2Y6UA

Peroxisomal alpha-beta-hydrolase lpx1 (yor084w) from saccharomyces cerevisiae (crystal form ii)
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
379
structure length
366
Chain Sequence
QNRFKKETKTSASWPRAPQSTLATDRLELTYDVYTSAERQRRSRTATRLNLVFLHGSGMSKVVWEYYLPRLVAADAEGNYAIDKVLLIDQVNHGDSAVRNRGRLGTNFNWIDGARDVLKIATELGSIDSHPALNVVIGHSMGGFQALACDVLQPNLFHLLILIEPVVITRKAIGAGRPGLPPDSPQIPENLYNSLRLKTDHFANESEYVKYMRNGSFFTNAHSQILQNIIDFERTKGPVRTKMEQAQNLLCYMNMQTFAPFLISNVKFVRKRTIHIVGARSNWPPQNQLFLQKTLQNYHLDVIPGGSHLVNVEAPDLVIERINHHIHEFVLTSPLQSSHIPQLTLEERAVMFDRAFDSFKNEALVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PEROXISOMAL MEMBRANE PROTEIN LPX1
publication title The Unusual Extended C-Terminal Helix of the Peroxisomal Alpha-Beta-Hydrolase Lpx1 is Involved in Dimer Contacts But Dispensable for Dimerization
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 127
structure length 366
sequence length 379
ec nomenclature ec 3.1.1.-:
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y6uA01
4Y2YA 1WHTA 1CUGA 2WUGA 1EDBA 3NUZA 3KOOA 1BN6A 2QOEA 3FYTA 3V48A 2PKYX 3DYIA 4FLEA 3HRHA 5A7FA 4J0CA 2PBLA 4XVCA 3IURA 4Q1VA 2WKWA 5HFNA 3G0DA 4C89A 1FFAA 1J06A 1Y37A 1CUSA 2R8BA 3BIXA 5E4JA 4KEAA 5ALFA 1VKHA 1N1MA 1ACLA 1LPMA 4YK7A 5ALJA 2OAEA 1CUAA 1DT5A 2BGRA 3C87A 2JGKA 2VT7A 1W6RA 3EBLA 5AK3A 4ZI5A 5EIEA 4C4ZA 4X85A 4BRZA 4QDUA 4J0JA 5JAPA 4G9GA 3AILA 1A7UA 5HF6A 2V98A 1QIJA 1Q0ZA 5CT6A 3PUIA 3ZWQA 2Q0XA 1QGED 4QZVA 4WY8A 4X3CA 3WIOA 1MX9A 2IIVA 3QMWA 3FAKA 1DX4A 4Q3LA 3DJYA 1NU6A 3L1IA 3RLIA 4ZXFA 4KAAA 2B20A 5CXUA 5IVIA 3GELA 4BTVA 1JJIA 4W1QA 3D5EA 2ZJ7A 2XMSA 1GPKA 3G9UA 5AIBA 2BAGA 2C7BA 3RARA 4CI9A 4M0FA 5LLSA 1KU0A 1GKKA 4CCYA 1G4HA 2PU7A 1XZJA 3R3VA 3IUNA 3ICWA 2QT9A 4HTAA 1CEXA 5FPPA 1EVEA 3IUQA 4W9RA 5A71A 3SX4A 4EBBA 4UHBA 4C87A 4RE5A 4Y7DA 3BWXA 3I2GA 3FBWA 5A2GA 3D2AA 2HADA 3H2IA 4QNNA 3EQ9A 1EH5A 1L7QA 1QIKA 1H2XA 5FP0A 4FNGA 1QTIA 1B6GA 4X00A 5DJ5A 3DOIA 3WYDA 2VEOA 5CBKA 1UOOA 3FLBA 3WK6A 2YASA 1CLEA 5LP1A 5AM0A 3FLAA 1DWQA 1ZD5A 4Y2JA 3E4DA 5JIBA 4X93A 4BC0A 2CMFA 3RM3A 4J0HA 4CG2A 4WJLA 3PUHA 4H7JA 1ZIYA 3VJKA 2ES4A 1F8UA 1P0IA 3FYUC 2QXUA 2OG1A 3LIPA 3WJ1A 3DEAA 1YSCA 4PNZA 4ROTA 1QE3A 3WA6A 3WQHA 2VF2A 1XLVA 1LGYA 2H1IA 3M83A 1K5PA 1JKMA 4FWBA 5BOVA 1XZDA 3ZLUA 2GZSA 2CBGA 5ALOA 4F0JA 3WYNA 1BCRA 4Y2VA 5JASA 4WDQA 1QIMA 4J7AA 1O6FA 5A6VA 4WCVA 3FWHA 5SYNA 1IMJA 4DM7A 4FNMA 3IA2A 2WG2A 2J3QA 3FNBA 2Y2UA 3V1NA 3O9MA 1CUEA 2HM7A 5AI4A 2PX6A 3E0XA 2WG0A 4O08A 1WB4A 3DOHA 4FTWA 1GQRA 5IVHA 1UT6A 1J2EA 4EY5A 2OAGA 1HKHA 5A7GA 2WIDA 4L72A 1FFEA 1XQWA 4ZRDA 1F0NA 2PSJA 3LS2A 3OM8A 5AP9A 5D6OA 1CUWA 1JT2A 1AURA 3QITA 1H22A 4GHWA 3BJRA 3IDAA 1LLFA 2QKYA 4LHEA 4QDZA 3PI6A 5ALTA 5C8ZA 3W9BA 1GQSA 1BEEA 2AJ8A 3ANSA 4FFWA 4X6UA 4PV7A 2I78A 4M0EA 2XUJA 5ALWA 4B0OA 2Y6VA 1EI9A 2HHAA 3B12A 4XJVA 4XWGA 4G8BA 2VAVA 3C5VA 3A2MA 4YX9A 3MUNA 2RAUA 3C45A 4Y2RA 3ESDA 5IH7A 4DNFA 1L7AA 4W1PA 2JGLA 4QA9A 2ZYIA 4NZZA 1GPNA 3ED1A 2G63A 1XLUA 2WIFA 4UUQA 4AQDA 1VZ2A 3D2BA 1T4MA 1UOQA 2HRRA 3WWPA 3AZOA 3H18A 3NGMA 4Q05A 4Q82A 3TEJA 4X92A 1XROA 3W9UA 4W1RA 1DWOA 1ODSA 1CUDA 3SWWA 2Z3WA 3S8YA 1TKRA 2XMZA 3C6YA 1ZD2P 3T52A 2HA7A 5AKYA 4H7EA 4OSEA 3QM1A 5T4EA 1CV2A 4LYEA 5AKZA 4S0XA 3ZLVA 4OU5A 2HIHA 1USWA 4E46A 1K8QA 3GROA 4KRYA 2VSQA 4RNCA 5CT5A 2OCIA 1LBTA 4DLNA 3LLCA 4K2AA 3H2HA 2HDWA 4WFKA 1N5MA 1C4XA 4X6XA 4L0CA 3HACA 1ETHA 1FFDA 4BE4A 3ANTA 1E8DA 2J4CA 1YS2X 1XZBA 4Q34A 2WU4A 5FDFA 2WTNA 3F97A 4INZA 4K6KA 5HFAA 1CUCA 1CRLA 3I2FA 2QUBA 3OOSA 4YPVA 5JZBA 1EHYA 4JEIA 5JZSA 1WHSA 5AM3A 2OGSA 3IUMA 3STWA 3GZJA 3V9AA 1KU6A 4Y2UA 2G4LA 1I6WA 2CKMA 2DHEA 1EB9A 2PSEA 1LPOA 4GECA 2HU7A 1IZ8A 4BAGA 2QM0A 4TGLA 3V1LA 3AINA 1JMYA 2QS9A 3H04A 3QPDA 4KE7A 1ACJA 7YASA 2I3DA 4DYHA 3U1TA 2J4FA 3FYUA 4IHAA 4UHFA 1JJFA 1PV1A 2DR0A 1QFSA 2JGFA 3OPMA 3R40A 1GZ7A 1DU4A 4C4XA 5BWBA 3ZPXA 1E5TA 3QH4A 4U2FA 5AKHA 5DYYA 4N8EA 1NU8A 2ZSHA 3VISA 3ZLTA 4J03A 2VT6A 4X90A 4HVTA 1C7JA 1ZGCA 2DFPA 3HI4A 1CUUA 2VJAA 3O4GA 1XRRA 2XMGA 4OB6A 3SK0A 3G9XA 1F6WA 5FPQA 1XFDA 4UBNA 4ARBA 5CT8A 2XB6A 4UBKA 4BP8A 1UOPA 4AO8A 4AX4A 1CUJA 4OB8A 3C5WP 1XZFA 2QXTA 1R50A 3C43A 1W4LA 3H2KA 3Q0TA 4N5HX 3I6YA 4G4GA 2CJPA 1WB5A 2ZJ6A 3BDVA 2RGUA 4AO6A 2JBWA 2XUPA 4QWMA 1TIBA 1A8UA 4KYVA 5HF5A 1MU0A 4AO7A 4EUSA 2BGNA 2FJ0A 4G4IA 2GYVA 1XKLA 3WIBA 4QEKA 5JANA 2X8BA 4FDMA 3UUEA 4KJXA 1R9NA 3FVTA 1EK2A 1ZJ4A 4A5SA 4WY5A 1LPAB 1ISPA 3EQ7A 4MEBA 4E11A 2PSHA 4PSCA 4GLBA 5C8VA 2ECFA 1HLGA 3HC7A 4MYDA 5ALXA 3F67A 1XZAA 4PSUA 1ZOIA 1ORVA 2Z5GA 5BWCA 2HRQA 1UKCA 4HXEB 5LZ5A 1DQZA 2GYUA 2VAXA 4J0GA 1FFCA 2FUKA 4DMKA 2RIPA 4FKBA 4DSAA 5JADA 2XQGA 2WFLA 1PJAA 2OXEA 4B84A 1XKTA 1LPSA 5AK5A 4FFVA 1A88A 3A2NA 5I8PA 2XUOA 5AK6A 1MPXA 1QOZA 3R41A 1ZICA 1WB6A 2EEPA 3WZLA 4EY4A 4GEGA 2PUJA 2ROQA 1G66A 1ODCA 4AXBA 1MTZA 4B9EA 1GGVA 4QLOA 2WILA 5AM4A 4QE3A 4DGQA 3CXUA 3F96A 4X91A 3BF8A 4B82A 1VZ3A 3G0IA 5FLKA 1UK6A 3OG9A 2ZJFA 5EHZA 5AI5A 1N5RA 4M0MA 5EGNA 4DIUA 1XRMA 2BKLA 1MO2A 1XRQA 1BE0A 4UPDA 2PU5A 2XUAA 3H2GA 3I2HA 4TPKA 3WL8A 5K3DA 5JYCA 3KD2A 3K6KA 3PFCA 2E3JA 3D7RA 1RP1A 2O2HA 1CUBA 1JMKC 3WKBA 2XMBA 4HRXA 3CCBA 3M82A 5AOCA 4UHEA 5JAHA 2AJDA 2XT0A 1GT6A 4E15A 2VJDA 1OXMA 1H2YA 3WWOA 5JD4A 5AKIA 2GBFA 1CR6A 1YB7A 2OCGA 2WTMA 4B7ZA 2CEKA 5ALPA 3H2JA 2XUHA 4H35A 1LPNA 4H18A 2JGEA 4P9NA 2VTVA 1CUZA 3DD5A 4UHHA 3QPAA 4P93A 1AMNA 3V1MA 2BUCA 3H1AA 4MJ3A 3F8SA 1U4NA 2WIGA 3MVEA 1YCDA 2D0DA 1D07A 4ETWA 1R1DA 1EXWA 4U2EA 4HXGA 5C81A 1EB8A 1SCIA 3R3XA 2WIKA 1MX1A 5AKJA 5K3FA 5ALHA 1G42A 3M81A 2UZ0A 1C7IA 1ZI8A 4BZZA 5AOBA 3PE6A 5H3HA 3G0CA 1QIGA 4WFJA 2WM2A 1ZIXA 2O7VA 5JZ9A 5DLPA 1CUYA 1IUNA 1TRHA 4ITVA 2WJ6A 1QFMA 3C8HA 1HQDA 3KWJA 3EIOA 3WWCA 1XRLA 5AM2A 3DNMA 1DWPA 2BUBA 3K9BA 3RK4A 4H7HA 1DTEA 1AUOA 2DQZA 3IULA 5HK8A 3VJLA 2WIJA 1GPLA 2R11A 4BATA 3R3YA 1RWQA 4JYMA 4B6GA 5AKKA 3H1BA 3F98A 3K2IA 5ALIA 4RPCA 4UHDA 5AIAA 3QMMA 3QBJA 2XQFA 3TGLA 1E8NA 2QJRA 2ZYSA 4GI1A 4KE9A 1VJ5A 3AZQA 1E89A 5HCUA 2B9VA 2OCLA 2WJ3A 3A70A 3M3DA 5J3JA 2XUDA 4KE6A 1P0QA 2WUDA 1YASA 5KREA 1DX6A 4AN1A 3C6XA 3FLEA 2JEYA 3CN7A 4G9EA 2FX5A 3OURA 3WK8A 1UK9A 2HA0A 5DNWA 1SOMA 2GBIA 4WFIA 4ZV9A 4EY7A 2OPHA 2PSFA 3STVA 4KAJA 2K2QB 4EA6A 5AOAA 4OYYA 1L7RA 4U2CA 2DQYA 1TCAA 1AQLA 5FOQA 5DTJA 3MGAA 4C4YA 1BS9A 1QZ3A 4BBZA 3FCXA 2QMQA 3BIWA 3GBSA 1ZI9A 2ACKA 4HS9A 1WPXA 5IVDA 2XE4A 6YASA 3L1HA 4FBMA 1EX9A 4LXGA 3FSGA 4QLAA 1LPBB 3FOBA 1VXOA 5HF9A 2OLEA 4BE9A 3KDAA 4MQMA 2Z8ZA 4KR0A 4W1SA 5SYMA 4F60A 3JWEA 4CIBA 2JEZA 2ORYA 4GBGA 3WK9A 5AI9A 5AI8A 1TAHA 4KACA 2WSLA 4C01A 2HFKA 4HZGA 3WKDA 1Q0RA 3L1JA 2JIDA 3WL5A 1YA4A 3IUJA 2HU5A 3BJMA 2RI6A 2XMCA 2QZPA 2OGTA 1QIEA 1H2WA 2VQ6A 4H0CA 5CH3A 1OCEA 5ALQA 3WL6A 2YYSA 5ALNA 5ALVA 4NS4A 2WUEA 3SC2A 5HQ3B 4DNQA 2H7XA 3OTQA 4X95A 4KRXA 5ALGA 3G0GA 2X76A 1IZ7A 3QMVA 2AJBA 2YXPX 3QVMA 4MQLA 4GW3A 5C8XA 3QPCA 1H23A 2WU3A 1IUPA 5K5EA 4X7BA 3WK4A 5FKJA 4Y2TA 4ZV7A 1HL7A 4N8SA 3N0TA 3Q8WA 5ISMA 4PF1A 4BB0A 4B81A 1E3QA 3JYHA 1UXOA 4NVRA 3CCCA 2OQVA 5FUMA 1WPRA 1LPPA 2XLBA 4UFOA 5AI0A 1GXSA 5AHXA 5A62A 4I4CA 3KXPA 1T2NA 4F5ZA 3DYVA 3WLAA 1VE7A 1EVQA 4LXIA 1MNAA 1VLQA 2Y2VA 3OC0A 5IKXA 1Y7IA 4X6YA 1PFQA 1THTA 1EINA 3PFBA 4DSZA 4K5QA 2XUFA 3O4HA 5AJHA 1UZAA 1AKNA 5LZ4A 5I9IA 1E66A 5ALSA 3P2MA 3WI7A 2DCMA 2XMQA 2WFMA 3D3NA 2QR5A 1JFRA 1YB6A 3IBTA 4B80A 3IIIA 2C0QA 4LIPD 3VVMA 4CG1A 3HJUA 2W22A 4MWTA 4IH9A 4JUIA 4UBLA 4BCBA 4FHZA 4L9AA 3DQZA 1UKBA 1QIHA 4NMWA 1W52X 5EHXA 4LYDA 3O4JA 4CCYB 1W76A 5AKEA 3NOXA 3WK7A 3GA7A 4A16A 4A23A 4CIAA 4FLMA 3LP5A 1CQZA 2PM8A 3S2ZA 5LKRA 4H7KA 1AX9A 1VXRA 5AO9A 3MUOA 1M33A 5AI6A 5A7HA 1TK3A 3R3ZA 5LZ9A 1QJ4A 1QIFA 4KE8A 2XMDA 2QTBA 2WLSA 3HEAA 1FSSA 1G5FA 2PL5A 5K3EA 5T4BA 2ONCA 1CVLA 2WFZA 5AH0A 1XZHA 3AZPA 1MJ5A 1BROA 2XQKA 5ALYA 3I2IA 1XQVA 4P92A 3AIOA 3DL4A 2RHWA 1VA4A 1LNSA 2O2IA 3G0BA 4TVKA 1QO9A 3KWFA 1LZKA 1Z68A 4B9AA 3QZUA 4OU4A 4MYSA 4GWLA 4N8DA 3O4IA 2DSNA 3DLTA 5DYTA 4Z49A 4IH1A 4GDMA 1XZCA 2X5XA 4FOLA 3I6ZA 4BVLA 2H7CA 3O95A 1CUFA 5FV4A 4J0KA 4LXHA 2GBGA 3DKKA 1UKAA 1Y7HA 4XX1A 1Q83A 4BYMA 5JD5A 2OQIA 1B41A 3VXKA 3U0VA 4UBOA 2HL6A 4EHBA 3QYJA 1MAAA 5AKXA 5DNUA 1AC5A 1QIIA 5YASA 3X3HA 5AM5A 2H7YA 4CCWA 5K3AA 5BV7A 4F21A 4HRYA 2HA5A 4I19A 4OB7A 2XLCA 2BFNA 3D59A 4AN0A 1ZD4A 1S8OA 2I3ZA 5LZ2A 4G8DA 1HPLA 1YAHA 3DDUA 4G1FA 2C4HA 2XDWA 5DWDA 1MAHA 1LBSA 1O6GA 1JU3A 1R4ZA 1UFOA 2XQJA 3ICVA 5LIPA 5EIAA 1F0PA 4Y2QA 5C7YA 3BF7A 1UK7A 4OCZA 3JW8A 1SC9A 1XZGA 1U65A 1YR2A 4B85A 5E4TA 5CMLA 4EY8A 1AGYA 1SCKA 1MN6A 3VVLA 4H7FA 4MEAA 4JH0A 1QIDA 5F4ZA 3VJMA 3WMRA 4ZREA 2CZQA 3GUUA 1FFBA 4QDOA 3O0DA 4AMZA 2EDCA 4PQEA 3FVRA 1VE6A 3WKCA 4E14A 3R3WA 2H9YA 2JGJA 3IB3A 5CTAA 2QVBA 5E4YA 1DINA 5EHQA 4KAFA 3HYSA 5DYWA 4JYPA 3E3AA 3I6MA 1N8SA 2XUIA 5CW2A 1GKLA 4MWSA 2RHTA 5LYYA 2G5TA 3W2TA 5EHNA 2O7RA 1X70A 4OUKX 2AJCA 1A8SA 2GBCA 3IVMA 4HAIA 5JATA 4MXDA 4U2DA 5JAOA 4DNOA 3I2KA 3BL8A 3DS8A 3H19A 3WKEA 3W06A 4GXNA 3C70A 2VJCA 5JD6A 2PVSA 2QJWA 3STUA 2WHPB 3AIKA 3PF8A 4IH4A 5EIHA 5ALDA 1EDDA 4BP9A 1MT3A 1FJ2A 3W04A 3DL7A 4QDXA 4DMHA 1VOTA 1Q84A 1ORWA 2ACEA 4OPMA 4BDTA 3ESAA 2XUKA 5K3BA 1WOMA 2LIPA 3LCRA 3T4UA 4B83A 4PO3X 5D7BA 4C6HA 2WG1A 5D3KA 4N5IX 4ZGBA 3CN9A 4DMCA 3LIIA 4Q3OA 5EFZA 4DNPA 1ZGBA 1CUHA 4I3FA 1K4YA 3I2JA 2QUAA 5KWIA 4U2BA 2V97A 4X71A 5ESRA 2CB9A 4EZIA 4UBMA 4H7DA 2ZYHA 5JARA 1J1IA 3N2ZB 1XZMA 3A6ZA 3EF3A 3AFIA 2V9ZA 4K6HA 5JAUA 4BCDA 3I1IA 2AJLI 3BE8A 1X2BA 4H7IA 1ZD3A 2BJHA 2Z3ZA 2GYWA 1CQWA 3H17A 3BXPA 3STYA 4EB0A 4Q3KA 1CUXA 1P0PA 2XQIA 5AKGA 1W1IA 4UBIA 4BC1A 1CUVA 5HF8A 4Y9SA 4BVJA 5HK9A 5CT4A 3DKRA 4IO0A 3R3UA 3B3QA 2B61A 3G8YA 4G5XA 5CT9A 2AXEA 2VATA 3PDCA 5IVKA 4IQ4A 3C8DA 5LZ8A 2WHQA 3FYUB 4FMPA 1YS1X 1VA5A 3HABA 1UWCA 3UUFA 1YA8A 2PUHA 2DHDA 5HKBA 2OGZA 5LZ7A 5CURA 4D9JA 1EA5A 3VDXA 1TCCA 4BRSA 3WWEA 2XMRA 2HA6A 3STTA 4LKOA 1MX5A 2YH2A 1ZI6A 2Y6UA 4OYLA 4OD0A 1RYYA 1EK1A 2NW6A 4J0IA 3C6BA 3AIMA 3GFFA 5ALEA 2HU8A 2VJBA 3PICA 4UBJA 1TQHA 3NWOA 3WZMA 5KWJA 3F9CA 1X2EA 1BCSA 3WWDA 4C88A 4BTLA 1XZLA 1JJBA 2IITA 2WHPA 1XLWA 2C0PA 1WM1A 3H0CA 3V1KA 5T4FA 4AB1A 4Y2PA 5ALUA 1WCYA 5KBYA 1IUOA 4EY6A 1XZEA 3STXA 2HA2A 1LZLA 1TCBA 1DQYA 4H77A 5CH8A 2Z8XA 3G9TA 2B4KA 1JU4A 3ZV7A 5T4HA 2D5LA 1P0MA 4CFSA 2G5PA 2PPLA 3VKFA 4J0DA 4YASA 2WQZA 4BAZA 3I28A 1CIJA 3FSGD 3C6ZA 4RGYA 3KSRA 1XRPA 5AM1A 3RKSA 3AUKA 4ZWNA 4L3WA 1JI3A 1THGA 1YAJA 4V2IA 3HLKA 4UFPA 3ESBA 4X94A 3W05A 2FJPA 1U8EA 4BVKA 2XUGA 1BU8A 1DT3A 4K6GA 2CUTA 5DNVA 1K63A 2GZRA 2JF0A 2V96A 2W6CX 5AK4A 5E2IA 1QONA 4PSDA 1CUIA 4G8CA 2HA4A 3WA7A 4W63A 2BUAA 2HFJA 4QWWA 3WKAA 3ILSA 1EDEA 3TJMA 4WDRA 4JNCA 1BEZA 1BRTA 3G02A 2WFLB 1R88A 2JGIA 2O2GA 3WK5A 1IVYA 1XRNA 1HDEA 2BCEA 1UK8A 5CH5A 4BDSA 3D2CA 1CPYA 1A8QA 1NX9A 3YASA 2P8SA 4P08A 4FLFA 3DCNA 5JALA 2WJ4A 3D0KA 2C5FA 4BCCA 4AZ0A 2WHRA 2XUQA 2IX9A 1CFJA 4U2GA 1XQYA 3I1YA 4DTCA 4UFNA 3D4LA 3PF9A 4Y2XA 5LKAA 3UMJA 4J3JA 1OILA 3WL7A 3E1GA 3ESCA 3TRDA 4AMYA 5HZGA 5I7UA 1KEZA 3R0VA 5CXXA 4XIIA 4PW0A 4QDTA 5FXMA 5ALZA 5FRDA 1QTRA 1AZWA 5ALRA 5HKAA 4HXFB 2PSDA 3AJAA 1QO7A 1U2EA 3HZOA 2RONA 2XI4A 4G4JA 1ODTC 2ZVDA 3O9VA 2C5GA 1R9MA 1J07A 5ALLA 1W75A 5ALMA 1QLWA 2DHCA 2ZSIA 4BZWA 3BDIA 1R3DA 1SFRA 2HA3A 2EDAA 1XZKA 1SCQA 1XQXA 3HXKA 1H2ZA 2JGMA 2WUFA 1ZJ5A 4CG3A 5AKLA 2C58A 5ALKA 1K6EA 5K3CA 1HBJA 5EI5A 2VA9A 5AICA 4DMFA 3A2LA 4ARAA 4X97A 3EQ8A 2J3DA 2I03A 5DTIA 4Y2SA 1XZIA 5D3ZA 2Y1KA 3G9ZA 3B5EA 3G7NA 4BAUA 5HQ3A 4RE6A 3HSSA 4FBLA 3WJ2A 2QRUA 3FCYA 1MNQA 3ZI7A 2ZYRA 1E8MA 1BN7A 5CRIA 4UHCA 5K3FB 2OCKA 4B0PA 4AZ3A
chains in the Genus database with same CATH superfamily
4NLLA 5HS4A 1QZUA 1CUGA 4B44A 3NUZA 2GN4A 3KOOA 2G8LA 3JWGA 2QOEA 4C3UA 3SPXA 5J4KA 2IDMA 1TT5A 1Z7WA 1VB5A 1S4MA 3PNBA 1BJRE 1L4KA 1ORIA 2MCFA 3U1BA 4QOFA 1RM3A 5JNSA 2IXBA 3REOA 3NVAA 3QE3A 1YU6A 3WSWA 4A15A 1M2OB 2EKQA 1GNRA 4XRRA 4OLHA 2BR3A 2Z9DA 3I8SA 5HFNA 4C89A 5ARDA 4CKEB 5IANA 1Y37A 2HCFA 4RHFA 1G59A 1UBMS 4QU0A 1YNSA 5E4JA 1QGUA 1VMAA 2C4UA 2ZP1A 5EUQB 4M9SA 4KEAA 1NYRA 1A4IA 1KF0A 3KG2A 4YMGA 5ALFA 1EGQA 1LSJA 1DL5A 4NK4A 2H00A 2QAGA 1N1MA 3DDHA 1ACLA 1LPMA 2WYOA 4MWZA 1WQ4A 4G41A 4H1HA 2HOQA 2BGRA 2HBZA 4N0PA 2QQGA 3TIGA 4B40A 3Q3VA 1T34A 2AEFA 3OICA 4OQEA 4U1RA 3M6WA 1CRQA 1YS9A 4MQFA 5D2CA 3E70C 1N7JA 2AIRA 2FW7A 3QHPA 5H5JA 1EVYA 2R6HA 3ZWKA 4Z51A 5BWMA 2OFFA 1VBMA 3HM2A 4TOIA 2PAFA 5B7NA 1TAQA 2VT7A 3L4JA 1ZMBA 3L49A 1P1KA 2I9KA 1M6HA 1UC9A 5TJ9A 4Y6GB 3W3AH 5ICMA 3KAQA 1C9YA 2BH2A 4F46A 3D7LA 3BTOA 5FTKA 2V6BA 4P98A 1RBQA 3AETA 1MA0A 4NDNE 4RF5A 2Q7OE 2PGXA 1XYGA 3ZWOA 3L02A 4C4ZA 4X85A 3B38A 2AN1A 4BRZA 8GPBA 1I4OA 1P19A 3HJAA 3HNOA 4G9GA 3AILA 2DPLA 4NC9A 1A7UA 1U90A 2GZDA 3N39C 3OETA 5DGHA 5HF6A 4FWIB 1ISHA 5GJWC 2WHEA 1IEWA 1Q0ZA 1XCBA 3B7WA 4CMIB 1JIJA 3ZNPA 5JCZA 1XQ6A 2QX4A 1JYSA 1RHQA 4L22A 2XRMA 3A27A 3ZWQA 4B3BA 5L4NA 4BBJA 2X9LA 5LU8A 4J9VA 4IGEA 4LYFA 5GV7A 4YUVA 2ZE6A 5LA6B 2R2AA 3WGHA 3I61A 4XI9A 3K0BA 4JB8A 4RGQA 3PNYA 2HK7A 1KGSA 4QU9A 2REXB 1KE2A 2I3GA 4IFIA 1NR1A 4LY9A 3ZLJA 2AR0A 3VGJA 1SHUX 4MK4A 1ZS9A 1LJUA 1VP3A 4LPKA 3RLIA 5AVYA 5IZCC 1BIFA 5CXUA 2B20A 3GIWA 1I7PA 3OZWA 1J9ZA 3ETCA 3GELA 2XA2A 3V4OA 4BTVA 3K15A 4O5AA 1WA5A 3AU8A 3D5EA 3VUEA 2UYQA 3DKIA 4AF6A 2F43A 3DFUA 5E6RB 4NECA 5BWOA 3KYJB 4JVMA 2BCGY 2GJ4A 4KWCA 4RHXA 1GPKA 2A5LA 4WH0A 4QQFA 5AJTA 4KLCA 1U4OA 1ZU4A 6NULA 1EUDB 1IFXA 3NBKA 4U8GA 3RARA 3TLXA 1M6VB 4XFJA 4I08A 3DTVA 4RD0A 4C43A 1JG4A 1U6JA 4Y1RB 5DYGA 5KYUA 4CGZA 1NIJA 4EJ6A 2N9UA 4L5YA 1WIWA 3IKJA 2C3OA 1G4HA 4V1CI 2PU7A 1U3GA 3M1AA 4Z99A 5FI5A 1ZAKA 4XCVA 5H83A 1XR3A 3IXMA 3ESZA 2WAAA 2NWQA 4HTAA 4O4IF 6ABPA 5FPPA 2PV0A 3ETEA 1T13A 3AYZB 2I91A 4HK4A 4EJSC 1DEAA 1Z74A 1WSAA 3KTAA 1M54A 3R6GA 5MGBA 1KIAA 3P2IA 3EGOA 1AKRA 3EIHA 3JQ9A 4M2LA 1P9LA 4P35A 1E99A 1L4YA 4URUR 5CPBA 1KDYA 3R5JA 4F9EA 4RTSA 2ETVA 4UHBA 3QLUC 5IUJC 1I24A 2G83A 2ZCUA 4QPZA 4RE5A 4F97A 1GPH1 4D5GA 1VQ1A 1JBQA 5A2GA 3D2AA 2GUGA 3W5HA 2EL9A 1Z16A 1YT5A 1JTVA 1SG0A 2H9AA 5U4XA 5CCXA 1IZZA 1EH5A 2NXJA 1PUXA 2B34A 3EDYA 1BWSA 4UEJA 4UTOA 3RYFA 5C8DA 1UDRA 5FP0A 3MS7A 1BVYF 1DMSA 4EG3A 5K3OA 4KSYA 1YE8A 2GPYA 1QTIA 1UCFA 2XJ4A 3A31A 3NM5A 2WJYA 4FCCA 3WL3A 4WOJA 3WYDA 4YMHA 2D59A 5CBKA 3CKMA 1G5TA 3BXGA 4U5QA 3IBYA 4YNBA 1Z5NA 4L5IA 4XDZA 4MIYA 3EN0A 4ER6A 3PUXA 3WK6A 2YASA 3ZHZA 5LP1A 2QAJA 4GRIA 3RC9A 3VH1A 1RIIA 1YB1A 3OF3A 2FSIA 4HV4A 1DWQA 4D44A 1N78A 3B70A 2N42A 1NVEA 1OI7A 2CKDA 1UUFA 3NRJA 4GMHA 3CFYA 4OJTA 3HWSA 3ORYA 1AUQA 4DC0A 1IXRC 3OAAD 2CMFA 5G0VA 4J0HA 3S8EA 1PX0A 4G9BA 5JXGA 2X0FA 2YXBA 2I2CA 4TWRA 3M4JA 3CRVA 4H7JA 5BWCA 1ZIYA 2PH7A 4BNGA 4QGHA 2Q6IA 1X86B 4H08A 4TZTA 4ZJZA 3KQKA 4HVLA 2B8NA 3MK31 5F3DA 2P5SA 1LKZA 4LQLA 4F2PA 1VMIA 5DKFA 5E1DA 4JSRA 5JCJA 4HYYA 3QXXA 4FFLA 3DTVD 4QRIA 4PNZA 1MFPA 2HK6A 2PBZA 3I04A 2ZUDA 4WZZA 2TMKA 3X1JA 1JL3A 4Q3EA 1RC1A 4ZPXA 3ZZUA 4A27A 3WQHA 2NU9B 3TLJA 3RS9A 1ZONA 5ITVA 1D4AA 5JO0A 1NOIA 1QDEA 1OFUX 3EF1A 1GKIA 4JR2A 3B20A 3KPWA 3DXYA 5KMGB 4MI9A 2B37A 1K5PA 2CZGA 2DH5A 2YJ3A 3LY9A 3O38A 4IWNA 4S3MA 4XOIA 3LCUA 3TRIA 1P7CA 4BO1A 1FSZA 1EXVA 1XZDA 2GJSA 1QKJA 3PA8A 4MLCA 1DDIA 3F74A 3GEDA 4KXFB 4QYIB 2CV2A 1DJMA 3HL4A 1NULA 4NOMA 2VOJA 3DLAA 3MWFA 3GXOA 5CNJA 1VSVA 4WVFA 1KEEB 3O90A 1K92A 4DY6A 3NTRA 2CBGA 2PZ8A 1FUUA 4CIVA 1DRJA 4LHSA 5E8JA 2GM3A 2MTBA 2C96A 3B85A 4FIDA 4MKIA 3WYNA 2QA5A 2F48A 3TUIC 1KNQA 1NQ5A 3I3SR 5JASA 1HDGO 2I71A 3DGEC 3TEMA 4R01A 1EJ0A 1NMYA 1F0YA 2QNIA 2QENA 2PQ0A 3I23A 3Q87B 4C21A 2QD3A 5F1KA 4EUHA 2QPOA 4GUAA 3SXJA 1AT1A 4U9HS 5I9NA 2G70A 4JP5A 3UJHA 4PLYA 5JI2E 5SYNA 4F3NA 3D6VA 3LOQA 3NCHA 3EIUA 4G5HA 1Z4MA 1KZHA 4IVNA 1C9MA 2H1VA 5BW5A 2VJLA 4J90A 5BNFA 4LFCB 2CFIA 4PANA 4M99A 2J3QA 4AKGA 2Y2UA 2ZG6A 5I7WA 1WHSB 3AEQB 1NMXA 4HB2A 4A0GA 4CXMA 2HQRA 1QP7A 3IAXA 1C14A 2HM7A 3RSGA 2Q3CA 3EG5A 4WLVA 4COKA 4ZAXA 3DC2A 2VG8A 5G0TA 2FG5A 1FBTA 4FTWA 1LQUA 3UMMA 5IT5A 2VDKB 3LTEA 4NWIA 1FDSA 1CETA 5SY6A 1TM5E 1U5BA 4NZNA 1HE3A 3SR4A 5IP5A 3AJRA 1PNTA 3E15A 2H0RA 3R5XA 4WNCA 2OAQ1 1E92A 1NZJA 5F9HA 1YCHA 1B8VA 1U2SA 3K09C 1YZ3A 4LG1A 4X6LA 4C22A 2DFLA 1TYZA 2OAGA 2ZI7A 1HKHA 1UPAA 3AG6A 4HB4A 4UMVA 5EQFA 4A8JC 5LN1A 4KN8A 1YBAA 4DADA 4ODIA 4MVJP 4WERA 5EL0A 4YAGA 2WI8A 3MZ0A 1XQWA 4MKGA 3FWNA 3IRVA 4FZ3A 2VXYA 4H60A 3HXLA 2C78A 2PSJA 4G1EB 1XU4A 1COWD 3N05A 4NCNA 3ZWPA 3ZW9A 5AP9A 4GKJB 3PFHA 4JOSA 2C31A 4C6TA 4HYQA 1JT2A 4D0SA 4N40A 1KP2A 1KJ9A 2P9TA 3GRRA 4IXMA 3A9UA 3NJ8A 3DNFA 3VRHA 1LK5A 2W6ID 2X19A 4UC0A 5HR5A 1GCOA 4GHWA 4P7FA 1A98A 1DDOA 1UIRA 1HE8B 2YV3A 5TPWB 3OO1A 1LLFA 4PZLA 3K1JA 5F7OA 4DIEA 3RUAA 5EXPA 3CQ9A 1Y3CE 1RCFA 4MWOA 4Z0HO 1KYIA 3H11A 1KI6B 4D4MA 2OO5A 3UKOA 4NBTA 4F2DA 2WNHA 5DHFA 1FFGA 1MABA 3G1WA 3W9BA 4XFDA 1NV9A 4JEUA 4N54A 1KETA 1C0IA 5GM1A 1GQSA 2AOUB 2OD2A 3CBQA 3I83A 4ZEXA 1BEEA 2H52A 2AJ8A 3BKXA 3KVVA 2XPCA 3FBTA 1QUEA 1H9BA 1W2WB 3JQ8B 3MJTA 4FN5A 3DLBA 4FFWA 2BDEA 3C3AA 4PV7A 2VK8A 1DEXA 4M0EA 3QKSA 3FRHA 1G8AA 5JNVA 2W7TA 2HHAA 2Y6VA 1NJGA 1IN8A 1H0RA 3LQ2A 4M1KA 1NONA 1QMGA 1NOJA 1WTAA 2HXSA 4X1YB 5EUMA 4MITA 2OVBA 3L93A 4IILA 3UXYA 1HC7A 4RA6A 1PWXA 3V3TA 3GLIE 1V45E 2JVIA 3AOGA 5FOTA 4RSMA 1U8UA 1KI8A 4BVAA 2RAUA 3C45A 4RPLA 4K6FA 3RNLA 3JWPA 1TADA 1JB9A 2GWRA 4JL5A 2A5FA 1Z29A 4KXUA 2IY8A 2QU7A 1TD1A 4XEUA 3OQMA 3OBBA 1RMQA 1IQUA 4QA9A 4OP1A 3WB1A 4KVFA 3JALB 1RJWA 1SKBA 2ZYIA 1Z2PX 2DE0X 4R51A 3F6CA 4ETIA 5A1JA 4N41A 2QAGC 4URHA 4D25A 2AC2A 4FD3A 4OXIA 1VZ2A 2ORED 3GLGB 3W4KA 3DR3A 4Q4CA 2RHDA 2VDWB 3AUTA 4F9FA 2TMYA 1UOQA 2PV7A 3ZHYA 2HRRA 1W5TA 2ZI6A 2NAFA 3N8KA 3AUAA 3I37X 5FEUA 4K9OA 1ZC3A 3BE6A 3NGMA 4Q05A 4OXXA 3U4QA 1BDHA 5BVHA 3Q7RA 5I3CA 3F7MA 4D0RA 1GVHA 3IILA 1NDUA 2X8LA 3A04A 2OXIA 3SQMA 5GADl 5KCMA 1CJKC 4QECA 4FEEA 1TC1A 1O87A 2ZRKA 5FLYA 1B1AA 1NPYA 4ROSA 1AS3A 2XYQA 4DDMA 3L6BA 4HAZA 1CUDA 3SWWA 1DCTA 2BBWA 1CNFA 2FWJA 3R23A 1JDPA 3U7QA 3Q2IA 2XMZA 3A58B 4NF2A 4OJKA 3EYWA 1Y7LA 5KB3A 4BX0A 9MHTA 3QVSA 1I2DA 5SYAA 1PE0A 2Z6AA 1RAGA 2F1JA 3MTQA 2C2BA 4PYQA 2FW8A 4TS1A 1QZZA 2CJWA 2MT9A 3MLBA 4XSGA 2W90A 2F4VB 4OSEA 4Q9IA 3ZDDA 3LNCA 1FE8A 1HZJA 1UOEA 3ADOA 4BVEA 2CY0A 3HBMA 2HLDA 5CB8A 3MXOA 2UVDA 1PG0A 4L9SA 4LYEA 4OU5A 4S0XA 4AZVA 4DZZA 1AHNA 1P31A 1I7LA 2O20A 2VHXA 4E46A 4HWOA 3TVYA 4LV6A 3GROA 3KC2A 1GEEA 1ZCAA 2HKIA 3AR2A 3BWDD 3OFSA 4L8YA 5EJIA 221PA 2ASEA 2QAIA 2FUG1 2VK4A 1BEUB 2XRZA 2WVAA 1IY1A 2BN4A 2WJIA 3UT0A 4YUWA 3L8MA 3ET4A 4LDNA 4FQ8A 2CHUA 5BMOA 4DLNA 1JIKA 2FGKA 3FCOA 4IV0A 4M9UA 4FU0A 1CY1A 4ZCRA 1MJGM 2HDWA 3PTLA 1M34E 2FRVA 2XVXA 1N5MA 2C4NA 3MYRA 4YIKA 2D62A 2ZIXA 1C4XA 4FI3F 4YT8A 1YBFA 3JV7A 1XKXA 1ILWA 1PQPA 5ULLA 1DHRA 4IHKA 1FF9A 5IT9A 2AF3C 2J4CA 3DUFB 1YS2X 3L0SA 3F7OA 1M66A 1J2UA 2QTAA 2IQ5A 1KQ3A 4NV1A 1JEYA 3L0ZA 5FDFA 2WTNA 4U02A 5BT9A 3F97A 1KH1A 1L5NA 1TM3E 5HFAA 4BFWA 3INRA 4PLHA 5KU7A 4GG1A 3OEYA 2JAPA 4RH0A 5C0OE 4M1MA 3I2FA 5B3JC 1NVXQ 4CM9D 1G5QA 2QL5A 2D74A 2JIOA 3IPAA 2Q4OA 3LC0A 2JI4A 4FMCB 3V46A 2J0SA 2GN6A 4YPVA 2VP0A 3U9LA 3GH3A 1CR1A 1QM5A 4NU5A 5H68A 3R3SA 2Q9BA 4GLLA 4IRMA 5F5XA 4Q9DA 1GLNA 4BGEA 3ZDYB 5ERGB 4D3FA 3EARA 2L18A 4HEA6 3B78A 1QRRA 2G76A 4IJ6A 3UKDA 3NC1C 1WHSA 3JQ9C 3OKCA 2W2OA 3SE7A 2OGSA 3I8OA 3ZDEA 1GPMA 4BWVA 4U7DA 1TOAA 2C3UA 2Y0DA 3BBLA 4PFKA 4DSOA 4QULA 5ABPA 6PFKA 3NVKI 3V9AA 1X7YA 1BKSB 3GJRA 2G4LA 1I6WA 3ENZA 3D7SA 4FR2A 1P7PA 4YYZA 5JWOA 1T5HX 1OGIA 4OHCA 5IM4F 3EDRA 2FWIA 2G36A 1KO4A 2J41A 1QGAA 2Y1GA 4FZ5A 4WIAA 3E5HA 4DSAA 1V41E 4XCQA 3V1LA 2CUZA 3FIUA 3TAUA 1TEVA 3OE7D 2XNKA 1ADGA 5KKAA 3HVHA 1T2EA 3NZEA 1A9XB 4KE7A 4MUKA 3OJFA 3EQ2A 3WISA 4L8VA 3ZY4A 4ZZ3A 3SJUA 1E7MA 2XNDD 1TKCA 1ZQ9A 3I0NA 3KJXA 4BNYA 4ENUA 4JJGA 2PCLA 3AKEA 1LDEA 1R5OA 4MRPA 1RCTE 4LKRA 3C3EA 3IE0A 4TXJA 2QPLA 5G1OA 3RVLA 3FYUA 1W0JD 2PS1A 4IHAA 2OB2A 2CF5A 2DCUA 4C7VA 3NDBB 1OR8A 2VZ0A 1JJFA 4K9SA 3G2QA 3LQFA 2DR0A 3K53A 1YJ5A 2P35A 2YIMA 1ZHOA 1KIMA 1FRZA 1NYLA 2WE8A 4N65A 4ER3A 2PWAA 1WCV1 2JPDA 3NXKA 3KHUA 4FT2A 1IG3A 1N2CE 1NF3A 1Y4DE 1DU4A 1XBTA 2H18A 2QZJA 3L4BA 3NHPA 4FHFA 1KVTA 3PR3A 2VJNA 2G07A 4WLFA 4YC7A 4C4XA 4EVSA 5BWBA 1DQRA 3ZPXA 4E2XA 4U2FA 1WCIB 2FPSA 1R0XA 3OI7A 5DMHA 2J67A 1NW4A 1MLDA 5AKHA 2AOUA 1V48A 1DQNA 4ML3A 2X4IA 4MQ4A 1PZGA 4R2KA 4AUKA 5IKPA 5JPDA 3F47A 4N8EA 2QD1A 3JQ8A 4UU8A 3T8YA 4DR1B 2EAUA 2H4FA 2DPMA 3VISA 3BA6A 2ECQA 4YEDA 4C29A 1P7ZA 4WASA 3HKCB 4RMJA 3VR6D 3C74A 1T25A 2WHXA 3V32A 5KU1A 4EUFA 2A58A 4NJEA 3LP8A 1H6BA 3RUIA 3TGPA 1QR2A 3AFMA 1KRHA 1C7JA 4LOJA 3DCYA 2ADFA 1OC2A 1U28A 2C77A 5ICCA 5KSYA 1JDJA 3EOAI 3OQ6A 1IXYA 3MHPA 1X7HA 2QMUA 2VJAA 4TXMA 1WXQA 4NL4H 3O4GA 1Q21A 2KW5A 3BB3A 3PFFA 5GJCA 4EHIA 5JSHA 2VQFB 3PRHA 4CN8A 3DE4X 3Q4GA 2QZ9A 2RHJA 3ZHRA 4DMGA 1QHHA 2P4UA 1GUAA 3GFRA 4EKYA 3WLIA 4BNDA 1R0WA 2VYND 1FQJA 4JZKA 2XB6A 3FYHA 1XG5A 2WU0A 2DLCX 3SNHA 4BP8A 2NT3A 3O8OA 4X9XA 4LF8B 2IXEA 4ADSG 4R2WA 1JIQA 1Z0AA 1Z6ZA 4MWCA 1OX5A 2CSXA 1EFVB 4OB8A 1BGVA 1TU3A 5J43A 1KMHB 2WBLC 3RREA 5ITZB 4O2AB 3RFUA 3O1JC 1ZP6A 2JIRA 2YV1A 2QQ5A 2R6AA 4KXMA 3FF1A 3NGLA 1B16A 5DGXA 3EIEA 3D31A 4C2UA 3H4MA 2GTHA 1M75A 4RLSA 2O1XA 3FY4A 2W8ZA 2O50A 3FOFC 4LQCA 1MEOA 1VL8A 4OHPA 4TWBA 2UU9B 3RBZA 3M5DA 3LQKA 3I9KA 3LCVB 4YCJA 1VBFA 3CMMA 3HV2A 1FSPA 5ELMA 4JGBA 3SEAA 3PIDA 3R5TA 1C30B 1YZNA 3BMCA 3E9QA 3HFGA 1NJ8A 1RPJA 3Q9NA 2OAP1 3JQ7B 1RE0A 2FN4A 2GCGA 2B7LA 4PSAA 1DCFA 2DBVO 1OA0A 3PKIA 1G3UA 4ZAZA 4BVBA 1J56A 3TQRA 2WUVA 1P4AA 4ZVPA 3SYKA 1U9IA 3D8TA 4PAOA 5TPZD 4QJ3A 3GRUA 5ER6A 3I9LA 3A25A 3P9PA 5COQA 4QEKA 1BGXT 1P4GA 2GZ3A 2NUAB 2GFQA 3CZCA 5JJ5A 4MPDA 3HEBA 3E61A 1S8FA 4I9NA 3TD9A 2IH2A 1XDWA 2AOTA 5A0VA 1CWUA 1SZPA 3CZ5A 3IT3A 2UYYA 2WYVA 1XN1A 3MA0A 4MNTA 4MPJA 1C80A 2F9LA 2WD9A 2B82A 5TMBA 4MUNA 3IJEB 4K6CA 1XP8A 3DUFA 3QFCA 4N9QA 3CIFA 4E11A 3G88A 3VYSB 2OO5C 3EE6A 2OBMA 2GXQA 1NW7A 1GEGA 3W5AA 4QXPA 4GLBA 5C8VA 2ECFA 1HLGA 3HXQA 3ROXA 5JAMA 4LFBB 5IDYA 3HC7A 4Z3OA 1SU7A 2DWOA 5ALXA 5BYKA 2PVPA 1Q44A 1FFWA 2BHTA 2QV7A 2G08A 4DZTA 1DTSA 4PSUA 3DEJA 2G17A 2HTEA 1ORVA 2PGNA 1TZCA 1XGKA 2F3SA 1EIWA 2HRQA 4PO8A 1C8VB 2OHXA 4KBYA 5E7IA 1TEZA 3D4NA 1RSZA 4PTLA 1DQZA 2BKVA 3OEEA 4KFSA 1U2DA 4O4HF 4F93B 3UK1A 1T6YA 1VLJA 1A9QA 2VAXA 3UWPA 5D86A 4QOHA 2HK8A 4AJHA 3B13B 4DMKA 1KI4A 1M67A 2RIPA 3P4XA 4J0QA 2PX4A 4UNNA 1CZUA 3H3FA 4LZLA 3OJCA 3Q40A 4WKOA 4MO9A 1IJBA 3F5DA 4X1OA 4ZO8A 5DHRA 2PS3A 3ZU2A 3QU5A 4G24A 2EG5A 1PJAA 2Q1UA 2C94A 1IG0A 4X7PA 4INJA 5IAGA 3S68A 4B84A 1LPSA 1JIXA 4DB4A 3PR1A 4GOLD 1E1RA 4G2TA 4C7OB 3HJHA 3SX0A 1A88A 4LYYA 5LNK6 2BI7A 3A2NA 1TAUA 5TGTA 1BD4A 2GN0A 2UVPB 3GG9A 3BWVA 2ALJA 3GYGA 1GFSA 1VDMA 4G0VA 1Z34A 3LPLA 4GPEA 1UMDA 1ZICA 1Z0SA 1HQKA 4ISBA 3WZLA 3ZXIA 4EY4A 1T5OA 2MMGA 2SKCA 2KLHA 4JJZA 2J6BA 2ROQA 4L5BA 2P3SA 2W6PA 3MT0A 3MJDA 4D4LA 4GQIA 3EZYA 1O1YA 1VI6A 1ODCA 4AXBA 1YQTA 4GI2A 1GGVA 3A4IA 2WILA 2F1HA 1MRNA 3HU1A 2YZ2A 3QIVA 5CYGA 1MB4A 2POCA 3FAZA 1JA0A 4FKMA 1I7DA 1JJVA 3I6QA 1ORHA 5ICSA 2NZUG 2AI1A 2JD2A 4BY9E 2EXXA 4B82A 1VZ3A 2AUMA 3G0IA 4G3XA 4NNPA 2LE0A 1ISRA 1PL6A 3L3BA 1OXXK 2FFBA 4IX9A 3NUGA 5CDHA 3LJKA 4JB0A 1N5RA 1WCIA 4OGGA 1T8RA 4D1YA 1PDWA 1QX3A 1ZH6A 3JZMA 1XRMA 3BB4A 4CV1A 3T3DA 1MO2A 4IGFA 3VYTB 4G0WA 5EPEA 1N8KA 1XRQA 4I81A 3W6PA 1WVGA 3RHZA 2XUAA 3NIWA 3R0XA 3V8NA 4RPIA 4DARA 1X7WB 3I2HA 1JU9A 4YP1A 1XPJA 5I5GA 2ZXFA 1PJ2A 2P2SA 2IS2A 4C0HA 3HMKA 3KD2A 1CF2O 2CDBA 5FPKA 1DV2A 2OORC 3LF2A 1J09A 1T26A 3VSBA 3GR6A 4YMTA 5EINA 3IUBA 3RU9A 1D6MA 2E3JA 3K9CA 3EZGA 3OIDA 5SZIA 3D7RA 1JQJC 4EFLA 3PYMA 1E61A 2XMBA 4PBSA 3GL9A 3N2LA 4EX7A 2EWWA 3PNOA 2PWBA 5E9QA 1WRBA 3BMOA 5DEOA 4HRXA 1JLLA 5A9SB 5LOVA 3Q8LA 1ONOA 5KTMA 4B3RB 3LRPA 4UHEA 1A04A 5CAEB 1U9YA 2AJDA 1NXQA 1TPZA 1H8HA 2ZRBA 4RIFA 2W98A 1VG9B 1N33B 2ZS8A 1J8QA 2C7PA 4IQGA 3QIAA 4Y2HA 1G41A 1H2YA 1M8KA 3VC2A 4BGVA 2HGZA 4ER5A 3W6OA 3BXFA 1FW8A 4BNWA 5JD4A 2OEPA 2P3LA 3G5MA 3JTEA 4IUYA 1E7SA 1D1QA 5TF4A 5FBHA 1OVGA 3PJGA 4R1QA 4B7ZA 3NAMA 3IE1A 5ALPA 5JH7A 3TFOA 3OX2A 2P9FA 4O2AA 2DT8A 4PYRA 1PYGA 4FB4A 5CIYA 4KR2A 1MEEA 3CZPA 3KZMA 3K9HA 2IY7A 3H2JA 4FYXA 4X5OA 5EZYB 3S1AA 1DC7A 4H35A 3SVLA 3U4MA 3UJ7A 1L7XA 1JLKA 3I9OA 3IMKA 1T3SA 1XVVA 2NTEA 2Q5HA 1ZOSA 4Z8XA 1LI5A 5IYZB 4S0ZA 3ABQB 4P9NA 3AVVA 2RC5A 5KVSA 4B32A 3AVUA 1PUJA 4O4LB 2DSTA 3H5RA 3CKKA 4N03A 4PM4A 5G0WA 3GLVA 1NR7A 4QTTB 1WVMA 2ZBGA 1VBKA 3TPZA 4P93A 2ZYAA 1QU3A 4J1TA 1LSOA 3G5UA 3NIGB 5KC8A 3ZCRA 4LJKA 3AR4A 3E8SA 4D8XA 1UBGA 5ETJA 3O6VA 3NHYA 1GYRA 1DAKA 4QOJA 3F8SA 1S3GA 3ODPA 3TLGB 1II8B 1GDHA 1SUEA 4ECEA 2A9PA 5JWRA 4BO3A 1C3VA 1GTMA 2DPGA 1OJ7A 2NUPB 3UB3A 4BNLA 1I94B 4KLRA 3VMFA 4M3NA 2ZRJA 1R1DA 3C6MA 4HXGA 4U2EA 3TI9A 2J0UB 5C81A 1EB8A 2PYDA 3KR9A 3L40A 4XARA 1P60A 4QVGA 3CG4A 1DARA 1TO6A 1MX1A 3SKVA 4TYQA 5JXWA 3UJNA 4N76A 5CG1A 3TQTA 5DNCA 1CJTC 4BTEA 1NY6A 2FP4A 3F5QA 4IOLA 1RPAA 3HN6A 2DQKA 2JIBA 2YZNA 3L4BC 1IHYA 3M81A 1X9GA 4JBWA 2E4XA 3ZHXA 2G09A 1UZNA 4OQFA 4MX8A 3LLSA 1CYEA 2DJIA 3KKOA 1YMQA 2Y1XA 3EIFA 3SM9A 5EQJB 2WM2A 3HDTA 3T1TA 4D3YA 1ZIXA 4S12A 1E1KA 4M36A 4E5MA 5CA1F 1XJ5A 2XVMA 4I2VA 3G1TA 4MGHA 1CUYA 1D2AA 5CGZA 2C9YA 3KEQA 1CEEA 4ITVA 5LMNB 1RXYA 1Z47A 1WP4A 1A4UA 3EEFA 3ONEA 5HIMA 3EIOA 3Q2OA 3WWCA 4YUYA 5IX8A 4RLQA 2GVZC 4DCTA 3NH6A 1XRLA 3U5TA 1HA3A 1H6CA 2Y1EA 5JLJA 4K9RA 1L7MA 1GG8A 4YWJA 1W88A 1TQ8A 1LW7A 4K9DA 4E1VA 1E20A 1AO3A 1G64A 1R74A 1F8YA 2JKYA 3CT4A 3TQFA 4E1AA 3A3KA 4F8JA 1DADA 1LI4A 1DRUA 1PK9A 1Z7YA 4D4KA 1GG2A 1VHWA 3AEKB 3IP6A 1DTEA 2Q4EA 5HRCA 2DQZA 2QP4A 2QN9A 1U3UA 3IULA 1DOHA 4O6VA 3CLUC 1I3NA 2VNAA 5TMDA 4BLWA 2RHBA 5FYQA 2EJTA 1O2DA 1ORTA 4N5DA 3G0HA 4AVYA 1N36B 3CX6A 2HJRA 4B6GA 4KO1S 5BYAA 1US8B 2QP9X 5C34B 1Q7BA 3VHLB 1N9GB 2MYNA 1WSDA 3F98A 5G41A 1GA4A 3GV0A 3G2NA 3VPDA 1YS6A 3ELUA 3REQB 3T9BA 4U6SA 3P9QA 3AG5A 1KRWA 5JNTA 3HCRA 1SXGA 2AW5A 5J63A 5LC1A 5ALIA 3U3ZA 3WWYA 2J5KA 4M8NE 4JASB 1F5NA 2H3EA 3D8RA 3FZGA 3WFZA 1D1TA 2RHOA 3G2LA 4UHDA 3AKZA 1T9HA 3QMMA 3QBJA 1C4WA 2XQFA 3K5PA 3C3CA 1P5RA 1NBHA 2PR2A 3AFOA 3LM8A 3SSOA 2ZYSA 4JUFA 5K01A 2WWIA 1KI2A 4OOFA 3B3FA 3KB6A 3JQ6A 1VJ5A 4P4SA 1VL6A 1C7ZA 1KHHA 1T9DA 1HNNA 1X8LA 1MA3A 4PO1A 3G8DA 3N7TA 2MINA 3U4HA 2FWMX 1DC4A 1E6LA 2DJ5A 1E89A 1F5SA 2YVLA 3SM3A 2WAXA 2EGUA 2ZPTX 3B9RA 3KJHA 4H2DA 3KLNA 3NBYC 1FTYA 2WJ3A 4IHJA 4JJ6A 4MP8A 4P32A 4XX0A 4DGSA 1V7CA 3IDZA 4ENSA 2FPPA 1U1IA 2Q8PA 2XUDA 1P75A 1J8YF 1P0QA 1WDKA 2G4VA 3D3WA 1DJPA 4GAEA 3KOYA 4KE6A 3TLCA 4B35A 3ZD7A 3SYRA 4AN1A 3P0EA 4TUYF 3BMQA 3W3AA 4JHXA 3OBIA 5KNDH 1QV6A 5KO2A 1U5AA 5L3SB 1SG6A 2O3UA 2V45A 3B3GA 1U9IC 3CXRA 3LPDA 4DR3B 3CN7A 2QGNA 2QNRA 4W5RA 4YP7A 5CB4B 5KNBA 2RGDA 3OURA 5CD1A 1UK9A 2HA0A 1SOMA 1Q2XA 1QBKC 1W46A 2OHJA 2DKOA 3O4VA 4EY7A 3EYAA 2KWIA 2X0JA 3IHKA 4J4BA 3MWEB 3S29A 5HX7A 3E9EA 3IQXA 1ZH4A 1JKJB 2IRWA 3IAM6 2RHRA 3AJEA 1Z4QA 2FEXA 2OPHA 3RIHA 1V39A 4RULA 1NMZA 1V5IA 2W6QA 2ZFUA 1K98A 3B7GA 3JQGB 3VNUA 7MHTA 4GGMX 5BN5A 1S1MA 3MTGA 4OLAA 1ZSYA 4Q4LA 3STVA 4B09A 4PLTA 3K9FC 4DAEA 1C5KA 1VLMA 2VJQA 4PO9A 3UWSA 4D79A 2K2QB 2BR4A 1Z6GA 5AOAA 4HPJB 4CR7A 1P5FA 3QKUA 3SMVA 2MSKA 3LUPA 4CEIB 5HOEA 3CZQA 3KBBA 2ZUVA 4RJ2A 4MPPA 1XXHB 2J5QA 2V59A 3TBKA 3MGAA 3TXAA 1BS9A 3OFVA 1YDEA 3ND7A 3PFIA 3K5WA 3PS9A 4I4NA 4MUXA 3UENA 3VM6A 3QYPA 4C05A 2GESA 4GMXA 2JCGA 2Q50A 2OCDA 3H8SA 1U3CA 3FD8A 2M98A 2PX3A 4O25A 1F17A 4HS9A 5ERYA 1WPXA 2ATEA 3ZOKA 4RQTA 4C7MA 4F4HA 3AV0B 2FUEA 2QN1A 4JC4A 5IVDA 4F3YA 3H5TA 2PYZA 3OZGA 2NTJA 5DP2A 3EFOA 1Z2NX 2G1JA 4AM8A 4HMQA 3AF0A 3KSBC 4NAHA 5F3WB 2E4AA 1EX9A 3WOVA 2BTQA 1YUBA 3GXBA 1EXDA 4GLJA 3B1WA 1O9BA 4W7SA 1PJQA 1A0OA 4LXGA 4P3KA 5I9MA 3VR5A 1HT0A 4FXOA 4HJXA 4C07A 4MPTA 4NICA 4Q3DA 5EMKA 4LOAA 4WZAA 1QH0A 1P1CA 4YRLA 3E48A 4A3SA 2O54A 3U17A 4TKVB 3PD0A 2R25B 3KDAA 2R3SA 4KR0A 4Z2YA 5SYMA 4QHYA 1NQWA 1V6CA 3C7DB 3JWEA 1DC5A 2YJNA 3P9ZA 3FTFA 4WJKB 2X4LA 4GBGA 4DXAA 1T6XA 2VHWA 3TLGA 2GILA 3NWJA 1D5CA 2Y0EA 4AG6A 1ZR2A 1ISJA 4ARCA 3FPLA 2ODQA 5F33A 1CNEA 4TVBA 3GUZA 3FHOA 5DWVA 3COSA 2C2OA 1NWHA 1TF5A 1OSNA 1S3SA 1XD8A 4HZGA 1TLTA 2H65A 4TT3A 3SZRA 3U49A 2W2LA 3WKDA 1PT9A 1FTGA 3K70B 2VXBA 2AG8A 4R1UA 1YJ8A 2GMWA 3WB9A 4B7UA 1TFUA 3WL5A 4F84A 5K0GA 1SBYA 3OPNA 1G3QA 4OQPA 2AYYA 2J30A 5JO9A 5DRTA 3E35A 2VYCA 3DOCA 4BGUA 4LVOA 1RQNA 4R9NA 3NRCA 2GKGA 2MJLA 4EB3A 2P0YA 3DAFA 3RVDA 5C80A 2Q4RA 2XJ9A 4ZYXA 2XMCA 3M6LA 1CQJB 2YVUA 4PAMA 2YIJA 1IN6A 2ZYUX 2OGTA 3E81A 1L5YA 3H9GA 3CE6A 1QIEA 3JATA 4H0CA 4Y18A 1VYHA 2FR0A 3MM4A 3O9ZA 4AJNA 3LLUA 2HXYA 3EPRA 3GLHB 5AOVA 3WL6A 3UTCA 4AMBA 5K0TA 3JQAB 2ERXA 5LXTF 3RTCA 1F14A 3GVPA 1KZ7B 1G1MA 1LRJA 4FDTA 5ALNA 4RTLA 3BCRA 4XUEA 1JLSA 2QTVB 5ALVA 2P2ZA 1VFPA 3GZNA 1INLA 4U6QA 1FNMA 3AY6A 3DVRX 1OXKB 4KQ1A 4DNQA 5HQ3B 1GAJA 2A9KA 2AMVA 5EXEA 4KRXA 2W00A 2OFOA 3TMYA 2W48A 3RFXA 5IKMA 1N6OA 3QMVA 1P1IA 4EATA 5LMCA 5EJ9A 2YXPX 4RELA 4YV0A 4MQLA 3GLGE 1FSGA 2YUTA 2XE6A 3WWZA 2VSFA 3VR5D 3K0EA 3MMSA 4FPXA 2IELA 4A10A 5F98A 2R6CA 3ME5A 4RHUA 5K20A 4G4SP 5EG5A 3H9QA 1WF6A 2J3MA 4MKFA 3UMSA 1CD5A 4U63A 1JDBB 1PG5A 2H2FA 3A4NA 4MVJH 1W44A 1EVLA 2FZ5A 1N9GA 2WU3A 2VAMA 1EE1A 2NO4A 3LZCA 4GLOA 3HYTA 2XCLA 4JLAA 4QARA 3VX3A 3LL4A 1V8OA 4TMKA 4XJXA 2D4HA 3VTAA 1IOVA 2ZBDA 2DFKB 1JVBA 3FDIA 2O9JA 1UC8A 2VJYA 3IOMA 3KBOA 4LHVA 4N5LA 5DCWA 3C3MA 4BZQA 3PXGA 3CV3A 3IQWA 3M6IA 4LXUA 1A2BA 6LDHA 1O6ZA 2ZTVA 3IOYA 3ASUA 4PBRA 3GWGA 4N8SA 1IUKA 4B3IA 4GPTA 3WDKA 5ISMA 1KXZA 2NSJA 2HNAA 4PF1A 1VCOA 2HUNA 3G2IA 2DB3A 3I1FA 2H1OA 1NE7A 4I6JA 1Q7GA 3CR7A 4QQRA 1NRXA 4MO2A 1EVZA 3OE5A 2R8XA 2FW9A 3UV6A 2FVXA 4G25A 4CIXA 3AX6A 5T57A 1UXOA 1SXQA 1MBZA 3G9QA 3JRXA 2X9VA 1OY1A 4DCMA 1FYVA 2CLFB 3BEDA 3K05A 1WPRA 4RK4A 1SZCA 1TJ3A 3SS9X 4UFOA 3OQ1A 3D6TB 4I4CA 3P71T 2G0NA 4A2WA 3V7NA 1JNYA 1XF1A 1Z5UA 4FUTA 1MO5A 1STOA 1T2NA 1YZFA 3WMXA 4Z4CA 3O1HB 5LVAA 5LD2B 4B6JA 5L3SA 3ZJVA 3HO1A 2OV8A 1J7KA 5KX5B 3DHNA 3WLAA 4TKLA 4C4PA 1VLQA 2UV8A 2XIQA 1WXHA 3OC0A 4WN3A 5IKXA 2J6CA 1YL7A 3JARB 1Q20A 5KHAA 4TZ0A 1THTA 2EZ4A 5KCZA 1BC5A 1DAEA 1K08A 4QM7A 5G53C 3PFBA 3HVJA 3MWEA 4H1VA 4UTRA 2CFTA 1JKJA 3WE7A 3ZWMA 5K4GA 4IW3B 4I50F 4GZ5A 4K5QA 3FPJA 1XL1A 2Q3BA 3T3OA 3O8DA 1JHRA 1MEJA 5AJHA 1YH3A 4WRRA 2QLJA 3G68A 4DLUA 1ISFA 4LYAA 1AQIA 4FFMA 1T8TA 4Q4HB 4RHTA 3ZGOA 2D2EA 2QRVA 1X8XA 1SC1A 1T15A 5DM4A 3TJZA 4PXYA 3OD5A 1UJ2A 1TB4A 1NVAA 4PGFA 3OIFA 1LDGA 2WFMA 3N8HA 1Z12A 7ADHA 4CEIA 2GBLA 4ND2A 2BTEA 1XCGB 3PQFA 2Z2YA 3CVUA 3RKUA 3D3NA 1FUEA 4HO1X 3Q72A 4Z0NA 1LJ8A 2H4ZA 2G88A 2AI3A 1AF7A 4RF3A 2C59A 3ZBUA 1YB6A 4RFSB 5I4BA 3IIIA 4HMOA 2EJBA 5JNUA 1S7CA 3C1UA 4CHTA 3WGIA 3NP7A 3OPQA 3C3PA 5TB5A 3RQSA 3BHIA 4A8HA 1KIFA 3AF3A 3FOAA 4PN7A 4IDOA 1OWNA 3UB4A 4IH9A 3UT5A 1TT7A 1VI2A 1EUYA 2B78A 2OFXA 2PUTA 3CCFA 5I47A 2XOKA 3IUYA 5G40A 4AK9A 1BS1A 4Q47A 3LYLA 4RVHA 4RZQA 5IAAA 3GCZA 1AK1A 1E0JA 3Q9SA 2IOFK 2WMOB 2WA2A 3AP1A 4LYDA 2QW8A 2W83A 1NXWA 2HIMA 5ADHA 1NZFA 3QKRB 4D2IA 4Z4GA 1W76A 3BXHA 3HDYA 4II3A 3NOXA 1FMCA 2HYDA 3T7CA 4ESHA 2A88A 1SVNA 1HV8A 1VCIA 5T7BA 1SOUA 4F3TA 4RTNA 4EYGA 1OFHA 1R2QA 1I0ZA 2RGAA 4KMSA 4R9VA 2CBZA 3S2GA 4CIAA 1DBPA 4BQNA 1YZKA 3ORQA 2BZ0A 4TSRA 3LKZA 1X9HA 5K4AA 1CQZA 2XTZA 3Q3IA 1AX9A 4OQ4A 3WLPA 1WNTA 1ZM2A 2XXBA 3DXZA 3Q6IA 3K0AB 2O5RA 4KPGA 2UXCB 3DOJA 4BX9A 4GU5A 4YRQA 1SR8A 3ROFA 3KJZA 3HGMA 3S8MA 4UPVA 5A4AA 5LZ9A 1BXZA 2YXNA 1YUMA 2EKZA 2YRXA 1DBIA 3ETDA 4LY0A 4TKUA 1YJXA 2HY7A 2OV6A 2Y67A 3CW2A 3I8XA 3K2BA 1BHJA 2PL5A 1G5FA 2I4NA 2RBGA 1Y5RA 4KN5A 1R0KA 4NY1A 2X0EA 4FN4A 1O97C 2V7EA 4LGCA 4U7PB 1EZ1A 3SLKA 3Q9LA 4UEWA 1JG7A 1N6IA 2R8YA 4GMFA 4UM9D 3GNSA 1FYFA 4J7XA 4RZIA 4A0RA 1R7RA 4BJ6A 3ABOB 4M9RA 1RKBA 2PO7A 2QLFA 5BSMA 4OKNA 3HGQA 3LNTA 1XDSA 2F8MA 5ALYA 4YP6A 1KMIY 1T36B 2AMLA 5I7EA 3JQPA 4ID3A 3LGSA 4P92A 1QH1B 3B3JA 3FXAA 3PZBA 5FV7A 2I76A 1JQ3A 4FXPA 1Z73A 2P77A 1VA4A 4ERXA 3VGPA 1CQXA 5IKEA 1CJMA 3G0BA 3IAAA 4FHCA 4DRXB 1XYYA 4JXXA 1G8FA 3EDMA 3U3MA 2XD4A 2NU7B 3C7AA 3E9NA 4GX0A 4U5XA 4CFYA 2XOKD 5F51A 5U9CA 4BL5A 2IPOA 1LZKA 4N01A 1T3GA 5LBUA 5C51B 2VRCD 1DAGA 4UXIA 5TJHA 3M33A 3QZUA 4N49A 4OU4A 1LWOA 4DLAA 2YMPA 4JBYA 4V0ME 2JFQA 1KAGA 3L8DA 1M2NA 5KI6A 1QB8A 3DLTA 3AEUA 2GX6A 1XMQB 4GDMA 2HEIA 3O26A 1I5RA 3B2QA 1XZCA 4ZCLA 2X5XA 1QP4A 2FN9A 3R20A 3OP4A 4BVLA 1BMTA 4PPFA 1EUCA 2QDXA 3JAKB 1U8TA 2PZGA 3M5WA 1BH2A 2Z4SA 1RBZA 3O95A 4KTTE 5DP1A 4M1TA 2BM9A 2BFDA 4IUDS 3RAFC 4ZJUA 3A1CA 3VUFA 3A9SA 2I6XA 2NO1A 1RWPA 3HP1A 2ESRA 4NHEA 4PINA 4WXYB 1SVLA 2C29D 2ZIAA 5F2EA 4G0UA 4CRWB 4S1VA 3DLCA 1Q14A 3HV0A 3OJXA 2Z1NA 5EYPB 4I1YA 2L2QA 4NEHB 3PUWA 1ZY2A 1M9NA 1NJ1A 5GVSA 10MHA 3IHWA 3M6UA 1EVIA 1MAAA 2Z4TA 5DNUA 5KVCA 1RAFA 2IW1A 3MWDA 1Y9DA 4MJXA 2ODEA 2EERA 1QIIA 3HR4A 5YASA 1MX3A 2BFMA 4JKOA 1TVCA 2ICAA 5AHRA 5EIOA 3X3HA 4E88A 1YHNA 3GPLA 4RD4A 4CCWA 5BV7A 2UZIR 2WDPA 2ZJZA 4N7MA 2Q8QA 3ZWAA 4REOA 4WUTA 4LRUA 2C4WA 2HA5A 2GFHA 5B2ZA 3NOOA 1A50B 3JAMA 2BFNA 4AN0A 5KX5A 1S8OA 4LJ7A 4LMRA 2Q0SA 3HADA 4L7VA 4QJIA 3KALA 4G5RA 1M2KA 1I5EA 4FFDA 4OGFA 2PMCA 4C2BA 3DDUA 2OCPA 3OD1A 2I2XB 5FWDA 1OD6A 2I6TA 4F6CA 5EKDA 1VLLA 3W5SA 2PBRA 1LBSA 2FEOA 3EWNA 1O6GA 3L6RA 1RS0A 1N5OX 1DBRA 3IJRA 5KSPA 3P9CA 1NG9A 4K88A 2EFEB 1LLQA 2FSVC 2Q99A 2R86A 3DGFC 1NVFA 4TQ9A 1UFOA 5F5LA 4D45A 5AUOB 4AJ2A 4R83A 4QNMA 4B5KA 4Q4HA 1I2ZA 4LE2A 5TF0A 1RM4A 4E4YA 4CLHA 3IP5A 2HMYB 3T5GA 1L8QA 3RU2A 2YJ5A 2Z2XA 4CMGA 5IW8A 1UK7A 1SELA 2FWBA 3KXLA 3U44B 2QD2A 2DR2A 3W1VA 4ARSA 5ILQA 1SC9A 3ZE6A 2IPNA 1FEZA 2UZ4A 1YR2A 1ZM4A 4B85A 4D0NA 5E4TA 4HTFB 4L0DA 5CMLA 4G1UC 3G85A 2IYYA 4NOLA 4EFKA 1R6VA 4H59A 1C1DA 3O4RA 1NBEA 1MN6A 1RJGA 4DV4B 3FGPA 2GAFA 1Y1PA 2GB4A 2Y0BA 3UWMA 4QJBA 1IN5A 1D3AA 2OCXA 4WY2A 1Q0SA 4GFDA 3F3MA 5F4ZA 1EMDA 1PGNA 4OFBA 4EQ6B 4X7RA 2WB2A 3GOQA 3G2MA 4MDYA 4F8YA 3GUUA 3RIEA 1PFUA 1E9VA 3GIDA 2NGRA 4AMZA 1GAWA 3FVRA 1VE6A 2B4AA 3DZDA 1FXWF 2HWYA 2XSZA 2H9YA 1E69A 3IB3A 1YZUA 3TZCA 3V8PA 2JLUA 5LJLA 3LHKA 3FW1A 1G20B 2EF1A 4CM8A 4IDQA 2QGZA 4EW6A 1LV8A 3SXUB 1I4WA 5F52A 1A9ZA 5EHQA 1B0PA 2C7VA 2DUMA 4I46A 4L4SA 5CCDA 1HF3A 4QSMA 1E2BA 3KB8A 2Y05A 3KKEA 1PJ4A 4MRNA 1Z9BA 1LVGA 3I6MA 3DEHA 4MDEA 1N8SA 3T1YB 1A97A 3ZG6A 4R8LA 4ZCPA 9ATCA 3CO5A 3HFJA 3ONNA 4HN4B 1AS0A 1Q1QA 3K35A 4DQKA 3PJRA 3KOMA 4I9FA 4XFKA 2A9RA 3BK2A 3BGVA 1K4KA 1FJGB 4IR7A 5EHNA 4BU1A 4LI0A 2O7RA 5C9ZA 4KO4S 4EX6A 4EKGA 1YGYA 4QUAA 3VHXB 3GMSA 2AJCA 3UMRA 4JUBA 4EJ0A 1T0PA 1V3TA 2GBCA 1QDUA 2VS1A 1BDMA 1EJ2A 3KXIA 4ZVMA 5JJCA 3U7FB 4S05A 3C3WA 4CL8A 4RF4A 3B8EA 4AUEA 1BDIA 1YE5A 3FCSB 2ZSEA 2X40A 3DS8A 3E9CA 4KMRA 1TZ2A 2A4MA 2ZBFA 3IMGA 2PMEA 1F38A 1FX0A 1TI7A 3BL6A 3CPEA 5GONA 2H85A 3QNMA 3CF4G 5DNYB 4MSUA 4ATNA 4NZYA 4L7QA 3CW8X 5C7OO 1QE0A 2I6UA 4FGSA 5TIIA 4O0LA 5TC4A 4G07A 4LS3A 1ISIA 5JD6A 3TPCA 4F85A 1ZU5A 2GVDC 2WHPB 2I3BA 1XWWA 3BOSA 3PF8A 3R6TA 3NG1A 4CM4A 4ZAYA 1DOAA 4OHMA 3R9XB 9ABPA 2A30A 2FR8C 1PT7A 2QORA 3PNQA 1MIOB 3IHLA 3KZKA 3HA3A 4OQDA 4R9RA 2Q62A 3GMIA 4BP9A 5KQLA 3S4YA 2GAOA 1OB5A 2C7QA 1TRKA 4FEGA 1L5HB 1FJ2A 3CX3A 3DL2A 3DT6A 2C9OA 4QYMA 4QDXA 5KYYA 4TZ6A 4Q1CA 4TL7A 4LVUA 4AIRA 2RGRA 4C30A 2DEUA 1Q84A 4EDFA 5KSWB 4GGPA 1F4VA 2ACEA 3L7IA 2WE7A 4MR7B 1M72A 1K8RA 2Y3IA 4RZXA 5I9LA 1KE1A 4BDTA 1RWMA 2XSZD 2IYAA 4TQGA 5E6SB 2CL5A 3ZZMA 1FUYB 3MOIA 3LCRA 2IYNA 4WNAB 3T4UA 5IDVA 1SIUA 3ETNA 1U0FA 4PO3X 1Y42X 1YL6A 4C6HA 3PGVA 3PLRA 3RANA 1EQAA 4N5IX 4ZKEA 4ZGBA 2P4SA 3DAYA 1IHPA 1L4MA 4R9SA 1RJDA 2A0XA 4HGPA 4YWHA 2BGKA 3DXXA 4MLZA 4Q3OA 1YFKA 2IIPA 5FLXA 3HG7A 2CVFA 4N5MA 4POOA 1F0KA 4XD2A 2DWUA 1X1DA 2Q6LA 4TTVA 1YJCA 4U2BA 4E6EA 2PUBA 3PK0A 1FDVA 1JHAA 3JAKA 4BO8A 1FNNA 2O57A 3IBSA 2CXOA 4FX2A 4YRKA 5I6DA 1S8NA 1ZEMA 3A0RB 4OI1A 5F7JA 3TOZA 1AIPA 4AP6A 2ZYHA 5EHIA 5C5IA 3B52X 2EJCA 3CA8A 1J1IA 3B9PA 3N2NA 5B3AA 4ZOLA 3A6ZA 2CC2A 1SUWA 4S1WA 5HTOA 3EF3A 3PEYA 4NATA 3W5UA 1L4FA 2WIAA 3FKJA 3A6HA 3GDOA 1NUTA 3TR6A 4K6HA 1SQ5A 3BH0A 2RSLA 5EYPA 3K9GA 5AVWA 4KLNA 1TJYA 3L8ZA 3L7KA 4PC3A 1Z75A 3DMPA 3M9LA 5H59A 1NN3A 1DRVA 5A4MS 2WQ7A 2WKQA 4FYJA 2SCUA 1TJPB 4GRDA 3L0CA 1XI2A 3F8WA 4XIJA 1HT2E 1QCCA 1X80A 5GJBA 3BE8A 4UATA 5EKSA 4RTPA 4Q7KA 2BDTA 5SY9A 2YFYA 2NUTB 3ORFA 3G6WA 2NU8A 5K09A 3FPHA 3QX7A 3B6ZA 1UWKA 3PCXA 4ZANA 4JB2A 2BW0A 2QVLA 2PPVA 3W9YA 3MNFA 4U7FA 3OX3A 2JBHA 3DO5A 1B74A 5CLFA 2EZUA 2BJHA 2AXQA 3DZ8A 4PSVA 3C3DA 4AECA 1E6KA 2A9VA 4NH0A 2GYWA 3EBPA 4KQ2A 5JT1A 3K70C 3BXPA 3JTMA 2CDRA 4Q3KA 4QXOA 3R5FA 1K7FB 3IAUA 4Y2GA 4KX3A 2CD7A 4CCAA 4BFZA 1ULHA 3R7DA 4DPKA 1R0ZA 1H2HA 1OLOA 2FFQA 2IZ6A 3B3AA 3ZE9A 1SCBA 3PE3A 4KGXA 3FPFA 4HWPA 1IN4A 1TZKA 3QY0A 4OREX 4ZU6X 3UW1A 4YV2A 2A0FA 2X7XA 5BOSA 2I9PA 4BVJA 2XEXA 5CYPA 2VTKA 5HK9A 4M0UA 1KOFA 1WL8A 1NUPA 4OHUA 5CT4A 8ABPA 4XDGA 4UUBA 2B61A 3PHHA 5BRAA 3QPVA 3CF2A 3BGWA 2AXEA 1XA0A 3OQJA 3PDCA 2ZSKA 3AUFA 4JBIA 3ZQKA 4ZDKA 2W2KB 4G67A 1JFTA 3KL2A 1JFFA 4KP7A 4M9ZA 3GRPA 1SVWA 3DQQA 3VPHA 2HRDA 3V2GA 1CG6A 3D7KA 4ETNA 3DZKA 2PKCA 3A28A 2QLBA 3I04M 2B4QA 1LRKA 4FWTA 2KM1A 5JFTA 2YJ4A 5JLAA 3H4IA 3HMQA 2WIBA 1I1OA 4AZ0B 4YAJA 1UWCA 1OW3B 4F4DA 2YVKA 5D00A 3F6EX 4WXEA 2HHLA 1T5SA 1JXQA 2ZR9A 3CUEF 4KFUA 3DW3X 3WLMA 3ZC3A 2X9GA 3KFLA 1FTWA 1KMQA 3OPYI 3PTZA 1L5WA 3N8GA 1QV7A 5ITSA 4EG1A 1K7YA 4JBGA 2GEUA 1SBZA 4LBVA 3CF6R 5LZ7A 5REQB 2N0SA 2Z6QA 3A7EA 1G20A 3HJNA 5CURA 4K7JA 3OOWA 1NLMA 4JX9A 3SXUA 3V6MA 4DA8A 3EIWA 2YV5A 4OLJA 4YPFA 3VDXA 1JDBC 5CA0F 3M4ZA 4TROA 3DWEX 3TFQA 4RXTA 3D4IA 2A0KA 4BO0A 3DOFA 3RRMA 3WWEA 2XMRA 3UVEA 2WJZB 5CIWA 4IDAA 3L6EA 2HA6A 3STTA 3CG0A 3G2JA 4WGGA 3ZS9A 1N32B 4HDSB 4RTMA 3TG2A 3VZBA 2ZAOA 5D84A 1MX5A 1TM2A 1PZFA 3BYZA 1NBMA 4GRAA 4MRMB 4REMA 4TMYA 3SZGA 4A0QA 4EGAA 3QVTA 3BD8A 4TXNA 2P6RA 2O5CA 1HTTA 1ULUA 1Z6AA 4J0IA 3K71B 3UZUA 1MC8A 1MH1A 1M7GA 3N86A 4KVAA 2AW3A 1W36B 4Q1DA 1S02A 3GFFA 1AKQA 1R4MB 5HKKA 1ZFNA 5D5QA 5DMXA 2VXOA 2Q3HA 3KOXA 5DHQA 5DOZA 5JS6A 4B4OA 3L4KA 3O03A 3D6HA 1UL1X 3BQMB 2PTGA 3DO6A 3NT2A 4HQFA 1NVDA 3CSDA 3W5BA 4IMJB 4WD3A 3WZMA 2V74B 3HWWA 5IH3A 3UOAB 2A7QA 3F9CA 1NVKA 1N2SA 2H4XA 4RH1A 1BCSA 4UDXX 3ROZA 5BN4A 3J81A 2E18A 5FFNA 3T5DA 4GPZA 4OHBA 2AFRA 4C88A 4KSCA 4BTLA 5DISB 2Z5VA 1XZLA 2QRKA 1ZVKA 1JJBA 2WHPA 5GGYA 5LD2C 1XNGA 4B3SB 1HUQA 1WM1A 1ARZA 3LK6A 3LWDA 3H0CA 4W99A 4L78A 3V1KA 1YR6A 1JAXA 3KR2A 1MIOA 3DA8A 1D6SA 4LXTA 1XJ0A 3B1VA 3KEGA 1AXRA 4I8DA 3TUJC 4YRSA 5BV0A 3DLHA 3ZIUA 3U4CA 8AT1A 3CSSA 2E49A 1IUOA 3NALA 4LDRA 4ZI7A 3ZV5A 1V16B 1U4SA 1JR3D 1DBVO 1E1QA 1KDOA 2SECE 3AW8A 5G02A 4DDHA 2I4LA 2ZUTA 3UK7A 3IESA 3IVGA 5EWJB 4FFOA 2NIPA 3DFZA 2ZEJA 1TCBA 1XXHE 1IY0A 2GH1A 4A03A 4OM7A 2VOEA 5CH8A 1ZW6A 2F9MA 3CGGA 2JDIA 1I6KA 3G9TA 4FEAA 3QPWA 4R05A 5T4HA 5C35A 2D5LA 3D8NA 3N2IA 1ADJA 2FZLA 4FSHA 2J3KA 1IH8A 5DGCA 3EGXB 1XTSA 2IGBA 1UDBA 4EW2A 3U4DA 4JYAB 4IY1A 4C1BA 3D8BA 4I55F 3C98A 4RS3A 5EJ5A 1YZHA 1NF2A 4MW1A 1TO1E 1R0BA 2VHZA 1WZUA 2WQZA 4YASA 4DRYA 1EIZA 3AEXA 5HIAA 1RTKA 2WWFA 5JS1A 1OXBB 3K6RA 3C6ZA 3HU2A 5E0KB 2G9QA 4EHHA 2IUUA 3WRXC 3JYOA 1C2YA 4EB6A 3RKSA 2AK2A 4A26A 2ORIA 4WT7A 3FYDA 4KKVA 1H4QA 1UDCA 2UZ3A 2X6RA 3AHFA 4JVNA 3PEUA 5A5GA 2UVQA 2VSYA 3W05A 3U7HB 1XMPA 1U3WA 1U8EA 1YB5A 3MJCA 3OF5A 2I67A 2AA3A 1SXPA 2DOKA 1V37A 2ZUSA 1BU8A 1K1EA 3M7IA 4K6GA 3K2QA 1A1VA 4AS2A 1G8SA 3OU7A 1EBFA 2GZRA 4MJ7A 4XB6B 2JF0A 1E18A 5FNZA 1GL7A 2X6TA 4NYMQ 1D2EA 3WQSB 2E5LB 4WOCA 1NSFA 4ZYUA 4RWEA 1WMSA 4F4CA 1C1HA 4ZVTA 4PC1A 3S5UA 1FBNA 2GPAA 4GF5A 2HFJA 3OU2A 1XHLA 3TIIA 1FU7A 4CE6A 1SK8A 1H0KA 1EDEA 4HEJA 3OQHA 3TJMA 3OZTA 4WDRA 1JXMA 2PGJA 3RVJA 4H3HB 4GE3A 5CDSA 1XDUA 4ND8B 3THWB 3TB6A 2WFLB 4IAOA 1SBCA 2JGIA 3E5MA 5JAQA 2O2GA 1ZZEA 1M0SA 3GT3A 4K9LA 2PT6A 4O8ZA 3TSZA 4D9IA 2FFHA 4L4UA 5B30A 5EJ7A 3OTOB 3EWSA 3GLHE 2J48A 1DO0A 5BUZA 5MDHA 3C0KA 3LQRA 2E21A 2JL1A 4LGMA 4B43A 4PLVA 1XPRA 4HC4A 3D2CA 1CPYA 4ZAFA 3RROA 4PCVA 2JLRA 2ID8A 1ZGAA 1S9DA 2BFBB 3GVHA 3YASA 2W0MA 4PVDA 4KPUB 5KQPA 3P9XA 1ZCFA 2GCEA 2PXAA 5A3VA 3OQVA 1JJ7A 4FINA 5JSZA 5K0JA 4XWOA 1J8MF 1E77A 2AUNA 3FCAA 4O4JF 5JALA 1GV1A 2WJ4A 3JQFA 3N7AA 4D9MA 2QVZX 2OCAA 4LK2A 4MKRA 2XRFA 4GPD1 4ASUA 2MSDB 5KJ6A 3OQOA 2REBA 4DV0B 2ZYWX 3DF7A 4K26A 4CKZA 4BCCA 4AZ0A 4HAWA 2WHRA 2W8BB 3QEMB 3I92A 3VFDA 4YQYA 1XMXA 4IFTA 1G5RA 2OPBA 4DMUB 1E1MA 1GP2A 5DVZA 3CX8A 4LJSA 3NBQA 2YWXA 3V34A 3I73A 4U2GA 1YHZA 2AV6A 1OE0A 1VC2A 4BMDA 5F2NA 4DLPA 3SJZA 4E51A 2BYTA 2ZB3A 5F5NA 1GARA 2GCNA 3TNDA 4FYVA 4M1EA 1LBIA 4HQ0A 3A6DA 5F1PA 1E9FA 5HS6A 4Y2XA 1FCJA 1IEXA 1I3MA 3LBAA 5IARA 2PUVA 3UMJA 4J3JA 1OILA 4G63A 3SQOA 3D9QX 3K72B 4XSHA 1J0EA 1QNLA 3RUEA 3WV4A 4CODB 1W47A 1EFDN 5FL7D 4AMYA 3PXXA 1F48A 3OESA 2GF9A 2H7VA 1A1SA 1FFHA 3OLCX 4LYJA 2CYBA 4U9IS 4R8VA 4HDSA 4GYJA 1FX1A 4MV3A 2Y68A 3F5MA 521PA 3ZKWB 4BO4A 5CEJA 2QRLA 5CXXA 1OMOA 4NU6A 1U7DA 2C5EA 1UT5A 1C29B 4NE2A 1RRGA 1GKUB 4PW0A 5GINE 2G72A 5FXMA 4ZEOA 3WLEA 4GWGA 4KYUA 3D64A 4YAKA 5TLSA 4DKJA 1N4AA 3VKVA 3Q8XB 1OTXA 2HPZA 3HPRA 1B26A 3WP1B 3OCYA 4UE2A 2EX1A 5MN4A 1ORRA 4YUXA 3ZGVA 3TPFA 1Y6FA 4ZI3A 2V0GA 3BKWA 3HZOA 2NTNA 1QB7A 3REFA 3LW8A 4MVXA 2YCLA 2IHNA 5F1YA 1SB9A 2ZVDA 3IVRA 4AL4A 1KK2A 2IUTA 1JR4A 3B1KA 1RZUA 4KPFC 4A0FA 2RKOA 4ALKA 1D9XA 1DLIA 1RZVA 3B5JA 1EEHA 1J07A 2F1RA 1USGA 2BISA 1TU4A 1MHTA 2PX5A 2W0SA 1LC3A 4BZWA 5EPUA 2P1RA 4GL2A 3LU1A 2AN9A 2XZPA 3O2JA 3WNDA 2PZFA 2VHJA 2HA3A 2SBTA 3DPSA 3HCPA 3K8OE 1O94C 2EDAA 1XZKA 1KTVA 4WOKA 2VHYA 3HXKA 3VPCA 1VE1A 3EEQA 4MV8A 2WUFA 4BMPB 1ZJ5<