3R41A

Crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/apo
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
302
structure length
302
Chain Sequence
GHMPDLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGNFLPEEAPDQTAEALVRFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
total genus 118
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r41A00
2VJBA 1JFRA 3MUOA 1JJFA 2D0DA 1EK1A 4BE9A 4KEAA 1P0MA 4DMHA 2JGEA 4K6HA 3QYJA 5C8XA 4AN1A 1FFBA 1CUAA 4UPDA 5HCUA 1ZI9A 3OTQA 4B6GA 2JGJA 3QMMA 3ZV7A 3WQHA 5LZ2A 2GBIA 2XUDA 1VA5A 2XT0A 5LYYA 2ZJ6A 3ZLUA 5CT6A 2HDWA 3PF8A 4ZXFA 4W63A 4E14A 2BUCA 1USWA 5DTIA 4WJLA 3RKSA 2QM0A 4CI9A 3F8SA 4G8BA 5FPQA 1BS9A 1BEEA 4HAIA 2OXEA 4YX9A 5ESRA 1WPRA 5ALSA 3QPDA 3IB3A 3S8YA 3HZOA 4N5HX 4DMCA 1IUOA 2PBLA 3OM8A 3VJKA 3VKFA 5DLPA 1XRQA 3H2KA 1QZ3A 2CMFA 3F98A 4WDQA 1AQLA 5LZ4A 5K3FA 1GQRA 4YPVA 3LIIA 5I7UA 4IH9A 1U8EA 4Y2XA 5BWCA 1W6RA 3D2BA 1EVQA 4J0GA 5JZSA 4L72A 1M33A 3KWJA 3STTA 3G9TA 4PF1A 2CBGA 5AOBA 2Z3ZA 3ESAA 1XRPA 1EDBA 4BAUA 2PKYX 4P9NA 1YR2A 4DSAA 2H7YA 5KBYA 4BP8A 5EGNA 4IHAA 4NMWA 2VAXA 2HRQA 1QTIA 1EXWA 1FFCA 4X6XA 4AN0A 1DTEA 1ETHA 4UBLA 1QO9A 3SK0A 2Z5GA 4HZGA 5CH3A 4A16A 3QITA 3O9MA 1RYYA 2PSFA 2OCGA 1JMYA 3SWWA 5ALZA 4L3WA 1Y7HA 2DHEA 3D2AA 4H7EA 3FSGA 4H7KA 2O2HA 1VE7A 3O4IA 3NGMA 1H2WA 4TVKA 4B82A 1MO2A 4I4CA 2JIDA 4MEBA 2R8BA 4UHCA 5DNUA 1THTA 2Y1KA 2PU5A 3DLTA 4HXFB 3WZMA 3NUZA 4JUIA 4M0FA 1XZBA 4C4XA 4UBMA 2PSHA 1CUSA 1ORWA 3O4GA 3NWOA 5EIHA 5AM1A 3LP5A 1CUWA 1ZJ4A 1ODCA 1XZCA 4ZV7A 3PDCA 3RARA 1VZ3A 5A6VA 1IVYA 1MNQA 2X5XA 1WCYA 2CUTA 3F9CA 3TGLA 3EBLA 1EB8A 4DTCA 1AGYA 4H7FA 2DQYA 3C6YA 1TAHA 2G5PA 4Y2RA 4J3JA 3BJRA 4AMYA 1XRRA 4MXDA 4EA6A 2W22A 3PICA 2HL6A 1A8QA 4BCDA 2AJLI 4N8DA 2PPLA 4IH1A 2ZYIA 2VT7A 2DFPA 1IUNA 5ALIA 5HQ3A 4LXIA 1GPLA 2HFKA 3WA7A 5A62A 5FRDA 3HJUA 5AI8A 1H23A 5AI5A 1LNSA 4J0HA 3A70A 4W1PA 3VVMA 4U2EA 4MJ3A 5FDFA 2WHQA 4BTLA 1K5PA 2WQZA 3A2LA 2OPHA 3QBJA 1VA4A 4BC0A 2WILA 4Q1VA 2GYVA 3KSRA 4QDUA 2HA0A 3QMWA 3H04A 1QFMA 4Y9SA 1QIJA 4OUKX 2CKMA 2WTNA 4C89A 1CUGA 5CURA 2XMQA 2VJCA 5ALMA 5JAOA 1DX6A 1N1MA 1VZ2A 2AJBA 4UBJA 1AC5A 3WIBA 5CMLA 3MVEA 2VJAA 2QJRA 3G0BA 3IULA 3EQ8A 5K3EA 2YXPX 3AILA 1W76A 2I03A 4BE4A 5EI5A 5ALWA 5T4HA 3HEAA 5ALQA 2BUAA 2C7BA 1GPKA 3M3DA 4OU5A 1DT5A 5JAHA 1NU6A 2WG0A 1KEZA 3I28A 3DNMA 3ZLTA 3JYHA 3WLAA 1MAHA 2Q0XA 5AI0A 3T52A 1X2BA 1UOPA 3H1BA 1CEXA 1XQVA 5K3FB 4FOLA 1YB7A 4N5IX 4XVCA 5ISMA 4HXEB 5LIPA 1XKLA 1QIMA 2ORYA 1VKHA 2PSJA 1XZEA 2H1IA 5E2IA 1J06A 4K6GA 4ARBA 1UKBA 4QDXA 5K3AA 3HRHA 3W04A 1CIJA 5CT4A 4DLNA 5A7HA 3FLEA 5AKEA 4EY6A 4RE5A 4G8DA 5DNVA 3E0XA 1ISPA 4PQEA 5LZ9A 2XUKA 2ZSHA 4B0PA 1MX9A 2ACEA 1PV1A 2QVBA 2PM8A 4X6UA 3OC0A 3FYUA 3H2JA 3GELA 4C4YA 3F67A 2O2IA 1E89A 4D9JA 5DYTA 3FAKA 2XDWA 4FBLA 1UT6A 1BN7A 4AZ3A 4RPCA 2JEYA 1YS2X 3HXKA 5BOVA 2VEOA 4J0IA 5JD5A 5HZGA 2X8BA 3BWXA 5JZBA 5HFNA 4UBIA 3CN7A 4UBOA 3G9ZA 4CFSA 3OOSA 5ALPA 5SYNA 4PSUA 2ROQA 1DWOA 2VQ6A 3WJ2A 3IIIA 4B9EA 1GXSA 4HRXA 5ALGA 1ACJA 3WA6A 1EX9A 3I1IA 4V2IA 5EIAA 4FWBA 2B9VA 3G0GA 3R0VA 1IUPA 5ALXA 1A88A 1JMKC 2Y2UA 2OLEA 3QH4A 4GI1A 2HADA 4QDTA 5JD6A 1GKLA 1T2NA 1UOOA 5C8ZA 3H1AA 3AZPA 1LPOA 3R3UA 2G4LA 1MT3A 5ALVA 3WIOA 3O4JA 2PUJA 3DKRA 4F60A 4W1RA 4BYMA 1WPXA 1Y7IA 2YH2A 4U2GA 1K63A 5EHNA 2HM7A 1CUVA 2WUDA 1BRTA 3I6ZA 4IQ4A 1QIFA 5HFAA 4Q3LA 1YA8A 1CQZA 1NU8A 1J07A 1GZ7A 3DKKA 2OAGA 1HPLA 4BATA 5A71A 4DNOA 1K4YA 5DNWA 1ZI8A 1CUHA 4B84A 1IZ7A 2XUQA 1TIBA 4FFVA 3BE8A 4C4ZA 4P92A 2HFJA 2XUIA 1UK6A 3QZUA 2WHPB 1R4ZA 5T4EA 3WL6A 5JANA 1ZIYA 4FLFA 3RLIA 2XQGA 1JKMA 3OG9A 4X95A 3M83A 5D6OA 3VISA 4DSZA 1E5TA 5H3HA 3F97A 1N5MA 1NX9A 3A2NA 3Q8WA 2B20A 2QTBA 1UK8A 2DQZA 3AFIA 4BTVA 4EY4A 5AI9A 1L7RA 3G0DA 1UZAA 1EK2A 1VLQA 4CCWA 4K2AA 2WFMA 2O2GA 2XMDA 1CUIA 4UFOA 5LZ7A 2XMBA 3M81A 4XJVA 3I2GA 1MNAA 1Q0RA 4P08A 3IUQA 5ALJA 3AIOA 4PSDA 1MX1A 5AKLA 5E4YA 2V9ZA 5AKGA 3H2IA 2GZSA 3WK8A 3STXA 3BL8A 4JEIA 5F4ZA 1DINA 2XUJA 3I2FA 2WIGA 5K3BA 1F0NA 3DL4A 3V48A 3GROA 5IVIA 1UWCA 2ZVDA 3ZPXA 2XE4A 3BXPA 1XZJA 4X7BA 2PUHA 2HA4A 5IVHA 3PE6A 3C5WP 1ZGBA 2GBCA 1ODTC 4BRZA 1E8MA 4N8EA 3VXKA 2WFLB 1CVLA 4DGQA 1LBTA 5T4FA 3KWFA 3YASA 4CCYB 1BE0A 3BDIA 5AKHA 4BVJA 3UMJA 3WK4A 1FFDA 3FYUC 1UK9A 4WFJA 5DYWA 4JYMA 1XQXA 1ACLA 5LLSA 1I6WA 3QPCA 1AX9A 4OCZA 4GHWA 4KJXA 1CLEA 1QE3A 1XKTA 3I6MA 1CUJA 1SCQA 2WG2A 2Z8XA 4W1QA 2IIVA 3ZI7A 4GDMA 4AO8A 2QXTA 4H18A 2EDAA 3FYUB 1MU0A 3GZJA 4A23A 2WJ3A 3L1IA 2ZYSA 4W1SA 1C7JA 4OB6A 4X94A 1QFSA 3KDAA 1F8UA 3FLAA 5DTJA 1QLWA 3W9BA 4BCBA 5ALDA 3D7RA 4XWGA 3V1MA 4AX4A 1DU4A 1K8QA 2J3QA 1IMJA 3DOIA 2HU8A 4AQDA 5AM5A 3WK7A 1HLGA 5ALOA 1DQYA 1H2YA 3R40A 1EA5A 1WB5A 1T4MA 5CT5A 1UKCA 2JGMA 2LIPA 5CXXA 5FPPA 4QLAA 2HIHA 1K6EA 2XUFA 1P0QA 2ZJFA 3LCRA 4Q3KA 1XZAA 1BCSA 5A2GA 1VXRA 1U65A 1LPAB 4DNFA 4C87A 5AM3A 5CH5A 2Y6VA 1R9MA 3AIKA 4IH4A 4BBZA 3IDAA 5AICA 5A7GA 4BVLA 1UFOA 1GKKA 2CEKA 1A7UA 1MJ5A 2YASA 4H7JA 1BCRA 4U2BA 1XZGA 1DWQA 5AI4A 5EIEA 3HLKA 5ALYA 2RI6A 1R50A 4O08A 1JJIA 3C45A 2WIJA 2WUFA 3WWEA 4B85A 2FX5A 4X85A 3DD5A 3TRDA 2RGUA 1E8DA 5AKIA 2JGKA 3FOBA 4UBNA 2WLSA 2XMRA 2WM2A 3QVMA 3HACA 1MAAA 2DHDA 4G8CA 1UXOA 3UUFA 1X2EA 2OAEA 3BJMA 1CRLA 1LPNA 2XI4A 2XUOA 2G5TA 2PL5A 3DOHA 1LLFA 1OILA 1ZOIA 5DYYA 3D3NA 4XIIA 1MTZA 3OPMA 4UHHA 4ZI5A 4H0CA 5HK8A 4KYVA 4ZREA 4NS4A 4INZA 3WWOA 3WL7A 5CBKA 2QRUA 1YA4A 3DEAA 4G9GA 1AUOA 2Y2VA 4E11A 4G4IA 1CUDA 1DQZA 3E1GA 3G9UA 2IX9A 3U0VA 1JI3A 2QUAA 5FP0A 2QT9A 3DS8A 4UBKA 1KU6A 5C7YA 1WB4A 4BZZA 3FVRA 1CR6A 4QNNA 4QWMA 1QIHA 1E8NA 4KE9A 3WKBA 4ITVA 5A7FA 2WHPA 5DWDA 1QIIA 1XROA 4ETWA 1O6GA 4G9EA 5CW2A 3O0DA 3PFBA 3QPAA 2HRRA 2WSLA 3JWEA 4W9RA 5JADA 3H2GA 4HS9A 4ZGBA 5LKAA 3MUNA 4YK7A 4J0CA 1Q0ZA 5JIBA 4DIUA 1GQSA 3BIXA 2D5LA 4WFKA 4NVRA 3FLBA 5J3JA 5AM2A 4WY8A 2UZ0A 1SCKA 2JF0A 2ZJ7A 3EQ7A 5HF9A 3B3QA 4F21A 1OXMA 3C6BA 4KR0A 3IUNA 3D4LA 5D3ZA 1ZD3A 4KRXA 4I3FA 4B83A 2H7CA 4J03A 3ZWQA 4EZIA 2G63A 4OB7A 5JATA 3FYTA 1EDDA 3RM3A 4X71A 4AO6A 3HYSA 4XX1A 5CH8A 2QXUA 4ROTA 2PX6A 3HC7A 2AJ8A 4E15A 4DM7A 1QJ4A 1GT6A 5AKJA 3WWCA 4AXBA 3DYVA 3C5VA 3O9VA 2XMZA 5HK9A 2WFLA 2WUGA 3C8DA 1QIDA 4CCYA 2WFZA 1TQHA 1DWPA 4P93A 5ALTA 1RP1A 4KACA 4MYDA 1XZFA 3K6KA 1D07A 3ANTA 2BFNA 3I2HA 1CUZA 5ALNA 4Q82A 3A6ZA 1WM1A 4YASA 1R3DA 2ECFA 4CG2A 3VDXA 2DHCA 4JNCA 4GBGA 2WHRA 1G4HA 1YSCA 4OSEA 1LZKA 4FKBA 5CT9A 4NZZA 4U2DA 4EUSA 4G4GA 4X90A 3L1JA 5AI6A 3VJMA 4Y7DA 2BGNA 5JYCA 3G9XA 3N0TA 5IKXA 5JAPA 3I2IA 1QIKA 4B0OA 1U4NA 4UHEA 1AURA 3K2IA 1LPSA 3R41A 1P0IA 1CUYA 3WI7A 4ZRDA 4B9AA 2B4KA 5T4BA 1A8SA 1HL7A 3HSSA 3GA7A 2V98A 1LZLA 3W05A 3DJYA 5LZ8A 2GZRA 1BEZA 2P8SA 1HDEA 1ZIXA 1DT3A 3JW8A 4BC1A 1TCBA 4QE3A 1R1DA 2AJCA 2XMSA 1VE6A 5AK3A 1EINA 4N8SA 2ES4A 1XZIA 1O6FA 4ZWNA 1TRHA 3QMVA 2HHAA 3S2ZA 3X3HA 3I6YA 6YASA 1G42A 2BCEA 1XQWA 5EHQA 5HKBA 1XZDA 3IURA 3LS2A 2C5FA 1UOQA 3WKEA 1QO7A 3EF3A 3G8YA 1A8UA 4AZ0A 4WCVA 4BZWA 2WU4A 4J0DA 2H7XA 3I2JA 3FWHA 2ONCA 4C01A 2K2QB 5C8VA 5SYMA 4Y2PA 4X3CA 1CUCA 4DNPA 4LXGA 1BU8A 4QZVA 4H7DA 4FNMA 4QA9A 1BROA 1CFJA 1Q84A 1CUBA 3IBTA 3BIWA 2O7RA 2ZSIA 3IVMA 3FBWA 3FCYA 4QDOA 2XQJA 1ZI6A 4UHDA 3VJLA 2JGIA 4WDRA 3CCBA 1PFQA 2OCIA 1JU3A 4H7HA 2R11A 4H77A 2B61A 2XLCA 2HA7A 3CXUA 4Y2SA 1TKRA 3I1YA 1GPNA 2QOEA 3G0CA 1H2ZA 4RNCA 4Y2QA 3TJMA 4M0EA 4EY5A 5AM0A 2VTVA 2ZYRA 3T4UA 2PVSA 3V9AA 3C6ZA 5ALKA 2QS9A 4F5ZA 2GYUA 4X97A 2Y6UA 4FLMA 5AM4A 2QJWA 3LIPA 1SCIA 1Z68A 1MPXA 4Y2YA 3HI4A 1SC9A 1FJ2A 1OCEA 1R88A 4CIAA 1E3QA 2Z8ZA 1YAHA 4OB8A 3FCXA 2J4CA 1P0PA 4LYEA 5EHXA 4BCCA 3KOOA 3GFFA 3R3VA 1VOTA 4MYSA 3STVA 1CPYA 5D7BA 4X91A 3QM1A 1E66A 3AZQA 2ZYHA 1AZWA 5AHXA 4Q34A 1XRMA 5AP9A 5HKAA 2XUAA 5AK4A 4LIPD 1HBJA 4C6HA 4KE7A 1XLVA 3PUIA 1YB6A 4B80A 3R3WA 4F0JA 1JT2A 3WK6A 4KE6A 4GW3A 3E3AA 2DCMA 4X92A 4EY7A 5HF5A 4B81A 4JYPA 1W1IA 4BDTA 1QIGA 4L0CA 2VSQA 1XFDA 3B12A 1W4LA 4DYHA 2DR0A 5ALHA 4DMFA 5K3CA 3W9UA 1L7AA 2AXEA 3DYIA 1QONA 2CJPA 3UUEA 2XQIA 1N5RA 3EIOA 4Q05A 1JU4A 4X93A 5AKZA 1TCAA 3WKDA 3RK4A 4K5QA 2HA3A 3A2MA 3AINA 2XUGA 2V97A 5AOAA 4UFPA 1QTRA 5I9IA 4OD0A 4FFWA 2OGSA 1ZD4A 4X6YA 5I8PA 3H18A 1Q83A 3ESBA 1ZD2P 4FLEA 5LP1A 2I78A 2JBWA 5HF6A 1JJBA 4Y2TA 5E4JA 4FHZA 4MWSA 4C88A 3HABA 1YCDA 4LKOA 3OURA 1ORVA 1XLUA 3WKCA 3L1HA 4L9AA 5LZ5A 3EQ9A 1XZHA 3C70A 3V1KA 3ZLVA 1MX5A 2XQKA 5AIBA 2H9YA 4LHEA 2GYWA 2QUBA 3BF7A 3D5EA 1ZGCA 2XUHA 5IVKA 5JARA 5DJ5A 3D2CA 2NW6A 4J7AA 3WL5A 5AH0A 3I2KA 4G4JA 2J3DA 2I3ZA 2EDCA 4RE6A 4Z49A 2C5GA 1S8OA 1LPMA 1BN6A 3R3YA 1FFEA 3IUMA 4CIBA 3AIMA 2JGFA 3Q0TA 5E4TA 2FJPA 3H17A 2OG1A 2RAUA 3WL8A 2VA9A 4BP9A 4E46A 4HVTA 1HKHA 4Y2UA 1QGED 1LGYA 2HU7A 4G5XA 3PI6A 1UK7A 1H22A 1QOZA 5JD4A 4BAGA 1WOMA 2XB6A 1SOMA 4FNGA 4QEKA 4AB1A 1EH5A 4UUQA 1PJAA 5AK6A 4GWLA 2FUKA 4PNZA 1XZLA 4GEGA 4Y2VA 2WJ4A 5CRIA 1CUEA 1G5FA 2O7VA 1W75A 3F96A 3STWA 1EB9A 1YASA 4RGYA 2WU3A 3H19A 4WY5A 3WWPA 3C8HA 2QMQA 3DDUA 1G66A 3AZOA 3WZLA 2OGTA 5BWBA 4DMKA 1HQDA 5JZ9A 1EHYA 2E3JA 1B6GA 3WKAA 4CG1A 4G1FA 4UFNA 2AJDA 2JEZA 3BDVA 1EI9A 4M0MA 4WFIA 3SC2A 2XMCA 5CTAA 3WWDA 2RHWA 1F0PA 4GECA 4QDZA 4KAJA 4KAAA 1YS1X 1LBSA 3D59A 2C0PA 1IZ8A 3ANSA 2RIPA 5AJHA 2OQIA 3LLCA 2OCKA 4FDMA 2VF2A 4BAZA 2WIFA 3FVTA 1FSSA 1ZJ5A 4PV7A 3PUHA 4H7IA 4U2FA 3PFCA 4EB0A 4GLBA 4JH0A 5EFZA 2BGRA 1R9NA 4U2CA 2WG1A 3KXPA 4ZV9A 3M82A 3STYA 1XRNA 4FMPA 1XRLA 5KWIA 4BDSA 2DSNA 2J4FA 4MWTA 4CG3A 1DX4A 1N8SA 5FXMA 2WIKA 3IUJA 5AKYA 1L7QA 1LPBB 1EVEA 1U2EA 3WJ1A 4X00A 1CUUA 4GXNA 1ODSA 1CV2A 1C7IA 2HA2A 1VJ5A 3KD2A 4UHBA 2HU5A 2X76A 2C0QA 3SX4A 3WYNA 4A5SA 5HF8A 3VVLA 1VXOA 2BKLA 4FBMA 5JASA 1WB6A 3ICVA 1QIEA 5KWJA 4OPMA 2CB9A 2OGZA 2WTMA 1H2XA 3AUKA 1TK3A 3STUA 5FV4A 3H0CA 5C81A 5FOQA 7YASA 4TPKA 4IO0A 2QR5A 2C4HA 1RWQA 2BAGA 5AKKA 4Q3OA 4HXGA 5IH7A 4DNQA 3WK5A 1J1IA 1XZMA 1THGA 2BJHA 2PU7A 1KU0A 2W6CX 2IITA 4EHBA 1ZD5A 3O4HA 3ESDA 3GUUA 2JGLA 1FFAA 1GGVA 2GBGA 2RONA 2CZQA 3W2TA 3ICWA 3U1TA 4MEAA 2XQFA 2Z3WA 4TGLA 3WK9A 5JAUA 4MQLA 4QLOA 4H35A 1C4XA 3DL7A 4B7ZA 5ALUA 5ALFA 5CT8A 2GBFA 3W06A 5LKRA 1CUFA 3P2MA 2BUBA 1TCCA 3MGAA 4EY8A 2VATA 3H2HA 3GBSA 5FLKA 5YASA 3G02A 2PSEA 1CQWA 3IA2A 3ED1A 4K6KA 4OU4A 5ALEA 5JALA 5AO9A 1XLWA 1XQYA 4ARAA 1UKAA 3G0IA 1WHTA 5K3DA 4OYYA 2V96A 5D3KA 5ALRA 4J0JA 2VJDA 3DQZA 3ILSA 1WHSA 2PSDA 1AMNA 1EDEA 5ALLA 4HRYA 3B5EA 3R3ZA 2RHTA 3AJAA 4BB0A 4HTAA 1B41A 2WUEA 4UHFA 3C87A 3R3XA 3D0KA 2EEPA 3CCCA 4BVKA 3FNBA 5AK5A 1CUXA 4AMZA 3E4DA 3O95A 2VT6A 5IVDA 3ESCA 2OCLA 4FTWA 2XMGA 4KRYA 4QWWA 2QKYA 5KREA 1XZKA 5HQ3B 1SFRA 1ZICA 4EBBA 2HA5A 3K9BA 1LPPA 2YYSA 4PW0A 2C58A 1MN6A 3WMRA 3CN9A 4KE8A 4AO7A 5K5EA 4LYDA 2WIDA 5AKXA 2VAVA 4LXHA 4PSCA 5FUMA 1X70A 5AOCA 3WYDA 1F6WA 2WJ6A 2QZPA 3G7NA 2HA6A 3C6XA 2XUPA 3V1NA 5CXUA 4KAFA 3C43A 4OYLA 5BV7A 1Y37A 5FKJA 4S0XA 2FJ0A 3PF9A 5EHZA 4PO3X 2I3DA 3BF8A 3NOXA 4I19A 4Y2JA 4BRSA 3N2ZB 3DCNA 1W52X 4MQMA 3V1LA 1AKNA 3TEJA 4J0KA 1YAJA 2ACKA 2XLBA 2WKWA 2OQVA 1J2EA 3FSGD 5AIAA
chains in the Genus database with same CATH superfamily
3ZW8A 1L3BA 3TIVA 2FSHA 2QNRA 2H92A 2WQ7A 1HI9A 3P0HA 3SZRA 1PIWA 1LVUA 5LDHA 4OBBA 3EH1A 1JZQA 3G2IA 3NH6A 1VPDA 3VNSA 1JJFA 5JEEA 4DR5B 4KN8A 2D0DA 1TM2A 2PT7A 4LBWA 4A8HA 4BMXA 3ST7A 2KLHA 3UBMA 4DR6B 1DXYA 2Q4RA 4RKRA 2PRIA 2HC9A 4AC9A 4OQMA 2IUSA 4D3XA 4F9EA 3GJQA 4RL4A 3GNQA 2JGEA 2WPDA 3EGWA 5LXTB 2H00A 1H3EA 4RZHA 1PFVA 3KR2A 3T0IA 3A4IA 5AW1A 5LQMA 1PWHA 5C8XA 1Y8QB 1FFBA 1CUAA 3LFUA 3E82A 2QG6A 1B8NA 4MUFA 2UKDA 3JQAD 4BYMA 3S8EA 2C2HA 3Q0EA 4LYAA 4M1WA 2ZIAA 2FEOA 3RNLA 3ZD8A 1R8QA 5HTOA 2GPJA 2GBIA 1EDOA 2QAGC 1S9HA 2H4YA 3C41J 3GLGA 1DO0A 4P84A 3ABIA 3FNGA 1OAOC 4DB4A 3WLEA 3ER8A 2XUDA 3ZDXB 2IVFA 1C1XB 1ZKDA 5K0CA 2WJZB 3KE9A 2XT0A 3RU7A 3RVSA 5ANRB 1UP6A 1K3TA 1R5NA 1YC2A 1Q0HA 2HDWA 2QVYX 3EGEA 4EYKA 1R6BX 1R10A 3T99A 3ZDAA 4KO4S 3IE2A 1L9XA 4RGQA 2Q0SA 3BXEA 2YWDA 2BUCA 2Y92A 1XNJA 1V5IA 2AEEA 2PZJA 3OZEA 4YAWA 4BNVA 1VLZA 3RKSA 3OZUA 1E6KA 4CI9A 3N86A 1SIBE 3RVLA 4DLPA 3AM5A 3EEFA 8ADHA 1FS4A 3AB7A 4MRMB 1RE1A 1AKYA 5IF3A 1BS9A 1SU8A 4XTCS 4HAIA 2OXEA 4DC9A 2MTBA 3FH0A 2WABA 1N2EA 3A7DA 4I7EA 2BWJA 4NOJA 1LLDA 2R6R1 1E4YA 3S29A 3D1LA 1TUBA 2VSXA 4HDCA 3S8YA 4BN5A 1L7DA 2PEYA 1T0PA 3HZOA 3L6UA 3M4YA 4H15A 4QTUB 4ZALA 4HN4B 2PBLA 3QEBZ 1U2GC 2E6UX 2IY9A 5DLPA 1XRQA 5FTWA 3VKFA 3MWDA 3PFWO 3VJKA 2ZR9A 2FFQA 4RDIA 1LI5A 1TM5E 4QU0A 4EPVA 1F3OA 2B99A 1NI3A 4BKMA 1DKRA 1CR4A 3V2HA 4D3DA 2CMFA 2I2FA 4MMYB 1ZBDA 3GJZA 4C4PA 1MMFB 3Q4GA 4I1IA 2CE7A 1XTJA 1ZSVA 1PG5A 3O93A 4O0LA 4YRPA 3G5MA 4YTEA 4XKJA 1DTSA 5H0IA 1VI5A 1VLMA 3RHFA 1QGZA 3TGPA 2Z1NA 2RK4A 3LH5A 3OIYA 4GEKA 4IH9A 4AZ3B 1U8EA 5H4HA 3QP9A 3ZNPA 4X0EA 2I7DA 4QUGA 1DDGA 1S7GA 1I30A 1Y6GA 4L72A 1J0XO 2GZMA 4BQSA 1M33A 3LBYA 5BSRA 4M6WA 1E2MA 1QO0A 4K9DA 4OQQA 1H5UA 1RQLA 1XK6A 2M6RA 2B7LA 3EZ9A 3HSYA 4CV1A 3GRKA 4HGYA 5AOBA 4Z0HO 3LXUX 3VH3A 2JVJA 3QXXA 2BFEA 2AV6A 5B6PA 3NYIA 3DZDA 4WGFA 3ESAA 4P36A 2PKWA 1D1TA 8MHTA 1Q21A 4J1TC 1QHXA 2Y1LA 5A04A 4Z3DA 4QVIA 4ZCIA 1KEKA 1IDN1 3SF0A 4D81A 1SCUB 3DM5A 1R5JA 3FKJA 3JRNA 4K03A 1YR2A 2AFIA 3ZDYB 1AKWA 3AF6A 3VUFA 3WLLA 1YH3A 4ZU6X 2IYRA 3FCUB 1IHPA 3BT7A 3A4LA 3CZ5A 3OFVA 3QPUA 2APJA 2X7JA 4GPAA 4C22A 4BP8A 4CKEB 1JXQA 3HUUA 2FMXA 1JKIA 1Y8CA 4Q4HB 4BN4A 1IBCA 3I09A 4DCPA 1U2QA 4JJIA 2QDKA 3MRSA 1N2IA 1P5HA 2P1DA 4LDQA 5EMNA 4HUTA 4JJFA 2IW3A 1C7EA 4AN0A 1DCKA 2Z2KA 3JQDA 2NXNA 4R31A 5AXAA 3U49A 1Q15A 1DTEA 2IXGA 3EVEA 4IGEA 3CVVA 1DBPA 2WSMA 4CNBA 3H0EA 2GF9A 4ZVKA 4EG6A 3JPWA 2Z5GA 4HZGA 4L0DA 1C0KA 2WOJA 4QUIA 3SC3A 3QITA 3O9MA 3IDFA 3Q7QA 3VOTA 4X7RA 4EO7A 1I7SB 2A30A 1SPBS 1PWYE 4BMNA 1CQIA 4RJJA 3QVJA 4DTIA 1YJXA 1VM6A 2D59A 3RTBA 5H9VA 5B1YA 1XJQA 1ENYA 4M54A 5AVSA 5KYXA 4LE1A 1J9EA 4D5GA 3KPVA 1NW9B 2EATA 2CLFB 1DC8A 4WMLA 1Y7HA 5G4LA 1KMNA 4NEHB 2PAAA 2ZIUB 1P1HA 4H7EA 4EI8A 4BJ6A 2ZJ8A 3M9XA 4UM8B 4CCAA 3FI0A 3BFPA 1LK7A 2I7VA 4B82A 1GQYA 1TVKA 1ZMTA 2ENWA 2FKNA 2NVOA 5AOVA 1JBKA 1RI5A 3NC4A 4NBWA 3L0IB 3IPYA 4O4LF 1EVIA 2AN4A 3I9LA 3DV9A 4XFJA 4E94A 2O5CA 3PQ5A 1THTA 4COKA 2Y1KA 2VDWA 1ZL2A 1X3LA 2FWJA 2VRWA 2H1SA 4TLAA 1DRKA 3FSJX 4R0NA 5FL7D 4YCMA 3VA7A 2GKSA 3HKCB 4M0FA 3PCXA 2OPBA 3HU5A 3TK1A 3TVYA 4BMPB 1KDZA 1LNQA 2PFSA 1KIAA 1OGJA 1ZK0A 3B9RA 1CUSA 1ZGHA 3ETNA 2C8JA 2KE5A 3EZXA 3VSCA 5FTMA 4IX1A 1ORWA 2DLNA 3QTLA 1VI2A 4LJKA 1E9DA 3LFTA 3I4LA 3Q6IA 1VCMA 4JR2A 4NP6A 3ROEA 3KR0A 2OBYA 3DOJA 5LDGA 4MV1A 1VRWA 2JFNA 2PGXA 4XPIA 3W5CA 1GPWB 3WLIA 2JH3A 3LP5A 4IEEA 1IJBA 1GITA 2E85A 1XZCA 4MA5A 3RARA 3O1IC 4PLWA 1AO0A 1VZ3A 5GOTA 4BMOB 1GNQA 2UYOA 2P35A 5JPIA 4YGXB 3K0BA 1T8PA 4N41A 1DV2A 2CUTA 3AERA 1J33A 1W5AA 3SKXA 3ZGOA 4TTRA 4GRDA 4DMGA 2CXRA 1TCVA 1XXLA 1YDFA 5I5EA 1XHLA 2HYDA 2NVUA 4H60A 4U6SA 4CU5A 1HNWB 4EW3A 3V5NA 2XCIA 3AFOA 1U5BB 3L5KA 4F04A 4KR2A 4J3JA 3U5TA 2Z2YA 1W4BA 2Q1YA 3MRXA 4GOND 2WU0A 4X65B 2X3UA 3NV7A 5IJZA 2QLBA 1DJLA 3FCEA 2GM4A 1K5DA 2OP0A 4FT4A 4Y6GB 3V8NA 2RGAA 1RE0A 4MGEA 4O25A 5C52B 2AJLI 2O5RA 4PFJA 4EBBA 1Z88A 1GILA 4R1MA 5D3QA 4HLNA 1IG0A 3T4EA 4PZAA 4QTTB 2VT7A 4INPA 3UQYS 4YJ3B 2Y71A 3ITKA 1B1AA 2R6DA 2WDZA 3HRIA 4BO9A 4LXIA 1HDZA 1U6IA 1N7IA 5FRDA 3OE1A 1IE3A 1QK3A 4YXWD 3KAPA 2NSDA 1IJFA 2C4NA 2Y77A 1G18A 4RC9A 4BMZA 4RTQA 1YIDA 4OHVA 5IX8A 1VCIA 4DIKA 4R3UC 2CNLA 1S2LA 2WUWE 2HHJA 2XB9A 3HRKA 1X9GA 5AI5A 3ZXUB 3VO2A 4B4VA 1QQ5A 1Z45A 4W1PA 2B3DA 3IVXA 2B34A 4MJ3A 5TQ0A 3QOWA 5JDCA 3A04A 3Q3EA 2ZYWX 4UDYX 4BTLA 3RKRA 1J9ZA 1K5PA 4F4CA 4E08A 1NE7A 4EAAA 3BQNB 3A2LA 2RG7A 5FBVB 3IP5A 3DNFA 5F51A 4M1TA 3F5SA 2RK3A 5WRFA 1NG1A 1PV2A 2B2XA 5IAEA 4F71A 1CJBA 2VPZA 4YP1A 1BYIA 1X3SA 2HX1A 2GYVA 2JLQA 1G9TA 3KSRA 4HMPA 3LCCA 1Y4SA 2WM8A 5CVCA 3S3TA 3U09A 1NT4A 1Q0PA 2CLKB 3QMWA 4F2WA 5I7EA 1EM8A 3A9CA 1RJEA 4OUKX 1T3GA 2VPIA 3J7TA 1BFDA 3HH8A 2WNIA 3UGTA 1DAMA 2WF5A 3AONB 3ZV4A 4IRXA 1CZOA 3EASA 2X3YA 5CURA 4BHTA 1ULSA 4R1LA 4DCSA 2VJCA 2F9LA 3OFKA 2Y1GA 1STOA 4LGMA 4MO9A 2VPWA 5DTMA 2YW2A 3RTEA 3MQ4A 5JRJA 2PQMA 1MAWA 2GJSA 2IEIA 2VNHA 2AJBA 3ASUA 4LMPA 3UICA 1R4NB 1AC5A 3NT4A 4FHGA 4F45A 1NJ5A 2D13A 4ENRA 7REQB 1JF8A 2OHJA 2IBSA 4M86A 2VJAA 2W0SA 3UH0A 4KWEA 1FOEB 4CM9A 4Z4GA 1V5GA 1UDAA 2FP4A 2QJRA 2AN5A 3VNAA 4LNUA 3Q40A 1UPTA 3BMOB 4E5KA 1E1QD 1O95A 4EW6A 3MXOA 2AS0A 5DO9A 1DRJA 3AILA 4B87A 1W76A 3S1LA 4KNYA 1RIFA 2DWQA 2MYUA 4TTAA 1OFIA 1GCIA 1UP7A 5CR9A 4P4SA 1ZONA 2DM6A 2CL5A 1R4MA 2HB6A 1UXIA 5FPTA 1RPJA 1UADA 3FYDA 1YZFA 4KQ2A 4AJKA 5ADUS 3HEAA 1UIMA 2YZGA 1CZUA 3R7WB 4A0SA 3O94A 1CNEA 3N7UA 5CLIA 2F6RA 3SQMA 1J49A 1GPKA 2E4VA 1WCV1 4IXNA 3A1NA 1LDNA 1ULZA 1XE3A 2CHEA 4U2KA 3UY4A 4GL4A 1HKUA 1NU6A 4RQTA 5KYUA 2CW5A 2KX7A 2O57A 2Z04A 3I28A 4BVGA 1O2DA 2PX8A 4ZOEA 3D9QX 4HDNB 3CWZA 1K8XB 1C81A 1MAHA 5ENDA 2LPMA 3MWDB 5AI0A 4V1CI 3T52A 4R0MA 1N78A 2MMGA 1CJKC 2HAEA 3H1BA 2ZIEA 3HJAA 4HC4A 1CEXA 1XQVA 1AUQA 2OORC 1PFUA 4M53A 4MX8A 2EFJA 4BJHB 4FOLA 1B3RA 2DFDA 5DM1A 1YB7A 1C9YA 1PRYA 2H0RA 5EKSA 1N1EA 3T5BA 5L9AA 3HJCA 4Q48A 1M1XB 3A31A 5DTQA 5E3JA 1PZGA 2FSPA 3G9QA 3IIEA 5TMEA 3I42A 1RZVA 2GO1A 4XVCA 5J5VA 1ZCBA 2AOTA 4G36A 4A91A 8ABPA 4HNRA 5LIPA 4TTTS 4BO8A 4WIAA 1WXHA 3G8CA 2R79A 2V7WA 2R0QC 4RW0A 4HGZA 4EHDA 4O4HF 4NCBA 1L5ZA 2QR2A 1YCGA 4ARBA 1UKBA 2BFEB 1CJMA 1D3AA 2PT6A 2X15A 3PUXA 2CN1A 2QG9A 2WZQA 3IPLA 3V8PA 5K3AA 3HRHA 3B3JA 1CIJA 3QF7A 3CH4B 5IDYA 4R3NA 3S2UA 4LOHA 5A7HA 4HQ6A 1KIFA 5TX7A 3UFXA 5SZHB 1FDIA 4RE5A 4D9IA 1ISPA 1TQDA 2VP2A 1KO1A 5LZ9A 4DLSA 4NOKA 1WO8A 4JBXA 1JIIA 3D3WB 5DMXA 1N5KA 3L8YA 3SNHA 4ZFNA 4H59A 2QVBA 3AV3A 1RWBA 2PM8A 2ZRHA 4MRPA 1YD7A 2NGRA 4XX0A 1UZUA 3GW8A 5DT9A 3OD1A 4GRIA 2VWQA 3UJ3X 1UM9A 2DTEA 2IY7A 2QSYA 4MV9A 4RPIA 5F4BA 3GG9A 2Q41A 4IKPA 2NTVA 5HSGA 2XF8A 4WA8A 2AFRA 1L4KA 4EB3A 3AW9A 3G2PA 1Q92A 3KZ1E 1A2OA 2W6IA 2XDWA 4OLAA 1WS6A 1BN7A 4KUHA 1T6ZA 3ZTTA 1JHMA 3MA0A 1YS2X 1CVIA 3ZGYA 3BTVA 4M36A 2JFYA 1YFKA 5ITVA 1CZNA 3NXSA 4RHXA 5I9MA 3BH0A 3ESRA 1J2JA 5HZGA 3DP7A 3BWXA 4GKBA 2JGNA 2KSQA 4WK0B 4MR7A 5HFNA 4AJ1A 3CN7A 1CQIB 3G9ZA 3M3PA 3RYCA 4CFSA 5H83A 3OOSA 4WOJA 4DHWA 1G8YA 1PK7A 2R6CA 1OR8A 2GQ0A 3DF7A 5KHAA 3R5XA 5EG5A 4UTOA 3P27A 2BP7A 3BORA 3F6RA 3K8YA 1E2UA 1DWOA 2VQ6A 3LQFA 3U48A 2ZPUA 3ZGZA 1NY5A 3KD3A 4JEHA 2IPAB 4XGQA 4B9EA 1NOJA 5BVGB 1G8SA 4HQFA 1EX9A 1SVMA 5T3YA 1D8TA 1J8DA 1XVLA 3EHEA 2BC9A 4QO8A 2FSVA 4O2BB 2CJXA 2W2TA 2VZLA 2IZOA 4V2IA 4A6EA 5K2OA 5EIAA 2W2LD 5HDBB 5J4KA 2B9VA 2BEJA 4XVHA 5E38A 3OZDA 3KVVA 4RJTA 1U28A 3TIIA 2YMLA 5ALXA 2VDWB 4MW1A 3PA8A 2EARA 3K53A 2HRZA 4L4YA 4A03A 4K6CA 1QS0B 2QE6A 3ODPA 3EEIA 5KDLA 4U7FA 5C34B 2Q1XA 1FLDA 1A88A 9LDTA 1V8FA 2AKYA 2IGBA 1PDVA 1JMKC 3TUZC 2YOHA 3JCZA 1G5QA 2PD6A 3VZPA 2O2YA 3WC4A 3QH4A 4UUBA 3W5IA 3MG9A 3EARA 5KS2A 3CZ9A 4ML3A 5JD6A 5K2MA 1UOOA 1OIVA 2IE0A 2IYVA 3AI7A 1T4CB 4A10A 3WIUA 1J9GA 2G4LA 2NO9A 4NV1A 3EPPA 1YUNA 1SUBA 3GA0A 1ZIDA 2M6KA 2IU3A 1E2DA 1QOQB 5HS4A 2PUJA 3GBVA 3ZZ1A 3RADC 3DKRA 1Z35A 1NF2A 2XJ4A 3AERB 3OJFA 3OQIB 3KXKA 4IEIA 1H93A 3F7NA 2QUHA 3KE8A 2EJTA 1QHIA 4NR0A 2R6JA 1Y7IA 1BA2A 3LSTA 3H16A 1WKCA 4U2GA 5HP4A 4TZ6A 4K40A 1ZCZA 2SECE 1J5EB 3CZAA 1I3LA 3HP7A 3MRTA 3SI7A 3F8WA 2QG4A 2W2KB 1QGUA 4KN6A 2VBFA 4K81B 3B6ZA 4OQZA 2VDLB 3R7NA 2JFHA 4RIEA 3EPJA 5J2TA 2VDOB 2XVYA 3JAMA 5H16A 3UOAB 3ER6A 3S99A 1X7GA 1F7UA 5K8UA 2KS6A 4C78A 4TV9F 3UWPA 1LD3A 1YJCA 1XD8A 2P75A 2ZRBA 2W83A 3PFKA 4Z2YA 3RV4A 2AVDA 1KJ9A 2HQ1A 4P54A 1R12A 2R66A 5E0KB 2NLOA 4LW8A 5HFAA 3W7BA 1NURA 1UKEA 3ON5A 4UMEA 2UVQA 2W8BA 2EQ5A 4FHCA 3EH2A 1FRZA 4LXXA 1FMLA 4P86A 5B6JA 2PZBA 2JCBA 3PVSA 4DILA 1HA3A 1A04A 2J9FA 1J24A 2GF0A 4XB1A 3ILHA 1AHPA 3DBLA 2HYIC 3BK1A 3F71A 1CWUA 2Z1DA 5A71A 3T5MA 2C03A 4YPFA 2JA1A 3TVDA 1CEQA 3DULA 1CIVA 5D3MA 5DNWA 2C3PA 5KVVA 1ZI8A 1NFQA 1CUHA 4M76B 1M34A 5IPFA 5IEBA 3GLIE 3ZDDA 3GVCA 4B84A 3VHXB 1T29A 1IZ7A 2XYVA 3O82A 1TIBA 4B31A 3AUJB 4D4GA 2HSWA 1YQUA 2P7IA 2VJKA 2YWHA 3FR8A 3H11B 3LUKA 3QK7A 5TSDA 4CV3A 1NFRA 3QZUA 4NK5A 1HXHA 3FCOA 3KZKA 3LK7A 5ITWA 5T4EA 3WL6A 2FX3A 1ZIYA 1YI8A 1D5WA 1KMMA 4WUTA 3UW3A 3OG9A 2VP5A 3M83A 5BSGA 3IJPA 4DSZA 4FFPA 1O54A 3DWIA 3OA0A 4WKOA 3TXAA 3E2MA 5FPYA 3T9BA 4W5RA 3GARA 1D4OA 2Z09A 4P34A 2HMAA 5CBPA 2O7SA 3HZRA 4IIYA 5K03A 1Z7WA 4H6PA 4DV6B 4GX0A 1XAGA 5B3LA 1UJNA 3ABOB 3AF0A 4BO1A 2G7ZA 3LT4A 1NMQA 2AOVA 2DQZA 3HN7A 5B3AA 4ERXA 4BTVA 4NFLA 2IJGX 5IC4A 1DC6A 4XEUA 1PQUA 3QV1A 3I9MA 5IN5A 5I01A 3HXOA 4MW6A 4XW2A 4LWOA 4PYNA 3Q6NA 1M2KA 4EJ2A 4CCWA 4OK6A 4K2AA 3VPSA 4J9VA 5TJ9A 3CHYA 4HPXB 4BU1A 1GNRA 2PMCA 3ANNA 5BMOA 5H3LA 1U9YA 1MR3F 4O4LA 4GXQA 3Q8LA 1UBMS 3SIWA 5DNDA 4ZMSA 4ROSA 1YV9A 2NP7A 2J5RA 3JSXA 3C5CA 5LZ7A 1XSEA 3D3JA 3EQ2A 2I4RA 1GQOA 1E3TA 4URYR 1V5EA 1IK6A 5DOVA 3DTYA 1NUSA 2YHUA 1MPTA 1OOEA 4LNUB 1SRQA 3MM4A 4TTQA 2DR2A 3OT4A 3A6HA 1XJWA 2GZSA 4CT5A 4F5DA 4G0MA 1W0CA 3C14C 3EXIA 1YFZA 5C32A 1XJCA 5A1TA 2JIQA 1H9CA 1KYIA 4MCAA 4HHEA 4L5IA 4FFRA 3LPCA 7ADHA 1JIVA 2ZJ5A 1WXEA 3NHYA 4X63A 3V48A 4MGIR 4HNQA 2VI5A 3ZY6A 1E9EA 4OHPA 3AUFA 4PQRA 5JVDB 2PKCA 4UZSA 3WB1A 1DIOB 1NSTA 4DB2A 2NV6A 3HB4X 5IVIA 1UWCA 2ZVDA 2ZXUA 4YJKA 3NFRA 3BXPA 3U3KA 2JD0A 3E9RA 5B55A 5K0JA 3F6YA 2GHIA 4CLRA 1UXJA 1O0CA 5KYUB 1T1JA 3H5TA 3DQQA 1IG3A 2FHPA 3A8TA 2CCJA 4HNSA 2AUNA 3LHDA 5ILOA 4IP0A 4MPRA 2E55A 4EJFA 4UUPA 1IYZA 1GTG1 1YJ5A 4FEEA 1F8XA 2GUGA 4CTMA 4LJ7A 4F2HA 3TF5A 4YBRA 2C2KA 4RD1A 3TSZA 3W8FA 4BQPA 4TTPA 2HV9A 5FPHA 4DGQA 3GNSA 1IB6A 4CCYB 4MQ4A 1NMYA 1RKXA 3KQVA 2HQBA 4BWGA 1TECE 2J3MA 2Y4OA 2ZT6A 3QKWA 3S1AB 4KB5A 4EB8A 4BVJA 1EP2B 3ORSA 3PFGA 4FCVA 3WK4A 1SEPA 3E0QA 1GTSA 1WETA 1DRUA 1NW7A 1D4FA 2AOTB 2W2QA 4HB3A 3EJ6A 1B73A 1ISSA 1SQSA 4NNPA 3ZN2A 3T12A 3WZ2A 1QBGA 3U4AA 3WB0A 3U40A 1ZLYA 3PGXA 5E7MA 5EIWA 4H2DA 1H4VB 1OBCA 3MRVA 4JYMA 3C7DB 3EPRA 1E62A 4RZ2A 3E81A 4RY2A 4F06A 1QK4A 5H81A 2ZUUA 3CONA 3NH9A 4LYJA 4LZLA 4OCZA 1OZGA 5L8VA 1NVGA 4HLQB 4O8ZA 1GR1A 1K8RA 4GBED 4IHKA 1NW6A 2G04A 2ZXEA 1QE3A 2FLVA 4IFIA 5I48A 3DEYX 3VI4B 1A4RA 2UUOA 3KQPA 1CUJA 1VHQA 4YHBA 3WGJA 2Z83A 3PC3A 4FZJA 4DE5A 1YQXA 1IIBA 5EJGA 2EKQA 5KHLB 1T9GR 1JAHA 3U7RA 4GDMA 5U4QA 3HNOA 3NX4A 2VLIA 3K4PA 4PG6A 2EYUA 1NYLA 3WQQA 1O3YA 3RFUA 4H18A 4R7TA 4OGLA 3USZA 4KU4A 2W2OA 1MU0A 1NNUA 4XWKA 2P6PA 1D2CA 1LQ2A 1QHHB 3A9RA 1L8LA 4A23A 2QSUA 4BKRA 2P2GA 1FNCA 1C3JA 2E2WA 3OFNA 5AK0A 1U90A 1C7JA 4R68A 1T34A 3KR1A 1Q2XA 2Q07A 2XDQB 4YJFA 3VR5H 1F8UA 3FLAA 1Y4ZA 1UEXC 2JH9A 5DCWA 4C2BA 3OZIA 3OQ1A 4BCBA 1N9GA 3N76A 2I62A 4ZI7F 2EX0A 2MSCB 3DDZX 5ALDA 4I46A 4XWGA 1L7OA 5JLJA 5CCXA 3QE9Y 3DE5X 1N6HA 4ZTZB 1WB9A 2CNNA 4QUBA 1DU4A 3BCHA 2GPYA 3ZTYA 1NW8A 3NVDA 4LY3A 1DBVO 4QX6A 3DOIA 2Z2ZA 5IFLA 2XYRA 1JFTA 2OZKA 3B82A 3EVBA 4MUJA 4CG0A 3S70A 5AM5A 1E2QA 1HLGA 3TAHA 3EW7A 3INNA 2C1XA 3H3JA 1LS1A 1WB5A 4QBTA 1PQWA 1B7GO 3HN2A 1UKCA 2X9NA 2LIPA 5CT5A 5CXXA 4EYSA 1CF4A 1H0HA 1O5IA 4QLAA 4DDHA 1K6EA 2M1XA 3LCRA 1Z2AA 4WW0A 1KAMA 3ROQA 1N6LA 1XZAA 2C5SA 5A2GA 1JQAA 4LDRA 1KSGA 4QYXA 5ICGA 2YYZA 4NNOA 2J9XB 5E0OA 3ELBA 5EE1A 4TWRA 2AYXA 4L1KA 2C2OA 1FTNA 2YBEA 5H5JA 2B8WA 2PGIA 5JSKA 3WNCA 3AK4A 3N8DA 3ESZA 5KYWB 3I39X 5C8YF 4Z8YA 3LQ4A 3IDAA 1WD5A 1CY4A 3H8SA 3M34A 2YFHA 2VK8A 4HWGA 1Y1KE 3ZR4B 1A95A 5BW5A 2QORA 4R5MA 1HDRA 2KBFA 3CF4G 2AFHE 4LDZA 3RWMB 3WGHA 2CEKA 2NZVG 2SKDA 1LI4A 3KHUA 4EHLA 2G9ZA 2O1XA 3NHJA 5EJ8A 3LUPA 4H7JA 4B45A 4E5NA 1L2TA 3REGA 4MKIA 3PC2A 1DJQA 4M2LA 1EESA 1PBNA 2BKXA 1ND5A 1XZGA 3W5HA 1FS5A 3MTEA 1T6BY 2X4IA 1RJWA 1U0HC 4QHSA 3VHQA 4PC3A 1Q1QA 3IOBA 2PJRA 5BO5A 5B7GA 3LC0A 3THXA 1JHXA 4GYJA 2ODEA 4Q16A 4F96A 1XCPA 1I3OA 1RIIA 2VF7A 1KEUA 2I2CA 4MICA 1NAHA 2YXEA 1Z4LA 3QLVA 3TQOA 2FPSA 1P1KA 1DAHA 1GARA 4RESA 1NLZA 3EEQA 4PG8A 4C5CA 5NULA 1NI4A 2NU6A 5BSWA 2WIJA 1OXXK 1JEYA 2E4WA 2WUFA 10MHA 4U8GA 3DE2X 1CW2B 4B85A 2FX5A 4G09A 2X8JA 4X85A 1I3KA 1RHMA 5JJIA 4MVYA 4RTOA 1WU7A 2QL5A 3HDTA 3L8HA 3O8CA 2LGJA 1CFZA 4MCJA 5C4GB 4KFCA 1XALA 2I29A 4FKMA 1CD5A 5JNRA 3O26A 1CDZA 2OV4A 1DAFA 1A4IA 2G72A 4MV7A 5J2TB 3EXFA 2WJYA 1ID1A 3GLRA 4NJMA 5DX8A 3NP7A 3VR4H 3FOBA 2P9EA 4Q39A 3A37A 4NMXB 2DR3A 5IZCC 1G3IA 5HIAA 2JFUA 3FG9A 2ATVA 2C5BA 3QVMA 2W9XA 5IMSA 4WXEA 1M8GA 1VPVA 4G8CA 4M22A 1UXOA 2H2HA 3EVDA 3I9NA 5DXJA 2O3SA 3OLXA 2QMUA 2P77A 2G17A 4MMXB 2D5CA 4RLFA 1CZLA 2BEVA 4KKVA 3RYIB 5JRZA 4B8WA 1RXCA 2O8EA 5J1TB 2G4VA 3DLPX 4C43A 3ZNOA 1NR1A 3BJMA 4B4OA 5JSZB 1LPNA 2XI4A 2WJJA 1UIRA 1PUIA 2HLDD 5D3MB 2PL5A 3C4QA 4LYHA 3BTUA 3OOYA 1ZOIA 1M34B 2R8YA 5DYYA 4FB5A 2FPWA 3SSAA 3HMQA 1SMKA 2JKVA 1AT1A 3MWEA 4BOYA 3DDHA 3ML1A 2JHFA 1F48A 1X7ZA 2BSXA 2Q49A 4G23A 4GLLA 2EG9A 2DHQA 3IEMA 1MTZA 4M1KA 4F56A 4D3FA 4M38A 2A5JA 2WRZA 2FWIA 3ZY4A 1L5OA 5G0VA 4JEMA 3AXSA 1KO5A 3PFIA 4ZI5A 3KPYA 4BKPA 1K7XB 1PQYA 3FHOA 4PHHA 3AKEA 3EVAA 3BRWD 4R9RA 4KXFB 2HSGA 2H5EA 1QE0A 2XVZA 4G85A 5D5HA 3SVLA 2IKQA 1YULA 3ZE9A 2ERYA 5L7YA 5HZKA 1XLTA 3QFCA 4MRRA 5BNZA 2XNCA 4B6JA 1A8PA 4BX3A 3X2FA 1Z5UA 1N5OX 5EIBC 3OKAA 1JG1A 3UHFA 4QFBA 4Q1CA 1JHYA 4G4IA 1F17A 2HK6A 3QW2A 1L4EA 1VP9A 2BHSA 4RVGA 3K70C 3K32A 5K0SA 1G1AA 5JXWA 1GJRA 4A73A 4BE7B 1JI3A 5LOVA 1OZ0A 1TF7A 4JMLA 3WADA 1G20B 4IQFA 1MORA 1I7QB 2OENG 3MMNA 3QUCA 1RADA 3KVOA 1R0CA 4U5QA 5CM2Z 3KKZA 5GOZA 2WYVA 2QT9A 5IDWA 3WGIA 3DS8A 2G09A 2OXIA 3QYFA 1BKYA 1TJNA 1YDGA 1OBHA 2ZYTX 4JJ4A 3JQ8A 5E9JA 1NKVA 2HMVA 1TT5B 2ODQA 2Q6KA 3FVRA 2Z57A 4BZZA 8GPBA 3OZTA 1CR6A 1P77A 3GXBA 4IJMA 4QWMA 4ER3A 4EUFA 4MGYR 3VTFA 3NEJA 4PPYA 4CF5A 4CUZA 1QIHA 2Y0CA 4AUNA 4D96A 4DXHA 5JUWA 2PDAA 1E8NA 3G17A 3G79A 4GQBA 3V1TC 4UEWA 5JJLA 4L2IA 1S8NA 4BVBA 4DLTA 2KPOA 2GK3A 1Q19A 2C9MA 1ONSA 3LPMA 4IHJF 3HUEA 4D82A 4ODIA 1TK2A 1XUOA 4B3CA 3EXIB 2LDXA 3NHFA 3KJQA 1OWLA 1K8YB 3BJIC 3CMMA 5ILGA 3TNLA 3V4LA 3ZWDA 1HTBA 3K9HA 2A58A 3LPDA 1GDTA 2WKSA 4R8SA 1C3XA 3D0RA 4WLVA 3KQKA 1O9HA 1ZP6A 3E53A 3FPBA 3IMEA 3R24A 4XUDA 3PL5A 3UEOA 1YO6A 1AUVA 2D0OB 2Y27A 3FFTA 3CW9A 3JWEA 3LXRA 2QVZX 3QE2A 1YCFA 4J2HA 5LB2A 3WRXC 5TLSA 5IM4A 4GWGA 2J09A 1AV6A 3TQCA 5ESWA 2PUCA 4G25A 4MI9A 3H2GA 5KNDA 4GDFA 3LUFA 3HBMA 3DEIA 3Q3GE 3VYTB 4ZGBA 5A0VA 4ND7A 3FPSA 2VNKA 3NHUA 4HH0A 5HUJA 1KNQA 4K9NA 4US1R 5JBIA 1NX6A 2ANBA 2QNBA 3SCZA 5A6SB 1E98A 1E9BA 1AGNA 4IILA 4C4SA 4E5SA 2G80A 3ZWNA 4HZIA 3MCTA 4BQIA 2H59A 3Q3VA 6NULA 4FUQA 4QG7A 4BFLA 4TXJA 3MQFA 2JBHA 3UZUA 4LF7B 1P61B 1SCKA 3GP3A 1KBZA 3GJTA 1Z5PA 2FEKA 4MVJA 3EQ7A 3AUYA 3AUSA 4BBPA 1QYDA 2WZDA 4DSOA 2YIJA 1YR8A 1OXMA 1VHLA 3T7RA 3B9QA 5L7WA 1V71A 4EF6A 3C6BA 4KR0A 4NY1A 2JHAA 3AI2A 5M3BA 3TTYA 1HL3A 1PNVA 3BA1A 1XU7A 3DZJA 3EUFA 3FUWA 3ZS8A 3HCOA 3K05A 3K6JA 1ZD3A 1T0IA 1Z06A 4AFNA 2JIPA 3PDUA 1UPFA 5TEWA 4B83A 2AQHA 1SG0A 3T5AA 1DE0A 4UTVA 1VSUA 4E22A 4JK3A 2II6A 1GAEO 4NRDA 4EZIA 3M1YA 2HBZA 4OB7A 1YXMA 3UOWA 4R2KA 4DPLA 1C3EA 1G4AE 2CVOA 3RM3A 2O2EA 4RH3A 4EPYA 4CETA 3RTAA 1VG0B 4XX1A 4CUKA 5C1BA 1P7CA 5COBA 1FUUA 1JYFA 4I6JA 2QXUA 2Q4DA 4Q3NA 5BQ5A 3JQBA 2FFAA 1WVGA 2OQ2A 3CLRD 2IYUA 2GRJA 5K6AA 2PUFA 1XAIA 2UVDA 2ZVPX 2FG7C 1XTIA 3V00A 1YZYA 3B9BA 3QKRB 5FWNA 1EEHA 4RTMA 3DVSX 3MWLA 1JPUA 1G8KA 5CLGA 3RROA 3LGAA 5MF6A 3P7MA 3GRRA 1T8SA 2QRZA 5TPWA 2J32A 2ZW9A 1Z0DA 2GARA 3OLQA 2ZUWA 3IP3A 5AVQA 2WLTA 2C07A 1ECJA 1SBYA 3MJVA 2JL1A 1N2JA 3C5VA 1L7PA 3KEOA 2ZBRA 3IUSA 4H4DA 5HK9A 3ETCA 5CX1A 2LWIA 4FHEA 1DFHA 3UN1A 2QN9A 1G21B 1QIDA 3C8DA 3OEEA 1AUPA 1FSPA 4YJFB 4YI3A 4FDUA 2NYVA 4YA6A 2WFZA 4CODB 4BKQA 3LYLA 1SCBA 3MIZA 3EB9A 4ACAA 3IQHX 4XD7D 1U3TA 1JB9A 1F4PA 1TKBA 3LX4A 4QTZA 3RS5A 1U3DA 1DZ3A 3AX6A 3ANLA 1E7WA 2CLHB 2WQ6A 5B2ZA 1DPGA 4QGAA 4MYDA 3H9QA 3GFTA 3WLPA 1XZFA 4NENA 1D07A 4X44A 3WBFA 4KI0A 4BO2A 1LTKA 2FSSA 3QUQA 2W70A 4ER0A 3HJFA 2C31A 2CD7A 3F1LA 5ALNA 4Q82A 3A6ZA 3T1NA 3K72B 4DADA 1SVUA 3A0RB 4KV9A 1Z6AA 1TRKA 5ITZA 2BGGA 1YE3A 2ECFA 1VKJA 2RHOA 4FFOA 1J1ZA 1Q1BA 4FMCB 1W0KD 5DBHX 4BQNA 1G4HA 3JASA 2HZ7A 4TUYF 4ATNA 4HS4A 1LZKA 4KPYA 1DQSA 4FKBA 1XTRA 3L7KA 3W3AD 3MXTA 4XM1A 2UYCA 4KWCA 3SR4A 5C37A 4LF5B 3ORYA 1KHHA 1T1EA 4IXMA 4EUSA 4GL2A 1FX1A 4YCDA 5BV8A 4GSLA 4ZQCB 3TOCA 1BD4A 2AHOA 3IIKA 1PVDA 3KLNA 3IQFA 1ADJA 3VJMA 4GNKA 1LSJA 2QM3A 2ISQA 1T25A 4NYIQ 3KL4A 1XNQB 4NX2A 3GLFE 1T24A 1RSZA 5B4UA 5JAPA 5FI0B 2DPXA 3OPQA 2CXHA 4Q9AA 4MI6A 4RACA 4B0OA 421PA 4EF4A 2WZBA 4POOA 4M1MA 4CW7A 1C50A 2ID7A 2G8NA 4KWIA 4YPOA 1B6TA 1YNSA 2O1WA 4U39A 3D6TB 2AWNA 2ZB3A 4IRUB 4ZKEA 5HPYB 3T3EA 1V9LA 5HUHA 1YJBA 3PLNA 4YRZA 3KV1A 3CE9A 3ITEA 2CFRA 2GB4A 3WL3A 1E3SA 3BKWA 4K9SA 5K4HA 4TKZA 4EHNA 4WN9B 3VPCA 2BFDA 2UZAA 3RC7A 2EJUA 1NBME 2IXTA 5HA5A 3EVFA 5L45A 5KQSA 3RI3A 4JWKA 2UXBB 3LQQA 4JR0A 3WI7A 1DTWB 5D01A 7MHTA 1I2CA 5A4MS 2FUG6 2XZDA 1JFFA 5GWXA 2AW3A 4B9AA 3IDOA 5I3ZA 2IS2A 1HL7A 3U62A 1NVFA 3U7QA 4RV9A 4KPUA 4DZRA 4TTJA 3FPCA 1IZ0A 5KHOC 2GDZA 3UK6A 3ZBPA 1G38A 3U9TA 2KJQA 3LC7O 3OBBA 2F8MA 2GVNA 4ZD6A 2QRKA 1TKAA 1Y1TA 3EXFB 5LZ8A 2JCYA 3OUZA 3PQEA 1KF0A 1DC7A 5FPSA 2P9CA 5AVVA 2C9DA 3L7IA 3ZGLA 1T1GA 3RU9A 2FQYA 5LB4A 1TUGA 3TD2A 5JW6A 1GTRA 2FPPB 3JW8A 4BC1A 2WWHA 1WG8A 3AM4A 3HP4A 2AJCA 4M0UA 4DCOA 2YVLA 4DA4A 1VPWA 2OK7A 3EULA 1D2MA 3LX8A 2XMSA 3IDSA 1VE6A 2RKOA 2NZWA 4KIFA 3S5UA 2FWBA 2Y1FA 2X19A 2B2NA 1E0AA 2ES4A 1XZIA 3IQZA 5FQOA 4X20B 3CIOA 4Q3EA 1TRHA 2Q5EA 5DHQA 4IMRA 1KYTA 2IV7A 3SQLA 2A7QA 4HEA6 1P9LA 5ER9A 3ZVNA 2HOQA 4UEJA 2HW8A 2WMNB 2JIRA 3A4YA 2XT9A 2J85A 5J5AA 1X1CA 3S2ZA 3X3HA 3G6KA 5A5FA 4DR4B 1BYUA 4RCZA 3ND9A 3PP8A 2ZB4A 4YJHA 1VHTA 4HUQA 1H5QA 1HH4A 2BCEA 1XQWA 4WBSA 5DK4A 3U7HB 4B3MB 5DVZA 1QX3A 4BBAA 2J5XA 3IURA 2HCJB 1R8XA 1S4QA 1V26A 2C2ZA 1X1TA 3FVVA 3MWYW 3V6LA 1G291 2IHJA 1PFYA 4NOLA 1Y9JA 3RFCA 4EVQA 5J4HA 2W2XA 1JB1A 5M2QA 3LGXA 3OBIA 3LZDA 5GJVC 4ZI7A 1JAIA 3DEHA 5ED0A 3FTFA 5AVUA 3PGLA 3THRA 1W48A 2FZKA 3OX3A 4Q03A 2A9VA 3H1FA 3BFXA 1VP3A 3Q72A 4MYCA 1U1GA 3DMTC 4NZOA 2C4TA 1RPNA 1XD2B 4OXYA 1EAYA 1JS1X 4BVHA 2ZP1A 2GXSA 3LC1O 3WX0A 2I91A 4DCMA 1W4ZA 4BLPA 4WNIA 2OBMA 1N6KA 5KCMA 4LMBA 3RVJA 3KJXA 3DAYA 1UEIA 5IJ9B 2J46A 1Z56C 2EW8A 3IJ5A 2BSQA 5F2NA 2D06A 4D25A 4G2TA 3DB2A 4Y2PA 2FNAA 2X7XA 1KAHA 1CUCA 1KK3A 3GEBA 5E8RA 3ZJVA 2Q6TA 4QHYA 3ZOZA 1TGVA 4LXGA 1A9RA 3HUFA 3ZD9A 5F9MA 1LSOA 4HEJA 4I50B 3MBOA 2WKQA 4MYRA 3VVCA 1V8BA 5EHIA 3TNYA 4AG5A 2R86A 1RKVA 2EFEB 2H1WA 4NFHA 3VPAA 4EGJA 3QI7A 1GL7A 5C8YA 1F06A 1QV9A 2P0EA 1CUBA 3TOZA 3JTMA 4KLZA 4R54A 3E5MA 3ILVA 5I7VA 1U0BB 1TZJA 3PQ2A 4PZPA 3JPYA 3VC1A 4EELA 3I3OA 4DLZA 3PUJA 3PUYA 3WNZA 2JRCA 3FBWA 4D0NA 5DB4A 3OHMA 3BGIA 1TMKA 3W1VA 4MDEA 4PHFA 1Z08A 1JALA 3Q5EA 2VG8A 3GLKA 1HFJA 1XAJA 4QDOA 1PI3A 1DJMA 2IUTA 1ZI6A 1CY7A 4JI2B 4N12A 4GKJB 1U2SA 2ONKA 4UHDA 3CTMA 4L8VA 4WDRA 1NYTA 1IVSA 5CA1F 4QPPA 3C1AA 4B3IA 3THWA 3DOUA 4N0QA 2B0CA 2O3QA 5F1KA 2H48A 3VPXA 2R11A 3CEPB 1L5SA 5TS3A 4Z51A 1QHEA 2B3TA 3N2GB 1OA1A 3CXUA 4IWXA 4Y2SA 4A8JB 3EY9A 1TKRA 2LNDA 2YN0A 1PEDA 5JDIA 4RKWA 3RIXA 4P4NA 2A92A 4LJ8A 3MTJA 5FI5A 5ARBA 1MAVA 4Q7KA 4JJ6A 2AOWA 5DCYA 5HIIA 1CS0A 4E88A 2I1VB 1Y98A 4KZKA 1J2UA 4RCYA 3UF0A 3PHBE 5K6TA 1Y3IA 2QUKA 3I6QA 4QUDA 5IAGA 4D5EA 1NNSA 3AGPA 1I4OA 3CUEF 5CB8A 2PFKA 1I7NA 1Z6QA 2DFVA 2PVSA 3QFTA 4C3ZA 4CZ2A 4KI7A 4D9HA 4BB5A 2ADFA 3I9V6 1QQ7A 3JWPA 2YY6A 1MB0A 1OZHA 2D0PB 1PJ4A 1T36B 1R0LA 1LA2A 2RSLA 1E3LA 1P0CA 2OQRA 1Z3IX 5TMBA 1A5AB 1Y80A 3G2OA 2YY5A 3C48A 3OJEA 4URUR 4RFLA 3LHSA 3SXUA 1S5PA 4DQVA 1RR6A 3E2IA 4JFRA 4F5ZA 2NP6A 3PLAE 2JLXA 4KOAA 3AP2A 1E94E 2Y6UA 2BJWA 4E70A 1RAFA 5CXSA 5AM4A 5FB3A 2X0FA 4KXYA 3LIPA 2OYRA 1RLOA 1UBGA 4BNDA 1J70A 4R5HA 4YAGA 1B8UA 1Z68A 2R00C 3DZ8A 1ESMA 2P9TA 4R41A 3W8RA 5EOVA 1AM4D 3IAS1 2M6SA 4QVKA 3FPKA 4OHWA 4AP5A 4CMCA 4ZHSA 1R74A 4D1YA 1N2HA 4L74A 1SC9A 2X6TA 3EBPA 2V7EA 1N2CE 1ZJJA 3RQSA 1U7ZA 4YQYA 4CIAA 3PUVA 1DKPA 1RVDA 2Z8ZA 3IMKA 1AA9A 1YAHA 3CF2A 2ICAA 4OB8A 5CFZA 3GAZA 5J47A 1YHYA 3LPNA 1KOJA 3T1OA 2ZUVA 3SM3A 1GHTA 1MRSA 1RWPA 3BRCA 3NUQA 3W2HA 2IYNA 2OILA 1S2IA 1X7XA 3PFHA 2VO1A 4JLJA 4WGGA 2MSLA 4BCCA 4ZIRB 5EHXA 3KOOA 2OBLA 1GG2A 4L57A 1KR5A 3L0PA 2O59A 4A9AA 3STVA 1KJJA 3TX2A 3FGOA 5CX1B 4EG8A 4HWOA 3GVHA 4KBYA 3QX3A 3O3NB 1E66A 2IQ5A 3II6X 4ER7A 3L0YA 3BTSA 4YR9A 3AZQA 2ZYHA 3EF0A 4YS6A 1NW4A 4CU2A 3T4PA 4LZPA 3OWHA 1QRUA 2H4XA 3TTWA 2O8FA 2BM8A 2VUHB 3HYRA 4OHOA 3BH7A 3R5FA 4F3TA 2WMOB 3EWIA 2FZCA 5HKAA 1HBJA 1Y9EA 1JEAA 1ZGZA 1DMSA 1WA5A 2B83A 3U3MA 2FV8A 1ONBA 4J0FA 1YQQA 2VYVD 3U1VA 2IUEA 4OJQA 5CYPA 4DLBA 4OA5A 4D99A 3KALA 2HWWA 3AR4A 3RSFA 3O91A 1GADO 3DEFA 1YDEA 3RAPR 2IXAA 1MEJA 5KTSA 5EE5B 1W88A 2OGWA 4F0JA 2C7GA 3ET5A 1U8UA 4X64B 1JG3A 2WSIA 4MIYA 5CAEA 3G7UA 3A14A 1TTHA 4TSFA 4M37A 1YI1A 2GA9A 4J8PA 4KQEA 1T1SA 4IHJA 2L69A 1JR6A 4KLNA 4FZ5A 2YHIA 5GV8A 3AM1A 3PXEA 3C7CB 2WW8A 3LUBA 4JBWA 4WKCA 2A9RA 1M1YA 1XPUA 1T0HB 2OO5A 1H6CA 1YOVA 4K3VA 4N5MA 2RCYA 3DE4X 5FOTA 821PA 4MV5A 4UVDA 2H7VA 2AXPA 4HDRB 4BDTA 5GV7A 1WMSA 3CBQA 3TN7A 2FXIA 3AQ4A 3FB1A 1W4LA 2QRGA 3QWIA 4JD5A 2W6OA 4M9ZA 4DYHA 2AOUA 2RHDA 2V6MA 1AS2A 1TIPA 2BGKA 3AM3A 2H2IA 3IQGX 4PO1A 1KK1A 3GWGA 4GGPA 1TC1A 2X7HA 2AXEA 3G23A 2QWXA 4JB3A 4LJLA 4Z0NA 5HOEA 3KEQA 4JB8A 1AV7A 2JC3A 1AE1A 1QONA 4L3VA 3UMCA 3NEPX 3RGWS 5CDHA 4FGLA 2AQIA 3ISVA 2EGHA 2BE7A 2P2ZA 4FXOA 3ISTA 2MMCA 5AXDA 2XVAA 5EWJA 3W6OA 4C4AA 2XKKA 1A50B 1EEXB 4BMSA 4PZCA 1JU4A 1S4MA 5JS8A 3WY9A 1QG4A 3WKDA 4Z4HA 3EHDA 1K0FA 1Z13A 2KWIA 4WZZA 2HO5A 4HFJA 2XWSA 1GSAA 3GDFA 4M99A 2BTOA 1JJAA 1T2FA 2VHEA 3UJ6A 4AJ4A 3LY9A 2I4LA 4BX8A 3G8BA 1PZXA 4LGVA 1JI0A 4RENA 1BXKA 3TRKA 3CSUA 1Y5IA 1QTRA 5I9IA 3FLMA 1L4NA 2UZ3A 3U3DA 5B6IA 4JVLA 4BO6A 1L5VA 1Z12A 1NHWA 3P5BA 4FFWA 4QUEA 3M1AA 3TQHA 2CNWA 4KO8A 5G1NA 4BFVA 1SUPA 3PYLA 3H18A 1T4GA 5I8PA 5JS1A 1GSIA 2IHUA 5DNAA 4D0GA 1NJ2A 1U1EA 3A05A 1G5PA 4CN9A 1ZEMA 4DLKA 2P9HA 5HJ5A 1U2TA 2I99A 3QQ5A 4FP9A 5CVEA 1WUJS 1E60A 3BK7A 2W2VA 1ZNQO 3PT5A 1XQ1A 1NVAA 2NU9A 3OU2A 4PRZA 5C31A 1P7ZA 2JDID 3K8OE 2PJDA 1FCJA 2A1TS 4JZYA 3UMSA 3ZUGA 4EKYA 4YJHB 1MJHA 3LQ2A 5T8KC 5TXGA 1H6AA 4C5AA 2AK2A 3H05A 4LKOA 4R1SA 5K1ZA 4KYTA 3TLAA 3KQLA 2W6ZA 3OURA 5BPFA 2QZSA 1WUHS 3WKCA 3E8MA 4NU0A 4ETNA 1SULA 4F3NA 3NASA 3FGNA 4Q3CA 1J8QA 1WHTB 3O0DA 4J1NA 5LZ5A 3VZRA 4HD8A 4IDBA 1Q17A 1S01A 2P27A 4MS1A 3FGZA 2X41A 2FPGA 2VDUE 3BQMB 4KHPB 4NBRA 1UFKA 1D7AA 4PIPA 3LP6A 5AIBA 1Y5MA 2YRWA 4HJRA 5F7XA 3H99A 4LHEA 2EWVA 5EUBA 3VR6A 4F3RA 3J81A 3OZSA 1IZYA 1NDHA 5GVSA 3GPBA 4OIMA 1L8XA 2Q9UA 3H87A 4Y3UA 3V3KA 3D5EA 3H9CA 1XCOA 3AUTA 1DCFA 3I0NA 3DO5A 4ND8B 3U31A 5D8DA 1DUIA 1VKRA 1ZOSA 5B4VA 2D4HA 5JECA 2QTWB 2RGXA 2FMTA 1CP2A 1FA9A 5IVKA 2GOYA 3P9KA 5TNXA 1O89A 5FR1A 3F6BX 4RF2A 3TUJC 4HEHA 2H1CA 5DJ5A 5BUCA 3K96A 1ZM2A 3QU9A 3EVNA 4IIBA 1SVOA 3FTEA 4J7AA 2FGKA 4KQ6A 1SVSA 4WA7A 3TNFA 2Z6QA 1PR4A 3RSGA 1BWRA 1T2EA 1OVGA 1Y8AA 3VYWA 1IUKA 4TUYA 3Q9LA 1SGWA 2QRLA 3D6JA 2ODAA 1BIFA 3Q98A 4KYIB 4BQFA 4S2EA 4RHUA 2Q4EA 2BFFA 3R3YA 5G53C 5TS2A 5GADl 2ZR7A 3JTEA 3K2EA 4BKUA 4CIBA 2EW2A 2GN2A 4WE3A 3RK1A 2Q4OA 3AIMA 3H5IA 4BY9E 2I6XA 3ZHZA 2DT5A 1KMCA 2DYKA 3TTXA 1RXUA 1NSFA 1FP1D 1L8AA 2A5GA 4ZZ2A 4AKEA 3L8ZA 4AWXA 3ETHA 4GYYA 3M89A 1VE9A 1S2OA 3PDJA 3WL8A 1P31A 4HVTA 5IJAA 4GI2A 4BUZA 2X86A 5F73A 3VH4A 4WZAA 1HLPA 1OF1A 1QGED 3B5IA 2WY2D 3OQ6A 2X40A 3OQVA 1LGYA 3HU1A 4HDQB 3EZ7A 3THWB 5C1DA 1GDHA 4MVJM 4HQKA 4RMHA 4YBZA 4E7OA 1KI4A 1C9MA 1NV8A 2YXLA 1UK7A 4AIIA 4EYEA 5K8IA 4ZI3A 4O6VA 1WOMA 5L3VA 2WAYA 2XIJA 2IDKA 1Z0SA 2YJ4A 4DUPA 4HQLA 4CT0A 5CD9A 1I94B 2VKTA 5A4AA 5KYNA 1UBHS 4LV8B 3BMQA 3WBBA 1L7EA 3T5CA 5IWCA 1CE8A 1MC8A 3G0HA 2O50A 2QENA 2FN4A 4UUQA 4KLAA 4PCLA 5FNZA 3AEZA 4RDXA 4B3SB 4PZEA 1Z6TA 1PR6A 1Q1GA 1ZS9A 1JP7A 2NACA 1A2QA 2JIOA 1A4XA 3NT5A 2XTZA 4NOMA 4PNZA 2REQB 4M9CA 1CC1S 2EHJA 2NO4A 2X6RA 3DE0X 3PU6A 4GEGA 4MWBA 4OQXA 5REQA 3UJAA 1GGEA 5IJWA 1A9PA 1UAGA 3KQHA 2BVNA 5JHHB 4B3TB 2YXBA 2Z5FA 2W90A 1G5FA 2F64A 3JVVA 1W75A 2B4AA 1Z6ZA 3F96A 1ZX1A 3KS9A 3LF2A 3LZ6A 1X7HA 1Z29A 4EX6A 1IHUA 4LPKA 1SURA 2AMJA 3LUDA 1FSFA 4ZVTA 4ETMA 3NG1A 1YASA 4NE9A 1O57A 1OH8A 1SVLA 4PFSA 2AX4A 3GGOA 2JJ2D 5M29A 2R6FA 2D5IA 1JMVA 3TD6A 3Q9SA 3FUUA 2UXCB 3C8HA 1IVNA 3DDUA 2WYOA 1RYFA 3A9SA 3U39A 1P2SA 3COYA 2ABWA 3IT3A 4WESB 3WZLA 1O1YA 1CRPA 1QH8A 2PLNA 5BWBA 9GPBA 2JIZD 4ZO8A 1HTTA 1RQ7A 4YN3A 1E0DA 4FFBB 4HGRA 3LTEA 5JZ9A 5LOVB 1GUZA 1OLUB 4R9VA 4E4TA 3U4QA 2O9JA 2AJDA 2ZWOA 3FKSD 4HKTA 2JEZA 3QLEA 2Y9PB 3PRYA 3BDVA 3DP9A 4JAVC 1EI9A 4Y18A 5PGMA 1X8JA 4E3WA 4WPGA 1T9HA 2ASEA 2XMCA 1IEVA 2X9QA 3JQCA 2C8VA 3CXRA 1X7XB 4LTDA 4QDZA 4XOIA 3BE4A 5G02A 5C7IO 1EP3B 3JXEA 1DFIA 2XYHA 3D59A 1E18A 1KI3A 2C0PA 1ODLA 3TINA 5JE8A 3ANSA 1CRWG 1NJ6A 3LO5A 4L0MA 2RIPA 4RY0A 1Y1LA 1YL7A 2OQIA 3L43A 3LLCA 4H7PA 3TOVA 2ZRDA 1DVRA 3QKTA 2CL6X 3CX7A 1O7JA 1RKUA 1S2GA 3FKQA 3E1KA 1NIPA 3RWBA 3B89A 4JP8A 1CZRA 2EP8A 1SHLA 4K87A 4MQFA 2DBRA 1G6HA 5LD2C 1K97A 1UBOS 1I3MA 3DR5A 3UAWA 1XWWA 2YY7A 2G1PA 2BGRA 5JNLA 1R9NA 3DWEX 4OXIA 5ER6A 3KOMA 4U2CA 5LA6F 2F59A 3CWQA 4JI4B 3ZE8A 1G3UA 1U2DC 4KPEC 3KL2A 4C4TA 4ZV9A 3H7AA 1XRNA 3L4KA 3U4HA 1FNDA 4IIFA 4PLTA 1REQA 2H3EA 2FZVA 2I2BA 3B1KA 3B53X 3BWYA 3P32A 3SYLA 3TZHA 4BQRA 1XNGA 2V45A 3EAQA 2Y1OA 1EWKA 1G8JA 1RRMA 5BMVB 5AMXA 1Z28A 4YRFA 5CA0B 1RLMA 1KBQA 2QTNA 5AKYA 4B2PA 6CHYA 2M6LA 4MHSA 4ON9A 3WJ1A 1EVEA 2VDVE 1V2HE 3IA7A 2ZTUA 2CDRA 1CUUA 5EVJA 2HH9A 4CQLA 3LXXA 2IDZA 1WEKA 1XWFA 1EE1A 5BT9A 1OXTA 1ODSA 2C4WA 3HWSA 2QQFA 1M2GA 3OOJA 4TYQA 5B3JC 3Q8KA 1CV2A 4DIEA 1WMFA 2HA2A 2J6CA 4K9KA 4WKBA 3IVAA 1YRLA 1ZD8A 2X76A 2YHIB 3Q87B 2RI1A 5GONB 3ZE0B 1NRWA 2YOGA 4QPZA 3ZDEA 4IDPA 2YV2A 5CA1A 5HIJA 4B7UA 1SVKA 3B1VA 2P4QA 1C30A 4S2UA 4YV1A 2OFPA 4BXOA 3V8EA 4LMRA 3VJRA 3OLCX 3OQPA 5EP3A 4ES6A 3PYMA 1UBNA 4P7GA 1ZVQA 3SDSA 2FW9A 1ZHFA 2Y8EA 4OMFG 2BKLA 4FBMA 4S1NA 5EY5B 2R1VA 4K9QA 4RJIA 3IBCA 1VHJA 1XZPA 3WICA 3HGMA 1V6CA 1Z73A 2IA5A 2FOXA 4D92A 4QASA 4BPRA 2X22A 5KJ1A 3RC2A 3D4PA 3EWSA 4Z9BA 1W36C 4F3KA 1QP0A 3ICVA 1QIEA 1K9VF 2GPBA 2H57A 2O20A 3DFKA 1DLIA 1WBJB 2CZGA 3NHWA 3QUSA 3RC1A 3RVQA 4AMGA 4E12A 5H82A 2QY9A 2RARA 3GDGA 4KWHA 2D2IA 2FE1A 1GT91 1L5WA 2N9UA 2WYUA 3O2NA 3VZDA 3AUKA 1RU3A 3PPVA 5EWJB 1P73A 1ID8A 2JI7A 3AUAA 3OFJA 1WLSA 1ODIA 4HVCA 4QFDA 4CLXA 5AJUA 3UCFA 2WHYA 4QBKA 2B6NA 1Z2DA 4HWKA 2FFJA 1XXHE 1ZFNA 2V7QD 2VPTA 4G0OA 4RS4A 1QDEA 3T7CA 1E5QA 1YZTA 2QR5A 2C4HA 1RWQA 1NASA 5HW0A 4X7MA 3W6UA 2RHHA 2I6FA 3JWIA 2IV3A 1O6BA 2AN1A 4OSOA 2BF7A 4DNQA 4PWYA 2SKEA 1WDMA 1J1IA 4WTOA 1XZMA 1THGA 1ZXBA 2JASA 1E6WA 1M72A 1UP4A 2PU7A 3UTDA 4B73A 4WQMA 3ND8A 1HYGA 1YVUA 2NN3C 2IIPA 1PO7A 1TJ4A 3OCZA 1ZO8A 4JENA 4QYMA 1OC2A 1UPBA 2PH1A 4S1PA 2B37A 2GCGA 1KI1A 2HTEA 2PK3A 4JKOA 4N49A 3V4FA 4ZDIA 4ANFA 1Z8FA 1ZD5A 1IM2A 3CLSD 1DO8A 4YONB 1E5DA 4JHLA 2Q29A 5EAIA 1X38A 2C2YA 3P97A 1KP3A 1ORHA 3ESDA 3EXHA 4GUAA 2NU9B 3WMEA 2IIQA 1VL2A 1GGVA 3ZX4A 2GBGA 3VBEA 2H2DA 4MRNA 2X0RA 1U6KA 3L1UA 1QBKC 1UPCA 4FGKA 2WM3A 4ZO4A 1PJLA 1OAKA 2CZQA 3W2TA 1EFAA 1XU4A 3QA3E 5F64A 5A4IS 5HILA 2SCUB 4IZHA 3B1ZA 1Q6YA 3UGKA 4R1QA 2Z3WA 4TGLA 2DT8A 4B6PA 1IPEA 4A1OA 4ZYZA 3PX7A 2XT6A 2D5AA 2FPGB 2FR8C 3DZGA 3FXAA 4H3HB 4I6EA 4IJUA 4LS3A 4YRJA 1XF1A 2CMHA 5BRNA 1SR8A 5AJYA 4H35A 5ERGB 3VH2A 2GVDC 3GIDA 4L51A 3TSCA 1TEXA 3GUYA 3H1TA 4B7ZA 4ZCSA 1O8BA 5ALUA 4ARVA 1T15A 2RGBA 2RGWA 1KC3A 1IWBB 1T2VA 1CUFA 1NQWA 1G20E 1ZC4A 3MINB 2GX6A 2BUBA 1PW5A 2V4ZA 1UJ2A 4AYTA 2GN8A 4IBOA 3UHOA 3MGAA 4E13A 3GLSA 4YFYA 2VATA 1VPEA 2P9FA 3GBSA 1TDJA 1PL6A 5LVAA 4RTPA 2MJLA 1K7SN 1A5BB 2CXNA 4WEQA 3RYHB 1UZNA 3NR2A 2V58A 3SX0A 2CNKA 1CQWA 4UATA 4XCXA 2WEKA 2J41A 1JHAA 1U31A 1KMHA 1NXSA 4IMPA 4OU4A 3OI7A 2I87A 5H3CA 5E6UA 3SHTA 1P6UA 2BFFB 2D0IA 3D4OA 3L1VA 1QLJA 2ZIVB 1CB0A 1XLWA 2HMSA 3FNIA 4P31A 3UNXA 1EFTA 2XCOA 5JQGB 3W7VA 2J45A 4AY3A 1QNFA 4HAZA 3ZCPA 2X1HA 3ZNQA 4DGSA 1X7WB 1FEZA 2VDMB 3VAAA 1GL9B 4KNVA 2JFFA 4L75A 1C8BA 5F1OA 4A2QA 3E6AA 2XSZD 3P4XA 2DBZA 4RHFA 3ZTWA 2VNSA 3M8KA 3FOWA 2J0SA 5HRCA 2C9BA 2WSYB 3HB5X 5AJWA 3G2LA 4AT1A 1E1RD 3PPXA 1WHSA 2A9KA 2GKGA 4EQZA 1EDEA 1UMCA 4D44A 3EGIA 3MGKA 3HR7A 1WZCA 1O6CA 3SYNA 1SCAA 1N8TA 3ZDCA 2XNJA 4JJZA 3ELDA 1P6QA 2YBDA 3MTBA 5KQGA 1D6SA 1RJDA 4DG5A 4PPNA 5FUQA 1KAQA 2C88A 3HUDA 3LQRA 3AL0C 2BMFA 2W6PA 4YLGA 1I33A 1P9OA 3CV3A 1C9NA 3ROZA 1KHTA 2C2GA 4HNAB 5I7FA 4DV0B 3NTQA 1CIPA 1NVDA 3G13A 3C87A 5KINB 1JJVA 3R3XA 3D0KA 1M1UA 1OXKB 2VKQA 1PEAA 3AI3A 3M5CA 4LZNA 4ZOBA 5EJMA 4EQ6B 4ZDKA 1X9HA 3R5TA 1SXQA 1J0AA 16PKA 1OX6A 4E3ZA 4FTWA 4MQEA 2QKYA 4OLBA 1FUYB 4HYQA 4JVOA 1JVNA 2VF5X 4ZOCA 2PCJA 4ZVMA 1KO8A 1VL8A 3GFRA 5TARA 2H9IA 1AZTA 4F8EA 2O5EA 3K9BA 4FINA 1AKMA 3SC4A 1CERA 2EBUA 2D7CA 3PUWA 4O2AF 6LDHA 4JLOA 2I4NA 2YZNA 1MN6A 4WRRA 2OXTA 2JCGA 3OZXA 3ANXA 4HNGA 1DKNA 4KE8A 4BPBA 2CFCA 5CDSA 4BNYA 5K5EA 1HE8B 4JLWA 2CFIA 1UJ4A 2WI8A 3Q6MA 3SIXA 2VHXA 3HJHA 4DVJA 4P5DA 2ZAGA 3AEUA 5FEMA 3SN6A 1TMGE 1K7FB 3MJTA 1TPYA 1RWVA 1E3JA 3K0CC 2UZ4A 3CB4A <