3R41A

Crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/apo
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
302
structure length
302
Chain Sequence
GHMPDLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGNFLPEEAPDQTAEALVRFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
total genus 118
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r41A00
1MO2A 5I8PA 1YB6A 5ALTA 3BL8A 4H7FA 4KEAA 2QZPA 4X94A 4G4GA 3WZMA 5HZGA 3MVEA 4BCDA 5AOCA 3DKRA 5FPPA 2VF2A 3ANSA 4WFIA 3D5EA 3BXPA 1YS1X 4LXGA 2XUHA 1S8OA 1XKLA 5ALSA 1L7QA 4X3CA 1QO9A 1TIBA 4FNMA 4P9NA 5HFNA 3VVLA 5ESRA 1MNQA 2C5GA 1ACJA 3BE8A 4DGQA 1CUVA 2XQFA 2VQ6A 4QZVA 4J0HA 2R8BA 1ZI6A 1JJBA 5IVDA 3WQHA 4C4ZA 1XFDA 1N8SA 4PSDA 2H1IA 4WDRA 2QJRA 5JYCA 2VJBA 4H7JA 4ZXFA 1R1DA 4DSZA 3EF3A 1XQXA 3ICWA 1HDEA 1EB8A 4RE6A 3D0KA 3R3WA 5K3DA 4H77A 5DNUA 5AOBA 1VXRA 1NU6A 4UFOA 2HA0A 4NS4A 2OGSA 1EB9A 4B81A 1VZ3A 1CUCA 3EBLA 2XDWA 1AURA 1C4XA 4WY5A 5D6OA 3I1IA 5K5EA 4OB8A 2XMQA 3G0GA 4G8CA 1JMKC 4G8DA 5IH7A 5AJHA 4N8DA 5EGNA 3LIIA 1QONA 4DNQA 3FOBA 2PBLA 4QWMA 3C87A 1CLEA 5LIPA 5AI4A 3R3XA 3DYIA 3D7RA 4F5ZA 1SCIA 3H2GA 3K9BA 2QM0A 2WQZA 1ZD2P 5KBYA 3WI7A 2XT0A 4PO3X 5KWIA 3FLBA 1VLQA 2RONA 5EIAA 2CKMA 4UFPA 3NUZA 2C58A 1LZKA 2Y1KA 1QE3A 1OXMA 4PW0A 4AN0A 1HPLA 1ODTC 2AJBA 4TVKA 5T4BA 1CUGA 3O4HA 4J0JA 5FDFA 4XVCA 3D59A 2FX5A 1EH5A 2AJ8A 4X00A 3O4GA 3G9UA 3SC2A 4G1FA 1A8UA 2ZJ6A 4X92A 2VAXA 3Q0TA 5FOQA 3E0XA 2B9VA 1XRPA 5ALRA 2DHDA 4L72A 5EHZA 1VZ2A 3W9BA 2I78A 4EA6A 3DL7A 2OGTA 3HC7A 4Z49A 1DU4A 5AI0A 3GA7A 3WWOA 1CUZA 1R9MA 3H17A 2RAUA 4UHHA 1XROA 4Y2PA 1E66A 2ZVDA 2WU4A 3M82A 5AI6A 4BC1A 1O6FA 3V1MA 1FJ2A 2WIKA 1QLWA 4K6GA 2PUJA 3FYTA 2PL5A 2VT6A 4ROTA 4W9RA 2QVBA 2Q0XA 2OCGA 4PNZA 3TEJA 4OU5A 2WJ3A 1LPMA 1QGED 1UWCA 3M81A 4BDSA 4J7AA 4P93A 2OCKA 2QRUA 4M0EA 1LGYA 1EDEA 1E3QA 3IVMA 3N0TA 3HLKA 3RM3A 3AZQA 1L7RA 5FV4A 4AB1A 4LYEA 2CUTA 1CQZA 3FSGA 1ISPA 1H2ZA 1K5PA 5AK5A 3IIIA 3S2ZA 1EK1A 1QJ4A 4UBMA 4QLAA 5JIBA 4U2EA 1AX9A 3WK9A 1XRLA 4WY8A 2BKLA 4ZV9A 5AKLA 1R88A 1TQHA 2C0QA 1GXSA 4LYDA 1DINA 1XZHA 4OD0A 2QTBA 3W9UA 1CR6A 5ALHA 4AXBA 1VE7A 1WHSA 1IUOA 2WFLA 1XZDA 3QPCA 3ESCA 1LPPA 5C7YA 1X2BA 4JYMA 4B6GA 4DTCA 4KE8A 5CXXA 3DLTA 5JADA 1MT3A 4RGYA 4BRZA 4GLBA 4IH1A 4UHEA 4N8SA 3ED1A 3VJLA 3G0IA 1WB4A 5EHQA 4LXIA 5LZ7A 4I4CA 4PV7A 4DMKA 4KRYA 1N5MA 2AXEA 1X2EA 3C8DA 1ZGBA 5FRDA 2HRRA 3MGAA 1USWA 5K3BA 5AKEA 3H2IA 3WL5A 4Q82A 3DD5A 2X76A 5AH0A 1EINA 5ALOA 3I2JA 1JU3A 3F96A 4GEGA 1WPRA 1WM1A 3MUOA 4YX9A 4Q3LA 3WL8A 2VEOA 3OURA 3VVMA 5KWJA 3D4LA 5D3ZA 1E8MA 3U1TA 3FVRA 3WA7A 2WUGA 4CFSA 4AX4A 2BJHA 3EQ8A 1VXOA 5C81A 2OCLA 2FUKA 3AIOA 3WL7A 2PSFA 3H04A 3QMVA 3I28A 4KAAA 5ALNA 1ETHA 3NOXA 2OLEA 1TCCA 1F0NA 4BATA 3KWFA 4I19A 5EHNA 2WM2A 3GBSA 3P2MA 4IO0A 5D3KA 3STWA 1XZGA 3QMMA 3KDAA 2QMQA 3F98A 4KAJA 2XUGA 5FUMA 2XQJA 3F67A 1FFAA 1QFMA 2WU3A 2HHAA 1YSCA 1I6WA 3FYUC 1XZLA 1A8SA 3UMJA 1WCYA 1NX9A 4KE6A 3GFFA 1W4LA 2XMSA 1JT2A 1W1IA 3STXA 1A7UA 3QH4A 5HF8A 3L1JA 2WTMA 1BE0A 1G42A 4J0IA 5E4TA 1Y7HA 3O9VA 3BWXA 4EZIA 1G66A 4HXEB 2VJCA 3QZUA 5ISMA 4X6XA 1MAAA 1VA4A 3C8HA 2Y6UA 2V9ZA 1G4HA 1KU6A 1BS9A 3CN7A 1H2XA 3WIOA 3RKSA 4X91A 2QUBA 3HACA 5CT5A 3A2MA 1CVLA 2D5LA 1E5TA 3SWWA 4W1QA 4X97A 1JI3A 2GYWA 4KJXA 4C87A 5T4EA 4EY6A 3C6XA 1CUAA 2ZJ7A 5LZ8A 4AQDA 5HK9A 4Y2QA 1DWPA 1MN6A 4WDQA 3WK6A 4HRXA 4GHWA 4OB6A 3DJYA 5ALGA 2G5TA 2RI6A 5JATA 4QEKA 1ACLA 1PJAA 3G9XA 1TAHA 4BTVA 2OQVA 1CUYA 3R3UA 5ALKA 5AK3A 1EDDA 2G5PA 3RARA 5BOVA 4IQ4A 1VJ5A 1XZEA 1VE6A 1ZJ5A 5DYYA 2GBIA 2XUIA 4X6UA 2HADA 4B82A 3C5VA 2XUAA 5LLSA 2BCEA 4C89A 3D2CA 4FHZA 3PF8A 5JD5A 2HA5A 4G9GA 5BWCA 3G0BA 4UHBA 5DYWA 3WWCA 4J03A 4YASA 5JAUA 1P0PA 2Z8ZA 4BCCA 2YXPX 3SK0A 1EDBA 1BN6A 5AIBA 3ESBA 4FOLA 1RYYA 4FMPA 1HLGA 1EX9A 1TKRA 3H2HA 5JASA 2WHPB 2QR5A 1J2EA 3BJRA 7YASA 5HF5A 1A88A 1Z68A 1U65A 2J3QA 4ZWNA 1C7JA 5JZ9A 2CB9A 5ALDA 1YS2X 3CXUA 4DNPA 4Y2UA 2Z8XA 2O2GA 1GKLA 1ORVA 5HKAA 1EI9A 1MX1A 3FYUA 4J0KA 2ZYHA 5ALFA 3HZOA 1OCEA 3HEAA 2D0DA 1H2YA 1LBSA 4UBKA 1UOOA 3PE6A 1SFRA 1XLVA 2OAEA 2B20A 4JUIA 2PPLA 5LZ2A 3BF7A 4Y2JA 4UPDA 1DQZA 1XRQA 1ODCA 2GBGA 2WG1A 1WB5A 4MJ3A 1CQWA 1WB6A 1RWQA 4K6KA 1DQYA 1YAJA 3Q8WA 1RP1A 3I6ZA 4Y2YA 4P92A 3I6MA 5EI5A 2QOEA 3AFIA 3HI4A 3D3NA 4EY8A 5I9IA 3AZPA 4XJVA 4FLMA 3ICVA 5AI9A 5EIEA 2QJWA 3LS2A 2BAGA 3DEAA 2AJCA 2HM7A 3STUA 1O6GA 2HA6A 4AO7A 1BRTA 1MTZA 1YCDA 1ZOIA 4FKBA 2WHRA 4ARBA 4BZWA 3TGLA 3E4DA 4HXGA 3CCCA 3O0DA 3C5WP 1CV2A 3C43A 2HRQA 2QS9A 4G8BA 4HTAA 5DNVA 1GKKA 3T4UA 1BEZA 1IZ8A 2HA4A 1YB7A 2E3JA 2XUPA 1FFEA 1C7IA 3PI6A 1ZJ4A 3UUFA 3W04A 4B85A 5ALZA 1ZIXA 3C6ZA 3OTQA 4BVLA 1DWQA 4ZGBA 1N5RA 1TCBA 3STYA 1QIFA 4UHCA 2XMGA 4QDZA 4KE9A 1DX6A 2OCIA 5CT4A 2VA9A 2GBFA 3R0VA 3DQZA 3SX4A 5KREA 3STVA 1MAHA 1XZBA 2G4LA 2PSHA 2XMCA 1XZAA 2G63A 5CBKA 5AM4A 3JWEA 4BP8A 3LP5A 3DOHA 2WJ4A 4UBOA 1D07A 2JEYA 5JAOA 4O08A 1FFBA 1QIKA 4Q34A 1QIIA 4W1RA 5FXMA 5SYNA 1WHTA 3WK4A 4K6HA 5HFAA 4D9JA 2HU8A 2HA2A 1XZCA 1XRMA 4YK7A 5A7FA 4GECA 4N5IX 1THGA 4QE3A 4EBBA 2HFJA 2BGNA 4CIBA 1YASA 5JAHA 4TGLA 3FSGD 1JJFA 1CRLA 1CUEA 1UKCA 1TRHA 3NGMA 3AINA 1UK9A 3H1BA 1K63A 3JYHA 4JYPA 2JGIA 2ONCA 1K8QA 1YA8A 3WK7A 4DYHA 3WKCA 2O2IA 3OM8A 3UUEA 4H35A 3V1KA 4WCVA 4X90A 4FBMA 2PSEA 5ALPA 5LYYA 5AKKA 3BDVA 1GQRA 1UOQA 2XUOA 4BB0A 3ZI7A 2WUFA 3H1AA 4CI9A 4Y2SA 5AKJA 3FWHA 4C01A 2RHWA 1VKHA 2XUQA 4OSEA 5ALIA 1B41A 1ODSA 4MEAA 4Y2TA 4Y7DA 1H22A 1EXWA 5CW2A 2HU5A 4H7EA 4B9AA 4Y2XA 1IZ7A 1CPYA 5AM0A 5A62A 4GDMA 2WG2A 3HSSA 5IVKA 4RE5A 2VATA 2WIFA 5SYMA 4G9EA 2XLCA 4XX1A 4A16A 4JEIA 4U2BA 4X95A 1UZAA 4ETWA 3ZWQA 2AJLI 1SOMA 1YA4A 1HQDA 5AKZA 2J4CA 1LNSA 3I2IA 2WIJA 5DTJA 2BGRA 1LPSA 2IITA 2GYUA 1QO7A 2OG1A 5LZ9A 4XIIA 1QIEA 2GZSA 3PICA 4B0PA 4EY7A 3A2NA 5ALWA 1XZFA 5C8VA 1Q83A 4BVKA 1XQYA 3TJMA 1GPNA 4E15A 4E46A 1BCRA 3R3ZA 2QUAA 3BIXA 1U4NA 2J3DA 2VAVA 3ZLTA 2DR0A 1MX5A 2AJDA 2IIVA 3BIWA 2P8SA 1M33A 2ZYIA 1AZWA 1PV1A 2I03A 3FVTA 1XRNA 3DKKA 3A70A 4MYDA 3IBTA 5CT6A 4FDMA 3I2FA 2ZYRA 5C8XA 1R4ZA 4BBZA 3EIOA 2ES4A 2WLSA 3CCBA 4B84A 1BROA 3K2IA 4H7DA 1BU8A 2HA3A 3WZLA 2JGJA 2ACEA 4QDXA 3IUNA 5T4HA 4KAFA 5HQ3A 4UHDA 1XZJA 5K3FB 4EY5A 3AUKA 1CIJA 4C6HA 2Z3WA 1FSSA 1UK8A 3E3AA 3WJ1A 2HDWA 5BV7A 1VOTA 4BCBA 2V97A 1LZLA 4UFNA 3I2GA 1AUOA 2XMRA 4MQMA 4C88A 1T4MA 2PKYX 1XQVA 4OU4A 3FNBA 2DHCA 2XMDA 2ZSIA 1YR2A 1E8NA 2WKWA 1GZ7A 4MXDA 1QIJA 1Y37A 2JGEA 5EHXA 3STTA 1F8UA 4K2AA 1NU8A 4PF1A 4ZI5A 1H2WA 5IKXA 4GW3A 4Q3KA 3WK5A 3F8SA 4YPVA 4Y2VA 1GPKA 2RHTA 2WHQA 3IA2A 4BE4A 3M83A 5E2IA 4X7BA 3O4JA 3M3DA 2QT9A 2WFMA 4CG2A 3VJKA 4CIAA 3PFBA 2GZRA 3ZPXA 5FP0A 3PF9A 1WOMA 2UZ0A 5CH5A 4A23A 4U2CA 1TK3A 1Y7IA 4PQEA 3DOIA 2YASA 4BE9A 5AK4A 4MYSA 1XLWA 2JIDA 3B5EA 5A71A 1HBJA 1CUWA 3O95A 4Y2RA 5C8ZA 2EEPA 2W6CX 4IHAA 4FFWA 4X71A 3I6YA 4UBIA 1EVQA 2XUJA 1XKTA 4PSCA 1W75A 3GZJA 1T2NA 3VXKA 4B7ZA 5JAPA 2WILA 3YASA 2QXUA 3E1GA 4HS9A 4UBLA 3R3VA 1IVYA 4F0JA 1XZMA 5AKXA 3DL4A 4CCYB 4GXNA 3DS8A 1EHYA 3GROA 3MUNA 4OYLA 1DT5A 1LPOA 1MX9A 1BN7A 3L1HA 4C4YA 1GPLA 3G9ZA 5IVIA 3L1IA 2XI4A 4MWSA 4KR0A 1CUBA 5T4FA 4WFJA 2XQKA 4RNCA 1CFJA 1FFDA 4GWLA 1XQWA 2Z3ZA 3N2ZB 4IH9A 4LXHA 4OB7A 3C45A 2XE4A 4BAUA 3QYJA 4DMCA 3D2BA 2Y2UA 1R50A 3FLEA 3KD2A 5AKGA 4MWTA 2C4HA 3FAKA 4PSUA 4J0GA 1CEXA 2DHEA 2PVSA 4AMYA 1ORWA 2ZJFA 4U2GA 4BAZA 1N1MA 1UOPA 4W1SA 1SCKA 4GBGA 5ALUA 3OOSA 4MQLA 3KXPA 4N8EA 2B61A 2Y6VA 4AO6A 1ZD5A 3PFCA 5K3EA 3TRDA 3H18A 2VTVA 2I3ZA 1JMYA 4P08A 2JGMA 5DJ5A 3B3QA 1LPBB 1AC5A 2CJPA 4KE7A 5ALMA 1ZI9A 3IUMA 4N5HX 3C6BA 2JGKA 3H2KA 1JJIA 3KSRA 1GQSA 2WUDA 4B80A 4BAGA 4KACA 3PUHA 3G9TA 1E89A 4CG1A 4HZGA 4DNFA 3DDUA 3V48A 3DYVA 3ZLVA 4FWBA 1KEZA 2O7RA 2PSJA 2PU5A 1W52X 3QBJA 2X5XA 4OPMA 2EDAA 2WSLA 4DNOA 5CT8A 1LPAB 3HRHA 2VSQA 3ESDA 4HRYA 4I3FA 5AKHA 1WPXA 5DYTA 3FYUB 1THTA 1F6WA 1CUHA 1F0PA 2JEZA 4L9AA 5HK8A 4AZ0A 4X85A 2CBGA 4A5SA 5JANA 3AILA 1QZ3A 4MEBA 4INZA 3QPAA 4EUSA 1R9NA 3WA6A 4DLNA 4AZ3A 2JGLA 1GT6A 2WIGA 1Q84A 2BUBA 5JD6A 5HF9A 2OPHA 2DFPA 3O9MA 3S8YA 4FLEA 1LLFA 3ESAA 4WFKA 3WKEA 4BRSA 1DT3A 2J4FA 3DCNA 3WLAA 3BF8A 5E4JA 3WYNA 4CG3A 2WUEA 5HF6A 5AHXA 2XQGA 3BJMA 4DIUA 1P0IA 3ZLUA 2WTNA 5IVHA 2XMZA 2XUFA 1DTEA 2XUKA 1B6GA 3GUUA 5CT9A 3QMWA 4BZZA 2DCMA 3R3YA 2PU7A 5F4ZA 4Q3OA 1JFRA 4CCWA 5CMLA 5CRIA 2H7YA 4EHBA 4M0FA 3ILSA 1AGYA 1L7AA 3AJAA 2RIPA 4UHFA 2O2HA 4G4IA 3IUJA 2H9YA 2O7VA 4K5QA 3D2AA 1MU0A 2CZQA 3G0CA 1K4YA 5HKBA 3DNMA 3BDIA 1UKBA 2Z5GA 5DWDA 3PUIA 1Q0ZA 3NWOA 6YASA 3A2LA 2XB6A 4G4JA 4Q1VA 3HYSA 5JALA 3F9CA 4L0CA 5ALJA 2B4KA 2WG0A 3OPMA 2ZYSA 2VJAA 4DSAA 2CMFA 3U0VA 4W63A 1CUIA 2HA7A 1CUSA 1EVEA 2HU7A 2XUDA 1UT6A 3CN9A 4NMWA 3R41A 5AM5A 3QPDA 5JZBA 4RPCA 4BYMA 2YYSA 1R3DA 1KU0A 3X3HA 1QOZA 2RGUA 2W22A 4KYVA 2K2QB 4ZV7A 2XQIA 2VT7A 1SCQA 4IH4A 5AICA 3ZV7A 5AM2A 4BTLA 2OQIA 3F97A 5LP1A 5DTIA 4B83A 3OC0A 4JNCA 3IURA 3QVMA 3G02A 5I7UA 4JH0A 5LKRA 4X6YA 1JKMA 2ROQA 3RK4A 2BFNA 2PUHA 1J06A 5DLPA 5ALXA 1W76A 1DX4A 4HVTA 1A8QA 1CUFA 1HL7A 3H0CA 2QXTA 1FFCA 5J3JA 5AP9A 1CUUA 5AOAA 4AO8A 4BVJA 5DNWA 4DM7A 2H7CA 2EDCA 4LHEA 4S0XA 3T52A 4HAIA 4UBNA 3WL6A 3A6ZA 3LIPA 5FKJA 5K3FA 3G7NA 3IB3A 5ALVA 3I1YA 5CTAA 5LZ4A 3C6YA 1U8EA 3LCRA 1K6EA 1UKAA 3AZOA 4H18A 1QTIA 1E8DA 2BUAA 4UBJA 1W6RA 2WJ6A 1UFOA 5AK6A 1CUDA 3WKBA 3I2KA 2CEKA 5JZSA 4QDUA 4E14A 1OILA 3RLIA 4FNGA 5FLKA 2ZSHA 3FBWA 3VJMA 5AM3A 4NZZA 4FTWA 2X8BA 1DWOA 4BDTA 1QIHA 2WFZA 1AMNA 2JBWA 2LIPA 5FPQA 3IDAA 2JF0A 5CURA 4BP9A 1IUNA 3WWPA 1ZD3A 1BEEA 4Y9SA 2OXEA 4H7KA 5A7GA 3WWEA 4C4XA 4LIPD 1MNAA 1JU4A 2WFLB 5EFZA 3WK8A 4AMZA 4QDTA 1QFSA 2VJDA 4BC0A 2HFKA 1BCSA 2ECFA 4FLFA 5AO9A 2H7XA 3FCYA 4V2IA 4FBLA 1P0MA 3W06A 4GI1A 1XLUA 2C7BA 3C70A 2R11A 4OYYA 1ZD4A 1ZGCA 4DMFA 2PM8A 3JW8A 5A2GA 2OAGA 1IMJA 4J0CA 3IULA 4XWGA 5A7HA 2Y2VA 4E11A 3KOOA 5H3HA 1U2EA 4M0MA 4ZRDA 3G8YA 3V1LA 1LBTA 5CH3A 3AIMA 3LLCA 4EB0A 1ZICA 1UK6A 3EQ9A 1MJ5A 5HCUA 4NVRA 3OG9A 1TCAA 1P0QA 4J0DA 2V96A 5CXUA 3WJ2A 5AKYA 2C0PA 1HKHA 5EIHA 4CCYA 1H23A 4L3WA 1IUPA 3QM1A 3H2JA 5AI5A 4HXFB 5ALEA 1XZKA 4U2FA 1YAHA 1VA5A 5ALYA 2JGFA 4F60A 5K3AA 3W05A 1AQLA 5D7BA 2DSNA 3PDCA 4G5XA 2ORYA 1MPXA 2IX9A 3R40A 3KWJA 3I2HA 3WMRA 1XZIA 4B0OA 3QITA 5JD4A 1ZIYA 1QIGA 4ZREA 5HQ3B 5JARA 1AKNA 2XMBA 3WKAA 3H19A 2WHPA 2PSDA 3ANTA 5AKIA 3VDXA 2C5FA 1LPNA 4OCZA 2ACKA 4TPKA 1UK7A 1Q0RA 5AM1A 3O4IA 5A6VA 4U2DA 2DQYA 3VKFA 4X93A 2QKYA 3FLAA 4QNNA 2HL6A 4QWWA 5ALQA 3HXKA 2YH2A 4KRXA 4H7IA 3VISA 3WIBA 4EY4A 2GYVA 3WWDA 4OUKX 3V9AA 3G0DA 1QIMA 2NW6A 1PFQA 1EA5A 3HJUA 1ZI8A 2PX6A 4WJLA 3V1NA 2I3DA 3GELA 4H0CA 3W2TA 4B9EA 5K3CA 5LZ5A 5ALLA 1GGVA 1QTRA 1X70A 4AN1A 4LKOA 4F21A 2OGZA 2HIHA 1XRRA 3WYDA 5BWBA 2BUCA 4ARAA 1J1IA 2V98A 4ITVA 3K6KA 5AIAA 2XLBA 3IUQA 2FJPA 4QA9A 3B12A 3EQ7A 2GBCA 5E4YA 3FCXA 3HABA 3WKDA 2FJ0A 2WIDA 5LKAA 4QLOA 4FFVA 1CUXA 3AIKA 5AI8A 4W1PA 4H7HA 1QIDA 1J07A 5YASA 2DQZA 1CUJA 1UXOA 4UUQA 5CH8A 4QDOA 1EK2A 4J3JA 1SC9A 1G5FA 4DMHA 4Q05A
chains in the Genus database with same CATH superfamily
1B76A 5I8PA 4F7WA 3P9RA 4Q37A 3EVCA 4ZT2A 3DCYA 3UJDA 4H7FA 4N4AA 1FXSA 2WDPA 3QE0A 4KDFA 5MGNA 2OHHA 1IQ0A 4JS0A 4N49A 2TMYA 2CWDA 5FOVA 1KZ9A 2WE7A 1PFWA 4MQFB 1EK6A 1KP2A 1TYBE 1GIAA 4XB1A 3ZI0A 4D5EA 4MS1B 2W2TA 4XQCA 1NVEA 2C98A 4R9UC 1DO2A 3BA6A 2W5UA 3RF7A 3U7RA 1P9NA 3MVEA 3W6UA 3ZHBA 4BCDA 3GEDA 5TT1A 1N77A 2FWNA 1YTLA 3IXMA 3UJBA 2F4VB 1H0HA 4WECA 1O7JA 1V71A 2YV5A 3D3KA 3NEYA 4PLFA 1LRKA 3ADKA 3TO5A 4E2WA 2EKZA 4QYSA 4CBVA 2W4MA 3D5EA 2FDXA 4AY2A 3WICA 2CJYA 4A5OA 1YS1X 3PHIA 4YRDA 1RE0A 2Q0SA 1RZRA 3X1MA 3IP3A 1PX2A 3IXQA 1XKLA 3AVQA 5K01A 3QVGB 4ID9A 4CMEC 2GN6A 1H1TA 4NZMA 4X3CA 4UAUA 5CNIA 5HFNA 2R7MA 5JJBA 4RDXA 1GCOA 5ESRA 3HA7A 3OI7A 3KSAC 1OYYA 1H2EA 1KXJA 1CUVA 3GT4A 3RS8A 5JHHB 1UMCA 1PF7E 2XQFA 2VQ6A 3QSGA 4QZVA 3EIWA 5JO9A 1GG2A 3E3OA 1QAOA 4GI3A 4XGKA 4Q12A 2R8BA 5KNDD 5TF4A 3JYOA 1L4GA 4K9OA 3LOQA 4IYJA 2PQMA 5CFQA 1Q1EA 2BOVA 1U1DA 4YMWA 4LI0A 1B8OA 3WQHA 2P4QA 1XFDA 5JBQA 3H87A 4PSDA 2G06A 1JHMA 4D5GA 1DKRA 3K8QA 1A7JA 4WDRA 1HR0B 4JI0B 1AZTA 4O4JB 2GXUA 3GD5A 4DSZA 1Z13A 4HB4A 1XQXA 2SKDA 3ICWA 1IBCA 3AM3A 1E2MA 4KGVA 3WGHA 4C78A 2IUEA 2CDBA 2JB9A 3HHEA 4QVGA 4WQMA 5D01A 3LAWA 5AOBA 2NTJA 3OKPA 4DA8A 2I0FA 2C8VA 4M21A 5BR7A 3TKAA 5CDGA 3N53A 3TE6A 4Y9UA 2GCOB 4FOTA 1UJ2A 4NJMB 1PTJA 3OZCA 1GCAA 2EF0A 4BEVA 4NS4A 1F8FA 4UEKA 2GBLC 2IOHA 2Q8PA 2VSXA 4JK3A 4Y6PA 4B81A 2Y92A 3HWWA 1CUCA 2G88A 2HO5A 4HDSB 4JY7A 4DMMA 1I4DD 1RYBA 5A3SA 3VPXA 1C3JA 2GN2A 3PIIA 1BE8A 3BFVA 3H65A 4J0EA 5LA6F 3ZKAA 4TWBA 2YFKA 5LYJB 1Q44A 2FP4B 2P5TB 1Y9AA 1XEWX 3MTIA 2WWYA 2QYOA 5D6OA 2YQZA 5KNBA 3P9SA 3GGDA 1J20A 3DE0X 4MRPA 4W82A 3RYTC 3GLGB 2UZAA 1A9RA 1PHPA 3N2IA 4G8CA 3GUHA 3DL0A 1KI2A 1JMKC 4G8DA 4ZN6A 5IH7A 4JIGA 5H4GA 5ER6A 3HB4X 1F5SA 3DLAA 4QXRA 4N8DA 4TXNA 1E61A 1JS1X 3AU9A 3LIIA 3NT5A 3ZR4B 4CV1A 4MW6A 5B3JC 1QONA 4UEWA 4CMAA 1S2LA 4BU1A 3CUEF 1Q21A 2QR2A 3WRVA 1K5HA 3BMQA 5DNCA 3Q10A 4JI8B 1VSUA 3GLHB 4I8DA 4H17A 1Z2DA 4JJAA 4LRXA 4PO8A 4AXBA 1CLEA 3DVQX 3D5QA 3Q5DA 4FP9A 1OBCA 4RGQA 5F1OA 4G0OA 1LLDA 5AI4A 2PUAA 4OBWA 1LC0A 3N5KA 4W8GA 1K3UB 1OV6A 3NHBA 3P94A 2PS0A 1SCIA 1WU8A 5J59A 3OWHA 1QHGA 2QM0A 4MGIR 4P1ZA 1A97A 2DCUA 5J4KA 1AT1A 2PUVA 2WM8A 4Q9HA 1VLQA 1QV6A 1PUJA 4XQ9A 3AUUA 2H4JA 2CKMA 3S2IA 4UFPA 1WTCA 2ZIGA 1U2GC 1LZKA 1B2LA 2FPIA 2Y1KA 5H70A 2G82A 3LPNA 1VMAA 4QFMA 4C4PA 1OXMA 3SGLA 2CNDA 2EOAA 3ZHTA 1C81A 4K6OA 4JKIA 4TSRA 1W36B 1S7CA 1HPLA 1DIAA 5CNMA 2QVLA 2YINC 4B3CA 4BNFA 3K70C 1UM9B 1AO3A 1UT5A 5U4XA 1IXRC 1NOJA 2R97A 4B2PA 3EF1A 2FW7A 3FHCB 4IRXA 2P2CA 1E2QA 3KR1A 5DNYB 4DKJA 2FX5A 2JJ8A 2FZ5A 1EH5A 4U9UA 1UIRA 4X00A 3I37X 3RS0A 1NVUQ 2P90A 4JP1A 1KO5A 4G1FA 2VFAA 4UE6A 4YWHA 1AN0A 3Q87B 2ZW9A 2WTEA 4MMYB 1PWZA 4ZCMA 1N9GA 2FDRA 2B3TA 4X92A 2L18A 4ZICA 1RI1A 2R7AA 5HS6A 4C0HA 1VB3A 1ZW6A 4DT1B 1FVHA 3FOFC 4FDAA 1I10A 2HZBA 1XVVA 1DAMA 3HA5A 1QQTA 2CWWA 2I1WA 3ADCA 4R8RA 5FUVA 3JRWA 3E0XA 2YBDA 5J47A 4UTPA 3GJZA 2NG1A 2NV6A 3R5HA 3R77A 4ZAFA 4JLKA 2D00A 3IS3A 1WDMA 3NETA 2AN5A 4L72A 4UNNA 4JBXA 2RJNA 3JSXA 3QJ5A 4UUNA 3PQ7A 3LHKA 4S2EA 3ZU5A 1HE1C 1VZ2A 3AFMA 2BTQA 2I78A 4PAMA 4EA6A 3BXGA 2VHTA 3DL7A 4KNVA 5T6BA 4JA0A 2IEIA 1XN1A 1K7YA 3EXHB 3RRFA 4L02A 4GX2A 1NKSA 1DU4A 4MDYA 3AO0B 2OQRA 3GA7A 2HPVA 1ZL0A 3PNQA 4UATA 1U6KA 3L82B 2FTKE 1U7ZA 4FEYA 1N2OA 2OHIA 3UK7A 3UMRA 4F46A 2ZRGA 3PDIA 3VFDA 3JU3A 4INOA 1KYIA 2F3UA 2A94A 2R62A 2FKAA 1PNRA 3RVMA 3TPZA 3RBXA 3AEUA 2A8YA 1NRIA 3CIOA 3LQFA 2CNBA 4PC2A 4X1KB 4M49A 1QKKA 4WXHA 3M82A 3LKDA 4PICA 1O94A 4E5MA 5HUQA 4ASUD 1MO5A 1Z8FA 3GUZA 4IUYA 4V1CI 2AOVA 5BRNA 3GDOA 3WGYA 5G4KB 4F6RA 2H6EA 3NTXA 2DWOA 4UDYX 5HMLA 1D5WA 4AMVA 1WUJS 5C1IA 1BRMA 1N4AA 1HO3A 4J1NA 4RQTA 1QH0A 3LYLA 2JS7A 3HI6A 2PUJA 2R751 4WBNA 1D8TA 2AZ4A 3VKUA 4MV1A 1UCFA 5BSGA 4YCLA 1HWYA 2Q3DA 4U7DA 4IWXA 2BKXA 4CL3A 4B48A 2ZUEA 2JFHA 2PMBA 3IBCA 1AKWA 1WD5A 2AOTB 2GD2A 3CM0A 3OIWA 4M8SA 3RKRA 3TM4A 4DLYA 1JEAA 4EL0A 2EU8A 4JR0A 4RVOA 2ZI5A 4MCIA 3BS4A 3LVQE 3MJCA 4JWKA 1VPWA 3WLTA 4CUJA 3HCBA 3AM1A 3EWIA 3KJZA 2AG0A 3A1FA 3K2QA 4HQ0A 4NZPA 1TO1E 4M0EA 3LDGA 1LGYA 1KFCB 1SKBA 2VK1A 3THYB 3I30X 3OQHA 3DMHA 3EFEA 3QKWA 3LVRE 4G5OA 3R2JA 2C97A 2X14A 1OI2A 3J7TA 1CIVA 4OO3A 4A8JA 4COKA 1XDWA 5FV4A 1D4ZA 3P9PA 4LYEA 3ZUGA 3FSGA 3KQLA 2GJ9A 3KLPX 1GTJ1 1IDOA 2YVLA 3HCRA 1H2ZA 4D4KA 4DLTA 1F6BA 3R3SA 1QH8B 1PEKE 4IRMA 3QTTA 1T1EA 3EW9A 1KBZA 2G6TA 4JSYA 2D7JA 3EXFA 3IIIA 3TQHA 3K70D 3WIEA 4JP8A 1ISIA 2NSJA 3QPVA 5EJ7A 3CBGA 3HCWA 3B9RA 3HVJA 4LRQA 4XPZA 3SC4A 1PL8A 1JDUA 3UB3A 1N2XA 1RWPA 2WP0A 3EA0A 4FFDA 1OYOA 3EYAA 3H42B 4OJNA 5I5GA 4ALMA 4BVFA 4X7RA 1N0IA 4F45A 3F7TA 4O8ZA 1I7PA 1KO7A 2OFOA 1Z73A 2P2LA 4WY8A 1G9XA 4IDOA 1IPFA 4J2HA 2M2IA 4D9NA 3RTBA 1Z08A 3FPCA 3P97A 3VR4A 1H4TA 4GUDA 4C1NA 3PFNA 3UK0A 1FZTA 1JMVA 1R88A 2C0QA 2P91A 3KZNA 1MB9A 4FN4A 4Y3UA 1F5NA 4F3CA 1NM5A 1W8DA 2OV8A 2I2XB 1GXSA 3MWGA 2C1ZA 2EP5A 4TV9B 4U6NA 2E4AA 1FU7A 3L3BA 3N2YA 3TMYA 1GDTA 1K2WA 4L4YA 1CR6A 2B1JA 3Q2OA 4G07A 3G8AA 2FW0A 3PQ2A 3W9UA 4O1MA 2IYPA 4PRYA 2Z9CA 1VFNA 6AT1A 1AKVA 1WHSA 2XRMA 3KB2A 1IUOA 5AK0A 2O4UX 1XZDA 3BJEA 3HZZA 5L4LA 4WZBB 3FMVA 1TAGA 5BQXA 3KKPA 5FUWA 1GNVA 4A8TA 1F1JA 4LX0A 2QW8A 3NLLA 1F6DA 4EYEA 6NULA 5KB3A 4PLVA 4KE8A 2L42A 2W8ZA 4A26A 4BGVA 3HPQA 4HCJA 1VG1A 3AEQA 1ECGA 1K75A 1MT3A 3CO5A 1OHHD 3F74A 3IDFA 3JRXA 4J0FA 4RGYA 2E1PA 3M4ZA 4RYDA 4BRZA 4D56A 1P5JA 1W4AA 1U7OA 1WB4A 1XNJA 5EHQA 3HU2A 3V8BA 4D6YA 1BXKA 1XTJA 2FN9A 2V9CA 3MILA 1EZ4A 3DC2A 1F1BA 3O8BA 4JJ8A 4PV7A 3VU8A 2FWIA 3HB0A 4JUFA 4DUGD 1ST3A 2NV2B 2FMTA 2P9QA 1RWVA 3EOZA 3G5MA 2IZ0A 1GSAA 3PPXA 1HNWB 2IW1A 1SU4A 5IG2A 4OQZA 3QF7A 1XEAA 5CVJA 3SBEA 1NXVA 4ZQHA 2JKZA 4EHLA 1RMQA 1O0CA 2ZBDA 3AP2A 2ZRPA 1PGJA 3F7NA 3N7AA 2AFHE 2BCGY 2I8AA 2F43A 1HQCA 3LECA 5K3BA 4I4TA 1T29A 5IXSA 4E6EA 3D3WB 4LXQA 2MSKA 3M70A 2XCUA 3S7TA 3PU6A 1GZDA 2X76A 1MUUA 4UHJA 4BFLA 3PB3A 1L1EA 1YDMA 3O47A 1EINA 3NWBA 3CBQA 2DOKA 4YVFA 4AF7A 2NUBA 1JU3A 3EEFA 3P2JA 1M1NB 4CGZA 1Y8QB 3CUSA 5KOYA 3W5CA 1PRYA 3MUOA 3N2NA 1NY5A 4RMJA 4F56A 2NP6A 3TZ6A 3L4KA 4GPEA 3D6NB 1EIZA 4Q3LA 4TOIA 3WIDA 2H1OA 1QRTA 5ES3A 4LF5B 3VNUA 1NOKA 3BSFA 3EVDA 3NM5A 1QOPB 4HQOA 4MPRA 3ZE7A 1EUZA 1F06A 1MX3A 4JJKA 2WSYB 1XLTC 3U1TA 1UDRA 4N6NA 5TSDA 1C8VB 1U7TA 3HCFA 1ZD1A 1Q91A 3M6XA 3LTEA 1PO7A 5AJVB 4AZWA 2HJ9A 3F7OA 4PZUA 6LDHA 1T91A 4Q3BA 3WGZA 3T99A 2I9KA 3ZK8A 4KLAA 1QTNA 3B6KA 3BGOS 1OWMA 4HP8A 2BYTA 4C08A 5FWYA 5KOHB 1AS0A 4PPFA 1NDQA 1VXOA 1YJXA 2CL6X 1R0RE 2DSTA 2R00A 4FEEA 4JQZA 1U4SA 4Q7JB 4BN5A 4D6XA 3DUWA 3LXXA 3M3HA 1WXIA 3CLTC 3ZUPA 4XJSA 2RFLA 2HOQA 1E4YA 2GWRA 2H2FA 4MB6A 3TE7A 5HIJA 3MFYA 2GK3A 2OA0A 3ZJTA 4K9QA 4EMTA 3CMCO 4TMWA 4ZEXA 2FWBA 4L74A 4LFBB 3NC4A 5HOEA 5CLGA 1AY0A 1MC4A 3I34X 3U4DA 1D03A 4EHJA 1GZ3A 1VL1A 3RRYA 2W2VA 4UZFA 3WLIA 1J99A 2BZ0A 2Y0DA 4QU0A 4DGSA 3OCYA 2D2FA 4EDHA 5B5SA 3KQYA 3L93A 1HMYA 4UTNA 1C7ZA 2ZG6A 1ISGA 5JQGB 1BCRB 4JL6A 1W85A 2ADFA 2GRUA 1FL9A 1UL1X 1WQ3A 2XJ4A 4FHCA 5KQGA 2XZOA 1N25A 3HGTA 3OZUA 3VR5H 4R2WA 1QOQB 1CSEE 2MU1A 3DE1X 1KY3A 5B1SA 4DLZA 1SQ6A 4IIYA 4JJ7A 2CVOA 2QMQA 4DZRA 4D0SA 2DT8A 3NGXA 1SXPA 2DVMA 2XUGA 1EWYA 2GD1O 3L49A 5HIIA 5FUMA 2Y1XA 1NJ1A 1YL7A 3AOEA 3N0RA 2FOIA 3I8OA 1I6WA 4FHDA 2GRAA 1EUCA 4J2OA 4DRXA 3LLMA 3IQGX 3H5NA 1NR1A 4G5SA 5A5GA 1V11A 5DI3B 5BUZA 1ZOOA 4BVGA 5JT1A 3EGXB 1EVKA 3OE5A 4RCYA 3QU5A 3DO5A 5JWRA 4RTMA 5IBCA 1XZLA 1A8SA 4WZBE 4G26A 3TS1A 3UMJA 4KQ6A 1WCYA 3MAGA 2ZIEA 1NX9A 1MLDA 1Z5OA 3LW8A 1KF0A 1NUTA 2JL1A 4LK2A 4KE6A 2OM6A 1YR6A 3UXYA 2QPLA 2PKCA 4RMHA 4KK3A 4HWPA 3IKLA 3LSTA 3GJ3A 4BLRA 1W4BA 3OZSA 5CCBA 1CF4A 4ZVTA 3V6LA 5CBPB 1BMFA 2FG7C 4UASA 4ZVLA 3IRUA 4WFQA 2N1MA 3NANA 1FTGA 3M33A 4B2YA 3PQ6A 4L57A 3PIDA 4NYIR 3FWYA 4XYGA 3SJ7A 4RETA 3EGIA 1M0EA 4Z0NA 2EVWX 5B6JA 2C7PA 5LXTB 3NONA 3O9VA 2M6LA 1R9JA 3IL2A 3D8SA 4P80A 3BWXA 4HXEB 4QIHA 1HL3A 2C88A 2YDYA 3QZUA 2F55A 4XLTA 1FDVA 1KK1A 2W6IA 3EDMA 1F2UB 3IDZA 3QOYA 4KQIA 3NC1C 5TS2A 5KNCD 1ZR4A 1Y9ZA 1A4XA 3L0SA 3ZVRA 3N75A 4C06A 1HDRA 1ZK0A 1G4HA 2BDEA 2FZKA 3CUWA 2WU0A 3QVKA 1XDZA 5EJ9A 4KREA 1KPIA 4X8OA 1EUDA 3KQQA 4HNAB 3GRUA 2XKBA 3UWPA 2QTRA 2YL2A 1PQUA 3LK7A 3A2MA 2CUKA 2NO1A 3NW9A 2D5LA 5TV2A 4D57A 5JJCA 1RXSA 4PZAA 1E5TA 5FTJA 4W1QA 3WY9A 2O2CA 3AEKB 1KJ9A 4J43A 5HKKD 4MYTA 3DZJA 3SBOA 1YS7A 2HLHA 3TFWA 4KJXA 3UOGA 2H5JA 3QTLA 1TE2A 2QAIA 4L0DA 5T4EA 4I5EA 5L4SA 4NNPA 2AN4A 1ADGA 4BO9A 2QL6A 1A4RA 5C0OE 4KRFA 2Z2JA 4A03A 2F1HA 1IN6A 1E2EA 3ML1A 1CUAA 1DAKA 2QN7A 2ZJ7A 4CV3A 3BFJA 4MWCA 4WOBA 1DWPA 3FBTA 1U7HA 1ACMA 4JITA 4MITA 4II2A 1GM5A 3CLTD 4DNXA 4GHWA 1GUBA 4UU0A 2C9ZA 1O5IA 3JWJA 1PTJC 1NQXA 3O31A 4IY1A 5TQ2B 3GJQA 1G17A 1EUQA 3DDZX 1U1CA 3BXZA 3L04A 3ND9A 2VHCA 3NKFA 3PD7A 3FOCA 2W4QA 3LYUA 4G01B 3UXHA 4AMGA 1R9GA 1OIWA 1V95A 3LU1A 4HZUB 4BNXA 1IYZA 4BTVA 1AIPA 4UARA 4Y6QA 5DNEA 1CUYA 4IIGA 2OAQ1 3L6OO 1YHNA 4YDQA 3OT1A 1F8XA 2CFOA 1T3TA 1OVMA 3NJ8A 4OHMA 3QXHA 5AK3A 3T1YB 4RVDA 5TVKA 3MEQA 4F96A 3QELA 4NFHA 3ENVA 2UZ1A 4IQ4A 4RIFA 3VC1A 3OE7D 2E2WA 4LZOA 5AVVA 4CR7A 2JC3A 5CDHA 2VRWA 5DYYA 1RYHA 4DYDA 3MYRA 2GCNA 3OAAA 2FMHA 4TZKA 4I6JA 1YRWA 2EJVA 5KNDH 1PN3A 1K8ZB 1G63A 4J29A 4LYJA 4OF4A 2XUIA 3W4IA 2A84A 2PBZA 2WWRA 3CFYA 3DWGA 3LRXA 2FU5C 1OGYA 1Z22A 3C5VA 2XUAA 1XBTA 3L8YA 2IODA 3M9LA 5LLSA 1T2UA 4MKXA 1U0BB 2BCEA 3WB9A 3EHEA 2EFHB 3E2IA 3O5AA 1LSUA 5CLLA 2RGEA 1XA3A 3T7KA 2ZRFA 1WMEA 3TQIA 3LCMA 2HA5A 4JR2A 4IIEA 3SE7A 3IPCA 1T5DX 5KZMB 2XXAB 3IQFA 4YASA 3ROMA 4ZK2A 4XDYA 1BE6A 1LX6A 1CJCA 1NFRA 1XVAA 1Z74A 5KJFA 2ZBUA 2LBPA 2VPQA 4P7KA 3C98A 3OZXA 3HO6A 4XWYA 2F8SA 2DWPA 1C0KA 1TYZA 3ABSB 4M86A 2P9CA 2YIDA 2CSXA 5CB4A 3EIEA 1NN3A 1M5RA 4CKXA 2G4VA 4O2AF 1E59A 4NCJA 2V6BA 3PCTA 1BVRA 3O4FA 4AJ4A 4OGLA 2IZZA 1RYYA 3DDOA 3PRYA 1BWSA 3GG2A 4QYIA 5DASA 4EFMA 4OYHA 2MHCA 5IW8A 1TKRA 2Z4RA 4QQNA 5A4DA 1O87A 1RZRD 4C0WA 2WHPB 3U4AA 1UPXA 3ZEIA 4YCDA 4YRFA 7YASA 4HF7A 4MUMA 5HF5A 3E22A 3OLQA 2GEFA 4ND5A 1Z68A 4D3DA 2I2WA 4IZIA 3G2HA 2YJNA 4XGRA 2PA0A 1JLKA 3FSEA 5FTLA 5F9HA 5ALDA 4Z4EA 3JASA 5DHRA 3A10A 2WSSA 2HU2A 3KKLA 1QHFA 4NFLA 1DNPA 5EZYF 3HXMA 1DKNA 2NSLA 1RR6A 4TLLB 5LOVA 1MX1A 3D3JA 4HG2A 2IEDA 4PQGA 4AKEA 3L7IA 1SGWA 2IDMA 2IY8A 3Q8MA 3CLRD 2AF4C 3HZOA 1OJ7A 3GXOA 2O1EA 4OK5A 1H2YA 4B3HA 4URFA 1LBSA 3E7XA 4W7SA 3C4JA 4ZJZA 1XF9A 3WYCA 5G0SA 5BQ3A 1ZYUA 2BFCA 4OGFA 4OP2A 2GPAA 1J0XO 1WUIS 1SFRA 1LI5A 2OAEA 1B6RA 3UJ6A 4DMLA 1ZR2A 2ZZMA 4JUIA 1EFPB 1NASA 2I4NA 3RVRA 3M5PA 3GL9A 3BF7A 5BYJA 4JVLA 4C21A 3NHMA 5IYZA 2GUGA 2FQ1A 5JNLA 1Q0UA 1DQZA 4D26A 3DTYA 3FKQA 3TQSA 1UEIA 2OORC 3U1VA 1QP7A 1WB5A 2ZBVA 2J9RA 4GLFA 3EXG1 1X39A 4PE5B 1MG0A 3L7CA 4MJ3A 3H2BA 3HM2A 3WHIA 5HJ7A 5KNBD 5TVGA 1O94C 1Z3CA 4LOIA 2DETA 4EJSC 2X86A 3V7YA 1G5HA 1NATA 4Z1MA 1E3IA 4L5YA 3RGGA 2OCDA 3BULA 1ZMRA 3PQ4A 4ZVVA 4UULA 1ORHA 2VP4A 3IV6A 1RP1A 4DBZA 4E31A 4YT4A 1Q7EA 2XAUA 3ADOA 4Y2YA 4R1TA 3UJ3X 4P92A 3Q3VA 5CVDA 1E1QA 2VJOA 2ZAGA 1YJQA 3IUSA 1TD1A 1PJ4A 5EI5A 3PKJA 1LWOA 3ONFA 1X7YA 3W5DA 3AFIA 2AEEA 1ITZA 1QK4A 2DJ5A 3KKKA 1ES9A 3ZQ4A 3GAMA 4M1TA 2X0NA 1KYYA 1PQYA 4DEVA 4N0DA 4XGIA 2O4CA 1P29A 2D0PB 2IKQA 4N65A 3QX3A 3LS2A 1IHUA 3DEAA 1AMNA 4OLAA 1ZO8A 1JLHA 1NG9A 1T6NA 1SAYA 2B36A 2J6BA 2X1VA 4DR2B 2DFVA 1SUCA 1NF9A 4BIIA 4YR9A 1NBWB 4AO7A 1RDFA 4KYUA 1J0CA 2CJWA 5EUCA 4A91A 1MQ9A 1BRTA 1W6UA 5CIYA 4QSMA 4L2IB 4IJQA 1DRKA 1YZHA 1MTZA 2X0FA 4A8JC 1SKAA 1LSSA 2GTHA 5CYGA 2ZUSA 1RJ9A 3IQIX 1KDRA 1KVQA 3HRIA 1G3RA 4HJRA 3ZU3A 3HWRA 2BMEA 1PK9A 1GRNA 2GK4A 4FYPA 4L22A 4L78A 4O33A 1V39A 5KNLA 1DKOA 4KPUA 5CVVA 4C0KA 3O0DA 3AEXA 3C5WP 3EEOA 1P1JA 1VSVA 2X9QA 1P3Y1 2D59A 2GO7A 1Y8CA 2QS9A 3EK2A 3O2SB 4B7UA 3MK31 1R16A 1YXMA 2AZMA 1X7ZA 2H16A 4MUKA 3DW1X 3H4IA 4LQCA 5DNDA 1DHTA 2WF5A 4WX2B 2HA4A 1YACA 3D8HA 2PTGA 5DB4A 1IEWA 1LDGA 4OHWA 2NNLD 3IBYA 3MHPA 3QU2A 3N8KA 3TLCA 3PI6A 1EQ2A 1ZJ4A 3LQKA 2EIHA 4Z9FA 3UUFA 4D02A 5C18A 4TKMA 4K87A 1VPLA 1M54A 1H9AA 1WCIB 2BGIA 3PWZA 2DXIA 3MTQA 1TA4A 2CCGA 4BO4A 1YIAA 4B2IA 2E49A 4QHYA 1S2NA 1NW7A 1Y1TA 4AZSA 2OV4A 4I7EA 4QHSA 3RAEC 3MGCA 3EDYA 5IT5A 1KHTA 1WTAA 3SYNA 4Z6KA 2A5FA 4BWGA 4PPNA 3UB4A 1YCGA 3OKCA 1A69A 3A3KA 4K3UA 5KSZA 3UXEA 1Y9EA 3B13B 4ZQIA 1JFFA 2QQFA 1DX6A 1K08A 1G8GA 3KZ1E 2D8MA 2JBHA 1XVTA 4GPAA 3BZWA 1NJGA 3SX4A 1Z7EA 1GPJA 4RBNA 4OAPA 2EFJA 1CJVC 3V9PA 2HYDA 4JT2A 1IOVA 1NW8A 1LBIA 1J56A 4HEA6 4V0OA 2G4LA 1VLZA 3LQRA 1O94D 3HY3A 5ESXA 3GVIA 5JXJA 3PPIA 4PYNA 1Y5IA 4KITB 1MO3A 4R7TA 3LW7A 4ZAGA 4YXWA 5LFAA 2WVAA 1YK0A 3JWEA 3UT5A 3SM9A 2VBCA 2I99A 3JQAA 1ESNA 1YR1A 2IKSA 3RTEA 2C8KA 3U2QA 3K6SB 4CMJA 2E85A 4JXJA 3LP5A 4DR6B 3DOHA 2WJ4A 4G5HA 5CLJA 1EGAA 4QDJA 1RAEA 2XEDA 2ZKIA 2IU0A 3SS8A 5L45A 2CV0A 4O08A 2VQFB 3KBOA 5HW0A 2DH5A 4Q34A 1G1AA 2ETVA 4V0NA 2RB5A 2X4IA 3OQVA 5AQ1A 2NT4A 1TLFA 2OOSA 4BPRA 1DEOA 1PQPA 3HBMA 1XMJA 1WHTA 5KSWB 3EVZA 4JSRA 2YVKA 4MGYR 5JWHA 4D9JA 3PKIA 3FFTA 2FF7A 3ONWA 3QEMB 1XZCA 4KO3S 2Q1TA 3GH3A 3P9YA 4UM9B 2A58A 1RRMA 5A7FA 5B3KA 3OJWA 5FTMA 1F48A 4AZ3B 1KDPA 3TZKA 1K97A 4FW9A 3LD9A 4IINA 5EP4A 4COOA 2X0IA 2Q3EA 2ODEA 1RQNA 2BGNA 2P62A 2PVPA 3MT9A 3RYFA 1XA4A 3AETA 1PJ2A 2C4VA 4X62B 1TYCA 1Z88A 2LP4Y 3GJ6A 2OFPA 1OMOA 3FSGD 4I50F 4TGLA 4UVEA 3MINB 1XD2B 3Q4GA 4OXXA 4QOEA 3SIRA 4DMGA 3IT3A 2XB2A 1JJFA 3OJXA 1EEXB 1VGRA 2WHEA 2H0AA 5JSHA 4CFYA 2NU7A 2COEA 2ZJAA 1U94A 3H1BA 2WSBA 4TKZA 1M1YA 5ILOA 1LXCA 1Z0IA 3NH6A 2QTTA 2CLDX 3G1WA 2JGIA 1P60A 1E5QA 1K8QA 5TC4A 1SWWA 2R68A 4NOMA 4HDMB 1H4SA 2WT4A 3AB7A 3BSWA 3JSAA 1E32A 4M9UA 1X8JA 1KGSA 3H16A 4OEHA 3ZK7A 4BWFB 4FKZA 5CXQA 1WXDA 1JQLB 3A1DA 3PNVA 3S4YA 2HJGA 2PGIA 1PGPA 2O2IA 3MWYW 1PLKA 5AJTA 2YMPA 3NU1A 3WVNA 1XNHA 1DC3A 4H35A 3C3AA 4RM2A 3V1KA 1M2OA 2WIBA 1O3YA 4X90A 1QYXA 1RYNA 3VR4D 1FNSA 4D9EA 2G5CA 5ALPA 2BHTA 4TWRA 4PX5A 4FT4A 2CHUA 2ZUDA 3STHA 5KOJB 3S5JA 3T38A 3F3SA 1E77A 3KO8A 4NBRA 1B0AA 1Y4AE 1T2VA 3MJVA 1GQRA 3EVEA 4QJIA 5L3ZA 4J2TA 3OCXA 3TH5A 4BMDA 4CEHA 1OFGA 4LQDA 5BQPA 1KI3A 1EGQA 4HLUA 1JB9A 4GRIA 4Y2SA 4YCNA 2JDIA 1SBHA 3HKDB 5E6UA 4YGYA 2DKFA 1QR2A 4WY2A 5F77A 2Y27A 5EJ6A 1LWNA 4A6DA 1DAOA 4C01A 5MF6A 4XR4A 5HBGA 5IFLA 1I30A 5IBPA 2REXB 5EG5A 2EHDA 3H5AA 5ECDA 3SS9X 2H63A 4W5RA 1S2DA 1L7PA 1VKHA 2OYCA 1N9GB 1X8LA 3JX9A 4PQYA 4PPQA 3WK4A 2EAUA 2C5HA 5BT8A 5ERYA 1B41A 1ODSA 4GP6A 1M6YA 3X1KA 4WCFC 4X84A 4LCBA 3BH0A 1TOAA 2F1KA 2JFBA 2P2DA 5FF9A 3LYHA 3ZW7A 3AV0B 5CW2A 1EXMA 3PUZA 3ZGXA 1JH9A 4PBTA 3TIIA 4BMVA 1EYZA 4B9AA 2LGJA 1IZ7A 1DI0A 2Q5EA 3SXUA 3AF2A 5KYGA 3HO1A 1REQB 2BBOA 4IGFA 4NDAA 4B47A 3HSSA 4HAZA 4GDFA 1L5MA 1VB5A 2OHVA 4FGWA 2BTQB 2QRGA 4ACAA 4ZCRA 3BQMB 2GJAA 3HLYA 3QTBA 3OWOA 3TIXB 4GBJA 1SU8A 2BFDA 1J8QA 1RYFA 3CJRA 5SYMA 3K8ZA 3DVRX 3DWFA 3QVSA 3A4VA 5CK5A 1RXWA 1V41E 1F2DA 3W7AA 3A3PA 2XLCA 3DE3X 4Y2GA 3RTCA 3CS3A 3PDIB 3WAGA 2EP8A 3VC7A 1NFFA 2FSPA 4A73A 4CKZA 3UF0A 2GESA 1P2GA 4BN0A 2HIMA 1JLRA 2I2CA 4LDQA 2AJLI 1Z38A 4BO2A 3O73A 5LN1A 1GGFA 5AKZA 2EL7A 3ZWBA 1TM3E 4XLZA 4Z9AA 4EJMA 2P9BA 3DZGA 3RCBA 3TX2A 1AV6A 2IYSA 2X41A 3RGWS 1DFIA 2XE6A 1U7DA 3EEQA 1T0JB 1E3WA 4AM8A 3WYEA 4EX7A 2I71A 5K8LA 5C8YA 2C31A 2G25A 3GHHA 1Z4QA 1T9ZA 4O5AA 4FC7A 4ENSA 4OQLA 4JLPA 4YXFA 1S8FA 2IRWA 4BL5A 1GR0A 3L0ZA 1M5TA 1LPSA 1RC8A 4DB2A 3SG0A 4TT3D 4B7CA 1QO7A 2M1XA 2RC5A 1FDOA 3W2IA 3KUXA 721PA 1TUEA 3T1NA 4RUKA 1UJBA 3Q6MA 1D6NA 3HZHA 3UKDA 3RIMA 1FMTA 1QDLB 4ESHA 2UYQA 3KJHA 3ETHA 1F20A 3KTAA 4P53A 3EQ6A 2AMVA 3P52A 5JI3E 5EEHA 3RNOA 3CJQA 3G9QA 4LVNA 5IH3A 4BVKA 1IRIA 3O2QB 3U19A 3O26A 2JD1A 4E15A 1OXTA 3K0BA 3QUQA 4YT5A 1BEUB 1P6QA 1WIWA 1OZ0A 2P1DA 1YMQA 4M76B 3KQWA 3RDPA 1EEHA 1CX9B 1HYEA 1FU4A 3BIXA 1J97A 2D06A 3KV3O 1Z4NA 3LZCA 1N3YA 3CUUA 4OQEA 4POOA 2FRXA 13PKA 4HRAA 2E4YA 4MR9A 2BGUA 3L1VA 2VAVA 3DMDA 3MQ4A 5FV7A 3TXYA 2B2CA 1W4CA 2ZOSA 3WZ2A 4BLOA 1NVMB 1I14A 4IAOA 4PWYA 1IZ0A 1BJTA 1MFZA 3T1QA 2MT9A 2P8SA 3ZGVA 4M1WA 5IPFA 5K4GA 3KAQA 3HBFA 4Q4CA 2XDQB 2AFIA 4A0GA 4UC0A 3U09A 2RAPA 4F3KA 2JFQA 2DPHA 1T6BY 1JTEA 5MN6A 3VYVA 1RVDA 4ZMRA 1NW6A 1XU7A 5SV2A 4MYDA 5CA1F 3TQOA 5I4CA 4E12A 2PRIA 1AVTA 4ZOLA 4D92A 2O5RA 3MRVA 3P96A 4MB2A 3H9BA 1JJ7A 4O4JF 3UJ7A 1C1HA 1JI0A 3EGOA 1YJ8A 2XVAA 1ECCA 4FR5A 1UANA 4YI5A 1NGSA 2A5JA 2ZSEA 4LA4A 2ZYUX 5DIZA 2ES4A 2H65A 1GZ6A 4GI2A 4JLBA 3KAKA 3DB2A 3T3EA 3AQIA 2ACWA 2YCLA 3TRFA 4CTOA 3KAJA 3G68A 2J5KA 3VAYA 3DBLB 1CULC 1VLHA 3OFKA 4UUAA 3K2IA 2W6QA 1DXOA 3DHWC 5GY7A 1ODLA 4ABYA 3RIXA 5J23A 3UQYS 2VCHA 5CCDA 2OZLA 1I36A 1NG1A 1OPXA 2F17A 1BMFD 4XVQA 3U62A 4RY9A 2P2ZA 1U02A 5IRCD 4W5TA 4C03A 4EHHA 1LDMA 1ZVJA 1SR8A 5KVQA 1J0AA 3KJFA 3LUJA 4CM8B 2B94A 1SC3A 2BELA 2O6LA 1N9ZA 3ISJA 3ND7A 2PGJA 4IGKA 5COQA 3RSFA 3L7YA 4HNVA 4JV5B 3OKAA 5IWCA 6ADHA 3RAFC 4EPTA 2I5PO 4CEJA 4ZO6A 3ZJUA 5GJWC 1JH8A 1VRCA 1XZJA 1X14A 3S2YA 1EP2B 3CNLA 3KHKA 3AUKA 2J5QA 5H80A 5IMSA 4FFOA 3ESYA 2GPWA 2W6ID 4G0YA 2WJJA 5JSKA 5I9MA 4MQUA 2CXXA 1T0PA 3SSOA 1ZMOA 2ENWA 4NYJQ 3K1YA 3BMNB 3HCPA 4NE9A 5C5EA 5EUBA 3WJ1A 2GK6A 2HDWA 3LC0A 4BZXA 3OTIA 2GEJA 5BV7A 5BRJA 4LEIA 1WW2A 4LBYA 1G8PA 4QXQA 2PUFA 1WVMA 2ZUTA 1P2SA 1P2DA 1VKZA 4UD6A 3P0EA 3M89A 4TTTS 3T5BA 2XMRA 4GWGA 4MQMA 4TV8A 4C88A 1BTOA 2IHTA 2PKYX 3H13A 2ICAA 4OH7A 2JRCA 3OLVA 4MAFA 4IS3A 1II8B 3GBVA 4QVKA 4WN3A 4Q24A 4D8XA 1UJMA 2DHCA 5J5VA 4YRNA 2OV1A 3OP1A 4G5RA 3KOXA 4M22A 5H7XA 4KO8A 1YR2A 2VQ3A 2PQ2A 5TRTA 4EYSA 1MB0A 3T12A 4EPWA 3HR7A 1GNRA 2BN4A 2NQ2C 1RC1A 2JK1A 5BSUA 3UO8B 5LMNB 5DI9A 2FV8A 1PGNA 4R9RA 1JKFA 4MXDA 1TFRA 1QFXA 5K05A 5D8DA 1NL3A 1US8B 3L8EA 4L8LA 4XWAA 4KMMA 1VLMA 1O0SA 1YGPA 3BG5A 3ORHA 4RZHA 1RPTA 2GERA 2C04A 4K2AA 1NU8A 3QE3A 3M6MD 5FBWB 3VZQA 3ZDQA 3GGGA 4F06A 4ZI5A 9LDBA 2AQKA 1EJBA 4NDNE 2PRSA 1ZK3A 3BQ9A 3KUUA 4Q3KA 4BBAA 5THKA 2AX3A 2AG1A 2HV8A 2V9PA 4LQ4A 4Y2VA 3ABIA 1IRXA 4S2UA 3NAMA 4MO9A 4B6QA 2E5FA 3M83A 2IL1A 4QGGA 1ZESA 3LBHA 3A6HA 2DH6A 2W58A 4H15A 4UPVA 3I45A 2XYHA 4X7BA 2M32A 1BCSB 4CQMA 1EDZA 1P5RA 2YY7A 2EHJA 2I3AA 2UAGA 2W98A 3OICA 2WFMA 3Q6IA 4G5FA 4G0VA 2W2KB 2B8JA 2L19A 3AL0C 1U9CA 3PFBA 2O5VA 4GSYA 4I6GA 3U49A 5EJEA 5FWYB 3EVFA 4NV1A 2AUNA 3FI9A 3FRIA 4RS3A 4R3NA 2WV9A 3M2PA 3TR0A 1KK2A 1JG6A 1MXFA 1GTVA 2EX4A 4QU5A 2HBYA 3VU1A 3R9XA 1W29A 4PWZA 2DE0X 4QECA 3ZZ0A 2ZWPA 3WGNA 3V4FA 1S96A 1WOMA 2XRZA 2QL5A 3MLEA 1XALA 4U2CA 2ET6A 4PQEA 1YS4A 5CPFA 4LV6A 3WSWA 3PR3A 3HKBB 1U0LA 1I6LA 4O4IA 5E3JA 3FROA 5EVJA 5AVTA 3DP7A 1CNMA 4L27A 4RF5A 1UJ4A 1GYQA 4PG6A 3ECSA 4OQXA 3ZWXA 1ISFA 3CKLA 3DMPA 3F5QA 2VZ9A 1JDTA 4RHEA 4XFDA 4PYMA 1ORRA 5BSTA 4LS3A 1KFJB 3EFHA 3HNPA 3T5TA 2WJZB 4CM4A 1DKMA 3TMAA 2NTVA 1T9GR 1OFTA 3QVVA 1DFHA 1EG2A 1FBTA 3G2MA 4B46A 4BTEA 1SEPA 2GQ0A 2FHPA 4UZSA 4BWYA 4EUEA 4LTMA 4P58A 1XTKA 3GAAA 2HF2A 1I4LD 3QUBA 4B31A 3O95A 2PMFA 1DXHA 1AB6A 2GFHA 3ULKA 4DMUB 4P4LA 1M7BA 2W6CX 1CRWG 2FPSA 3DZKA 1MKYA 3KWMA 3LCCA 4PC7A 1MA3A 2C2KA 2C9OA 1OWLA 2I8LA 3SNHA 2VHWA 3RREA 4KX5A 2FF5A 3AU8A 1EVQA 3UV7A 2XT9A 3CF2A 2YZNA 1B8NA 4S3MA 3DP9A 4AECA 1POWA 5G1OA 4KXQA 1AQJA 2PIDA 5ITZA 1D0IA 1L4MA 2G0AA 3PT5A 1WSBA 4K9SA 1AKMA 2X4GA 2AC2A 1RWWA 2VPWA 3YASA 3ZG6A 5T6MA 1MMFB 3KQPA 1DG1G 1UFKA 4UAGA 1NHWA 1T6ZA 4MV0A 3UUGA 4E3WA 3ILYA 4YCMA 1E1YA 1N0WA 2J1LA 3FRJA 3FHLA 3GCDA 1ML4A 1FPQA 2PY6A 4HLNA 5DHPA 3TNLA 5A05A 4C3OB 4X66B 5LB2A 3QE2A 5DEIA 3VHXA 1UDWA 3W2HA 3WXMA 2WSSD 2ERCA 3K96A 3DL4A 4P4SB 3P0JA 1OX4A 2VDMB 4CKEB 4FILA 3JVVA 2QU7A 4Q1DA 3ZH9B 2JJ2A 2J3IA 3FCSB 4WINA 2X58A 1RAFA 1R64A 4L0MA 3GP5A 4O5OA 3WO0A 3NALA 4ZU1X 4AJ2A 1LPOA 1MX9A 3FKSA 3L1HA 4V1CB 4Z4FA 1DJLA 1GPLA 2PRJA 4J76A 4ZDWA 5BN3A 1CEEA 1VCOA 2DX7A 3G2OA 3L1IA 4YV1A 2HJRA 1VLLA 2XI4A 4KR0A 5AW8A 2HJWA 2JIZD 5JWOA 3KKOA 3QEJA 3Q2KA 4DDVA 1ZUWA 2WYUA 4M60A 4R2JA 4ZCTA 1LTKA 1EUDB 3OO1A 5FQNA 4F9TA 4N3CA 4JLSA 4ZT6A 3COYA 1FFDA 4R1OA 1BMDA 3LT4A 3MZ0A 3BRSA 4WRRA 2CF6A 1DWUA 1E6EA 4MO2A 4YCJA 2J9GA 3TJRA 1ESEA 1S5PA 3B8EA 4FI3F 2QPAA 5T7BA 2OBLA 1TJ4A 3N2ZB 5KHAA 4DV1B 3C1TA 2JAOA 4N40A 3VU9A 5LQKA 3VPDA 1NQTA 5JRJA 4HGOA 2XB9A 4BAUA 2J32A 4YREA 5LPNA 1TUIA 1RHKA 2I67A 3C3MA 3PTLA 5C7IO 2KBEA 1R5OA 2VHXA 4UTZA 4PIVA 4RKQA 1YVEI 4Z1MD 2BWJA 2WLTA 4FZJA 1R50A 3FLEA 4JU8A 1I32A 1AHHA 3TVDA 4EA9A 1M7GA 2I22A 3C1OA 2XNDA 1QANA 1E0JA 2GAOA 4RHTA 1YVDA 4ESVA 2OB2A 1NDHA 3SHFA 1W0CA 4U5XA 1ISJA 2PNFA 2XITA 1S89A 4HAVA 1PSDA 2FETA 2Z4TA 3G2KA 3S1AA 3EFOB 3P9KA 1XJ5A 1Z25A 1Q17A 2PZGA 5DX8A 1WNFA 4DS3A 4DV4B 2QL7A 4D0GA 2DUMA 2Q4EA 5HYVA 3WZMA 3ZZTA 1O8BA 4NV3A 3RYHA 2HWXA 1U90A 1QZUA 3GP8A 3MRTA 1GFZA 1R0SA 4B3BA 2FZCA 4OMUA 2P27A 1BDJA 1PZFA 4Y6RA 5G53C 4DLKA 1FXUA 3S2GA 2N3ZA 1JXMA 4K9LA 1ZD5A 3PFCA 3CGGA 3C97A 4XDGA 4E5VA 4PNEA 1CEYA 3HCCA 1QDUA 2XCQA 1TW2A 3EZLA 4MQEB 1D4AA 4XQ0A 5KYUA 4QRDA 4QXAA 4D25A 3E82A 2X8JB 4OH1A 5BSHA 4QFBA 3NCHA 2YWXA 1N0HA 5FB3A 4P08A 3P45A 4XYEA 3G7UA 4ZVKA 4X9XA 3OCCA 4ND6A 5ALMA 4WE3A 1PT6A 4TMTA 1WF3A 2DUWA 3FI0A 3IUMA 3NHZA 3ZY2A 1QYIA 3SFZA 5IAOA 2FWRA 1P6UA 4PZEA 3GAFA 4N1AA 2V7EA 1FFWA 2FY8A 4OXQA 1HFEL 3G0OA 2XNKA 3FPBA 4KP7A 3R23A 4B4KA 3CLUC 1IPEA 4DFDA 4ZEVA 4UOZA 1W2HA 5CGQB 2RK4A 1WV1A 4OHFA 5F7ZA 4B80A 3ADDA 4QXPA 1OWNA 1E3TA 1JXQA 1NT4A 4KACA 1LLQA 3TOCA 2VXOA 3ODPA 4NJEA 2O54A 2WT9A 3IB6A 621PA 3K5PA 1ANKA 1E89A 2AG8A 2XZDA 4CG1A 1U1GA 4QSHA 2ZBFA 3KIPA 2WZBA 2Q3BA 3EVAA 3D6VA 1JXOA 5DBOA 1MW9X 4ALLA 4DR7B 2YJ5A 3DYVA 5KQRA 5LMCA 4NENA 1KEZA 3DV9A 3AUFA 1S2MA 1RHJA 4OJKA 3CO0S 1S02A 3G5AA 5BUQA 2PU5A 3PBKA 1W52X 1TI7A 3SXJA 4IEIA 4GNRA 4CMIA 1C3EA 1JQKA 2RGCA 2BFEA 4BO7A 2XB4A 3F4BA 3ND8A 4REQB 3H99A 4WXYB 3KXDA 1KEEA 1PR9A 3E22B 1EJ6A 1XMOB 1L3BA 2ACVA 2JZCA 2WSLA 1BKDR 5CT8A 1JTFA 4DNOA 1Z8NA 1YI0A 3HYLA 1N2BA 1GNTA 1KC3A 4BB9A 1NN1A 2O8BB 2VSQA 4Y30A 4KHZA 1V8BA 2F90A 4MAAA 2PX4A 1BYIA 1SQ0A 5H5JA 2AS0A 1KETA 4GWKA 3SSAA 3VDRA 1DUIA 1KJZA 4RZSA 4FNAA 3ZE9A 3B3JA 3MWKA 3FFAA 2PUCA 1THTA 4FYMA 1F6WA 4TVBA 2A9OA 4ZKEA 5C1OA 4RVFA 3ZWYA 4WKPA 1K0UA 5F1YA 1SCUA 1U8XX 4EF6A 1ZAYA 3NUQA 1F0PA 5TQJA 4CIYA 5ERXA 1TM1E 4AZ0A 1P9LA 3CUYA 1NZJA 4KFUA 4YXWD 2FMIA 2Y05A 4GOMD 3RVLA 4BGUA 3JQAD 4W7IA 3FUCA 1QZ3A 4KPGA 4XUEA 3R20A 1X7GA 2IYNA 1AXRA 3PA8A 4Z3KA 3BSSA 3QPAA 3AMVA 3A1WA 4HH4A 4G9BA 4IXWA 1ZQ9A 3WA6A 1PTKA 2HDHA 5H02A 1IG0A 1JEQA 2ZUVA 5BNFA 1F0YA 3RUHA 5H1YA 3HWSA 3TW8A 2FFQA 3VU0A 4ZYLA 2RJOA 4IFBA 2IY7A 3SQXA 3D81A 2BE7A 3A4IA 4OHUA 4ZZ3A 4U02A 1KKUA 4UNRA 5FHRA 1OI3A 2XNHA 1GT6A 1ZP6A 4MUNA 3ZV6A 5KO2A 2G1AA 3MF4A 1IN8A 2BUBA 2VHQA 3ZHUA 1RLUA 3M0EA 5HF9A 4JP2A 3JARA 5BPHA 1UDBA 4JBIA 4RFLA 1C2TA 3LM8A 3O9MA 2DAPA 3IKMB 3JQDA 4MCAA 5JXGA 4KR2A 3VTAA 3BK7A 3ESAA 4P83A 1SXHA 4WFKA 1HYBA 1LS6A 2WTUA 2BKUA 2QLBA 1DT3A 1GQYA 2J4FA 2QRKA 3DXFA 3WLAA 4G89A 3BF8A 1FX1A 5J2UA 4MX8A 4F5DA 1RFLA 2QUHA 5CVUA 5E4JA 3TKYA 3ND6A 3ER6A 1MJHA 2WAAA 4CG3A 1U9IC 2WUEA 3TWOA 4RKYA 2IHJA 1X7YB 4O4HB 4QUHA 5CIWA 2ZPTX 3A1NA 1AS3A 4KH1A 1UJCA 1J5XA 3O8QB 4BRWA 4MWBA 5A3VA 1QMPA 2WTNA 3TGPA 1CHNA 3CR3C 2EJUA 3UC5A 5DDIP 3HBAA 1DEAA 3NXSA 5HBRA 1P45A 3IP1A 4QM6A 2VHJA 2VA8A 1C0PA 1JWAB 1W581 2I6QA 1YVUA 3NYQA 5H9WA 1ATZA 3UGTA 4QOHA 5TPWB 4HL6A 4PHGA 3VYWA 5CUQA 2WNSA 2P2YA 4DCOA 4KN5A 2R60A 3GJ8A 4U7JA 4U7FA 2QHXA 5F35A 1DTEA 4OHXA 2C4KA 2CJWB 4K9PA 4HATA 3IAM1 2XUKA 1B6GA 1FBNA 3BE5A 3PUVA 4MV7A 5AJZA 2J9YB 3IEKA 5DM4A 2DCMA 2GM3A 5SICE 3GO4A 3K0CA 5F4ZA 1RJ9B 3QBVA 4Y0AA 3WNCA 4V0LA 2AI2A 3VVBA 5KWSA 4V0MA 5CMLA 1UDAA 1EVJA 1J8FA 1ZS9A 2K2WA 4AWAA 2H7YA 3I32A 4ZFNA 2OHXA 3H8VA 3VPBA 4B8ZA 3QX7A 3ILSA 3O1LA 3AJAA 2FXVA 3LV8A 1USIA 2RIPA 2ZRBA 2JDID 3RJTA 5ENZA 4HRVA 4CLDA 1HLFA 1GA6A 2H9YA 4LVUA 2JFNA 1ZXXA 3HB7A 2O7VA 2J4DA 3EPRA 3EJ6A 4OGKA 1OLSA 5EWMB 4I1SA 3T1HB 2VHZA 1HDGO 1P44A 2V4UA 5FHQA 2OY0A 2XOKA 1X1CA 1MU0A 2CZQA 3G0CA 1K4YA 3NIBA 1KI4A 3NRJA 1LTQA 4JX8A 4MK4A 5HKBA 1BDBA 2GEBA 3KTDA 4QJ4A 2H7VA 4L5IA 1K8YB 1QGZA 3PV0A 3PUYA 2NU8A 4DKXA 1Y63A 5C34B 1SCAA 1ZVVA 3JQ8B 4LDRA 4D6PA 1Q0ZA 1RPAA 1HRKA 2TMDA 3AWIA 1KH2A 4LNAA 4UVDA 5TPZA 2DC1A 1C1DA 3D4PA 2C77A 3QY0A 4HNSA 5EIXA 4DRYA 2DM6A 5K8IA 1SD5A 4G4JA 1OH6A 4P0TA 1ABFA 4BX3A 1U2QA 2YJZA 2VJMA 3QNMA 4L8GA 3V8QA 4CTKA 4ZI7F 5ALJA 3TW0A 4QATA 4D7AA 4WEQA 3ERCA 2V7QA 3HDTA 3OPMA 2IHZA 4XRRA 3DT9A 2QZ9A 1BS2A 3HBNA 2I7DA 2JI8A 1NUUA 1QZZA 2CMFA 3W2FA 3EMKA 1LV7A 2CEAA 5FBHA 4CF4A 3ZDCA 1U7XA 2DHQA 2LNDA 4MQ5A 3TCKA 3CH6A 2WJPA 2RBEA 3L7DA 4ZJYA 5IXJA 2A0UA 4P32A 1B8PA 4DA4A 1PLJA 3WLJA 3E8XA 1TO6A 2HA7A 3AFHA 3H83A 4M1SA 4C0JA 4CQNA 3L6UA 4IFIA 1OFUA 2E4UA 3HU1A 1B4DA 3K9HA 4FYYA 5HCNA 4AJHA 2HU7A 2X6TA 4JOCA 4D46A 4OMDA 3GPDG 5ECWA 2Z1DA 4D4MA 4OGGA 2P2SA 2EFEB 1EFHA 1GUYA 2XNCA 3RC8A 5EJFA 2AOXA 4P3XA 5AM5A 2HJHA 2GAAA 1RIFA 3S1SA 2CL7X 1F38A 4XJTA 3VDMA 1D2EA 4X8MA 4HMOA 2Q27A 1CF2O 5IJAA 4ZI7A 1BWQA 2W22A 1Y3BE 1M2EA 3HSKA 3RH0A 2BGJA 4EA7A 1GLVA 1OUMA 2O2XA 3DV0A 5BQFA 3PA6A 1CB7A 4BFVA 2K2QB 1LRJA 4ALKA 5SZIA 4N54A 4MLPA 2VT7A 2XZTA 3UPTA 3E70C 5KCMA 3ZV7A 3TVYA 2MIIA 1FOEB 3ELDA 5CX1B 1S4MA 5DGCA 3WLNA 5AM2A 2JHCA 3PWTA 3F97A 3L41A 4M9CA 1FF9A 5DTIA 5JBNA 5KTPA 1YDFA 1JU9A 4PFJA 4O2LA 4LBVA 4NF2A 4JNCA 4OQNA 2QTWB 1H8EA 3QVMA 4HEHA 4OHOA 4OREX 4C3ZA 3G02A 1PGQA 2AWNA 4W5HA 3ASVA 3OPQA 2BT4A 3VMMA 4JH0A 5SYAA 5I7UA 1QV9A 5LKRA 4O3MA 5IT0A 4F7DA 2ZWVA 5IJ0A 2JBAA 4Q5IA 3H3XA 1S7GA 2BFNA 2J6CA 2PH5A 2ZU6A 3SQNA 5K0TA 5LP6A 4MHTA 5H3LA 3ESRA 1E6KA 3QA3E 1JILA 3DSRA 1ABEA 2IPAB 3ANXA 2QD2A 2CVHA 2B78A 1NAIA 4ND4A 1A8QA 1CUFA 2AC7A 2JI4A 3TTTA 3WLKX 2BGTA 3UEOA 4CV0A 1AUPA 4R2MA 2QXTA 4G56A 5T8KC 4LY3A 3LC7O 5ER9A 3WQSB 2VXCA 5FJJA 5DCLA 1U2RA 1KQOA 4F8YA 3CUKA 2XJ9A 3HXOA 1EKXA 1NN5A 1T5BA 1UBKS 5ECGC 1J25A 3QF4A 5J3JA 3CVXA 3E6AA 4AK9A 4DILA 3OLXA 2WAOA 4IOMA 4JLWA 5FFNA 5L7TA 5IDYA 2HPHA 3EVGA 2HW8A 1KC1A 3AVXA 4JBHA 1TGVA 4AKTA 2WZQA 1HZZC 2ZT6A 3MJ4A 4Q4HB 5IJ9B 4HX2A 2EG5A 4MV8A 3EWSA 3LFUA 4DJEC 5KYXB 3CSUA 1JDZA 4UBNA 3GVCA 3VSCA 1GVNB 2WWTA 3A6ZA 3PXGA 2J09A 1CNFA 3AGPA 5FKJA 5K3FA 1OAOA 3F6PA 1XDBA 2R84A 1OLXA 2WD8A 4FDVA 3N3BC 1F8YA 2R8ZA 4ZQCB 1P8JA 2AD5A 4M9RA 5EVCA 3ORYA 4CMKA 2BJVA 4D44A 4DR5B 1KRWA 1W94A 4M8IA 3P9CA 5F9FA 3N2GA 3GJ5A 4QYTA 4AICA 2W2OA 1B00A 2WSIA 3GNTA 5KVVA 1QRAA 5DM1A 3L6BA 2OFWA 1I0LA 1L7NA 4R68A 1K6EA 1UKAA 1YE8A 2Z6VA 3I9KA 2JHAA 3QFHA 2EJTA 1HE3A 5DH9A 2MDTA 4OQYA 3ZKWA 3I9JA 2BUAA 1Y4SA 2NGRA 4YLYA 3IR6A 1W6RA 3M1AA 1M76A 3GEGA 4Z5XA 4BQOA 3CLSC 1UFOA 2G1PA 3HR8A 4R0NA 3WKBA 3GX1A 4X8HA 5FL3A 4ER3A 1RRCA 2JFWA 2YBEA 4M1YA 3GMIA 1WW3A 4QDUA 2Q7XA 2B5WA 4IEEA 3GQVA 2XKAA 3AW9A 3EXIA 4JMPA 2XCIA 3ZE1B 2VG8A 1FNBA 4L5JA 1BE1A 3CT4A 4N9WA 3R7WA 3ZBPA 1DRJA 1IOWA 2ZSHA 1WUKS 2E89A 3D7KA 4MROA 1EXDA 2FJUA 1V4BA 2ZJ3A 5B7QA 4NZZA 1WRBA 1DWOA 2X8BA 4BDTA 1QIHA 2QE7A 4N7BA 2WFZA 4HTFB 2EXXA 3CX6A 3FSRA 3REOA 2YWJA 2JBWA 1YL6A 2HI0A 3LCVB 3PXDA 4G86A 5FPQA 3ZS8A 2JF0A 3MJRA 1XCMA 2YWGA 4N5MA 3O1JC 1CJBA 4Y9SA 2OXEA 3ZBUA 1NP3A 4HGYA 2GFIA 3WK8A 3GUYA 1E2BA 2J41A 4J1QA 2RHMA 5EGSA 5G3ZA 2VJDA 1NI4B 1EWKA 3N87A 3ENWA 2BR3A 4RD1A 3TN7A 2VO1A 1B8VA 3QKRA 1SG6A 3FCYA 4MP6A 4V2IA 3JAMA 1HE2A 5T41A 3VR1A 2HK9A 2HRBA 4MQ4A 1RCTE 2JGDA 1P0MA 3R5KA 5DWQA 3FUWA 1Z33A 5F2KA 2IVZA 4IILA 1L5VA 3GFQA 4R41A 4IR7A 4DVGA 2C7BA 1QYWA 1IC6A 5T3YA 5J58A 3K09C 4HUTA 4CQMD 3U9TA 1E2PA 1HSOA 2Z8YM 4OQ4A 3FNRA 3FJOA 4JXKA 3T3IA 3WXBA 3K94A 1Y8ZA 2YFYA 1MENA 3ES9A 4DZZA 2HHCA 3KU1A 2NXCA 1WXGA 5FPHA 5EWJA 2R47A 3EC2A 4QEDA 4AW9A 5A2GA 5TGDA 2NYAA 5E0KB 3HRKA 2CFSA 1ISRA 2D2VA 3M1LA 1L3CA 3JWHA 1Z8DA 3KL4A 3IULA 2GA9A 4WLUA 5DM70 2NN3C 3QFTA 2CMKA 1FJHA 2OCXA 3OUZA 5A7HA 3ICQB 1Z62A 1U0SY 2NUTB 4OHRA 2HLDA 1PYGA 1U2EA 2FN7A 1M10A 4ZVMA 5THXA 5TY0A 3NWJA 4C7OB 1HDZA 1M1YE 4FQ5A 4AJ1A 3BXFA 3TRHA 3V1LA 4HYYA 3GLQA 1KEUA 2YXEA 5DW0A 3RVKA 5I9LA 1YFJA 4D0LB 3AIMA 2IHYA 1M67A 1DMRA 1OX6A 1RAIA 2LRHA 1Z2AA 4Y0NA 3A8TA 2BMVA 5KDOA 4IIHA 3ZYZA 2Y68A 1UK6A 4MQBA 1N2GA 3NAGA 1D3AA 1VCHA 2ZR7A 1CZKA 2EC5A 3CEHA 3GGOA 3IT0A 1MJ5A 2ZWMA 2BEWB 1SUEA 2NU9A 4X0EA 4YACA 1DC7A 5E6SA 5HCUA 3E9CA 2QAGB 1MIOB 1TCAA 2FCRA 4QGFA 5AVQA 4J0DA 3MWDA 4KWEA 2V96A 4O3FA 4OQMA 3QLVC 5BV2P 2FXIA 3N39C 2PTHA 2B4YA 3L8MA 4EH1A 5AKYA 4KQ1A 3GR6A 4MZXA 2I2DA 3UCXA 2G0NA 1Z6XA 1V26A 3FZYA 4Q7KA 5L40A 4P0QB 3D1VA 4L3WA 2AZDA 1F3LA 5DU2A 5AXBA 2IV3A 3OCUA 2AK3A 2PK3A 3H2JA 3U6BA 3V4OA 2D13A 2A9FA 2H4HA 3FR7A 5LQNA 1N36B 4TMZA 1YAHA 2I2FA 2Z83A 5A5FA 1S3IA 1VA5A 2OK7A 5BNZA 3KHTA 2HF8A 1EWVA 2PGNA 3LDUA 1TPZA 1Y7PA 3DAHA 4MI3A 3W05A 4LYHA 3PHJA 3QW4B 4JEHA 2EL9A 3RV3A 5CR9A 4EVRA 3GRVA 2PHZA 2QQGA 1MPXA 4C20A 3R40A 3L92A 1M72A 4NCIA 3I2HA 2JJ1D 4X1YB 4HDAA 4US0R 1XZIA 1YZVA 2YX1A 5FTNA 4D96A 1JZTA 1LI7A 4RO0A 3NRCA 1YU9A 3SIPA 5JARA 4PVCA 3AL2A 4RPGA 5DBEX 2XMBA 2VDWA 2MSCB 3FKSD 3TW6A 3TSOA 1EM8A 1VCNA 3IE0A 2XB8A 1AKTA 4HBGA 4QOIA 1FFHA 2KSQA 5BN1A 2ORIA 2AHOA 2J07A 1R4AA 1D9XA 4LE1A 5L3SB 1I0IA 1K8XB 3WTBA 1P8AA 3VDXA 2QZ4A 4ENPA 4ITRC 3RSCA 1VE1A 2F3PA 5BYAA 1SOUA 2X8WA 3U4GA 5ADHA 4KBGA 1R5NA 2BEVB 3DT6A 4URYR 3L8ZA 3M6AA 4K0RA 2KBFA 1V5IA 4MMZB 4TPKA 5L51A 5CYOA 1J9ZA 4OIMA 3S2EA 4YRPA 4RZQA 4JT8A 5FPYA 2KQUA 3B9QA 3VKFA 2Q3FA 3OPNA 1LQ2A 1M34B 1ULTA 3LVBA 2BFOA 1UAYA 3FYCA 1PX0A 5EE5B 1Q57A 4PR3A 5IAGA 4O0MA 2XCTB 1EWTA 4QJ3A 5ALQA 3UMSA 2VPTA 5DLEA 1SZCA 2YH2A 1HDIA 4AD8A 4Z3OA 2XNDD 3WIBA 5DM0A 1RBMA 1GNQA 4BKMA 1NVGA 4OUKX 5A0TA 1M83A 2IUFA 2B69A 2Z57A 2CFTA 2FSHA 1XCLA 2W6NA 1TZBA 4G0ZA 2FR8A 1ZG3A 3LUPA 1TX4B 4Q9IA 1L5HB 4OXRA 1T35A 4CLHA 1NJ8A 1Z35A 2C99A 1MCZA 2BHNA 1PFQA 3GMDA 3HXLA 1EA5A 1YT5A 1PJSA 4BIMA 4EB6A 1UXKA 4GPIB 4PINA 3VKHA 1O89A 2IHNA 3A9WA 2P9YA 2UVDA 3CEMA 3E03A 4GOXA 4GPZA 4B9EA 2FPMA 4HGZA 3DBRA 1L5QA 2GJKA 3PGLA 1E6LA 1AF7A 2YVAA 1EFUA 3EMVA 4HJXA 3PKZA 5FBQB 4BFTA 1X70A 3SCZA 2AEJA 2QG4A 3F6CA 4I9HA 4M36A 1UBNA