1PJ2A

Crystal structure of human mitochondrial nad(p)+-dependent malic enzyme in a pentary complex with natural substrate malate, cofactor nadh, mn++, and allosteric activator fumarate
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
553
structure length
553
Chain Sequence
IKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD-dependent malic enzyme, mitochondrial
publication title Crystal structures of substrate complexes of malic enzyme and insights into the catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 184
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pj2A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1pj2A01
5L3ZA 3BMQA 4IJKA 3B1KA 5FWNA 1I5RA 1JAYA 1K2WA 2DKNA 2ZK7A 2GF2A 3SXPA 4DQUA 3OF2A 4RF4A 1DIAA 2F00A 2VZ0A 3H6KA 3KLPX 3F1LA 2PGJA 4TRNA 2H6EA 3WQSB 1VL6A 1QV7A 1UXKA 3JQ7B 3NJ4A 4R1NA 4R41A 1ZK1A 3VTFA 4QX6A 4ZGWA 2EW2A 3O03A 1X0XA 4CMCA 3FTPA 3BMNA 3FD8A 1PQWA 3RWBA 3PDUA 1PGNA 2OBNA 3GLQA 4JBIA 4OQYA 4X54A 2X58A 2EXXA 5AXAA 3ZNPA 3TZKA 1XU7A 3GH3A 2J3HA 3MJ4A 4GKVA 3DMYA 4L74A 4MDHA 3VH2A 2CFCA 4Z9XA 3ZU4A 5IJZA 4IZIA 3HG7A 1VL8A 1ZNQO 2JD1A 4MVJF 1DBVO 3ZU5A 2OGUA 3BTSA 1IUKA 2E49A 3GZNA 5GMOA 4Q39A 3P2YA 1JWAB 1ZJYA 4IGEA 4R01A 3EZYA 4KTVE 5ENVA 3I9OA 2Q2QA 2QRJA 4E12A 2HMWA 4BKRA 4BO4A 3GHYA 4KUEA 2QIOA 3G0OA 2OP0A 1HDGO 3I9LA 3DOCA 4AJIA 1XG5A 4YXFA 3JV7A 3CXRA 4PZEA 3WGIA 5EINA 3NTQA 4W6ZA 4OXYA 4LGVA 3IKTA 3ORFA 4MKRA 4BKPA 4DREA 1EBFA 3LDHA 1DDOA 5I7FA 2IE0A 1N1EA 1F0YA 4DPMA 3WGZA 4Z0PA 3RROA 1GYQA 2H9IA 2VYVD 3E8XA 3GC6A 3GRPA 3QLJA 5ER9A 1E0DA 1WDLA 1M66A 1XYGA 2VHWA 3GR6A 1F06A 3KUXA 4WLOA 1FJHA 2ZATA 1VKOA 3D5TA 3GPDG 1J0XO 2QHXA 4IZHA 4OAQA 4HWKA 4XCVA 2P4HX 1V3UA 3GDFA 2HMTA 1UAYA 2HK8A 4LRTB 1DO8A 2IYPA 1SNYA 1MXHA 5IXSA 4PG6A 1OC2A 1DJQA 1YVEI 3OP4A 1PS9A 4KOAA 3D4NA 2ZCVA 5JPIA 3RFXA 3ZHYA 1ULUA 3S55A 3W4JA 3NJ8A 3JYNA 5BNFA 4PLWA 5G2OA 4XWYA 1LRKA 4Z3DA 4RDHA 3KB6A 5JAQA 3WB9A 3KEOA 3WGHA 1QKIA 2ZYDA 3VZSA 3FNEA 3P2OA 3VPXA 3D3WA 1U7TA 4KDEA 4J1SA 1Y5MA 4DMLA 1K3TA 3KLMX 1D1TA 3DBHA 1JDJA 4IGFA 3OIFA 1A71A 1DIHA 5B1YA 5I7VA 3JQDA 3DR3A 3CH6A 4XR9A 4YBZA 1QYVA 4M8SA 5TT1A 5JAIA 3LQFA 1ZBQA 4CL8A 4GSKA 5HM8A 2P9EA 2RBEA 3L6DA 2O4CA 2R00C 4PLGA 5I8WA 3K96A 2HSDA 4MVJH 4KMSA 4MVJI 3D7LA 5EN4A 3QVOA 1PU2A 2H5LA 3HQ4O 3IOYA 2Q4BA 4PZDA 3ENNA 2PZMA 4IM7A 2AG5A 4II2A 1SB9A 4OKNA 4RVSA 3IKVA 5JSFA 3WGGA 4MKZA 1N9GB 1LI4A 2NACA 3FTNA 4KZPA 4R51A 4XQEA 4BB5A 4EI2A 3V1UA 4A7PA 2RHRA 3IUPA 1ADCA 4RPHA 1KY4A 3O8QA 5EIOA 4BHTA 3PVZA 3AUSA 4FFNA 3QWAA 1DRVA 1SCUA 2YFHA 1XA0A 3VC7A 3TF5A 3KXDA 3KYBA 5HWSA 5EQDA 4BNIA 3H3FA 4D43A 4XB1A 4L75A 1JTVA 3WMWA 3ZHXA 3E48A 2BKAA 3FBGA 1LC3A 3RC2A 2YY7A 1WMBA 3JQFA 3E82A 5A9SB 1P1JA 2YHUA 2NLOA 4PG5A 4WCFB 3PTZA 1CF2O 5B37A 4CLEA 2O7QA 3QRWA 2BLLA 2AQKA 3AY6A 2V7PA 3AY3A 1ONNA 1UZMA 2NQTA 4YJDA 1D7OA 3ZWWA 5A1TA 1T2AA 3NDJA 3ZU2A 1Y9AA 4O59O 5K9ZA 2YFQA 2DBVO 3Q1LA 3BAZA 4OH1A 1ZMOA 4BO2A 2JHGA 4CM9A 3W6ZA 2YZ7A 4XQGA 3DFZA 4N5MA 4YT2A 1C0IA 2AQHA 1T2CA 3RUHA 1JW9B 3HE3A 1ZK2A 5T8KC 2AE1A 1RPNA 2EG9A 1KS9A 1QYCA 3AOEC 2NVUB 2C5AA 1EQUA 4J91A 3TOZA 3WGOA 4A5OA 2BGMA 2DFDA 4NFHA 3FR7A 1ADBA 1LEHA 4W9NC 1E3JA 4FGWA 3UCFA 5IZCA 1T4DA 4GMGA 5JAZA 1DFGA 3JQ6A 4GGOA 4N18A 1BMDA 2PA3A 2PZLA 2GN6A 1W8DA 4PCVA 5L4SA 4G2NA 4BGUA 4GWGA 2Q45A 2YYYA 4BNKA 2QYTA 3HN2A 1DHTA 3NDRA 2JCXA 1U8FO 4JXKA 2DBRA 3JD0A 1Y8RB 1GDHA 2B4QA 4XQCA 3WOHA 4E31A 2X4GA 4AJ2A 2X5OA 4QECA 4B4OA 3JQ9A 2C54A 3GT0A 4R9SA 1UP4A 2YDXA 4MO2A 4BGEA 2BF7A 2HLPA 3UUWA 2HMUA 3PJEA 5JCXA 5THKA 1JU9A 1E5QA 5DDIP 4DWVA 4AJJA 2D0IA 4IY1A 1BG6A 1W0CA 2VRCD 3WTCA 1YB1A 4K26A 2JFHA 3PZRA 1BHSA 3ZWPA 5TF4A 1E7QA 4BGIA 1X15A 3UICA 1NQAO 4E32A 2D8AA 2Z1MA 3OJOA 1I30A 4RF3A 3ZHZA 2JCYA 2VTDA 3UOGA 2LDBA 5DBIA 4LCEA 3BHJA 1HDZA 3DHYA 4YAEA 2W2KA 4ALLA 1PTJA 3T4EA 1SEPA 1I3KA 4OOEA 4MVJE 5DBFA 4BUCA 3WJAA 5H82A 1YOVA 4AICA 4BO3A 1VL0A 1YJQA 1UDBA 3RIHA 3ASUA 4LK3A 1IPEA 1T26A 5JO9A 1HXHA 1ENYA 1NPTO 3NTOA 3LU1A 1XLTA 2V65A 3A4VA 4EUEA 3KSZO 3TWOA 4UULA 4MVJA 2BFPA 4A10A 5FYDA 1B2LA 2V6FA 3RUEA 1R0SA 3DMTA 1Z45A 3JQ7A 1ZEJA 3V2UA 4NBWA 4GH5A 3HB5X 3CPSA 3FHLA 4J4BA 4E2XA 3QP9A 3GVXA 1R37A 4ZA2A 3ZWMA 2YUTA 2FSVA 4ZICA 1KVSA 2V6MA 4BMNA 2C2XA 4XDYA 3TFOA 2BELA 4BNLA 1R4NB 9LDTA 1U5CA 5IDXA 4DPLA 1X13A 3GGPA 2QQ5A 2V6GA 1PGQA 4IUYA 3AK4A 1M76A 1U5AA 1H5QA 1U9JA 2PH3A 4YR9A 1YB5A 4MIYA 1F14A 3PGXA 5FFFA 1U4OA 4XQ9A 4ZRNA 3INTA 1KC1A 4DYVA 5KWEA 1M6HA 1GZ3A 1PJBA 3S2IA 4WJZA 3B70A 4H7PA 3BMQB 3CTMA 3JQEA 4B8ZA 3RJ5A 4W7HA 4M55A 4L4RA 4IJVA 2Y1CA 4OGWA 2GRAA 1NYTA 3SEFA 3KHUA 1CIVA 3ZWBA 3G49A 1PS8A 3JD4A 1WLYA 2GASA 5TC4A 4EITA 2ET6A 3V2GA 4GX0A 1V3TA 1WDKA 4W7IA 3GQVA 3TL3A 1QRRA 1V0JA 4ALIA 5JBIA 1Z7EA 3BMNB 1YDEA 1E1MA 1ZJZA 4CLHA 3RI3A 7MDHA 3FNGA 4NH4A 2XXBA 4OSOA 5I8ZA 3TQHA 4Z3KA 2X8LA 3GAZA 4AJEA 1GZ6A 1NXQA 4CQMD 1Q0QA 2Y99A 2GSDA 1D4FA 5FI5A 4FSHA 3P5SA 4E2YA 4BMSA 4LVUA 3DEYX 3GZNB 5ES3A 2BRUA 5B4TA 4TRJA 3CZMA 4TMFA 4ND3A 1DIRA 4MKXA 1NPDA 4A0SA 1DC4A 5IDYA 5CG2A 3DZKA 4D45A 5C7OO 1I2ZA 3QW2A 2Q1SA 1LRJA 4YRDA 2WE7A 4GAEA 4NPCA 3ZWOA 2X23A 4F46A 1WXDA 3E03A 4GLOA 1KERA 4ZRMA 1ZO8A 5A02A 2J3JA 1LUAA 1NWHA 4RCVA 2JCVA 4AJPA 4DYDA 3UF0A 4BKUA 1UDAA 1Z82A 1M2WA 1K0UA 3GN2A 3HFSA 4HFNA 1XEAA 2AG8A 4RO0A 4CLXA 5JC8A 3K5PA 3B1JA 5CDSA 4Y6PA 1IULA 3E5RA 4U0KA 2ZYAA 3F5QA 7ADHA 1B15A 2OOSA 2C59A 5CHEA 2AXQA 4PLTA 4EUFA 2XF8A 4FD3A 1VRWA 3UAGA 3WGQA 5ILOA 4BO6A 2HCTA 2DTXA 3DXFA 3ZWYA 1BRMA 4CMIA 2VHVA 4TWRA 3PYLA 1IY8A 5G4KB 4URFA 4BV9A 2P68A 4OMUA 3GVPA 4I9NA 4FB5A 2CZCA 5F1PA 1RM0A 1H2BA 1RKXA 2C7GA 2EIHA 1MGOA 1GZ4A 2P5YA 5DP1A 4IINA 2PFGA 4XGKA 3WJ7A 2JD0A 4LMPA 5HBRA 4B4WA 5A3JA 4ALJA 3I9MA 3NX4A 4DC1A 1MXFA 3Q3CA 4ID9A 2QX7A 1F8GA 1XQ6A 3ITDA 1U28A 4NJMA 2EEZA 3D3WB 4P4GA 4TZTA 1N92A 4NFSA 2Y68A 3GNSA 4EZBA 5ICSA 1QP8A 1ISGA 4BO1A 1LDMA 3NT5A 1HRDA 1H0KA 1YS4A 3OM9A 4EYEA 4HNGA 3VVCA 4WCFA 2VNSA 2OXIA 3TSCA 2OFPA 3H2SA 1GR0A 2OBYA 2R6JA 3A06A 4BMVA 4FN4A 4OHUA 4XD2A 4WLUA 3VKVA 3H8VA 2UUPA 5BSEA 1H93A 2PK3A 3BHMA 4HXYA 4BNFA 3N7UA 1XQ1A 3LT2A 1XDWA 1PQPA 1DAPA 5C37A 5U1PA 3JTMA 3O26A 3A1NA 2J5RA 2EWMA 1LDGA 1PJ4A 3LC2O 4YAGA 1N5DA 4YT5A 3WWZA 3JCZA 5L40A 2Y1DA 1EVIA 2I3AA 3O8QB 3DHEA 3GUCA 3L9XA 5KIAA 1HE3A 4OJNA 4ZQBA 5F1KA 1GQ2A 1LSSA 3E1KA 1GTMA 4G5HA 2Y1OA 3C7CB 1YWGO 1BXKA 5L53A 2A9FA 5COBA 4WGGA 4DVJA 4PG8A 3PI7A 2AQ8A 3SC4A 3MTGA 4H3VA 2Z5LA 3OIDA 4EJ6A 1GL3A 3VPGA 1Y8RA 1KVQA 1HT0A 2PLAA 4NK4A 4D46A 3FPCA 2RH8A 2GPTA 3PLRA 4E33A 1JLLA 1HLPA 3VH4A 4Z0HO 4J49A 3A9WA 3NKLA 1EBUA 3CSDA 3TFQA 4E30A 4HBGA 3NGXA 1GUFA 3GNTA 4QSMA 4ND1A 4R1TA 1Y8QB 4HKTA 4RLHA 1HE5A 1IB6A 3AUAA 5LDHA 5A5FA 3GG9A 2P4QA 5TRTA 2VRBA 1LA2A 1LLCA 3FPLA 4DRYA 1H6DA 2EKQA 4PFJA 2O3TA 5KCZA 2ZJ0A 4BO8A 4TQGA 4IJWA 5JW6A 2YW9A 4ZQHA 1PQUA 2W98A 4YJGB 2I6TA 1ZIDA 4E21A 2GYYA 3MJCA 1E6EA 2UYYA 5A03A 5BSGA 2IEBA 4FFRA 1ISIA 2I5PO 1YL7A 4IDBA 1GY8A 3BMOA 3MJSA 2DC1A 5AVOA 3DZIA 1PJCA 2ZJ1A 2IDZA 3F3SA 1H94A 1Q7BA 4JCOA 4JJFA 1DHRA 5ER6A 4LSWA 1NFQA 5TIIA 2AE2A 4L8VA 1E1LA 4E4YA 4K6CA 5A3VA 3IMFA 4PGFA 2I66A 1H9BA 5G0SA 3GEMA 1QSGA 3IJRA 5KKAA 4DTIA 4E5MA 2C5EA 4JN6B 3RUAA 1KBZA 3MZ0A 4R16A 1B8PA 2IEDA 3M2PA 4B7CA 4CM8A 1LLQA 1R4NA 3GGOA 3INGA 3GRKA 1EEHA 5CDUA 1B16A 3GY0A 1LX6A 4BV8A 1KIFA 1U2GA 1EUZA 1LC0A 1PZHA 4UUPA 3VKUA 1Q1NA 4U6QA 3WBBA 2WSBA 4FC6A 2JFGA 4I5FA 4BO9A 3AUUA 1VI2A 1X1TA 4BNMA 4J2OA 1E7SA 4R1SA 4DMMA 4WLEA 2W2KB 3RC1A 5C7IO 4DIBA 1YOVB 5K6AC 4IJUA 4PVDA 3OEWA 1HYGA 5I7SA 4QO8A 3QWFA 2ZB3A 1EZ4A 3UGKA 3ZWCA 2FP4A 4GWKA 5JAMA 4BNYA 2NTNA 5GY7A 2W4QA 1VPDA 1Q7GA 1T2DA 5MGBA 2YQ4A 5A9RA 5AXCA 1PR3A 4DPKA 1HLDA 3KTDA 4UVGA 2YV3A 4EGFA 4Y9DA 4A27A 4J0FA 2BH9A 3MJEA 1FMCA 1B14A 3IS3A 2A92A 5DOZA 3F9IA 5CDYA 3RUIA 1PIWA 2HMSA 2VWQA 4J9VA 4R4JA 3ROPA 5G0TA 1G1AA 1DLIA 1GPJA 2DPGA 2OHXA 1DB3A 1QLJA 4TVOA 3QWIA 1X14A 4GSLA 3IDSA 2Q99A 3JQBA 4UVEA 3ZNQA 2P5UA 1MB4A 4UAGA 4KUHA 1OFGA 2OZPA 1YQDA 4I5EA 2X22A 4IQ8A 4J0EA 4U8GA 4AJKA 1Q0LA 4BKQA 2POQX 1A7KA 4ILKA 3PWKA 1DLJA 4YAIA 2I99A 2VHZA 3RAJA 3BYZA 5I9MA 1QORA 5TGDA 3HUDA 2D5CA 3OFSA 3STHA 3ZW8A 1N7HA 1ZSYA 4DUPA 3WNQA 5KJ6A 4XJTA 1C0LA 3U9LA 2DFVA 1U2DA 1GV1A 2DT5A 3EZLA 1C3VA 2Q1UA 4RLSA 4IXTA 1GQYA 1U7HA 4PLPA 3I6IA 3FNHA 2CF5A 5DNAA 4H16A 1ISMA 1SZJG 2HJSA 1P31A 4AL4A 2O2SA 2QW8A 2GDZA 1HETA 2IXBA 4EUHA 4NDNE 2GZ2A 4GGPA 4F3YA 4MVJM 3ONEA 3ON5A 5JDCC 1XGKA 1JKFA 5JS6A 2IZ1A 3I83A 3F6YA 2NUAA 4CUJA 4CQMB 4FCCA 2VYVA 3NEPX 3DO5A 2BFAA 1NBOA 2CY0A 4HNHA 1LJ8A 1T1SA 1P33A 1H9AA 5AQ1A 3MOIA 1E1KA 5G4KA 4IDDA 1NP3A 1E7YA 3OECA 1NASA 3PIIA 2NVWA 2G1UA 3BA1A 3BTVA 2VOJA 3ADOA 4J7CA 3D5QA 5K0ZA 3GDOA 1GU7A 5IN5A 2HO5A 4INAA 4P8RA 2NU8A 5KJ1A 3AOGA 2I3GA 3UXYA 1GPDG 2A35A 2CVZA 1YQXA 4GI2A 2HK7A 4RORA 4CUZA 4IDFA 4GQAA 4LMRA 3JQAD 4RZIA 4JNKA 4C7KA 3I6QA 1CETA 1Z74A 3ZWVA 3PYMA 4D3DA 1KYQA 2X6TA 4ND2A 4CMBA 1O9BA 5COQA 4BNZA 5C3MA 2JKVA 1PZEA 1SC6A 1HZJA 1HSZA 2PD6A 1U3TA 2G82A 4TROA 5DCUA 3VAZA 4AJHA 1D1SA 2HAEA 4CMIB 3AI1A 3ITKA 3M1LA 3RD5A 4D0SA 4U6SA 2PZJA 2VYND 1MX3A 5TNXA 4CMGA 5G0VA 2FMUA 4YT8A 1E7WA 1TEHA 2C29D 2VYNA 3JD3A 4Z9YA 2EF1A 1N2SA 2QG4A 1Q2XA 1SBYA 1PJLA 2NV6A 4EEXA 3DQPA 1IHYA 3I23A 4BIIA 2JL1A 9LDBA 4BVAA 2HDHA 3DONA 4YCAA 3W8DA 4NJMB 1XSEA 4YQYA 2FHSA 4NIMA 3E6AA 4QEDA 4QT0A 1O5IA 4IPTA 1XWFA 2NQ8A 2GCGA 3A28A 2SCUA 3PFFA 2BFMA 3L4BA 4RL6A 1KEPA 4CMEA 2X9NA 4KP7A 5ENDA 5G0WA 4RJTA 1QLHA 3ZV6A 1C0PA 4WCDA 2OMEA 3EC7A 4ZVVA 1JAXA 1NHWA 4DIFA 4F6CA 4XGNA 1EUDA 4NU5A 4GVLA 5C7LO 2IZZA 3I4CA 1UDCA 3S1LA 4JIGA 4TKMA 3HB4X 2BGLA 3RUCA 1JVBA 2B5WA 1NNUA 2NNLD 4ALKA 1RJWA 4E3ZA 4CV2A 4XEHA 2CDCA 4Q3BA 3S2FA 5KVSA 3DC2A 2GZ3A 3VDQA 5GZ6A 1ZEMA 2AA3A 3H5AA 2FSSA 4RF5A 3EDMA 4Z9FA 4CLDA 4WKGA 3VH1A 2EJWA 2NTJA 1OBFO 4G81A 3MWEB 1ONPA 3DBRB 4FC7A 4RVGA 1Y8QA 3K2BA 1KEUA 2WTBA 3AFNA 4WUVA 3Q9NA 2BGKA 5TJHA 1J6UA 1K6JA 1LNQA 2GN8A 2H1SA 3I9KA 4E5NA 3TOXA 1T2EA 1BXZA 2PKQO 4MP8A 1TXGA 4C7JA 5KVVA 1LBEA 4DGSA 2WEKA 5F3RA 2E48A 3I1JA 3QVTA 1UXIA 1HWYA 1XCBA 1YQGA 4O63O 4DXHA 1MG5A 5IN4A 1EQ2A 2C82A 2EGHA 1ENZA 2ZIZA 3O9ZA 4YJGA 5JDIA 1JKIA 1ISJA 2WYUA 5DN9A 3HFGA 4NBTA 2P2SA 2C2YA 4QXMA 8ADHA 2B4TO 4M49A 4Y8VA 3KSDO 3QHAA 3WYCA 3DAGA 3W4KA 3CKYA 3RSHA 2CVOA 3C3XA 4J4HA 2EGGA 2HK9A 3QJ5A 4O6VA 5L4LA 3MWDB 2I76A 3AFMA 1KETA 4Z0TA 5LC1A 3N58A 4XR4A 4XX0A 2AEJA 3I52A 3LF2A 3ANLA 4K1LA 3FCOA 4HX5A 1QG6A 3RQSA 2PZKA 1HL3A 3RUDA 3ZNOA 5H83A 2PGLA 1L1FA 1U3VA 3ZDFA 2ZTVA 4ZQEA 1AXEA 3FBTA 2VRCA 1TT5B 2CDBA 1DPGA 4PVCA 1GUZA 4OM8A 4ZN6A 4N7RA 2YV1A 1R12A 1PS0A 4YQZA 5I9LA 1LLDA 1C1DA 2VQ3A 5F21A 5T6BA 3S8MA 4TZKA 2GN4A 1R0LA 1VE9A 1SO8A 2FRDA 1J4AA 3KEQA 1PZGA 1U1IA 2YHIB 2FY8A 3ZI0A 1EDZA 3BMOB 1EFKA 1G6KA 2I67A 4EJMA 3PJGA 2HQ1A 1O0SA 4AJOA 2YV2A 4R5MA 5I9NA 3EVTA 1I24A 3OBBA 4MVJP 3KV3O 4JJIA 4FQ8A 3WGTA 1F8FA 3K73O 4MP3A 4A2CA 5L7YA 3OEYA 1TI7A 3L6EA 3H5RA 4E2ZA 4JROA 3LLVA 3LYLA 4PLHA 1TT7A 4MPDA 2C0CA 1BWSA 1DFIA 5TS3A 1R16A 1LSOA 3C1TA 4CM8B 2Y0EA 4J7XA 2D4AA 2JFFA 4RVHA 4BQPA 1ISHA 3IJPA 2IXAA 1ZUD1 2JHFA 1ZZEA 3PP8A 3U62A 1GEEA 5T67A 2E37A 1A4UA 1LQUA 4IQ0A 4J7UA 1IYZA 4TRMA 1VJTA 1E3WB 1A27A 4D79A 2HJRA 2VHXA 4EEZA 2AEMA 2JJYA 5A5EA 2PY6A 2UUOA 3B6ZA 2Y67A 5AYVA 3T4XA 3O38A 5TT0A 5CEJA 3LT4A 4P4NA 2ZB8A 4RV9A 1V35A 3GEDA 4JJGA 1UXHA 2QRLA 1XHLA 4BNVA 3CIFA 4FIZA 1D8AA 3HDQA 2DPHA 1YBAA 4Q9NA 3WYEA 4GVXA 5HS4A 3UKOA 1ADFA 4E5PA 2Z95A 3KOUA 4I1IA 3PWZA 4NBRA 4WASA 3VPSA 1CRWG 4Y98A 1WDMA 2QYSA 1B0AA 4PG4A 4PRLA 3RUFA 3UN1A 5L95A 4N5NA 5DULA 1WZIA 4KWIA 3VZPA 3TZ6A 1EUCA 5IDQA 3G1UA 3IQDB 3CE6A 5H81A 5B12A 2DBQA 1LU9A 1V9LA 1DSSG 1HDRA 3JYPA 3WQQA 1MP0A 1SEVA 4GX1A 2A4KA 5JFOA 1VSVA 3VDRA 2NVBA 3E9NA 3FWZA 1WNTA 3W1VA 4CQMA 3WLFA 1UUFA 1E77A 1SB8A 1FF9A 4WE3A 1DAOA 2NWQA 4XJSA 4YB8A 4KQXA 1Q7CA 1I36A 2YJZA 4BQRA 4YA6A 3OA0A 1EVYA 4DBZA 2Q1WA 2ZQYA 1KEWA 1ZMTA 3UHAA 3K92A 3M1AA 2QRKA 2UV8A 3V8BA 2WWRA 3E9QA 4H15A 1I01A 3WNVA 3P7MA 1BVUA 1RYDA 5EQFA 3U4IA 3U4DA 1ENPA 1YRLA 4LSMA 5IG2A 1K89A 5HTOA 3JQGA 3TNLA 2B0JA 4Y6SA 4U5QA 4K6FA 2ZQZA 1ONOA 3MTJA 1UZNA 1BDBA 1DC6A 2GGSA 2AHRA 2CVQA 1XIVA 3TDKA 2WD7A 1ZCJA 1P0CA 3QIVA 1I2BA 4YJFA 1P74A 1QYWA 3C7AA 3V1YA 5KNLA 3DTTA 4M54A 2O3UA 3QQPA 4WLNA 3IP3A 1K6IA 3GUYA 3LT1A 4JX8A 2NU9A 1PR9A 3COSA 2FZEA 4OXNA 3PFWO 4B3JA 1IL0A 1OAAA 3PHHA 2G0TA 1P77A 3FR8A 5LDGA 2J5QA 3VVBA 3H65A 4K9DA 3DL2A 5HA5A 5CAEA 2DAPA 1N7GA 3JQFC 1FXSA 2O7SA 1MUUA 3ZZNA 4WECA 2HRBA 2IRWA 3BZUA 3V5NA 1B8VA 1IZ9A 4DQVA 2X0RA 1JA9A 4PIVA 4CV1A 2Q46A 2PD4A 1AHHA 1KVRA 4ZU3A 5A9TA 5ADHA 4UVHA 4XIYA 4XGIA 3L07A 1HDOA 2DBZA 1YKFA 3U4HA 4EW6A 3JQAB 1ZXLA 2UDPA 4RVDA 4S1VA 4FPXA 1VJ0A 5FF9A 3RJ9A 3VPFA 3GA0A 4YRAA 1DEHA 3ZH2A 1P1IA 5F5NA 1S7CA 4TKLA 2H63A 1YH3A 2W2LD 3ZWNA 4GMFA 4R1UA 3PEFA 4YJHA 3OA2A 4PG7A 1U4SA 3WFJA 3C1OA 2DLDA 3AWDA 4XB2A 5EESA 3ETGA 3EW7A 3SJUA 5IZCC 2PWZA 4GX5A 4DIOA 2VZ8A 4IDEA 5CFZA 3BHIA 1NAHA 3DZBA 4W82A 1KEVA 1NHGA 3GDGA 3KZVA 4RVFA 5B4VA 2Y0DA 1UXJA 2AW5A 4EDFA 3C7DB 1P9LA 4O5OA 1B26A 2BI7A 3AI3A 1IZ0A 3DBLB 5JYEA 1YBVA 1OZAA 3DBRA 1P45A 1Y7TA 3GVHA 3A14A 4CR7A 4ITUA 3HHPA 4BNXA 4CMKA 3E5MA 1HYEA 3DZHA 3NGLA 4N5LA 4XIJA 4IBOA 1JQBA 3DTYA 3JQ9C 4D3SA 4FFMA 4NHEA 1WAMA 1BSVA 1O89A 2VWHA 5IF3A 3D0OA 2NM0A 4YPOA 3GFBA 3GPIA 1JKJA 1H6BA 4CQLB 1QYDA 3H9JA 4BNWA 4ZHSA 1T24A 2HU2A 1ENOA 4QO7A 5L4NA 1LSJA 4JLWA 2R00A 1RYEA 2EERA 3GEGA 4J90A 4BS9A 2OL4A 1YONA 4GX2A 5J23A 1J5PA 1T1RA 3NTRA 2B35A 3OJEA 3ONDA 4OL9A 3PHGA 3EMKA 4IIVA 4NNJA 4D42A 5BSFA 2FR8A 1LDEA 5JMPA 3RU7A 4NI5A 3T7EA 1XU9A 4YAKA 1UXGA 2VUTA 4I9UA 2ZYGA 3GGGA 3LF1A 4PRKA 5JNLA 4UEKA 1A72A 3HJAA 4CMJA 1WP4A 2X5JO 4WPGA 4BNGA 4TSKA 4WEQA 5JO0A 5KOIA 4MINA 4TVBA 5BT9A 4YWJA 1H2HA 4RGBA 4F45A 4Y6RA 2D59A 3ST7A 1ISFA 1E7RA 3S2GA 1TT5A 1GUYA 2NSDA 3DMTC 4UVIA 3GMDA 2VN8A 1GCOA 2CSUA 3CMCO 4GLLA 4WLFA 5A06A 3UFXA 5KTKA 2AQIA 3H9GA 4FOSA 4WK6A 4BGVA 4Z6KA 4J1QA 4FFLA 2Y05A 3VH3A 2OP1A 3PK0A 3WSWA 1PGOA 4DL9A 2YHIA 3BIOA 4MP6A 3H7AA 1NVGA 4BNTA 4DLLA 3RC7A 2Y1GA 3ZV3A 2NU6A 6ADHA 2ZB4A 3C24A 1WMAA 1YJ8A 4HY3A 5F5LA 3NYWA 1CQIA 2Z1NA 1E3LA 3L77A 1RM4A 3ZWXA 4Q3EA 5CDGA 1NQOA 1RWBA 1YB4A 1ZK0A 4FDAA 4NQZA 3C8MA 2DU8A 4EJ0A 4F6LA 1C0KA 4I5GA 4KUGA 2Q3EA 2D2IA 4M87A 2EJVA 2ZCUA 3U3XA 2P9CA 4FJ1A 1GCUA 4I8XA 1NR7A 2DTDA 3SLKA 4FFOA 1HZZA 5T8KA 3AOEA 1AXGA 3L9WA 3JSAA 1GV0A 3B1FA 4KDFA 3PHLA 3TZQA 4GBJA 3FNFA 1HDCA 5CP8A 3I9JA 1E3WA 1T25A 4W9NA 1GADO 4CUKA 1C1DB 3WXBA 3FI9A 3JYLA 3OJLA 1I0ZA 5DT9A 1ZSVA 1GQQA 4G65A 5TJ9A 1DJNA 3RU9A 1BTOA 1MG0A 1R0KA 3OJFA 3R0IA 4E5YA 5THQA 1P44A 4YDRA 1Y1PA 4DC0A 1NR1A 2WM3A 1QMGA 4P22A 2QZZA 4FGSA 4J1TA 2TMGA 3U0BA 1Y81A 3AJRA 4I08A 1CERA 1MLDA 5GZ1A 1HDXA 1PJ2A 5JY6A 5DF1A 3NT2A 4FS3A 2XPCA 1U8XX 5L7WA 2O3SA 8LDHA 3ZV5A 3D3EA 3WQRA 1YE3A 4BO0A 3ETEA 1XKQA 4W99A 5HS6A 1DIGA 1I2CA 5MDHA 1X0VA 2X0JA 3W4IA 4KTTE 2WYVA 2FPPA 4B8WA 5GZ3A 1O95A 1M75A 3DOOA 4RPLA 2HKIA 1MV8A 1PJ3A 3B20A 3TPCA 1GYPA 3AU9A 4KQWA 3R3SA 4DBVO 3QVXA 1I32A 2B4RO 3F4LA 4IMRA 5T64A 5U4QA 2XAAA 1HE4A 1IPFA 3H3JA 3ANNA 1D3AA 2GZ1A 2D3TA 3KYDB 4U0JA 1HYHA 1P1HA 1BW9B 1PGJA 5A04A 4CLOA 2P9GA 3DZJA 4BKOA 1C14A 3IL2A 3PWSA 3LZ6A 3DZFA 4LISA 4BO7A 3ZN2A 4OO3A 5A05A 4UEOA 3F1KA 4XDZA 4ONEA 3DFUA 4JGBA 4IXWA 3PQFA 1KC3A 2CDAA 5BR7A 4CLRA 4BNJA 3ZCXA 3WYBA 3IUSA 3W8EA 1HF3A 1M67A 3VZQA 5T57A 3CEAA 2BD0A 3NV9A 4N54A 1LDNA 3E9MA 3WX0A 3K9QO 5FI3A 1X1EA 1J49A 1LDBA 3AM4A 3N74A 4A26A 5EMHA 3QVSA 3EHEA 4R54A 2RAFA 2FR0A 4JQCA 4NMHA 4CMHA 1A5ZA 4J43A 2RHCA 4B3HA 1N1GA 3DAFA 4E6PA 4WNIA 2X9GA 4ZD6A 4PN3A 1I3LA 2DUWA 2OO5A 5DBGA 5L45A 4WEOA 4HP8A 4WLVA 3RKUA 3FF4A 2VNAA 1PEDA 1PGPA 2A94A 2VCYA 1KVUA 5JE8A 1YGYA 2NADA 3DDNA 1P1FA 3RVDA 3JYOA 1U3UA 3IIEA 4CV0A 2CNBA 4LVCA 5COAA 4NZ9A 3FRJA 2E82A 3FWNA 4AJ1A 1T4BA 3CMMA 1VLLA 1AN9A 1WWKA 4WCFC 4B4VA 1UJMA 4OQZA 3RFVA 1ULSA 3JQGB 2UAGA 3C1AA 5TX7A 5JY1A 2C20A 1Z73A 2VZ9A 2X0NA 3SLGA 4CM1A 1NFRA 4AJNA 4QFCA 3ROMA 4CPDA 3HDJA 3H9UA 4MVJG 1YXMA 4AFNA 1R4MB 2WD7B 2YQ5A 1GFSA 1W73A 2V6BA 3JQAA 1Y6JA 3PLNA 1TB4A 1V8BA 3EUWA 3PPIA 1DRUA 4YJFB 2RH4A 1DC5A 2CF6A 5LCXA 4OSPA 2XOXA 2Y0CA 1NFFA 1BDMA 1YL6A 3NT4A 5L7TA 4B4UA 3LT0A 3UH1A 2GERA 1Z6ZA 1LQTA 2G17A 1EE9A 2O2YA 4IDGA 4FW8A 1PJTA 1FDTA 2PTGA 3AY7A 4HFJA 5EJ2A 3ZGYA 3DOJA 4PLVA 4BNHA 3WMXA 1EDOA 3ZHBA 4BO5A 3TRIA 3X2FA 4FFPA 2Y93A 5ITVA 3LC1O 1CEQA 1CYDA 1DOHA 3LK7A 3LLSA 4Q3CA 1I3NA 4NG5A 2I9PA 3IAHA 3DBLA 3ZNNA 3CZRA 5CDTA 4PLZA 1MA0A 4L9RA 3NUGA 2LDXA 1W6UA 1CDOA 1SMKA 1FDUA 4CMAA 4CM3A 5BNIA 3AU8A 1H6AA 3NDIA 2C07A 3F47A 3KBOA 4CQLA 3D1LA 3WWYA 1BGVA 3EYWA 5KVCA 4E0BA 3GAFA 2X0IA 3HZZA 4C4OA 1X7GA 2ILTA 4YJHB 4DLAA 1JN0A 5HRUA 1MFPA 2IODA 1E6WA 3U4CA 1ZVMA 3WIEA 2X1HA 1HDYA 3ZW9A 3ZWAA 1TVEA 2B36A 2CD9A 3ABIA 4XYGA 4ZQGA 1Q0HA 1UP6A 3U09A 2DVMA 1ZK4A 2BMAA 3R3JA 4L0QA 2IZ0A 4I9HA 4M1QA 1TA4A 3UW3A 4J6FA 1O8CA 3Q2IA 4M86A 1E1NA 4ESOA 4OKIA 3I9NA 2VUUA 2AMFA 2HRZA 4IDCA 4M89A 3S2EA 3PHIA 1PWZA 3K31A 3PJDA 4II3A 2PH5A 4UVDA 3KRTA 4DA9A 3KYCB 2DM6A 2Q50A 3BTOA 3OIGA 3D4OA 2VWGA 3W8FA 4CM7A 3SVTA 3K2EA 2FN7A 1FDWA 1OI7A 2Q49A 4CM9D 4GPD1 3ZV4A 1PL8A 1F12A 3EGOA 3L6OO 2VUSA 2D5AA 2J8ZA 2Y1FA 4RVUA 4LRSB 4XKJA 5A4DA 4UUNA 5ICMA 5JCJD 1SOWA 4BNUA 1XELA 3WIDA 4FOOA 2EP7A 1GAEO 4QFDA 5JCJA 3T7CA 2BI8A 1WPQA 5TSDA 2X5KO 1ZSNA 3H2ZA 4NK5A 5JXWA 3ONFA 3JD1A 4HUJA 3FSRA 2PKQP 2RIRA 4YVFA 3SJ7A 2OORA 4RF2A 1YL5A 3EY4A 1LSUA 4YTEA 1PSDA 2B83A 3FN4A 3GN1A 2NU7A 3L0DA 2ZTLA 2EHDA 4A73A 1OMOA 1GYRA 4Y67A 2VWPA 4O1MA 1B3RA 2PV7A 1V6AA 3MJVA 1P1RA 3G17A 1RM3A 3NAQA 3OH8A 5JLAA 4J1NA 2FPGA 5T5QA 1LLUA 2FZWA 3Q0EA 5BQFA 5DOVA 1AE1A 1E7MA 4RDIA 4ZJUA 1G0NA 4K28A 1UZLA 1Y5RA 1LRLA 2EKPA 2GD1O 3JQ8A 2WJPA 3F46A 4LCJA 4WOJA 4D3FA 4QQRA 5CPBA 2VT2A 4NU6A 4MIEA 2YDYA 4O0LA 4IMPA 1O94A 3BMCA 3QSGA 3OETA 4R68A 1Z7BA 3WS7A 4PLCA 2B37A 4FJ0A 3HWRA 3D4PA 1ZFNA 4UEJA 4B79A 1ADGA 3KSUA 5AXDA 3H9EO 2JAPA 4XRRA 2TMDA 3JQBC 4JP2A 4DQXA 5JMWA 2G76A 1I8TA 4W4TA 3OSUA 1EVZA 1G0OA 4RPGA 4YAJA 3DHNA 1IHXA 3QWHA 5JYDA 1AUPA 2WDZA 3H5NA 4S3MA 1DC3A 4Q3AA 1KOLA 1C1XB 1NWCA 5EL0A 2PR2A 1ZH8A 3G3EA 1PX0A 4CR6A 5IDWA 4XYBA 3ETDA 3QWBA 5FEUA 4A03A 1VJ1A 5L9AA 1BXGB 4D0RA 4MVJD 4IS2A 1O6ZA 4CM4B 1FDVA 1EK6A 2XXJA 4R3NA 4B3IA 4Q3NA 4R3WA 3V2HA 1IE3A 3F5SA 1YBMA 3GVCA 1Y9EA 3RKRA 2GN9A 4E13A 2WD8A 2DTEA 5BSHA 3KYDA 3PYXA 2I65A 1ZKMA 3KM0A 3VZRA 1BW9A 2ZB7A 4I5DA 1NM5A 4ND4A 1S6YA 4CL3A 3OQ1A 4FR5A 1A9ZA 2F1KA 3VHRA 2JAHA 3HNPA 1Z75A 1NVTA 1ID1A 1A9YA 1EE2A 2Y1EA 3MJTA 4YRBA 5CEEA 1ML3A 2D1YA 1ZK3A 2VOEA 1P1KA 1QYXA 3K30A 3KVOA 1ZW1A 3WGYA 5G4LA 2O48X 4NR0A 5L51A 1P3DA 2G5CA 2HUNA 3P19A 1RM5A 5KJCA 3VTZA 2X86A 5IAAA 4CR8A 4QUKA 4PZCA 4LW8A 4TRRA 5F1OA 5CEFA 1X7HA 1NPYA 4L73A 3RC9A 1P0FA 3TZCA 5CG1A 1U3WA 4BNNA 3ANMA 1NVMB 4IQGA 5G0UA 2FOIA 3W6UA 5B4UA 1IOLA 2C7VA 3QV1A 1E3EA 4B7UA 1I33A 1ORRA 4CLOB 5K6AA 1JWBB 4RPKA 4IIUA 1HE2A 2EP5A 4ZQFA 2QZ9A 5IFLA 3I3OA 3UCXA 2FPIA 3PRJA 4YYZA 1WVGA 2WE8A 5AOVA 4ALNA 4CLRB 5JC1A 1EFLA 1DIBA 2O4UX 1EMDA 4AJ4A 4XA8A 3U49A 3HDHA 3OJ0A 1W4ZA 1YDWA 1R4MA 4YACA 1SOVA 2UVDA 2HMVA 1KVTA 4R69A 1A7AA 1F17A 3PIDA 4XYLA 1EK5A 2DQ4A 2CUKA 5DCWA 4KWHA 3IP1A 3LVFO 3PXXA 4JBGA 2O23A 4Q3DA 4GKBA 1QR6A 4WNCA 3TZHA 3VPHA 4YEDA 4B7XA 3SC6A 3D64A 3EAGA 1VC2A 1FDSA 1UR5A 3GVIA 3ROKA 1L7EA 4IDAA 2W8ZA 1SPXA 3CINA 1PWXA 3M6IA 5KJFA 2O3JA 4MOWA 2NTVA 1V3VA 3WICA 4BL5A 3U5TA 3L4BC 4YT4A 2PKRA 3AUTA 3RCBA 3OICA 1CWUA 2GR9A 4RQUA 4CMEC 1CJCA 3K6JA 4D7AA 4JK3A 1LTHR 4NBVA 3UCEA 5TLSA 1SAYA 4R9RA 4AG3A 5IXYA 3O4RA 3IC5A 4HADA 3PDJA 3R1IA 3WBFA 1X7DA 2P91A 3BXXA 4AVYA 2ZTUA 2Q1TA 1E5LA 3PHJA 4ROSA 1WW8A 1UAGA 1OOEA 3PGJA 2J3KA 2Q2VA 3QA9A 1K6XA 2OUIA 4EBFA 1AHIA 2Y66A 3EK2A 3TJRA 3MEQA 1N9GA 4OYRA 5DZSA 1EVJA 1H6CA 1B3BA 1E3IA 5JDCA 3NRCA 1VKNA 3DZGA 2W2LA 3TL2A 2GUGA 4HFMA 3DB2A 2W90A 1HKUA 1VSUA 2GLXA 3JD2A 4OXKA 1E92A 3WLEA 3GZ4A 4MIOA 4CJXA 1N8KA 3GNQA 2PGDA 1NTOA 1WZEA 2BHLA 3Q9UA 3DBHB 2WYWA 3Q6IA 3I4FA 3H9QA 1QXSA 5JDIC 3OMLA 3BTUA 1TLTA 3E18A 5A9SA 5IZ4A 3ADPA 2O3RA 3PQEA 5I7EA 2CMDA 3EVNA 3RBXA 4E5KA 2FWMX 3GOHA 3L4SO 1PJSA 4RQTA 3KYCA 1LXCA 1HTBA 3WDSA 2BFOA 5BNTA 1AGNA 4AJLA 2RCYA 3WSVA 3K8ZA 1MC4A 1E6UA 3ZU3A 2EV9A 2O50A 3AM5A 4WOKA 4L76A 3RASA 1YO6A 1PJQA 2JD2A 3GHHA 1NX6A 4L4SA 1DXYA 3ICCA 3V1TC 3DAPA 1T2FA 1NAIA 1JVSA 2NVUA 3ULKA 3KETA 3DBVO 2EKLA 1R6DA 1M6WA 1UP7A 5KKCA 3HSKA 1DRWA 3C85A 4RZHA 1NQ5A 3H4VA 1XR3A 3G79A 1L7DA 2DUUA 3AW9A 3F4BA 1PL7A 1VM6A 3X2EA 4J4TA 2X7HA 2VTEA 4XRGA 2B5VA 3UVEA 4J9UE 2J3IA 3QVWA 4P4LA 3GK3A 3MOGA 4J2HA 5ITWA 3RFTA 4D44A 1PL6A 3I5MA 4E2WA 3AM3A 5KVQA 4RPJA 3GMSA 4ALMA 3WFIA 2IYOA 3SBOA 3ICPA 4LN1A 1A4IA 3LC7O 3M2TA 4DLBA 1GD1O 5KJEA 5ILGA 3OQBA 1R15A 3PJFA 5U9CA 4CODB 3CUKA 1UH5A 3GG2A 3GF4A 2O3QA 4IS3A 1I10A 2J5KA 4OOFA 2ZKLA 2AEFA 2VT3A 4XYMA 3WTBA 3INRA 5DCYA 1DFHA 3PQDA 1ARZA 1PZFA 3HN7A 1K5HA 3KO8A 3HADA 3PZBA 4FJ2A 1NQTA 3QY9A 1C1XA 5DP2A 2PD3A 3Q11A 4OIMA 4MJLA 4XYEA 4XZ3A 3LSYA 1BVRA 3TN7A 1E3SA 3ENKA 4ND5A 4U7WA 1I3MA 3ROQA 2GNAA 1BXGA 4UUMA 3WG9A 3AI2A 1MC5A 1R66A 4L4XA 5EERA 3SX2A 4CM4A 4J3FA 3QE3A 2E4AA 3VOSA 2FR1A 1FK8A 1KY5A 3JQ8B 4NJOA 4UREA 5CPFA 3JYQA 1LDYA 4QTZA 1B8UA 2ZTMA 4D41A 4CV3A 1B7GO 6LDHA 3BMCB 3WR5A 5TQVA 1OC4A 5C5IA 4NBUA 1CQJA 3DWFA 5EPOA 4J16A 4R5HA 1HEUA 4HFRA 5AXBA 4PLFA 2WMDA 4P38A 3RBVA 4HV4A 3HDYA 4UUOA 3OQ6A 4JBHA 2J6IA 3ASVA 4BB6A 2PNFA 2VHYA 1MFZA 2X9VA 4GL4A 4NFYA 1QV6A 4BOYA 2Q4EA 2EW8A 2E6UX 3JQCA 3R6DA 4FBGA 3RBZA 1ZXBA 2Q2WA 4JP3A 4CM5A 2R2GA 2GO1A 3OHSX 3MCVA 3G1TA 2B69A 4PLYA 4CM6A 1GEGA 3GFGA 3Q2KA 1HSOA
chains in the Genus database with same CATH superfamily
1QHHB 1ZW6A 4IJKA 1X7XA 1L6IA 3PU6A 3RRJA 5IP5A 1ZMBA 1K2WA 5AVJA 1W0KA 4MWBA 2GF2A 3TI7A 5K01A 3OF2A 2XIJA 2IIBA 1DIAA 2P3OA 1T8RA 3NIGB 3H6KA 3BEDA 2V59A 2PGJA 1WD7A 4G3XA 4R41A 4LJYA 1ZK1A 4DHWA 4ZI3A 4QX6A 4QQNA 4NC9A 4ZGWA 3FWPA 1W85A 2ZWMA 5BXQC 2XMBA 5HKOA 4H6VA 1PQWA 3DMPA 5KSYA 4ZYVA 2OBNA 3GLQA 2Y8EA 4V24A 1M5UA 3GLUA 3CGWA 1VRCA 2ZLBA 4CF4A 4RIGA 1XU7A 3GH3A 5BVHB 2QRVB 3MJ4A 4EHFA 5ABPA 5FT9A 3KAJA 3KS9A 4GKVA 3A6GA 5EMMA 1CQXA 3DMYA 4MDHA 3UAVA 1BDJA 1KI8A 2OEPA 3K0HA 2CFCA 4LE1A 3ZU4A 4B80A 4NYJQ 4IZIA 3HG7A 5DNDA 1VL8A 4D74A 4IDOA 4DSAA 2W58A 3ZU5A 1IY0A 3T1NA 2R8BA 1IUKA 2E49A 3LJKA 4KQ9A 5GMOA 5KQRA 2I0FA 2CLLB 5KNCA 1KYXA 3LC0A 4RS3A 4IGEA 2ZUEA 4KTVE 2PXAA 3I9OA 4E12A 5CB0A 2MDTA 3UTCA 4TS3A 1M1XB 1ADYA 2GJ9A 5TPZA 2QIOA 4RVOA 2OP0A 5JATA 9ABPA 5AVUA 3BK7A 3I9LA 4OUDA 2ZM6B 2W7TA 3HJTA 2O57A 1KJYA 3X0DA 3CXRA 3WGIA 1T0HB 4GI7A 5EINA 3VBEA 3FYDA 3O8CA 5FR2A 2JI8A 2YXPX 3NTQA 5KAMA 3IKTA 5FBZA 1WXWA 4GBED 1IN5A 4NARA 4I4LA 4UM5A 4BKPA 4BTVA 3AUJB 1EBFA 2WR8A 3LDHA 1Q0RA 1JFFA 2GYVA 2IE0A 4MS4B 1N1EA 4N5DA 3IEPA 4FQ5A 5JS8A 2VF7A 4Z0PA 4E07A 4OUKX 3JQQA 5JROA 2H9IA 1G60A 1U6KA 5AESA 3E8XA 3GC6A 5FTKA 1OJ7A 4C4TA 3Q98A 1KMMA 1MT3A 4PPYA 1VJ5A 3K70B 1WDLA 1M66A 4WLOA 4AKIA 4LQCA 5K09A 3ZK9A 1FJHA 1JYEA 1VKOA 2ETVA 2QPOA 2ZDGA 3BZWA 4ZYXA 3D5TA 3ZDAA 5HVNA 1BVHA 1J0XO 3CLUD 1VBNA 3W8NA 4HWKA 1NULA 1JLHA 1V3UA 3GDFA 3HA5A 1Y8ZA 3RS7A 5H8WA 3EULA 4RJKA 5D86A 2J5BA 1DO8A 2IYPA 3X2SA 5AKEA 5A5DA 1P4HA 1FCJA 1YVEI 1YFKA 4MUMA 3B82A 5B7GA 4FZRA 5IXSA 3BRWD 1Z0ZA 1UPCA 1FYXA 2ODTX 2ZCVA 1ULUA 5I9IA 1UXOA 5FAXA 3TOCA 2GYWA 2YV4A 2D2VA 3E53A 3EBOA 3FCEA 3NBFA 3PR3A 2I4RA 2NN3C 3OSZA 2Q2NA 4XWYA 3SJBA 4HWSA 3KEOA 2B4KA 4HB3A 5GVRA 4ACBA 5B7PA 1Z0UA 5MFZA 3EZ7A 2AG0A 4R83A 3UT5B 2PE5A 1P0IA 4OMDA 1ZJ6A 2R6AA 3FNEA 1FSZA 3KCNA 4TXLA 1JHZA 1U7TA 3D3WA 4MRMA 3VPXA 4A16A 4GQIA 1TJ5A 2G9ZA 2NTEA 3IEMA 2ZBGA 5E8RA 4I99A 3U7IA 1M7GA 2YR0A 5BN5A 1JDJA 3AR6A 5YASA 1Z47A 1Z8DA 2BFDA 3JALB 4N82A 4ZYWA 3K9NA 4B09A 3KXPA 1XMOB 4O8ZA 3VSAA 4O29A 1KO8A 2HCFA 4YBZA 4V0OA 5DI3B 5TT1A 4CL8A 4YP5A 2J5XA 3X1XA 5FOWA 2R00C 3B9PA 3K96A 1BEUB 3P2IA 2Y9MB 4MVJH 3FGZA 4DWOA 5NLLA 5DTMA 3MRXA 4QJIA 5FOSA 5AFSA 3W5SA 3KQYA 4JI2B 1NJSA 4F1WA 1RIFA 2H4FA 5BSUA 2H5LA 1BROA 3HC7A 2Q4BA 1KFCB 4O2LA 4PZDA 3KOYA 4F6RB 2WJAA 1PFWA 4NPHA 1SB9A 1QVAA 1FVHA 1M5TA 4J76A 5C5DA 5EHZA 3Q8LA 3IURA 1HA3A 5ECGC 1NJGA 3V6MA 3FTNA 4KZPA 2QE6A 4EI2A 2OG2A 1EK0A 3Q3GE 4AY4A 2ZJOA 1I4DD 4FNMA 1C8BA 3TLZA 3U13A 4TL6A 4KVZA 2VNIA 1IZZA 1KY4A 1YD7A 2WV7A 3I05A 1OAKA 3O8QA 4M9ZA 1Y7HA 5C5CA 4OP1A 2B82A 1MVOA 3GLRA 5EWJA 8ABPA 1SCUA 1PG2A 2VP4A 3KT8A 2NSYA 2WMOB 3MIIA 3RS4A 3E2MA 1OT3A 4HNVA 1FDOA 3D31A 3Q8KA 1C0EA 3H3FA 1NUPA 5JTTA 1N0VC 1P2GA 1JTVA 1CDDA 3DEAA 5E7QA 1BXRA 4G0MA 3OD1A 1Q1BA 3LRTA 4TGLA 2Q3JA 4URWR 3VR0A 1P1JA 2IUFA 1L5LA 1TO6A 5J2UF 2P41A 3HM2A 5DNVA 2A0YA 3PTZA 2JFNA 1J8FA 3A32A 3GP8A 2ZBQA 1CZLA 2O7QA 1P2UA 3QRWA 1ODSA 3JWPA 5K0CA 1RWXA 1CY4A 2MMCA 4UQPA 2V5AA 3EOAI 3VSBA 2C5LA 4JVLA 1BE8A 5A1TA 2RGGA 3JX9A 3DW1X 2C3OA 2G3YA 3QU9A 5AKLA 3D3NA 2DBVO 3FXAA 3BAZA 3MD9A 4I36A 1USGA 4K05A 1Z5PA 2O0KA 4KN6A 4OH1A 2YZ7A 4RZQA 1QKKA 3CLRC 1RMQA 3LVBA 4XIIA 1KDOA 4X90A 1HZZC 1UJNA 2BJHA 1JW9B 3HE3A 3RUHA 3RRXA 4HSEA 2QGNA 2AE1A 3BOSA 3BDAA 3F97A 1RPNA 2CXQA 2XMZA 1GWNA 3O2QB 2EC5A 3PHCA 1EQUA 5IK2A 3TOZA 4A5OA 4Z5XA 5K0FA 4XOUA 3J81A 1QTQA 1GL9B 3NPAA 4LGMA 1P0QA 3VR2D 4BNDB 3DMGA 1O1YA 1E3JA 1X1RA 1Z9BA 1CD5A 2GPSA 3AJ9A 4H08A 3UCFA 3GEHA 4GMGA 3VDNB 2HIGA 4UARA 4N18A 3ZD7A 2BKUA 4K2AA 1SCDA 2EL7A 2PA3A 4Z7NB 3FNIA 4OHCA 5IVKA 3E4CA 2YYYA 4NOJA 4BNKA 3HO1A 1EFPA 1PKEA 2ADOA 1V4NA 4QLAA 2E21A 2JCXA 2B99A 2HQRA 3BFVA 4JXKA 4EHKA 1DBIA 3JD0A 4H4EA 1YJCA 1ZN9A 2VVTA 1PD1A 3U1BA 1Q12A 2YL2A 3WOHA 1HNNA 1T6ZA 4E31A 2P6NA 4LJ8A 2X3YA 4A8JB 2NV0A 2X5OA 1G64A 1TVCA 3JQ9A 3GT0A 5K2MA 3IMCA 2W8BB 1RMTA 4UFOA 4EPRA 1KAGA 4MO2A 2PT9A 4JL6A 3ZHQA 1R9NA 3COJA 2F8TA 3W79A 1W9MA 4WJLA 1MEEA 2A7XA 2B78A 1GUDA 3EQ9A 5GONA 1NQXA 1KQGA 2ODAA 4EMTA 1JU9A 2CB0A 4RK5A 5DDIP 1SXJE 4TN5A 1JRLA 4C07A 2AXNA 3LPNA 4AJJA 3UUFA 1XMQB 4CIVA 4NMMA 2Y4OA 3VZDA 3HUEA 1W0CA 2VRCD 5D84A 4K26A 1O95C 3R3ZA 1WX1A 5CVJA 2R1UA 2UZ0A 3PR1A 5DSTA 4LF7B 2PZBA 3KQMA 5CLLA 1CS0B 1MJNA 4C0SA 4MVWA 2G06A 2Z1MA 4UTOA 3OJOA 1I30A 2LDBA 3H2JA 4WKPA 5DBIA 3DHYA 4LBYA 2H2WA 3FPEA 3OOWA 4FDMA 4ZC1A 5CLGA 1PTJA 1I3KA 3X44A 3M5PA 4X97A 5DBFA 4REMA 1GTG1 1O9HA 1KH2A 4HHEA 4TXNA 2Y1LA 3I0MA 4AICA 4M6WA 2NXWA 3LFTA 1N32B 4H7KA 1UPFA 3ASUA 3OM1A 4XJVA 3RIHA 1IPEA 1T26A 2OT3B 1HX7A 3MG9A 3OQMA 1NPTO 2GVDC 3IE2A 5FP0A 5DWQA 3QIAA 1L1EA 3I30X 4TSFA 3WK7A 2ERYA 3H2HA 8OHMA 5ENZA 3NRJA 4NG4A 3RUEA 1Z45A 2GAIA 4BJ5A 1YDMA 2IXFA 2ZR7A 3JQ7A 4RY9A 3V2UA 1ORDA 4HO1X 1FP4B 4GH5A 5BO5A 2HB6A 3CPSA 4QXRA 4J4BA 2UYOA 3GVXA 4CG1A 1R37A 1YZQA 3H5VA 3LXMA 3ZWMA 1S01A 1RABA 3GGCA 1KVSA 2IY7A 2V6MA 1WXXA 5B6PA 5CIYA 2BFEA 4L50A 5HDQA 2YIDA 3L7CA 1UJ5A 4ZGGA 1VG8A 2ZUFA 3WRYA 4DAOA 1Q14A 2D1TA 1H5QA 4BVFA 2IX9A 2OWDA 4Q4HA 5J1TB 3S99A 5TY0A 2GBIA 3QKRB 4I3GA 1JE0A 1TAHA 2Z2IA 3MWFA 4HDRA 4EM6A 1YB5A 4MIYA 1F14A 1GNLA 3DZ8A 4TTQA 1WXFA 1Z18A 3FZYA 3JVUA 1ZMRA 2FG7C 1P7PA 3HYSA 3T38A 1KKUA 3MGKA 1DE0A 4XUGB 5EXEA 4B9EA 4X62B 1JEYB 3LX6A 1MGPA 4TS4A 1E9EA 3V4RA 2OXEA 4R2XA 1XUOA 2Y9PB 3BMQB 5EJ7A 1FRZA 4GT1A 2WP0A 3GNLA 3FOBA 4OG2A 1CE8B 2K87A 4QFBA 4M55A 4L4RA 5ERXA 5HP4A 4IJVA 2HNAA 2GRAA 1NYTA 2D06A 2GEDA 1XEWY 1KMHA 3ORYA 4B48A 3EARA 4D81A 4KREA 1XXHA 1DQSA 1PS8A 1Q17A 2G1AA 2GASA 3BXPA 3G49A 4RA9B 4W1PA 3LLCA 2X0DA 4GX0A 4GEGA 3V2GA 4AFNA 4AXXA 4EI7A 4W7IA 621PA 1KO7A 4EGQA 1V0JA 1Z7EA 3M3HA 2ZRLA 3AF5A 4B44A 5KU1A 1E1MA 3O4VA 4AQDA 3OKAA 1AGYA 4HNTA 1IG3A 3RI3A 2W6ZA 3FNGA 1D2AA 2C9DA 2GPYA 4G37A 4MI6A 1PVOA 2X8LA 3BFKA 421PA 4HGPA 4K03A 2GSDA 1D4FA 4EY6A 1QCZA 2JGIA 3P5SA 2D0DA 1XMSA 3ESRA 3M1IA 1TMKA 4CN9A 2XXAA 1SC9A 5M29A 1QTIA 3GZNB 2WU8A 3GQBA 5ES3A 3KKQA 4BY9E 1WW2A 1NLMA 1TADA 4ZCSA 4ND3A 2R8EA 3A4YA 2X2PA 3BKWA 5IDYA 1UMBA 4MRVA 4I4TF 1LRJA 4YRDA 2WE7A 4GAEA 4DLNA 4G5XA 2LR0A 2X23A 1P72A 1RI5A 3E03A 4F46A 2H4ZA 3MC1A 4ZRMA 4FINA 5CLIA 5J4VA 2D7CA 1FX1A 5A02A 3VYUB 5B1SA 3FY4A 1M83A 3I1IA 1H2RS 2GTPA 4L85A 3UF0A 5FYQA 3C3BA 1Z82A 4HFNA 1K0UA 2JIPA 3F6PA 3GN2A 3HKEB 4RELA 1V96A 3NHAA 2L69A 4G9GA 3E5RA 2RI0A 3NUQA 5LXTB 1STOA 1FFHA 1GTZA 3F5QA 4KR0A 3RYIA 3OCYA 5CH5A 2OOSA 3UB3A 3BA6A 1E69A 3RYFB 5FI0B 4PLTA 1PK8A 5AW5A 2XF8A 1X9IA 3UAGA 2ZRQA 2PMCA 2XHZA 4UEWA 3PG5A 3GJ3A 3VAAA 3D59A 2GAJA 3ZWYA 1DL5A 2DTXA 1A69A 2V3CC 4FCTA 4S1NA 4H7FA 1YI1A 2XEXA 2CFIA 4TL8A 2G88A 4FNOA 4Y2YA 2BZSA 1TMOA 1VG9B 1W94A 2JLBA 3SXUB 4C88A 1YQUA 1Z07A 4OMUA 3GVPA 4PPFA 4FB5A 5CIQA 2W70A 2FJUA 1RM0A 1IUOA 1H2BA 5JNSA 2C7GA 5LU9A 1Q7EA 3HEBA 4JI7B 5DP1A 2V7UA 2PFGA 2QUJA 1Z7GA 4M0PA 4RULA 5EY5B 2JD0A 5A3JA 2WJWA 4MUGA 4TUYF 4ALJA 3G6WA 3I9MA 3NX4A 4ABTA 2Y0BA 4ID9A 4HQKA 4MV3A 2YIMA 3ET4A 1AHPA 3LY8A 3B36A 3OCZA 5G3YA 3RVPA 2G71A 4ZZ2A 3ZI4A 4LFAB 2O06A 1J24A 4DQDA 1KEZA 2BMVA 1I7LA 3L8MA 2HBQA 5JNUA 3P9RA 2GI4A 5ETJA 2DUNA 2H51A 2ODQA 3G02A 4TZTA 5JJ5A 2XCLA 3AEUA 3GNSA 3EXHB 3PE4A 4ZVOA 5T3UA 5KSPA 3PKJA 4B2PA 4NCAA 2BBSA 3UXEA 1N8SA 2QA5A 3C8UA 2O5VA 2AXPA 1HRDA 1JSCA 1H0KA 2JZNA 3CH4B 1YS4A 3CVYA 2C5SA 2JARA 4P3PA 4Q1VA 2YICA 4OGKA 5CT6A 3LNCA 4BJ6A 1DJMA 3OLWA 5AVSA 1XXLA 5LZ8A 4WCFA 2F1IA 3TSCA 3VTAA 3JAKB 4JC5A 4RJ2A 3ZYZA 4W5QA 4LWPA 3ANTA 1NUSA 2I2CA 2P35A 2R1TB 4IRMA 2BL4A 2VJAA 4WLUA 4XD2A 4IH4A 4BTLA 4RHXA 4RTPA 5G1NA 5EZ6B 5BSEA 4LYYA 2F3TA 5AHWA 3T5TA 4Y2QA 1TIPA 2C9MA 1SUSA 5EZYB 1ZGZA 1M2OA 1H66A 1E3DA 2A0FA 3BHMA 3IYLW 4NESA 4EDHA 3N7UA 1RQRA 5ALRA 3DLBA 3NV7A 5EKTA 1UMCA 3RE1A 4C7OB 2GFIA 2DHDA 2J5RA 2EWMA 1M72A 1PJ4A 5KDLA 3RVNA 3TCKA 3U7FB 4AMYA 2PWYA 3MMNA 2WIJA 2Y1DA 4D4HA 2V7BA 1Y48E 4AQ7A 1I0IA 4AMBA 2VLBA 2WVHA 3ELBA 3GUCA 3V46A 5KIAA 4P3XA 2FUKA 5LN1A 2RKBA 1K9VF 3QUTA 3CXUA 4ZQBA 2PV0A 1LSSA 5F1KA 5FPPA 2H54A 4UC0A 1FX0B 4Z2AA 5GINE 3AM1A 4QUEA 2VPTA 3O8NA 5H0IA 3RQIA 4ETNA 2CMKA 3DCNA 2FLVA 4DM7A 3HS3A 1MJGM 1OLSB 1VLJA 4D98A 1UKVY 1PWHA 3K9BA 3U81A 1NZJA 3AHDA 4DVJA 2D00A 2FQ1A 4IWNA 4KYVA 4L9AA 3O3NB 2PAAA 2GCEA 4H3VA 2WM8A 1TYEB 2Z5LA 4MKHA 3Q9SA 3OIDA 5DGHA 3U1VA 4EJ6A 3KJEA 1Y8RA 1KVQA 1KYVA 2GCPA 1C9YA 3A1CA 3DAYA 4U2GA 4B83A 3T3PB 3L7BA 4D46A 4C1BA 4ESHA 3NBUA 1J5XA 4FS8A 4JOSA 2GPTA 3PLRA 1GJRA 3TMAA 1QJCA 3VV2A 3C3MA 3TZEA 3U3MA 4J49A 3L06A 3S7ZA 2Z30A 2XT0A 1A2QA 4E30A 4J0QA 1QNLA 3OVMA 2IXDA 1GUFA 1ZN8A 2OO3A 2VNHA 3C6BA 1Q3TA 4QSMA 1XQYA 2PSJA 3OT1B 4G5QA 5JQGA 5A5FA 4DIDA 3T7JA 5B58C 4C20A 3L8DA 2MWMA 4JA2A 3K4QA 1CR1A 1Z4KA 3A1UA 2QJTA 4YAOA 1C2YA 1SBIA 1GG9A 3AUKA 3R44A 2G72A 1QZXA 3E3LA 3T95A 4IJWA 3O93A 1JFSA 3HVJA 4U00A 1H2FA 3ER6A 1L5QA 2I91A 2ZRBA 4YJGB 1OROA 4ZCQA 3T3MB 4E21A 2L19A 4MHTA 3F71A 4FFRA 3SE7A 3S8EA 1TQHA 2PKCA 3MJSA 2DC1A 3TMKA 1VYTA 3IH5A 3TLEA 3LBAA 2IDZA 3A0UA 2ZCJA 1H94A 4UCQA 3USCS 1AT1A 5LBUA 3TGLA 1PNOA 3EGXA 4ARIA 5BN4B 3WYGA 5JCOC 1J7KA 1DHRA 1SK8A 1YULA 3QF4A 3OX3A 3PGA1 4CV0A 5H16A 5DYNA 1XN4A 4EECA 4QBHA 2IYQA 4F7WA 2QX6A 5FTMA 4JB3A 4N03A 4Q4AB 4M99A 4E4YA 1H69A 5FLEX 2HJVA 3AC0A 5G0SA 5TV2A 3LAWA 4UAUA 5JMTA 1KI9A 4E5MA 1Z2AA 3HB9A 4M9UA 4Q21A 4JN6B 2M6SA 4OREX 3P5BA 5AUOB 1AK1A 3HBNA 2IEDA 4B7CA 4CM8A 2Z0MA 3GGOA 5CDUA 2R1ZA 3GRKA 1B16A 1K4YA 4E1AA 1LX6A 4D6YA 1KIFA 2YBDA 1V4VA 4KIGA 1QP0A 1A82A 2HR1A 4JUDX 1K63A 4MW1A 5F52A 3WBBA 1JDPA 1GKIA 4FC6A 1A0OA 1Y0BA 3BSSA 2HIAA 2HJGA 2Y1WA 3WZMA 1JEEA 3LCRA 4J2OA 1RAGA 3R5XA 4K81B 3M9XA 2W2KB 3DMNA 4OQDA 4QWWA 4U02A 3RC1A 4COOA 3K9WA 4FMCF 3ZQKA 4CKWA 1EDDA 1R64A 2AZDA 3F3YA 4MUXA 4ZO7A 5GONF 4F3CA 4D3XA 1IK6A 1XTRA 3I32A 4IHQA 4B82A 3ERCA 3OEWA 1B8OA 3ZZ0A 5I7SA 3PX3A 4QO8A 5ICFA 4FILA 2J4CA 3NEAA 3QWFA 1WHTB 3W5BA 3UAZA 4UM9D 4CEJA 4JP5A 4DTCA 2W00A 5GY7A 4F1KA 2W4QA 1FZTA 2YS7A 3EGIA 3GYBA 5KMGA 1TL7C 4HDCA 3NGMA 3SHWA 2H17A 1ICIA 3GFTA 3B6EA 5A9RA 4LJ7A 2R1VB 1RZUA 2ZRJA 4AX4A 5IJAA 4DPKA 2OZLB 1X3SA 4H6WA 4QU5A 2F4VB 4A27A 3OPVA 2Z3WA 1SC1A 1QANA 4RIFA 1BN7A 5E0OA 4BKMA 2CLEB 3UT6A 3RUIA 2HSGA 5I3CA 2HPHA 2P2CA 5BW8A 2P2YA 3BJZA 1SUPA 4UTZA 4PICA 5FNVB 5FJJA 5G0TA 2ZRKA 3BDVA 1YACA 1Y5IA 4FCWA 2PU7A 2DPGA 4BB9A 2ZR0A 1DB3A 1JBEA 1Z08A 1QLJA 1NXWA 4Q93A 2ZAYA 3D6VA 5KNDA 4KX3A 4XB6B 1G42A 3A4TA 4ZU6X 5K3FB 3RG2A 2WSLA 1O03A 4EMBA 2QTVA 1MB4A 1TUGA 4UAGA 4KUHA 2PBRA 3O47A 4IQ8A 4LMAA 1JH8A 2VZLA 4BKQA 3KYJB 1J99A 3B3JA 4ILKA 5D7BA 2QAGB 3ZLBA 4YAIA 3R6TA 1O58A 5I9MA 1QORA 1VMIA 3HUDA 2HC9A 3ZW8A 4OX9Y 1UM9B 1N7HA 2ZT8A 5JV5A 5C8ZA 1KHTA 1QH1B 3WNQA 4DUPA 4JL8A 5KJ6A 5KX5A 3VKHA 4L4ZA 5IVPA 3BIWA 4KZKA 1JDNA 1FJ2A 1U2DA 1GV1A 4HYTA 5EKSA 4C6SA 4AKHA 3UMVA 1RQGA 1C3VA 4ROTA 2Q1UA 1H5UA 4WNAA 1Z0DA 4WFIA 2OD9A 1GQYA 3U37A 1M6YA 3I6IA 1GGFA 4HVAA 1NLZA 1EUCB 1P31A 2JANA 2A0WA 1RXUA 3EIEA 1CY1A 4S2UA 3U6BA 4OJTA 2IXBA 1HETA 5DSZA 5SV2A 5AKZA 1CEEA 1DXHA 2YXBA 5GM1A 1W76A 2OAEA 1ZUHA 2BI4A 2GZ2A 3PEVA 2OVFA 2VL7A 1NRIA 3ONEA 2PA0A 3ON5A 1JHQA 1XGKA 4P84A 1JKFA 1SIUA 4BQNA 2G1KA 3H4IA 2I8LA 1U94A 1MQAA 2NUAA 4CQMB 1Q1AA 1RJGA 4TV9F 1BVYF 4DABA 5AP9A 4H7DA 2BFAA 1D0IA 2BIFA 2BP7B 5A71A 3W9SA 2GKSA 4H3KB 4HNHA 5ITSA 4JZKA 4LKRA 5AQ1A 4DR4B 5DLPA 2B94A 1E1KA 3K6SB 2DT8A 4POOA 2QGZA 4C6HA 5HX7A 1E7YA 1KI6A 1LPOA 4KPUB 4M3NA 2QSJA 1TM7E 3PIIA 3L7OA 4JJZA 4E3WA 2NVWA 4FHCA 1G3QA 2VLIA 3BTVA 3TKYA 5IW8A 2JI6A 2AI1A 3KT3A 5HPYB 5HUJA 3D5QA 3VR4D 3FI0A 5K0ZA 4DV2B 5K3CA 2VG8A 3K0CC 1QBKC 1GU7A 3EGEA 3GW8A 3KPYA 4HDSA 4RGQA 1E2QA 5AR1A 4ZEXA 5IN5A 5IASA 4LJ6A 3H4TA 1PLKA 3ZDBA 2YJ5A 4D5GA 5H9WA 3GJ5A 2H07A 1JJ7A 2GZHA 4Q7EA 4CUZA 2ZIWB 4IDFA 1QV9A 3JQAD 1QFMA 3B9QA 3IAEA 4JNKA 4Q1DA 2G5TA 4QYIA 3KOXA 5JECA 4JI4B 4TTJA 1Z74A 4PZPA 4DA0A 3PYMA 2AH5A 1WB5A 3SHTA 3ES9A 1MAHA 1DKUA 4CN8A 3A9RA 4BU0A 3A1DA 3L7IA 4ND2A 3IV6A 3LDAA 4ZYLA 3E9ZA 1J8MF 3L4JA 1O9BA 4DV4B 5H02A 4ZK6A 1DT5A 2CHEA 4F8YA 1L5WA 4KWTA 2QZSA 3W5VA 3R23A 4I55B 5JANA 1HSZA 1Q16A 2HU8A 1BD3A 4YS6A 4GW3A 2IIVA 4XVQA 2H4XA 2B8TA 2G82A 2H1RA 3GOQA 4TROA 3LL4A 4X20A 3VMFA 5HKKD 2JAQA 1TTQB 2HAEA 1EWKA 4XE5A 2HPZA 3L1HA 3ITKA 3RS3A 3SJAA 4MQ4A 3T5BA 3T3HA 2Z9DA 3JPWA 4KN9S 3RD5A 3VZBA 4YCMA 4GKJB 2FX2A 4TYWA 1CVLA 3D3JA 1EDEA 3QNMA 4R2IA 3H11B 4Y2TA 3V7FA 2KBEA 2Q4RA 1XZNA 1MT0A 1A9SA 3KKKA 1YI0A 3K1AB 1LPNA 1W88B 3R5JA 4Z9YA 4QGSA 1IQRA 1T4CA 3UB4A 3KELA 4DT1B 2LKDA 1ZS9A 1YRYE 2EEPA 4JDPA 1PJLA 5I7AA 2GAFA 4XGRA 3IA2A 2Y6VA 1FOEB 1G2QA 5I9BA 1ZD2P 4OI4A 1MOSA 3JSXA 4B3BA 2PXCA 1JSRA 2MSNA 1GKYA 4TQ9A 4YCAA 4ZDWA 3RAGA 4MGYR 4NJMB 3TOSA 2W42A 3DBIA 3QEBZ 2VPWA 1LWOA 4JOQA 1NW9B 1EU1A 2ZUBA 2FHSA 1DZ3A 3S0JA 3E6AA 4IPTA 1TAUA 4JGGA 3PFFA 5EFOA 3AEZA 3L4BA 3ZEIA 4EJ2A 5I4IA 2AUNA 3MCAA 5F51A 3NVDA 5IT4A 1MO3A 1C0PA 4KL8S 3D43A 3EC7A 3MLAA 3S68A 2YWHA 2QSYA 5AW3A 3UAXA 3VXKA 1VGRA 3RNLA 4G24A 2YMMA 4RA6B 1R0YA 3L7LA 4A6PA 3A6PC 2IZZA 2AD1A 5LOVB 4BEWA 1UDCA 3FAKA 3HV2A 4DG9A 4TKMA 1CB0A 3HB4X 5HJ5A 4ZQIA 1BMFA 4L57A 1J2TA 3RUCA 3B8HA 1UWKA 3DYVA 5JSHA 1ZLYA 3L18A 2VSXA 1ZL2A 2Z2JA 5C53B 3DL4A 4PHGA 5A62A 2CDCA 4Q3BA 3W5JA 4IDQA 5KVSA 3DC2A 5JIBA 3RW9A 2K7ZA 3EZNA 4P93A 1E9VA 1M1YB 3I73A 4WT7A 3TQOA 3BHNA 4QDJA 5LZ9A 4Z9FA 4CLDA 4WKGA 1XVTA 3LKZA 3VH1A 2ZZMA 1E2MA 4EHIA 4FFVA 3MWEB 4M38A 3AFGA 4UHCA 5DNWA 4AJ1A 2WJGA 3ZY3A 4WUVA 4BKUA 1YA4A 3JWHA 1K6JA 1LNQA 1ZP6A 1JZTA 4HMPA 4JJ6A 1Y89A 2IHKA 4QBKA 4BQFA 3U7QA 2PKQO 4MP8A 4C7JA 2XODA 4O2RA 1X2BA 2EP8A 4GF5A 3UWKA 2WEKA 4ZI7F 4DA8A 5E9WA 2JGMA 5EVJA 1DCKA 1IG0A 1KPGA 1RAFA 1GZDA 2E48A 4HZUB 1C7ZA 1M0WA 2FWAA 1S4MA 5BV1A 2GRJA 3QE0A 4DNPA 1J23A 2IIPA 2ZIZA 4PO1A 1XRNA 1E4EA 3O9ZA 4CKCB 5JDIA 2CMFA 3QSYA 3K0SA 2IK8A 3HFGA 2DQZA 3NHUA 2PSFA 3M4YA 1YCHA 2E3JA 5JOQA 5IVHA 1QGAA 4P53A 3HB7A 1CP2A 1M8FA 2UXCB 2B4TO 4M49A 4QEZA 4O2BB 2RC6A 1E66A 1ONSA 4JEUA 1KQFA 1Y6QA 3KSDO 1MX1A 4LYDA 3CG0A 1RTKA 4E70A 1F4PA 1T9ZA 4CEIB 3CKYA 2IV7A 4DDHA 3RSHA 1GPUA 5FJIA 2EGGA 2DR2A 2QDKA 3W2IA 3OFVA 1NJFA 4J6EA 2OV8A 4HX9A 1EFRD 1FU7A 5JPCA 1EX7A 3T9BA 2AEJA 2G08A 3I52A 3ANLA 1C4WA 2HQSA 4K1LA 4QU9A 3KTAB 1C8KA 1EFRA 1EXNA 1QG6A 2XKJE 3RQSA 3ROZA 4FYIA 4AWXA 5K0TA 1Y9ZA 1KXJA 3CM0A 4FFBA 1KZ6A 3QPVA 4CCSA 3K9CA 3ZVKA 2QTHA 4DQKA 5B1DA 2AFIA 3R7WA 3R9KA 1U2QA 4GLJA 4GQBA 5DBHX 4DF3A 1H22A 1TT5B 1DPGA 1GUZA 3V42A 1PO7A 4P2BA 3MSXA 4RKEA 4YQZA 2QROA 1K8YB 4XAQA 1ORHA 1U80A 4HH1A 1O94D 2QW1A 5T6BA 1R0LA 3MJHA 1LY1A 1SO8A 2JKZA 4PPGA 2QQ0A 1YR9A 2FY8A 3WBJA 3ZI0A 3WLKX 3AKZA 1EFKA 4EJMA 1RBZA 3OE7D 4Y2XA 3UUEA 1QH8B 2YV2A 4P08A 5DYWA 3OBBA 4MVJP 2Z2KA 3OZUA 5CB4B 5I9NA 5JQGF 3OE7A 1VBKA 5L3QB 1NW3A 2OXRA 1Z0KA 4JENA 1HI9A 1D2MA 5LUBA 2VDJA 5IJ0B 5JH7B 5EP2A 3LDUA 3OEYA 3BE6A 1RE0A 3H5RA 1SBZA 1H42A 3NH6A 1SUCA 5D00A 4PAGA 4JJKA 3SXJA 2ECFA 3LDGA 3ONWA 5EE5B 1TT7A 5JLJA 5CYPA 4Q1AA 5LLSA 4GIBA 5JASA 1TK9A 1TD1A 4GP6A 3JVIA 3R74A 3V7WA 2WWGA 4KQFA 1LSOA 3H9BA 3H9CA 4J7XA 2D4AA 3HI6A 3IJPA 1SVIA 4D4KA 2IXAA 3ZY2A 2UXDB 3GCXA 3BE4A 3OPXA 3PP8A 3U62A 2JFXA 4ZREA 3H8WA 2AOUA 3LVRE 2M6LA 5KHOC 3C0KA 3HTXA 2CL6X 1E3WB 4MIKA 1DUIA 2HADA 4PNEA 1YQ9A 3OPYI 3EXIB 3UC5A 5I7UA 4FMDB 3R3YA 3S3TA 1VB3A 5JVDF 1YZGA 1R18A 2KS6A 3ML1A 2Y67A 3VU9A 4J07A 2WHPB 5K05A 1U11A 2GZDA 1NNEA 4R9VA 3LT4A 2C57A 2ZB8A 3NM6B 3QVLA 5FORA 1UXHA 2VPXA 1XHLA 3FNRA 4FIZA 1F60A 2JJ1D 1QUEA 1G4HA 1SOUA 3N5KA 4IAOA 4PC2A 4TM7A 3NW9A 5KYKA 3I5XA 1ADFA 2Z6VA 3C2QA 1BE0A 2JJ1A 3EEBA 5ALZA 2HRRA 2XGJA 5GOZA 3LY9A 3RTEA 1WV1A 1HMYA 4Y9UA 2QYSA 2A14A 4K9MA 4A5SA 4ZVQA 2IIQA 1A50B 3ZHRA 4O4LA 5DULA 2B8WA 3KHKA 2AEEA 2J0UA 121PA 2ZETA 5H81A 4CKEA 2DBQA 2X2EA 4IIJF 5B12A 4N41A 1M0EA 4Q9DA 3KIPA 5GV8A 1LU9A 1V9LA 3O75A 1HDRA 3IA7A 1N4AA 1Q20A 1XQWA 3VPDA 3CB4A 4GX1A 1XRLA 3HO8A 3QFSA 3VDRA 4YRTA 1SQ5A 3E9NA 1T5TA 3ILHA 1V37A 1L7QA 2H8KA 3QU4A 3SHOA 3UMFA 5DTJA 4UTNA 2VBIA 3LBYA 1WMSA 1LK5A 1DAOA 2ZJBA 2CT8A 3R6WA 1DBWA 2NWQA 4N7MA 4N49A 1IVSA 1V5FA 4OH7A 1FTWA 3KJQA 1QU2A 1Q7CA 1I36A 1GFWA 1C7RA 1TF5A 2F48A 2FF5A 2G9RA 1DQZA 3N8DA 4GI3A 4JQSA 1HNXB 3OA0A 1EVYA 1G8HA 3QYPA 2QTMA 1TEVA 4W1RA 4LV8B 1DTWA 4EX7A 3B52X 3DE1X 3LBNA 3EC1A 2R6DA 1MAAA 3K92A 4HMQA 5KYXA 3PUXA 3V8BA 3E9QA 3G1WA 1I01A 3SDSA 2YXEA 1A9RA 3NATA 3WNVA 1B0PA 1BVUA 3VHLB 4DG8A 1GTSA 1KFEB 1YCDA 2CE2X 1P9NA 3CT4A 2IDMA 2V8OA 5A4KA 2EFJA 4DZZA 1ENPA 3AHIA 1YRLA 4YP1A 1K89A 3R7FA 1ZNYA 3WGKA 1U0FA 1DC7A 2IHTA 2Y4NA 3JQGA 3KPVA 1JG1A 4G84A 3SDBA 5KTTA 2J87A 3ZJTA 4K6FA 3BK1A 1ONOA 4IIBA 1D2GA 1G5RA 3ESQA 1UDWA 1NKVA 3N87A 4BU1A 4DCSA 1I7QB 1KAHA 3DFMA 3G2LA 5K3BA 1CZKA 4H1HA 1F1JA 2DP4E 1E20A 1J56A 1P0CA 5BN1A 3C7AA 3MQFA 3PF8A 3HN6A 1G20A 3IUQA 4IO1A 1F48A 1SURA 4M54A 5GJWC 3AEXA 3NHYA 1RWNA 3HCBA 4H0NA 4WLNA 1S4QA 3IDZA 4QRHA 3GUYA 1X6VA 3GJ8A 4UU8A 2RGRA 2UVPB 3COSA 5EGNA 2AFRA 4N3NA 4KXVA 5BYBA 1KFBB 2XQVA 3NFYA 2XTMA 3ECAA 3L79A 3PHHA 1R5JA 2IKSA 2PR7A 4CTJA 3FR8A 4WN9A 1B42A 5DW3A 5LDGA 1DRJA 3CR7A 1PT9A 4G36A 2CL7X 3PNPA 3VVBA 2IU6A 5CAEA 2B6NA 2QDXA 3DL2A 4ZO8A 5J4LA 2ST1A 1KIAA 1N7GA 2NO4A 3JQFC 4LTDA 4UHFA 3VZCA 4CNQA 3A1VA 1EFHA 1MUUA 5G53C 3BZUA 1IZ9A 4GNKA 2X0RA 1GKUB 1FFAA 1PR2A 2AC2A 1G8JA 4C5BA 3NBKA 4P2GA 1AHHA 4ENQA 5A0TA 3LSTA 3NAGA 2R85A 4NS4A 4GEKA 2O8VA 3K32A 3IBFA 5EE1A 5ADHA 4XGIA 2K2QB 2EVWX 2PZGA 1MZVA 2P90A 4RD6A 3L07A 2DBZA 1XVUA 4QYWA 5BYKA 3IEVA 1T3HA 3EW9A 1U8AA 3U60B 2WIKA 2NYUA 3OT5A 4NATA 4ZZ3A 3RAEC 4FPXA 3RJ9A 3VPFA 2RKOA 3RS2A 1DEHA 3RTBA 9ATCA 1XTKA 1S7CA 2HGSA 3NHSA 3K0KA 2H63A 3FYUB 4TKLA 4B74A 1YH3A 3ISJA 3ZWNA 1JEOA 3DKVA 1AO0A 4R1UA 4QAJA 1DKMA 3A7EA 3Q87B 5CYFA 3ELUA 3ZWWA 3OA2A 4PG7A 1DX4A 2C4UA 2ZUWA 3CKMA 2E4XA 2I87A 2DLDA 4I4CA 5EESA 4XB2A 5IZCC 3ETGA 3AKDA 3EW7A 1P73A 1MO5A 1S2DA 1VCIA 2PWZA 3EMBA 4I4NA 5BMOA 5BR1A 5LZ2A 5CFZA 2GHQA 2IDJA 1OI3A 1GNSA 2UYQA 3DZBA 3OCVA 3PUIA 3GGDA 5CCXA 1MX5A 4A2QA 4AF7A 2DFTA 4R8MA 4RVFA 4ER5A 2OBLA 1RJ9A 2CLCX 5B4VA 1J5EB 2VBFA 4J0JA 2VH5R 3C7DB 1P9LA 4O5OA 3WLOA 4S2EA 4IOMA 5J5VA 3RR2A 3DBLB 2CCJA 3F0TA 1L5HA 1Y7TA 2TSYB 3GVHA 4ITUA 4BNXA 4OLFA 1HYEA 4O0MA 4XIJA 5EJ4A 3OWOA 1YKSA 2QP4A 1PR1A 1L3IA 1Z16A 1NONA 4D3SA 3PPVA 4NHEA 3LPCA 1MX9A 1BSVA 2L82A 5ILQA 5DYIA 1KJIA 5IF3A 3AG5A 2CK3A 2P11A 2WC1A 3KB8A 3NVMB 4L0CA 2F55A 3GFBA 1T8TA 3WLMA 1UBKS 3FE2A 1ML4A 4CQLB 1T9HA 3I12A 1OV4A 4IVPA 1S1CA 4L28A 1KI7A 4ZHSA 1N5MA 2HU2A 2AOTA 3M4JA 4PZ0A 3FNQA 4QO7A 1BIFA 3HNOA 5DXJA 3WZLA 4A23A 1C7QA 2G70A 3MBKA 3NBYC 4PSKA 2E87A 2WWVD 4S04A 1P7ZA 4LQLA 4JLWA 2R00A 3G23A 1EFUA 3TQSA 3OEED 3VNRA 2JVIA 3DO6A 1XROA 3LV8A 1NT2A 2PSSA 1YONA 3DEHA 3IDAA 1J5PA 5J23A 5J2TA 2AD5A 2B35A 4OL9A 3JRWA 1YAHA 4WVFA 4KAAA 2WNSA 5FX2A 2XD9A 2XNHA 4QQFA 4NI5A 4XQ0A 3ZCSA 1EYZA 4Q82A 1N6HA 5FUMA 5C1IA 2V7VA 4YAKA 4URUR 3VU0A 3TNDA 1ZI8A 4EUSA 5JNLA 3LF1A 4UEKA 4HQFA 4R71A 2C92A 1Y42X 1VXOA 3ZOKA 4CMJA 4BNGA 1E0KA 1YVRA 3QYFA 3LUPA 4WEQA 5JO0A 5K6RA 3FUCA 1Y34E 1J9EA 2BFWA 3RJMA 1XLTC 1V7PC 1S89A 4XPIA 2Q2OA 2ZR9A 4FXPA 4Y6RA 2D59A 2G63A 2JGNA 2RJOA 4F4DA 2C2OA 2OENG 2PRZA 1S2GA 1DU4A 1GCOA 2VN8A 3QBEA 2WF5A 3II6X 4MUHA 4OGFA 4EW1A 4PYJA 5A06A 3PQCA 4B5KA 4DFDA 4GL2A 2AQIA 1XZLA 4BGVA 1XZ8A 4Z6KA 4B84A 3ZQJA 2OKGA 4TXJA 4J1QA 5J2TB 2EZ8A 1G5TA 1VRVA 2IZ6A 2YINC 4KLNA 3RJTA 2NT3A 2HTFA 3WRXC 3BIOA 3BGOS 3GUVA 4MP6A 4BJ1A 2X1MA 4BNTA 4D9FA 4OX9B 3RC7A 3M3DA 3ZV3A 2NU6A 4GOND 3AXTA 5F5LA 2X