CF4A 4PLHA 4MUYA 2HCRA 2WT8A 1IUKA 5CDGA 5ITZB 4U3JA 5EIBD 2H2AA 3TAUA 4JI2B 1QQTA 1DBRA 3O4RA 3BF8A 3UENA 3BMCB 1E7QA 2MHCA 3VYVA 5BWOA 4EI7A 5HF8A 2C4WA 2I54A 4B46A 4C01A 4CG0A 1HE8B 3WADA 4CBVA 1JIXA 5CU7A 5JVDF 4UAVA 2V8BA 1E89A 2WWTA 2YRXA 1KE2A 1ZO8A 2NGRA 2WUDA 4F93B 2XW6A 4FHGA 5CNMA 3WP0A 3ZHTA 2E2WA 3SC3A 4A82A 3BZUA 2JEZA 4F8EA 1W36D 2QM8A 4YRSA 4YRJA 5HF6A 2QSZA 3JVIA 3M70A 1EINA 3DWFA 4TMKA 3KX2A 4R8KA 4M55A 4M1QA 4UKDA 2D7DA 1U7ZA 4Z0TA 4EZIA 1Z4PX 3EF3A 1JDJA 1RAGA 1SXHA 4KL8S 1CNMA 1Z15A 2AOWA 4P5EA 3CG0A 2X9GA 4RVFA 2GD0A 2EX4A 1QH0A 3VJRA 1MLDA 2FG7C 1GSAA 1L7BA 1MAUA 1SZDA 2JIZD 1UWLA 1FP4B 2N9UA 5KWSA 3DEJA 3C48A 4MV3A 1E6MA 5JMPA 5MGNA 1M74A 1DI0A 1TGVA 2C4TA 3OX1A 4PFKA 1YR3A 5IZCC 1W93A 1P5HA 4KC0A 4OU5A 5ADVA 2IEBA 4NECA 1WB9A 4L9SA 2AEFA 1JL3A 2WIBA 5AK5A 2W7TA 4LOLA 1DFHA 5FUMA 4EGAA 1ECLA 3PHHA 3VC7A 5I8WA 1L7PA 4JBWA 1T3GA 3S5UA 3OLXA 5E4JA 1EP9A 2C84A 1ZM7A 1NT2A 2F67A 5A5DA 2N42A 1ISJA 1SD2A 2YMMA 2APJA 3FZGA 3MTGA 2SKDA 5KTSA 1Y4DE 3W8DA 4LJ4A 4BNJA 4WAUA 1RYDA 1VMEA 2UVPA 3B2NA 2GCNA 5EGNA 5DW3A 1GUAA 2VT2A 2H4HA 1CCWA 1OWOA 1HY3A 3IMFA 1CQJB 1NBMD 2C8LA 4Y8VA 1P4JA 1IPHA 1CRLA 2B1GA 5GV8A 2VDWB 1MPXA 3C85A 3D02A 3FPSA 4CQMD 4ZJZA 1ZM2A 4GG1A 1W75A 1JSRA 3CJQA 1X7WA 3UUFA 3M6MD 1IJKA 3WL6A 5B3JC 5BOSB 5KBYA 2DAPA 4B73A 5A4JA 4R98A 1Z6YA 2VH2A 3K9NA 3UATA 4ZCLA 2H63A 1BRTA 2R6R1 1SKYB 4Z99A 4Z2AA 5EC8A 1UBJS 3LDFA 2XVAA 1HH4A 1H9BA 3N86A 3TJMA 3SLKA 4GXTA 1ZUNA 3PQ7A 4PPGA 4F21A 1JPNA 3OJEA 4WN9A 4YMWA 1NVEA 4EY4A 5IRCD 2V9CA 1YIOA 4DXDA 5KOHB 5FA5A 5A7GA 2H85A 2JBAA 3RIEA 1R16A 3E82A 1IBCA 3DH0A 3U16A 4BVLA 1FE8A 4DPLA 1QLHA 3WGZA 3KR1A 5LCXA 3BHJA 5BYAA 2P2LA 4UHCA 3AEZA 5EWMB 5E4YA 1UPCA 3TAXA 1K06A 1AB6A 1TF2A 3JS5A 2R751 3B53X 4FYYA 2D2EA 5E95A 4C0JA 4ED9A 4CQMA 1Q1ZA 4MYCA 4IWYA 4XGNA 2GM9A 1HZZC 1ZL2A 3HXLA 1XI2A 2BBTA 3U4GA 3CW8X 1X1BA 4IDQA 3VC2A 4B43A 2ZRGA 4MR7A 1PG2A 3D7RA 4KDEA 5EKDA 5HA5A 2D3WA 5J58A 1K3FA 2ATCA 2QAGB 2DLDA 3HNPA 1T4CB 4KSCA 4MVCA 4WDQA 3Q98A 5FTNA 3SBXA 2O2GA 1SM4A 2DTXA 3ITKA 4G65A 3CPSA 2IZ5A 4X71A 4C9BA 4DYVA 3ZX5A 1VHQA 2H11A 4TS4A 4A15A 3DP7A 3WK6A 3KZ1E 1UT5A 2XKJE 3COJA 1LPNA 4JBYA 4HXGA 5C7YA 2BSXA 2JFZA 2C9OA 1Z34A 3PITA 1USGA 4OBWA 1QCDA 4INAA 1K68A 3L7LA 4M3NA 1QO7A 5JT1A 3NO4A 4PZCA 5KQRA 3NGLA 5JAUA 1XHLA 2YC4C 1DEXA 5E7JA 5FD8A 1IQUA 4MLPA 4MPDA 1PJCA 1B93A 1XWFA 2JK0A 4BMDA 1TAUA 2AF3C 1TQDA 3ROFA 1JNYA 4INOA 4YRNA 5IJZA 3RYTC 4AM8A 2AX4A 1NKVA 2Q9CA 1B6SA 1K2WA 3LS2A 4L73A 3MRSA 3QVOA 1U80A 3THSA 5SV2A 3NH6A 1XJ5A 2ZS7A 3WLPA 4EVRA 1KSJA 3NUZA 3UFXA 1UC9A 1ZL0A 1DUSA 3AOEA 4M99A 5CVUA 3S99A 4O0LA 3SP1A 4B8WA 3U44B 4NYIQ 3CLSC 2VDNB 3FCXA 3JRNA 5AOAA 4IAOA 4FGWA 1LLQA 4DA6A 4HQFA 1OA0A 3GDGA 4WE3A 4NIMA 1HLGA 3V00A 1PQWA 4ZO6A 3REOA 2QG6A 3N0XA 4Q3EA 2BI4A 3WB2A 3I45A 3RT1A 3ZU6A 4BGDA 5ITZA 1L5HB 4MPTA 1GQRA 3WO0A 5CB4B 1X19A 3OA2A 4M1TA 1NYTA 1MAHA 5CUQA 2OV4A 2RK6A 4D02A 3PEEA 4TLEA 4A92A 4UXIA 3RFXA 1PE0A 1DAHA 1W5SA 1X3LA 3ZIUA 3W79A 4V0ME 1V41E 2VOEA 3ADOA 1T6NA 4Q3CA 3SS8A 5EXDA 3QHAA 3CH6A 3DOJA 4QTXA 1OWMA 2QNBA 1PO7A 1S2GA 2P6OA 1GGEA 2OV8A 5EMHA 3TOXA 3TZQA 3H6KA 1B3RA 2I6GA 1E1CB 4MRAA 1TVMA 4L3OA 2R5FA 5ALWA 4IWXA 1MHPA 5CDFA 5LLSA 4RNCA 2R84A 4IBOA 4RZSA 4IIBA 4DQXA 4KO2S 2B7CA 3KZKA 1OB5A 2Y9PB 1DX4A 4R8SA 2C82A 3P2YA 4EG6A 1SU8A 4TX1A 3UKDA 1FNNA 1WW3A 3A6DA 4L8GA 5DI3A 5DX0A 4W5NA 1Y34E 1AGNA 2B94A 1V4BA 3ZE7A 2Z2JA 2R00A 2QX6A 3RS5A 4Q6BA 4PYIA 3DXFA 4MGHA 5A6VA 3TLJA 3G79A 4O4LA 1X80B 2C3MA 5K9ZA 4OHFA 4KPFC 3DA8A 5DGIA 2O0JA 2C42A 2ZUBA 1KAOA 5ALOA 1WTCA 2QLTA 4CL3A 1RAIA 1WW8A 5TPZD 2VXBA 3DHEA 2PT9A 1KZ4A 3RS0A 5AKEA 5JZBA 6ABPA 4YHBA 2GUWA 3LFTA 4GDMA 4YTEA 3PXAA 3R23A 4E94A 4LRYA 2H54A 2XUDA 3OSZA 3AHEA 3PUIA 3IBTA 4JUFA 4QXRA 3WSTA 5B4TA 3HI4A 1QYIA 4YCDA 2GM3A 4Y1GA 5A0FA 4MKIA 2XNKA 1JFSA 5CFRA 5FLKA 4FGKA 1IFXA 1FP7A 4XUDA 3HDVA 4MW7A 4LDNA 1SR8A 2FPPB 2GXSA 3BHIA 3IYLW 3LI2A 3RVBA 2VWQA 2A6PA 1ANKA 1Z5UA 3P32A 4AZ3A 3O2JA 2BR3A 3HBFA 3KSUA 5BQPA 5DN6D 4G09A 1M34E 2JFVA 5JQGB 5CA0F 1SWWA 3KZCA 1A82A 2QD2A 4BB9A 5AI0A 5JDIC 1TZ2A 2D8MA 3GRRA 3NHUA 2BGRA 1TVCA 1ZU5A 1T4MA 2ECQA 2O2DA 5KDLA 3EZNA 1TYBE 4Q1EA 3OZXA 3H5AA 4C4YA 4OYLA 3ZJTA 1HMYA 3FNQA 3LPMA 3T9EA 3O8LA 4LBYA 3ZE1B 2YYYA 3IA2A 3ZZNA 4OUDA 4DCSA 2C9BA 5F4ZA 4RZQA 4D0NA 2WHQA 3KKKA 1J8MF 2XYVA 2PXAA 3KT8A 4MGEA 1GTSA 3MCVA 3W5JA 1Q2XA 3I9NA 4D46A 3COSA 3V4PB 5G4KA 1LV8A 3ISJA 3ZHZA 2XTAA 4X63A 1SA0A 1U0RA 2C7QA 4BVJA 2FFHA 4X7MA 4NV1A 2NVUB 5BY2A 1P8JA 3EZ6A 3H75A 4LQDA 5NULA 4J0CA 5KYTA 3NHBA 4M0DA 3C1AA 3HVHA 2IXAA 4DEVA 3BRQA 1M6YA 5JCZA 2YKGA 1Z4OA 4KN6A 4ENUA 4MVJM 3AF1A 2PLFA 2GBCA 2I34A 2J4FA 3TSYA 3AFOA 621PA 1YFKA 3GUVA 3W3AH 2VRBA 4YMLA 4ARZB 4QM7A 2AYZA 1J8QA 5ELMA 2VHWA 1LSJA 1N2EA 1FTGA 2OCAA 4CMKA 1IBRA 1IQPA 1DKMA 5HS6A 3KLOA 3JQRA 4BMXA 5IYZA 2GRAA 5MF6A 3I34X 4BDTA 4BE9A 1NN5A 4JBNA 2OHOA 4BGEA 1J7KA 1K7FB 2A0UA 4GF5A 4BMYA 2V9PA 4CM4B 4WZAB 5AM3A 1SBNE 1T6BY 3TW4A 1ID8A 2OYRA 3KTAB 3R5FA 1RABA 3EVAA 4YDRA 1Y3BE 1FYXA 2AOTA 1GPDG 2DB3A 1QYRA 4GOJA 4BQRA 4A0QA 1NW6A 3A27A 1P75A 1B2RA 3S55A 3QE2A 1IN8A 3FWHA 4YK7A 3U31A 1SBHA 4UULA 1CUBA 2R1VB 2TMDA 4A5SA 5C4GB 4DLKA 1IEQA 2BW0A 3BILA 4WKOA 3WK4A 1II9A 3CF4G 3VISA 2CNWD 2V3WA 3ZDYB 3H2ZA 4Q0MA 5JARA 2C3UA 2W0SA 3HWWA 5IBRA 3ZDAA 5JJLA 1E7SA 2MTBA 4TVKA 3DNMA 1L0BA 2JA1A 3BS4A 4PWYA 5C8XA 1E2FA 1VGRA 4DA0A 5T4FA 4OKIA 3AF3A 3O2QB 3MD0A 3EVBA 3EWNA 5K3CA 4ETNA 3R0JA 3KYBA 5HJ7A 1B2LA 1R6XA 3AVQA 3SYLA 4EJ2A 2J31A 2JFHA 3WAKA 2X8JA 1CETA 4AKHA 4US2R 1VYTA 1RAAA 1RHUA 1U94A 1YOVB 4WASA 4RO0A 4C0WA 2EJUA 3W1VA 1ZVKA 1SFRA 2IDJA 4LZAA 4ZOQI 5KQMA 3NBFA 1HM5A 3DBHB 4FDMA 4MW1A 5GZ3A 3K6SB 5T64A 2GAOA 4N5NA 3P9XA 4UE3S 2CB9A 1Q91A 3S2IA 2DHQA 1XXLA 1YCHA 1G8MA 3HYRA 4F1WA 4DKJA 4B3SB 5B6PA 2Y0DA 3KE8A 2Q7OE 1FPMA 3A1WA 1Y7TA 2WHYA 3GT4A 3AMVA 1UDAA 1MXFA 2IDMA 5FRDA 3G13A 1N2ZA 2CL6X 1SURA 4XVHA 4QEKA 1K97A 4WFIA 1SU4A 1KEZA 3GGJA 2GN4A 2W2VA 3NFRA 1E2BA 3KSDO 3JQBA 1A8QA 2AJCA 1JILA 2A5DA 2L18A 3R0VA 4DXHA 4ZZ3A 9LDTA 1IAQA 2G6BA 3SSAA 1DCTA 4CHGA 3VKHA 3CLRD 4ER0A 1ZNYA 2O1EA 4Y6GB 3VHQA 2FUG6 2J7PA 2XCOA 3OUTA 4OQZA 4CEIB 1E6UA 3KCQA 1SXQA 1PHRA 1W0JD 4LW8A 4WSOA 3WWYA 1EUCA 2ON6A 2OMKA 3OX3A 5IP5A 3TOSA 1PWEA 3A9CA 1XNHA 2I22A 4H18A 4G2NA 1TF7A 4QHSA 5L3SA 2CWWA 4H6VA 2HSJA 1HR0B 2FOXA 3C8MA 3H1GA 3D6UA 3KDAA 2PQ2A 3ZR4B 4I7EA 1XE3A 2QLNA 4NQRA 5C18A 1MH1A 3VZCA 1I5RA 1SQ5A 4TZ6A 3A6HA 2NU8A 2HIAA 1T2UA 4K6HA 4RV9A 4WBXC 1H65A 1OT5A 3GDHA 3NGXA 1YXMA 3HR4A 1SG0A 2JDID 2R44A 3VPXA 4BE4A 2GM5A 2PX0A 3EXHB 3BFKA 2AUMA 3N8DA 2IZ1A 2E49A 4IHQA 4Y9TA 3R7AA 4DM3A 3G5UA 1A76A 1RI4A 3R3XA 2JAUA 1XFDA 1RJGA 5DHRA 4QTZA 2ZJ6A 4YREA 1MEJA 3IT0A 1E79A 4JBHA 5FUQA 1G7CA 3O94A 4V03A 1QLJA 4JLPA 2JC3A 3RTDA 2FPOA 3SSOA 4B6RA 1SY7A 4HLNA 1YCDA 2CMDA 1EA5A 4L2IA 3HUUA 3KEQA 1E3QA 2ZB8A 3FTQA 2Q6VA 1G6HA 1DS6A 3N8GA 3U0BA 2H31A 2Z09A 2Z04A 4UBKA 2AG5A 1ZSNA 3OHMA 2VP0A 5D87A 4BASA 5JNSA 3WWOA 2EF1A 1U81A 5DNCA 4U39A 2ZJYA 4B4WA 3DDCA 2BGJA 4W9RA 2XDQB 1ZM3A 1YQUA 3MT7A 4ZHQF 2M9MA 1YQ9A 4M6WA 4E51A 2G6TA 4MRMB 3M9LA 4RXMA 5FHRA 3AEKA 4IVNA 8GPBA 4S05A 1OREA 2F3PA 3H4MA 3GJ7A 3KR2A 1NMXA 3A4VA 2PPLA 3EFHA 5EFZA 5IVKA 4H16A 3DUWA 1XTRA 1W1IA 1L5RA 5DYIA 4CQNA 2CYCA 1Y4SA 1P2SA 4X24A 3E23A 1O5IA 3KDPA 1ORIA 1ID1A 1ZHFA 1M2GA 4H6PA 3MJHA 1RJWA 3R5HA 5FR2A 4GKJB 4LXXA 3I01M 1M6HA 2QENA 4DKXA 1FFAA 4XB6B 3SLRA 3W7VA 2GNPA 4MW0A 4WMLA 1L7XA 4J1TC 4OP2A 4RLQA 1N5JA 1E32A 1RYBA 2EQ5A 4G1UC 3LP5A 5CPBA 1PEYA 2HIGA 2QJFA 3DR3A 4HNGA 5C5CA 4MUEA 5CB4A 1L3CA 1TQ6A 3JARB 3OLYA 4D0RA 3W6ZA 3JQ9C 4AQYB 1KI1A 2W6MA 3U60B 2WU4A 1M2FA 4RZHA 2OSBA 5DOZA 1MQ8B 3I72A 4ZZ1A 1KKUA 4NPCA 4TTRA 3VQTA 2C7RA 4KRGA 1BJTA 1SKUA 2KI5A 1E69A 2NYUA 5F1YA 5KYKA 1CY6A 2GBLA 3P7MA 5EWMA 1I2AA 3VKFA 3ZKWA 1MGPA 2MJLA 5IM5A 4E5SA 2IH4A 2JHFA 1PLLA 3DEFA 2QVYX 4FI3F 5DYNA 4ZO4A 5F78A 4DWWA 5GTDA 4UUBA 1FLVA 3L8ZA 1FRQA 4C0HA 4CODB 1R3UA 1U3GA 5CT4A 5A1TA 4XFKA 5EWJA 2HV8A 1MZPA 2ISSD 2F4NA 1VLLA 2NQTA 4LC0A 1GUBA 3TMKA 3KQMA 4FU0A 5A2GA 2WR8A 2YBDA 5AI8A 3SIRA 3T34A 1P7WA 3GZNA 3WA7A 3CRMA 2I2XB 2P77A 1ZU4A 2IYOA 4AUMA 2NW6A 2RC6A 4P98A 3FPLA 4LRTB 4EQZA 3RYHA 3H97A 4B9EA 2IIBA 4DMRA 1XV5A 1AUQA 3G9QA 4PGFA 3C14C 5DFAA 1MRSA 3VU8A 3BH6A 4ANFA 1WXGA 2GJ8A 2FFAA 1AK1A 2CHGA 2OCGA 2P4QA 4HGRA 2CB0A 4IW3B 5H16A 3RODA 3FETA 3RSOA 3ZLBA 4CLHA 4CU2A 1ADCA 4XVRA 1EGQA 4N12A 3VR1A 3X44A 3ZDBA 3ZD7A 2X14A 1MIOB 1MP0A 5G3ZA 2CYAA 1WSBA 1GAWA 2E9SA 2JFFA 3GFVA 4QELA 4RTNA 1Z5VA 3I76A 1WG8A 3KYIB 3VHRA 4QZVA 1YT5A 1XZGA 1U1FA 1QGOA 3LO8A 1ZK2A 2FZ5A 4QHYA 1WPRA 1T9GR 1NMSA 3M4NA 3SS7X 4IS2A 3VKWA 2CF6A 4CF6A 4FFVA 5A4IS 3U4QA 4XYEA 1B42A 4RW0A 4BNLA 3G17A 3I09A 4YDHB 1ZMXA 2GXQA 3ISVA 3LCUA 4F46A 4LISA 2UZ1B 4R54A 3WK7A 2Z1DA 4QYTA 4GWGA 4L5AA 5IVPA 3I01A 2BYTA 2DFNA 2XAUA 3DAFA 4IHJA 3OOWA 2P5UA 4RGQA 4PZPA 4PC7A 1RQNA 3DBVO 2IS2A 3SFZA 4F91B 2FSGA 2PTGA 1SCJA 3R4VA 4C0LA 1LK7A 5AVUA 1Z88A 1N2JA 5EP2A 4EL5A 2GBIA 1VQ1A 2I1VB 2I4MA 4U6QA 3GLVA 3KJGA 2BJWA 2IDKA 3R6TA 4RD2A 5AUPB 4PVDA 3ZDEA 3O95A 4CM9D 3ZGYA 5DLYA 1D6JA 2AJLI 3GK3A 4GW3A 1GRCA 3PC6A 3GRZA 4IMPA 3AR5A 1IOLA 3FR8A 3VU3A 3RKRA 3P4UA 1A2QA 2FP4A 4TTQA 1Q5PA 2AJ8A 2ECKA 1VHWA 4ID3A 5MHTA 1J9EA 1SBCA 1WM1A 2XPCA 4J9VA 5DM70 1U0JA 2FZCA 4HXEB 3F78A 3T3GA 3LGSA 4FJ1A 1QNFA 3AI3A 4Y2VA 2CN1A 1SOMA 3HA2A 1DNPA 4O2BB 5TQJA 3I5MA 3WMWA 3D64A 1YS7A 1M5RA 1WZIA 4AXXA 2RJOA 4UHFA 3HCFA 3RRZA 1M0SA 3TR5A 3D1VA 2R4QA 4LPKA 2IF2A 2Q3JA 5B4VA 2YINC 3HJAA 5C1DA 2QROA 3ZXSA 1QQ7A 3HM9A 4YJ2B 1FNCA 5BWBA 2BH9A 2NVOA 5CA1F 1SVSA 4IFBA 3VTKA 1XMPA 1Z2PX 2EQBA 4O59O 3KPYA 3QX8A 1QGDA 5MFZA 1KZGB 2EL7A 2IODA 3IVGA 1ZKDA 1DRWA 2JIQA 3DLTA 3FJYA 3JZIA 4LTNA 5FTKA 1ULHA 3U1TA 3HDGA 2DE0X 1JGTA 1ZGJA 3U7QA 1WUIS 3PWKA 1FU7A 5SZHB 1KSHA 4REQA 5CK4A 3GHHA 3GRCA 4TZKA 5T7BA 1KPIA 3KUDA 4R01A 4DDHA 4XYMA 1IJFA 1T5BA 5ESDA 3U3DA 2DHEA 3NIGB 4A6DA 1FYFA 3IB3A 4IDEA 1JMKC 1PVDA 3UUEA 5E6RA 3GJYA 5I6DA 3DXZA 3WDKA 1R0ZA 1XXHE 5AUNB 1J6UA 1HYQA 1NJ2A 2WNIA 4KFCA 2XUKA 2CL0X 4L4YA 4RK1A 2CMFA 3A6ZA 4FFBA 3DV0B 3DONA 4MX8A 4HTAA 3Q7EA 5DM2A 2AZXA 1W5EA 4ESEA 4CT0A 2J08A 4X60A 2CDNA 2GZDA 3K0AB 4N6NA 2IZ7A 5CXSA 3K2EA 5AJUA 5TQ0A 1GLVA 1SCKA 2QSYA 3NC1C 4I55A 2ZUEA 4DV7B 3ADBA 2WHXA 4NZMA 2WKSA 5DHPA 4YJ3B 2QNRA 4MQMA 4QQFA 1ZEJA 3BMOB 4D8TA 2ANBA 2XUIA 2JLQA 4XI9A 3RI3A 1YTLA 2NO4A 3OUZA 1U1GA 1AQUA 2VFAA 2VJOA 2CF5A 3DTYA 6PFKA 3PRHA 3K72B 3VVLA 3UV7A 4NXMB 4LHEA 4H59A 4HTFB 1TIPA 4YO7A 1VRCA 1WCIB 2IYTA 2VZLA 3JTEA 2YZ7A 2CW5A 4EMTA 1S7CA 1NJGA 1YTUA 4QUHA 4EOGA 1DPGA 1XPUA 1P4HA 3D6HA 3LDGA 4HUQB 1XNRB 5K01A 4R83A 4I6GA 5ESRA 3L7BA 4Q15A 3V97A 1QH8A 1HF3A 5AP9A 3TNFA 4HJXA 1JZSA 1MO2A 4MQFB 4BKOA 3DFIA 3NVDA 3UYKA 2YWRA 4X1OA 1JT9A 4KI0A 1ZH8A 1UKEA 5CA0A 1WSDA 3EQ2A 1BO6A 4JYAB 3E61A 3CO0S 2KB0A 3VBEA 3E9QA 4GZ3A 2HMUA 4LC9A 4MYSA 3FMVA 5IN5A 2H7YA 2MR5A 2ZT6A 1FDWA 2JAPA 2I80A 4Y2YA 3QVGB 1KYYA 3DHVA 4RZXA 4V3BA 3ABIA 1O1YA 1NWCA 1V16B 2YIVX 5HK8A 4M0CA 2RI6A 1YRWA 2NSDA 3KT6A 3N05A 3PTAA 1DRKA 3PHJA 3Q0TA 3IS3A 4P0PB 1T2CA 1FVHA 4E12A 4J1QA 3AVYA 2OA0A 2XWPA 1UWCA 1LTQA 2I4OA 2ZIZA 1JDNA 1I30A 4JSRA 2ZITA 5JI3E 1U0SY 1GCIA 3CZMA 3G8AA 4LDRA 4UEWA 3GW8A 4DCCA 4HWGA 2J3LA 4K9QA 2GA8A 1GNTA 2R3SA 2CXRA 1K4YA 3OVMA 3H2GA 1RR6A 1YQQA 1ITZA 3CEHA 1I0ZA 1L3BA 3RHTA 1T8TA 1T1JA 3S6JA 1DE0A 1RLJA 3ITEA 4IO1A 3C3CA 3WKDA 1SKBA 2LR0A 3FTNA 1Q3TA 5TY0A 3VR5D 4D6XA 4EKEA 4JI8B 4HY3A 1FUYB 2H1IA 2YASA 3HV0A 4HN2A 1VLJA 5JDCA 5KPDA 2O7RA 5ALZA 1M5TA 2D06A 3ITNA 2IHKA 1OI7A 4GD3Q 1WXEA 2QTFA 2A5LA 4IXDA 3U4HA 4BNFA 3K0CA 5LD2C 3H8JA 3NYWA 2FUEA 1KORA 3GH3A 3VSEA 2Q45A 4MQUA 4NZZA 2J59A 1PUJA 4QNMA 2BTQA 1UBNA 4LRQA 4Q12A 3I2FA 1X77A 4BRZA 3VGJA 3WMXA 3DL2A 1B0UA 1NF9A 2XZOA 3MJSA 5A9TA 1MQAA 3QF4A 4RY0A 1EVYA 3O3MB 4AU1A 5FPKA 4IUDS 4EK9A 3ONFA 2J3DA 2OGWA 4FDAA 1H1LA 1L1QA 4F4JA 1NVKA 1E3IA 5EJIA 3KEGA 1P5RA 4UQOA 1OAAA 3WNCA 2Z5LA 4TT3D 2FRXA 3ESYA 4UMVA 1JLRA 2E87A 2FPIB 4PXAA 1VMKA 5E0KB 3SJUA 4L4UA 1LQTA 1X1QA 3M34A 4MVJI 3RO7A 2I3DA 4ZQIA 2V6IA 4B2LA 1O0BA 1JA1A 4NBNA 3UH0A 4WBNA 1EWTA 2I7DA 3ICWA 3GUZA 2QU7A 4FW8A 3HTXA 4MJ7A 1YC2A 3ULKA 2O59A 5CJ2A 1XZAA 2VQDA 1OBVA 1D9ZA 2FR8C 4KUGA 3CVWA 4LXQA 4XLTA 4J94A 1KYZA 4WA7A 5KAMA 4ZGBA 3D8SA 3RFUA 1CP2A 1X7GA 3BE4A 4N8EA 4KPEC 3IIMA 2WJ4A 1Y5IA 4TVBA 1EUCB 3AV3A 3NUGA 4AG5A 1XA4A 1ZZGA 2DPHA 3OUUA 5A9SA 1RWVA 5IM4F 3IVMA 2UDPA 2B83A 5BYKA 2GD1O 1TA9A 5D5QA 2I67A 4F96A 2BUCA 2WU8A 3LKBA 4HRYA 3VH1A 4BCCA 1OFHA 4CG2A 5G2OA 4D96A 4EEXA 4EJSC 5BWCA 1TMYA 3QF7A 1GP2A 1JXQA 1P5JA 1MX1A 4BEBA 3DMHA 3ZCRA 3O5AA 3E03A 2AQ8A 2DQSA 4OJYA 1GG5A 1EB8A 2QAGC 4NLLA 4M60A 3WKAA 4HX9A 3ROPA 1SU7A 2V45A 1W44A 2W11A 1EJ2A 1MC4A 1ZR4A 3M2PA 3NC0C 4O3FA 3DFKA 3LQQA 5DMHA 4PCUA 4OG2A 4QUAA 4ZANA 2HK8A 1JG6A 3G0CA 4FLFA 2EHDA 1LC3A 3FHCB 3AWIA 2O8EB 1JEAA 5HKLA 1EVEA 2VTKA 4Q3AA 4R7TA 3FOWA 2NUPA 4K9DA 4D81A 3VR4A 3E9EA 2Q0QA 2WAXA 5LP1A 3FYUB 3ES9A 4WLUA 3CZ5A 1T5IA 4NXNB 4IQ0A 1MTZA 3WLQA 3TI7A 3O91A 1G4AE 4Z7OB 4MARA 5LQMA 1YRYE 4AY2A 3HJTA 3KWFA 2CLIB 2HREA 2CK3D 2ZSJA 5E6SA 1ULTA 3PUVA 1Q1NA 4ML3A 2ZZNA 4DUZB 3O7WA 4C0KA 1P0IA 3AR4A 5AOVA 4ALKA 1KGSA 1M8PA 2O23A 1NWHA 1Q92A 1UQTA 2WJYA 4V2IA 4C0BA 1LPOA 1LWNA 3ESAA 3OG9A 4RVSA 3IJEB 3SHOA 2QV7A 4UHHA 2P2GA 3A1UA 3CX4A 2PSSA 4RMNA 5BOSA 2VWHA 3HSKA 3P2OA 3VZPA 2PYIA 4XVUA 3WFZA 2FSVC 5F73A 5KWIA 1C29B 1GL9B 1OYOA 4URZR 2WTMA 4UBMA 2G7ZA 2VK8A 3RVKA 2DG2A 2G88A 4YP7A 4TTJA 1MAVA 4LHYA 3FCYA 2IYNA 1P2TA 1A9QA 2MIIA 3KKZA 2XRMA 4J7CA 1SKMA 3C5HA 5JYCA 1U5AA 4U2KA 5EVCA 3QVWA 3R76A 3WWPA 4F4FA 2G9QA 1UZNA 3KPJA 4L5BA 1GGMA 4BFSA 4DIUA 5TX7A 3EXG2 4PNEA 3BMXA 3GO4A 3K70B 3MBIA 1ZAKA 3AY7A 3PQEA 4TSFA 4AJEA 2C2ZA 1Z17A 2I29A 4UCQA 4J4BA 2WW8A 3EUWA 3HFSA 5EJ8A 1N34B 1QOZA 4RHEA 3TR0A 3IEKA 2GPWA 4LHXA 3JVVA 1OGIA 3KU4A 4LJ5A 4JT8A 4XAQA 5H81A 4YYZA 3FNGA 3DL4A 4BL5A 2JLUA 5IH3A 2I6TA 3HVIA 5K2OA 1Z0UA 4UPDA 2VF5X 4WXMA 1O6GA 2GERA 2J5RA 1WWKA 2QW8A 2YHAA 3NTOA 4JQSA 1FB5A 1G2IA 4PLCA 3R09A 3EGEA 2CE2X 4W99A 3CF6R 2I4NA 4NK5A 5CNKA 4ZOLA 5JG7A 1UXJA 1CRWG 1OZAA 1U98A 1YDHA 3DBRA 3LUDA 4JITA 3CCFA 1OC2A 4WNAA 3O3NB 3DZJA 4JNKA 5AW9A 3RNOA 3TK1A 3ZBTA 5IDQA 2DXIA 2X8AA 1P5ZB 1ZCJA 4ZAGA 3EXIB 3SK0A 4Z3OA 3PJGA 4YAIA 3D3QA 5B64A 1NASA 1NVWQ 1FFDA 2ZTLA 5TPZA 4Q1AA 2OMEA 2Q4BA 1VIYA 1HRKA 3LVQE 4F71A 1E2UA 2QR2A 2GTPA 2Q6IA 1L8QA 3MGKA 1GPWB 4TV9A 4ZP1A 1K27A 3V33A 4C2BA 4F8YA 5SZIA 3HLTA 4RF4A 3A1TA 3T4XA 3UJHA 4AURA 5CLJA 1UK9A 5COAA 3UMMA 4JQYA 2FX3A 2RE8A 1VKJA 4M1WA 5DTMA 3RLIA 4PU0A 3ENVA 4JEMA 1NRIA 2OQ2A 4R84A 1O77A 1EVQA 2JVIA 3GJ5A 2TRSB 3OJFA 4XQCA 1QQBA 5TC4A 2EKLA 1E0KA 1XRMA 4XWOA 1K7CA 3DLPX 1ZSYA 1DG1G 4WJLA 3FUCA 1AK2A 7GPBA 4FCVA 5ETJA 2RJNA 5EJ6A 3CH4B 2IY7A 2IBMA 3JQPA 2DRIA 3CC8A 4FCCA 4NE9A 3MYRA 4NCXA 4ZKEA 3WLSA 4B3RB 1DJNA 1I6KA 3G2MA 1QU3A 1Z29A 1PT5A 3H04A 1JHQA 3IJRA 1L3IA 3IE2A 3PQCA 2EJWA 2X0IA 4HP8A 3SX4A 4BLPA 2QLBA 3FFAA 1W4BA 3E3OA 1XTBA 1G60A 1OBHA 2OV1A 3N0VA 5E4TA 2HF9A 4MI1A 4C1BA 3WWEA 4NBLA 3HN7A 5A2QA 4C4AA 2VHQA 2X7XA 4UVHA 3P9NA 3TW8A 5C8YF 2NXJA 4C3ZA 1P33A 2OFFA 3V4VB 1TIBA 5JXWA 4GSKA 2FKAA 1I10A 2B8EA 4B5LA 5FNVF 1RXUA 5DXAA 5GGXA 2BPOA 1RWOA 3S5JA 5IVHA 4A9AA 4Q4HA 2DUWA 5BSGA 2B36A 3N8IA 3NTQA 3RU3A 5J4YA 1A9PA 5I5GA 1G18A 2FUCA 2QT9A 3AF0A 5HW0A 1DOZA 1RWQA 2BZSA 3EZGA 3GAAA 1XROA 3T1VA 4H1TA 1KJIA 2DOKA 1TW2A 2GAJA 2AA3A 3H5RA 4H4DA 4X9XA 3CH5A 4UBLA 4CMIB 2R8ZA 2EFEB 1RBYA 2R5WA 1TPZA 2VH5R 4RFSB 5JS8A 4F04A 1SEPA 2WHPB 1RCTE 4G9GA 3RJZA 2BE9A 4XM1A 4L27A 2IX9A 4XRGA 1JSCA 2GFHA 2VP3A 2X5NA 3I8XA 3GT0A 4NWIA 5TRTA 5HM8A 1ZJ6A 2B3DA 4OJMX 4TLDA 4UXJA 2NO5A 3INRA 1PZMA 2VS1A 1Z6PA 4O5AA 3N0WA 4B34A 2RT5A 2CVZA 5B3KA 1MN6A 3G0GA 3NM6B 3WX0A 3O75A 3EIUA 2E1PA 3AEUB 1LI7A 1P19A 3HBLA 1DKOA 2NPOA 1B73A 4D4IA 5FHQA 4JVOA 3GUCA 1U1CA 4PZ0A 4C76A 1R7RA 2CLHB 3BFJA 3ZIDA 3GL9A 4JFAA 1YONA 4QGAA 4YQYA 4DA8A 1NI5A 4KQWA 4F3YA 3H6GA 2FSSA 4KQGA 4PYRA 5JHGB 4FWTA 2YN2A 3KHUA 1NVTA 1XVUA 3VTAA 1RKUA 1G9TA 1B6GA 3B48A 4G1BA 1NDUA 4EG8A 2HCFA 4MGYR 3X1JA 4Q66C 3M8KA 4U7FA 2MSLA 4CNQA 2GS9A 4MKZA 1KEUA 1I1HA 3D3WA 2J41A 3F90A 1W8IA 1Q20A 2H7CA 3PL1A 1RYNA 3R5SA 4N01A 3RSHA 3KC2A 4XRRA 2OLEA 4QKQA 3B38A 4B44A 4CKYA 1D4OA 1JS1X 1MABB 5E7IA 4GX0A 1BGXT 1QE0A 1A7KA 1WR8A 5CLQA 3ZWDA 5TJHA 1MVNA 1KOLA 2R7NA 3RVLA 2WABA 2YZKA 4QG7A 4DCJA 1JKXA 4DWOA 4EB3A 3LP6A 3VKGA 1YMVA 1ND5A 3C41J 4TMVA 2C54A 1UM8A 2J5BA 1G8SA 5JS6A 3H19A 3M33A 2ZYSA 3DMGA 5HF5A 3JYQA 5CH3A 3O83A 1RC8A 4NOJA 4II7A 4Z8YA 2J6BA 3GHYA 3SVLA 3TZBA 4IX1A 5ES3A 2ODNA 3SYKA 1PGJA 4INJA 4DLPA 2WTBA 2W2TA 3IJ5A 1E4YA 4FDVA 2BKVA 1EP3B 1Z0KA 3A8TA 4I0WB 1FQOA 3KWJA 4F4HA 1KEVA 2UYCA 1OE0A 2HB6A 4L0QA 4NNOA 4Q37A 3LTNC 2JI8A 4RSHA 5HVNA 2IEZA 2OLKA 1K75A 4H60A 4MYTA 3P71T 4FFDA 4RAOA 3GLTA 3O1LA 4KO8A 4YIKA 4Z0PA 4TTPA 1EDOA 4IVRA 4KRFA 1QFZA 3C97A 1KEEB 4EPXA 2QE7A 4F6RB 2EX1A 4JL8A 1J0XO 2FQWA 3DV0A 5EJ9A 5IT9A 3L40A 3UT0A 3CM0A 1QQAA 4L1KA 1U6KA 3UPUA 1ZXLA 3IKVA 3GPIA 1LS6A 1P3JA 1S3FA 2DFPA 4AT1A 4R51A 3DWIA 5E6SB 4BVBA 3MMZA 3PUJA 2ZBRA 2Z8XA 3AU8A 3HFJA 2R62A 5DSXA 1LLUA 3M1IA 3F1KA 3MWDB 1C0EA 1TEXA 1NUTA 4N5IX 1TEHA 2FDCA 1V7CA 2BBWA 1RVV1 1K63A 1UPXA 3PBKA 3PEYA 3WRYA 4BEWA 3I4LA 5E1BA 1ZONA 3NV7A 4R9VA 3W6NA 1JXOA 2Z43A 4LOIA 3QZUA 3QQPA 4KMRA 4C7OA 4E33A 1QF9A 3D8RA 3GAMA 3K0HA 4DTCA 3FTFA 3OZSA 3CY6A 5CT9A 2HDHA 2NYAA 2RH8A 3HI6A 3MVEA 4N3BA 3NR2A 3RJ5A 3EPKA 1EDZA 1OXMA 3NHMA 2NIPA 4DJFC 3GJ8A 1KJQA 3GFGA 3LLUA 3W8FA 4LDJA 3LD9A 4ZYUA 1LSUA 1NONA 1P31A 1ZGZA 2MMCA 2VOJA 3I58A 1J00A 3W05A 1O7JA 1IVYA 3LBYA 3PTLA 3C5VA 1ZESA 2DTDA 2J85A 1ZMBA 4LE2A 2WPDD 1B14A 1J39A 1FJ2A 1QDUA 1ULAA 2JGRA 1LX6A 2HQOA 4K9MA 5EHGA 4C4TA 4A2CA 2HW8A 3LC0A 5J9FA 1FU4A 3I4CA 1LC0A 3WGHA 1VOTA 1JJVA 1RD4A 2GDZA 1BXRA 4IDOA 3IESA 5D3ZA 5FYDA 2OP0A 1PEDA 4U5XA 1P2GA 2BBOA 5D3QA 1OFUA 1W96A 3NI2A 4DQ0A 1X42A 2YWGA 1JMYA 2P9CA 3GAZA 5EOVA 4ZK2A 1A9XB 3MQFA 3DKIA 1AH2A 2ZJ8A 3OZUA 2PUTA 3ZYZA 4B7ZA 3UT5B 3D43A 3GBVA 1UBGA 2CCGA 3VR6D 4J0QA 2OENG 4DIDA 1J8VA 1V7PC 4L08A 4F0JA 1J1UA 3PEVA 5AR1A 2Y67A 5TB5A 4DC1A 1C9NA 1L5ZA 5IUJC 3D6FA 4BMNA 4GRDA 1XTKA 3IBSA 3RARA 3FLMA 1UAAA 2WYUA 1TLFA 1PJ2A 4G84A 1J21A 1ZEMA 2OECA 2QQ5A 5IKOA 4PRYA 3GOHA 2EFHB 3N59A 1EK1A 1USVA 1UOPA 1OH6A 1G5TA 1T3SA 2C7GA 5KYWB 1EHIA 3OICA 1JB9A 1HEYA 3D7MA 2ZE7A 4N8SA 4YV2A 4X7BA 2VYVD 4UM5A 4BFUA 2O57A 2FGJA 5K8CA 3LBNA 4QJ5A 2QIPA 1I3NA 4Q3KA 1C7IA 4RQAA 2BC9A 2ZI7A 4C0QC 3KSBC 3O9MA 4PEVA 1H2BA 4AMBA 1EWQA 1QX4A 1A9XA 3LO5A 4DR7B 3UAXA 2VUIB 3OPXA 4C7XA 2FZWA 4B48A 4UNNA 4FMDB 2GVZC 1FCJA 1MB4A 2FQYA 1PZEA 1QGYA 4Q9HA 4W7SA 2F8TA 1L4HA 1F6DA 3QKUA 2O2ZA 2G09A 1J8DA 3W7AA 2P2CA 4A23A 4V0SA 2JFNA 3C7CB 3DVQX 3K1TA 5HTKA 3SXUB 5ERXA 1QTNA 1JALA 5CR9A 3DD5A 3UQYS 3Q9LA 1YS6A 4G8CA 2PGAA 5DK4A 1E2MA 4KR6A 1T1RA 2GR9A 3G2NA 3CB2A 4QYMA 4ALNA 1WZNA 3TQIA 1HPLA 3BB4A 4PCAA 5ALKA 2IQ5A 1J33A 1XKTA 1UEIA 1PJSA 1TYZA 1UJ4A 2Y71A 1VP9A 3GROA 3OCCA 3S4YA 4LMBA 2ACVA 1M76A 3UHAA 3ZUPA 1E5XA 5L4SA 4YP0A 3Q40A 2VYQA 4AJIA 2BDUA 3MUFA 4OHXA 5I45A 5IN4A 1YFJA 2AK3A 3INGA 3OEEA 4UBJA 4EZEA 2DWOA 2IYLD 1HA3A 2V7WA 4L02A 3T61A 1RAFA 5HIMA 5I4IA 1DQNA 2XCLA 2ZETA 4HH0A 2ZJ1A 5BT9A 2Y4NA 2PMWB 3BMCA 3LIIA 2AW3A 2QQ0A 5CBKA 1GPBA 3H5LA 4Y1RB 3EDYA 4HDSA 2XJ9A 3M1LA 3DNFA 4BFZA 4ROSA 2IYAA 2XT6A 2QY9A 2XOXA 3JD1A 3E5MA 4U2FA 4WCFB 5KQPA 1U2DA 5FI1B 3X1KA 2ID7A 1OFUX 3EZ9A 3H8SA 5ABPA 1DL5A 2W70A 4J2TA 1K92A 4O2AF 4D3ZA 1UBFA 1K6MA 2GEKA 2IGTA 1F6BA 1C2YA 4JI3B 3S2YA 1CZKA 5A9RA 3T1TA 1K86A 2R1UA 2C97A 4OHVA 4FR2A 1X7ZA 4P7BA 3TEJA 1OH7A 2VH1A 1V26A 2AD1A 3PFNA 4DW8A 4H9GA 2IXBA 3QEBZ 4N1AA 3VNAA 5BNFA 1D09A 3ANNA 2C5FA 2X0KA 3G7SA 3O9ZA 1V8BA 4EG5A 5ES4B 4B3BA 1LI4A 3B6EA 1YBFA 3PC7A 3HKDB 1FUUA 3ZWQA 3B3GA 2FMXA 2AI2A 2I4TA 3G0BA 3LE8A 3EPRA 2F4VB 1S2IA 3HV2A 4ZVPA 3JASA 1IUNA 1JSLA 3BK7A 3QVMA 1JSZA 2B78A 1EGMB 1MENA 2A5GA 2X6TA 4IDBA 1WD7A 4WOBA 1KU0A 2QN3A 3HO1A 4OEHA 2J9XB 5FOSA 1MQ9A 2O19A 1ACLA 4YMSA 5C37A 2R6CA 3BSYA 4KVZA 1CPYA 2GK7A 3D59A 3QXSA 4DBLE 1TK3A 4I9HA 5H3HA 3C8HA 3IBCA 1E2GA 3NX4A 4URHA 4BYGA 1U9IC 1RQ7A 4QAQA 1GZHB 2ECOA 3E9YA 3PNVA 5C3UA 1OJ7A 2H1WA 3VOBA 1I36A 3KV1A 3ZU2A 4Z1MD 1NR1A 2C3PA 3GJQA 4I4LA 4QRDA 4PBTA 4TRRA 4OFWA 1KERA 4WXYB 2WKRA 5ILOA 4MR8B 1UDWA 5JZMA 1DKNA 2VDMB 3ONDA 4E5PA 1CJVC 2QD5A 1LJLA 3DOOA 2ZSKA 3WG9A 1QH1B 2QTWB 2XWJI 3ZE6A 1P2UA 1RE1A 2QGZA 4FGJA 4HQ6A 2ODEA 2EZTA 1CUDA 3WIOA 3FSRA 1NUPA 2J09A 4LMPA 2DUMA 3A1FA 5C4MA 4X90A 4WK2B 2FN7A 3MM4A 3OO0A 2E7ZA 5A6SA 4M0KA 5AW5A 3ETLA 4O2RA 1ZC3A 3E7DA 5FA6A 3WOHA 1L5MA 4CEIA 4M8LA 2HU7A 4BBAA 2VYFA 2AXNA 3HCEA 4NU6A 2ZYVX 4MR9B 2ET6A 4X84A 4YLEA 4EYQA 4R81A 4RLSA 3HMKA 2FK8A 1KK3A 1QF7A 1U8TA 2WJGA 2WG0A 4KH0A 2UUBB 3QOXA 3V80A 5BRNA 2DQ4A 3BMNB 3G89A 4WACA 1T10A 3BXEA 3V7NA 2KX7A 3R6GA 1UJBA 2HM7A 1NW3A 5BW6B 1ATZA 3S29A 4MS4A 3TVYA 2UZ4A 1ST2A 1A7AA 2DCUA 4CKBA 1GY8A 1K6JA 2PMCA 3NBUA 4S0XA 1GPAA 3DMFA 3MWLA 4CMIA 1U8UA 5F2NA 4BZXA 3VYTB 5ICCA 4EFMA 4KQEA 4I3FA 2IPOA 1I7DA 4KXWA 2LE0A 1D2RA 2Q9UA 4K6GA 1S8NA 1DU4A 1MXHA 1NPYA 3CPEA 4C04A 2GZSA 4GVXA 1YJQA 2ISCA 3MGAA 3GGPA 3N7UA 3QNWA 1V47A 1MC5A 3QVUA 3COPA 1S2NA 4KIJA 2NACA 1J5PA 4J6FA 4YWHA 1WDLA 2GAIA 2BEWB 1BDMA 1P7YA 1ZH0A 1KA9H 4IQ8A 1VL8A 4ZI5A 2PL1A 3GQVA 1N0IA 3WB0A 1Y8QA 2ODTX 1EP1B 1V8DA 2YFQA 5CB8A 2DT5A 3HDTA 3DHYA 2FWBA 4IUBS 4PX5A 1EE1A 5DBIA 1GM5A 2QYSA 1I9GA 4ND3A 3A70A 5HJ5A 1QLWA 3HN6A 3FLAA 3DL7A 2QYTA 1KAQA 1V11A 3LSTA 4EJSA 4ZAFA 3D4PA 4UUAA 4GLBA 3KKLA 1JJIA 4JB2A 1GYQA 1C7QA 1E6KA 2EBFX 2FFBA 5FLYA 1J0DA 2WV7A 4I55F 3VMMA 1S4MA 3C87A 4PCVA 3QXXA 3EXHA 4UE6A 5K4HA 2QKYA 4J1SA 2GBFA 4XPZA 1WXQA 5E2BA 4PRLA 4CCYB 1NW9B 3ON5A 1EFDN 4BO9A 3DPUA 2FW9A 2PAFA 2H1FA 1KIFA 3MCWA 4RHYA 3V55A 1Y48E 5ED4A 3F6BX 4EUKA 2ORWA 1Y9JA 4QDZA 1QK5A 2QF7A 2CDCA 2NAFA 2A1UB 5GOZA 1D2EA 3ZWWA 2V6MA 5LB2A 2P67A 3M6AA 4H1WA 1TVKA 4CM5A 1H85A 2JBHA 4WBSA 3RG2A 2XY4A 3QV1A 1L8AA 4ZT5A 5JNLA 1R0KA 1TT7A 4QX6A 1EXWA 3K8ZA 2R8YA 3NKFA 5C5EA 2PG3A 3HS3A 4V1CI 1DDOA 1VPVA 1KS2A 1POWA 1OZGA 2O2SA 3QPDA 4EW6A 3JX9A 5IAKA 3HJHA 1G17A 4ZAYA 3OBIA 5JSUA 1V0JA 3O1HB 2QVXX 1DFIA 2O8FA 1J56A 4WOPA 3QE9Y 1DC7A 1NVBA 2HADA 3HBNA 4I66A 4U7WA 4R1LA 2B92A 4RA9B 3UMBA 3VMFA 4D9JA 3FFXA 2XZLA 3BMQA 4IIXA 2C83A 4BUCA 721PA 3FNEA 3NT5A 4KO3S 2NVWA 3E0XA 4DC9A 1T5OA 2DH6A 4OH1A 1W2WB 2ZR7A 3B6JA 2ZJ4A 4ZO7A 3SYTA 2B69A 1PZNA 3A6EA 4MRSA 2LP4Y 2MSEB 3FKJA 4RM3A 5E2IA 5IBQA 3NBQA 1KBQA 1YUNA 5BVHB 1J42A 2JFWA 4JU9A 1YE8A 1IHUA 1TM2A 3GLGA 1QGZA 4B6PA 4CQJA 4FHEA 1IEVA 4XX0B 2DU8A 1X9IA 1XZPA 2F9FA 3KZMA 3MQ2A 5FL3A 3ZE9A 5BSHA 5C7LO 4P35A 3M1AA 5KPJA 3J81A 2FEAA 4L28A 3UJBA 2J33A 1Y6GA 1J07A 3QYPA 3YASA 3ZHUA 3SF8A 4YT2A 1JP7A 4NBKA 1ZD1A 2F59A 2AC4A 4M7WA 4EELA 1XHFA 3AVOA 3RJTA 4MGIR 1WX1A 1ZIXA 3KR9A 5IVDA 3O8OA 1P7ZA 4R40A 2Y93A 4YI3A 4L8VA 1FMFA 2WDPA 3K5WA 3BVPA 4RIIA 3ZJYA 2ZXEA 1KEEA 1XQ6A 1NG1A 1N2CE 2W6ZA 3SSMA 5CH8A 1YWGO 2IKSA 2AXPA 4ZDWA 5C31A 5DW0A 4CKCB 4L51A 4UW9A 1COZA 1YFZA 3ECAA 4QU5A 1PR0A 4UHJA 3P0JA 4OI0A 3HYSA 1TJ3A 5AOBA 1T2VA 5EXTA 5LNK1 4ATNA 1KO4A 3JSAA 1PJRA 5M2QA 4X1IB 2ALJA 5FO0A 2EZ8A 3FTDA 3WYFA 1UOEA 1RTKA 3K5HA 4HOYA 3Q3JB 4LY9A 5AXBA 1VI2A 2WUGA 1PV1A 5HF9A 3L77A 1WF3A 1REQA 4PVCA 4OATA 1T1GA 3AL3A 4J0IA 1EFAA 3M3PA 2ONJA 4JIMA 2SKCA 4GZ6A 1ZN7A 3NHLA 4PIPA 1J23A 2FPSA 2W37A 5ALDA 5JR3A 4QQKA 3A7DA 5DHSA 2YV3A 3V34A 4RZUA 2I2WA 4DSAA 4L8WB 1SAYA 2OC9A 3DDWA 1TK9A 2EG9A 2QLJA 3LX4A 1NM5C 4R68A 1XJ0A 2FTKE 1W9MA 5I7HA 4LZLA 1E1DA 3OIGA 5L8VA 2OT3B 3QXHA 3RLFA 3R7FA 4BRUA 4I1VA 3WLLA 2YJNA 5KNCH 2WE7A 3K0FA 5FFNA 2DPXA 2GD2A 1NE7A 3EDQA 4DR4B 1CEYA 3OEHA 2YOHA 4M7PA 1MW9X 2XCRB 3I61A 4CMEA 2QNIA 1G21B 1NI4A 2GPAA 1MT3A 1C1XA 3LWNA 3ZK8A 4BLQA 1X2EA 3VR4D 2GDJA 3R0QA 4O5OA 5AJHA 5ARCA 1V37A 2OVBA 1NQVA 1T5LA 2ZYDA 4JL5A 1CY4A 4Q4LA 4ZCQA 2CLLB 4IJKA 1AA9A 2JW5A 5G4KB 3SBDA 4YPVA 4V0QA 4D3YA 5GONF 3WWDA 5G0VA 4MQLA 3EXEB 2OBBA 1IDN1 1KJ8A 4GZ5A 4E2WA 4Y9DA 5B58C 1HYEA 3KUUA 1YDMA 4KUHA 3A6LA 1F8UA 4IV8A 4HNRA 4RPKA 1TE2A 3NNNA 1A69A 4MICA 4NCAA 5E0OA 4WPGA 5CYFA 3CR8A 3GIWA 1FFEA 1QG2A 1MJ5A 3GMDA 5JSZA 1JLLB 1MO4A 1FDRA 1XHEA 4GMHA 1EE2A 2WD8A 3ZVRA 1D2HA 5JFOA 1ZBDA 1ZOPA 3W2EA 2KJQA 1Z4KA 4NYJQ 1CEEA 2QVCA 4NZYA 2Y1CA 2J9ZB 2CSUA 2Q0XA 2XWSA 1XZCA 3NBKA 4E5DA 1TTHA 1XR3A 3RC2A 3VH2A 2XE8A 3LUPA 2PD6A 3EZFA 4NQZA 3GRPA 2HZ7A 1JAZA 2HSZA 2QUJA 3WLHA 3ZWAA 4DAEA 3IEMA 2ZPTX 3EGVA 4DJ5X 5HSGA 3BREA 5LQUA 1HDOA 5IDYA 2GTIA 4UUOA 4ZU3A 1HQDA 4PRZA 5EVJA 2IBTA 1JNXX 5C2JB 3LOUA 4MLZA 2CBZA 3F71A 4KBFA 2NUBA 1TF5A 2PA3A 3AHCA 3IRVA 5BW8A 1O57A 1JFVA 1GA1A 4CN8A 3KZOA 1YSCA 3NBZC 3NC4A 1YR6A 2BL4A 5BP7A 3BN3A 1XEWX 1J2RA 1E3WB 4C29A 1WBBA 2Y1KA 3MJ4A 4XR4A 3NM4A 2ZT7A 1RJDA 3ZCVA 4D98A 2QR5A 4UCXA 3SC6A 4A8JB 4TYNA 4RDCA 1X13A 2R1VA 2JCVA 4IDFA 4LV6A 1EFLA 3OWXA 1T1SA 4M88A 1DJLA 4OHKA 5BURA 4E5NA 4AIRA 1GPNA 4XTRA 1KI6B 3FBWA 1JFFA 2QN2A 4A27A 3PUYA 3LH5A 5GJCA 3OECA 3H99A 1NXTA 2DR0A 1U0LA 3GV0A 2LXNA 3WAJA 2W22A 3K4PA 4BNVA 5CFQA 3NWPA 5KMGB 1XMXA 2Z4SA 2C78A 5A6SB 4MUJA 5AHRA 3P94A 3ZNOA 4BVHA 3JD2A 4UD2A 5HZGA 1XCOA 1VGVA 3BH0A 5CDUA 1L4MA 2GBPA 4B7XA 3I04M 1I94B 5KKNB 1FFCA 1D2MA 2MYPA 3PE4A 4PHTA 2DM6A 3THRA 2B5OA 2XB8A 1WUKS 2RGWA 3W9BA 1KOGA 1Y89A 2O7NA 3GQBA 3RK1A 1C50A 1GQYA 1D2NA 4EUFA 1H2FA 3KLMX 1T9CA 3N1UA 2OHIA 4IWNA 3H9GA 4HS9A 4UZFA 5TGTA 2JS7A 2P0EA 3KJZA 2OPBA 3Q2IA 5K03A 4BFCA 1XAJA 4BX9A 3NTVA 2QAIA 3BC1A 1QRDA 2CLDX 5AJVB 4O3MA 3JATA 5KQLA 2I7CA 1PK7A 1XZJA 3AEYA 3DZKA 4H2DA 2NG1A 2I7VA 5DT9A 4ENQA 1ZH6A 1Q0ZA 2EWVA 3NFYA 2I3BA 3KT3A 4H35A 1GKUB 1E8NA 1F3LA 2VHTA 1F2TA 2ZCJA 2JH8A 3VVMA 3BCUA 3CRZA 4CV1A 5ISMA 2IHUA 2P27A 2ZWMA 1K7EB 4WCDA 1O8BA 4WW0A 3A6JA 1RXYA 4EYSA 2PX4A 1WKBA 4YC7A 1SA0B 3PJEA 1NUAA 2C2OA 5EXPA 1C0PA 2A94A 1ZAYA 1T8SA 3HWRA 3IIKA 4LXGA 4MP3A 4N6GA 3U19A 4QAJA 4C6HA 3P0EA 2J3QA 4GXRA 4XASA 2XKBA 3PIDA 4YBRA 2IL1A 4MINA 5I7OA 4M0FA 5F21A 4ERNA 3ZGNA 4B0OA 1NR7A 4C2AA 3VAYA 3AVWA 2COEA 3ROXA 4WZAE 5HZMA 1YZNA 2GO7A 2OGZA 2F6RA 2OZLB 3BWCA 1C7EA 2H65A 4B74A 3QVVA 4QT0A 3COWA 4IYRA 5EXSA 1W36C 3IMKA 1QONA 4KX3A 1MU0A 4UOQA 3RUFA 3B1JA 3BG5A 4UOEA 1A2KC 1WABA 1P9RA 2PANA 3D3NA 3FN4A 4JYBA 5H7XA 1UKAA 3T9DA 4I1YA 1ZMOA 1NURA 2ZBGA 4XGIA 2NU9A 3P5BA 2Z5FA 1BKDR 1SNYA 3Q8WA 5CA1B 2FW8A 2RGGA 3ELDA 3SR0A 4YONB 1W88B 1XK6A 1DCKA 2ZBVA 2AGVA 3RVPA 1KYQA 3OT5A 1Y63A 3G1TA 4NX2A 2IX3A 4ESOA 3LIPA 1WZCA 1MB9A 2VLBA 1ADFA 2O7SA 3MELA 3OM1A 1Y8QB 3OQJA 3TQQA 5TF4A 4D56A 3UCFA 4J4HA 1FSGA 3SF8B 4OCZA 1QUFA 2FDRA 3FYUA 3GCZA 2AKYA 1WXFA 1E6WA 2VPZA 2E85A 1B6RA 4IMIB 5AM4A 4YMHA 1QHIA 1GNQA 2Z4RA 4RH1A 5T8KC 3QSGA 1GNVA 4ZCPA 1V39A 2R6AA 4RHTA 1DXYA 3GJ0A 1O58A 1XO1A 3P9KA 3TTUA 4EKGA 4KI7A 5BVHA 1OQAA 3K9HA 4IDNA 3MLAA 3WNDA 2IPNA 1LSSA 2WG1A 3Q8LA 3PTZA 3DDSA 1H4SA 2RAVA 2JFQA 3HWSA 1IYZA 5D85A 5EP1A 2BFCA 3WSVA 4BNXA 4GKVA 1NJ8A 4EUNA 1CUFA 4Z51A 4F9FA 3RVQA 5LZ2A 1QFJA 3PFGA 1CZOA 3ZXUB 1ZVVA 5IH7A 1YGYA 1B8PA 1ECPA 1P61B 1Z0FA 1R5NA 4Z4HA 3QE3A 1XRLA 3AZPA 1QP4A 4X44A 1BD4A 5K3DA 4S1NA 2NTNA 5SY4A 2WTUA 1L8XA 4E5KA 2FPRA 4YX9A 4UEOA 1KE1A 1SIOA 1XF1A 4OXKA 4R5MA 4EKYA 4IVPA 1KDPA 1OHHA 1YJBA 3D0KA 1RMTA 3IKJA 3HA3A 1CD5A 5EP3A 3L6DA 3PEWA 3FPJA 3ZWXA 3CF2A 1HDGO 2Y1LA 4GVLA 1V95A 1JKFA 2OWDA 4BXOB 1JV2B 2NAPA 3UG6A 1UXOA 3FKSD 4WZZA 4B6GA 3S8YA 4C6TB 1RQGA 1XAGA 2C5SA 4POAA 2BEUB 4O2LA 4B7AA 2NP7A 4MS1B 1Z8NA 2FSPA 2Y27A 3EA4A 3CW9A 3V1LA 1YFLA 4KPYA 2PUVA 1GGKA 4TLBA 2FN8A 1PS0A 4WEQA 3ZCSA 2QD4A 3F6RA 4DLXA 2V0CA 1QIFA 2F1JA 4PO3X 1CTQA 3WYEA 4BWGA 3BTUA 1H0KA 3DMYA 4HXFB 4P53A 3D6MA 3FVRA 5BWNA 3DS8A 2XB2A 2W2OA 1E0SA 3V8BA 3DEHA 3PI7A 3SX2A 4D6PA 3ROMA 8OHMA 1I3KA 4PN3A 1OLXB 5D2CA 4BYMA 2Z9BA 2O1XA 3BXFA 2KLHA 4D8UA 2VWGA 2EV9A 1NT4A 4CHTA 5DCYA 1N2CB 3GA5A 2VQFB 2VF2A 1W48A 1SBZA 2PGXA 1B74A 4UAJA 5CDSA 4B7CA 1JG4A 3RVMA 2K5UA 5J4KA 3TD6A 4C2TA 1AMUA 1AHIA 1W4LA 1XEFA 1YDEA 4AKGA 4GX5A 4UUPA 1QAOA 2ZM6B 3BHMA 4DARA 2XOKA 3CJRA 3DZBA 3H9CA 2YL2A 5JFGA 5J40A 3I6YA 2CFSA 2LWIA 4RV5A 1TRHA 3SDZA 1G8KA 1MA0A 3ABSB 3DDUA 5KSOA 1Y1KE 1UDRA 1NXSA 3ANLA 4QDJA 2J9FA 4C30A 3LUHA 3I6IA 3GCWA 1NMQA 2YN4A 4MITA 2WF8A 2XUQA 1PP4A 3EOZA 1G3QA 3HCPA 3PB3A 3P9RA 2XUHA 2OCDA 4JDUA 1JZTA 1UJ2A 4K3UA 4WKGA 4HB3A 1U2SA 4M76B 4YP6A 1Z3CA 4ZYYA 4WVLA 4LYJA 1EX1A 4D82A 3LDHA 4HNUA 4HAWA 2NXWA 3QHPA 1S2OA 1X3SA 3F5FA 4BNTA 1UODA 1YZ3A 3ETGA 1NXOA 3IKTA 3DT8A 4N5LA 1JHAA 4BZPA 1KVSA 3LHKA 1PS8A 3HJRA 1PTKA 5DU2A 2HJHA 1JJFA 1V2HE 3FDZA 4DY4A 5BPFA 4FZVA 4RU1A 3O8RA 2RHOA 1CUSA 4DRYA 1YVUA 3LBAA 3QTLA 2ZPAA 1EK5A 2UXBB 5SYNA 1NY5A 2EFDB 2QPOA 3DEZA 1XFAA 4HZIA 4ZOAA 3IJPA 1QCCA 2Q2OA 1WVIA 2VQ6A 2PWBA 4JXJA 3BWEA 4Q7JB 1O3YA 3LF1A 4DDWA 1YS4A 4ZI7A 5AKXA 2J3EA 5LQDA 1JYEA 1VC2A 2HLPA 2XMCA 5DHQA 5L6MB 3VZDA 4JMPA 4M8SA 5JE8A 3IUSA 1QH1A 3MB8A 5JVDA 3HFGA 4ZQFA 5T6MA 2Y1XA 5IKEA 2ZAMA 4OXIA 3UTCA 2Y99A 1JQ3A 2WI8A 3BTVA 4WHMA 1Z2AA 1R10A 1M1YE 5AD1A 4RWEA 2PRZA 4YT4A 2JLAA 1W87A 3LUBA 1ARZA 4Z9FA 3QKRB 3KJXA 5IS2A 1BRMA 1DO8A 1X1CA 3JAKB 4FLMA 2VHUA 5F51A 2HHHB 1PR6A 3OPQA 4A1OA 2G76A 1Z28A 1ZJWA 1RYYA 3JQDA 2ZCVA 4JJIA 3FMGA 5ITVA 4MQEA 1VTKA 4GFDA 1VBKA 4XE5A 3UOGA 4PZUA 4TSRA 5KJCA 3QXJA 4TRMA 3TQRA 3OETA 4JLUA 3KLNA 1EFUA 2YCBA 3OC0A 4BO2A 4EGQA 1Y4AE 4ZYZA 5LXTA 1YI8A 3VKUA 4P7GA 5CT5A 3AHGA 2GJKA 5CVJA 3IQXA 2QT0A 2QM3A 3EIHA 4WGGA 4IILA 2VPQA 2EL9A 4O29A 1B41A 1QF6A 1S9HA 1JUDA 2L69A 2DWCA 1ZA2A 3JVUA 1Q1BA 2XZTA 5AQEA 2DHRA 3L6OO 5JSQA 4NOLA 3IE0A 3HB0A 2IYYA 1V71A 3H0EA 3IAXA 8ADHA 1ODJA 5BSFA 1UFRA 2GGSA 3K70C 5CGQB 1R6BX 4RGYA 2WJ6A 1OLXA 1XZHA 4AG6A 2P62A 4RCYA 1U0GA 3AF6A 4FK8A 3ST7A 2LZ0A 4QOEA 2Z2ZA 2BJVA 4XJVA 2X0EA 3Q1LA 3ZHXA 4PW0A 2VNJA 4JJ8A 4E2FA 5DOVA 3GFPA 1TJ4A 4WCFA 4G26A 1LPSA 1NW4A 2QVGA 4S0ZA 5EJMA 3BE8A 4WFJA 3RYFA 5IXSA 1AHPA 2UYHA 3FOEC 5M3BA 2MYNA 3HM2A 3RE1A 3DF7A 3DE7X 1W76A 2I6SA 2W9XA 1HETA 4FUQA 5DJ5A 2I2BA 5JYEA 3DHNA 3JR3A 5AVTA 4JLMA 1L5FA 4PYKA 4UM8B 3SEFA 4LWQA 3ETDA 5EGSA 5B37A 4FYXA 1BU8A 1QHSA 4GSYA 4K1XA 4UVIA 2FUNB 3K53A 5KOJB 3N7TA 1S3SA 3AQIA 1I24A 1MPTA 3DYIA 4BKPA 2IP1A 4Q7QA 1PJAA 3DCIA 3IUQA 1VIMA 3K1AA 5EJGA 3UAGA 3VSAA 5EJ7A 5ICSA 4NEQA 1Q1AA 4Q3DA 1WHSB 1XD9A 3K6KA 1PNTA 3DZHA 5CK5A 1Z12A 3IE1A 4LNUB 1GN8A 5TMPA 4ES6A 1TAHA 1JHYA 2QN1A 5JEEA 1DO2A 4CIVA 4QLBA 3EVFA 1U8AA 2A4MA 2FMTA 1KY5A 4O2BA 2GN8A 1U3FA 2E4ZA 4TLLB 2BGNA 3WV4A 2O14A 3WLIA 1O4VA 3AJDA 4P34A 3BQ9A 2RDMA 2X5JO 3EVDA 3PFHA 3SQNA 1UK8A 4PTYA 3VO8A 3MT0A 2WFLA 2R6FA 1FVOA 2AYXA 4ALJA 1HDEA 2VNIA 1JDPA 1M6VB 2UU9B 3JQAA 2A7XA 2ZBDA 2HFKA 5FWXA 3TUIC 1KETA 2JZOA 3DR5A 4Y9UA 3BIWA 2CD7A 5TF0A 1W1UA 1RSZA 3AUAA 4BNKA 1T5DX 1FMJA 3K09A 4IH1A 2O4CA 3H1PA 3IALA 1GD1O 4PIMA 5PNTA 3R7SA 1WF6A 3W7BA 5LLTA 4M0UA 3QVSA 4A8PA 2X19A 3N07A 4E2YA 5E7QA 1C30B 4TKVB 1ODTC 1S1CA 2PJDA 3BGWA 4G8JA 5FPTA 1B76A 3VPDA 1HFJA 3AINA 5DBOA 5ELLA 3N87A 4HRAA 5EIFA 5F5NA 1U28C 1F12A 4GZLA 1A9YA 3Q8XB 1P0QA 4P3PA 1KTIA 2BHLA 1QRUA 4AN1A 4URYR 3GMTA 2CNWA 3HB4X 4LVNA 3UBMA 2IIVA 4RPCA 2PCLA 4FOSA 3ZY6A 4B6FA 3CVYA 1E0JA 4D57A 4KGDA 4MI6A 2WKPA 3OPVA 4QOHA 3SEZA 1AN9A 4Y2GA 2M2IA 1C3EA 1FXSA 3EAQA 3L4BC 3A2NA 3FZEA 2WJPA 2IY8A 2XVXA 3KAKA 3QEOA 2XDWA 3EEFA 1JMVA 4MA0A 5IUKC 4B5KA 5BSEA 4PLPA 2P40A 3I30X 3UJ7A 3RADC 1ESDA 3T3DA 3AFNA 4MIKA 1RHKA 5IJ0B 5JLAA 2PZGA 4HDKA 5AMXA 3RAEC 2ZJAA 2FPKA 3TQTA 3FAKA 3W78A 2IXDA 1NBIA 5A4FS 4E15A 1TADA 3KPUA 3K9QO 3NHPA 1U0FA 4HG2A 4X1KB 4EHHA 4JBIA 1D1SA 1JQBA 3K9BA 3U26A 4DHWA 3M3HA 4TN5A 5BSVA 1N2BA 2O7VA 4ESHA 2CLFB 1VE9A 2VHZA 4CYMA 4QL3A 2IVFA 2BHSA 1BCRA 3JWIA 1E7YA 2FLVA 1OYWA 3PCRB 2D59A 2PTHA 4WNAB 5DCUA 3ZEAA 3UPTA 3MTJA 3TQCA 2VHEA 2HEGA 3BBPA 5BMVA 3ZGXA 3T12A 3GFRA 2CL7X 4MGKR 3R74A 5B2EA 2NP6A 1KEWA 5DP1A 1ZX1A 1WMAA 4JT9A 1Q0UA 3DTVA 1UT6A 3BERA 4O4HA 3RCBA 1C0LA 1AOXA 5LUBA 1DB3A 2VJKA 4HL6A 5DIFA 1HEUA 3UMCA 2TMGA 2VAXA 1E2EA 1AGXA 1G3IA 1K6IA 3TFQA 3VDRA 2FW0A 3I73A 3I6BA 2BCJQ 1KFJB 1CE8B 1YZVA 3AZOA 5FFMA 1Y8CA 1U5BA 4FFWA 2XMRA 5KYYA 4X62B 3IXLA 3ABRB 4C07A 4MVYA 2C2XA 1PYDA 1HKUA 3OAAA 4RCZA 2Q1TA 2ZW9A 1EGAA 1G8GA 2C3YA 2P6UA 3G1WA 3KK0A 5E1MA 2REQA 4WZBA 6NULA 4AP9A 3RGGA 3IUYA 4HEQA 2Q29A 2FJ0A 4JC4A 4FBLA 4RF3A 1E99A 3T5CA 4DFDA 5LJLA 3GEEA 2JA2A 4MVJF 4MW6A 1LB1B 3AJAA 3DZDA 2V3CC 3QI2A 4ITUA 4A0RA 2II6A 2VLIA 1URPA 5DNEA 4KWTA 5INTA 1AHNA 4H3HB 3E18A 4F6RA 5LZ4A 1TMKA 4BNGA 4G41A 1SVKA 3Q9SA 1WV0A 1U2GC 2VPWA 4Q48A 2BRUC 1Z36A 4YUAA 4QWWA 5ED0A 2EEZA 4RTSA 3UXHA 4NG5A 4BO1A 3LNCA 2C2MA 1VG0B 4DWJA 1G16A 3LC7O 2O3JA 2RB5A 1RT9A 1LLCA 1IN5A 4MLDA 4QYXA 3WGGA 4JQOA 4BFLA 1F5NA 1YHYA 4EF4A 3FDIA 2Q5IA 3TTWA 4NNPA 4LOHA 4OREX 1B8NA 2WMDA 4Y6QA 4M9UA 4X94A 2G80A 1SOUA 3H2HA 1UFQA 1YAHA 3LQFA 4A16A 4DDVA 4ZGWA 2CVPA 3G2IA 3OLCX 4RHCA 5G41A 5ALYA 1XTVA 5DRTA 3PP8A 1EM8A 2COKA 3HABA 3O8QB 5BN4A 1YR1A 2QW1A 3DE4X 5TARA 2VJQA 1C4WA