1PJ2A

Crystal structure of human mitochondrial nad(p)+-dependent malic enzyme in a pentary complex with natural substrate malate, cofactor nadh, mn++, and allosteric activator fumarate
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
553
structure length
553
Chain Sequence
IKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAD-dependent malic enzyme, mitochondrial
publication title Crystal structures of substrate complexes of malic enzyme and insights into the catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 184
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pj2A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1pj2A01
4TWRA 4ZGWA 3D5TA 2YYYA 4WKGA 2I3AA 3I6QA 2OP1A 1KBZA 4IXTA 1H9AA 4FOOA 3GEGA 3LVFO 3WX0A 4E32A 4A26A 3IS3A 5GY7A 4O59O 3C7DB 4TRNA 5JC8A 3O9ZA 1XG5A 3RC9A 4B7CA 3PGJA 3MJSA 4NBRA 1V9LA 2NU6A 4NMHA 8ADHA 1PJ3A 1O89A 4CUZA 3WR5A 1UZMA 3U3XA 1B26A 4INAA 4RPHA 5L4LA 4NFYA 2YJZA 4NJMB 3ZWBA 3CSDA 2X6TA 4IMPA 4AJJA 1JKFA 5G0VA 1D1TA 1XA0A 3HADA 3H4VA 1I2CA 1TT7A 2OBYA 1GUYA 1NAHA 3W8EA 4LW8A 4XYGA 3ZV6A 1LSUA 3OETA 1H6AA 4A0SA 4UUPA 5I9LA 1Z82A 3P5SA 3FHLA 1JAYA 2UV8A 2BMAA 1AXGA 1M6HA 4KUEA 1N1GA 3K73O 5T64A 4AJHA 4FDAA 4DVJA 1HKUA 3R3JA 4WCFA 1Q7GA 4UVGA 4ZA2A 3D0OA 1EFLA 2Q1SA 3OA0A 2UAGA 2J5KA 3QV1A 1Y6JA 1GPDG 3F4LA 1O8CA 2ZK7A 1PSDA 2C0CA 3JQ9A 1G6KA 3PYLA 4IBOA 1UZNA 3PVZA 5I8ZA 3DONA 4MVJF 5U4QA 1BXGA 2CVZA 3H9QA 1GYQA 2JD1A 4MJLA 1U28A 1EUCA 2PV7A 3RSHA 4NBVA 4J1QA 4NU6A 4JJIA 1EEHA 5A5EA 1BMDA 1SB8A 1N8KA 4N5NA 4DXHA 3WLFA 3TDKA 4CV2A 3PWKA 1SO8A 2I65A 3LDHA 5IN4A 4YAJA 3TZHA 3Q2IA 4XYLA 4WNCA 5JAQA 2JHGA 1DAOA 2QYSA 3LYLA 3OHSX 3P2YA 3V1YA 2PY6A 4NK5A 1J6UA 3C1OA 3U4CA 3EUWA 3NAQA 1P1JA 5IZ4A 1LJ8A 5DOVA 2H5LA 5FI5A 3GEDA 4J4HA 3HZZA 1P1FA 2VHXA 4GGOA 3PHIA 3OM9A 4BQRA 2I66A 4B3JA 4J1TA 3A14A 1LDNA 1ADBA 4KUGA 3Q0EA 4E2WA 1SNYA 2ET6A 1XR3A 4KDFA 5A9SA 1YXMA 1V6AA 2PGJA 5FWNA 1QYDA 2FPIA 4YB8A 5KJFA 1BWSA 4BMNA 4U8GA 2BKAA 1JWBB 3PQDA 1PX0A 3LC2O 4GKVA 4OIMA 3O4RA 1MXFA 2VT3A 4IQGA 2GRAA 4YRDA 3IKVA 3AI1A 1LSSA 3KO8A 4OKIA 4XQGA 4Y6PA 5TJ9A 3WJ7A 4CLRA 1PS0A 5JXWA 4CV1A 4DTIA 4LGVA 5JSFA 1VL8A 4NH4A 4JJFA 1DHTA 3OEYA 1U8FO 2O2SA 3WFJA 3GRKA 3ZHXA 4J7CA 4ALKA 3WIDA 1D3AA 1O5IA 1ZH8A 1LDBA 5C37A 2VTEA 1N5DA 1DRVA 5COQA 4BHTA 3QSGA 1NAIA 3JQ7A 4GAEA 5C5IA 3BTSA 2Q3EA 4ID9A 1IY8A 4IDAA 4W99A 4R3WA 3LQFA 2FRDA 1WPQA 1EMDA 2Q4BA 1MP0A 3DZJA 5L45A 1Y8RB 2HSDA 5KCZA 4RCVA 4ZQEA 4DIFA 1N7GA 2E82A 1ZMOA 1K6JA 3GHHA 5I7EA 5GZ3A 3T4EA 1VI2A 3BZUA 5EJ2A 1PJ4A 4JQCA 3INTA 1MFZA 1E92A 1NVMB 2VRCD 1EK6A 3HQ4O 3LLVA 3KLMX 4Z0HO 1TEHA 3F3SA 2O50A 3AJRA 3TPCA 1GPJA 4N7RA 3Q3CA 3BMNB 4J9UE 3IC5A 5HS6A 1DFIA 1Y5RA 3FD8A 1RKXA 3F4BA 3KHUA 4WJZA 3GGOA 3MJTA 1ADCA 3HDQA 3OA2A 5HBRA 5FFFA 4AL4A 1DPGA 2I9PA 1IULA 4CR7A 4IDFA 4XDZA 3BMOA 1C14A 4R41A 1I3MA 3B1FA 3WGTA 1NASA 1QYWA 5CEJA 3GPDG 2CNBA 1F17A 3H9GA 3GZNA 3E6AA 4OSOA 3VDQA 4U0KA 2QRKA 4DLBA 3EW7A 2YHIA 3KYCB 1CDOA 3TZCA 4BGIA 2PWZA 3FR7A 5KVQA 2SCUA 4W9NC 4GI2A 2IYOA 3A06A 4PZDA 4MVJD 1LDGA 3ZWNA 3JYQA 1CQJA 1DB3A 1W6UA 2I3GA 3IMFA 1PJCA 2CDCA 2Y67A 4RJTA 2ZJ0A 3P2OA 2BHLA 2B4QA 2ZJ1A 2GERA 4JX8A 2NU8A 4OHUA 5KIAA 1SB9A 2BFAA 5JAMA 4BO4A 1WZEA 3RWBA 1H9BA 1IE3A 3JD3A 2JD2A 1EUZA 3K2BA 3HHPA 4C7KA 2C2YA 3L77A 4AVYA 2IODA 1E5LA 4IINA 3E8XA 4IDCA 3GNSA 3PQEA 1LSJA 1V3TA 1HE4A 2JD0A 5B37A 2Q2WA 1XU9A 2ZQZA 3CIFA 1PTJA 2DBRA 2PZLA 3O8QB 4FC7A 4X54A 1B3RA 1H0KA 4FW8A 4ZQBA 4AG3A 3WYEA 2EG9A 1T4BA 3O03A 1N7HA 2GASA 5HA5A 1DRUA 3AUUA 4KQWA 4Q3DA 4R9RA 4A27A 3NT2A 5U1PA 1TT5B 5TC4A 2GYYA 3RAJA 3AI2A 1T25A 4JBGA 3GK3A 1PL6A 3DZIA 4NJOA 2GNAA 3E5MA 4E2YA 1HDYA 1I5RA 3DMTA 4CLOB 4CMEA 2RHCA 1P1KA 2Y0DA 2R2GA 1HETA 1ZBQA 3VH4A 4BNUA 5CP8A 3IL2A 3GUYA 5F21A 2O3SA 2CUKA 2WYWA 1FDVA 4Y8VA 3V1UA 2J6IA 3QE3A 3ICCA 3WFIA 1GZ6A 4QEDA 3NGXA 4FFMA 1ISIA 4DQUA 4OAQA 3WTBA 5J23A 3E48A 1MX3A 4FC6A 5K9ZA 3DHYA 3ON5A 1JVSA 1B14A 4F6CA 4R1SA 3INRA 4YPOA 5L9AA 4RPLA 5KNLA 3Q2KA 4MKXA 5DCUA 2WD7B 4I9NA 4XJTA 4EUHA 5G0TA 1N9GB 2BGMA 3I83A 3NTOA 4JP2A 4N54A 5G0UA 3WXBA 4MPDA 1A71A 3ROKA 2C54A 5IG2A 1EDZA 3ANLA 1N1EA 3HFGA 1WW8A 2Q2QA 1HTBA 1R0LA 2A4KA 4BO9A 3NDJA 1VE9A 1IHXA 2P9CA 6LDHA 2JCXA 5ILOA 4AJKA 4QXMA 4YJFA 1LRLA 1GU7A 3U4DA 3CTMA 4A03A 7ADHA 3QRWA 4XRRA 4S1VA 5JMWA 4PLTA 3WSWA 1KEUA 3UN1A 4DPLA 2WSBA 4FBGA 1B16A 4GBJA 1YQDA 2DUUA 1U5AA 4ND3A 3RUCA 3FR8A 3NEPX 2DC1A 2VHZA 3SXPA 2FSSA 2X23A 2BLLA 5TQVA 3QWFA 2NSDA 4DMLA 1Y8QA 4IXWA 2QX7A 4BKPA 1JQBA 3KOUA 2YQ5A 2A35A 4HWKA 4O6VA 2QZ9A 3IP1A 1PR9A 2DM6A 5IN5A 3W8FA 4H16A 4MP6A 3FCOA 1H6CA 2C59A 3D5QA 3G0OA 4WLEA 5KKAA 4D3SA 3VC7A 4ROSA 1EVIA 1E7MA 4FGWA 1A72A 3U4HA 4TMFA 3A1NA 4YAEA 3DL2A 3C24A 2EJVA 5CEEA 2UDPA 4IM7A 1IB6A 3LC1O 3C85A 4BV9A 4ONEA 1ZJZA 3BYZA 1ZK4A 2EP7A 2VN8A 3KUXA 4L8VA 1R15A 2NADA 3ZU2A 1DIAA 4DREA 3SBOA 2XOXA 5EN4A 2B4RO 3TFOA 2PH5A 4N18A 4HXYA 4IJVA 4DQVA 3KETA 3UCXA 3CH6A 1UZLA 2YW9A 2Q1TA 3FNEA 3RFXA 1PQUA 5ITVA 1HE3A 1KETA 5TF4A 2YV3A 4E0BA 2G82A 2PD3A 4R1TA 4HY3A 1ZW1A 4M55A 5DCWA 4PN3A 1I36A 1KIFA 2CDAA 4CMIB 1TVEA 2BD0A 1GUZA 1PEDA 3CZRA 1E7QA 1SMKA 3ZU3A 1YOVB 3D3WB 4QFCA 1NPTO 2V6BA 1PJLA 1C0KA 2I76A 4TRRA 3LC7O 4CR6A 1LDMA 4R16A 2GDZA 4G65A 3VDRA 2FWMX 4MO2A 3PK0A 2EJWA 2C7VA 3HFSA 3SEFA 4CM4B 3QVSA 1LRJA 3AUAA 4CLDA 2NNLD 1X7DA 4J0EA 2Y1FA 3JD0A 1SEVA 1VL6A 1PWXA 2RH4A 5L4SA 3V2HA 2Q46A 5KTKA 4J4BA 4OM8A 3ROPA 3K30A 1CIVA 4GX1A 1LLUA 4RVDA 1B8VA 1BG6A 1OI7A 2DVMA 2HLPA 2QRJA 3C1AA 5T57A 1UDBA 2BH9A 1PGJA 1L7EA 4PGFA 3H2ZA 1P3DA 1Q1NA 1BDBA 2DBVO 4J3FA 2CF5A 2PD6A 1W4ZA 1P9LA 1T26A 2OZPA 2X0NA 3BHMA 4GVXA 4NI5A 2PZMA 4RL6A 3PP8A 4BNTA 3FWZA 3E03A 2Q1UA 1YL5A 4D0SA 1X7GA 2NU7A 5ILGA 3AK4A 5I9MA 4E31A 5B4VA 2X9VA 1WDLA 3D4OA 4U7WA 4Z0TA 4IPTA 1B15A 3VKVA 1G0OA 5ER9A 3I1JA 5A04A 5JDIC 1ZXBA 3DZBA 3QVXA 4L4SA 5F3RA 1UDAA 3I5MA 2PGLA 3IOYA 1DIHA 1U3TA 3VKUA 1C1DA 3WYCA 1B2LA 2OBNA 3ZGYA 3FN4A 5MGBA 1ZFNA 1ZO8A 3DWFA 4ZQHA 1K6IA 2W2KA 4BNGA 4CV0A 4D45A 5B4TA 1PZEA 3U49A 2DLDA 2C2XA 4GVLA 4RLHA 3ZHYA 3D7LA 3DTYA 4II3A 1ZZEA 2Y1GA 1HL3A 2NWQA 2A94A 1E6EA 4MVJH 3GHYA 5JCJD 4Y67A 4XYEA 3T7EA 1E3JA 3G1UA 3LT4A 3OEWA 2B37A 4CV3A 5IDQA 4W7IA 2QYTA 3K6JA 4J43A 1PGOA 1A27A 1NR1A 5EIOA 3ITDA 1QV6A 1K2WA 4WEQA 1PZGA 2HJRA 4BNWA 3GVXA 5FI3A 4YT5A 1QP8A 5ES3A 1QMGA 5FEUA 4WEOA 4GQAA 4CMBA 3ROQA 1SC6A 4BMVA 5GZ6A 5KVVA 1HXHA 5LDGA 4GX0A 5HM8A 4EEZA 4JN6B 4U0JA 4R51A 5TJHA 1PJQA 2VYND 2RAFA 4H3VA 3JQEA 1GUFA 1ID1A 4J16A 4OGWA 5THKA 2BI7A 4MVJM 1ENZA 3WYBA 5LCXA 4QX6A 3NGLA 4EBFA 1HDGO 2WDZA 4B4WA 3FBTA 1YH3A 5I7FA 5COAA 1Z6ZA 3AU9A 3RU7A 3GPIA 4YDRA 1PJSA 3IUPA 1AXEA 4D7AA 3TL3A 4J91A 1YBVA 2VZ9A 2HMVA 2Q2VA 1JKJA 2H63A 4JXKA 4QECA 2W98A 1E7RA 1EQ2A 1XDWA 1GCUA 4CM9A 4ZHSA 5JYDA 4N5LA 3HJAA 2GZ3A 4EEXA 3R0IA 3JYLA 4BO0A 3U4IA 3WGQA 4FSHA 4G2NA 5A4DA 4S3MA 1A4UA 3RUHA 4XGKA 1YVEI 3GAFA 4OH1A 3V2UA 4AJLA 3OQ6A 4B3HA 4XD2A 4YEDA 4QQRA 4CMHA 1HDXA 1G0NA 4MIEA 4CM5A 4RO0A 4AJ1A 1OC2A 2EKQA 1CF2O 3TOXA 1JTVA 5BR7A 2YY7A 1FDWA 4HFNA 2DTEA 2NU9A 4KP7A 5A9SB 2YUTA 4FS3A 1IL0A 1MLDA 1Q7BA 4XQ9A 3JYNA 2VZ8A 1C3VA 3RKRA 4GSLA 1Q2XA 4DGSA 3COSA 2C7GA 4PLHA 4GWGA 3VTZA 5EMHA 4U6SA 3GF4A 5IDXA 2EW8A 4HNHA 3RFTA 4BO2A 1EQUA 4HNGA 2FHSA 1D8AA 3EHEA 3H8VA 1TA4A 1FF9A 3A4VA 4P22A 2FPGA 3K8ZA 3M2PA 2YV2A 4AFNA 4BO5A 3MJEA 9LDTA 3DOCA 1U9JA 4JIGA 3HSKA 1PJBA 5IF3A 1UP4A 3EMKA 2C29D 4BGUA 1ZIDA 3STHA 5G0SA 1LX6A 4ZRMA 1JKIA 3E82A 3TZQA 2RCYA 4F46A 3JQ7B 4R5HA 5AOVA 5DT9A 4EZBA 1M6WA 5L95A 3UF0A 4URFA 4GGPA 4IDDA 3H5NA 5K6AC 5DF1A 3S2EA 2B0JA 2X0IA 3GY0A 4RVGA 3GG2A 5K0ZA 5HTOA 1PS8A 4E21A 2B36A 1VJ0A 1N92A 1RM0A 3DOOA 3PDJA 3DDNA 3EZLA 1DDOA 4MVJE 5H83A 1OZAA 3TWOA 4B7UA 4Q3NA 2OO5A 2ZTUA 2AQIA 4ESOA 5DULA 4XB1A 4D79A 3S8MA 2Q4EA 5JC1A 1KVQA 3ADPA 1LQTA 1ULSA 1U1IA 2X5OA 4E5MA 4TSKA 4D3FA 3AY7A 4ND1A 3WGZA 4UVIA 4GX2A 3ZW9A 1W73A 3WOHA 2HAEA 4II2A 4PRKA 3ZNQA 1Z75A 3H9UA 3PZBA 5IDYA 4I5FA 5ICSA 5EINA 2FN7A 3ETEA 4A2CA 1ADFA 4FB5A 2WJPA 1MFPA 3DZFA 3GZNB 2Z95A 2VOEA 4XCVA 1PL7A 3V1TC 1PS9A 3O26A 1R12A 1GYRA 1PGNA 2XXJA 4XJSA 3RASA 5DBGA 2OGUA 3FSRA 5FYDA 2YFHA 1EZ4A 3L9WA 4OOFA 1T2FA 1ENPA 1NP3A 2X5JO 3JD2A 2O3UA 5JAZA 3QVOA 2PR2A 3S1LA 3SVTA 4LVCA 3I6IA 5AXCA 4E2ZA 1ZSYA 4EGFA 5CEFA 1ISHA 3B1JA 4IJWA 2CZCA 3K9QO 3AY6A 1UP7A 5B1YA 1I2ZA 1LUAA 2VWPA 2J5QA 1XLTA 5A3VA 1TI7A 2AXQA 2P9GA 4BQPA 3OJOA 4HP8A 3ZN2A 1IOLA 3IDSA 3TF5A 1F06A 4TZTA 3FNHA 3IUSA 1I2BA 1WLYA 3ZNNA 4K6FA 5L3ZA 2D4AA 1EUDA 4OXNA 4NFSA 1DC4A 1YBMA 4QUKA 3DAGA 4XDYA 3IAHA 4BNZA 4L74A 1HLDA 3ZH2A 1YQGA 5F1KA 3DZGA 3V5NA 2QG4A 3M6IA 1U7TA 1HDZA 2WYUA 3VH2A 3IJRA 4J49A 5L7YA 1WNTA 4XYBA 3UW3A 1TB4A 1DBVO 1KEVA 2ZYGA 2EKPA 1FMCA 3KZVA 2Y68A 4LSMA 3ZU4A 4EYEA 2P68A 4KOAA 4NQZA 1NQ5A 4L76A 3LSYA 4E4YA 1ZEJA 1ZJYA 1I0ZA 1H5QA 3HDHA 3C7AA 4GL4A 3EDMA 3I4CA 1Q0QA 2JAPA 4MKRA 4FPXA 4RDIA 4RZIA 4FQ8A 4NR0A 4BNLA 5IAAA 3DHNA 4R1NA 5H82A 2IXBA 3WWZA 2DBQA 4UEJA 4R69A 4CM6A 2FP4A 3D4NA 3DXFA 4P8RA 2AMFA 4YWJA 4CLHA 1P33A 1BW9A 3H2SA 2DFVA 1TLTA 4NFHA 4CM7A 2BGKA 1NVGA 1WWKA 4YRBA 4XQEA 1AHHA 2ZQYA 3UFXA 2HU2A 3JCZA 3PQFA 2W2LA 4A5OA 1FDTA 1HF3A 1UH5A 5TNXA 1X0XA 4WLOA 4KMSA 4DBZA 1EFKA 3PFFA 4HADA 4OXKA 1DHRA 2X7HA 1SAYA 5JCXA 4TROA 3PHHA 3Q6IA 1PQWA 1PJTA 4BGEA 2GUGA 4Q3BA 2O7QA 3B20A 1BRMA 4NIMA 4PG8A 4BNVA 1EK5A 1ZK0A 2HMTA 1GQQA 2ZTMA 4WNIA 1Y1PA 1HEUA 5TT1A 1YJ8A 2Q45A 2D8AA 1EE9A 5BSEA 1U2DA 3CMMA 4JBIA 3DBHA 4TKLA 2VUSA 2DPHA 4J6FA 4LK3A 1R4MB 2UVDA 4Q9NA 2PZJA 4YBZA 3DAPA 4YYZA 1GZ3A 4PLGA 2X0RA 2OP0A 2HK9A 4WPGA 4ZQFA 3ZU5A 2C20A 3DMYA 1AHIA 2FR8A 3ZI0A 3VZSA 2TMDA 4P4NA 4CR8A 1M67A 1ISGA 3PJFA 2D59A 1QR6A 4I9HA 5GMOA 4XRGA 3QWAA 4FFPA 1FDUA 1LEHA 4BNYA 5JO9A 4ZRNA 1EBFA 1NR7A 2GLXA 2OMEA 3FPCA 1DSSG 3SX2A 2QQ5A 5A02A 2DUWA 6ADHA 2IZZA 3F9IA 2AQ8A 1PGPA 5EPOA 3NV9A 5JDIA 3IKTA 3L4BA 5IDWA 4JGBA 2EF1A 3WBBA 5KVCA 1C1XB 3VPHA 3EK2A 1WAMA 4OXYA 5L53A 5I7SA 4LRTB 2ZATA 3DBVO 1M2WA 4IZIA 1PJ2A 3V2GA 5F1OA 5IXSA 4IGFA 3D3EA 3UUWA 1ZK3A 1UR5A 1DJNA 3TQHA 4IY1A 4LVUA 1C0PA 3NJ4A 5C7OO 4A73A 5HS4A 3B1KA 3CUKA 3JQBA 5T67A 2R6JA 1UXJA 3DZHA 3X2FA 2CMDA 2DKNA 4B7XA 1XIVA 5BSHA 2UUPA 3BMQB 2X22A 4BMSA 5ENVA 2FMUA 3MTGA 2Y93A 4MKZA 4BVAA 1KYQA 4BNHA 1VSVA 1CRWG 2E48A 3FI9A 2BFPA 3RI3A 3WDSA 2AEMA 3DR3A 1KS9A 1N2SA 4CM9D 3E5RA 3LT0A 3ASVA 4P38A 1QYVA 4MP3A 4TQGA 5CDGA 3KV3O 3P7MA 3H9EO 4ALLA 2IEDA 4JJGA 4U5QA 3ZNPA 2AEFA 1ONPA 1P1IA 3OECA 3WJAA 3KEQA 2BF7A 3PWSA 5JBIA 3JQ8B 3GGGA 4KDEA 1JA9A 1E7SA 4LCJA 1YWGO 4B8WA 2O3TA 3KVOA 4UEKA 3WGYA 4WLVA 1XSEA 4L73A 4XYMA 3TN7A 3RQSA 4E6PA 1KY4A 5IZCA 3I23A 2XAAA 1U2GA 3ONDA 2GN4A 5BNFA 5CDTA 2D2IA 1Z74A 1DC5A 3KRTA 4XX0A 3DBLA 3F1KA 1GAEO 3MEQA 3VZQA 3QIVA 5JAIA 4Z9YA 4CL3A 4XKJA 5TS3A 2I99A 4CM3A 3H65A 1ZUD1 3QW2A 5DCYA 4XA8A 3ADOA 8LDHA 3CMCO 5A06A 3DBRA 1MXHA 3M1AA 1DIBA 3DO5A 4DIOA 5JE8A 4F6LA 1NFFA 5CDYA 1K5HA 3ZNOA 3KSZO 4ZU3A 5G4LA 4NPCA 1GFSA 4NBUA 4IGEA 1WP4A 3GVHA 2VYVA 5G4KA 3QY9A 3JQGA 1NBOA 4EJ0A 4FR5A 5THQA 3NTRA 5TRTA 5BNIA 3LF2A 1B0AA 5MDHA 1OBFO 2IZ0A 2YQ4A 3PWZA 1NX6A 1U8XX 1ADGA 4XIYA 2GN8A 1LC3A 1KVTA 1AN9A 3RBZA 4XR4A 2P2SA 4TVOA 1OMOA 4YT2A 3A28A 3EYWA 1ORRA 3GR6A 3JYPA 1CYDA 3GFBA 4EJMA 2POQX 2R00C 3IIEA 4EW6A 1EVZA 4FJ2A 3G1TA 4JBHA 1WDMA 4FFRA 5A3JA 3RIHA 2EXXA 1HZZA 3DB2A 3INGA 3JQ9C 5G0WA 3WNQA 3PHLA 1XWFA 4FCCA 3PZRA 4R54A 1Y9AA 4DBVO 3PYMA 3RUFA 1LU9A 3N74A 1NM5A 4M49A 2GPTA 3NT5A 4J90A 3L4SO 1A7AA 3W4KA 4Z0PA 1JWAB 3TZKA 1NFQA 2E4AA 1W0CA 1ZK1A 3PFWO 3BMNA 1XELA 3BMCB 1IPFA 4ZJUA 5CDSA 1U4OA 1DFHA 2YZ7A 1NYTA 4OJNA 4EUFA 2LDBA 4RQTA 4RGBA 4WOJA 1QRRA 4NBWA 2P91A 2RIRA 3WNVA 3WMWA 1F8GA 3F5QA 1P1HA 1GQ2A 3OP4A 4CPDA 1KEWA 1YB4A 3CZMA 4XR9A 3H5AA 3OBBA 3ICPA 4I8XA 3AOEC 1T24A 2DQ4A 2ZCUA 2YFQA 3MJ4A 4RV9A 1IZ9A 2PTGA 3VVCA 1P45A 5A1TA 2A9FA 1GEEA 1I10A 2QHXA 2X8LA 3E1KA 1CEQA 3TNLA 1QLJA 3WLEA 3NDRA 1VRWA 4IDEA 1DC3A 3EVNA 2FSVA 4CM8A 4BO7A 2D5AA 1DEHA 2X1HA 3UHAA 2LDXA 4ND5A 3ZHBA 4DUPA 3SLKA 2B5WA 2PGDA 3HWRA 3FTNA 3JD4A 5TGDA 2YHUA 1GYPA 1FK8A 4XZ3A 5JW6A 1VKNA 3UOGA 2CY0A 1YL7A 4DIBA 5A05A 3F5SA 2F1KA 3RC1A 5T5QA 4AJNA 2G5CA 2AA3A 2AHRA 2AQHA 2HMSA 4HV4A 2B4TO 1Q0HA 2QW8A 4BB6A 1I3NA 2XXBA 1J0XO 1DC6A 4R9SA 4H7PA 3M1LA 4AJPA 4B8ZA 5AXBA 4BO1A 1ULUA 2D3TA 3O8QA 1LLCA 3PJDA 3DC2A 4FD3A 4NDNE 4BO6A 5BNTA 1K3TA 3DFZA 1P74A 4KZPA 1K0UA 2Y99A 3BTVA 3UXYA 1LQUA 3I4FA 1T2AA 4L4XA 4N5MA 3QWBA 4UVEA 3TZ6A 4ALMA 4U6QA 4ZQGA 1DRWA 1XU7A 3NKLA 1GD1O 3JQCA 1YO6A 2DT5A 3PLNA 3RC2A 1X1EA 3GDFA 4Y6SA 4RVUA 1M76A 5TLSA 1LBEA 2P5UA 4PLZA 2NVBA 2VNSA 1IPEA 3OMLA 4J0FA 1UP6A 3JTMA 5TT0A 4I9UA 5CFZA 1I30A 4CQLA 4PLWA 4AJ4A 4AJ2A 4H15A 3ZV4A 1O9BA 1E6UA 3GNQA 2FR1A 3OJ0A 1TXGA 1E5QA 4Z3DA 1HE2A 4L9RA 4UREA 1Z7BA 4CLEA 1S7CA 2Y66A 5LDHA 5CG2A 3OFSA 2WD7A 1GL3A 4KTVE 2V6FA 4EJ6A 3AU8A 3OF2A 2IXAA 1N9GA 4DYVA 4IZHA 4PZEA 3JYOA 3PIDA 1H2BA 2VHVA 1EE2A 2O2YA 2C82A 3ONEA 2Y1EA 4O1MA 3ANNA 2VRCA 1FDSA 4GMGA 4L0QA 5CPFA 1T1SA 4YQZA 4W82A 5TX7A 1MA0A 2W2LD 4JP3A 3GAZA 4RDHA 2FY8A 1GTMA 2X58A 4J1SA 3UH1A 2G17A 1R4NA 2GSDA 3VPXA 4Q39A 2CSUA 1IHYA 3BHJA 1UJMA 4K26A 3K31A 2Y0CA 4B3IA 3QVTA 1DJQA 4P4GA 1SOWA 1BXKA 4DC0A 2AG5A 1YGYA 2GN9A 3EAGA 4PG6A 4LRSB 1ISFA 3PJEA 1KEPA 3DHEA 3AY3A 3GDGA 4Q3EA 1YONA 1I32A 1KVRA 4CUKA 2WTBA 1ARZA 2VZ0A 1E3LA 3BXXA 1I3LA 1P77A 2CVQA 4E5NA 1V35A 4BKOA 4R4JA 3PLRA 4QFDA 1J5PA 4BO8A 2NVWA 2DU8A 3AOGA 1KOLA 4WCFB 4JNKA 3ZWCA 1YE3A 4OQYA 3GRPA 1R16A 2OHXA 3FPLA 1M66A 5L7WA 4CM1A 3B6ZA 1E3WA 1F8FA 4IS3A 3DEYX 3NYWA 3ZWXA 4DPKA 4LMRA 3RVDA 1Q0LA 3W1VA 1U3UA 4CMEC 4OKNA 3BIOA 1BXGB 4ZN6A 1X0VA 4YAGA 3PJGA 5IFLA 5ENDA 1I01A 2HMUA 1SBYA 4XEHA 2J3JA 2OUIA 2ZTVA 5A9TA 5A03A 4OQZA 2AG8A 3ZWVA 2HKIA 1KVUA 4MVJI 2EHDA 4FFOA 4CMAA 4TRMA 3KYDA 1BSVA 3NJ8A 1BVUA 3E9NA 3L0DA 4GKBA 5ICMA 1A7KA 5DP2A 2VCYA 1MV8A 5KJCA 3KSUA 4I5EA 4NZ9A 1B8UA 1GZ4A 1S6YA 4RF4A 2NACA 3WTCA 5CPBA 1RYDA 1E1MA 3GVIA 3WGHA 4PLFA 4BNMA 1O0SA 3UCEA 1T4DA 3ORFA 2AE2A 2AE1A 4MINA 5BSFA 3DZKA 1R0KA 3E9QA 4W4TA 4WECA 3ENNA 1CWUA 1I3KA 2VWHA 3GA0A 3H9JA 1VPDA 4RLSA 3PTZA 1WMBA 2G1UA 3AI3A 2PLAA 4W9NA 3UCFA 2ILTA 3UKOA 3HDJA 4IDGA 4LISA 4BL5A 4E5KA 1EDOA 2DTDA 4ND2A 2HUNA 3GN1A 4YT4A 1ONNA 3GZ4A 2O4UX 3H5RA 4R01A 1P31A 1ZSNA 4CLRB 1PIWA 3ZWPA 2PA3A 3BAZA 2EKLA 3LF1A 4NNJA 3RU9A 4IUYA 2P9EA 4J9VA 1BVRA 4WUVA 1E3EA 2D1YA 1RM3A 1VL0A 3GT0A 3U62A 1PGQA 5DBIA 4IJUA 2GR9A 7MDHA 3WGGA 1BW9B 3AWDA 3EC7A 3C8MA 3HB5X 1Z45A 2TMGA 4XB2A 1DIGA 1NHWA 3SC6A 4AJEA 3CINA 1OAAA 1YKFA 1SEPA 2WM3A 1H6BA 4M87A 3S2IA 3PHGA 3UICA 1VJ1A 1PL8A 3W8DA 2UUOA 1E0DA 1I33A 3C3XA 3NRCA 4BNJA 5C7IO 2E37A 1DLIA 2HO5A 3RKUA 1A5ZA 3U9LA 3PHJA 2RH8A 2VYVD 3RUIA 2VWGA 3I9LA 3R3SA 5DP1A 5EL0A 1JAXA 1NXQA 1PU2A 4GMFA 1A9YA 2CDBA 5JPIA 4YJDA 1NQTA 3DQPA 3RROA 4E3ZA 4RPGA 4B4VA 2Z1NA 4KWHA 4LCEA 5DNAA 3VH3A 5JY1A 2WE8A 3ETDA 3I9OA 1ZKMA 4YACA 3WGIA 4OSPA 3BMOB 4HFRA 4PIVA 1R6DA 1GQYA 1O95A 1JLLA 3WIEA 1XEAA 2HK7A 4TKMA 2JFFA 3H3FA 1XQ1A 2Q99A 3PGXA 3WQRA 2BELA 3JQAA 4OYRA 1BTOA 1PR3A 3TL2A 3TSCA 1O94A 5KVSA 3PRJA 1XYGA 1YB1A 2Y1OA 4GLLA 2IDZA 1U5CA 2GD1O 2YHIB 3G3EA 4BO3A 5I9NA 5IXYA 4FJ1A 2W8ZA 4RPKA 4NU5A 4IIUA 2NUAA 4WE3A 1XGKA 3AM3A 2H9IA 4YJHA 1QLHA 2I67A 2O23A 4UVDA 2GCGA 4DPMA 5AVOA 3AFNA 3R1IA 4DC1A 1GV1A 3GDOA 2NV6A 3ZDFA 3N58A 2I6TA 3K96A 1T2DA 5COBA 3Q9NA 3G79A 4CODB 1JN0A 3F46A 3P19A 3VPSA 1VM6A 2V65A 2J8ZA 1H94A 3GGPA 4OL9A 4CQMA 1HYEA 2B35A 1HLPA 2R00A 2FZEA 2AQKA 3W4IA 1HYGA 2EP5A 1YJQA 4PLPA 4Y6RA 2I5PO 2ZB4A 3ZWOA 3WG9A 3O38A 4K6CA 1NWCA 2O4CA 3B70A 1BXZA 4W7HA 4K9DA 3U09A 2HRBA 2IYPA 3WQQA 4YJGA 3GOHA 1UXHA 4BNKA 4FJ0A 3MJCA 3T4XA 4JROA 2PD4A 4K28A 2C5EA 3AM5A 1V0JA 2QZZA 2B69A 3I3OA 5HWSA 2GN6A 2GGSA 4DRYA 4FIZA 1LRKA 3QVWA 4HBGA 1VC2A 3ONFA 5DDIP 1QKIA 1VLLA 4L4RA 5TSDA 4M86A 2NVUA 2WD8A 3L6OO 4BS9A 1NQOA 3AOEA 2H6EA 3LT2A 3RC7A 1MG0A 3RJ9A 1H93A 3NDIA 2WMDA 2WE7A 3OJFA 3DBLB 2NTJA 3PYXA 1G1AA 5AXDA 3K2EA 2O3JA 1P0CA 4RPJA 2ZKLA 4CLXA 3MTJA 1WVGA 4MDHA 1SCUA 2IEBA 3JQ6A 4J1NA 3DBRB 1MC4A 2GO1A 3KBOA 2W90A 3I9MA 1X15A 3OQBA 4RVFA 3JV7A 1U3WA 5G4KB 1H6DA 4RF3A 3JQGB 1LA2A 1LNQA 4HFMA 1VSUA 3LK7A 3FRJA 1X1TA 2EIHA 4YJFB 2Q1WA 2NQTA 3MWDB 2YDXA 3CKYA 4E5YA 4NG5A 3F1LA 4XIJA 4UUMA 1NHGA 2VNAA 1ZEMA 3AFMA 3S55A 1GCOA 1SZJG 2XF8A 3QA9A 1X7HA 4RZHA 4CMKA 1BHSA 3QLJA 3S2FA 3WGOA 4K1LA 5CG1A 4ILKA 5JCJA 3ROMA 1D7OA 5JYEA 2P4QA 1Y8QB 4C4OA 4YXFA 4G81A 3RFVA 1F12A 2F00A 5JMPA 1P1RA 3EZYA 3GN2A 1V3VA 2JCYA 3Q1LA 1CETA 9LDBA 3HG7A 4EUEA 2P4HX 4YQYA 3JQFC 4TZKA 2Y1DA 5JLAA 5JDCC 1X14A 3KTDA 2ZCVA 1FXSA 4DYDA 4MIOA 3E18A 4QTZA 1K89A 1J4AA 4B79A 3KLPX 1UXKA 2VYNA 4NJMA 4AICA 5FF9A 1AE1A 5CHEA 1B8PA 1GY8A 1LI4A 5T6BA 3H3JA 1D1SA 2PKRA 3ABIA 3D64A 4HKTA 2UYYA 2PZKA 3KXDA 4XQCA 2X5KO 3DFUA 4NHEA 4I1IA 4BNIA 1R0SA 3DTTA 4I08A 3VZRA 1GEGA 5KJ1A 4BNFA 2FOIA 4BB5A 3PIIA 1QYCA 4LMPA 3GEMA 4D41A 1ISJA 4CM8B 1Z7EA 2V6MA 5B4UA 1LC0A 1E1NA 2HCTA 2OFPA 3FTPA 2PKQO 1PZFA 4D46A 1MGOA 4GSKA 5DN9A 4BUCA 2IE0A 1DAPA 2CFCA 2WYVA 2VOJA 3EGOA 3ZCXA 4ITUA 2WWRA 5U9CA 2B5VA 2ZIZA 4MIYA 1RPNA 1ZMTA 4UEOA 3SJUA 3VTFA 3LLSA 1UUFA 5KJEA 3OJLA 1UAGA 5IJZA 3C1TA 1YDEA 4E33A 5DBFA 2DTXA 4PLYA 3RD5A 2EWMA 4KWIA 4R68A 4PLVA 1WZIA 2HMWA 2J3HA 1E3SA 1PQPA 4D43A 5T8KC 1MB4A 2Y05A 3PXXA 3SJ7A 3ZWYA 2CF6A 3JSAA 2JJYA 2E6UX 3CE6A 4PLCA 5I8WA 4GWKA 1E7YA 3BTUA 1ZVMA 1UAYA 4JCOA 4EITA 3R6DA 2A92A 4OMUA 1OC4A 3S2GA 1OOEA 2Y1CA 2Q50A 1AGNA 5HRUA 5GZ1A 4UAGA 2V6GA 3DOJA 1XQ6A 4Y98A 4BNNA 1RM5A 3GMSA 2Q49A 3QJ5A 2Y0EA 4RQUA 2YV1A 1JW9B 4EDFA 2OOSA 3FBGA 4TVBA 1I8TA 4XGNA 4WLNA 4WGGA 3GQVA 1NQAO 2D5CA 2CVOA 4YCAA 4CQLB 4DLLA 1H2HA 2QIOA 3AUTA 4J7UA 1M75A 1HDRA 4B4UA 2GZ2A 5A5FA 2ZYDA 1QXSA 1HWYA 1UXGA 3V8BA 3NUGA 5DZSA 2ZYAA 3HN2A 3WQSB 3D4PA 4AJOA 2PK3A 1C1DB 1HDOA 1ONOA 1KERA 4J4TA 3F6YA 3RUDA 1B7GO 1LTHR 2DFDA 2W2KB 2X9GA 3VPFA 1Q7CA 3WB9A 3RJ5A 3C7CB 3W6UA 3NX4A 1QSGA 5F5LA 4HX5A 5L51A 2NM0A 3AUSA 3U5TA 1YBAA 2QRLA 3KSDO 3Q9UA 5EQFA 3HNPA 4WCFC 2HDHA 2J3IA 4F45A 1JVBA 3TRIA 3T7CA 1Y8RA 3VZPA 4EI2A 1Y7TA 1FJHA 3AM4A 1ISMA 2AW5A 4DWVA 3ASUA 4PVCA 5DOZA 4Q3AA 4UULA 3OIDA 1R4NB 1ZNQO 3PPIA 4B4OA 4WLUA 5EQDA 5CDUA 3KEOA 3Q11A 4I5GA 1JDJA 1WXDA 1SOVA 4CMJA 4CMGA 3W4JA 5BT9A 4LSWA 1RJWA 3HB4X 2FPPA 1E6WA 3SC4A 4F3YA 4M8SA 4RVHA 2VUUA 4WLFA 3CXRA 3QQPA 3RBVA 3MCVA 4YVFA 1E1KA 3OIFA 4O63O 4ZVVA 1EBUA 2GF2A 2HJSA 1HYHA 2BI8A 2D0IA 3PI7A 5KJ6A 1AUPA 2CD9A 4PVDA 1R4MA 1SPXA 3ANMA 1E1LA 3VVBA 5K6AA 3HDYA 4ALIA 3CEAA 4PFJA 3JQAD 4ZD6A 3G17A 3VAZA 4XGIA 3SLGA 4RF2A 1IZ0A 4AJIA 4WK6A 1E3WB 3K92A 3KYCA 3RUEA 4I5DA 5C7LO 2EGGA 1DLJA 1YB5A 4GH5A 5KOIA 3L6EA 1U4SA 1PWZA 2HQ1A 3G49A 3PEFA 3I9KA 1GDHA 5BQFA 1Y5MA 4YAKA 1LSOA 1HSOA 1DOHA 2J3KA 4ZICA 1E3IA 4FFNA 1L7DA 1C1XA 4DLAA 3IP3A 1Z73A 3OJEA 5I7VA 2JHFA 3HUDA 3KYDB 1YDWA 2VRBA 4IQ8A 1ENOA 2AEJA 3VOSA 2OL4A 3EY4A 4JLWA 4YR9A 4CQMD 2HRZA 3MZ0A 4R5MA 3RBXA 4J7XA 3TJRA 3GC6A 2O7SA 4UVHA 2NTVA 1MC5A 3X2EA 4BIIA 4JK3A 3ZZNA 4QT0A 3KM0A 4DA9A 5LC1A 2G76A 4R3NA 2DAPA 4E12A 2GZ1A 4E30A 1PZHA 1HE5A 4FFLA 3VH1A 3ZHZA 4M89A 1HSZA 4Z3KA 2EV9A 3ZWWA 3BMQA 3GLQA 4UUNA 4RORA 2EGHA 3OQ1A 3LU1A 1KC3A 5JY6A 1TT5A 2VUTA 1LLQA 3ITKA 4P4LA 3GMDA 3QWHA 3BTOA 2JCVA 2DBZA 3OICA 4E13A 3ZW8A 2VT2A 1J49A 1P44A 4CLOA 2C5AA 1UXIA 2WEKA 1HZJA 1F14A 3D1LA 3GNTA 3JQ8A 4D0RA 1ZXLA 1R66A 3OH8A 4O5OA 3LZ6A 4WOKA 2ZB8A 2H1SA 4D42A 4DMMA 1MUUA 2PNFA 4PG4A 4M54A 1Y9EA 1QV7A 4Q3CA 2HK8A 1OFGA 1KVSA 4IDBA 3FNGA 1KY5A 4W6ZA 1O6ZA 2ZB7A 3I9NA 1XCBA 4GPD1 4E2XA 1UDCA 3MOGA 3ENKA 2BFMA 2O48X 4BKRA 1IYZA 1ZSVA 1QG6A 2V7PA 1F0YA 4KQXA 3L9XA 4BKQA 2JKVA 5ADHA 3U0BA 3L07A 1NNUA 5EERA 4NBTA 1T2CA 1C0IA 4PZCA 5F5NA 4IIVA 5JO0A 3F47A 2FZWA 3L4BC 4M1QA 1DO8A 2X86A 3WMXA 3GVPA 1DFGA 4BKUA 2JL1A 5BSGA 2Z5LA 1E77A 3A9WA 4HUJA 5ER6A 5C3MA 4QSMA 4IJKA 1MG5A 4ALJA 1LXCA 4OOEA 4FOSA 4YTEA 1RM4A 1P0FA 4BOYA 4MP8A 1EVJA 1LLDA 1NTOA 4Y9DA 3BHIA 3JQAB 3ZV3A 3ETGA 3WWYA 5JNLA 5EESA 4DL9A 4D3DA 2B83A 3FNFA 4PRLA 5L4NA 3JQBC 3H7AA 4FGSA 1VKOA 3H6KA 2VTDA 1JU9A 4YJHB 3MJVA 4MVJA 1YL6A 1YRLA 3I9JA 1RYEA 3OSUA 3MOIA 4LN1A 3ZWMA 4E5PA 3ULKA 2PFGA 4CL8A 1A9ZA 1BGVA 1WMAA 2PKQP 1IUKA 3BMCA 1ZK2A 2EEZA 5AQ1A 4GX5A 1ENYA 3DMTC 4D44A 5CAEA 5JFOA 4A7PA 1U7HA 3WICA 4OO3A 4A10A 3MWEB 1T2EA 1DXYA 2P5YA 2RBEA 2XPCA 3TFQA 5B12A 3KB6A 3QP9A 4R1UA 4PCVA 4YA6A 1LDEA 4CQMB 5F1PA 5H81A 1XHLA 3CPSA 5IZCC 1E7WA 1K6XA 2NQ8A 3QHAA 3NTQA 3GUCA 3UAGA 1LDYA 1WDKA 3GH3A 3AW9A 3UVEA 1V8BA 1YQXA 1X13A 2ZTLA 4KUHA 1EVYA 2BFOA 2O3RA 5L7TA 1QYXA 3JD1A 4CJXA 4IQ0A 3KYBA 4QO7A 2JFHA 2FR0A 3FF4A 3LT1A 4KTTE 4YJGB 4CMCA 2RHRA 2OXIA 1I24A 3OIGA 2O3QA 4O0LA 2OORA 4UUOA 4TRJA 3K5PA 2VWQA 5L40A 1L1FA 1NPDA 1NWHA 4GLOA 1R37A 3JQFA 1XKQA 4CMIA 2BRUA 4WCDA 5JDCA 1DIRA 1HRDA 5JS6A 2E49A 5KWEA 3ZWAA 3ST7A 4XWYA 4MVJG 1YOVA 2DPGA 1D4FA 3D3WA 4PG5A 3RCBA 2VHYA 3WS7A 3ZV5A 5AYVA 2YDYA 3WBFA 3BA1A 3GFGA 3HN7A 1NVTA 2NVUB 3I52A 4RF5A 4BGVA 1B3BA 2X0JA 2JFGA 4CM4A 2IZ1A 3W6ZA 3IQDB 4BNXA 2VQ3A 3TOZA 2JAHA 2VHWA 3QWIA 3WSVA 2G0TA 3M2TA 1ZCJA 2PH3A 5G2OA 4IS2A 1CERA 4YRAA 4J2HA 4MOWA 1RWBA 4CUJA 4J2OA 4Z6KA 4NK4A 1GV0A 1CJCA 2BGLA 1A4IA 1ML3A 4G5HA 4IMRA 3VHRA 3GG9A 3NT4A 4PG7A 2X4GA 1NFRA 4C7JA 1GADO 3IJPA 3E9MA 4ND4A 3N7UA 5TIIA 4L75A 3FWNA 2EERA 5AXAA 4YAIA 4WASA 4BV8A 1U3VA 2EW2A 3GVCA 5ITWA 2Z1MA 5A9RA 3UGKA 4Z9FA 3L6DA 1V3UA 1VJTA 1C0LA 1W8DA 2C07A 1HDCA 1GR0A 1NPYA 3RUAA 4YT8A 4QO8A 4Z9XA 2IRWA 1CQIA 4FN4A 3JQDA 4MVJP 4HFJA 1T1RA 5T8KA 3EVTA 3VPGA 4DQXA 2J5RA 4ALNA 3DAFA 1BDMA 1KC1A 2W4QA 4RVSA 2ZB3A 1HT0A 2X9NA 2NLOA 3HE3A 1YS4A 3PDUA 2NTNA 1QORA 3DBHB 1Y81A 5KKCA
chains in the Genus database with same CATH superfamily
4TWRA 5LVAA 4NXMB 4DTCA 3D5TA 3NWBA 4ARVA 3ONNA 4EY6A 4DW8A 2OP1A 3KB1A 4TL7A 3CNOA 4FI3C 4BECA 1AURA 4EB8A 2GKSA 3LVFO 5I45A 2RE8A 1CR0A 2DFKB 4O59O 2RARA 3C7DB 3TLCA 4LOKA 1FFXA 1ZI9A 1NU6A 5JC8A 3U7GA 1KMHB 5BR1A 1XG5A 2QN2A 3RTEA 4IXDA 1W7AA 3MJSA 3PFCA 4NBRA 2HRRA 8ADHA 4NMHA 3BF8A 1PJ3A 3ETNA 3HXKA 3QW4B 2CXQA 2JANA 4LGCA 1E0JA 3T3GA 2W48A 5EMNA 2BZSA 4OP2A 4Q4CA 4NFYA 3U16A 3PNMA 3CSDA 2M1ZA 2WJ4A 2X6TA 1B8OA 1KKLA 3TTYA 5AM4A 3IQIX 2VP3A 1D1TA 4AJJA 1XA0A 3GELA 3HBFA 1TYDE 5KNBD 4YRJA 3FOZA 3W6NA 1Z8FA 2WTNA 4MWCA 1GUYA 3UIEA 1Y3IA 3KDAA 2VJBA 3ZV6A 1LSUA 2YJ4A 3OETA 1H6AA 3AVQA 4C1NA 1HT3A 4L15A 4A0SA 5I9LA 1Z82A 4Z4EA 3CW8X 2HPHA 2P6RA 4RKEA 1C9DB 1M6HA 4KUEA 4AJHA 2NO5A 1Y42X 3H83A 1J0EA 1XPJA 5AWFC 2CVHA 2JPDA 2I80A 3O9VA 3R3JA 4F97A 1TIKA 1U1DA 4HXEB 5GGYA 4O1IA 3IB6A 3HYLA 5BRNA 1EFLA 3OA0A 4F5EA 2J5KA 3HJCA 1Y6JA 3H2YA 4COOA 4XW2A 1O8CA 1I51A 2ZK7A 1YAHA 1YB6A 3NRBA 3QI2A 2OHVA 3PDIA 1T36A 1AF4A 1WQ1R 3KVVA 2JW5A 3I0MA 2YY6A 5U4QA 4MVJF 4BP3A 2UYGA 1IFXA 1QVAA 1BXGA 2J7PA 2YWRA 1D2GA 1GYQA 5LZ8A 1EUCA 5DNCA 2O20A 3OFKA 2O0MA 4DWOA 1SG6A 3HZHA 4J1QA 1HORA 5DRTA 3W7BA 1DI0A 3ML1A 3CRW1 2IJGX 4DUYB 4JJIA 3ND7A 1PHPA 1NBME 2EZ8A 1ZNWA 2GBIA 2I8LA 3JARB 4BCBA 4KREA 5E7QA 3SQDA 1EKXA 3JZFA 4JYCA 4MAAA 4TT8A 4J29A 1CR6A 1KMQA 1SO8A 2IYXA 2I65A 3LDHA 2AOTB 2Q8QA 4WA8A 3UJ8A 3Q2IA 4BAGA 3NTUA 4WNCA 2JHGA 2B2CA 5TV2A 1OXUA 4A92A 2ZREA 4IVQA 3N70A 4N0MA 3H11A 1J6UA 4NK5A 4X8OA 4X8HA 5ARDA 1P4SA 3EUWA 4JEHA 3V2IA 1ADYA 3AV3A 5IZ4A 4KFCA 4ZI7A 5FI5A 1H4SA 1MW9X 2V4UA 2F1IA 3O8BA 3GEDA 2RGBA 4MHSA 4HN9A 3HZZA 4UBOA 2VK8A 2GZMA 3OKCA 2ZRNA 4JENA 4UU7A 1R9MA 1HNZB 3PHIA 2XEXA 3HJRA 4B3JA 4U63A 4J1TA 4X1YB 2ODPA 3A14A 1G8FA 2PMWB 1ADBA 3GJ0A 4XX0B 1QPBA 1XZLA 1RWQA 4ME6A 4E2WA 2ET6A 4FEYA 4LDRA 3UPDA 1XR3A 4KDFA 3JZDA 1YXMA 2H29A 3PUIA 1BN6A 5FWNA 3U19A 3LQQA 5KJFA 1V3QE 4U8GA 1UZAA 1VIVA 5KTOA 1MO6A 1NV8A 1TL7C 5IAOA 5K3AA 3M34A 3NU1A 1GFIA 4KMMA 2L69A 3FDZB 3ZQ4A 1MXFA 1UEXC 3BJIC 4IQGA 5IT0A 2GRAA 1UKBA 4R8RA 4J3NA 3AI1A 1LSSA 2C78A 2VT7A 5EE1A 4BFCA 2IYAA 5TJ9A 3V7WA 1U0RA 1R5JA 2ZYVX 5JXWA 4DV4B 3ZYCA 3TQSA 4IJ5A 1T3HA 4LGVA 3TGWA 3L7JA 3VKFA 1EB9A 2BTEA 1DAFA 3ZD6A 2BT4A 3WFJA 3B2EA 3LPCA 4J7CA 2FETA 3H1FA 5KNCA 1M0EA 1PK8A 1LDBA 2XWSA 4Y2GA 5C37A 2EFYA 4PBRA 5FBHA 2VTEA 1N5DA 4WK0B 3WV4A 3V32A 4BHTA 4XWTA 1B6SA 1K8YB 1YVRA 3KEMA 2ZUWA 3DE1X 3DFKA 4K9SA 5JANA 3CJRA 2ZAOA 3U1TA 1BKDR 3L18A 3Q0TA 4Z7OB 2PO5A 1ZGHA 2FRDA 4ZC1A 3A4LA 1MP0A 4EMSA 1IZ7A 4Z7QB 2TYSB 2A1TR 4N0QA 4CIAA 1QIJA 5KCZA 4QXOA 4ZQEA 1QF6A 4DIFA 3VPAA 3NIDB 1K6JA 3CF0A 3GHHA 2R25B 4JMPA 4ROTA 3T0FA 3T4EA 5GZ3A 1QFMA 5K3EA 1ZIYA 4MPPA 4YGXB 4N5HX 4JI4B 1XF1A 3RLFA 2HJ9A 1Y5LA 3W2TA 3VO8A 1EVKA 2WINI 5ALEA 3J80A 1O0CA 1JQEA 4OQPA 5E2IA 3LLVA 2UKDA 3I6ZA 5EHNA 1TEHA 1JAZA 1H85A 2XUKA 4NEGA 4ZV9A 4TXNA 3WZ2A 1AIPA 5FADA 3L79A 4GFDA 3TPCA 5CA1F 2ZFUA 4HNAB 5GV8A 3UWKA 4KYIB 1WHTA 2OHIA 4LYHA 4ATNA 1N0WA 1Z25A 4JL5A 4GNRA 3ZDBA 3DE0X 2HNKA 3AKYA 2ENWA 4CDGA 3MJTA 3D7RA 5KKNB 5FFFA 3LDGA 3ASZA 2FEAA 2QX8A 2XKAA 4AL4A 4DCMA 2I9PA 2C4TA 4XDZA 3BMOA 2VYFA 3U7QA 2Q9AA 1NVAA 3TSYA 1G5RA 4MAMA 4PYQA 5DTMA 3VGPA 4LF6B 3D6AA 1Q15A 2QLTA 1RWWA 3N2KA 5EIBC 2RGEA 3GPDG 1N6HA 1MF7A 3IV7A 4JLPA 3SQWA 3QHQA 1F17A 4MVWA 4REMA 1WDWB 4H1UA 2NPOA 3ZKAA 1VMEA 2XDAA 1ZDMA 3VDQA 3WLIA 2L42A 1KBOA 4TSFD 1CDOA 2QL5A 1T8RA 3QPCA 2Z6AA 1D2EA 1Z2CA 3ESBA 1Q19A 4OFWA 2Z9CA 1F1BA 2OCKA 2YFYA 3KX2A 3LP6A 1FFEA 1MOQA 3O7WA 4FW9A 4MVJD 1EK0A 3PSHA 4P33A 2E5LB 4OQEA 2DSNA 3KPUA 1SQ6A 3ROXA 5EJ4A 4JV5B 2CDCA 3HXQA 3P2OA 1PYOA 3B48A 4BX8A 2O0LA 3KCNA 1AS2A 4JX8A 4AYTA 4C0AC 4X93A 1USVA 3G8BA 2CKDA 3MJDA 3BA6A 1SB9A 4M0FA 3RSGA 3U1VA 4C05A 3M6UA 2DPLA 2Q2NA 4E14A 1OXSC 5JS2A 4BO4A 2JJ1D 1Z28A 1ZPDA 2CLIB 4RKYA 1YMQA 3I3SR 3JD3A 4OL0A 1RPZA 4C2TA 4H17A 2DHCA 1KI6B 3HHPA 1IUNA 3GFQA 1JRLA 1FU4A 2FEXA 2XGOA 2QAIA 1M7BA 5IAGA 1E5LA 4IINA 4IDCA 3L1JA 5TMPA 3PQEA 1W1UA 2JD0A 1A9TA 1PQYA 3CZ4A 3FDJA 1T0HB 1ZJJA 1E0AA 3U26A 3CIFA 3EQ7A 1E9BA 2RC6A 1PTJA 2WVHA 3H19A 2OWEA 3H1EA 3P9RA 1B3RA 2PX3A 3QE0A 4WKBA 4ZQBA 3WYEA 3O03A 1E99A 3IAM1 4JMLA 4MEBA 4XUGB 1RZ3A 4KO8A 1N3IA 3L82B 3MRSA 4A27A 2I7CA 4LTMA 4DLZA 3K0FA 1EDDA 2GYYA 2OO5C 3OO1A 5DX0A 2OFXA 2XYHA 1UMCA 1Y80A 4ANFA 3BHNA 1EFUA 1PL6A 3KR2A 3MWGA 3U2QA 2XOKD 3SN6A 2GNAA 3E5MA 4ZGGA 4JVMA 3NGMA 2ZP1A 3L40A 4CMEA 1Z7GA 4FNMA 1ZBQA 3VH4A 3VM6A 2QAGB 3IL2A 2O3SA 1F4VA 5A3QA 4F5WA 1K75A 1NF3A 1NUAA 2BI4A 1UPAA 1XTPA 2CUKA 2W2XA 3GJ8A 4KKVA 1FLAA 3GA5A 4XD7D 3V1UA 3WFIA 4HTFA 1WVIA 3HI4A 3NGXA 5DI9A 3H99A 1FLVA 4OAQA 2FZ5A 1ZH2A 2OV3A 2DPMA 3DHYA 1TIPA 4BZXA 5ITZB 4F6CA 3UXMA 4FX5A 4R1SA 2ORIA 3INRA 4KU4A 4Y18A 3TLMA 4ZI7F 2Z09A 4ZYTA 3CZQA 3REQA 3WMFA 5CVTA 1WPRA 2Q3BA 3OU2A 1JEAA 4JFAA 4LSGA 4XJTA 3OG9A 4KBYA 2QMHA 1BYUA 2HBZA 4EUHA 3IEMA 5G53C 1IXYA 4OK3A 2F9MA 3VO1A 1N9GB 5F9MA 4P3YA 2IP2A 4KFRA 1VPWA 1E4VA 1G64A 1QF9A 3WXBA 1SVMA 2VAMA 2XR1A 1XMXA 3CF4G 1LGYA 3ENWA 4ZT3A 4OI1A 5BUZA 4DJDC 4CT4B 3IILA 3ROKA 3TW4A 3VJKA 5IG2A 1GN9A 1JMKC 1U7UA 4JQZA 2FJUA 2ZJBA 3NJRA 4P5DA 3HBLA 1ST2A 1U11A 2VHTA 1HBJA 1QE0A 5DISB 2A4KA 4BO9A 4DZZA 3QLTA 3FLMA 2WMNB 1AQYA 1WD7A 3MBIA 2J9ZB 4HAIA 6LDHA 1RI2A 3RK4A 2PE5A 4BBPA 5KNBH 1VIDA 4K8OA 4LY6A 1YQUA 1CEXA 2YVLA 1Y5NA 5ED0A 1IUOA 4AZVA 1AV7A 1BA3A 3CONA 2XX3A 3QRWA 7ADHA 1AO0A 2ZRMA 1AN0A 3FOAA 1N6OA 3TW0A 4DPLA 4L07A 2NSLA 4FBGA 1Z18A 3HR8A 2PRSA 4K5QA 3ILYA 3KKKA 1VLQA 1YQDA 2RIPA 4LJSA 1KFJB 3TBFA 4ND3A 4Z4IA 5JCOC 3RUCA 2ZYWX 5LD2C 2GA8A 2GN1A 5H4HA 3D8BA 5EKDA 4NYJR 4R1OA 3KWLA 4PSAA 2BLLA 1WCIA 4MYUA 4Z1MA 4ZYZA 1NG1A 1Y8QA 5FR2A 2WP8J 2QZJA 4YQEA 4EZEA 1KEEB 3VMMA 3DCJA 3Q3GE 4AS2A 1O95D 1A69A 4G0MA 2A35A 2O07A 4CKBA 1GG9A 4C89A 2PYIA 3HU1A 3ND9A 5IHXA 5DNDA 1M0SA 2OV2A 2DM6A 3ORRA 4OJYA 5IN5A 2BGUA 2G36A 1NT2A 3NETA 3OEHD 4MP6A 4E7OA 4G1UC 4BATA 4GLJA 3VNBA 4NV1A 4D25A 1J8MF 2WTUA 2XB8A 4NMWA 3S0JA 3OTHA 4G37A 4ML3A 4KE9A 5ALMA 1IBCA 4JT8A 2ERYA 3NCTA 1EP2B 5IS2A 1G8JA 2FN8A 2OKGA 4GHWA 2VQFB 1IB6A 2GHQA 3LC1O 2P2DA 5FBLB 5JCZA 4CU5A 2Q41A 4UATA 3E8SA 4URXR 1QM5A 3KUXA 4HEHA 3OZIA 4L8VA 4G4IA 1TZMA 2RCNA 3L7KA 3RIXA 4L7QA 4L7VA 2JZNA 4DREA 1PFVA 2XOXA 3QELA 1PVOA 2B4RO 3TI7A 1X1SA 3TFOA 2IBTA 2PH5A 4DQVA 4IJVA 3K32A 1KHTA 3H17A 4GPIB 4RFLA 2YBEA 5AKZA 2FFQA 3CH6A 1QP0A 1KRXA 3FZGA 4JA0A 3T5MA 4NYIQ 4BP1A 3LYHA 5HIJA 1K8QA 2GFHA 3R0QA 4BJ3A 4A3SA 1FYVA 4ZPXA 1TVCA 4RTNA 2LP4Y 3UJ7A 4H27A 2DPXA 2G82A 4R1TA 2HQRA 1ZW1A 2OCLA 3P2KA 4HY3A 4TL6A 5DYTA 4D9FA 1I36A 2I2DA 4A1FA 3G8CA 1TRKA 4GM0A 3UA3A 2DR2A 4CF5A 1XTKA 4M21A 1JR3D 2H17A 1N3BA 1STOA 1BRTA 1DV2A 1WXHA 1KZ4A 5BW4A 4CKCB 3PX2A 4NFLA 3TEMA 1PEDA 4FDLA 1UBLS 2BBTA 3EOZA 1U2RA 2AR0A 2H18A 1NJ1A 1YU9A 3C6BA 4LBYA 1GDTA 3D3WB 1JYSA 4K8RB 1NPTO 1UC5B 2I76A 4CR6A 4HQNA 4Y2TA 1QKKA 3ED1A 4G65A 2JCGA 3NANA 2FWMX 3N5KA 1OBCA 1RDFA 1IWBB 3QVSA 1ZGCA 1UPCA 3AUAA 4B33A 1RQPA 5KPDA 4CLDA 1QYIA 4P4SB 3STYA 3HKEB 5AKHA 2GTHA 4J0EA 4QYTA 3R76A 2E6KA 5SYAA 1NV9A 1RTTA 1SEVA 2WHRA 5ECYA 4C29A 5BMVA 1IATA 2EBHX 2Q46A 2HL6A 4Y2JA 2DLNA 1TUBA 4J4BA 3E23A 2CJWB 3ZBQA 1MJGM 4BQNA 1LLUA 1VPLA 1JJFA 2AMVA 3H04A 1U2DC 3L1IA 4N3NA 1C7JA 3WB0A 4F4CA 1PT6A 4ZO8A 5T57A 3TXAA 3UTDA 4A2QA 2VH1A 3R5KA 1IN4A 1G5FA 1BOOA 2YZKA 3PTAA 2G1PA 5A4JA 1CNEA 3H2ZA 6REQA 5MHTA 2CN1A 2DBVO 3FVVA 1E62A 2Q8PA 1OZ0A 2QTHA 3H2HA 2PD6A 4GVXA 4NI5A 4TLBA 4ZAFA 5HR5A 4X7RA 4O4IB 3FWZA 4C7VA 2R48A 1BNCA 1B0PA 3RGWS 1EUYA 2HM7A 1NJ8A 2BR4A 2YVQA 4K86A 3KZCA 2WT8A 4D0SA 5JU6A 5FKJA 3WLMA 3OCZA 4Q05A 5FD8A 3B1YA 1KF0A 4ND7A 3ZCVA 1ZVVA 2ZZMA 5B4VA 2A78A 2W58A 3AR3A 3INNA 2IPAB 5EKUA 4RE6A 3WHKA 3OQMA 2QVZX 2ETVA 2G08A 3B7GA 3GEHA 3KLOA 4IPTA 4Z0TA 2XIQA 5JT1A 3WK8A 3B52X 1BXRA 1HDEA 3PITA 3QOFA 5FTNA 4WJLA 5A04A 3FI0A 5KX5A 1CQIB 3ICVA 3IOYA 3LV8A 4DMKA 5LQKA 3KL2A 4PZZA 2FWIA 2OBNA 4YJ3B 3FN4A 3DZCA 5MGBA 1G60A 4RGYA 5B6PA 5KYTA 1FFCA 3R8CA 5H8WA 1AF7A 4CV0A 4D45A 4ZIRB 4LA4A 3ZH9B 5CBPB 3U49A 2QN7A 1VP3A 1E4EB 1WXWA 3FA2A 3LG2A 1Y3FE 3D7LA 5ELLA 1WX1A 2YJ6A 4IIGA 1TFUA 1ZZEA 2G0AA 1AUQA 1FQJA 1V43A 2I2AA 4C6RA 3I92A 5LMCA 4MVJH 5JCJD 1Z0DA 3OOSA 1XTSA 3UWMA 3G1UA 1EHYA 5L6LB 5EJAA 2DQZA 2XMZA 3DO8A 4YUVA 2D5IA 4YMLA 1PGOA 1PG2A 4M0UA 3ZKWA 4BVJA 5B36A 2JI7A 2MT9A 4EJSB 3NRJA 2X40A 1QV6A 3CEJA 1VKRA 4AK9A 5F4ZA 4WEQA 3AKCA 1CDZA 4ZEWA 1PZGA 3OE7A 4D9NA 3GVXA 1PD0A 2N42A 4NZYA 2FHPA 2WM2A 4HHEA 3ZDCA 1GSAA 1PW7A 1QP8A 1LF5A 1XUOA 3AI7A 5ES3A 3GLFE 1NRIA 1DUVG 1WTCA 2ZXFA 4U9UA 5D7BA 4UHDA 3RB8A 4GQAA 4CMBA 1SC6A 1UADA 1B1CA 3F9CA 2PL9A 3K9CA 8MHTA 5LDGA 2FSFA 1GL6A 5EZ5A 3AHCA 2PSJA 3QFRA 4Y2HA 3DWGA 3KKQA 4YRKA 4DLXA 5AVZA 4LJAA 3U3OA 3GRVA 1ECBA 2P4EA 4HXFB 1TYCA 2XA9A 1A9PA 3F78A 1IBMB 1IXRC 3R6TA 4OGWA 3DMNA 1UL1X 1QIMA 1E2PA 1T0BA 3EEBA 4Y6QA 4CQJA 5BOVA 1ENZA 1A2OA 4NEHB 1EESA 4QX6A 3I76A 4EBFA 3E5NA 3OAAA 3OOHA 5HX7A 1SJ9A 1HLFA 3EWNA 1LBHA 1ONSA 2W2PA 5D3KA 1NBWB 1KPHA 3FGPA 4OU4A 1Z2DA 5COAA 3AU9A 3L93A 5KTYA 1Q12A 3KQKA 4QXRA 1JEEA 5TMDA 1PJSA 5DFAA 3RE1A 1AXEA 1YVPA 4DXDA 4J91A 4RPCA 4KDCA 1WUKS 3ITNA 1A5AB 2Q2VA 1FFDA 2V6IA 3PD7A 3GJZA 4IG9A 1JKJA 2H63A 1L9XA 2FJ0A 3BWEA 3BXEA 1YK0A 4JXKA 4MVCA 3VC2A 1XDWA 3ZZTA 1EFPB 3K0AA 5AM1A 2H51A 4CM9A 4YCMA 2JLZA 2HX1A 1A8PA 4EEXA 1J8YF 1M2NA 3R0IA 4BO0A 3D7SA 3ZVLA 2ZDGA 5EGSA 3NBKA 3U4IA 3WGQA 5HYVA 3HLTA 4P53A 5A4DA 1GPYA 3E8MA 1O08A 2FSHA 1ABBA 1T0PA 4WFJA 2GEJA 3TTSA 5BR8B 4OH1A 3V2UA 3HA5A 2ZSFA 3OQ6A 4HWGA 4AJLA 1RS0A 3P27A 1F3OA 2R84A 4RGVA 4MIEA 1PK9A 3DA8A 3KP1A 2FPSA 5FRDA 2XT9A 3X1DA 1OC2A 3PEYA 1P7ZA 1VB3A 5HGJA 3GJXC 2YY7A 3TOXA 2DTEA 2NU9A 4KP7A 2C04A 4RV4A 4YALA 4EKNB 4ER6A 5A9SB 5DM0A 1IL0A 1MLDA 1SURA 3WK6A 4FI3F 3G0GA 3AXSA 5FDFA 3OLXA 2XD4A 1HZZC 1OFUX 3QXHA 4GSLA 4LE2A 5CT6A 4YRSA 3CM0A 4B6JA 3VTZA 5LWQA 4S1NA 1M33A 4U6SA 5FX2A 4FFWA 5IDXA 1HURA 1QAOA 3I34X 5ERXA 1EQUA 1ICIA 4BWGA 4D6YA 5K7SA 1D8AA 2OXRA 1FF9A 1MVLA 2CV0A 3C7TA 2YWXA 1JXOA 1YGPA 4NAVA 4E03A 1ZIPA 1KXZA 1UBNA 3C6YA 4JIGA 1HY3A 3BCSA 4KIWA 4P3OA 4PO1A 3R7NA 1PJBA 2A5FA 1UP4A 4KMOA 5IF3A 4B3MB 3EMKA 1GGNA 2YZMA 1XZCA 4IV8A 1XNJA 1XCGB 1ZIDA 3ZJ4A 2OKCA 4QM7A 4GOJA 3RSZA 1VP9A 3LS2A 4EZBA 4RDXA 5E3IA 4CG1A 1G5QA 1UDXA 4GGPA 2IL1A 3OPYA 1XK7A 4RHCA 3O74A 1C9MA 3HL0A 5BMVF 2X0IA 2C7OA 3P9KA 1HL7A 2CK3D 5K0ZA 1KMCA 2WVAA 2V58A 1NJFA 3TMAA 2B7CA 3AZOA 4IOKA 3L8CA 3E9DA 1FNBA 3VHXA 5HF6A 2O2IA 4IMIB 3IPRA 2HWWA 2XB9A 1RM0A 3OM1A 1FYDA 3IUBA 1W2HA 3UYLA 1DDOA 3JWJA 4MVJE 1ZJWA 1NSYA 2IHUA 1UBJS 1OZAA 1LK7A 1WMSA 4Q3NA 4B7UA 1HDIA 2OO5A 2ZTUA 2AQIA 4ESOA 1T2NA 3HEAA 4Q3LA 3D0KA 4UHCA 3EE6A 2QRGA 3ACDA 1IBRA 3U9TA 2WTAA 4BN4A 1C7RA 3DSRA 1O97D 2R8XA 3QKRB 3CN9A 1TYAE 2Z9BA 2ATCA 5B37A 4E5MA 4WQMA 1Y7HA 4DV3B 4QOFA 2ID8A 4PGMA 3WGZA 3BL8A 5LZ7A 5AOCA 5TVGA 3Q0IA 2WSMA 1Y1LA 2HAEA 1NXVA 1IHPA 4PRKA 3R74A 4O25A 3H9UA 1RXYA 1MQ8B 1Z12A 3LCVB 5EA2A 1MW8X 4FZ3A 1IK6A 2OC4A 4I5FA 1AQJA 4EG8A 5KX5F 1BYIA 3VHLB 2JEYA 3LHFA 1CY0A 3JAKA 4QBHA 4E70A 2HSEA 5JFTA 3TK1A 2UZ1B 3GFVA 4KN6A 5KMGB 1RZRA 4XWGA 4AZ0A 4K9OA 4KQ1A 4Z1MD 4FQ5A 4B9EA 4G0PA 2GD0A 4ZI2A 4K46A 1ZD8A 3CLVA 1BD3A 1PL7A 3LPNA 2ZWIA 3O26A 4I50A 1R12A 4TN1A 3R7LA 4L57A 3A58B 1TYEB 4HI0E 1L7QA 2XUGA 3ORSA 4KR7A 2GPBA 3FSRA 3D1JA 5FYDA 2YFHA 4L9WA 2AOWA 2BUAA 1CQJB 2QMQA 4LEIA 1JR2A 1ENPA 1Q22A 2X5JO 2O3UA 1NUUA 4DFDA 3ZY5A 1FRVA 3MMSA 5LMUB 4OUDA 1QIDA 4JJ8A 1YIAA 1EHCA 4KH1A 3VR5D 5JBQA 2GLTA 3L02A 3VKHA 4LVCA 1QHFA 3I6IA 2GEBA 2ZU6A 1LBTA 3ESRA 3NM5A 1ZSYA 2WPDA 4DDMA 1ISHA 1JHDA 1R10A 2ZJ5A 4ZCMA 5LN1A 1QHEA 4XUEA 4RTSA 3C4VA 3MWEA 4IXNA 1THGA 3KBBA 1FXWA 5LQNA 1EVLA 3L6RA 3RAEC 5AI9A 1T8SA 4GPTA 1BOFA 1KO1A 1I2ZA 4MQ5A 4NNOA 1P0IA 2J5QA 2A5YB 3WO1A 1MJ5A 4KK4A 1OCEA 4AUNA 4TTSA 3ZN2A 3KJXA 5FTLA 2B92A 2C4VA 2QRVA 3KQHA 1N8NA 4DLTA 3JYHA 5AW3A 3NKVA 1LFAA 1NATA 5HKOA 3N7TA 2CEAA 2ZIVB 2C92A 2RK4A 1GCGA 4BEJA 5IVPA 5B1IA 2F67A 4MWEA 1TA0A 3LUCA 4A8PA 3ZXSA 1PCXA 4US0R 4M88A 4K3UA 4BQFA 2SECE 3FH0A 5AP9A 1W34A 3TQFA 1EINA 4QUKA 2PSDA 3DAGA 2JFWA 3LGSA 4KFSA 2YWDA 5G1NA 1HLDA 2PL5A 1PNVA 1M6VB 3I4LA 3PGVA 4HOYA 4P98A 4ZT7A 5B5SA 3TX2A 1IVNA 1U7TA 4QQFA 4U2GA 3MTBA 5TMBA 4ACBA 3LYAA 4K0RA 3SQMA 5H3LA 2WYUA 3VH2A 2BZ1A 4BCCA 5LIRA 2VA8A 1WNTA 4XYBA 3UW3A 1RWXA 3VR0A 2H31A 4HWRA 1HNWB 1DINA 4RCZA 1MTZA 3C14C 2ZM6B 5KNCH 5KOHB 3ELYA 1WVMA 2QSYA 1Q0PA 3FE2A 2IHZA 1W59A 3ZLUA 4Q1AA 1SIBE 4R7TA 3MWYW 4L76A 2J32A 5AVTA 1UANA 1H5QA 1GRCA 1KH1A 3DDZX 3MUOA 3EDMA 4AY4A 2YC2C 2SKCA 1JPNA 4OHBA 4AZWA 3D3NA 5REQA 2QDKA 4BZQA 2G9QA 1UBCA 4RDIA 4DN6A 1CR1A 1JDNA 1Q6YA 3PWTA 4NR0A 3HBJA 4BNLA 1L5HB 3D2AA 4C3UA 5C2JB 3O4GA 4UDXX 1AMUA 2AMYA 3EVBA 2BUCA 2RG7A 3EEFA 4RSGA 2IXBA 5KSPA 3R7AA 3U40A 1FTSA 2G5TA 4UEJA 2CSXA 3RSFA 3D4NA 1YS1X 4XVQA 5KAPA 3PS9A 2H7YA 3KS9A 2HDWA 3EGEA 4OHXA 3ZTWA 2P7IA 3LD9A 4HRAA 4J0GA 1TLTA 3UK0A 5CCBA 4B35A 4LYYA 4MR8B 3B85A 2BGKA 1NVGA 1V95A 2WABA 3FCYA 3HPQA 1Z7YA 3CSSA 4XQEA 5EP2A 4DG5A 3NBMA 4D9JA 5IXJA 1QGUA 3UUGA 4NAUA 1Q21A 3JCZA 4QAJA 4A5OA 2DWUA 8AT1A 1L1QA 3FNIA 3IBGA 1FDTA 1N6PA 4FCWA 4OHKA 4YMSA 1H4QA 1C41A 5JS1A 2ZRCA 3HO8A 5CCXA 1Y82A 4HLCA 4DBZA 1EFKA 4HADA 4OXKA 1V2HE 1DHRA 1TECE 1JHRA 2ASVA 2I8AA 3W8NA 5B57C 3BSSA 5J9FA 4YRNA 4AY6A 3Q6IA 4IIFA 3DE5X 2FPPB 2WLTA 2ZJ2A 2EX0A 4EYSA 1DTWA 1Z4PX 1EK5A 1N7IA 3L8MA 2HMTA 4O2BB 3T3IA 2SICE 3KU1A 3KHSA 1RAIA 5EKSA 2ESRA 2P67A 2FW0A 5TT1A 5F64A 2Q45A 3D6TB 5SZIA 2QRQA 5BSEA 1U2DA 2VP2A 4EFLA 2IOHA 4JBIA 4DQKA 1WP9A 2HIGA 2L18A 2UVDA 4Q9NA 3DAPA 4AM8A 4UNNA 1GZ3A 3IOMA 1W85B 4HRVA 2BSAA 3T94A 3LXRA 3UQYS 1JR3E 1TK3A 2HK9A 3AHHA 2FR8A 2RKBA 4CR8A 1IOZA 2M98A 1ISGA 5ESWA 3LNTA 4XRGA 2FEKA 4FFPA 2HD4A 2XQVA 1G3RA 3IEUA 2PV0A 1AMNA 4ES6A 3C3KA 2QTFA 3C6MA 5DGCA 5JO9A 4BASA 3R75A 5WRFA 2R60A 4H7FA 1J2JA 1EBFA 2IIQA 3OE7D 4HWSA 1NR7A 2OMEA 4DY6A 3FPCA 5A02A 4DCGA 4FNOA 2IZZA 5HG0A 1M8PA 1PGPA 4DIMA 1I7QB 4OATA 2XMBA 2B8TA 1XI2A 2V8OA 4R7ZA 1GITA 2EF1A 3GBSA 3K1AA 3VPHA 1NE7A 1C7FA 4JGGA 1SOAA 4NL4H 1IBSA 4U7DA 5IULC 2TECE 5I7SA 4ZEOA 5TEWA 2H48A 1MPTA 3ZQJA 4G0NA 4D4GA 5BUQA 5HKKA 4KRXA 4G5SA 4NCXA 5IXSA 3GRAA 4IGFA 1F7VA 4WXHA 3EGIA 3ZGOA 4IW3B 4DLKA 4LC1A 4ETNA 2Z0MA 3OAAD 4V03A 1DJNA 1YZGA 4H60A 2CCJA 4I50F 2FKNA 5FL7A 1KGDA 1JH8A 2FZVA 1YR3A 3ZGNA 1JEYA 4QUEA 2B98A 1V5IA 1JLSA 3N6RA 5FPYA 1CR4A 2CMDA 2HH9A 4JB0A 4XTCS 4B7XA 4C7XA 4EPXA 3PX7A 2H11A 4G8CA 2UUPA 3BMQB 2X22A 2ZI3A 4R0MA 3MTGA 4WZAA 5CYGA 4BNHA 1HFKA 4GE0A 1SXJE 2E48A 2BFPA 1SRQA 3WDSA 3CIOA 1Z0KA 2HI0A 1N2SA 3P9IA 5IC4A 3B60A 4CM9D 7YASA 4P38A 3ASVA 1VLVA 4QHTA 3MM4A 4TQGA 1K63A 5CDGA 1VBNA 3KV3O 3IHLA 2A9KA 4ALLA 1GNPA 3GLIA 2ACWA 1ESEA 4FYYA 4U5QA 4G89A 5EXXA 4OQ4A 1MJHA 1CUDA 1FXWF 3PGLA 4C08A 3WJAA 2OWDA 3CU5A 3JQ8B 1NDUA 3IKLA 1PUXA 1B23P 3EFHA 5IVKA 1XROA 3KG2A 2WKWA 3KVOA 1X7ZB 3OZSA 4U7PB 2BKLA 1W76A 4WDRA 3PXEA 3F7MA 2MSNA 1NNEA 3IVGA 3F2VA 2HT1A 1JG1A 3CEMA 3A2NA 3OPVA 4JL6A 1U2GA 3DM9B 3ONDA 3BJZA 4XM0A 5C3UA 2D2IA 1Z74A 4ZRDA 3KRTA 1VJCA 3NM4A 2FA9A 2M6LA 2GNPA 4U4AA 3F1KA 2W42A 821PA 3VZQA 1XCPA 4DR5B 4KR3A 3B1VA 4WRRA 3QIVA 3ZHRA 1YJ5A 1UEIA 1UM9B 4DSAA 1SCNE 4AKGA 5TS3A 5EWLB 5IHPA 1OIVA 4CM3A 4ND8A 3IMEA 4XA8A 3D54D 5A06A 5BWCA 5AIAA 4DIOA 5JE8A 4F6LA 2PEZA 3Q3EA 1EWRA 1OX4A 4H18A 4N3CA 5HIMA 4V3BA 2JJQA 3SDZA 1Y8AA 2PS9A 1TX4B 3H8JA 4IJQA 4LY9A 4MUFA 5DMHA 5LNK1 2VYVA 2P2GA 1PEYA 3LCMA 4FR5A 4G67A 4G1EB 2O2ZA 4ZU1X 5THQA 2GEDA 4DHWA 5BNIA 2Z8YM 3HDGA 2ZWAA 1LVUA 4MUIA 5MDHA 3GLHB 2IZ0A 2VYQA 1JAHA 3PWZA 4M36A 5CMLA 1U8XX 3H2IA 3F7OA 2G77B 2GN8A 3REOA 4C2AA 2O1XA 2D2EA 5FTJA 4BZZA 2IKSA 4V2IA 1R50A 3NW9A 2D7CA 4QDOA 2F43B 2QGNA 4HX9A 4X84A 3RBZA 4XR4A 5HQTA 2P2SA 1E20A 1OMOA 1RWKA 2JBWA 2NZXA 2P9TA 3BH6A 3I1YA 4TVOA 4HB2A 5CDHA 1RJ9A 4A0FA 2POQX 3DF9A 3DW1X 3UNXA 2X6QA 4EW6A 1EVZA 3IPXA 1U8CB 1U8YA 3G1TA 2RGWA 1R0YA 3BE4A 2W2QA 4FFRA 3A1TA 3W2FA 2FN4A 3F6PA 1HZZA 3DB2A 3INGA 3JQ9C 1ZUNB 4YROA 2WUFA 4C03A 1AC5A 3WNQA 3PHLA 1XWFA 5C1DA 3PZRA 3G13A 3RU2A 2XSZA 3RGGA 4FGLA 1U28C 4MMZB 1YR1A 2QBYA 4L5YA 1SC9A 5C8XA 1XQVA 1ZWLA 4HDRA 3L4SO 4AQ7A 4K2HA 3IQWA 4E94A 3NHFA 5AH0A 4QDJA 4WH0A 2XCSB 4YP7A 1XELA 3EBLA 2F8SA 1W0KD 4ADSG 1U4OA 1NYTA 1X39A 2LGJA 4L3WA 4EUFA 2R1UA 3GJ6A 5E95A 4MWTA 2VF4X 1TFRA 3OCXA 3DE4X 3NPMA 4WOJA 4NBWA 2RIRA 3Q6NA 5AQEA 1JDBB 4KPUB 2I4IA 4CPDA 1Q0RA 4PF1A 2ZBEA 4Z9AA 1V11B 1EP3B 3OBBA 2PANA 2IPXA 2WNHA 1RZRD 4LX8A 5JYBA 2MSCB 2ZCUA 5GIOE 5D3ZA 2G5GX 2PTGA 4DMRA 4U2BA 4PW0A 4N01A 3CNLA 3ZC3A 3KJGA 5AHRA 3E1KA 3VR3D 5AESA 1TQHA 5BYJA 3WLEA 4JU8A 2ZG6A 3HM2A 2GJ4A 4C6TB 1WUIS 2I29A 4BO7A 1GZSA 5CVEA 3C5WP 3T9EA 2X1HA 1O5TA 1SHJA 3BB1A 4OREX 4IL5A 3UHAA 3VU8A 2LDXA 4OUKX 4X1IB 5TGZA 4Y2PA 3SLKA 4DUPA 3LRTA 5JS8A 4P0PB 1HYBA 2GZRA 4MV5A 2H7VA 3CY6A 3OD1A 5LB4A 3JD4A 5J4KA 5TGDA 4LZNA 5DGIA 3DM5A 1OVMA 3UOAB 5FUMA 1CP2A 3L06A 3PV0A 2WPDD 1KGSA 4GT1A 1T8PA 3NHPA 3O84A 5KOJB 3VJMA 3K15A 3LECA 1E3DA 2VEDA 1USUA 3HJNA 3RS4A 4AJNA 1V8DA 3CTPA 4XLLA 2IBMA 4YUYA 2I87A 4DMHA 1NMSA 4YXWA 1DDGA 4XSHA 2IYRA 1Q0HA 3AHDA 3CGGA 4X90A 1KFCB 2EQAA 1I3NA 4OH7A 5DTQA 5B2ZA 1CQWA 4BAZA 4I4IA 4H7PA 3RRJA 4AJPA 1IZYA 1WZNA 1ECCA 4C6HA 4X63A 1ULUA 3O8QA 2V7EA 4NDNE 4UCFA 4J0IA 5BNTA 1QDEA 2B6NA 4UPEA 3LQRA 1SU7A 1R8JA 1XQWA 3H5WA 2CLDX 2Y99A 3BTVA 3DMPA 1E3MA 2OXFA 2HA7A 4N5MA 2B78A 1SCDA 3JVVA 5LB2A 9MHTA 3FTFA 3KZ1E 2NO1A 3PE6A 4RY8A 3WMEA 3NKLA 3U61B 1IU9A 1QKJA 4DBLE 3JQCA 3RC2A 3S68A 1JDVA 1IJKA 3GFPA 3L7MA 1A2KC 1XMIA 3MN1A 3IHKA 4LHEA 4X20A 3U7FB 4Y6SA 3TR5A 4YFVA 3TB6A 4BYGA 1U04A 4EI9A 3CV3A 2GS9A 2EQBA 3G23A 1TM1E 1CS4C 2NT3A 2BAGA 1LPOA 1WV0A 5LLSA 4J0FA 1Y4SA 4O4LA 1UP6A 2BKVA 3BDAA 4Q21A 2I78A 5TT0A 1NIJA 3QBEA 4PZ0A 1CE8A 4PLWA 5EXTA 4AJ2A 4FYPA 3HNOA 4BFWA 3IP5A 1NN5A 5BV7A 2VP4A 3GNQA 2H5EA 4YJ2B 4QUAA 4TMZA 3KSBC 5IBPA 4N39A 1HE2A 4NE9A 1E4OA 5L3QA 4UREA 4DC9A 4HYYA 1KYWA 1S7CA 2Y66A 3PPVA 1IJEA 3T34A 5CG2A 1PTKA 1LBSA 2WD7A 3DYBA 3OFSA 3SQXA 1Z6XA 2FUCA 2V7UA 3P1JA 5KQPA 2CT8A 5LWHA 2B5OA 4DYVA 3GYBA 1M2JA 4PZEA 5CA0A 1I7PA 1B4DA 1M1YE 4DMCA 1KQGA 5HOEA 2ZDQA 1H2BA 3F4KA 1V9SA 3ANNA 4QGFA 4AUKA 2R44A 4YCDA 3OCJA 1Z33A 2JAQA 3AEUB 3ZCTA 4YQZA 1P5JA 3GAZA 1N4AA 4RDHA 2FY8A 1AX9A 4QPCA 4RTJA 4W5TA 2JBAA 4H3KB 4Y2RA 2PS0A 4I99A 4IRUB 1Q0TA 2GSDA 5ETJA 3VPXA 1V8OA 1UODA 4LZJA 3OLWA 4PY2A 3WL8A 2CSUA 1U6KA 5FI1B 1O6CA 3V4VB 3VRHA 3TTWA 3W8RA 1UJMA 1F2UA 1V5GA 1W2WB 4MQ4A 1DQNA 1W75A 4NYIR 2ZUTA 4A6XA 4C7BA 3BFJA 3E70C 4M22A 1DJQA 1JLHA 1SOWA 4Z1OA 1FNDA 5CVUA 1FS5A 1XTBA 4Y6OA 1U31A 4WY5A 4F2HA 4ZDJA 4LRSB 1QWOA 2PXXA 3ABQB 3PJEA 1PJAA 4LY3A 1C8KA 1UPBA 4JYMA 2ZYUX 3BWCA 1YONA 3AGPA 1RHUA 4Q3EA 4EB6A 5LP6B 5KBYA 4P82A 4MRPA 1GRNA 1E3LA 3LW7A 4O2RA 4Y7DA 2CVQA 4E5NA 3KAJA 1U7XA 2F1JA 4TTIA 1M1NB 1TD1A 2H1FA 2QTTA 2R2AA 2XYPA 2DU8A 2YV4A 4HQLA 4BO8A 4WBNA 2GAAA 3G2NA 4WCFB 4ZAZA 2GRJA 3BD8A 5A6SA 1U3GA 4I4CA 3K7EA 2XZDA 3KC2A 1OR8A 4BVKA 3ENQA 1QBKC 2CLOB 3L3BA 4JS0A 3C39A 5J2UB 2CHQA 4Z4CA 3DEYX 3E7WA 3ZWXA 4Q48A 1WDTA 4LMRA 1KZ1A 3KZKA 4DCSA 1X0VA 2PX4A 1P7WA 1YB2A 1YZVA 2ZI9A 1EM8B 2I6SA 2G72A 1SBYA 1S01A 4XEHA 1GPBA 1JS1X 2CL5A 2OUIA 2ZTVA 3DE6X 4US2R 5DWQA 5A03A 3SSAA 4WVLA 4AG5A 2FFRA 2XUDA 1KVUA 2PUWA 4G5YA 3LBNA 2BM8A 4M9ZA 3A1SA 4HSEA 1I0IA 4M98A 1CTQA 1K66A 3E9NA 3L0DA 2GXUA 1HTTA 3DMDA 2VCYA 3KJHA 5IYZA 4W5OA 1UKZA 4KQFA 3R9IA 1S6YA 3M6XA 4KQGA 3WTCA