1PJ2A

Crystal structure of human mitochondrial nad(p)+-dependent malic enzyme in a pentary complex with natural substrate malate, cofactor nadh, mn++, and allosteric activator fumarate
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
553
structure length
553
Chain Sequence
IKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD-dependent malic enzyme, mitochondrial
publication title Crystal structures of substrate complexes of malic enzyme and insights into the catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 184
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pj2A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1pj2A01
1P74A 1XHLA 3VAZA 2Y05A 4PLTA 4XB2A 1WXDA 2P2SA 3VZRA 4G81A 3TZQA 2ZYAA 3PHIA 4XQCA 4P22A 4WNIA 2C7VA 3HN2A 3WBFA 3I4FA 4BQRA 4MVJF 4AFNA 2J5QA 3WMXA 1EUZA 1A9ZA 1K6IA 4R54A 3EUWA 4XR9A 1NNUA 5K6AC 2O2SA 4RV9A 3A1NA 3WOHA 4AJ2A 1MLDA 2Y1EA 2H1SA 1RM3A 4CLEA 1Y5RA 4IXWA 1GEEA 4EGFA 1X7DA 3RUIA 1GUFA 1YQXA 4HNGA 2DBVO 3FNGA 1M6HA 4O0LA 4BGVA 1P3DA 1CYDA 4OJNA 4GSLA 8LDHA 2VHYA 2B36A 4RPGA 3Q6IA 1AE1A 4GL4A 3WSVA 1YB4A 3PHLA 3VVCA 1I0ZA 3H6KA 3TJRA 3A06A 3WXBA 4R4JA 1G6KA 2BLLA 2DUUA 1LTHR 3VH1A 1MXHA 1ZJYA 1NPDA 4E6PA 1VSVA 2EXXA 4L75A 3UGKA 3H9EO 1MG5A 4FFNA 1DC3A 1WDMA 3BA1A 3EY4A 4Y6SA 3D5TA 1MGOA 3FTNA 5CHEA 2GCGA 5DBGA 2A94A 3OIFA 5JDCA 3U09A 1E0DA 1T26A 3GPDG 1ZK4A 4II2A 2Q3EA 3EW7A 1ORRA 2Q4EA 4KTVE 1PGJA 3JQ9A 1PIWA 4I9NA 1ENPA 1UXKA 4K6FA 4FSHA 1LC3A 3OSUA 4BNMA 4WLFA 3KO8A 4QQRA 1SZJG 4HKTA 4UVIA 4HFMA 2LDBA 2O2YA 2BFOA 3OFSA 1UXHA 2XF8A 4F3YA 2O23A 3DFZA 4YT4A 1SPXA 4W4TA 2H5LA 2BI7A 4BB6A 1PS9A 1UP6A 2POQX 1ZCJA 2Q45A 3JQAA 2GD1O 4O6VA 4PZEA 2VZ8A 3ADPA 4LK3A 1CF2O 3AUAA 1VJ1A 3Q0EA 5MDHA 3KYDB 4B3JA 4ZGWA 5CEFA 1E92A 2X5KO 1HE5A 4JJGA 4BOYA 2EF1A 4J9VA 1X15A 3RUHA 4BGIA 2GSDA 4ZN6A 7ADHA 3OA0A 2P5YA 2VOEA 2Q99A 3OEWA 4R9RA 1GL3A 3QSGA 1NP3A 5KJ1A 1N9GA 4QUKA 4HADA 4OH1A 3MJ4A 3JQGA 1PZHA 4BO4A 3K92A 1UZNA 3ON5A 3GEDA 1EE2A 1C1XB 3L6DA 3FTPA 4QFCA 2QYSA 1R15A 4ZD6A 3ZHBA 1GQYA 1YL7A 2CUKA 5JAIA 2JD1A 5DCWA 2PZKA 3DONA 2VQ3A 4YRBA 1NQAO 4YJGB 1LLDA 2BH9A 4JN6B 2FN7A 5DF1A 5AVOA 3IAHA 2Y1OA 1GR0A 2WJPA 2HMTA 1JVBA 2PKRA 4PG7A 3H2ZA 3IS3A 1PTJA 1R37A 1E5QA 4XJSA 4A5OA 1HDRA 1DIRA 3ST7A 1E3WB 1N9GB 4GQAA 2G1UA 3ONEA 4LGVA 4CQMD 1HE3A 4YB8A 1ADCA 1EFKA 3ZDFA 2I5PO 4WJZA 4L9RA 3WX0A 3TF5A 1K89A 1J49A 1E7MA 3FWNA 3KVOA 1YBVA 1HF3A 2AQHA 4U6QA 4NZ9A 3SEFA 1FF9A 4MVJE 3WJ7A 1B16A 1M6WA 3FRJA 3H9JA 4I8XA 5GY7A 1MA0A 1HSZA 3I6QA 1MG0A 3DZJA 3RC7A 4BNLA 5L51A 4QTZA 2RCYA 1KVTA 4GX0A 4YVFA 4D3SA 5IZCC 5A3VA 2QRLA 3EZYA 1O0SA 1YDWA 2ET6A 5IXYA 2EWMA 3NTQA 4TRRA 5EESA 3BMQA 3VH3A 2WTBA 2PGJA 2WD7B 4A26A 3HWRA 1VKNA 3ROPA 4BO8A 4WNCA 1P1JA 4YAEA 2EW8A 1E7SA 2X9NA 4BNGA 1C0KA 1D3AA 1TEHA 3UCXA 4ZQBA 4YJFA 3ORFA 2FY8A 3VKUA 4Q9NA 4U8GA 2H6EA 3T4EA 4YAKA 1R4MB 3LDHA 3EVNA 3KLMX 1PL8A 3LSYA 4BNNA 2WDZA 3P2OA 2O7SA 4FW8A 3VKVA 2I76A 2OZPA 3V8BA 4EI2A 4CR8A 2GDZA 5G4KA 2BD0A 2VUUA 4IMPA 1HDYA 2NVBA 3RVDA 5JPIA 3SX2A 2X4GA 4CM1A 2DTDA 4PCVA 1YWGO 2DFVA 2DT5A 2PZMA 5GMOA 3E9NA 3CPSA 4I9HA 3JQ8B 1LC0A 5A5EA 2G5CA 3BMQB 3CIFA 1ML3A 1WW8A 1NR7A 1QR6A 3PGJA 3AOEC 1Z75A 4Z3DA 3T7EA 4E0BA 5CP8A 2WM3A 1PZGA 3W1VA 2E4AA 3GZ4A 4J1NA 3A14A 3V5NA 3HDJA 2LDXA 5A9TA 2C5EA 2Y1FA 4AJHA 4EEZA 2Q1WA 5ILOA 2XXBA 2A9FA 4FB5A 4H3VA 3EDMA 4Z0TA 4LCEA 1WDKA 4OSPA 1U1IA 4DYVA 3PYMA 2DM6A 4NG5A 5EERA 1T2AA 2F00A 3WIEA 1R16A 2V6GA 5U1PA 3OJ0A 3ZCXA 1B14A 2C2XA 4WLUA 1HRDA 3QQPA 5I9MA 5A3JA 5CDUA 1NTOA 1GZ6A 4RF4A 4AL4A 2ZTLA 4Q3NA 1B3BA 2RHRA 3BTUA 4MP6A 5F1OA 1PGPA 3TOZA 5EQFA 1BW9A 1L7EA 1Y81A 2W8ZA 3NRCA 5ILGA 2YW9A 1DFGA 5HRUA 2HLPA 1UP4A 4AJNA 3GVIA 2ZB4A 4WLVA 1YH3A 2I67A 1VKOA 3ONDA 3PVZA 3S2EA 3ZWYA 3RD5A 1JAYA 4RVUA 4MVJA 4DYDA 2DBQA 3TZHA 2P9EA 4MVJP 1JKJA 3Q11A 1BMDA 3TPCA 5B4VA 4BUCA 1P44A 2VWPA 3IJRA 5JO9A 5ER6A 1IHYA 1HZZA 4NPCA 1Y8RB 1QRRA 3JQFA 2JCXA 3RBXA 4DLAA 4OKIA 3ASUA 3PGXA 3TFOA 1A71A 1ADBA 4GPD1 4GKVA 3BTOA 3ETEA 1LNQA 2BKAA 3EC7A 1EQ2A 5GZ1A 2UDPA 1XQ6A 4IINA 1PJLA 5AYVA 2VHZA 3NX4A 2XOXA 3IDSA 5H81A 2IEBA 4J7CA 5F5LA 4BO9A 1FMCA 4RZHA 2NTNA 3PWZA 4Q3DA 3AI3A 4RF3A 3RUDA 2CZCA 5CPBA 5BSHA 4OO3A 4HFRA 2QYTA 4PLPA 4ND1A 1R12A 1V0JA 2E82A 2PA3A 1W73A 4M87A 2V6BA 4MVJG 2ZK7A 3C7DB 3CZRA 4MINA 1ZFNA 4M54A 3HFGA 1YQDA 1BHSA 1N2SA 1NQOA 4RLHA 1KETA 4WPGA 2DLDA 5C5IA 4NJMA 3F3SA 4YAIA 1D4FA 3C85A 3DZKA 5JCJD 2NU9A 3DBRA 3JSAA 2BFMA 3LF1A 2DFDA 1JWAB 4XRGA 1LA2A 3OP4A 2FZWA 3D0OA 1SOVA 4BKRA 1ISFA 2X0NA 3GNSA 5JC1A 4U0KA 2BRUA 4WK6A 1UDBA 2NVUA 3ASVA 4H15A 4AJ1A 5IZ4A 5KCZA 3CMMA 1YO6A 3RC1A 4DMMA 1T24A 3O03A 1LSSA 3DBHB 4URFA 3SLKA 4J7UA 5LDHA 4A2CA 3LLSA 1DAPA 4MVJH 1F17A 1HDGO 2B4TO 1B8UA 4DREA 2J5RA 2WD8A 1V3TA 2DAPA 3AY7A 1EK6A 2CD9A 3VPFA 3DZGA 4QO8A 3EMKA 4EZBA 2GLXA 5EJ2A 2A92A 1XU7A 4H7PA 4TRNA 1F06A 2HKIA 2BFAA 3R3SA 4FC7A 1CEQA 1X1TA 1LI4A 2HMVA 2QX7A 3FR7A 3GG9A 1EK5A 3PXXA 4UVEA 1JKFA 1FJHA 3GMSA 3X2FA 2PD3A 3IIEA 4ONEA 4N7RA 1IPFA 2V7PA 3WGZA 3PHHA 4F46A 5JDCC 2VWGA 3B1JA 2NVUB 3F46A 4IMRA 4PRKA 3GVXA 5CPFA 1P0FA 3KYCA 1UR5A 4WOKA 2C5AA 3MZ0A 4LSWA 4ND3A 3OA2A 5KJ6A 2XAAA 3HNPA 4RDIA 1H9BA 3JQ9C 1M76A 5BSEA 2I3GA 3FNFA 2A4KA 1ZUD1 3GVCA 2VWQA 4GGOA 2PZJA 3L77A 1O6ZA 1KEPA 1YQGA 2AHRA 4CM9D 2Y67A 1KIFA 1E5LA 5TC4A 3D4PA 1ZNQO 4M49A 4MDHA 3DC2A 3KYBA 1DRWA 1VJ0A 4E2WA 3FBGA 3WLFA 2VYVA 2QG4A 1W4ZA 3JYLA 3IOYA 1IHXA 4D43A 1EBFA 4J3FA 4IQGA 3HB5X 2HQ1A 5I7SA 2JFGA 4RLSA 4CQLA 1M2WA 2DC1A 3ADOA 4LRTB 4JK3A 1SB8A 4EEXA 1UUFA 2GZ3A 3GN2A 4BQPA 3PJGA 3LC2O 3NDJA 4Y8VA 5IFLA 3WFJA 5LDGA 1U4SA 2O3JA 3BHMA 2PWZA 5IDYA 1QP8A 1GYQA 1TT5B 4BO5A 1E1NA 3IKTA 3DAGA 4D42A 1QMGA 3I9LA 1GYRA 5AXAA 5CDSA 1DSSG 1HYGA 1A4UA 5F21A 1IULA 4J1TA 1BTOA 4OOFA 5THKA 2PZLA 3WMWA 2X22A 3ZWCA 3B70A 3GHHA 4XDZA 1XKQA 2PD6A 3BMCB 3QVWA 4E2ZA 4LRSB 3OF2A 1C0LA 3LF2A 3JQDA 2OHXA 3F4BA 4XB1A 2B0JA 2GN6A 1NPTO 3FBTA 1BVUA 5HM8A 3RWBA 3H9UA 3GMDA 1U9JA 2CY0A 3DTTA 1A7KA 1ONPA 5CG1A 4NU5A 2FP4A 1KVRA 4L4XA 1B2LA 3QV1A 1R4NA 4M86A 2Q4BA 3GGGA 4DA9A 4U6SA 3CE6A 2CDAA 3F1KA 1P1HA 3L9WA 4EJ6A 1P33A 1RYEA 4J4HA 5AQ1A 4IGFA 3UF0A 1Z74A 4AJLA 1BDMA 3ZWOA 4FFPA 1P1IA 1V3UA 4IJUA 3RFTA 1C3VA 3QWHA 4RPHA 4GH5A 3GNTA 5EIOA 1U3UA 3S1LA 3C3XA 1NASA 2BGMA 4O59O 4J43A 5BSGA 1VRWA 4IIUA 3P7MA 4DIOA 1X14A 4NBVA 4AICA 3KOUA 2ZTMA 4MVJI 3H5NA 5T8KA 2X7HA 1JN0A 1NWHA 1D8AA 3U49A 2NVWA 1L7DA 4E13A 4NK4A 3G1TA 2QIOA 1BXZA 1I2ZA 1R4NB 3NT2A 1VL8A 3GA0A 1GUYA 4NR0A 4Y9DA 2RBEA 4RJTA 1NR1A 4NQZA 4E32A 1BXGA 5K0ZA 3MTGA 3OH8A 1DIGA 2NQ8A 1DC5A 7MDHA 3RJ5A 3I52A 1I32A 4A03A 3UICA 4BVAA 2Y1GA 3GF4A 3JD2A 3QRWA 4OXYA 1MC4A 3EAGA 4RQTA 4DBZA 3QVTA 3VH2A 4PLFA 1XEAA 1C1DB 1V35A 2NLOA 1SNYA 3PZRA 4IY1A 3TZCA 1QKIA 1E6EA 2PH3A 3BHIA 3AM4A 3NV9A 3OETA 3RUCA 1LLUA 4YJHB 1KVSA 4CLRB 1OBFO 4XX0A 5JY6A 2CNBA 4BNHA 2FR0A 3F6YA 3W4JA 1QYVA 5ENVA 4ZJUA 4GAEA 4HXYA 1E3LA 1OAAA 2W98A 4U7WA 1I30A 2AMFA 3MWDB 5JDIA 4J91A 4PG8A 3GH3A 2AG5A 1BXGB 4BNYA 1ZEJA 1MXFA 4YEDA 3H4VA 3RFVA 1Y8QB 4MKXA 4NH4A 1VL6A 2VUTA 1E7QA 5H82A 4D44A 5DOZA 1QYCA 1BDBA 3F4LA 3HB4X 4KP7A 3ZHXA 4DL9A 5JAZA 2I66A 2VHVA 4IXTA 1EQUA 5A02A 1PGNA 1H2HA 3DB2A 3DZBA 4BNZA 4EJMA 5BT9A 4W99A 3OHSX 5F5NA 1UXGA 5EL0A 3UFXA 1ZZEA 2JFHA 1QG6A 3M6IA 5IG2A 1EMDA 3L0DA 2PNFA 1H94A 3CTMA 3PQFA 2IODA 4ZVVA 3JQ7B 3IJPA 1LUAA 4Q3CA 1GFSA 2VNSA 3OQ6A 5K9ZA 1DXYA 4ZICA 4YDRA 3GDOA 1YJQA 5G2OA 3JQEA 5DULA 2OMEA 4Q3EA 2I65A 1UJMA 1FDUA 1DIBA 3H5RA 3H65A 3GEMA 3K30A 1GV0A 5BNIA 1HDXA 1PGQA 2GNAA 2VUSA 5IDQA 3AK4A 4CV0A 3K2EA 3HSKA 1EFLA 5ES3A 1SOWA 4XA8A 4P8RA 1Y9EA 1PJTA 3CH6A 3OEYA 4F45A 3JQFC 4RGBA 4ZRMA 3WJAA 3UW3A 2ZTVA 5JAMA 3AU9A 3WQRA 4DIBA 3ZNPA 2IYPA 3V1TC 1T4BA 4BV8A 3EHEA 4XJTA 4DC0A 4CV1A 1P1FA 1T25A 4CL3A 1T2EA 1XU9A 4GMFA 1E3SA 4LCJA 3AU8A 1K2WA 4ND5A 1ENYA 1X1EA 1OOEA 4HUJA 4TQGA 4W7IA 3ZU3A 1WDLA 4OGWA 2B83A 4W9NA 4WGGA 4D45A 4DGSA 5LCXA 3G3EA 4LMPA 1ZSYA 3ZWMA 3GFBA 2CVZA 3WNQA 3LT0A 3W8EA 1B8PA 3WYCA 3DO5A 4Y6PA 5A1TA 1Z7EA 2NU7A 4B8WA 3PFWO 1LJ8A 1XWFA 4BO2A 1BXKA 4A27A 1LSJA 1N1EA 3VOSA 4RL6A 1DLJA 2BFPA 4WLEA 2EGHA 4HP8A 4CQMB 3OJLA 4BL5A 1E7WA 3VPGA 4BIIA 3AY3A 1H5QA 2D1YA 2J3HA 3WGOA 3AWDA 3KYDA 5L7TA 1CQJA 3KM0A 1E7RA 2TMDA 3DDNA 4HFJA 1F8GA 1P0CA 2ZTUA 4YJDA 5FEUA 4UVHA 3JYOA 5HA5A 1EDZA 3ETGA 2DBRA 4YT8A 3M1AA 2B4RO 3ZH2A 1YBAA 2VRCA 1G1AA 1CDOA 4B4OA 1P9LA 2RAFA 3GVHA 1C1XA 3WFIA 2Q2VA 4NMHA 3RBZA 4CM8A 3E03A 4BKPA 4XYMA 2PY6A 3UAGA 1OZAA 2GF2A 2NU8A 1X7GA 4PLWA 4ND2A 2W2LA 4YJGA 3ETDA 2IZ1A 3ZWXA 1MB4A 4GLOA 3ZV6A 5I9NA 5JMWA 3IP1A 3TZ6A 1JDJA 3WTBA 4I9UA 4BO6A 2NQTA 4J90A 1MFZA 4BV9A 1NVGA 3LT4A 5GZ3A 2HK7A 1U3VA 3HADA 3DBLB 1PWXA 3NGLA 5COQA 1D7OA 1E3WA 2WMDA 5JLAA 3RU7A 1DIAA 1HDOA 2EJWA 3QWBA 2O50A 1MC5A 4FQ8A 2VNAA 4I5DA 2O7QA 4J16A 2O3TA 3QWIA 4FPXA 3WYEA 4YQYA 5JC8A 3Q9NA 4CM8B 4JNKA 3OECA 3WGQA 2JL1A 4ZA2A 2Y0DA 3C7AA 4LSMA 4M1QA 3ULKA 3NDIA 5I8ZA 4FC6A 4JIGA 1W6UA 5IXSA 3GPIA 5TRTA 4JXKA 3WQSB 3N7UA 1JA9A 4L76A 2Q46A 4R16A 3MOGA 2HMSA 4XIYA 1DHRA 3I9JA 4JJIA 4IZIA 4CR6A 2R2GA 1YDEA 2OP1A 1LX6A 2DUWA 3W4IA 2X23A 3E1KA 3W6ZA 5C7LO 1UXJA 2OL4A 2ZKLA 5IN5A 1QV7A 4KUGA 3RFXA 2X0RA 4BNUA 2WD7A 2VRBA 5DBIA 3E48A 3OJFA 1F8FA 2D4AA 3DZHA 4K9DA 5TQVA 1U5CA 5L7WA 3ZU5A 1ISMA 4PG4A 4PIVA 3ZWBA 4B4VA 3BYZA 2NTJA 4GMGA 5IAAA 1QV6A 1IOLA 2Y93A 3IP3A 1HE4A 5B4TA 1RWBA 2QQ5A 1QXSA 2B4QA 3VPXA 4AJJA 2W2KB 2EERA 3C8MA 3AI1A 3L07A 3UH1A 4D0RA 3WGYA 1R4MA 4N5LA 1E77A 3N58A 3PP8A 4O1MA 4R1TA 4XDYA 3QWAA 1GPJA 3PYXA 4O63O 3PIIA 1JQBA 2TMGA 5CFZA 3GNQA 1E1MA 3AM3A 1PR9A 2DPGA 1P77A 1PZEA 5AXCA 1HLPA 1KY4A 3BMOB 1IL0A 3G79A 3CSDA 1TLTA 3JQ8A 4CMIB 3NTRA 2PLAA 4N5MA 2R6JA 4J0EA 4EUHA 2X58A 2VCYA 5I9LA 5A9SB 1EVZA 1CQIA 2AG8A 3DHYA 4N18A 1G0NA 4B8ZA 1CJCA 1I2BA 2DTEA 3NT4A 4IGEA 4YT5A 3TDKA 5KKAA 4CM3A 4D3DA 4U5QA 3S55A 1B3RA 5I7EA 3FPLA 3W8FA 1BVRA 1TI7A 4Q3AA 1FDTA 3DZFA 4J9UE 2O48X 2YV2A 3INGA 2J3JA 3BMNB 1DO8A 3I9KA 3KRTA 4LISA 4D7AA 2J6IA 1SMKA 2DQ4A 4J49A 5T8KC 1T1SA 1VI2A 5KVCA 1EVIA 1XR3A 1Z6ZA 5CEEA 1PQPA 1EUCA 1HTBA 2VOJA 1YE3A 1IZ0A 4XQGA 2C82A 5GZ6A 2B5VA 2PK3A 1J0XO 3GAZA 4BNIA 3KETA 2UUOA 4NBTA 4IUYA 2J5KA 1ID1A 2AXQA 2HRZA 1KC3A 2JJYA 1ZO8A 4UEOA 5H83A 3NTOA 5ITWA 1RM0A 2VTEA 3STHA 4XR4A 3T7CA 4MP8A 2P68A 4HNHA 4OSOA 3VZPA 2WYUA 4PG5A 2HMUA 2Q50A 3OM9A 1Y5MA 2YDXA 3FR8A 3LC7O 1KEUA 1VM6A 3NAQA 4XIJA 4Y6RA 1Y8RA 5TIIA 4KTTE 1DFHA 1L1FA 3PYLA 2NADA 4RZIA 4UEKA 3ZU2A 3GR6A 4GVXA 1PSDA 1YOVB 2XXJA 3JQAD 3QJ5A 1ZK0A 1DBVO 5KKCA 5JCXA 1HDZA 2FMUA 2V65A 2IZZA 3VDQA 4NK5A 4WEOA 1HT0A 4GLLA 1U2GA 1IE3A 2FSSA 5JDIC 4MPDA 3JV7A 3JD1A 2FZEA 4FBGA 2G0TA 2AE2A 4EW6A 1HDCA 2JCVA 4YAGA 1YRLA 2FWMX 2O4UX 1ZW1A 2BF7A 3OIDA 1PWZA 4TZTA 1P45A 3AI2A 1M75A 5IDWA 1FDVA 1D1TA 3IMFA 3ZW8A 1NVMB 1ONOA 4FOSA 3S2IA 3O8QA 2PD4A 4C7JA 1X7HA 3VZSA 1ZH8A 4MIYA 4LW8A 1U4OA 3WWZA 3E6AA 4R1UA 3LVFO 1EE9A 4QFDA 1WMBA 4CLOB 3PJEA 1Q2XA 2GN8A 1DFIA 1U28A 1TA4A 2Y68A 1U7TA 4NJOA 3GDGA 4BNWA 1E3IA 2HSDA 2NWQA 2ZQZA 3L9XA 4R9SA 1HL3A 1P1KA 3ROKA 1I5RA 2QW8A 1YONA 3I23A 2BHLA 2GN9A 1PJ4A 2SCUA 3GQVA 4OM8A 4I5GA 5A9RA 1A4IA 3U9LA 4GX5A 1U7HA 2GR9A 3DBHA 4IBOA 4PVDA 3S2GA 4MP3A 1OMOA 3PI7A 4YRAA 4ROSA 5JYEA 4AJIA 2OFPA 5CDGA 4DLLA 1N7HA 3QE3A 1U3WA 1O5IA 3O8QB 3WBBA 1PL6A 3I9OA 3WNVA 4IQ8A 4IDCA 2EKPA 3AUUA 5KIAA 4IDAA 1EBUA 2IXAA 3MOIA 5G0SA 4NHEA 3ZWVA 2Y1CA 4CMKA 5BR7A 1NPYA 1IYZA 5TLSA 1HLDA 3GZNB 1DJNA 4IPTA 4J4BA 2FR1A 4MJLA 5F3RA 4A7PA 1ZSNA 4ALMA 3R3JA 4WCFB 5ENDA 3JQ6A 3I3OA 4KQXA 3TOXA 4CMBA 1D1SA 4FFOA 3G49A 4QECA 1SAYA 4BMNA 3DMTA 4HWKA 1WVGA 3H5AA 2X0IA 1ENOA 3PWSA 3L4BC 4JROA 2YHUA 3DXFA 3SC4A 1Z45A 1NFRA 4W9NC 1LSOA 4RVSA 3LZ6A 1DRUA 1AHIA 3DEYX 3TN7A 3V2GA 1YB1A 4AJ4A 4UVGA 2PKQP 2G17A 1LQTA 1R0SA 2OBYA 3SJ7A 4ALKA 1A27A 4CMEC 2DU8A 4GSKA 1KEWA 5DN9A 2YY7A 1PQUA 4E5MA 1J6UA 1F0YA 4KDEA 2HUNA 5THQA 1ULSA 3UHAA 4GGPA 1C14A 1PR3A 1U5AA 2VYNA 4OHUA 5DZSA 4K1LA 1GADO 3GY0A 4PVCA 1LBEA 4GX1A 1HWYA 1I24A 4L4SA 5MGBA 4BO3A 4BNTA 3RBVA 3EZLA 2C54A 4L73A 3RUEA 1LRLA 2ZB8A 3U4CA 5A5FA 2NU6A 3I6IA 2FOIA 1T2CA 2Q1SA 3D3EA 1IB6A 1TT5A 1LSUA 3KSZO 3WTCA 5B4UA 2X1HA 1NFFA 5IN4A 1S7CA 3UCEA 3R6DA 4IS2A 1GTMA 1Y6JA 4TSKA 2P91A 3M1LA 3SVTA 1NFQA 3M2TA 3U5TA 1HE2A 4E3ZA 3ENKA 2FHSA 2ZIZA 1SBYA 4BNVA 4YCAA 3BMCA 2EV9A 3DOOA 2ZCVA 1MP0A 4INAA 1DB3A 2VTDA 3M2PA 1PJCA 2NSDA 1I10A 1H9AA 2DVMA 3QW2A 4UREA 1Y1PA 4I1IA 4BGUA 1DEHA 4HFNA 1X13A 1LDYA 1V3VA 5BNFA 3BIOA 2BI8A 2JFFA 4MOWA 2Y0EA 3RSHA 3KEQA 4MVJD 2O3SA 1TT7A 2GZ1A 3HZZA 4N54A 5DCUA 4F6CA 1FDWA 1FK8A 2AQIA 2ZQYA 1S6YA 4FGWA 2NM0A 5FFFA 3VVBA 4AJOA 2E48A 4GVLA 3OQ1A 4DPMA 4FIZA 1V8BA 3C24A 4E2XA 1Q7GA 2OORA 3D1LA 4GX2A 4J0FA 1QYDA 4PRLA 5AXDA 1IY8A 3E82A 4CV3A 3FN4A 1WZEA 2GO1A 3KLPX 2Q49A 3HJAA 5BSFA 1VPDA 3QVOA 4ALNA 3PEFA 4AVYA 4IDGA 4BGEA 4NBUA 4MIEA 2C59A 2CDBA 4PLYA 2JCYA 1NX6A 2NV6A 3OMLA 2OO5A 1HYHA 3ROMA 2JHGA 1BG6A 1C0IA 3LT2A 3Q1LA 4RVFA 3JQCA 3ZW9A 1ONNA 2HU2A 4YRDA 2HO5A 3HDYA 1TVEA 5DDIP 1C1DA 3WGTA 3GLQA 4P4LA 1YKFA 2AW5A 3GRPA 4CM7A 4EBFA 4J2HA 1R6DA 3WB9A 4DPLA 1SO8A 4R3NA 1NAIA 3ZZNA 4YJHA 5EPOA 3UOGA 4CLRA 5F1KA 1PS0A 3D3WB 3L6OO 3DWFA 1NWCA 4JGBA 3H7AA 2EKLA 4KZPA 2Y99A 1O8CA 4PZDA 2X86A 1K6JA 4TRJA 4BS9A 3RASA 3RI3A 2FR8A 5KNLA 4CJXA 3QVXA 3ZU4A 4B3IA 5JS6A 1PL7A 2HJRA 2FPGA 3HN7A 1MUUA 4XYLA 3UKOA 1BRMA 4Z9YA 4FD3A 4PN3A 3AW9A 5L4LA 3ZV3A 6ADHA 1Y8QA 4YAJA 4FFMA 5EMHA 3QY9A 4UUPA 4HY3A 5I7VA 2C2YA 4WLOA 4PZCA 3QVSA 2VZ9A 1PJSA 4C7KA 4RDHA 4TMFA 3A9WA 3F5QA 3OJEA 5L4NA 3BTVA 4JX8A 4UAGA 3GGPA 1MX3A 1JTVA 4CLXA 2JAPA 2DBZA 1AXGA 3EYWA 1LDGA 3G0OA 3NJ8A 5G4LA 3JQ7A 1PS8A 2AEJA 3C7CB 3QA9A 2Q2QA 5L40A 4RPJA 3B6ZA 3JYPA 2HK9A 1E3EA 1O9BA 3KUXA 1I3KA 1O94A 4R5HA 4XZ3A 1QORA 4XYGA 4YYZA 4B4UA 1R66A 3FPCA 3IUPA 3D5QA 1O95A 1K0UA 4ZQFA 4BMVA 1HZJA 2I9PA 5DBFA 3H9QA 5I7FA 3WGIA 4CMJA 2AQKA 1UDAA 3ZHZA 4YACA 1PZFA 1Z73A 5ICSA 4XQ9A 4NFYA 1GQ2A 2GRAA 3COSA 4CM6A 2VYVD 3K6JA 5JNLA 4Z6KA 1GY8A 3AUTA 4QEDA 2D2IA 2HMWA 3UCFA 2AEFA 4S1VA 4P38A 3HQ4O 2XPCA 2QZ9A 1BWSA 1I3MA 2BGLA 1J5PA 3GAFA 4FCCA 5T64A 5TT0A 6LDHA 3MWEB 1WPQA 2PR2A 2AA3A 4FJ1A 4JCOA 4K6CA 4BO1A 1YVEI 2I99A 4IQ0A 3INTA 3LLVA 2OP0A 2VHXA 4HX5A 4Z0PA 2I3AA 1U8XX 1DC4A 1YGYA 1U3TA 1RJWA 2YHIB 1JLLA 3B1FA 2R00C 2GN4A 4QT0A 2PFGA 1DRVA 2Q1UA 4RVDA 2FPPA 2VZ0A 3RKUA 1VSUA 4PLVA 4IZHA 1P31A 5G0UA 2NUAA 4TRMA 4GBJA 4EDFA 3OJOA 1KERA 1AN9A 1DIHA 1F12A 4PLCA 4ZRNA 4RQUA 4J7XA 1KC1A 3LK7A 1LQUA 4FFRA 4IDBA 4QX6A 2UYYA 4OYRA 2YV3A 3OQBA 4J1QA 5L7YA 4CM5A 1Z82A 4D3FA 3B1KA 4YWJA 3DZIA 3OICA 3TL3A 3SLGA 4CQMA 5TS3A 5CDTA 4ALLA 3KHUA 1GUZA 1Q0LA 4CM4B 2FSVA 3L4BA 4B79A 5B37A 3I5MA 1DOHA 4CODB 2PGDA 4RVHA 1R0KA 3E5RA 1UAYA 1GZ4A 3GDFA 5ITVA 2HK8A 4JP3A 4OKNA 1B15A 2D3TA 3V1UA 5CG2A 4OXKA 2QRKA 1U8FO 2C20A 3JYNA 1KS9A 4BKQA 3V2HA 4CMEA 1VL0A 3PFFA 4LVUA 1PX0A 3W6UA 2OOSA 2EGGA 3QIVA 4PLGA 4B4WA 5CEJA 2X8LA 5FWNA 2HRBA 2X9GA 3NGXA 4DBVO 1XQ1A 4YR9A 2PV7A 1H93A 5JSFA 5COBA 1EVYA 5F1PA 2Z5LA 3DMTC 2RH8A 4W7HA 2HAEA 4OIMA 4DQUA 3TNLA 4C4OA 2WYWA 1WAMA 1EEHA 2B35A 5J23A 4R3WA 4DWVA 2YYYA 1UZMA 4YBZA 3DBLA 1SCUA 2NNLD 2C29D 4D46A 3ANLA 4X54A 3ZN2A 2YDYA 1DHTA 5HWSA 1T1RA 3RC9A 4E2YA 3GC6A 4KDFA 2WEKA 4Q3BA 4CUKA 1SEVA 1O89A 3DAPA 3RU9A 2BMAA 3AY6A 4HBGA 2O4CA 2HJSA 1I2CA 3VPSA 1NQTA 2A35A 2WE7A 1XELA 2O3UA 4KUEA 3DAFA 4ESOA 3DMYA 3ZWPA 3JD4A 3P5SA 3WWYA 5JBIA 4RORA 1SEPA 4JP2A 4NBRA 3K5PA 1SC6A 5FYDA 3HG7A 1ULUA 2NTVA 4Z9XA 3RAJA 2D8AA 3VC7A 2EIHA 1NVTA 5JMPA 3H8VA 3KV3O 2CFCA 2JKVA 2V6FA 4FGSA 3DL2A 4RF2A 3MJSA 4IIVA 2GPTA 4DVJA 2RIRA 3BZUA 3SC6A 1AUPA 2O3QA 4WEQA 2P9CA 2UAGA 5L9AA 1N8KA 1QYXA 5G0WA 4FJ0A 4IJKA 2P5UA 4PFJA 2YJZA 3ANMA 3RJ9A 4AJPA 1GCUA 5C3MA 3IL2A 1NHGA 2ZJ1A 1EUDA 4MVJM 5LC1A 4CMGA 4DXHA 1N5DA 3CXRA 4UUOA 4BB5A 4BKOA 2OGUA 2W2KA 4DIFA 4GWGA 4TZKA 2D5CA 4I08A 2CF5A 4XD2A 2YQ4A 2PKQO 5DNAA 4ND4A 1ZK1A 4WOJA 1NAHA 3QLJA 3VTFA 1WNTA 4WE3A 3PQEA 5EN4A 2BELA 3H2SA 4NU6A 2IZ0A 3U0BA 1R0LA 2EEZA 2ZYDA 5BQFA 2Y1DA 3BMOA 2QZZA 1E6WA 1ZXBA 3QP9A 1DPGA 4CLDA 2Q2WA 3PPIA 4AJEA 4CMIA 3K73O 3WYBA 3S8MA 1CERA 2RH4A 2C0CA 1JWBB 4E5YA 2P4QA 3FHLA 3KSUA 4E5KA 3U4HA 3ABIA 3NUGA 3NEPX 3D7LA 1EZ4A 5A9SA 1E7YA 1PU2A 4P4GA 1Q7CA 4MO2A 3JQAB 3JYQA 4R51A 3GEGA 4R01A 2CF6A 4CPDA 3K2BA 2GYYA 1A9YA 4XYEA 1AGNA 1ZXLA 1ZMOA 3AFNA 1A72A 3D4OA 3KEOA 1ISJA 2GUGA 4EYEA 1W8DA 4TROA 3BMNA 1XA0A 3U3XA 4B7UA 2Z95A 2IRWA 2D5AA 3JQGB 2UV8A 4WLNA 3FF4A 4PGFA 4XQEA 3DTYA 1PJ2A 4Y98A 1RM5A 3E5MA 3JD0A 3TQHA 4A10A 4XGNA 1JVSA 5JXWA 4L8VA 1BSVA 2G76A 1YXMA 5C7OO 3TRIA 1HEUA 5CAEA 1B7GO 1GPDG 3EGOA 1KY5A 5B1YA 2VT2A 4GKBA 4TVOA 1IUKA 4FR5A 3DHEA 4I5FA 3ZV4A 4AJKA 3OIGA 1WP4A 1H6BA 3VPHA 5JCJA 3B20A 3ROQA 1ARZA 1UXIA 2IDZA 4BNKA 3VH4A 4FS3A 5JAQA 3CKYA 5DP1A 3SXPA 1TB4A 3HUDA 2FRDA 5KJFA 3PWKA 4D0SA 1RKXA 1GDHA 2EP7A 2IYOA 3A28A 5TT1A 3ZNNA 1V9LA 2CSUA 1ZSVA 3RC2A 2IEDA 5U9CA 1LRKA 1Q0QA 4K26A 1YBMA 3X2EA 1YOVA 4BO0A 3H3JA 2V6MA 3UUWA 1PGOA 4CL8A 1ADGA 1T2DA 1RPNA 2W4QA 3WS7A 9LDTA 1QLHA 4XWYA 2GASA 2E6UX 3HE3A 3KSDO 3GRKA 3K31A 3NYWA 3RUAA 4FJ2A 5TF4A 1B0AA 1OFGA 1H6DA 4DRYA 1XIVA 3V2UA 1DDOA 3DQPA 2VRCD 3IC5A 5DCYA 3GOHA 1K6XA 4G5HA 2CVQA 3IQDB 3MEQA 4LMRA 2UUPA 3RROA 5AOVA 1K3TA 3NDRA 1XDWA 3ZNOA 3VZQA 4BNXA 3I9MA 3U4IA 4ZQGA 2W2LD 3I4CA 2EG9A 1KYQA 1GCOA 3WIDA 4CLOA 1Q7BA 4EITA 3PIDA 4YJFB 1KEVA 1SB9A 5ADHA 4CM9A 4DC1A 1XLTA 4CR7A 2YZ7A 3L6EA 4DLBA 4DQXA 3KXDA 1VE9A 3C1OA 5HS6A 1H0KA 1B8VA 2WWRA 2R00A 2JHFA 4NBWA 2EP5A 5G4KB 1ZBQA 3JQBC 5TSDA 3FI9A 5A4DA 3LQFA 4DUPA 3ZNQA 4TVBA 1C0PA 3O26A 4WUVA 4CMHA 4KQWA 3S2FA 3W8DA 4EUEA 3FD8A 1Q1NA 1H2BA 4TKLA 1ZJZA 3O4RA 4B3HA 1FDSA 2UVDA 2E49A 3F9IA 1XSEA 3MJVA 5KJCA 4DTIA 4MKRA 4E12A 1ZEMA 3GZNA 5IDXA 3PHJA 1W0CA 4WCFA 5U4QA 1NYTA 1LRJA 4J1SA 5AXBA 5ICMA 4M8SA 4ZU3A 3RUFA 1XCBA 2H63A 9LDBA 5C37A 4FOOA 4OL9A 3RQSA 4E5PA 3AOGA 3DHNA 5JY1A 4PLZA 1ENZA 2C07A 2P4HX 3FSRA 3GN1A 3ITDA 3P19A 2OXIA 1VLLA 3HHPA 4L0QA 4E31A 3CINA 4ID9A 4OAQA 3DBVO 3PLNA 5JO0A 5HTOA 4B7XA 5K6AA 1CWUA 5L45A 1NM5A 1DLIA 2HDHA 4CUZA 4ALIA 3WSWA 1XGKA 2YFHA 4PLHA 4BKUA 3KB6A 1BW9B 3ANNA 4NIMA 3LC1O 3KZVA 3SBOA 3VHRA 3LYLA 1ZMTA 4UULA 3E9QA 4QXMA 4L4RA 5DP2A 3AM5A 1WLYA 3MCVA 2DTXA 2JD0A 4RF5A 5KVVA 4N5NA 1GU7A 2X5JO 1LDEA 3RKRA 3WR5A 4B7CA 4Z9FA 1HKUA 3FNEA 3AFMA 4KOAA 3KTDA 3L4SO 1HXHA 5ER9A 3GUCA 3ZWAA 1ZK3A 2C7GA 2VHWA 2O3RA 1LLQA 3OBBA 4IS3A 3TWOA 4CMAA 1WMAA 1UH5A 4CLHA 4WECA 3FWZA 1T2FA 3GUYA 4YQZA 4U0JA 1H6AA 3DOCA 5JYDA 5TJHA 4XRRA 1DJQA 3HDHA 1OI7A 2VWHA 4Q39A 3SJUA 3N74A 2VN8A 3PDUA 2ZYGA 3WQQA 3T4XA 2GZ2A 3NT5A 3D4NA 4IJVA 2D59A 4UVDA 3UN1A 3Q3CA 3E18A 2FPIA 4NNJA 2J3KA 3GVPA 2VT3A 3WG9A 3FCOA 1RM4A 1E3JA 1F14A 1PJQA 4WCDA 5IF3A 2J3IA 4BNJA 2YV1A 5G0VA 3PHGA 4M89A 3RCBA 4M55A 4R41A 5DT9A 5JE8A 5I8WA 4YT2A 5L4SA 1M67A 3PDJA 3CUKA 4EJ0A 1HYEA 3GFGA 4XCVA 1LDNA 1GYPA 2PH5A 3K96A 5KOIA 1J4AA 1LDBA 4IM7A 5T57A 1GEGA 1PEDA 4NJMB 1K5HA 2AE1A 5T67A 2F1KA 4NFSA 4DMLA 3DBRB 2Y0CA 4E30A 1G0OA 5JFOA 4I5EA 5L53A 2IXBA 3K8ZA 4YPOA 1TXGA 3PQDA 4DPKA 1XG5A 3A4VA 1JW9B 4XGIA 3BHJA 3F1LA 5A05A 2ZATA 3WDSA 1EDOA 3KBOA 1I3LA 2B37A 3PRJA 3UXYA 4GWKA 1DC6A 4OOEA 5FI3A 1UP7A 3TZKA 3ZHYA 1IPEA 1T4DA 2AQ8A 2NACA 4E33A 2X9VA 3ONFA 4TWRA 1Y9AA 3Q9UA 4OQYA 2Y66A 4KWIA 3WICA 4KMSA 4RO0A 5TNXA 2IE0A 4LVCA 1A7AA 4RCVA 4JBIA 2WSBA 2WYVA 4NFHA 1YS4A 3ZWNA 4P4NA 1RYDA 3O9ZA 1UAGA 3ICPA 4UUMA 1LLCA 3H3FA 5TX7A 3I1JA 4IDFA 3GK3A 4JLWA 2EJVA 3P2YA 2J8ZA 4WKGA 3LT1A 5A06A 3HDQA 3G17A 3NJ4A 1GAEO 2OBNA 5C7IO 1NXQA 1V6AA 4G2NA 3INRA 3TSCA 4JBHA 2D0IA 3KYCB 3C1TA 4R1SA 1X0VA 2CVOA 2P9GA 4RVGA 1LXCA 1BGVA 3PJDA 4PG6A 5L3ZA 1NQ5A 1ISHA 5A03A 2CDCA 4H16A 1X0XA 1E6UA 1VJTA 3D64A 3DFUA 5EQDA 1JKIA 1YL5A 3VTZA 5KVSA 3V1YA 3QHAA 3Q2KA 4W6ZA 3R0IA 4WASA 4E4YA 5HS4A 4OMUA 3D3WA 4HV4A 3PZBA 5G0TA 4FDAA 4QO7A 5KJEA 3DOJA 3CEAA 1KBZA 4XKJA 4EUFA 1Q0HA 1GQQA 4BNFA 2YQ5A 1PJBA 3VDRA 4BHTA 1WZIA 3ZGYA 4J4TA 1EVJA 4IJWA 4CQLB 1Y7TA 2JD2A 3ITKA 1ZK2A 4II3A 1LU9A 1ISIA 3BAZA 5IZCA 4Z0HO 4W82A 5KVQA 3F47A 2ZB3A 3HFSA 2ZCUA 1LDMA 3C1AA 3AJRA 1GZ3A 3LU1A 3E9MA 1E1KA 2PTGA 4Y67A 1PQWA 2Z1NA 1LEHA 5COAA 4UUNA 1VC2A 3PLRA 5L95A 4FN4A 1HSOA 3PTZA 4QSMA 4A73A 1QLJA 3IUSA 3PK0A 3ICCA 4CUJA 3NKLA 1N7GA 4O5OA 3EVTA 3TL2A 3WGHA 1NHWA 5JW6A 3GT0A 1UZLA 4G65A 3U62A 4J6FA 2I6TA 4FFLA 4ITUA 4R68A 4A0SA 1KVQA 4YA6A 5FF9A 2ZB7A 2AEMA 1P1RA 3R1IA 3DR3A 4KUHA 1JU9A 4RPKA 2DPHA 3MTJA 4UEJA 2X5OA 3E8XA 8ADHA 3Q2IA 4TKMA 4NI5A 4R69A 4R5MA 2DKNA 1I36A 4JBGA 3W4KA 1DAOA 4ZQHA 1OC2A 5FI5A 4AG3A 5B12A 4YXFA 3I9NA 3JD3A 4CV2A 3K9QO 3MJEA 2H9IA 1KOLA 4YTEA 1MFPA 5T6BA 2QHXA 3G1UA 1OC4A 1Z7BA 4D41A 3AOEA 2B69A 3FNHA 1PJ3A 1MV8A 2QRJA 4JQCA 1CETA 1HETA 3CMCO 4IDDA 5TJ9A 3ZWWA 2VYND 3JCZA 1I33A 4Z3KA 3RIHA 3O38A 4NDNE 3AUSA 3MJCA 5DOVA 4LN1A 1FXSA 4S3MA 3WLEA 4BO7A 4BMSA 4GI2A 1H6CA 5IJZA 4RPLA 2EKQA 2BGKA 2YFQA 1ADFA 1AHHA 1U2DA 4IDEA 2OUIA 3JTMA 3BXXA 3PJFA 2YHIA 1QSGA 1M66A 2JAHA 2CMDA 5KTKA 3EK2A 3JQBA 3H9GA 4XYBA 4OXNA 4CMCA 3GG2A 3BTSA 5TGDA 1AXEA 1YJ8A 1E1LA 1ZIDA 4F6LA 1ZVMA 3UVEA 1YL6A 1CRWG 1N92A 1XYGA 1QYWA 1UDCA 2ILTA 1JAXA 5HBRA 2ZJ0A 3ZV5A 3GHYA 4MKZA 5A04A 1I8TA 1I3NA 4ILKA 1A5ZA 2G82A 4KWHA 3MJTA 2Q1TA 1GV1A 2X0JA 2GERA 3ZI0A 4D79A 4JJFA 2X6TA 4MIOA 4E5NA 4CM4A 1ZKMA 2E37A 3QWFA 5BNTA 5EINA 4ZQEA 2B5WA 5T5QA 3IKVA 1B26A 1YB5A 1IZ9A 4K28A 2YUTA 2Z1MA 2EHDA 2RHCA 4XEHA 5KWEA 1KVUA 3ENNA 2PGLA 3CZMA 4J2OA 4E21A 1N1GA 2WE8A 4DQVA 2W90A 3I83A 2HCTA 4L74A 3TFQA 3WGGA 1GD1O 1ISGA 2EW2A 2GGSA 3GGOA 3U4DA 5CDYA 3F5SA 4R1NA 1I01A 1NBOA 4OQZA 1CIVA 4ALJA 1WWKA 4ZHSA 4WCFC 4XGKA
chains in the Genus database with same CATH superfamily
1P74A 2JFUA 2Q0XA 4MVCA 4O4LF 4XB2A 2WIFA 2P2SA 1QGYA 3LCVB 3C39A 3PNSA 2VDPB 4Y0VA 4YMTA 3BRWA 2ODEA 3PHIA 2MSWA 1B23P 1CQWA 2PL9A 2H1WA 1P2GA 1J97A 4KGDA 1TEZA 1S4QA 4Y9UA 4I1UA 4R54A 1JR3D 2VSNA 2WIKA 4XR9A 4RA6A 1RAAA 4UFOA 6YASA 3M6XA 3DJFA 1F9EA 1PEAA 3A1WA 4IH4A 5B58C 1XXHB 1TKRA 1N25A 1R0ZA 1EG7A 1SC9A 2C3PA 2HCRA 1FUKA 2ONYA 2I7XA 2YHBA 2XDYA 3UO8B 4AKGA 3ESAA 5D00A 2C31A 3HFJA 3II6X 2OZVA 4EGFA 1X7DA 2E18A 4LI0A 5LMUB 2QXYA 2ZIGA 3QM1A 2JI8A 4V3BA 1A0OA 1XF9A 2DBVO 1LZLA 1W59A 3FNGA 4MTLA 4QVIA 4BGVA 1R6TA 3WO0A 1CYDA 3WLAA 4GSLA 2FX3A 4WXRA 2L18A 4OUDA 3IALA 1KZ1A 3Q6IA 1T9ZA 3T54A 3WSVA 1YB4A 3HXOA 1M6YA 4OYLA 3RYCA 4GW3A 4M8LA 4MHTA 3BCHA 2ZI6A 4XPIA 3ZJYA 3WL8A 5L3SB 3EIXA 2PBZA 3WXBA 1N1DA 4Q66C 1WBJB 4R4JA 5FL7D 3HXLA 2NP6A 2BCEA 1EHIA 1S2LA 2TMYA 2LBPA 1MXHA 1PNVA 1ZMRA 3MAJA 2B8EA 4HSGA 3L7MA 4CHGA 1GRRA 3ZE8A 2EXXA 2X14A 1VPVA 4JXJA 1DC3A 2IQIA 3W34A 1ZCBA 5IBRA 1F6DA 3N07A 3RRMA 3BA1A 3D5TA 1XYYA 3FTNA 5CHEA 4TV8F 1TPZA 5HKKD 3A6JA 1ZGCA 2A94A 3MPUA 3OIFA 3T3NA 3B6MA 2O5CA 4ARCA 1Z8FA 4YV7A 3NOXA 4B81A 2HWXA 2C9ZA 3P0JA 1K9VF 5BV8A 4Q48A 2FQQA 2D1TA 1QHFA 5HP4A 2Q3EA 1ORRA 1PGJA 3JARA 3HYRA 1J7KA 2X1MA 4PNEA 1C4XA 1X74A 4FSHA 1IG3A 1W94A 2C9DA 2JK0A 2SECE 2YY5A 3UWOA 4IDNA 3WYDA 1LPMA 2JA1A 2W2XA 3M6MD 4QSHA 3ZDYB 1NVFA 1XNRB 3IIMA 3IUJA 3O47A 4HRXA 4UQOA 2HZBA 2ST1A 2WWXA 3D6AA 4ZXPA 5DX1A 1MPTA 1G21A 4MV8A 3EZ9A 4G9GA 4J0KA 2BFOA 5E38A 1UXHA 1U9IA 2O23A 1UDWA 4UNRA 3DMPA 5LYJF 4FI3F 1SPXA 3IH5A 2YJ6A 5FNZA 5TEVA 2JBHA 2OHIA 4W4TA 3T4PA 4ZYLA 5B2EA 4BB6A 4QAJA 3RIYA 2POQX 4Q9AA 3K9CA 1XEXB 2GD1O 2GYWA 4C4SA 2VZ8A 4LK3A 2OAEA 2MIIA 3AUAA 4JR2A 4HYEA 1AKVA 1E92A 1MRSA 3P9QA 2EF1A 2ZE8A 2GBFA 4BGIA 1YKSA 7ADHA 5KYWA 3OA0A 1V2GA 5KPJA 5K2MA 1NKVA 2Q7XA 4NMXB 4R7TA 2C2HA 4HADA 4CZ2A 3I72A 1KK2A 3DV2A 5LD2B 1UF9A 4EW1A 1IJBA 2P9YA 1N7IA 4B3DA 3ON5A 2M6SA 4YRJA 1KZ7B 2LUOA 1NXWA 3GEDA 1RHJA 2RHJA 3L6CA 3DEJA 2BGGA 2JGNA 3N86A 3PL5A 2CUKA 2OBXA 4RAOA 4N6OA 1M33A 4WMLA 4F97A 5I51A 2IOQA 3VO8A 5F3WB 4X8HA 4UMVA 1WUTA 4G8CA 4QUDA 2AFHB 5KKNB 3SYTA 3TBFA 4H7KA 5D87A 4YRBA 1ZH0A 2WVAA 3HA3A 3AF1A 4YJGB 2BH9A 3NANA 4JN6B 1JVNA 1VP3A 5DF1A 2ACVA 5AVOA 2Y1OA 2MU1A 1BJRE 1GR0A 2CLDX 3C3AA 4KQFA 2CYCA 3SFZA 2HMTA 4RHEA 3OE7A 1P8JA 2PKRA 4LKRA 1JSLA 3ZV7A 3IS3A 1R37A 3H5LA 3O4VA 2PAFA 3U44B 3Q10A 2R4TA 1HY3A 4C0WA 3DTVD 4CG0A 4O4JF 1GP2A 4L9WA 3AUJB 3WRXC 1PI3A 3K0EA 3EEIA 3ONEA 4LGVA 1IY0A 4JJAA 1ADCA 4EB6B 3F5DA 2I5PO 4XI9A 5E7QA 3TF5A 1LKZA 1UODA 1MEOA 1K89A 3DVAB 3VSEA 3R9XA 1A4XA 3UATA 3LHIA 3UK2A 4TKVB 5HQJA 1JKXA 1DG1G 1HF3A 2XITA 3SEFA 1FF9A 1KK0A 5LXTF 3THRA 2LKCA 1FFBA 4Z1MA 3ACBA 5GPBA 3FRJA 3CLVA 5I9SA 5CFQA 2QENA 5LNK1 2M6RA 5GV8A 3I6QA 1SBNE 3DZJA 3I5UA 4BVLA 1I94B 1QU2A 4D9BA 3DUWA 1DKUA 2XJ4A 4GX0A 1GILA 3C3YA 4NJEB 2XTZA 4YVFA 4ETIA 2TECE 3HU1A 4R1QA 4ZKDA 3O8NA 1Z16A 5A3VA 1O0SA 3YASA 3IUMA 4YRRA 5LJIA 5IT5A 1W36C 1C81A 3P1JA 1B0UA 2A5FA 4GXQA 5IT0A 1VSTA 2ZDHA 4K6KA 2Z6AA 2WD7B 3DNFA 1VKNA 4OJMX 4U3JB 4JL5A 4WNCA 1P1JA 2AJTA 2C8JA 5KOYA 3MK31 1E7SA 1SXJB 4YONB 5LA6B 1V37A 4AY4A 1D3AA 1YGPA 4BNGA 3KQUA 1E2BA 1LJLA 1IDOA 5KWIA 3CZQA 3BXEA 4WADA 1S3FA 1KFCB 3VKUA 4ECEA 4WERA 2YMQA 2PUWA 3FSGD 3LDHA 4ETNA 3PI6A 4NCJA 1REQA 2WOJA 1T9CA 2FZGA 2FE1A 5G3ZA 3TQTA 2WDZA 3IO3A 3P2OA 1BE1A 1Z8DA 1RXEA 3A25A 4FXOA 5EIBD 5EJMA 2O7SA 4P5PA 1RWQA 3CEPB 3G7UA 2FPMA 2ZJAA 4G0OA 4HLUC 3S27A 3HVUA 3T3PB 2BD0A 4C7XA 3BS4A 1CZHA 5HCUA 1U8TA 3OPVA 4XGRA 4AP9A 1FVFA 3ASZA 4QU5A 4CM1A 4KQKA 5BWCA 1YWGO 2DT5A 1LVGA 1MIOB 3GFSA 3KTFA 1K7SN 3FGOA 1D5WA 2BMFA 1LC0A 3VR6A 5A5EA 3NW9A 2G5CA 3CIFA 1ZWKA 1ML3A 3DSRA 4D4GA 1JG7A 1R0WA 2YC2C 5JJBA 1QR6A 3OPYA 3D3NA 2X4IA 2OLEA 4PNHA 5ICGA 1Z75A 1SQGA 2H4FA 4BDSA 3KKPA 2ZZMA 4POAA 4ID3A 2WM3A 4YRIA 1PZGA 4N3NA 1XZIA 1GPH1 2E4AA 3JASB 3K7EA 4R9UC 4HDMB 3SX0A 1DXQA 3QU4A 3R9WA 5SZKB 3M6FA 3Q3VA 2LDXA 2JLYA 2RAUA 2QYHA 3WBKA 2Y1FA 1USWA 2HD4A 3MAGA 2PX8A 2QAGC 2Y71A 4EEZA 4CEIB 4EDHA 1CDZA 2JAXA 2OBFA 2XXBA 2ZUVA 1JMYA 4RYDA 5LLDA 2E4WA 4UNIA 1M1YB 3T3MB 1AO0A 1WDKA 4OSPA 2ZW9A 1T5HX 1KYVA 2C03A 1R16A 3KFLA 3UG6A 2ISQA 3TSCA 2I7CA 4EENA 3QQPA 1EQAA 5I9MA 2DJIA 1NTOA 3UAXA 4PTLA 1WD7A 4IRUB 1B1AA 1GN8A 2D0OB 3N76A 3PA8A 4PS0A 4RF4A 3RHTA 2GJ4A 3QE2A 1N6PA 2O0HA 4CTOA 2O2EA 3FKSD 4PSAA 3MUNA 2BSAA 5F1OA 5DWDA 4QAQA 4ZHQB 1X38A 1C8KA 5C32A 2FFQA 2OCDA 1BW9A 5B2ZA 1Y81A 5ILGA 3WLIA 1I6MA 4BJ1A 5A2GA 1MABA 1DV1A 1V41E 3NHYA 1H4SA 2QVXX 4HQRA 1OY1A 1NG1A 1Y4AE 3ELBA 2QD5A 1XNQB 3OOEA 2G88A 3TE7A 2BGUA 3PVZA 2ZTHA 1AG9A 4ZEXA 3O4FA 5CT5A 4L1KA 4MVJA 4DYDA 1D07A 4I55A 4PQYA 3QOWA 3TZHA 2MDTA 1JKJA 2J7PA 4FEAA 1RTTA 3EPJA 2O0MA 3TPCA 3C5HA 1IN8A 1J0DA 1N6KA 5ER6A 1IHYA 1HZZA 3E3LA 3TUZC 2AN9A 5DIFA 1FVOA 3G88A 1QRRA 2LKDA 5ADWA 2YN4A 4DLAA 4UPDA 3ASUA 3PGXA 4RMJA 3MXTA 1OFIA 1FJ2A 3Q2OA 4GPD1 3ZLUA 2BKAA 2AFVA 1DBQA 1FDRA 3AHJA 4JIMA 2CE2X 3T1NA 3NVMB 2AKYA 4A6XA 2WTNA 1ZOLA 2VHZA 5DNCA 5H81A 5AKZA 3KJEA 1RW4A 3GARA 1SK9A 5F5LA 2WAYA 2XZDA 1N5KA 3D8TA 4K8OA 4BO9A 4PAQA 4B2PA 3N3AC 4HH0A 1CF9A 3PWZA 4FFWA 1SD1A 4RF3A 2G7ZA 1PFVA 2L2QA 4Q47A 5CPBA 3T9FA 1CUXA 4DY6A 3NASA 5BSHA 5FOQA 1JEQA 4PLPA 4ND1A 2WJHA 4F8YA 4O4HF 4C76A 2E82A 4EKYA 3MD0A 2P5TB 1JEYA 1NLFA 1V7ZA 2JGDB 2ZSJA 4M87A 3BQMB 5T4FA 3KB1A 3EZNA 4KOEC 3T7JA 3QU5A 3WI7A 5ELMA 4KO8A 4LWOA 4MVJG 4MDEA 4KMMA 1LWNA 3PQ8A 4E70A 1CB7A 3EFOB 5CX4A 5GONF 2VDUE 1SUEA 5B3AA 3FPFA 4Q05A 4ZT3A 3FMPB 3QYAA 1NQOA 1TQ2A 2XRYA 4HQFA 2DLDA 2XGJA 1TZKA 2QRQA 2I1QA 1N2CE 3A6GA 3P0IA 5AMXA 1TCAA 4KPFC 2UUAB 4PHCA 1JWAB 3WOHA 2B7BA 1RXWA 2G07A 1KDOA 5FBLB 2FZWA 2RGUA 1RYMA 5K0SA 3ZCTA 4BKRA 3GNSA 5IM4F 3ZQUA 3GV0A 3ZOZA 2BRUA 3R7NA 1V47A 1UDBA 1XNGA 4B3XA 4AJ1A 3KX2A 5CR9A 4S04A 1JPVA 2OENG 5FBWB 2C8KA 1YO6A 5BMVA 1V4VA 3SS7X 5IUNC 4URFA 4UCWA 3SLKA 4J7UA 3JPYA 3DV9A 1N5IA 1M5UA 3SM3A 3LLSA 3K9GA 1LS6A 5CFPA 1GXSA 3GLHE 1N5OX 1XMJA 1V3TA 2FEPA 4WINA 3TCKA 5EY5B 3KDAA 4KN5A 3BJIC 2BEVA 3VPFA 3CNLA 3NJRA 4PEVA 1FRQA 1OXVA 1NMEA 3UTDA 1IK6A 2XA1A 8GPBA 2PGOA 2CLEB 1EYZA 1XU7A 3U7HB 3V80A 2HKIA 3FZNA 5HQTA 1CEQA 1WPGA 2VZLA 5DLDA 5CD9A 5KB3A 1F0KA 2GCIA 1E2IA 2HMVA 1SRRA 4Z4CA 1M2OA 3KEMA 2PZAA 2QX7A 3GJQA 5LZ9A 3PXXA 1NXOA 1FJHA 1OLUA 4AXXA 4IIDA 2QI9F 2I8LA 1IPFA 3B8EA 3GYBA 2IYUA 2GLUA 4MPRA 4MW5A 2V4UA 3SKVA 3WDKA 3V8EA 5JDCC 3W5DA 1OJ7A 2J5BA 1X7ZA 3F46A 4WFKA 2I55A 3SXJA 5HSGA 1W85B 1UR5A 1L7VC 4OATA 3L1VA 3V46A 2CHQA 4LSWA 5KJ6A 1H0SA 5D7NA 2XAAA 3HNPA 4RDIA 5F73A 1H9BA 1M76A 2BISA 2V6IA 3HXQA 3OJXA 5DHPA 3VBCA 3GVCA 4NXMB 1K4YA 1NZDA 1FFHA 2CB0A 2B1RA 3WGJA 4MB6A 4F4FA 2C98A 2WSIA 5D3QA 5JQGF 3TUJC 2Y67A 1E5LA 1HFWA 3CGGA 4B73A 3FCSB 1K88A 1P4SA 3KCNA 4J75A 4MW1A 4W1PA 5JNVA 1X8LA 3F6BX 3HHEA 1TVKA 2HHHB 3LD9A 3WGKA 4QPCA 4E2WA 1MHPA 4L28A 1OWLA 1JNYA 2J08A 3GA5A 3OM1A 3FRIA 5T6MA 5DYIA 3ZC3A 1IHXA 2AI2A 3R3VA 2NZXA 1EBFA 3KUCA 4U1RA 1OLXA 3CUYA 3L05A 4B47A 2HQ1A 1JECA 2BN4A 4RLSA 4UQPA 4CQLA 5M04A 1M2WA 1FQWA 2TMKA 3ADOA 3UHJA 1NKTA 2ATIA 4EEXA 2LZ0A 1IEVA 4AMUA 1RMTA 4BQPA 1WOYA 3JAKB 3BB4A 3D7RA 4NU0A 3Q9LA 4Y8VA 1VA4A 3E8MA 1Z2AA 4W5WA 3I9V6 3R5SA 5IDYA 3LMKA 1JHYA 1C3OB 1UMCA 2P1DA 4J8PA 2BBSA 3IMKA 1P91A 2P9JA 4UD6A 1KDVA 1J09A 3RIXA 2IC5A 1EJ0A 3UAZA 4BO5A 1SK8A 5HCIA 1N36B 1NRJB 3DAGA 4D42A 4KHZA 2OZLB 4H3HB 2CNNA 2O2IA 3VZCA 1XDDA 4RKEA 1BC5A 4P33A 3ECCA 1T9HA 4IX9A 1ZKDA 5AI0A 4BB9A 5H02A 1XO1A 3JZFA 2FSIA 2ZRQA 4OFZA 4D98A 1QTQA 1PTKA 3CXUA 3UMCA 3EXAA 5ICFA 3IE2A 3ZWCA 5EUQB 4UCFA 3RSGA 5BQXA 1IIRA 4XDZA 2NUPB 1GTRA 5AO9A 4D26A 4GHWA 3V8MA 3OF2A 1C0LA 4ZP1A 3JQDA 5DNDA 1CBUA 3ZXXA 4D8YA 3EDOA 4QRHA 1P7PA 1NC1A 2H1CA 1A1VA 1WY7A 4LZPA 2QVZX 3RWBA 5IP5A 5SYMA 3H9UA 2C7RA 2CY0A 3LKZA 1ONPA 3L01A 4NU5A 1H3NA 3OU7A 4GEKA 2UVPB 2FP4A 4L4XA 5F12A 2XYHA 2AN3A 1A9XA 4B0PA 2KSQA 5D5PA 4B5LA 4FILA 4DA9A 1SVUA 3ZE9A 4U6SA 3V3TA 2F8LA 4RY2A 2CDAA 2I3DA 2IOFK 1Q11A 2B78A 2H9YA 4MW2A 1QO7A 2WG2A 4BLOA 1Z74A 2NZ2A 4R8VA 1U7WA 2HB6A 2P9HA 5D6OA 3PXCX 1ZN9A 3N2GA 3K8OE 1XRLA 1C3VA 4Q4HB 3P20A 5E4YA 1JHZA 2WPDA 4BUZA 1U3UA 3RNLA 1GGMA 4FKMA 3C3XA 4A0GA 4L8YA 4B75A 2CNWD 4ZCQA 2B0CA 2ZRLA 1ULBA 3EASA 1J2UA 2AD5A 4J43A 4MWEA 3KL4A 1JQLB 1TW2A 3NVAA 5I4CA 1YZKA 4UHEA 4LX0A 3QLUC 2B1GA 4YMLA 5T8KA 1G9XA 4EQ6B 1JN0A 4NS1A 1CD5A 1N2GA 2I78A 2QPAA 1RYZA 3U49A 3UHPA 3OPXA 3NWBA 4E13A 3UAWA 1NBME 4Y7DA 4NK4A 1XMXA 1KJIA 2EKZA 1DX9A 3G1TA 1T36A 2IYQA 4RH0A 3WL7A 1R4NB 4ZMSA 3KT8A 1H2AS 2P27A 1GUYA 2AUNA 2VVTA 2RBEA 4BECA 2ZUWA 3M33A 4ABTA 3KSRA 3QX8A 2FETA 3I2HA 1KI6A 3OH8A 3O4IA 3TRFA 1IG0A 4EG8A 7MDHA 4JELA 4N0QA 4TTPA 3I52A 4B83A 5JLJA 3GF4A 1AX9A 2W6JA 4MQLA 4HLCA 4RQTA 3EBPA 3VH2A 4CKCB 5J5CA 2OESA 2NZWA 2QG9A 1V35A 3AB7A 5D51S 5KNDA 3PZRA 2QD2A 1C2TA 4EYSA 2ODWA 3WOVA 3ZU6A 5GADl 2HX1A 1SKBA 1SCAA 2ZBEA 3OZIA 4UZEA 2P2DA 5KYYA 3ZBTA 3V8NA 1SKMA 4YJHB 3CPJB 3G9XA 4N4AA 4CLRB 1U1GA 1OBFO 2AOTB 2EX0A 3L18A 4XX0A 1VYUA 2CNBA 4BNHA 2Z9BA 5JH7F 3QA3E 3F6YA 3MBOA 1QYVA 3GT7A 1JEDA 4MCJA 3ETHA 1OAAA 1H2FA 2QNRA 1NKSA 1OT5A 1K8XB 3MWDB 4PG8A 2FG5A 5KTOA 1SOMA 13PKA 3T1VA 4JZYA 4KPEC 4BNYA 4XJVA 4RJIA 4BRSA 1JPNA 5A4FS 4EF6A 2JFXA 1V16B 3THXB 2ZREA 4PYNA 3U26A 1Y34E 2VUTA 1E7QA 2HCBA 4M9RA 4LYHA 5DOZA 3HB4X 1BDBA 5E7IA 4D44A 2IYXA 3IQXA 4DL9A 2P9ZA 4LYJA 3UHFA 4IXTA 4DC9A 4O8ZA 1XVTA 4HQ0A 3DB2A 4KGVA 3DXZA 4BNZA 1EX6A 3GFQA 1GPKA 4H7DA 3OHSX 3PNOA 1UXGA 4OA5A 4OMFG 3I2KA 4DXDA 2BHTA 3EXEB 2JFHA 1QG6A 1ZI9A 3M6IA 4URVR 1EMDA 5CK4A 1FUUA 2NSHA 3BGVA 1SR8A 3L0DA 1H94A 3ED1A 2RHMA 2IODA 4CI0B 1QHSA 3N2ZB 2P6RA 1EESA 1SVKA 5AKLA 4D9GA 3EULA 1WUYA 3M81A 4L78A 1YA6A 4Q3CA 5JNUA 1GPMA 4YJ2F 2B61A 3OQ6A 5K9ZA 3KKEA 3N6XA 1PUIA 2IUUA 3GDOA 4BQSA 4MYSA 1YJ5A 3JQEA 4W5QA 4Q3EA 4E94A 4MRAA 2I65A 5K20A 2ZROA 1DIBA 1NUSA 3L0CA 4Q4JA 1AK1A 4LZOA 4C22A 1EFUA 2JFVA 4X1OA 3K30A 1GV0A 2R8YA 2VPQA 1PGQA 2GNAA 2VUSA 4U9HS 1QBKC 4BZXA 3HB0A 1UZAA 1J70A 2YR0A 3PITA 3UKJA 2BEKA 2TSYB 3K2EA 5JRDS 5DM2A 4XA8A 2MINB 3K20A 4MGYR 5JI3E 4B4DA 2R8PA 3D59A 3JQFC 1GPAA 1TQHA 4RGBA 4ZRMA 2JKZA 3RODA 5J5AA 3UW3A 4CU2A 2CUTA 2PLFA 3H86A 3CWCA 4PSDA 2QPLA 5JAMA 1WUJS 4H9GA 5AKGA 3O31A 3HEBA 1CC1S 3IEXA 4ISBA 1J5EB 5HXAA 3ABOB 1D2NA 1EIZA 1MJGA 1T4BA 3IODA 5EP4A 4XJTA 4U2GA 5FTLA 3GD5A 1L1EA 4RWZA 2G9NA 4F3KA 3VYRB 3S8EA 4CL3A 4GMFA 1E3SA 1F38A 5DRTA 1RYBA 3CLUC 1U0RA 5BSMA 3K09C 3E22A 4LTMA 1X1EA 2GK7A 3HACA 4YS6A 2ONKA 3MA0A 1WDLA 3R09A 1US8B 4WGGA 4JLAA 5GONB 2ZWVA 4XIJA 5LCXA 3G3EA 1PF7E 3G68A 3LBFA 1YT5A 1T3GA 4IICA 3BIJA 4CCWA 1ZGBA 3WYCA 4EKNB 2W0SA 2NUAB 4Y6PA 1VBNA 2R1ZA 3F3MA 2ZRBA 2JFOA 5BMOA 4ACAA 4DLWA 2GQ0A 5BYAA 4MI9A 3EF1A 5IS2A 3S29A 4ETMA 2NZJA 3P26A 4BO2A 1BRTA 3LYAA 3PSAA 3M4XA 2H59A 3C70A 3OF5A 4QGBA 2HGZA 5DM70 1IHOA 4U5XA 5H9WA 4OHBA 1SIOA 2WNHA 4TWZA 4HAXA 3SYNA 1SQ6A 3D0RA 3NM5A 1XQXA 3REOA 3OJLA 1Q0UA 1VZ3A 4KE6A 1J0EA 1OROA 2HIGA 2VAXA 4KNYA 1Z9BA 3Q3HA 5GM2A 1ZU5A 1CQJA 2JFYA 1YRHA 2QM8A 3NFYA 4G0UA 4MI6A 4DNOA 2Z5GA 1E7RA 1ZD8A 2VH1A 4QJIA 1DWPA 3DDNA 4HFJA 2YZKA 1N6NA 3MT8A 5IC5A 5AK5A 3UJ6A 2PE5A 2JKYA 1GLGA 10MHA 5HA5A 3ETGA 1SUBA 3QH4A 1CZNA 1CP2A 2B4RO 2GCPA 3CKKA 2JATA 1F2TA 3I2GA 1XLWA 3REFA 4Z4HA 1GA4A 2O19A 3QMPA 4EUSA 1G1AA 1CDOA 4B4OA 1P9LA 4WDRA 2D7DA 5KTNA 4YLYA 3VKWA 2A1UA 1X1CA 3GVHA 4A91A 3EOAI 4TMYA 3NV7A 3WFIA 6GPBA 4HDSB 3E03A 2QT9A 3B3QA 3BF7A 2XWSA 3H5WA 4B2IA 5JWHA 2IWHA 5E9JA 3ORSA 1GKIA 2NU8A 1O6FA 1X7GA 2DBYA 3MWJA 3VVMA 2CHEA 4DA7A 4WN9B 4I4LA 3U2QA 1DDGA 1OH6A 3ZWXA 1EXDA 1MB4A 1N1MA 4R6WA 3VC3A 2YVAA 4EATA 3NONA 4OL0A 4RTRA 1M1XB 4JI7B 1Z0AA 2IA5A 4I9UA 4LYFA 1GKKA 1MRNA 2NQTA 2QEQA 2DGDA 4K9QA 4PX5A 3UMVA 2A0UA 2V8BA 1M1NA 2FE4A 3FF1A 1DQYA 2HK7A 3P2EA 5CLLA 5E9AA 3D3JA 4YV0A 5JNTA 1B42A 1II9A 4U7DA 1G2IA 4LDRA 2VDQB 4RTPA 5BR4A 1DIAA 3FVRA 2P6NA 4X20B 1MC5A 3SCZA 2FEAA 1MPXA 1O1YA 1PP4A 1UKAA 2X5NA 3IVMA 1MAAA 4FQ8A 3V8VA 4ZJYA 1JAZA 9ATCA 1SXQA 2AW3A 2AUMA 2RFLA 1IPHA 3H11B 5BWBA 1KTVA 1C30B 4CT4B 1KKLA 2YX1A 4ETWA 3Q9NA 1TADA 1DP4A 4CM8B 2JL1A 5BR1A 5CJPA 2UYCA 3QEMB 4AWBA 3ULKA 3NDIA 2Z3VA 4FC6A 4JIGA 5I8ZA 3RABA 1TYEB 2OAP1 5TRTA 5K0CA 4PNPA 4CL2A 5IPFA 2UZ1B 1RCFA 1CS4C 4FDTA 4G5YA 2HMSA 5K01A 3ZNQA 3I9JA 1KP2A 3FYHA 4CEHB 4L3VA 2A3NA 4Y7CA 3G9QA 3FOFC 2FW1A 4GG1A 3EB9A 4DCOA 3I3SR 5FR2A 4CR6A 1I0IA 1YDEA 2C4NA 1USIA 2I7VA 4MS1B 4EW3A 1B4DA 2OP1A 2DUWA 1HE8B 3IPXA 4YV1A 3WAGA 3EG9A 3EXHB 1UXJA 3NIGB 3VV3A 2Q41A 4MKFA 2CNLA 3HVIA 1JJFA 3FFTA 4M46A 4BNUA 3PQ3A 3T9EA 2IK8A 5KNCA 3IVGA 1CZRA 1DO2A 2OM2A 5AUQA 4V0RA 5JXIA 1NUQA 1SOAA 1U5CA 1VGVA 4FYJA 3BPSA 2JIRA 2IL1A 1QB8A 2NTJA 4TLCA 1V43A 2H07A 1IOLA 2IY7A 2Y93A 4KU4A 1EUDB 3T3IA 3E7XA 1T0IA 4KRXA 1T43A 1RWBA 4JEUA 2VHJA 1CPYA 2W2KB 1FMTA 3KJHA 2EZUA 2ZEJA 3AI1A 2QP4A 4PS1A 5CCXA 5JV5A 3L07A 3MLAA 4D0RA 3VNUA 1BMFA 2HFJA 1M2GA 2F67A 3N58A 4LZNA 4R1TA 2ZVQX 2WM2A 2GJ9A 2E5LB 2V4MA 3PYXA 4ZEMA 5EIXA 1S01A 3PIIA 2OCYC 3ECSA 3FNBA 3P9KA 2TMGA 4IIGA 4QBGB 4YCLA 3AM3A 5LNK6 3RYHA 1PZEA 4X1YA 3HY3A 4IO0A 3G7SA 1ESNA 4NXNB 5AXCA 1HLPA 1KY4A 3BMOB 1Z4NA 2AV6A 4KI7A 3G79A 3UBMA 5ALGA 5EWLA 3MUFA 1W0JA 1TLTA 1ZH4A 2ZR8A 4OP2A 4ZVUA 3HYNA 5IKXA 4EG4A 2FFBA 2PLAA 4N5MA 4P32A 5J2TF 3TJMA 3F6RA 3HWWA 3GRUA 3UQYS 4J0EA 4AY3A 4M88A 1A9SA 1L3IA 2ORIA 3BKXA 3UT6A 1H8HA 4EGQA 3I28A 1JA0A 1JX6A 1CDEA 3IQEA 1N0WA 3IDOA 4ND6A 4F9GA 2R6CA 4Z4QA 3WISA 3DHYA 4IILA 1G0NA 1M6VB 1QHNA 4B8ZA 1Z8HA 1ZPDA 2YBEA 2P69A 1H0RA 3H17A 2ZS7A 4CM3A 1ONSA 1I4LD 3TGWA 3BFPA 1F8YA 3W2TA 4MITA 3AQ4A 3P0FA 1BVRA 2J32A 1L5MA 2F3UA 2VFAA 3AFOA 4MMZB 2QV0A 1T5IA 2LV8A 2GZSA 2O48X 4O0MA 4QDTA 3CNEA 3INGA 4F5EA 2J3JA 1NF2A 1JMVA 3BMNB 3I9KA 3KRTA 4HAZA 4LJ6A 1QM5A 4EB8A 3A1FA 5IF9A 2RB5A 4XM0A 3L0YA 4K6HA 3JVIA 1DC8A 1B73A 1T1SA 2OXFA 3K70B 2NO1A 3H2KA 1EVIA 1XR3A 5KVCA 4LJ9A 4ARBA 3AEKA 1EUCA 3DPUA 1HTBA 3OTQA 1KZ9A 4QGSA 2BEUB 2C82A 4R2KA 1CFZA 2CXNA 2WTEA 3H4MA 5DLYA 3GGCA 3C5VA 3PRHA 4M0LA 5EKSA 1ZUNB 3C41J 3LPCA 5B7QA 2UUCB 1M73E 1UWCA 1ID1A 2AXQA 2HRZA 2XMZA 3CH4B 4UEOA 4C87A 1G5RA 1E20A 2BP7A 1COWD 4O2BA 5BRJA 3NTOA 5ITWA 1RM0A 2NPIA 3VNBA 2VTBA 3CUSA 2VTEA 1XZHA 3RYFB 2ZM6B 2QB5A 2A5YB 4HNAA 3WIUA 4C9BA 3FCEA 1R0YA 3ZI4A 2EL7A 4E1VA 1AV7A 2XCIA 4GNKA 4S2EA 3UUEA 4OSOA 1SBIA 1Z5UA 2WYUA 3CNBA 4KXNA 2C7OA 3OM9A 1DS6A 1EE1A 2ZP1A 3E3MA 3EIQA 3LC7O 1VM6A 2P1ZA 4FNOA 3OE5A 1J7JA 3O4JA 3TXYA 3U40A 4N12A 3ZDAA 1DFHA 4AZSA 4Y1FA 1ABBA 3UM9A 4RZIA 3ZU2A 1MDBA 2HSGA 3SIRA 3HABA 2JVJA 1PSDA 5KKCA 1ZD5A 2XXJA 3JQAD 5DGDA 3U4QA 3SOZA 3TQSA 5JCXA 1FSGA 2IZZA 5KTTA 1YHYA 2GN2A 1O0BA 4NCNA 4PFSA 4PZUA 4GLLA 1KU6A 1TEXA 1U2GA 2LPMA 2Y3IA 3EOBI 4I8DA 4D6YA 4I1VA 4GC5A 3GUVA 1EJ6A 4UBMA 3SK0A 1W5BA 2FZEA 3DUFA 4GZ6A 4FBGA 1ST2A 2RK6A 5AHWA 3SZ3A 3OMXA 1LF5A 2JCVA 1QVRA 1M34A 1PVVA 4EB3A 1HR0B 3JWEA 2BF7A 4ENRA 1KL7A 1R50A 1CLEA 4V24A 1IUNA 2W4MA 4DDHA 4EAQA 3E5NA 4UBKA 3NM4A 3IMFA 2E1RA 3Q1KA 1NVMB 1ONOA 2VS1A 2AUTA 2XHEA 4K9OA 1X7HA 1ZH8A 4MIYA 4W5HA 4LF7B 1PLJA 3WWZA 4R1UA 4NEQA 1XTZA 4DSNA 4M1OA 1EE9A 1H3FA 3DVLA 2HWKA 3FWHA 4LE0A 4QFDA 1EK2A 4JSYA 1Z6AA 3QKSA 3MFYA 2CDNA 5CYOA 5FTJA 3EQ7A 5CFRA 1NI4A 3CX4A 1C4KA 1TA4A 2BKUA 3R7DA 3GDGA 4NATA 1QAMA 2AHOA 2JEOA 1W8IA 2ZQZA 3PFKA 4TXMA 4BFXA 3CZAA 1JHRA 1HL3A 1K7EB 3L3BA 2Z5FA 4XFJA 1W5FA 2WR8A 1WF3A 4RK6A 2BTQB 1NXSA 1A4IA 2ZUBA 5TQ2A 1T9KA 5A9RA 3AM1A 5KX5F 4GX5A 1C4OA 2GR9A 3DBHA 4PVDA 1HEYA 4XSHA 1QS0B 4RZUA 1ECGA 2OYRA 3WSTA 4C4RA 1U8UA 2YHSA 3RSZA 4TN1A 3HJUA 3ID6C 4ILEA 1SXJD 4DMRA 1RQLA 2EJTA 2E5WA 3L7KA 4FZVA 1W2GA 4YRAA 1PFUA 2O8NA 2NN3C 2OFPA 3H7IA 1RI3A 4UE6A 3WNVA 4XOUA 2D5LA 4IDCA 4AW9A 3E8SA 3GLIA 4KI0A 2XZTA 3F71A 1UWVA 3G6KA 3IFSA 3PE6A 2BE9A 4TWBA 2C5LA 2Y1CA 1KF0A 5FUQA 3H5OA 2J5XA 4KWTA 3DOUA 1ZN7A 1OR8A 4M9UA 4UAUA 4MROA 4U2FA 4HDRA 5C4GB 4JFRA 3V32A 1LVUA 4J4BA 3AR8A 4ALMA 1D6NA 3ZDQA 3R3JA 4WCFB 3JQ6A 3I3OA 3TOXA 4CNQA 1P18A 2AVDA 1RR6A 2OB2A 2VNIA 1G5HA 1HEIA 2XDWA 1SWWA 1CE8B 4KXYA 4BMNA 3DMTA 1YJCA 2PEZA 3H5AA 2HBYA 5HIMA 4YUWA 1M2JA 2EHJA 3N8NA 3PWSA 3AF3A 1XDUA 3WGMA 3T5AA 4RH3A 4TUYB 2R1TA 5CIWA 1JQKA 4W9NC 4XM2A 3RK4A 2B2CA 2R751 1HUQA 3PNKA 4NP6A 1KSGA 4JQSA 4AMZA 3AI7A 3TN7A 1ZU4A 2C4MA 4HRVA 4ABYA 4AJ4A 5CYGA 3SMVA 2PN1A 3LQYA 1WB5A 5CXSA 1OI3A 5ICCA 3V7UA 2CJPA 3VPAA 1LQTA 3FDIA 2OBYA 3SJ7A 1G98A 2J85A 5FOTA 4P3NA 5DV9A 2IPNA 3GEBA 2R48A 1T4MA 2WAOA 3ZD9A 1KEWA 2P3LA 4JBYA 4RY0A 4E5MA 1J6UA 3HB7A 2GPAA 1F0YA 2G7MC 1IRIA 4V03A 5HEKA 2F8MA 5ALOA 5BYJA 2HUNA 4ZAYA 3NGMA 5THQA 3NNNA 2B1JA 1IK4A 2CXTA 3TTWA 5KSYA 1NE7A 1I7QB 2PUAA 4KH1A 2CLFB 1U2SA 4PRYA 2WTAA 3BWBA 3Q8LA 4OHMA 3Q12A 1D2EA 4PSVA 1G3QA 3L8FA 5LOVB 2O8CB 3AFHA 1GADO 4XTCS 1XMOB 3E5HA 4CFYA 1W88B 3AF4A 4ZPXA 2A9OA 4LXIA 2GI4A 4A6DA 1DUVG 1H2EA 3OFNA 3MWLA 2H4WA 4F71A 4GPTA 1UPAA 1VDZA 2C54A 4KLZA 4L73A 3U4CA 3OFVA 1WLSA 2FOIA 2XNCA 5K1ZA 1AZSC 1ZVKA 3TGPA 2OGWA 1T2CA 2RGWA 3VR2D 3WTCA 2EG5A 1A8IA 2X1HA 3C16C 4NFLA 2ZRJA 4ANFA 5IH7A 1V9SA 3FFWA 4GPAA 2XAUA 4RVNA 4R81A 1U9ZA 1GAQA 2J33A 4H17A 2DHDA 4I19A 3NHWA 4UUAA 1MVNA 3RTCA 1NIPA 3HJFA 2ZRKA 1KQFA 2X15A 1HORA 5F98A 3ZIDA 1F4VA 4E3ZA 1JFSA 3BGOS 3HNOA 2ZIZA 1SBYA 1ESEA 4C3VA 1YSCA 1PW7A 4Y6OA 4D25A 2MYUA 3TBHA 3QSYA 4GOJA 3BMCA 1JB9A 3DOOA 4WZAB 2Q9UA 5FNVF 2VTDA 2R1UA 2WWVD 3U7IA 4AY5A 2WWYA 1S7GA 2CXRA 5LU9A 3FDZB 5DYTA 3H2IA 4HDAA 4B17A 2GEUA 3N8DA 1H9AA 2DVMA 3EBOA 3QW2A 1PVDA 3ELUA 1MO5A 4FCTA 4CDGA 4BGUA 2ZYVX 1X13A 3W5JA 2C2OA 4AO8A 4DIKA 1Q19A 3SPXA 1V3VA 5FA6A 3PXBA 1XWWA 4RZQA 4TT3D 1VHJA 4Q9HA 1V8PA 4XW2A 5ALZA 3OIUA 3TMYA 4ZCTA 2VDNB 3FOBA 3H5IA 1ZR2A 1YR3A 1SIBE 2AF3C 2PR7A 2O3SA 1TT7A 4N54A 4IIJB 4FLMA 3S5UA 3TKLA 1V9CA 3S44A 3O2SB 5CXUA 4LOHA 2D4HA 2AQIA 4CTJA 1E62A 2F3RA 3CZ9A 2FMIA 2G3YA 2VEOA 4WTOA 4O1IA 3TTUA 2QGFA 4AJOA 3AG6A 2LWIA 2E48A 3BILA 4GVLA 4LVNA 4NE9A 1IQUA 1E5TA 4QXAA 5CHYA 1XL0A 4UNQA 1V8BA 4JLVA 2PRJA 1QKKA 1P0MA 2VT7A 5K0JA 5H8WA 1OYWA 1FOEB 1SBQA 2ZTSA 3JWPA 4G89A 4DLXA 1AY0A 2ZVPX 3K1JA 4GX2A 4PRLA 1P39A 2VYFA 1IY8A 4UE3S 1MJGM 4CV3A 5J4LA 1CY4A 1SC1A 2IUEA 3UOAB 1EWRA 1G4HA 1GUAA 3WLSA 4EHKA 1JA1A 1AZTA 3ZGOA 2VHEA 2Q4OA 3QF4A 2I4NA 1N2BA 4UU7A 4D92A 3HJAA 4WIAA 4KE7A 1WUHS 1YIAA 1YJBA 2EZ9A 4G84A 1J8FA 1NQUA 3D3KA 4KPUA 4PR3A 1OGJA 2FVYA 5I47A 1AKRA 3VDNB 2C59A 2CDBA 4P58A 2BOVA 3SFTA 3E58A 2O7NA 1VYHA 1NX6A 2I8AA 1QX3A 3LA6A 4FNGA 4HYQA 4ZOBA 3VNQA 4RZXA 1JR3A 4OAPA 1HE1C 2JHGA 4ZVKA 3LX6A 2X1VA 2I6QA 1OBOA 5CVUA 4IMJB 3SP1A 3R7WA 1OWPA 3JQQA 3OLQA 2ZUCA 3HJRA 4RVFA 1RIIA 2HU2A 2HO5A 5DDIP 4P4LA 2WMOB 5BSUA 3AL2A 1X92A 4RAQA 1GITA 5HVNA 4WAUA 4CM7A 5I3ZA 1R9NA 1R6DA 2PXXA 4MPJA 2C2GA 1FFAA 1FA9A 2O2ZA 4IUBS 3WB9A 2IYNA 2RGEA 5K8IA 5EVCA 3ZZNA 3EARA 4EA7A 4IXNA 5F1KA 3WL5A 3KPYA 1PS0A 2C2KA 4RPIA 3L1IA 3L6OO 2BUCA 1EG2A 5IM5A 1NWCA 3CLSC 4KZPA 3GAAA 5HQ3B 4IFBA 4PZDA 4K8RB 4P3PA 5ARCA 1D0IA 4H6XA 2IYFA 1S4MA 5FL7A 4TRJA 3DE2X 4BS9A 3RASA 3X1DA 1MO6A 1PN3A 4ER3A 2FR8A 2XDAA 5KNLA 3HCFA 1OV4A 1WKVA 4B3IA 1EI9A 3O3NB 5CT4A 5ETJA 1XX6A 3ZLBA 1I14A 1CRZA 2FPGA 3D7MA 2XCTB 1L5RA 4Z9YA 4PN3A 2ICAA 1G55A 3LGSA 1Y8QA 5SZJA 3OG9A 3KAQA 1NVVQ 3DF7A 2C57A 2R79A 4HY3A 2MYNA 1JG4A 4HDKB 5F7XA 1UM9B 4CCSA 1NZJA 1WBDA 5HKKA 1FYDA 4XIGS 4N9WA 2AN1A 3DBIA 4JVMA 2XYGA 3AHEA 4RDHA 4RZSA 1U5BB 1RMQA 2QLLA 2XUFA 3PFHA 1L3CA 3K9FC 3WLRA 1Q0PA 3Q8KA 1QVAA 3SS8A 2OD7A 4BIMA 1TU4A 1MD9A 3OQPA 3TQIA 3EMDA 5DTQA 3G0OA 1YQWA 3D6HA 1P2BA 3A