1PJ2A

Crystal structure of human mitochondrial nad(p)+-dependent malic enzyme in a pentary complex with natural substrate malate, cofactor nadh, mn++, and allosteric activator fumarate
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
553
structure length
553
Chain Sequence
b'IKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD-dependent malic enzyme, mitochondrial
publication title Crystal structures of substrate complexes of malic enzyme and insights into the catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 184
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pj2A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1pj2A01
1UZNA 3WNVA 4O6VA 4D3FA 8LDHA 4PLGA 4NFSA 1JVBA 3WGOA 4EUFA 3L9XA 4XB1A 4CLHA 3UFXA 1YBMA 5HTOA 4YAKA 3S2FA 5G0WA 1RWBA 3LT1A 4FSHA 1YH3A 4R41A 4WCFC 4URFA 4BO3A 1AGNA 3EZYA 3AK4A 4YXFA 1I36A 5A9TA 2XAAA 4NH4A 4IM7A 4AJHA 1Q0HA 4CUZA 2GERA 4E2YA 3KHUA 3TOXA 3S1LA 3LU1A 1D8AA 2ZB8A 3FCOA 3OA0A 4W99A 4AJOA 3D3WB 1QMGA 1K6IA 3Q11A 4DUPA 5KKAA 1YS4A 2HQ1A 4BKOA 1EVJA 2ILTA 5IFLA 1ZJYA 2D1YA 2WMDA 2IXBA 5CP8A 3TN7A 3VVBA 3G0OA 3LC7O 3OQ1A 2QQ5A 3LK7A 4E32A 1DJQA 1BTOA 2QG4A 4W6ZA 1UH5A 5K6AA 3KETA 2R2GA 4O63O 1HE4A 2NVBA 3CZRA 1GV1A 2JL1A 1PSDA 4RV9A 4BS9A 3NT4A 2ZKLA 3PDUA 2AEMA 2BMAA 1UP6A 4L9RA 2A4KA 2FPIA 4CQMA 4J4HA 3UF0A 2XF8A 3LC1O 4NI5A 2GN4A 2CVOA 2Y1DA 4MJLA 5U9CA 4DGSA 3B1JA 4BGEA 4J0EA 3JD2A 2FMUA 4B4UA 2V7PA 3LT2A 1F14A 3HHPA 1EVYA 3I4CA 4ZD6A 4RF4A 3W8DA 3VZPA 3UCXA 3MOIA 2XPCA 3A28A 3L4BC 2DC1A 3UCFA 5ICSA 2ZK7A 4AL4A 2Y1OA 1DO8A 4ILKA 4QTZA 3MJTA 3ASUA 4W82A 4DLLA 3S2IA 3OJLA 3JQGA 1GYQA 3WYEA 4H3VA 3F1KA 1PJSA 4RPKA 4MVJI 4EBFA 4HFMA 3MJVA 2ZCUA 3GOHA 3WFJA 1XHLA 3WIEA 1LDEA 1KIFA 3DONA 4KZPA 4YRBA 5THQA 4P8RA 2B5WA 2VZ8A 5H81A 1MX3A 2O2YA 4MP3A 2ZYDA 1C0KA 1M2WA 1PWXA 3H9UA 2X1HA 1AE1A 4CR8A 3PLNA 5G0TA 4LRTB 1Q0QA 3ROKA 4E13A 4RF3A 1DSSG 3WJ7A 4E0BA 3UCEA 1CRWG 3UGKA 2NTVA 1T2AA 3Q9NA 3SX2A 1LUAA 3L4SO 5GZ6A 1YVEI 2NACA 1Y8RB 4IUYA 1UDAA 1HWYA 4BV8A 1PJBA 2PD3A 4Q3AA 3E9NA 1B3RA 1NQTA 3C7AA 4AG3A 5B4TA 2E82A 4RJTA 3D3EA 1T26A 2WYWA 2RIRA 3MJCA 1ZKMA 4IDBA 3NTOA 3QWAA 1EK5A 3RUEA 4R68A 3NDJA 2C7VA 3TSCA 1ZEMA 4F45A 3ZV6A 5I7FA 2FWMX 1U28A 4I9NA 4DIBA 3DAFA 4BO0A 1PZGA 4BV9A 1KEPA 3WMXA 4WE3A 3I1JA 4WGGA 3ZI0A 1B2LA 1F12A 2CNBA 3ORFA 4IIUA 1YXMA 4EDFA 2POQX 2PZLA 4JBHA 3OEWA 3RIHA 2I99A 5JY1A 2X5JO 4MVJF 3CKYA 4UREA 3BMCA 1EFKA 3VH4A 4DYDA 2C2XA 4Z0HO 4LVCA 2BKAA 5KNLA 3OIGA 2X4GA 3BIOA 4D46A 3ZNPA 2AQHA 5G0VA 1UP7A 4J2OA 1XEAA 2ZYAA 1Z45A 4XWYA 4RCVA 4WOJA 2VYND 2O7QA 2DAPA 5FFFA 2EW2A 2V6GA 5AXCA 2DBQA 1OMOA 1ZK3A 3QSGA 2EWMA 3GA0A 2NTJA 2OZPA 4PZEA 6ADHA 4JQCA 3G1TA 3JQCA 1P77A 1WXDA 4IIVA 1Q7BA 4BMNA 3TZ6A 3MJSA 1A4IA 3TJRA 4NJOA 4GQAA 1YWGO 3FI9A 2GN9A 2G82A 3I83A 2HK9A 1O95A 2Y1CA 3AWDA 1VC2A 1P1HA 4GH5A 3IQDB 4DLBA 3H3JA 1WNTA 3EYWA 1PGPA 2FR0A 4JJGA 4WLVA 3ENKA 3T7EA 5L4LA 3D4OA 1R15A 3FBGA 4B4OA 5KVSA 2PKQP 4K1LA 4E31A 4KUEA 3ROMA 5L95A 1KBZA 1NWHA 5DP1A 1SCUA 3ETGA 3A1NA 3DHNA 1PJ4A 4XEHA 4GBJA 4KDFA 4IDFA 3QWFA 2G76A 3O38A 4RQTA 1DEHA 1J6UA 1V9LA 4YRAA 3JQ6A 2FSVA 5AOVA 2O4UX 4CODB 4YQZA 1BHSA 5A04A 3K2BA 4Q9NA 2VYVA 5L4NA 3BAZA 4QO7A 1NVTA 1XKQA 3U9LA 2BD0A 4FQ8A 4HWKA 1KVQA 3WR5A 1C0IA 4G5HA 5DDIP 1DHTA 3H2ZA 4L8VA 1D4FA 1DLJA 2Q99A 1SEPA 3KLPX 3ON5A 4OMUA 4YT4A 1BXGA 3ZGYA 4GGOA 1V8BA 4CLRA 2FOIA 4I1IA 4M49A 4RORA 4UEKA 1YOVA 1E1LA 1MA0A 3AY6A 3I9LA 3RC9A 5JO0A 1OC2A 4GAEA 4CM8A 1HDZA 4TROA 5I7EA 3V1UA 1CETA 2DM6A 1I3MA 2ZTUA 4K28A 5I8ZA 1U8FO 4MVJG 1RM3A 5CFZA 5TIIA 2H63A 2VZ9A 4IJVA 3O9ZA 4J6FA 1YQDA 1LBEA 2AA3A 4PLWA 4BO4A 1GTMA 1B26A 4A10A 1IOLA 2CF6A 3C1TA 4PLFA 2OMEA 3ANNA 1HYGA 3HG7A 5BNIA 2GDZA 3H5RA 4D42A 2CZCA 4CLOA 1IYZA 1GEEA 2EGGA 3A06A 4J3FA 1E7QA 3NYWA 1MXHA 4JXKA 2VT2A 2YV3A 3RUIA 1WDLA 5ILOA 1RJWA 5TJHA 1DOHA 3X2FA 1MLDA 4GWGA 2OP0A 4FB5A 2PFGA 3KYCA 1TEHA 3JQ8B 3M1AA 4IQ0A 3HDJA 2P5YA 3BXXA 2PZJA 1EQUA 2PWZA 4NFYA 1YO6A 3WYCA 1E1KA 4B4VA 3PTZA 4BNKA 5IG2A 5KWEA 3IDSA 4RZHA 4OXNA 3JQAA 3U4DA 4CM9A 4E2ZA 2I65A 4BNXA 3AW9A 1X7GA 3ZU5A 1E0DA 1LXCA 3EVNA 4FC6A 3PYLA 2AQ8A 2C5AA 3L6OO 1N1GA 2NWQA 4GLLA 4PG8A 1NPDA 4FFRA 2AQKA 2OUIA 5JLAA 1KC3A 3RJ5A 3JQFC 3RSHA 1JA9A 5DBIA 1R12A 3ZU2A 1LRLA 5BQFA 1F0YA 1TVEA 3K9QO 3TZQA 1ZSYA 4FJ0A 4ZICA 3PK0A 4K9DA 5HM8A 4PG5A 2P4HX 1R37A 1ZMTA 4BO7A 1QKIA 5A5FA 1XQ6A 4A0SA 1F06A 1HF3A 4YT2A 4J4BA 1KY5A 4OKIA 3NUGA 4ZQEA 5TSDA 3OJOA 2RHCA 4CLXA 2RH4A 4A26A 4ZRMA 5I7VA 3FD8A 4FOSA 4BVAA 4A73A 1A9ZA 3OMLA 3VKUA 1Y6JA 1EE2A 3ASVA 4OHUA 1YJQA 3JQBC 1HSZA 4CL8A 2NVWA 1SO8A 2Z1MA 2HK7A 4PRLA 5CDUA 1HDXA 3WDSA 3VPFA 1LQUA 1UP4A 1QR6A 2Q1UA 4UVDA 1GY8A 3RBXA 3UN1A 4DQVA 1QG6A 2AE2A 4CMBA 1QLJA 3R3JA 3JQ9A 1JAXA 1E6EA 1H5QA 1JW9B 4JK3A 3GQVA 4GVXA 3MOGA 3HJAA 4MVJH 3CIFA 4HNGA 4BNWA 2X7HA 3Q2KA 1E6UA 4XIYA 3SLKA 3OQ6A 3OF2A 3ZZNA 3PGXA 4MOWA 1P31A 1ISIA 1VE9A 2C59A 1K89A 2YV1A 3RBVA 4AICA 3QWBA 1O94A 2HK8A 3AI3A 3IP1A 4ZA2A 3V1YA 2IRWA 3V5NA 3K73O 5L40A 1O8CA 3JYQA 1MG0A 1NYTA 1Q0LA 3E18A 3E9MA 1GUZA 4A03A 3GPIA 4D79A 2PKQO 5I8WA 3RFXA 5JY6A 3C3XA 3WGZA 4MINA 1CF2O 1I0ZA 2GUGA 1X7HA 3OFSA 2O3UA 2DPGA 1N9GA 3IMFA 3ZV4A 4W9NA 4BNVA 4NHEA 2E6UX 4RDHA 5IZCA 1DFHA 1SB8A 1ZSVA 3T7CA 4INAA 1DIGA 3K96A 4XQGA 3Q2IA 1C14A 4M89A 1I01A 4CUKA 1ML3A 3DDNA 4IZHA 4R1NA 4KQWA 5JDCA 2D3TA 3O03A 3GG2A 3LQFA 2EKLA 2J8ZA 1BVUA 2PV7A 1ZIDA 2CDAA 3B1KA 3BZUA 3U3XA 3W6ZA 2DTEA 5AVOA 1XQ1A 1MP0A 2H9IA 1O6ZA 2YV2A 2HDHA 2D8AA 1G0NA 4D43A 1QYWA 4CQLB 4IDAA 4OYRA 4K26A 5H83A 3H5AA 4PG7A 3PEFA 1B14A 3QE3A 3MTJA 3FWNA 2E48A 3ZWAA 2C20A 3H5NA 4R16A 1X7DA 3W4KA 1ZO8A 4WEQA 1YRLA 4TMFA 3DOJA 4BNMA 2NQTA 3IKVA 1N1EA 2GYYA 2JD2A 2WYVA 1XA0A 5G0SA 2JFGA 1OI7A 1BXZA 1PQPA 2X86A 3GGPA 3KYDB 1IHXA 2PD4A 3JYNA 3I3OA 1N8KA 2J3JA 3GVHA 3WBFA 5ICMA 4NR0A 1P1RA 2PA3A 2VWGA 3QV1A 2V6BA 1EUCA 2EW8A 3AUUA 1P45A 1HE3A 1V3TA 2O4CA 4L0QA 4IGEA 4QECA 3WWZA 5B1YA 1EFLA 4J90A 4NDNE 2Y68A 1VPDA 4B79A 3GRKA 1HZZA 3GC6A 4RVHA 1YDWA 5BNFA 2O3QA 3PP8A 2VYNA 5THKA 3AM4A 1QV6A 1O89A 3C24A 1P1IA 3TDKA 4BNHA 1IE3A 1I24A 4P4NA 3COSA 1I30A 2D5CA 3HFGA 1R4NB 4CV3A 1PQUA 4J1TA 5JW6A 3PHJA 3PVZA 3DBLB 5GY7A 5BR7A 1A7AA 2RH8A 3OM9A 2GPTA 1HLDA 1DIAA 2Q45A 3JSAA 1UXKA 4E21A 5TT0A 1PJQA 1PZEA 3HN7A 1ADBA 4E3ZA 4NBTA 3JTMA 2D0IA 1QV7A 1VJ1A 1CQIA 5CDYA 3SBOA 5K9ZA 4O5OA 2JHGA 5ES3A 5L7YA 4IXWA 1C0LA 2VWPA 1GV0A 1E3JA 2DFVA 3OP4A 1QXSA 2BGMA 2EHDA 4OQZA 1DFIA 4WCFA 3BMNA 2EERA 3WJAA 5JNLA 1LRJA 4JCOA 2OO5A 4F46A 3UXYA 4CLDA 3I9OA 2PR2A 3MJ4A 2JAHA 4MVJE 1W6UA 3E9QA 1K6JA 3BHJA 5BSFA 3M2PA 2IEBA 3AJRA 4NJMA 5FF9A 2YFQA 5IXYA 3F4LA 5I9MA 1FXSA 4PLCA 2GASA 4PLTA 3DTYA 1KVRA 1WZEA 4WJZA 3P19A 3PWKA 2R6JA 3BMOB 2RAFA 2J3KA 3KLMX 4GKVA 4IXTA 4M1QA 3HFSA 4BMVA 4FOOA 2BGKA 1TI7A 3X2EA 4ZN6A 3OJ0A 1NXQA 1T2CA 1ZEJA 1NHGA 2OORA 2EGHA 4H15A 1SC6A 4YT8A 1E3SA 5CPBA 3L6EA 4GLOA 1WP4A 3PJDA 4Z3KA 1UAYA 4JLWA 5IAAA 1ULSA 1NR7A 1IHYA 3DZJA 3QY9A 1TA4A 2FHSA 2NLOA 2VTEA 3ZV3A 1ULUA 5IDQA 1HKUA 1GUYA 5KJ6A 1X0XA 2B4QA 4WEOA 1LSOA 2X9VA 4IPTA 1PS8A 1VL0A 1U2DA 2E49A 4ONEA 2QYTA 4TRJA 5B12A 5JYDA 2AEFA 2R00C 2GZ1A 4TRRA 3ZWVA 2YHIA 2PKRA 4OSPA 5G0UA 3ZHYA 3SJ7A 5GZ1A 1KETA 1U3TA 1TB4A 4QT0A 2W2LD 4RVDA 5F1OA 1SB9A 1YKFA 3ZDFA 1M75A 1H6DA 2A94A 4CMIB 3TZHA 4UVIA 5JFOA 4AJEA 4ND5A 4DPLA 1DC6A 4HFJA 3M2TA 4CLEA 1KY4A 3DMTC 5DP2A 2Q1TA 1B8PA 1ORRA 4RVUA 4NBRA 5T8KA 3WSVA 5AXAA 1P1KA 2AQIA 4UVGA 3RKRA 3WSWA 4L73A 4ZVVA 3F5QA 2Y0CA 4JP3A 3ZHXA 1PU2A 2DPHA 5BT9A 2NVUA 3JYLA 3PQFA 5JCJD 4W7HA 1I33A 3DBRA 4XQCA 2VWHA 2YUTA 4TRNA 4XD2A 3AUAA 2FP4A 4XB2A 4CMKA 4KWHA 3AU9A 4BNGA 1DIBA 1T24A 1X0VA 1VI2A 3WX0A 2UUOA 2O3SA 4Q3EA 5JMWA 4GX1A 2YJZA 5TLSA 2NADA 3WQRA 5CHEA 3TFOA 1NFQA 1ZZEA 4GSKA 1I2CA 4H16A 1B8VA 4BB6A 5CEFA 4YCAA 3GNSA 5DBFA 3SJUA 2W8ZA 2X6TA 1R6DA 4WLNA 1A71A 3FPCA 4HKTA 4JP2A 1UDCA 2GF2A 2DFDA 1GCOA 3HQ4O 4NBUA 4L4SA 5L3ZA 3JQDA 5BNTA 4RVGA 3EVTA 3RWBA 1G0OA 2LDBA 3VDQA 4EYEA 4QX6A 3NJ8A 3C7CB 1LSJA 5G4KB 3UVEA 4CQMB 2FPPA 1GYRA 2HSDA 1PGQA 1DC5A 5C7IO 4I5EA 2IE0A 5L4SA 4F6CA 2E4AA 3KSUA 1LRKA 4TWRA 4LCEA 2TMDA 4RPHA 1ENPA 4XGNA 3WXBA 3WGTA 1H2BA 1JN0A 5TF4A 1QYCA 5DBGA 2EKQA 2CSUA 4IGFA 2HJSA 3C8MA 4AJIA 1J0XO 2X5OA 3QVXA 4LGVA 5KJ1A 1ZK2A 3G1UA 4BKPA 4CM6A 2PZMA 3JD4A 3JQGB 4B7UA 2VHWA 3EMKA 1G1AA 1KEUA 4RPGA 4WKGA 1CEQA 4ZQBA 3RUHA 3OH8A 4R1SA 1WMAA 1EMDA 1NAIA 1ZJZA 4XYGA 3CMCO 3AM3A 4D45A 1CWUA 2Q49A 4MKXA 4YT5A 5C5IA 2Z1NA 3KZVA 3U49A 1Y5MA 4G2NA 1E77A 1E3WA 3H3FA 1PTJA 2HMVA 3D4NA 5COAA 4ALJA 2HLPA 5I9LA 2I6TA 4QFDA 3F1LA 4DMLA 3DZBA 3KYBA 1CIVA 2WJPA 3ZWYA 1BGVA 1BSVA 1F17A 2NNLD 2VNAA 2J3HA 4E5PA 1FDVA 3WTBA 1BDMA 1RM5A 2QZZA 3GRPA 3H8VA 3PRJA 1LLCA 2Q1SA 4IMPA 1PJTA 4PLVA 4BGIA 3DBVO 1Q7CA 4OO3A 4YB8A 1ZK0A 4EW6A 3IC5A 3EDMA 2I5PO 3JYPA 1ZMOA 3TZKA 1VKNA 4DC0A 2NTNA 1DB3A 3JQEA 4MVJP 2ZCVA 1KC1A 3GFBA 1C1DB 3AOGA 2HMWA 1C3VA 3VTZA 1O0SA 3VPXA 2UV8A 3DO5A 3F46A 1DRVA 1SOVA 4RO0A 4G81A 4HFRA 5TJ9A 1DJNA 4ND4A 3AI2A 3GEMA 5KOIA 1ZH8A 1PR3A 4YACA 1ZSNA 4YAIA 5JO9A 1XIVA 2Q50A 3I5MA 3Q6IA 4HFNA 1WAMA 9LDTA 1P9LA 3RROA 4MVJA 2X0JA 3O4RA 3BMCB 9LDBA 2HU2A 4MKRA 1ADFA 3LT0A 1NQOA 3S2GA 3LZ6A 3OECA 4ZGWA 2NQ8A 2J5RA 1E1MA 1I2ZA 4RF5A 2NV6A 3EW7A 1X1TA 1LNQA 3GF4A 3PXXA 5A3VA 3FF4A 1KS9A 4YWJA 2P91A 5TNXA 2BRUA 1YGYA 2PNFA 2CF5A 2D59A 3GVXA 1EVZA 1SNYA 5T6BA 1JWAB 1ENYA 1NQ5A 4JGBA 3ZWXA 3AY7A 4PLPA 5K6AC 1HLPA 4BO1A 3CEAA 1NM5A 3ZN2A 4R4JA 2FR1A 3FNEA 3IOYA 2CVZA 4QQRA 3ZU4A 1QORA 3HDQA 3SC6A 3GDFA 1EZ4A 2DBVO 1PS0A 1QYVA 1P74A 3GH3A 1F8GA 3MTGA 3ROQA 2P2SA 3ADOA 3ANMA 1I3LA 3ZWNA 4U8GA 4I9UA 1E3LA 1Y9EA 5C37A 1A5ZA 5IDWA 4JJFA 2EIHA 1L7EA 1PL7A 4FFLA 1T2DA 2JFHA 2B83A 3AOEC 1T4DA 4IJWA 2OBNA 3H9GA 1T2FA 3ONDA 4P38A 5IDYA 1VLLA 4RL6A 3JQFA 5IN4A 4KDEA 3JQ7B 1BRMA 1UXHA 4OGWA 5EL0A 2YFHA 1Z82A 3KRTA 4EJMA 5CAEA 5A05A 1ID1A 3FN4A 3DAGA 5L51A 2XXBA 4R1UA 4NFHA 1HYHA 2WE7A 2VUSA 1OC4A 3INRA 4XQ9A 5K0ZA 5KCZA 5DT9A 2EJVA 4DC1A 3K2EA 3RI3A 3E1KA 5B4UA 3R0IA 1UXGA 1BXGB 4ZQHA 3H9JA 3N7UA 4UVEA 4M87A 4CLRB 1YOVB 3HE3A 4AVYA 4YJGA 1Q2XA 4MO2A 1VL6A 4F6LA 1R4MA 3LLSA 4QXMA 3JQBA 4H7PA 3ZCXA 4II3A 2GRAA 3TWOA 5IJZA 4E2XA 4IBOA 5T57A 5AXBA 2B69A 3NT2A 4MIOA 2DBRA 3GZ4A 2IXAA 2VOJA 4CMJA 3U5TA 3BTSA 3DZFA 1U5CA 4CMEC 3F6YA 3JD3A 2OHXA 3ZHZA 2P9GA 1JKJA 1V35A 4R69A 1CJCA 1LDGA 3VPGA 1K3TA 4IS2A 4CLOB 4HUJA 2AG5A 2FZWA 1P0CA 1V3UA 3KV3O 5U4QA 4EGFA 4DPMA 4KOAA 4XRGA 1WPQA 1EUDA 4Y9DA 3GZNA 3ZWPA 3WGQA 4CM1A 1XDWA 4OIMA 2NU8A 2Y66A 4KUHA 2W2LA 5EJ2A 2DBZA 3LDHA 4NIMA 5EPOA 2Q2VA 5A9RA 3QVTA 1B16A 1GD1O 1Y7TA 3KYCB 3VDRA 4BHTA 2W2KA 4BOYA 5IXSA 3RC7A 1ZXLA 5COQA 5LDGA 4DIOA 3JQAB 4M8SA 3A9WA 4QO8A 3FTPA 2QRLA 4QSMA 1SEVA 5KJCA 1U3VA 4BNYA 2Y0EA 3ZWBA 2FSSA 4ZRNA 3PHHA 1RYDA 2A9FA 4LSMA 1P1JA 1OBFO 1JKFA 2J5KA 2AEJA 3PDJA 4M54A 3VH1A 1MXFA 4EEXA 4L4RA 5TRTA 1W8DA 4YJHB 4ZQGA 1H9AA 3ETEA 4CV0A 2I9PA 4PG4A 3ONEA 1V3VA 4S1VA 2H1SA 4LN1A 1LDYA 2WD8A 4U5QA 5A9SA 2PH3A 1BXKA 1MGOA 4HX5A 4RVFA 3KO8A 1OFGA 1HSOA 3T4EA 3ICCA 2I3AA 2D4AA 4Q3NA 3QJ5A 4IQ8A 4QUKA 1HETA 4WNIA 5DNAA 4EI2A 5I9NA 4FBGA 4J9UE 3NT5A 4GX2A 2HMUA 3FRJA 3H4VA 3PYXA 3C1AA 4CV1A 3N74A 3NTQA 1VJTA 2VZ0A 3DXFA 4ND3A 2ZTVA 3PHIA 4FPXA 1ONPA 1LU9A 2C0CA 2J3IA 4P22A 4EUEA 4C4OA 2RCYA 2HRBA 3PWSA 1ENZA 4ID9A 4RVSA 1YBAA 1UXIA 2HJRA 4FCCA 1EDZA 1R0SA 1SMKA 1FJHA 4Y67A 4EZBA 5JC1A 3IIEA 3DFZA 1ISHA 4J49A 1PQWA 2HKIA 4BNFA 4J9VA 4NU5A 4C7JA 1YJ8A 5HA5A 1LX6A 1GPJA 5HS6A 5C3MA 3QRWA 3MEQA 4GX5A 3D1LA 4LRSB 4J1SA 1CQJA 3V2UA 3MWDB 3V1TC 4N18A 4D41A 3OJEA 4UAGA 4TKLA 1H93A 3CE6A 1P3DA 3ENNA 3OHSX 4N5NA 5EERA 6LDHA 4S3MA 3QLJA 4NBVA 4CM4A 2BFOA 4DBVO 4DQXA 2EKPA 2P5UA 1XELA 4NU6A 3WBBA 2Y0DA 1M67A 5IZ4A 2BFPA 4DA9A 5L53A 1NNUA 4WLEA 4CQMD 4N5LA 4O0LA 4Y6PA 2YZ7A 1HDCA 4WLUA 4ITUA 1XLTA 3TRIA 1B8UA 4JROA 4FD3A 4A7PA 5A06A 2JCYA 4EJ6A 1N9GB 3IL2A 3O8QA 3W4IA 3U62A 2O3JA 2W4QA 1T4BA 3I9MA 3S55A 3CPSA 5EQFA 5LC1A 2GN6A 4BGUA 4DMMA 3QVOA 5U1PA 5B37A 5DF1A 3RCBA 4QEDA 4AJ2A 2ZYGA 3DAPA 4UUMA 1Y5RA 1O9BA 1XU7A 5CG2A 3L07A 1WDKA 5JSFA 2IZZA 1GEGA 1CDOA 1B15A 1GZ3A 2B35A 2EF1A 4N5MA 2O3TA 1PZFA 4RLSA 2DT5A 2ZTMA 3LF1A 3RFVA 4YJFA 2X9GA 3DQPA 3C1OA 3MJEA 4IJUA 2ZQZA 2W98A 3BMQA 2O3RA 4B3HA 4ESOA 3PZBA 2I66A 1PJ2A 2WD7A 2NM0A 3D64A 5TX7A 3PQEA 4XYLA 2O48X 4TRMA 3GVCA 1GR0A 4BMSA 2DVMA 3OSUA 3DB2A 3OQBA 1EBUA 4OL9A 2BFMA 4PVCA 5DOZA 3VTFA 4AJKA 1U8XX 3BHMA 2OFPA 3BTVA 4FJ1A 5TGDA 1HL3A 3GGGA 4J16A 2ZB4A 3HNPA 2EEZA 3W8FA 4KMSA 3DMYA 3VOSA 3R1IA 1L1FA 2Y67A 4YEDA 1PR9A 2HMTA 4RF2A 4I5DA 1YBVA 5F5LA 4HV4A 3SVTA 1U9JA 2VWQA 4IZIA 3GEGA 3P2YA 3H9QA 4E30A 2C29D 5CEEA 3ABIA 2C5EA 1LLDA 1DIRA 2J6IA 2DUWA 3H65A 4XYBA 3G79A 3GVIA 1IZ9A 3NDIA 3DEYX 4NK4A 3HDHA 3QP9A 2ZATA 3M1LA 4A27A 3MCVA 1O5IA 1TXGA 2RBEA 5FI5A 5JAMA 1WMBA 4YAEA 3FPLA 3MZ0A 4O59O 3RKUA 1OAAA 3IJRA 3K8ZA 4FC7A 4FFPA 1ZCJA 4PN3A 3BYZA 2R00A 4MIYA 1JLLA 1E3IA 4FGSA 4J7CA 3WQSB 2GZ2A 3PYMA 4BB5A 2NU9A 4UULA 3ZWOA 3AU8A 4DWVA 1CERA 2IDZA 1Y8QA 1LTHR 3AY3A 4ZQFA 1PIWA 4K6FA 4XIJA 4PGFA 1UXJA 3DMTA 4G65A 5ITWA 4BNNA 4RPLA 5JPIA 1ZUD1 1IZ0A 2IZ0A 4RZIA 3W4JA 2I76A 2AMFA 2VCYA 3UUWA 2Q4BA 3VKVA 4D7AA 2PK3A 4NQZA 2HRZA 1UZMA 1XWFA 2B4TO 3I6QA 3BMNB 4Z9YA 4ROSA 1GZ6A 1Q1NA 1GADO 4WOKA 5JAZA 1ADCA 4LK3A 4OOFA 5T5QA 3RC1A 4Z0TA 4PZCA 2HCTA 3GEDA 4GL4A 4ZU3A 4HNHA 1GCUA 4BL5A 1DRUA 2YQ5A 1SZJG 3KOUA 1TT5A 3LC2O 4HY3A 4N7RA 1HRDA 3EUWA 4AJJA 1NPTO 4XA8A 2VOEA 1U4SA 2VQ3A 1C1XA 3PZRA 3L9WA 4IMRA 1Z7EA 4YAGA 3B1FA 1YL6A 1ZFNA 2VRCD 3F47A 3I9KA 4I8XA 1TT7A 2UAGA 2V6MA 3GT0A 5A02A 4W9NC 4JNKA 3WGHA 4M55A 4UEOA 4BO8A 4BO5A 1U3UA 1MFZA 2JAPA 3H9EO 4PCVA 1QYDA 2FY8A 3U0BA 4R9RA 3VH2A 3IAHA 4Q3BA 3KVOA 3R6DA 4KQXA 3HB5X 5JDCC 2UVDA 3FNGA 2OXIA 1WZIA 3PHGA 4Z3DA 5JDIC 1F8FA 3GR6A 5T64A 3BHIA 3RUFA 3L77A 4FDAA 1HZJA 1JWBB 3D5QA 4CR7A 4Q39A 4GWKA 2I3GA 3PLRA 4IQGA 4MP8A 4IDEA 2SCUA 5EN4A 5CDSA 2Y05A 1X15A 1GDHA 1LDBA 2G5CA 1M6HA 1YE3A 1X13A 3HWRA 4IJKA 1P1FA 5DCUA 5TC4A 1SBYA 2YHIB 4YRDA 3BMOA 3ZU3A 1GU7A 1MV8A 5J23A 4FFMA 5AYVA 1WDMA 1K6XA 3WMWA 3L4BA 1BW9A 4BNTA 2VN8A 3D4PA 2GD1O 3O26A 4DQUA 4IY1A 3ANLA 3ZNQA 3EZLA 2UUPA 1RYEA 5HBRA 3IUPA 1T1SA 1UDBA 3ONFA 5KVCA 3LVFO 2CUKA 5JBIA 3HUDA 1IULA 3DWFA 1WWKA 4CMAA 5FWNA 5KKCA 1RPNA 5HS4A 1IUKA 3F3SA 1KYQA 1LI4A 1IY8A 3CMMA 1MC4A 2NVUB 1I2BA 1JQBA 3G49A 4GMFA 4BNLA 1NQAO 1ISGA 2OOSA 4OM8A 1K2WA 4J4TA 5GMOA 1AUPA 4E5NA 1I10A 3PIIA 2Y93A 1GYPA 1NVMB 1Z6ZA 2C07A 3QA9A 4YDRA 3P7MA 4JIGA 4CJXA 5GZ3A 3WGIA 1JAYA 4J91A 1W0CA 3D0OA 1JVSA 1H2HA 3ZNOA 2J5QA 4Z9FA 1DHRA 4J7UA 4PLYA 1SPXA 3GHHA 4DBZA 2X8LA 3DC2A 4PIVA 1M6WA 1ISFA 2VRBA 2X0NA 3DBHA 3U4IA 5JE8A 4DREA 3DTTA 3KEOA 4J1NA 1VKOA 4XKJA 2EXXA 1PX0A 4R5HA 1MC5A 2C54A 2ZIZA 2A35A 4NMHA 2PGLA 2BELA 2QYSA 5A1TA 1VRWA 2ET6A 5B4VA 1DLIA 3JQAD 4CM9D 4EJ0A 4CM7A 4XDZA 2PZKA 3TZCA 1G6KA 3ZH2A 4B8WA 4CUJA 4PVDA 4JJIA 4IDDA 4MDHA 4P4GA 4D0SA 1E5QA 1T1RA 2ZTLA 1ZW1A 1S6YA 4WCDA 1ZNQO 2Z95A 1DC3A 4B4WA 1J49A 1GQYA 4WK6A 5HWSA 3QQPA 3CH6A 1RM4A 1YL7A 1U2GA 4XGKA 3E5MA 2G1UA 4PLZA 1JDJA 4GGPA 3GGOA 1XR3A 1PGOA 1NHWA 4NPCA 2GNAA 3KTDA 4J0FA 1R66A 2NU6A 1FF9A 1Y9AA 3D3WA 4KWIA 4BQPA 4CMGA 1H6AA 5C7OO 3CXRA 1NBOA 2AXQA 4BNIA 1MG5A 2EJWA 1XG5A 1V0JA 1XSEA 3FTNA 2X22A 2VUUA 1OOEA 3QWIA 4CR6A 4OXYA 1N5DA 2EG9A 3PJGA 1NPYA 2CD9A 3VC7A 4DPKA 3DZHA 5G4KA 3IP3A 3WOHA 4XR9A 2GN8A 3WIDA 1ZBQA 4E5YA 1N92A 5IF3A 1E3WB 4B8ZA 4FS3A 1A27A 4FN4A 4D44A 3WLFA 1TLTA 4TZTA 5ENVA 3IS3A 3GPDG 2BHLA 3ZW9A 4IDGA 1FDUA 3GMSA 1SAYA 1KOLA 5MDHA 3D7LA 1NASA 4XJSA 4A2CA 4B7CA 1XCBA 4AJNA 4CM5A 3MWEB 5JAIA 1Y1PA 1GQ2A 4E6PA 3AOEA 2ZQYA 1PL6A 1PGJA 3TOZA 3S2EA 3E5RA 3RU7A 4BNZA 4E12A 2JD0A 5L45A 4MVJM 1NFFA 1NR1A 1ZXBA 2VUTA 2XOXA 3AM5A 1BMDA 2JJYA 3RVDA 2HMSA 4II2A 1CYDA 1DIHA 1EQ2A 1E7RA 1E6WA 4MKZA 3Q0EA 2VT3A 3EHEA 4R1TA 2FN7A 1P44A 3LLVA 4Q3CA 4J2HA 1GQQA 1NTOA 5FEUA 3A14A 5T8KC 1ENOA 1M66A 3F9IA 1YQGA 3G3EA 1K0UA 4WNCA 1MUUA 1SOWA 1UZLA 2E37A 1DC4A 3FNHA 3ZV5A 1E5LA 5A4DA 1YL5A 4E2WA 5F1PA 4BKRA 4IS3A 4D3DA 5AXDA 1DXYA 3CINA 3STHA 1E7SA 1MFPA 1D3AA 2DKNA 4E5MA 3WB9A 1E7WA 2BLLA 5BSHA 1KVTA 4Y98A 3PGJA 3R3SA 4HBGA 3S8MA 3CTMA 3RU9A 3LT4A 4MIEA 2CY0A 2PGJA 3P5SA 1HT0A 1Z7BA 2VHZA 1Y8RA 3K5PA 3NX4A 4K6CA 4Z9XA 2PLAA 4BGVA 1I3NA 1YB1A 4CMEA 4E33A 1EEHA 2YHUA 3V2HA 4EITA 5L7TA 5A03A 4YTEA 4OH1A 4DTIA 3KUXA 4YPOA 4U6SA 3B70A 1C1DA 1RKXA 1JKIA 5ITVA 3NAQA 1YB4A 1YONA 1NX6A 2GZ3A 2CDBA 1A72A 3GAZA 4QFCA 4YQYA 2ZJ1A 3NV9A 3K31A 1X14A 2VHVA 4EEZA 3PJFA 1H94A 3LSYA 1ONOA 3UICA 4XR4A 3E8XA 3BTUA 1W4ZA 2LDXA 3ZWCA 1EBFA 3DL2A 1QYXA 3UH1A 1U7TA 3EY4A 1H6BA 5H82A 2B37A 1GL3A 3EGOA 3TPCA 3WYBA 5LDHA 5KJFA 3H7AA 3PPIA 1L7DA 3ICPA 3UOGA 3WNQA 4U0JA 5KTKA 3NRCA 4GPD1 5L9AA 1HDOA 4YR9A 1HE2A 4Y8VA 3M6IA 3RUCA 5BSEA 3AFNA 2OL4A 1Q7GA 5JAQA 4UVHA 5TT1A 3WQQA 1E7MA 3P2OA 5KIAA 4BNUA 1OZAA 1B3BA 1HYEA 3E03A 4L76A 4ND2A 2X0IA 3QVWA 4NK5A 1ISJA 4JBGA 4DRYA 4D0RA 1U1IA 1GAEO 2WYUA 5JS6A 1LSSA 2PTGA 1NVGA 4OKNA 1AXGA 1W73A 1NWCA 4I9HA 1GFSA 5CG1A 1U3WA 2Q4EA 4R3WA 5DZSA 2CMDA 2EP7A 3GG9A 3TL3A 2QZ9A 4MPDA 3PWZA 2VHYA 3VHRA 2X5KO 3LF2A 4J7XA 3OEYA 4OAQA 3VPSA 4FJ2A 5DN9A 1DBVO 4YJGB 2PY6A 3ZW8A 2VRCA 4CL3A 2CFCA 4OSOA 1R4MB 2FRDA 3FSRA 1KEWA 2D2IA 1P33A 4U7WA 5F21A 1HDRA 5DCYA 3OJFA 5CEJA 5G4LA 2O2SA 3JYOA 4TVOA 1N7HA 3FR8A 3KBOA 4Z0PA 4BUCA 2ZJ0A 4RDIA 1GUFA 1LDMA 4CM8B 3HN2A 5EMHA 4D3SA 1N2SA 1LC0A 4M86A 4MP6A 3JQ7A 1IL0A 5ER9A 3SLGA 3VH3A 1DAOA 2IODA 1VM6A 1JU9A 3IUSA 5KVVA 4J1QA 1R0KA 1EDOA 2B0JA 3JCZA 3UHAA 1HXHA 5MGBA 5A5EA 1AHIA 3DZKA 4FIZA 3I9JA 5TQVA 4AJLA 5EIOA 2CDCA 3ZWWA 3GZNB 5G2OA 2Y1GA 3D5TA 1K5HA 3IJPA 4RPJA 4DXHA 3I52A 1FDWA 2WE8A 3DR3A 3DOCA 4PFJA 4UEJA 4L4XA 3WLEA 3INGA 3AUSA 1PL8A 2W2KB 4DVJA 4GKBA 2BH9A 4CM3A 3N58A 2GSDA 4TVBA 2WSBA 3GNTA 4GVLA 1PJLA 1HDGO 1LDNA 4NG5A 1ARZA 3H6KA 1PJCA 1QLHA 1ADGA 1D1SA 3EC7A 4LVUA 5ER6A 4XCVA 2IEDA 3K6JA 3TNLA 3E48A 3GLQA 4PZDA 4E4YA 3U4CA 1T25A 3FHLA 1HE5A 3JD1A 4NZ9A 1A9YA 4P4LA 4Y6RA 4DL9A 1EK6A 3VZQA 2AW5A 4LW8A 1I3KA 1U5AA 2X58A 3DZIA 3EK2A 2WEKA 5JCJA 3WWYA 1U7HA 4KTVE 5KJEA 4B7XA 2JCVA 1IPFA 1GZ4A 4R9SA 3GVPA 3TQHA 1JTVA 2DQ4A 4AFNA 5ENDA 2G17A 1FDTA 2DUUA 4DIFA 4J43A 3ETDA 5I7SA 5A9SB 1P0FA 1T2EA 3WG9A 2WWRA 1YDEA 3KSZO 4HP8A 4I5GA 2AHRA 1MB4A 3G17A 4XGIA 2I67A 3EAGA 2QIOA 2ZB3A 4C7KA 1Z75A 3W1VA 2GR9A 3CUKA 2QW8A 4ND1A 2VNSA 3AFMA 4A5OA 4XZ3A 4CMHA 2WDZA 4JN6B 2Q2QA 5DOVA 2OGUA 5JYEA 3WFIA 4KUGA 4NNJA 3WS7A 3JQ8A 5IN5A 4XX0A 1E1NA 3IKTA 1Y81A 3OIFA 1B0AA 4YVFA 4Y6SA 3RD5A 1AHHA 4CMCA 1S7CA 3AI1A 1DDOA 2DTXA 3KXDA 2C2YA 1KEVA 2GO1A 5CDGA 3HSKA 4Z6KA 2BI7A 2P9CA 4FFNA 2EP5A 4YJHA 3NDRA 3QHAA 4E5KA 4XYEA 1BG6A 4O1MA 2GLXA 4PRKA 4I08A 3GAFA 5LCXA 1FK8A 2QX7A 2PH5A 5F1KA 2IZ1A 4YJDA 3GMDA 3OICA 3WGYA 4UUNA 4OXKA 4RQUA 1WLYA 2Y1EA 2B4RO 2OP1A 4CM4B 2BF7A 2ZB7A 3ITKA 3B6ZA 4WASA 2C7GA 4BO2A 3UKOA 1FMCA 3KEQA 3QIVA 4GMGA 4OQYA 4XJTA 3TL2A 3A4VA 3RJ9A 3F4BA 1HEUA 2G0TA 4HXYA 3SC4A 3DHEA 1UUFA 3WGGA 3F5SA 5F3RA 3GHYA 2Y99A 3O8QB 3TFQA 3DHYA 1I8TA 4FGWA 1UR5A 1WW8A 1DPGA 2O23A 2OBYA 3RC2A 1BDBA 3QW2A 2FR8A 1LA2A 3GFGA 3W8EA 4TSKA 3Q3CA 2YDXA 3B20A 2AE1A 3VPHA 3GN2A 4W4TA 5EESA 4OOEA 1Z74A 1HDYA 5JMPA 4BO9A 3RUDA 4R3NA 4ALIA 2WTBA 3BTOA 4W7IA 2HO5A 1B7GO 2H5LA 2AG8A 2FZEA 3L0DA 3LYLA 4L75A 1R16A 2P68A 3FBTA 1BVRA 1LQTA 3E6AA 3NGLA 1V6AA 3OA2A 4FW8A 4YJFB 2F1KA 3C85A 3HB4X 1UAGA 4BIIA 2RHRA 2UDPA 4AJ1A 3VAZA 3RAJA 1ISMA 3BMQB 3NTRA 2YQ4A 3C7DB 2HAEA 2WD7B 2GGSA 1RM0A 3ITDA 3PFWO 3HADA 5T67A 3RUAA 4ALKA 1D7OA 3JD0A 2GCGA 1HTBA 1EE9A 1U4OA 1E3EA 1LC3A 1M76A 4BNJA 2WM3A 1DRWA 3OETA 4F3YA 3H2SA 3RBZA 5FI3A 2YDYA 3PI7A 2QHXA 3ROPA 1QP8A 4X54A 2X0RA 4YBZA 4TZKA 4IINA 2JD1A 5EINA 3GK3A 1LEHA 3I9NA 3PQDA 3I6IA 4NBWA 5TS3A 5JCXA 2O7SA 5JDIA 1DFGA 1E7YA 2NSDA 2Q2WA 2X9NA 3RFTA 3I4FA 4CV2A 1PJ3A 1PZHA 3E82A 3RQSA 1PEDA 1J5PA 5AQ1A 4U6QA 5IDXA 2W90A 3PHLA 2H6EA 2NUAA 1QSGA 2DU8A 3K30A 1AXEA 3I23A 4GX0A 4WPGA 3PIDA 2EV9A 4CQLA 2Y1FA 1VSUA 1Y8QB 4XYMA 2JHFA 3QVSA 1NFRA 4MVJD 4GI2A 4WLFA 1LLQA 1Z73A 5JXWA 1YQXA 4I5FA 4IDCA 2O50A 3INTA 2JFFA 3CSDA 3GN1A 5KVQA 3U09A 1A4UA 3GUYA 4ZHSA 3KYDA 4YYZA 5L7WA 3JQ9C 3T4XA 1VJ0A 4R5MA 4U0KA 4WLOA 1N7GA 5A3JA 1PWZA 4JBIA 2F00A 2P4QA 4ALMA 4CPDA 4FFOA 4RGBA 5CPFA 4UUPA 4WCFB 2YYYA 3K92A 3V2GA 4XQEA 3GDOA 3OIDA 1XYGA 4YA6A 1TT5B 4OJNA 1NAHA 3OBBA 5HRUA 1EUZA 4ZJUA 1J4AA 1C1XB 1PS9A 4LMPA 5COBA 4NJMB 3RASA 3ZWMA 3FR7A 3FWZA 3KSDO 1ONNA 2BGLA 1R4NA 3FNFA 4KTTE 2IYOA 3DBLA 2PD6A 3UAGA 1KERA 3HZZA 3JV7A 3PFFA 3WICA 5DULA 1A7KA 4DYVA 1EVIA 2Q46A 5F5NA 2A92A 4KP7A 1NP3A 1H9BA 2D5AA 2P9EA 2Z5LA 4JX8A 3QWHA 4WUVA 4BQRA 5IZCC 2TMGA 1C0PA 3PJEA 5ILGA 4LCJA 2NU7A 3DOOA 1QRRA 1KVUA 2C82A 2QRJA 3VVCA 2PGDA 4R54A 5JC8A 4BO6A 2HUNA 2X23A 2FPGA 3AUTA 4LISA 3ZHBA 1I5RA 3V8BA 4ALNA 5C7LO 1DAPA 2VYVD 4WECA 4XDYA 3VZSA 2YW9A 3CZMA 1GPDG 3DFUA 3W6UA 3L6DA 5CDTA 1FDSA 4XRRA 3TF5A 4B3IA 1BW9B 1D1TA 4R51A 4R01A 2VTDA 1I32A 3KM0A 4N54A 3U4HA 1ZK4A 1ZK1A 3Q9UA 2Q1WA 1LJ8A 1H6CA 1BWSA 1VSVA 1LSUA 4HADA 4TKMA 1XGKA 2BFAA 4RLHA 5FYDA 4ALLA 4UUOA 1PGNA 4PLHA 3SEFA 3ZNNA 1LLUA 3ST7A 4FR5A 1YB5A 3NJ4A 4EUHA 2B5VA 7MDHA 4AJPA 1X1EA 3Q1LA 2B36A 1E92A 7ADHA 3SXPA 1VL8A 2UYYA 3HDYA 5EQDA 3NKLA 1IB6A 4AJ4A 4BKQA 4BKUA 3GY0A 3GDGA 4GSLA 8ADHA 3DBRB 5BSGA 3NEPX 3BA1A 3ADPA 1IPEA 1XU9A 5DCWA 3UW3A 2Q3EA 4PG6A 2DLDA 5ADHA 1H0KA 1UJMA 1AN9A 1KVSA 2V6FA 2YY7A 3DBHB 4TQGA 3KB6A 3VZRA 2QRKA 3GUCA 4L74A 2XXJA 2CVQA 2DTDA 2JCXA 3DZGA 3GNQA 4LMRA 3ULKA 4YAJA 4Q3DA 3WTCA 1ZVMA 1R0LA 4B3JA 3NGXA 4LSWA 2JKVA 1WVGA 2VHXA 4CMIA 2BI8A 2IYPA 2V65A 4DLAA
chains in the Genus database with same CATH superfamily
2PYDA 4QPCA 2JLBA 3WNVA 2IBMA 1P72A 5ISMA 4QNRA 5CURA 1JVBA 5BN4B 3TQOA 5HTKA 1CZUA 2C0QA 3TZLA 3WGOA 1TD9A 2P4UA 5HMLA 4BTVA 3JXEA 2NUPB 3Q7TA 1XL1A 3ROTA 5G0WA 4F5WA 5JD5A 4GRDA 2G4CA 3KFVA 4FSHA 4KGZA 3ZKAA 1NMZA 1KFEB 3M5DA 4BO3A 2IS1A 2XJ9A 3ADDA 5CYGA 1TM7E 4RJIA 2H0RA 3K20A 2GYWA 1ZHOA 2P2YA 2IPMA 2CLCX 5KWIA 3BFVA 2J3MA 2XAAA 3DE0X 4IM7A 4YLGA 3UUGA 1RQXA 1LW7A 2VYQA 3BCRA 2VPIA 4C29A 3I28A 4OJMX 3PICA 2YV4A 2NU6B 2ZWPA 5FBKA 5AVWA 1V25A 4AJOA 1QMGA 2MYPA 2JH9A 3CUSA 3HEBA 1AQIA 2IYUA 4G97A 3F6SA 5EIEA 3HU3A 821PA 4XM1A 5DH9A 3P0RA 3S68A 4B81A 5A4KA 3OUZA 3U37A 2WMDA 4L7QA 1PNTA 3TN7A 2O5VA 1HG1A 2B1QA 2QMOA 3B36A 2REBA 3E4CA 3L7YA 1SU6A 1RR6A 1ZQ9A 3P0IA 4FNAA 3LK7A 4HYTA 4MUGA 4P84A 1KDYA 4B17A 4BE7B 4EHFA 1A9PA 2E87A 5IH7A 1IM2A 1CJBA 3NC0C 2QG4A 2BTEA 3KETA 2R2GA 4RQAA 4EEKA 1THMA 2CFRA 4WKBA 1DL5A 2GWRA 4OL0A 3QEAZ 2HA5A 2XWQA 4Y7CA 2XMBA 4F97A 3TB4A 5SZJA 1HFEL 4EELA 3EEOA 3D7RA 4KNWA 1UP6A 4L9RA 4QLAA 4TTIA 1S2DA 4LJ4A 3HO1A 1SRQA 4CEJA 5BOSB 2OKGA 4MYRA 3UK1A 4NI5A 2GN4A 4J0IA 4DWOA 4M3NA 3B1JA 4WKNA 4YUYA 4A5SA 5F7XA 3RO7A 5C1IA 3MGKA 5AKEA 2FMUA 3F0TA 3VSEA 1X7WA 2MINB 3AUFA 3LSTA 4X90A 4PW0A 3D43A 3NNNA 2LE0A 2F8SA 3PXBA 1XRPA 5DVZA 2ZT8A 1LBHA 4L2IB 4RSHA 1QHYA 3AKEA 1CE8B 2II6A 3F78A 3MUEA 3W8DA 3ZGXA 3ZX5A 3LUFA 4EY6A 4BASA 1U2DC 3A28A 1XZJA 3L4BC 4HG2A 2ZK7A 5D6OA 2KX7A 4AL4A 3FTQA 1GGHA 2J30A 2Y1OA 4ZOLB 2FXIA 5H9WA 2M1ZA 2Q3FA 2GFHA 3DPUA 3ELUA 2P5SA 2YMMA 4QE3A 3S2IA 1X74A 2ACWA 2HX1A 1JNYA 1DEKA 3F1KA 3VDXA 4EBFA 1P4SA 1CUCA 3O3MB 5LQNA 3CRMA 1VYTA 1XHLA 1GG9A 3R5JA 2Q6LA 2YYAA 1OZ0A 1QNLA 2IYSA 4P83A 4G5GA 4KN6A 3SJAA 3SM9A 3R0ZA 4DRZA 6REQB 3KT3A 2CVPA 2OBXA 4P8RA 5H81A 1V71A 1YZUA 1J0DA 4OI4A 1M2WA 2QSZA 1PWXA 5KOHA 4LYHA 4JBYA 5PNTA 1AE1A 3DT9A 4CR8A 3PLNA 1PTKA 5G0TA 3NGMA 2RHJA 2B21A 1KR5A 4GM0A 4B6GA 1XKLA 1AMUA 3BB1A 1RDFA 4FD2A 4MUXA 1PYOA 3HCBA 5I9TA 2CBXA 4E0BA 4MVXA 1QOQB 3QEKA 1UJ2A 1D04A 1T2AA 2RG1A 3Q9NA 1SOAA 1Z56C 3RIGA 4DILA 2TMKA 5J4VA 3DQZA 1YVEI 5HMMA 3WKDA 5LMUB 3QMWA 4OATA 3BAFA 4K88A 2PHZA 1UDAA 3DE4X 5AI8A 5FP0A 1RAFA 4O4JA 1ZJ6A 4BV8A 3O4GA 4DNOA 1M0WA 3ILHA 1OU4A 4Q3AA 1KBQA 2JJ8A 1U1EA 1V5EA 2FOLA 3LRXA 1B3RA 3PEUA 3VX3A 2OESA 4AG3A 4HLCA 2C9DA 4XI9A 5B4TA 3KLOA 3B9RA 1IN5A 3D3EA 2FZVA 3PCRB 1XCMA 4GC9A 2ZBQA 2DLNA 1H5NA 4M98A 1L9XA 3ZHSA 1RI1A 2RIRA 5KTNA 3DVQX 4HX9A 2HNBA 1ZKMA 3ZWKA 1CP2A 2C2KA 3NDJA 4DSZA 3LQKA 4O8ZA 4BKMA 3ZV6A 2A7XA 4D81A 4RSRA 3L7DA 4XLLA 4BZQA 2ZI3A 3W9BA 4DMCA 3V7FA 1T5IA 4KVZA 1PZGA 5CCEA 4AECA 2ATXA 4X20B 4HUTA 3GLKA 4K81B 2R4TA 1JIJA 4OUDB 4ZVUA 1DIOB 1K27A 1KEPA 3NIBA 2BKXA 2OM6A 4WE3A 4EQZA 1F12A 3DYIA 1H2RS 4LYYA 4JOBA 5HJ5A 1I94B 2H11A 3VC1A 3CKYA 1SBCA 1EFKA 3KR9A 4W5HA 2W4IA 4KZKA 2H2IA 4ND7A 5FJJA 5KNLA 1OR8A 2XE7A 1QVRA 3BIOA 5FTMA 3R7WB 4M99A 1KQPA 1TCAA 2AQHA 1EXDA 1ZH4A 1CUZA 1MOSA 3L82B 3TG8A 4AN0A 3A1UA 2E4WA 3MWYW 4XWYA 1A9RA 1ZD3A 3S1AA 3PUXA 3KQHA 3IBGA 5FFFA 3L4JA 1RYHA 1NKSA 4LRQA 2JGNA 5AXCA 3J7AC 2TMYA 3O1HB 5EWMB 2NTJA 1TLLA 4RNCA 5AI9A 4JUIA 3HKEB 3A6EA 4ZCLA 4KQMA 3G02A 2J0EA 1PFWA 3K0CA 4MHOA 4GQAA 4EOGA 2OLJA 2O8BA 1YWGO 1VPLA 2BP7B 3G5UA 1DAHA 1V5GA 2AJCA 3NWJA 2BFBB 2C92A 2R97A 5ALKA 3TPZA 4DLTA 1USGA 4JGIA 4EY3A 3Q3IA 4PBRA 3L7CA 4DLBA 2PGNA 3RS7A 4Q9KA 1K9SA 3VVLA 4BP1A 5DFAA 1UJ4A 4QG7A 1EB9A 2H1RA 4F06A 1PAUA 3FX2A 4PWYA 3T7EA 5L4LA 1YB6A 4M9UA 4MPPA 4LF6B 3AERB 3V97A 2ZGVA 1Z0KA 1EG7A 2HLDD 2O2GA 1Y3DE 4GMXA 4N12A 4P7KA 4XH9B 2GCPA 4O3FA 1XP8A 5BO5A 4RTMA 4KUEA 2H4XA 2P5TB 3ROMA 4AUNA 5ALHA 5E4FA 2JG3A 1SCUA 1V8FA 1ZL2A 3ETGA 1PJ4A 2QTVA 4IDFA 2IOQA 2GK7A 2G76A 2W22A 3H1PA 3R3HA 3WRXC 2EC5A 4DG9A 2ASVA 1T8UA 1A2OA 2XUHA 3FTCA 3L8EA 4MPRA 3R9WA 4KMRA 2O4UX 3QA3E 1UC4B 4NKRA 4RTRA 4YQZA 1V2HE 3RS8A 1BHSA 1D9XA 4Z2YA 1J24A 3K2BA 3R0JA 1S01A 2OG1A 4OK5A 1CY6A 4Q9NA 5FULA 3WLSA 3BAZA 4X1IA 4PV7A 4REOA 1ZD2P 5EUMA 3QE0A 2WILA 1RAAA 3I39X 3FKQA 1XAIA 1OX4A 1CB0A 1C0IA 4PZLA 3TRKA 1SVSA 1K8ZB 3QKSB 5DDIP 3SE7A 3SG0A 3D81A 3PGKA 4Z4QA 3E7WA 3AYZB 1XMQB 2FSHA 3ON5A 3SYLA 4C0HA 3WWPA 3ZGYA 4KGXA 4CGZA 3U7IA 1N5LA 3OZBA 1FY2A 4RORA 1E64A 2XQJA 1LKZA 1E1LA 1NSFA 1AQLA 1Z5NA 2CEAA 1OC2A 2MSDB 1EM6A 2QTBA 1GA1A 5BQ5A 1HDZA 5I7EA 3V1UA 5HKKA 5CFZA 1RM3A 4KDRA 2PSSA 5H3LA 2XOKA 4D96A 2VZ9A 1XNJA 4IJVA 3O9ZA 3GGJA 2GM5A 1GPAA 2J41A 2XYHA 1VMDA 3H8SA 4G67A 4HNAB 4RFVA 2XGJA 3PRHA 5IKXA 3W2IA 4MI6A 5EZYA 1VMIA 2PPLA 1GTMA 1B26A 2ON6A 4LV6A 2W2OA 3F96A 2F9LA 3G6KA 3LHKA 4LWZA 2FCRA 5AHWA 2BEWB 2CF6A 3C1TA 4MGKR 3HG7A 1AC5A 3T3EA 4C7OA 1MRZA 2GDZA 4N6GA 1PFYA 2D2FA 5EKUA 2I2CA 5HG0A 4D42A 4W1SA 2I62A 1ABBA 1PT9A 2P2NA 2YW2A 1IYZA 1OW3B 3H5TA 4J3FA 1E7QA 3V7WA 3SZ3A 5FUWA 3RVKA 2M6LA 3M1YA 3ECCA 3FHTA 2C9YA 2XWJI 3EULA 1RQPA 2GJSA 4IUBS 1XXHA 3H05A 5BYAA 3DVSX 4HXEB 4YJ2F 3R7BA 5ILOA 1BX0A 1DTSA 1RJWA 5IHPA 3DOIA 2CMHA 1DOHA 4ACAA 5JTUA 2R8YA 4PPYA 4GWGA 2GM3A 2KW5A 4JB2A 3M1AA 4IQ0A 3IQEA 4PO8A 1VGVA 1P60A 3FNQA 2R3SA 4Z51A 1EQUA 2PZJA 4JLBA 1YO6A 1RBQA 2QTWB 4OXNA 3WZLA 1I4DD 1SCKA 2I65A 1N5OX 3QLVA 2AKEA 1X7GA 3ZU5A 1E0DA 5FBWB 3GLGE 4AKGA 3M89A 4M1TA 4HO1X 4FC6A 4TLMB 2NIPA 4L78A 4URHA 2B9VA 3LFTA 3I6BA 4GLLA 4JXXA 4FFRA 1F4LA 3B3GA 5JLAA 3JQFC 4ZXFA 1KYZA 1LRLA 2QQFA 4IIJF 2D0PB 2DBYA 3D7NA 5AUOB 4Y30A 5A5VA 5KDOA 4YP6A 1NZFA 3TZQA 3UMYA 3NMUF 1Y1RA 1RNLA 3NTXA 3SZUA 1T29A 4FJ0A 1OVGA 2Z4TA 2JBAB 1H2AS 4PG5A 2P4HX 2V7XA 1ZMTA 3IUJA 4BO7A 4CCAA 4PYJA 3LC0A 4H59A 4DMKA 2Y8EA 4ZC8A 2J4FA 2BUBA 2EGUA 2GF0A 5TSDA 1WEHA 3FKJA 2BE7A 2HM7A 3PBKA 3FD8A 4ZRMA 2ENWA 4FOSA 5EFOA 1AZTA 4BECA 1HORA 4A73A 2IHJA 4CKEA 1E6CA 1D6JA 3PEEA 3W6OA 1Y6JA 1EE2A 1SU7A 3ETLA 3W34A 1YJQA 2IBSA 3SQOA 2ZDGA 3JQBC 5I9BA 1GHTA 1HSZA 2ZSJA 4GLBA 1DKUA 1W59A 3U4QA 1UPAA 3NWBA 3H1EA 4MEJA 2AKAB 2YFKA 5IM5A 4OCZA 2C2ZA 3JWEA 3WDSA 1DBWA 1JFVA 3Q7RA 3KB8A 3Q3HA 4P0PB 1V8PA 2ZJYA 1I51A 1UP4A 3MFQA 1L3BA 5A2QA 4I50F 4JJ4A 3E3MA 2HU7A 2VTKA 2YTZA 2R11A 4B6PA 2J0UB 1JW9B 3LMKA 1XCJA 3MILA 5DYIA 5CITA 2ZZKA 1XTVA 1Z6GA 2WHPB 3TW8A 4LJRA 2IUSA 1DXQA 1FUKA 1RIIA 3CCCA 3UYLA 3RJTA 3LP5A 3I8XA 1LS1A 2VAPA 3HJAA 1CRZA 4BUZA 4G4JA 3AEKA 4WL0A 4Y6GB 1RYYA 2E1RA 4OJTA 2X7HA 2NUBA 2MSNA 4BNWA 4DHEA 1U0FA 1C9DB 5CT6A 1KI8A 5D85A 3V55A 3OQ6A 3OF2A 1ZCFA 4PCUA 1QH1A 5IUJC 4X00A 1OXSC 2FPWA 3V1NA 1RI5A 3H2YA 4Y2QA 1K89A 2FLWA 4MZXA 4YP0A 4PC2A 1F4PA 4ZA2A 4JXZA 2IRWA 3WP0A 5BP7A 3K73O 1V6CA 4R2IA 1O8CA 1MN6A 4ZT6A 5L40A 4ARIA 3U7FB 1THGA 1K5DA 1GOTA 2QTTA 1Q0LA 3E18A 4MYHA 4TQAA 1F0PA 3ZVRA 2Q5HA 4WD3A 3BWEA 3S40A 1GUZA 1D07A 1NBMD 2PKQO 2QAJA 1V1JA 1QK5A 5HQ3A 3ILYA 1DC8A 3WGZA 3QTBA 1CF2O 3ZX4A 1N9GA 3IMFA 3NHRA 1NLUA 1XJ5A 1W48A 3B1YA 4W9NA 3TTSA 1AMOA 5M7EA 1BN7A 2G63A 2H4WA 1FB5A 2ZFUA 4BNVA 1KXZA 4D99A 3A58B 4QUHA 4PRYA 3NAZA 1EFRA 2QW0X 4ZCPA 3T1VA 4INAA 3T7CA 2R7MA 2BTQA 4CUKA 3R3VA 3NXKA 1PV1A 4HXFB 1T5HX 2CHUA 1Y4AE 4O4IA 3OUTA 4R1NA 3QLUA 4LXHA 3EPKA 5GJVC 2CUZA 2XOEA 3MBKA 1YRQA 4JFRA 1RJEA 2J8ZA 4MWBA 2A9OA 3G5AA 3DLCA 4MWZA 4RW0A 5JSYA 2HWKA 3RVLA 3I1YA 1KZYC 3GROA 4BYMA 5IT0A 4PZUA 1MX1A 1XQ1A 4G0PA 5FA5A 3O5AA 1MP0A 2XX3A 1TIPA 5AUPB 2YV2A 3KAPA 3IQHX 4PONA 4B0PA 4BWGA 3ZLBA 4D43A 4CQLB 3NTLA 1IK6A 3ZJUA 3EZGA 3VR2D 5FUQA 3DKPA 4I66A 4UNNA 4RJKA 2XB2A 2XNDD 4DT1B 4BPBA 2Q8PA 5K3EA 4FQ5A 4W8GA 3RBAA 3DOJA 2NQTA 3DEAA 1CDEA 1N1EA 2ZRMA 2OECA 3ACBA 1XA0A 5IUKC 3FSGA 4YAUA 2ONJA 3OQJA 3RVOA 3P9PA 4BX8A 3BD7A 1EIWA 3A7EA 2O0MA 4GUDA 4X92A 1N8KA 4Y2HA 1M33A 3KPVA 3WBFA 3ABOB 3FVRA 1NBWB 3A36A 4HQLA 1X9IA 4NR0A 5C4MA 1QHIA 3KZCA 4QECA 4Z7QB 4IGEA 3WWZA 5B1YA 4QU5A 1EFLA 1LJLA 1JJAA 3QBEA 1PZNA 4J90A 4EKGA 1E3DA 1HZZA 3G7NA 1G3MA 3GRKA 3TGWA 1FDOA 2A78A 4S0ZA 5ESWA 2VYNA 4A1FA 4HF7A 1JB9A 3AM4A 4AROA 3TAUA 3C24A 4B09A 1P1IA 3NIFB 4MIKA 3RHSA 4BNHA 4ARBA 1UANA 1I24A 4Q18A 4X7PA 1RHKA 2BY4A 3COSA 3FH0A 4YXWD 4XJVA 1ONBA 3KTAB 2D5CA 1VTKA 1YQUA 2JLXA 5KQPA 5DM4A 1PQUA 4J1TA 3PVZA 3DBLB 4B84A 2WK1A 1NOIA 3QXJA 1NN1A 3ESBA 3NWEA 4XWKA 3HXTA 1A7AA 3I1IA 3R09A 3U48A 1T4CB 2J9GA 1KAMA 2FEKA 4MWOA 1N8NA 3SPXA 5F2EA 5I6DA 3HVJA 3ZQKA 2ZBGA 1KDOA 1PZEA 3WLIA 1ADBA 4NBTA 2HQSA 2D0IA 1QV7A 1RQ2A 2HWUA 2P1ZA 3SBOA 4BE9A 1QR2A 4FDLA 1SOMA 2B25A 3WK8A 4D4GA 1L5MA 2NU7B 2QGNA 3PF8A 5BMOA 3KQPA 1FZQA 4IW3B 1C3EA 1DE0A 1RRGA 1VYHA 3BK1A 4GP7A 5KNDA 3OLWA 1U02A 1H5UA 2OO5A 3EPHA 4ZYWA 4DJ5X 4D8TA 2R6CA 2PR2A 2IWHA 1AGYA 3LCUA 3PPWA 4KAAA 1LS6A 3RABA 1FYEA 3UTDA 2BEJA 4LY9A 4NJMA 2IEBA 3E8MA 3FRHA 4G0YA 3TR6A 2JDIA 4F4CA 2IYLD 2HTFA 2PDAA 1FXSA 1QDEA 2R87A 1BEZA 2NYAA 1OKKD 5FCDA 1WZEA 3NM4A 1NVKA 4KR7A 1NN5A 2RAFA 3VHXA 3ESZA 4DV7B 3M6VA 4BMVA 4HRAA 1E2KA 1EFVB 4KH1A 2AKYA 5GM1A 4GU5A 2BGKA 521PA 4JC0A 1NXQA 1T2CA 3SIPA 4J0GA 3ICWA 2EGHA 2PSFA 3QMVA 1SC6A 4LWQA 1TDJA 4JKOA 3L0PA 4TYWA 4G4SP 3M4XA 4RYDA 3JASA 3PC8C 1WP4A 4ID3A 1UMBA 4KN9S 1PX2A 1UAYA 4LAFA 3S29A 4YDQA 1NY6A 3IMCA 1ULSA 1A88A 1NR7A 4AZ3B 3QH4A 4YGXB 4TTRA 1QE5A 1U9CA 2BFFB 2W6QA 1RPZA 4BLUA 1TA4A 2O59A 2AN9A 4J0HA 4PC1A 2I4TA 4ZMBA 1YZLA 3LDAA 3PGVA 3GT3A 3KHSA 3ZV3A 2VDWB 5B36A 2C4MA 4R9NA 1GUYA 1Q11A 2OILA 4AXXA 1YAHA 4WEOA 5F23A 4BVFA 2PU5A 4QIHA 3K1AB 4IDNA 3NHYA 2W0SA 4H6XA 3EUEA 3M6LA 2E49A 4IEFB 4K9PA 1B0PA 1OFTA 3G5LA 2R00C 4NMXB 4TRRA 3ZWVA 1ZWKA 3Q40A 4OSPA 5G0UA 2PNJA 2Z09A 1KORA 3E3NA 1E1CA 1BGWA 2O2XA 4F3KA 5J4LA 1Z07A 3L6CA 1SB9A 2GRJA 2NYRA 3ZDFA 4CMIB 2A94A 2XB6A 1HG0A 3QPUA 1SD1A 3TZHA 1I2MA 3WLQA 4DPLA 2Q5FA 1IXKA 3M2TA 4HFJA 4YP1A 3WMEA 5JAUA 3G59A 1ZN8A 3DMTC 1Q16A 5L3QB 1DC7A 2I6QA 1B8PA 4RVUA 1ODKA 3PRYA 4NBRA 5T8KA 4AG5A 5AXAA 1P1KA 1RI3A 1WD5A 1UJ6A 3WKBA 3FE2A 1WV0A 1SR8A 1KOGA 4L73A 5A6SB 1RQRA 2W6NA 2Y0CA 4JP3A 1F1JA 2O2CA 4R0NA 4OQDA 4C3UA 4H0NA 5BT9A 2BC9A 3JYLA 3PQ8A 4TXLA 5JCJD 5KREA 1NDQA 1KDTA 4XQCA 2VWHA 3FMVA 4MI1A 4FWIB 1Q5PA 2OV2A 3DDZX 1W30A 4FONA 4C4ZA 4KWHA 1U1CA 3AU9A 3DE1X 1VI2A 3PU6A 4M8LA 3WX0A 2B1GA 1SBQA 4Q7EA 4X8HA 5DX8A 1T6ZA 1IOZA 4Q66C 4NAVA 2YJZA 1U81A 5E6SB 1WHTA 3ILSA 1XTTA 4ZJYA 3WQRA 3BZWA 5JADA 5H02A 3I2HA 4NARA 4M0LA 4ZAZA 3CF2A 4H16A 1J07A 1B8VA 3JAWB 4YCAA 5E6UB 2YXBA 3OZIA 5EFZA 2QBYB 2ZBUA 1R6UA 2Q0QA 2VJAA 3GWZA 2BEUB 3RDPA 5FNVF 1CJKC 1NURA 4RPIA 4XGRA 2PMKA 1OLSA 1VMEA 3EQ9A 1ST3A 1FSSA 3PF9A 4RFSA 3ZJVA 2GF2A 4MUBA 5DGTA 1GCOA 1YUBA 2RGDA 5FORA 1XVLA 4QRIA 1PNRA 1H0SA 2AR9A 1PQYA 5EE5B 5L3ZA 3JQDA 3UMGA 4NZPA 4PICA 3USES 1RKQA 2ZXUA 3WWDA 1NLMA 4AY5A 4II7A 1GTSA 1M34B 1G0OA 3KU1A 3OZTA 3P8ZA 1H23A 4M0MA 4MSUA 4LJLA 3VDQA 5JXGA 3QF4B 5FWXA 5IKEA 3UVEA 4L9SA 3IQIX 4JS0A 1DC5A 5CNKA 1E63A 4ARAA 5C7IO 1EX1A 5LQKA 3OPYI 3H9CA 4IJMA 4LXGA 4QYWA 3S3TA 4LK2A 4IVRA 3HCAA 3HABA 1V7PC 1QGZA 1VIAA 4EW1A 1UEIA 4YV0A 4E5UA 2G80A 4JP5A 5MHTA 1XX6A 2WWWA 3AF1A 1IRXA 3DL4A 1BOOA 4RVOA 4UNIA 2CSUA 4I81A 4HNQA 3P9IA 9GPBA 1GAXA 1BFUA 3A32A 3DM5A 1C3XA 4DR7B 5KJ1A 2CFOA 3FTEA 1GFWA 3PKJA 3UJCA 1ZK2A 4LKRA 4CM6A 3FTFA 2GBLC 3R3YA 1QOZA 2QL6A 2RG7A 2PZMA 3D0QA 3KTOA 4FNGA 4K9NA 4BVBA 3JD4A 3JQGB 3GLIB 2W2TA 2HRDA 1I0LA 4WX2B 1ZKDA 1GSOA 5BUZA 2AMYA 1CEQA 1XRJA 3OH8A 4R1SA 2AOWA 2ERXA 1AQ6A 2LP4Y 2WSIA 2H1FA 3U7RA 5LXTA 1E9VA 5JNRA 1CWUA 3NH9A 2Q49A 3A9TA 3CW8X 3CUUA 3TXYA 1I7SB 1R8YA 1Z8NA 4QYTA 4YECA 5B57C 2PQ0A 5J2TB 3QHQA 2QNRA 3BK2A 2WTEA 5C5IA 3TYXA 4I4TA 3U49A 1PFQA 2QT9A 2I22A 1E77A 4INOA 4RKEA 1E0JA 1E3WA 1SN7A 2HMVA 3M7IA 1QH9A 4Q1EA 1UMCB 4QFDA 4C6TB 2Z5VA 4ESEA 4RK7A 4NY1A 3JAMA 1YDMA 5FPHA 4ZDIA 5KSWB 4ZO4A 1Q0ZA 3PI6A 5DW0A 4DR4B 4ACBA 2WJPA 3X1XA 2A1UA 1JNXX 3OPYA 2EFHB 4B3BA 1E0SA 1GTVA 4I1OA 2VYCA 3WWOA 1U6JA 1YZNA 3U7GA 3KJIA 3PRJA 1GPUA 3HUUA 1OZFA 4BGIA 5F51A 3TQFA 3ZIDA 1EA7A 4GIBA 5FWYA 1CKEA 2FPSA 1VE1A 1YS2X 3BEOA 2PQ2A 2ZCVA 3GJTA 1G6OA 1ZM7A 3T7RA 4S05A 4ZHQA 4UM9D 1IZ7A 2HMWA 3LBYA 2V98A 2AFIB 2OCGA 2ZUDA 3DGFC 1I4WA 4G0WA 3DO5A 3C6KA 2CSXA 1JT2A 4ZEVA 5KBYA 3N2EA 4F12A 2OV8A 4BXOA 5TJ9A 2OBMA 3AI2A 5D6NA 3ZVMA 2G1JA 1U7UA 3B1XA 1PR3A 3AJ8A 3BGSA 5C51B 3I05A 2GBFA 1WAMA 1W36B 1P9LA 5BSKA 4H31A 2FZLA 4MVJA 2RONA 3EFEA 4WZZA 3T9DA 1K5PA 1UK7A 1USWA 1XNHA 2HU2A 3B78A 4PAWA 4IZOA 3LT0A 4RE5A 3SDZA 4F9FA 3CJTA 3LGAA 2ZSUA 2PUFA 4MGYR 1JHVA 2G5GX 3T52A 1SK9A 3IBCA 4F4HA 1PT7A 1EI9A 1FU8A 1XTIA 2WHXA 3ECAA 2JFUA 3JWHA 1X1TA 1Y34E 4YWJA 2DEUA 1GCIA 2QSJA 5ALZA 3LUDA 4P31A 3VKWA 2OLKA 4KIJA 3VOTA 4HI0E 3CGWA 3NEJA 3GVXA 4KPUB 3TTYA 1EVZA 4UQPA 3LNCA 5AK5A 1JWAB 3NEYA 3QXXA 2GK6A 2AD5A 5CIYA 2CGEA 2XT0A 3L01A 5F2OA 1NQ5A 3K5IA 1ECPA 1KI6A 1RBYA 2EKBA 4N0EA 3CEAA 1NM5A 4R4JA 5IC6A 3W5VA 4B0OA 3KDAA 1QCDA 2JH8A 3PNSA 2CVZA 2LXNA 4QQRA 1TUBA 3E1SA 3OD5A 5KHAA 1QORA 2AN3A 3UIEA 1PBNA 5E9QA 3UAWA 1EZ4A 4EA6A 3WO1A 2PA0A 1Y5LA 4FK8A 1ZS9A 5KYUA 3I01A 1F2UB 3OZCA 3PFCA 4D57A 2PZAA 1SZCA 2BSQA 4ARCA 1K8RA 3CEJA 2P2SA 3ADOA 3TCXB 1EG2A 2OKCA 4B76A 3L84A 5EC8A 1I3LA 4LYJA 3LQRA 2Z08A 2CL5A 1GSIA 2VDJA 4KBYA 5IVIA 3IQZA 5C37A 4YAOA 2FSFA 5MGNA 2P2DA 4BMXA 2PXAA 3E3LA 3HV0A 2EIHA 1XAHA 4FFLA 1RS0A 1W25A 2JFHA 1YBHA 1CUBA 3GLVA 2B83A 5HFNA 1G2QA 1C41A 1T4DA 5DLYA 2JA1A 3HRKA 1PEAA 2V4UA 1C4WA 3IT2A 3MM4A 4FX5A 5ALLA 1W0KD 2P62A 1RWMA 1VLLA 5KYXA 3O4IA 3B3AA 4W5JA 2VDNB 1I4OA 4QQ8A 3TSOA 3CX4A 1ID1A 4YCBA 1EM8A 1T8YA 2AC4A 3T7SA 1O03A 1C81A 1MHTA 3HU1A 1JTEA 1UOQA 1ZAYA 2WE7A 2VUSA 4K9OA 4I6EA 1OC4A 5K0ZA 2WTUA 3DB1A 4QTXA 5DT9A 3C97A 2EJVA 4ZHQB 1BCRA 3CF6R 3NVKI 1QMPA 4B6FA 2VR1A 3R0IA 1BXGB 3R40A 3AV0B 4HSEA 3C5WP 5AHRA 4JLAA 1JPJA 4UVEA 4ZQHA 3ZDQA 3DLHA 1F5SA 4X1OA 3PQCA 2YJNA 4QYXA 2CBZA 4HNUA 4CKCA 1VL6A 3N2IA 4TN5A 1KO1A 4JBWA 1ZITA 2ZI7A 3VPBA 1G7CA 4JMLA 3WLOA 1IEWA 2OM2A 3ZI4A 4E1BA 5CA1B 1B93A 1YBFA 3VPCA 1R18A 4DDVA 3NT2A 2VA9A 1OJLA 4KN5A 4MIOA 4E70A 1FX0B 1YIDA 2R1TB 3UWDA 4DDWA 4RJLA 1MIOB 1SM4A 4KXXA 4OFWA 3E7FA 1TFRA 3U5TA 3HVRA 3F6YA 5CX1A 5E8JA 3ZHZA 1V35A 3DP7A 4R69A 5IH3A 3H6HA 4YO7A 1LDGA 2ICAA 3WLTA 1OLXA 2DY1A 2P77A 4RJ2A 1K3TA 1QQ5A 4LECA 4Q48A 4CLOB 5TQ0A 2O1EA 2VHEA 1V3UA 2AYXA 3ZE1B 2OCKA 4EGFA 2HIHA 4KOAA 4DPMA 5BWBA 1O6CA 3JARB 3HL4A 2I1QA 5EE0A 5SZKB 1N6NA 4Y9DA 1Y4SA 3GZNA 1I0IA 3TMAA 3ZWPA 4CEIB 5REQB 3U7JA 2FUEA 3RS3A 4X6XA 2HD4A 3H1GA 5AESA 3D8HA 1U4NA 2KE5A 4IOKA 4Y0NA 4LF9B 3PXCX 2Q2VA 1ZNZA 4PR3A 4WUTA 3Q7SA 2JLWA 1B00A 1IEVA 3KYCB 4BHTA 3H7IA 3EZ9A 2OWDA 1PHRA 3OC6A 2VS1A 1QO0A 4LTDA 4BOYA 3BRWA 1JLKA 2XUZA 3DAOA 5COQA 5LDGA 3WL8A 3O1LA 1Y6RA 4F1KA 4BLSA 4UMFA 4DIOA 4LKOA 3U19A 2XUKA 3VBEA 4RHXA 3BQ9A 2QRLA 1U0SY 4QOGA 1TEVA 3D8SA 4JT8A 3U44A 1KPGA 2FSSA 3P20A 2ZRPA 1S1CA 3EGXA 3HJGA 1PFVA 2HV8A 2QE6A 1AF4A 4ZRNA 2CD7A 1Z63A 4J76A 2J5KA 5DTIA 2AEJA 2P75A 3VH1A 1MXFA 2EJUA 4EEXA 1FP1D 1KFCB 4Y2PA 1E66A 1XHEA 2PWAA 3NHFA 2CHEA 2UZ3A 1GKIA 2B20A 3L1KA 4MYTA 1H9AA 2WLSA 3P97A 5CVCA 2VJCA 3AR8A 5AUQA 3ZY4A 4PG4A 4CI0B 1V3VA 4S1VA 2H1SA 1DAGA 2P6NA 4LN1A 2IV7A 3VNRA 4DSTA 1LDYA 1VHJA 5A9SA 1PD1A 2PH3A 1OB2A 2Q6OA 5CD1A 1FFXA 2R8XA 2QVCA 2Q0XA 3URMA 1MH1A 1RBZA 3VR5A 5B7QA 2QD5A 3P2MA 5KYYA 4TZ0A 1ZOSA 4V39A 4MAMA 1RRMA 1YE8A 7GPBA 2I3AA 5H3CA 2WWIA 3OMWA 4QUKA 1T3TA 4C14A 1DG1G 2CNNA 2ZYSA 1QTIA 3MT7A 3PXEA 4GO1A 1SG9A 2E5WA 1ZDMA 1AXRA 3EXIA 1G8PA 5FI1B 2VNHA 2F67A 4FBGA 4J9UE 4Q1DA 2QRPA 4GX2A 1UBJS 4QJIA 1GO2A 1RRPA 2LIVA 3HYNA 4Q9HA 1UC8A 4MI9A 4BJ5A 1UBTS 3MCUA 1CU1A 1GPYA 4ND3A 4ZWNA 4UUAA 3VI3B 1AMNA 4EABA 1EFPB 1QKJA 2D7CA 3GRYA 3IKMB 4FFWA 4QYIA 3PNPA 4G23A 4HK4A 3RJMA 5FTJA 4RUKA 4WCVA 2HRBA 4ME6A 3G8CA 4MWGA 3ZLUA 3FMIA 4A0GA 4RVSA 4DSUA 1UC5B 2VFAA 4N9QA 1HM5A 5K51A 2HJRA 4C43A 4KYUA 4D4LA 1SQFA 1S4MA 4OUKX 2B61A 1SMKA 4Y67A 3SQNA 1ZI6A 2ECPA 3O8OA 2O8EB 3TEFA 1SKYB 2Q4DA 3DFZA 4U2DA 5HUHA 4TYQA 1R0ZA 4BNFA 3IXQA 4US2R 4J9VA 4NU5A 3P26A 4FN5A 1YJ8A 5KWVA 1LBQA 5ADUS 1ZVVA 1JXMA 5CYOA 2CK3A 1AKYA 3FLAA 4GX5A 3H5LA 3D1LA 4LRSB 2ZIXB 4N1AA 4J1SA 1U1DA 5LA6A 4D41A 3A2LA 1VBNA 3MWDB 4N18A 1NMQA 2JFYA 5A2GA 1H93A 3GL9A 1ZICA 4R2MA 3NBQA 2BGGA 1U2TA 2R9VA 2FOXA 3OHSX 1OILA 2IHZA 1UOEA 4KSBA 5CXSA 5D86A 4S3MA 4XSGA 4V38A 5JSKA 5DSXA 4BBZA 1XDDA 2P5UA 2VK4A 4NU6A 3WBBA 2O2IA 4FZVA 1N2GA 1M67A 4KFUA 1NNUA 1Q44A 4WLEA 1GT91 4N5LA 2O8FB 4Y6PA 3HB9A 1N4AA 2ZJ7A 2IS2A 5D1NA 4JHXA 1Q22A 3RKSA 1KSHA 1JIIA 4HEA6 1XLTA 4A7PA 4JROA 5LDDC 1QC5B 5DE3A 1PR6A 2QL5A 4U8HA 3IL2A 3W4IA 4R1QA 1U0JA 5IANA 3TIIA 1T9AA 3D02A 3F6CA 4HDQB 1WEKA 5TPZA 1F38A 1KEZA 1T4BA 1J1ZA 5EQFA 1KI2A 4BGUA 3GH1A 4LOAA 3RSCA 4BNDA 1QJ4A 1QO9A 2H52A 2RI6A 4H1WA 1NVVQ 3GDWA 4LOHA 3DAPA 4QEDA 3V9PA 4AKTA 5HRAA 4IRXA 4RXTA 2BGIA 3FA2A 1Y5RA 1W1IA 1XU7A 1N5KA 4DG8A 4RMJA 1EHIA 2DJIA 2IEIA 1GZ3A 2EF1A 3OWHA 3OC0A 4FTWA 1M2GA 2ZTMA 4KLZA 2XWBF 4DUGD 3RFVA 3MINB 3BICA 1DT5A 1TAHA 3N2KB 1M2VB 1DOAA 1H2EA 2Q6IA 1F5NA 2X2OA 5D3QA 5LQAA 1M0TA 2V58A 3AETB 4J2TA 3R8XA 1BCSB 3AFIA 3BMQA 1AKMA 1LVGA 4B3HA 4NOJA 2GEKA 3I30X 4RY2A 3PQEA 2AWNA 3ZDDA 4TRMA 3GUUA 1KPHA 3K9HA 1RZRA 1GR0A 3A31A 2GN0A 5EXDA 4G84A 3DOEA 1X2EA 1EBUA 3D7KA 5DOZA 4AWBA 3KAQA 4MS4B 2FFAA 3GGGA 1CEYA 3LK6A 2Z8ZA 3KHTA 1XMPA 2P4EA 2ZJ5A 4XVQA 3W8FA 3W9SA 1PL0A 1EB8A 3I34X 4KMSA 4WZ6A 2XRFA 3I5YA 2F62A 2HMTA 5F5LA 1OYOA 3HGTA 4NG4A 2NN3C 2P9TA 2VJNA 2V0NA 2V55B 3DDSA 1EUCB 4I8DA 5KOJA 1ECBA 3TSZA 2H1LA 4NMMA 4Y18A 1LLDA 3DF9A 3UTCA 4C5CA 2DUWA 2DX7A 1AS2A 1P73A 1VJ5A 2CDNA 2HDOA 3BDIA 4GVPA 1T6NA 4UAUA 1Y0BA 3DEYX 2WF6A 4LC1A 1RRFA 5EMMA 3GLHE 4YRSA 3IIIA 1UOOA 3LWBA 5EHGA 2B3TA 3MCVA 4HDSA 4HGYA 2EDAA 2RBEA 4BQQA 4R9VA 4KXVA 3G82C 1U2ZA 2C5GA 1PKEA 1OAAA 2ZS7A 2AG1A 2HBYA 3BE6A 2I4OA 2QM0A 1IN1A 3NTUA 1JLLA 4KAXA 1AQJA 5KMGB 1WF6A 1Y6FA 2QD1A 4O2BF 2MJLA 1KMMA 1MORA 4BB5A 1Q0PA 2G8NA 2FDXA 4UULA 5LB4A 3ZWOA 3ZVNA 3L1HA 1YB2A 3GJ8A 5AW5A 4WK4B 4DWVA 2IDZA 3AY3A 1OGYA 1OROA 1C1YA 1Z0UA 4K6GA 1KYIA 4G65A 4HCJA 1TE2A 2CLLB 5FQOA 1DDIA 2RGNA 4RZIA 1IZ0A 4OHOA 4EYSA 2WF7A 3OCVA 3QPCA 4GECA 4PRZA 1SKQA 3I53A 1Q95A 2AMFA 2WHRA 2OHIA 1DTWB 3KXIA 2Q4BA 5J47A 2JFWA 4D7AA 3D3QA 3THWB 1IBRA 5DYNA 2HRZA 3FYUB 1N2CA 1SBIA 5JOQA 4N5DA 1SBHA 2B4TO 1SIUA 2QVZX 5CT4A 3K9NA 5EUCA 2G06A 1SKBA 2CLIB 5H4GA 2VJBA 4CCYA 5LU9A 1NQVA 2GETA 3TW6A 2C7OA 4G25A 1ZD9A 1USIA 4OOFA 5FOXA 2YMQA 1BS9A 4N8SA 3EG9A 1QIDA 3PFKA 1SUAA 2REOA 4U1RA 2HCTA 5JWHA 3Q7EA 2PU7A 1A5TA 1VE5A 3KAKA 1QF7A 4HNHA 4CEHB 1NOKA 1GGNA 4DWWA 2REQB 1GQRA 1P2UA 3KJGA 2G1KA 4E03A 4N7RA 3TTWA 2QUJA 3EC2A 1DI0A 3T5TA 1GRQA 3BXOA 1NPTO 4XA8A 1GIAA 2AOTB 2VOEA 5DHAA 3P0HA 4KKVA 3IT3A 3AP1A 4KODA 1FRQA 2JI4A 1W1UA 3IUBA 3LBAA 3BZBA 4MO9A 3F47A 5AI6A 5CBPB 3AKYA 5JT1A 1QTQA 1VDMA 3LVRE 5A02A 4YN3A 4W9NC 1GQFA 3MAJA 1KZGB 1XPOA 2BCJQ 2WJGA 4BO5A 1XPRA 2D5BA 4RIFA 3W3ZB 4Z4GA 3U0BA 2FWIA 2IEAA 2AI2A 1CHDA 3SYRA 4IV5A 1AJEA 3JWPA 1KY3A 1SC3A 3ABQB 3NHAA 3QLUC 4KQXA 1LBTA 2H92A 1JIXA 4LUCA 4DM3A 1CQXA 7REQB 5E0OA 1DV1A 4OHRA 1WZIA 4WXHA 5C5CA 5AW0A 4ZOEA 5JDIC 4REQA 3RYCB 1ZX1A 1RD4A 5HFJA 1ZD1A 2WBLC 3RUFA 3Q15C 3HN6A 1IDOA 5JBQA 1U3FA 4IX9A 3L7JA 2ZYUX 3OTGA 2HBRA 4EB8A 2D74A 4IQGA 3R7DA 1R4ZA 4KB5A 2SCUA 3K72B 4EENA 2FQQA 3RVSA 1GDHA 3PGA1 3LLUA 3HWRA 1K5GA 4IJKA 3IILA 3R77A 3AGQA 3HZOA 4XUDA 5DCUA 2PAAA 1SBYA 2YHIB 4KYTA 4YRDA 3ZU3A 1ZR4A 4DIMA 2ZRJA 4YONB 2HJHA 1MV8A 3RAPR 1OT3A 2B6HA 3ZD8A 4QU8A 3ZS8A 4EPWA 1Y33E 4D82A 2RC5A 3KFLA 1PR0A 2MDTA 2IXFA 4G0MA 4GYJA 1AKTA 4DMFA 2VN8A 2HGZA 4YJKA 5KX5A 4Q5IA 3O26A 4DQUA 2SBTA 4F85A 1SBZA 4OHFA 4ENTA 3A1CA 3PC2A 4O3MA 4KK3A 3NC4A 1RYEA 2HCBA 3GIDA 1U1FA 3LXXA 2XOKD 1NRXA 1OI2A 2VTVA 1F8YA 5JBIA 4CMAA 3DWFA 1YZ3A 4B35A 1IUKA 3KQLA