2Y6UA

Peroxisomal alpha-beta-hydrolase lpx1 (yor084w) from saccharomyces cerevisiae (crystal form ii)
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
379
structure length
366
Chain Sequence
b'QNRFKKETKTSASWPRAPQSTLATDRLELTYDVYTSAERQRRSRTATRLNLVFLHGSGMSKVVWEYYLPRLVAADAEGNYAIDKVLLIDQVNHGDSAVRNRGRLGTNFNWIDGARDVLKIATELGSIDSHPALNVVIGHSMGGFQALACDVLQPNLFHLLILIEPVVITRKAIGAGRPGLPPDSPQIPENLYNSLRLKTDHFANESEYVKYMRNGSFFTNAHSQILQNIIDFERTKGPVRTKMEQAQNLLCYMNMQTFAPFLISNVKFVRKRTIHIVGARSNWPPQNQLFLQKTLQNYHLDVIPGGSHLVNVEAPDLVIERINHHIHEFVLTSPLQSSHIPQLTLEERAVMFDRAFDSFKNEALVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL MEMBRANE PROTEIN LPX1
molecule tags Hydrolase
source organism Saccharomyces cerevisiae
publication title The Unusual Extended C-Terminal Helix of the Peroxisomal Alpha-Beta-Hydrolase Lpx1 is Involved in Dimer Contacts But Dispensable for Dimerization
pubmed doi rcsb
total genus 127
structure length 366
sequence length 379
ec nomenclature ec 3.1.1.-:
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y6uA01
4G8BA 3ESBA 3IUNA 2JGJA 5KWJA 1VE6A 2WJ6A 3G9TA 4OUKX 5A71A 5CT4A 2DHEA 1YS2X 3RKSA 7YASA 5AOBA 3OC0A 1RYYA 1MAHA 2YYSA 2HA0A 1LZLA 4BCBA 1KU6A 3F98A 4J0GA 1R9MA 2JEZA 4Y9SA 4B83A 4G4JA 5K3AA 3F97A 3OG9A 1K63A 2HU7A 1W75A 5E4JA 5KBYA 1YAJA 2OG1A 5JARA 1AUOA 3WL7A 4OD0A 2V96A 3C87A 1JJBA 5EIEA 2OAGA 3E1GA 3M82A 2H9YA 4E11A 1ORWA 3R3ZA 3GZJA 1A8QA 5FLKA 4DNOA 5AKYA 3BIXA 4WY5A 4F60A 4GI1A 3FBWA 4I4CA 4BZWA 2QRUA 4H7KA 1PV1A 4MJ3A 1VXRA 3AILA 4HZGA 2WLSA 4AN0A 3F96A 4E46A 1N5MA 3V1MA 1IUNA 5AM1A 1XZBA 5ALPA 2RAUA 1ZI8A 3I2KA 5C8ZA 1VLQA 4HTAA 4F5ZA 4P92A 1XRLA 2CEKA 2VSQA 1XZIA 4FLMA 1CFJA 5AKJA 1QIHA 4UFOA 2Y6VA 1UK6A 3IBTA 5ALVA 4AO7A 4MWSA 5K3FB 4N5IX 1FFBA 1Y7HA 4BATA 3AZQA 2CUTA 4W1QA 4BRSA 1AQLA 2WIFA 5AM5A 2HIHA 5CURA 4KE9A 1A88A 5EFZA 2XUFA 3FOBA 5AM4A 2OCKA 3CN7A 3TEJA 1QIIA 4AMZA 3JWEA 4M0FA 3QH4A 5AKLA 5AKKA 2ZSIA 2W6CX 3G0DA 3HC7A 4BVJA 4KEAA 1A8SA 3STUA 4EB0A 4X6UA 4D9JA 5LYYA 4BAZA 3SX4A 1T4MA 4Y2RA 4J0JA 3K6KA 1Y7IA 5AI0A 4BYMA 5FPPA 5JYCA 4FKBA 5IVDA 1QIEA 4DLNA 1PFQA 3V9AA 2PSHA 1ODCA 3C6ZA 4FOLA 2JF0A 2PSFA 3QVMA 2C0PA 2Z3WA 3BF8A 3WKEA 4INZA 5ALEA 1GQSA 4DSAA 4ZI5A 1YCDA 1LPMA 1ZD2P 3I2IA 1AC5A 1FJ2A 3MUNA 2JEYA 4Q82A 4HS9A 4AO6A 3STYA 3WWOA 1TCCA 1ZJ5A 2YASA 2OCLA 4AQDA 1DQYA 1QTRA 4ZRDA 1EHYA 3BIWA 2XUOA 4LYEA 3T52A 5ALRA 3O0DA 4X97A 4OSEA 5LKAA 1R1DA 3IA2A 1XROA 1EI9A 1TQHA 2HU8A 3LLCA 3WA6A 1GPKA 3GROA 4WFIA 1H2WA 2HA2A 5C81A 2HADA 1ODTC 3O4GA 2JGLA 4MQMA 4Y2VA 2R11A 5AK5A 2PSEA 1G66A 3ILSA 3G0IA 3FNBA 1YAHA 5CW2A 4X00A 1XZMA 3NOXA 3ZI7A 4JNCA 4BVLA 5DWDA 3ESCA 2XQKA 3QITA 2GZSA 4XWGA 5AKXA 1K6EA 2DHCA 3PFBA 1DX4A 2QUBA 3EBLA 3H18A 5CRIA 4HRXA 4Y2SA 3B5EA 4TPKA 2WILA 3I1IA 5ALFA 5AP9A 3IB3A 3VKFA 5JADA 5EHXA 4IHAA 3FYUA 4W1PA 1LLFA 4DNQA 4AXBA 4AMYA 4NVRA 1BCRA 2OAEA 3TGLA 1E8NA 4J0HA 5C8VA 3R40A 2WIDA 3R0VA 1L7QA 2XLCA 2O2GA 2PM8A 4G1FA 1MN6A 2HRRA 5HQ3A 3BE8A 4FMPA 5FOQA 4FNGA 4H77A 2HHAA 2H7XA 3M3DA 1UXOA 1EK1A 1QLWA 4U2GA 1MJ5A 3DDUA 2HA6A 1VKHA 3DLTA 3F9CA 4LXHA 1FFDA 2WG1A 1GKLA 3WI7A 4UHHA 4Y2XA 4EY4A 1J07A 2JGKA 3QMWA 2ZYRA 1GGVA 3U0VA 3WL6A 3WLAA 4G4IA 1LPSA 5AJHA 2XB6A 1BEZA 4Z49A 4U2BA 4K6GA 4CIAA 1G42A 1H23A 5CT5A 2B9VA 3FYUC 3RLIA 4Y7DA 4G8DA 1QJ4A 4X90A 5I7UA 3E3AA 2WM2A 2HA3A 4J0DA 2D5LA 5BV7A 3STVA 3OOSA 1CUBA 3A2LA 1P0QA 3V1KA 4P93A 3F8SA 1ZGCA 2BFNA 1R9NA 5K3FA 4UUQA 5DYYA 4FBMA 4QDXA 5CH8A 5K3EA 1U65A 4YASA 5ESRA 4UBOA 2HDWA 2V98A 3O95A 4DMCA 1THTA 2C4HA 2BAGA 4Y2TA 4BAGA 3FVTA 1U8EA 2VAVA 2XDWA 4K6KA 2G63A 2CZQA 2HL6A 3L1HA 2BUAA 1NU6A 5BWCA 5ISMA 1YR2A 5E4YA 3SC2A 2WG2A 5HK9A 1A7UA 3C43A 5EIAA 4AX4A 1LPNA 1WB5A 5DLPA 1HLGA 3WL8A 4MEAA 3ZV7A 1YSCA 3R3VA 5T4EA 4OU4A 4Y2QA 2VATA 3DD5A 1LBTA 1XLUA 4CCYB 2AJDA 4QWMA 1ORVA 1XZHA 2XUQA 1ZI9A 3KSRA 2FJPA 3SK0A 3BJRA 2WIKA 4ROTA 2Y1KA 2QUAA 1TIBA 3D2CA 1HQDA 4P08A 2WUDA 4B7ZA 1HPLA 1THGA 2QOEA 4IH4A 2WJ4A 3FWHA 3STXA 3G7NA 3UUEA 1FSSA 4EY7A 4AN1A 1XLVA 3C45A 4RGYA 4F0JA 4QE3A 1ZIYA 1ZOIA 5CH5A 3HLKA 2QZPA 3HZOA 2VJCA 2WG0A 4Q1VA 4W1SA 2BGRA 1CQWA 5K3DA 3TRDA 5LZ2A 1U2EA 1MTZA 5A7HA 4RE6A 3WWPA 1WHTA 1XKTA 3H2JA 3QBJA 5A6VA 4X93A 1ZGBA 3GFFA 3WL5A 2XUGA 3DOHA 3LP5A 4WY8A 1CUAA 3HEAA 3DOIA 4J0CA 3H0CA 3BDVA 3C70A 4C4YA 2RONA 5JANA 4U2DA 1CUJA 1ZD5A 1TCBA 4BC1A 4DNFA 4FDMA 2H7CA 4A23A 3FCXA 4XVCA 4Q3OA 3OURA 3G0GA 1MX5A 4X6XA 4JYPA 3WKAA 1LPPA 4B0OA 2IX9A 2XUIA 3CCCA 3O4HA 3E0XA 2HFKA 3C8DA 2Z8ZA 5JAOA 1CUUA 4P9NA 5HFAA 3I2HA 3ED1A 4J03A 2V97A 5HF6A 2EDCA 2AJBA 1YASA 1E89A 3E4DA 2OGZA 2JGEA 5ALZA 1N1MA 3PF8A 3ZLVA 3B12A 3VVLA 5A7FA 2GBGA 3W2TA 1CIJA 1HBJA 4QWWA 2H1IA 2ECFA 4GBGA 2R8BA 2WTNA 1XQVA 1WM1A 3I2FA 3VJLA 3D7RA 4J0IA 1WOMA 3UMJA 4IH1A 3AJAA 1P0MA 1CUZA 5ALWA 1LPAB 5LKRA 4J0KA 5LP1A 2X76A 1XQWA 3U1TA 2XMGA 5AHXA 4UHDA 1EX9A 2C7BA 3I2GA 1MAAA 1UZAA 4OB6A 1EINA 1JJFA 4UFNA 2XUJA 4F21A 2FUKA 5AI6A 5A2GA 4WDRA 2ZJ7A 4AZ0A 2CMFA 3G0BA 4UBIA 1TAHA 2B20A 4MYSA 5I8PA 5ALSA 5JD6A 2OQVA 5CT9A 2QKYA 4QDOA 5T4BA 5SYNA 3H04A 5AKGA 5AIBA 2AJCA 3C6YA 1WPRA 2PL5A 1EK2A 2GYVA 5AKZA 1UT6A 5AOAA 1EDBA 4ZV7A 5AI8A 2GYUA 1MNQA 1Q0RA 1NU8A 1EDDA 2OXEA 5JZBA 3V48A 2C0QA 2JIDA 4A16A 5HQ3B 2UZ0A 3WKDA 2VT7A 4ZV9A 3O4JA 4CCYA 3I28A 1XKLA 2EDAA 2WFZA 3EQ7A 3WZLA 4X6YA 2CBGA 3HXKA 4Y2JA 2XQJA 1KEZA 2PX6A 1H2ZA 4W63A 4OCZA 4B9AA 1J2EA 1CV2A 4X3CA 5YASA 1EXWA 4UBJA 1UKAA 1QE3A 3A70A 1NX9A 4G9EA 4B85A 1GPNA 3MGAA 1CUCA 3BJMA 1XZDA 4YPVA 2WHPA 4L3WA 3FVRA 1QFMA 4FBLA 1VJ5A 3CN9A 3AIMA 4G5XA 4DNPA 1CRLA 1QGED 3PI6A 5AKEA 2WUGA 2XUDA 3I6MA 2OQIA 5CT6A 4H7JA 1XRRA 1LGYA 2YH2A 3CXUA 1QO9A 2GYWA 4GW3A 2ROQA 3TJMA 3V1LA 3WWCA 4H0CA 1E8MA 1ZICA 1R50A 3G0CA 1FFAA 2DR0A 3WMRA 2QXTA 1LNSA 5JAUA 3F67A 3P2MA 5ALQA 1B41A 1WCYA 2BUCA 2I03A 1UKCA 4LXIA 4N8EA 3IUJA 3WK8A 1WPXA 2VJBA 3HACA 4RE5A 1X2EA 4W9RA 2AJ8A 3H2IA 2DCMA 3WKCA 3EF3A 3IUQA 3V1NA 1YA4A 1S8OA 5AK3A 5AKHA 4QNNA 1ZD4A 4HXFB 3O4IA 5DYWA 4CG3A 2WUEA 1ETHA 5HF9A 4BZZA 1CUVA 4PQEA 5LIPA 5ALXA 4NMWA 1BS9A 2ZYIA 4K5QA 3A6ZA 4WFJA 4WJLA 1XZCA 4HXGA 5ALMA 4CG2A 3I1YA 1XRPA 2K2QB 1MX9A 1JMYA 4O08A 5AK6A 2PSJA 3HRHA 2XUAA 3NUZA 3QPDA 1AMNA 4KE7A 1GQRA 3WJ1A 3FYUB 4OB8A 1TRHA 3QM1A 3LIIA 3FYTA 4ZWNA 4N5HX 3B3QA 5IVIA 2VEOA 2DQYA 2QT9A 4OYLA 4W1RA 4C4ZA 2GBFA 5AOCA 1P0PA 4UBKA 1U4NA 3QMVA 4XJVA 5ALTA 4MQLA 1F0NA 5ALYA 3A2MA 1DWPA 3BXPA 3AIKA 4GHWA 4PSDA 5FUMA 5AO9A 3OPMA 4MXDA 2IITA 1FFCA 3VVMA 3BL8A 4KAJA 4QDTA 2DSNA 2ZVDA 3W06A 1AZWA 5E4TA 2B4KA 2DHDA 3ZLUA 2BJHA 1FFEA 4WFKA 3D3NA 5ALNA 5ALHA 4FTWA 4J7AA 4QA9A 1BE0A 1K4YA 3ICWA 3D59A 3IIIA 2PUJA 4EUSA 2XQIA 3W04A 1IUOA 2ZYHA 2VJDA 4BE4A 4BVKA 2XUPA 2WKWA 4EZIA 1CUIA 2G4LA 5ALLA 3H1BA 4QLOA 1E3QA 5DNUA 5AM0A 2XMRA 5JZ9A 3LS2A 5IVHA 4MEBA 1MO2A 2XQFA 1GKKA 1I6WA 4X94A 4UHEA 1TCAA 1UOQA 1XRQA 5CT8A 3WZMA 4KJXA 4KRXA 2QXUA 4EHBA 4UHCA 1ZI6A 4CI9A 4U2FA 4BCCA 4RNCA 1CQZA 3DNMA 1J1IA 1E8DA 4OB7A 4UPDA 1BN7A 5HCUA 2ACEA 1T2NA 3WWEA 1CEXA 4PNZA 5EHQA 1JMKC 3PF9A 3D2BA 5ALGA 4U2EA 4DTCA 1GPLA 2ES4A 3HSSA 3Q0TA 1BRTA 1TKRA 4X7BA 3W9BA 1C7JA 4H18A 1LZKA 3FSGA 3STTA 3QPCA 1R4ZA 2BKLA 3G9ZA 1CR6A 3Q8WA 4JH0A 3KWJA 4B81A 5CTAA 4V2IA 2CKMA 3IDAA 4CCWA 2AXEA 4DYHA 3LIPA 4KYVA 4CFSA 1CPYA 2XUKA 1F8UA 1SFRA 1JU3A 2XT0A 2G5PA 4I3FA 5AH0A 4LKOA 4Y2PA 3HABA 4PSUA 3DEAA 4NS4A 3OTQA 4ITVA 1CLEA 1QONA 2Z5GA 3R3UA 1UOPA 4C4XA 5T4HA 5CXXA 1SCIA 4PV7A 3PE6A 4BB0A 1VZ3A 2XMQA 5DTJA 3H2GA 3G9UA 4QDUA 1HL7A 4H35A 1XLWA 3WK5A 3EQ8A 3RK4A 4GXNA 5JD5A 3UUFA 1LBSA 1CVLA 1OXMA 5EGNA 3G02A 2PKYX 2XMSA 3W9UA 3JW8A 4I19A 5ALKA 2HU5A 3PUHA 2GBCA 1XZJA 3IURA 1DINA 1VZ2A 2Z3ZA 3ANTA 4ZREA 3O9MA 4GWLA 2XI4A 4JYMA 4HVTA 3D5EA 4C6HA 3S2ZA 4FFWA 4C88A 1ACLA 2XUHA 1QZ3A 5D3ZA 1MPXA 5H3HA 5FRDA 3N2ZB 1F0PA 3FAKA 5KWIA 2RHWA 4TGLA 3MVEA 3DQZA 4Q3KA 4BP9A 4UHFA 5E2IA 4C89A 1LPBB 2FX5A 2HRQA 3SWWA 1P0IA 4E15A 3WK7A 2J3QA 3VDXA 4YK7A 1JFRA 1JKMA 5CBKA 5AKIA 1W52X 2ONCA 2PUHA 1H22A 1AKNA 1DU4A 5LZ5A 5KREA 1CUXA 1DT3A 4GEGA 5LLSA 1YB7A 4DIUA 1XFDA 4EBBA 3AUKA 4PSCA 2O2HA 2JGIA 3RARA 1HDEA 3H2HA 5K5EA 4Q34A 4C01A 2AJLI 2Q0XA 3FLBA 4L0CA 1MNAA 5LZ8A 2WQZA 4WCVA 1K8QA 5AK4A 2OGSA 3LCRA 4N8DA 1PJAA 4Q3LA 4NZZA 1M33A 2EEPA 2VA9A 4QZVA 5CMLA 2QTBA 5JZSA 3FSGD 3KOOA 2WJ3A 4DGQA 4RPCA 1ZIXA 1UK7A 1XRNA 5FP0A 3H19A 1CUWA 5FV4A 2RHTA 3R3WA 3D4LA 4DMKA 1IZ8A 1J06A 4BAUA 4BC0A 1GXSA 5AI5A 1XQXA 1IUPA 1CUHA 3KXPA 3DS8A 5HZGA 1K5PA 2V9ZA 4B9EA 3KDAA 2WFMA 3CCBA 3JYHA 1W76A 5DTIA 5ALDA 3WQHA 4Y2UA 5A7GA 1MT3A 2C58A 4U2CA 5D7BA 2XMBA 3PICA 1QTIA 3IVMA 5A62A 4Y2YA 4KE6A 4IQ4A 5CXUA 2OPHA 1CUSA 2WU4A 3GBSA 4OPMA 2XMCA 3H1AA 1BROA 3QMMA 3M83A 1RP1A 3DKKA 3PUIA 1VXOA 2QMQA 1UK8A 4KR0A 2RIPA 1ISPA 2J4FA 1EB9A 4ZXFA 4ARAA 1O6GA 4TVKA 1EDEA 2RGUA 2WHRA 4AO8A 2XE4A 1TK3A 3ZPXA 4DSZA 2PSDA 1EVEA 3L1IA 4BDSA 5K3BA 1GT6A 5EI5A 2JGFA 4HRYA 1WHSA 1A8UA 1WB6A 4A5SA 5JASA 3K2IA 1BEEA 2H7YA 3ZLTA 2J4CA 3WIBA 1UKBA 3M81A 4E14A 1L7AA 3DJYA 3GELA 1CUFA 4EY8A 1H2YA 2QM0A 3H2KA 3FLEA 4J3JA 1XZLA 5EHNA 5SYMA 3G8YA 5JAHA 3ZWQA 5BOVA 1ACJA 1SOMA 5ALIA 2PPLA 3DYIA 2XLBA 5DYTA 5HFNA 4M0MA 4IH9A 2WSLA 1WB4A 3N0TA 1CUDA 2DQZA 4Q05A 1R3DA 3WJ2A 1E5TA 1QIKA 2WIGA 1X2BA 3T4UA 4FNMA 3EIOA 4UBMA 3DCNA 2WUFA 4FWBA 4AZ3A 5ALOA 1BN6A 3DYVA 4QEKA 4JEIA 3VXKA 2J3DA 3WK6A 2B61A 2WFLA 4EY5A 2PU5A 3C5VA 5FDFA 3PFCA 4K6HA 2FJ0A 5T4FA 2BUBA 4UBNA 5JATA 4L72A 4H7FA 3NWOA 3BDIA 3WYNA 4BRZA 4LYDA 3HJUA 4FHZA 3VISA 1Y37A 3WIOA 3OM8A 1XZEA 1L7RA 5IKXA 2X8BA 2C5GA 1QIFA 1VA4A 2CJPA 1DT5A 5DNVA 1MU0A 1RWQA 1DX6A 2OCGA 2ZSHA 2XMDA 2X5XA 4CIBA 2OLEA 1QIGA 3H17A 4PF1A 3C8HA 4HXEB 3GUUA 2LIPA 3QZUA 2Y6UA 3IUMA 1YA8A 4BTLA 1EVQA 1CUEA 4KAAA 4CG1A 4N8SA 2HA7A 1E66A 3WK9A 4QDZA 1HKHA 1G4HA 3DL4A 4ETWA 1UFOA 2E3JA 4BDTA 2QJWA 3D0KA 4M0EA 1JJIA 3I6ZA 3STWA 2GZRA 1XZGA 5AIAA 4G4GA 4BP8A 1R88A 4B82A 1ODSA 2Y2VA 1IVYA 2OCIA 2XQGA 4YX9A 4PO3X 4LHEA 1W4LA 2WHPB 3HI4A 3FCYA 3L1JA 1G5FA 3D2AA 5LZ7A 5CH3A 2BCEA 2QS9A 4G8CA 2I78A 4X71A 4OU5A 1QOZA 2IIVA 3EQ9A 4XIIA 3A2NA 4UFPA 2NW6A 5HKBA 1SCQA 4H7EA 3NGMA 5EIHA 1VA5A 4B80A 4C87A 5IVKA 5DNWA 1EH5A 5D3KA 2RI6A 4FLFA 2CB9A 3WYDA 3C6XA 3ANSA 1UOOA 4BTVA 3S8YA 3QPAA 1Q0ZA 3KD2A 4HAIA 1USWA 5JD4A 2WTMA 2O7VA 1LPOA 2I3DA 4KACA 2WFLB 1DQZA 2QVBA 1VOTA 2WU3A 4KE8A 4B0PA 3I2JA 5LZ9A 3C6BA 4EY6A 2GBIA 3AFIA 1OILA 1F6WA 4BCDA 4JUIA 1JI3A 1AX9A 3K9BA 1W6RA 1OCEA 1YB6A 4H7HA 1XZFA 1UWCA 2P8SA 2C5FA 2G5TA 3BF7A 4DMHA 1EB8A 2HFJA 3I6YA 1IMJA 4QLAA 1Z68A 3AIOA 4EA6A 5AM3A 4ARBA 4IO0A 5J3JA 2ZJFA 3ESDA 5AICA 3R3YA 3DL7A 5LZ4A 3RM3A 5AI9A 4X92A 3C5WP 4BE9A 4GDMA 5I9IA 2OGTA 4H7IA 4XX1A 5EHZA 5AI4A 4L9AA 1VE7A 1H2XA 3ESAA 2ZJ6A 2HM7A 4UBLA 2Z8XA 2VT6A 1X70A 3IULA 2PBLA 5K3CA 5IH7A 1AURA 4X91A 4KAFA 3W05A 3WA7A 2DFPA 4MWTA 2WHQA 1Q83A 5AM2A 4X95A 4FLEA 4LIPD 1JT2A 5D6OA 3FLAA 2O2IA 4OYYA 4G9GA 4B84A 1QO7A 5JAPA 4BBZA 2XMZA 5ALUA 3VJKA 5HF8A 4S0XA 2PVSA 3WKBA 4UHBA 1IZ7A 2I3ZA 1UK9A 3O9VA 4DM7A 1QFSA 1YS1X 1AGYA 1N8SA 3YASA 5FPQA 1W1IA 1C7IA 3G9XA 4ZGBA 5FXMA 1DWQA 4FFVA 1CUYA 1QIDA 1DWOA 2VF2A 1GZ7A 3PDCA 2JBWA 5JALA 2ACKA 2JGMA 2QJRA 1D07A 3AINA 3VJMA 1DTEA 1BU8A 1XRMA 1ZJ4A 1QIMA 1XZKA 1B6GA 5HKAA 4WDQA 3QYJA 3KWFA 5HK8A 3WK4A 3DKRA 3HYSA 2ORYA 4H7DA 4DMFA 2QR5A 1CUGA 2HA5A 4MYDA 4B6GA 3BWXA 4GECA 1ZD3A 1SCKA 2O7RA 2VJAA 5C7YA 1KU0A 4X85A 3ICVA 1Q84A 5ALJA 2VAXA 5HF5A 3MUOA 4LXGA 2WIJA 1XZAA 2ZYSA 3WWDA 4KRYA 2D0DA 3R3XA 5BWBA 2PU7A 3R41A 1N5RA 5F4ZA 2BGNA 5DJ5A 2HA4A 3AZPA 2VQ6A 1MX1A 1QIJA 5C8XA 2VTVA 4K2AA 2YXPX 1SC9A 6YASA 1O6FA 1JU4A 3X3HA 4PW0A 5JIBA 3GA7A 5FKJA 4GLBA 1BCSA 1C4XA 4AB1A 2W22A 1EA5A 2Y2UA 3AZOA 1XQYA
chains in the Genus database with same CATH superfamily
1V7PC 1AS3A 4GT1A 1K97A 1IXZA 2FB9A 3ESBA 2RAFA 3IUNA 3HEBA 1DFIA 2ZJ1A 4UEJA 3SE0A 3EMVA 3RJTA 4RXTA 4UASA 2LCIA 1NMXA 4ZVOA 1XTBA 2IDKA 3ORQA 1VFPA 3KCNA 4ZT3A 5A71A 1PJ2A 2V1UA 2B2CA 5JYEA 1FZTA 3EIQA 3R6GA 1TU0A 5CFOA 3RKSA 2GS9A 1VYTA 1WDWB 4N0QA 4V0OA 5E6SB 3BD7A 5A5DA 2Y1XA 2I6FA 3AW9A 1I8TA 2R44A 1MAHA 3B1ZA 2QRVA 2ZU6A 4H1HA 1LZLA 1YE8A 4AZ0B 3K2EA 1XO1A 2FP4A 2JFHA 1LV8A 4CV3A 4HFRA 1DQNA 1ODIA 2WM9B 1KU6A 3QPVA 4RBNA 5F7JA 2W70A 3HP4A 4HDAA 3TDKA 1REQA 2YOFA 4DJFC 2WJVA 5JY1A 4G4JA 4ESHA 5IRCD 1TAQA 3ZK7A 4L85A 3OG9A 2O8DB 4MWDA 1WHSB 1W75A 2VQEB 1H5UA 4EKDA 1WL8A 4A15A 5IDYA 3R4CA 2ABWA 4XVQA 2GETA 1YAJA 3L7NA 2JAUA 2Q5QA 3IH5A 1XVLA 3L6OO 1L5MA 2NZ8A 3A6DA 2ZJ2A 3CZ5A 3MTGA 4R4JA 3RVJA 4BECA 1HF3A 2OZVA 4KFUA 3WL7A 4OD0A 1O5TA 4HB2A 4NICA 1PGJA 3JWPA 4J9UE 4JVOA 2YHUA 3E05A 3PYMA 1KVQA 2HZBA 3DL0A 4M0LA 4EX6A 1AG9A 3K4HA 5B58T 1H9CA 1X94A 4ZO7A 4PNPA 2NU7A 2CHUA 1QX3A 5AW0A 1IC6A 1T9BA 1FUUA 2BDUA 4TWJA 3P0FA 1NW4A 3H0EA 2B92A 3IOCA 4O02B 4C43A 3NEJA 1K4MA 2V7PA 4YCAA 3M82A 3VDQA 4NHEA 1GEGA 3OA0A 4OI4A 1GADO 1TJPB 4RHEA 4RENA 3UK2A 5CUQA 3CHYA 3OCWA 3E0QA 3R3ZA 2YC4C 3VHQA 1WR8A 4Q24A 3PHHA 1SQGA 3AHEA 4ZOBA 2WJJA 4MUIA 1WZIA 4RDHA 3H3FA 2G0TA 2OAQ1 4GG1A 4RK4A 3EZGA 4ALKA 4MUEA 5JZMA 2ZBFA 3BIXA 5K01A 4LBVA 4RH0A 4GBMA 1JWAB 1MDBA 1NUQA 4WY5A 5HP4A 4GE0A 2Y27A 4N9WA 4XARA 4OYHA 1M34E 5J1SB 1GDDA 4G65A 2PK3A 1SU8A 1Q6ZA 2PKCA 2BFEB 2HSWA 3R5FA 4QTZA 5CFLA 1RJ9B 3FTFA 3E3MA 2FX2A 2FCAA 4MRNA 3JASA 3LRTA 3GRVA 1PZMA 3HP1A 1PV1A 1KK1A 3H7IA 1UC5B 4MJ3A 4FCCA 4C2TA 1PFGA 1AJEA 1KETA 1AHIA 3NT5A 3AILA 1S02A 3PJDA 4IY1A 4HQNA 3RIEA 2WLSA 5TLSA 1YZLA 2ZUUA 4OXRA 4F1WA 1L8AA 1VGQA 1J49A 4MCIA 2XMPA 4E46A 2HO5A 3ZXYA 3OX3A 3CZQA 3F8TA 3WICA 1ZZGA 4ZHQB 1YCGA 1ZI8A 3I2KA 1HFJA 3L7BA 2NXWA 1J0BA 2IU0A 1Q3TA 2X22A 1V1JA 2FPRA 4HDMB 4F5ZA 1AN9A 1VHQA 4AKTA 2V59A 1ULTA 1TVEA 2NO5A 1LBIA 3DHNA 1PBTA 3S81A 4BUZA 2X19A 4NV0A 4FLMA 3X1MA 1XZIA 3DOOA 3UK1A 2IY9A 4XIJA 4YRRA 5CBPA 1QIHA 1QRRA 1G6OA 1Y5IA 4K40A 4NJEA 3CLTC 3PDHA 2SCUA 1N9ZA 2UXDB 1OH5A 3IBGA 4RYLA 3U48A 2QP9X 2Y6VA 4X41A 2JHAA 4DF3A 2FEMA 5ALVA 2I87A 5I7FA 4DPKA 1M1NA 3KT6A 3O82A 4EJ0A 1DXQA 3DUFA 3ZVKA 3V2IA 4FB5A 4K6CA 2QE6A 1E7RA 1K98A 4NZPA 3GLSA 2PGIA 4Q4HB 4ZDWA 3OLYA 4P3YA 5JHHB 4BB5A 4W5HA 4Q16A 1OBHA 4BATA 2HDOA 2JVJA 2QVCA 3I04M 3GEPA 1I3OA 1OBCA 1G0NA 3TEFA 5EKUA 1DO0A 3IP6A 1Y1SA 2WIFA 3DMYA 4OHVA 4AF8A 5CURA 2J3MA 2EWVA 3FYDA 5JNUA 5EFZA 3IEVA 2WC1A 2O3UA 4AMGA 3BBLA 3KZCA 2VDLB 3TEJA 4RELA 3OM9A 4BP1A 1YZYA 1Q7GA 2ILTA 4FDLA 3JWEA 1VSTA 4KXUA 3ADCA 3E1KA 1MV8A 1W87A 3QH4A 4LAFA 2X9NA 1D2GA 1TGVA 4WZBA 1JDNA 1P8AA 5AKKA 2ZSIA 4D3XA 4DZTA 3L0SA 4ADSG 1TVMA 3G0DA 1PTKA 1QH0A 4BVJA 3CLSD 4RF5A 5DGDA 1L1EA 2F43A 2OB2A 4FYHA 1NF8A 2WJIA 5DHQA 2ODBA 3MCVA 1NG9A 5KNBH 4R2WA 4EB0A 3LX5A 5C35A 5JLAA 3PLAE 3MM4A 5DTRA 5FO0A 3ZY3A 1ZK0A 1XHEA 2ISCA 3SX4A 3Q7SA 3VOSA 1MMFB 4DZRA 1T4MA 4XSHA 3RSGA 4HATA 2WPDD 3K6KA 1Y7IA 3LT0A 3MT9A 2Z2IA 2B34A 3ORFA 5JYCA 1VGVA 4AJ1A 1WCWA 3GJ7A 4RDIA 1QIEA 2WWXA 2ST1A 3GGCA 1G8SA 3DEZA 3V9AA 3QE9Y 4IJVA 2F4VB 1ECFA 2RCNA 3BQMB 3C6ZA 3K8QA 3QKRA 1AKEA 4Y9UA 5ECYA 1HH4A 3UH0A 2PSFA 3QVMA 5G0SA 2RARA 2MMCA 1Z39A 3DTNA 2ZZNA 3WKEA 2J0EA 1K92A 3KJXA 1E3JA 4QUAA 2IH2A 2GA8A 4YJ2A 3LHDA 2GAOA 2I4MA 4HHEA 4ZI5A 5D2CA 3OTIA 3ZBTA 4EWLA 1PFWA 1ZUNB 2DLNA 4QXMA 3OCYA 1F5SA 3WLJA 2FFJA 2Z95A 3HKBB 4DCPA 3Q15C 4EQ6A 2FSSA 4CL2A 3QEMA 4HS9A 2RK3A 3IESA 4QODA 4MPTA 3V6MA 4JI2B 3A4YA 1Q77A 1A1SA 3EVNA 3GJXC 3SQLA 2FWRA 3C4QA 5EE3A 3WWOA 1PWEA 4XR9A 1US8A 4FCWA 3H7AA 4AY4A 2PE5A 1V96A 5KTNA 1CZKA 5GZ1A 1O89A 5IYZB 1DQYA 1EHYA 3BIWA 2XUOA 4HYTA 4DIFA 5ALRA 1DP4A 2OZKA 1E20A 4TKUA 1CZHA 4X97A 4F8EA 4OSEA 4XUGB 2A1TR 2HMUA 4ABTA 1SCUB 1FVHA 3IA2A 4H4EA 1BCRB 3W4IA 1E1YA 2M6KA 2WF7A 1PJLA 2HU8A 3O1HB 4JENA 4KDRA 4Z1MD 1YQDA 2YFKA 3BSWA 1HNNA 1THMA 4ED9A 1XTQA 3ZYCA 2K5UA 2MSDB 2REQA 2X58A 3GROA 1VI2A 3M33A 3ZQKA 2ORVA 1M8PA 3FMFA 2NU8A 3K96A 2YWHA 3SXUB 2D06A 3KYCB 3X1DA 3LRPA 4OP1A 2HA2A 3D7LA 2JHGA 1T26A 3O4GA 2JGLA 1BYUA 1T5TA 3DTTA 3HPRA 4G0QA 4I55A 4J94A 2Q9CA 4R40A 3RVBA 3S2YA 4EHJA 2VS1A 3UMMA 2R11A 1IZ9A 2ACWA 3D3JA 5AK5A 3RAFC 3FKJA 4HEA6 1MQ9A 4MQEA 4MGZR 4WKPA 1ZH6A 3ZTWA 3FNBA 2EBFX 3M6LA 4EF4A 4OKIA 3ROGA 2VYQA 4J75A 2I2BA 3NOXA 1WPQA 4P82A 4UE2A 3FMGA 3ICQB 5CCBA 1UR5A 1G8KA 1I2MA 5H8WA 1XL1A 4HTFB 3B7PA 5T67A 2G7ZA 3KR9A 1MQSA 1W8DA 2VPXA 3EZNA 4WY2A 2DZDA 2P9TA 2DE0X 2V3CC 1NVDA 5KMGB 3RSLA 1UM8A 2X0RA 2OOKA 3IERA 4JMLA 4RVDA 3BD6A 1QK3A 3CZRA 2DHCA 3VA7A 3G2OA 1EFVA 1ZZEA 4QX6A 4OLHA 1M2VB 2AQKA 4JVMA 1POXA 4AQYB 1EG2A 2Z6AA 2GCPA 2DM6A 2WILA 4K9NA 1Y3CE 2P9CA 2ODQA 3LWBA 5ALFA 1E9SA 2G9NA 5DBGA 4DG8A 1DQSA 5AP9A 1DTWA 2FEXA 3GNLA 1BMTA 1V5GA 5GJBA 5EHXA 2ZYAA 4KHPB 3LF1A 1Z4JA 4WXEA 5JH7F 4W5QA 1YZTA 1LLFA 2EIXA 4TRRA 5EP3A 4C5CA 1SZJG 1JB9A 2B25A 2ZRHA 1NFQA 2TMGA 1VG1A 3OEHD 3R6LA 3U31A 4DNQA 3MWEA 2RH5A 1WD5A 2WAMA 3F90A 4LVOA 4NVRA 1X1DA 1R6VA 1DC3A 1E8NA 2H2DA 1ZVKA 4RK6A 4M9QA 4DJDC 3CRZA 4OQYA 4QYIB 3RS9A 1J8VA 1L7QA 2F4NA 1GGHA 2XCTB 2B1RA 5DK6A 3GGGA 3BCRA 1DTSA 4FZJA 1NQXA 1KZ9A 4H08A 1QLJA 2D74A 3BX1A 3GO4A 1OAOA 3RBVA 1YBAA 3TYXA 3W4KA 1RXVA 4G1FA 3K70C 2PLRA 5JECA 3TTSA 5HQ3A 3TWOA 4IDNA 4MCJA 4FMPA 3K1AB 2N0SA 2CMHA 1V2GA 4FNGA 5FAXA 5JCJD 3GUHA 5BWNA 4H77A 2REBA 3OEHA 1NKVA 4X45A 4BLSA 4J6EA 2JFNA 4PAOA 3FHTA 3GJ8A 2XGSA 1NW8A 3IHWA 3K0KA 2GCIA 3PQ2A 1P6QA 4XLLA 4AXXA 2C8JA 4JI4B 3FY4A 2CL0X 3JD1A 1D6JA 1DMRA 1Y9AA 4C4OA 1KRWA 3GRZA 3C3CA 4U2GA 3A7EA 1CC1S 2KB0A 4MW6A 1B0UA 1JQ5A 2HA6A 2NNWB 1V4NA 1Q3KA 1SRRA 1VKHA 1YJCA 2XJ9A 3AUFA 1CJMA 4LNUB 4G5SA 4LXHA 3TZCA 1FFDA 1KQPA 2YV4A 2QMZA 3K0AA 2Z8YA 7AT1A 4GX0A 1NWHA 1KF0A 4Y2XA 5F2NA 5LDDC 5T8KC 3UENA 3CO5A 4EY4A 1W9MA 2JGKA 3QMWA 2Q8PA 2XCLA 3LHSA 4D9FA 4YAOA 2ZYRA 5BMVB 5LJIA 1GGVA 2GXAA 3VVCA 3ND9A 4NEQA 4YMIA 1XB2A 5JC8A 1WMDA 2F1IA 3WL6A 3GAAA 2NUTA 1UXJA 5CK4A 3T41A 4HN4B 3E1SA 1YB4A 2O6HA 1LPSA 1N2JA 2IQ5A 4MWCA 3RREA 3O7WA 1SKUA 3DW1X 2XOKD 1BEZA 1AIPA 1ID1A 1UBHS 3ETCA 4WIAA 4U7JA 1CDDA 4U2BA 4K6GA 1Y9EA 3UT5A 1P1CA 4CIAA 4CUZA 3LPAA 2XWSA 2APJA 3CUKA 1IK6A 1N6RA 3U3OA 1RAEA 1FQOA 1IQRA 1N9GB 3AEUA 2YWBA 4AG6A 4KWHA 5JR3A 1ESNA 4DR1B 1GTRA 4CT5A 1Z2OX 4KK4A 4XM0A 4W8HA 5EA2A 1NQWA 2PZGA 2PZBA 1M7GA 3E3AA 4DR2B 3U7FB 1TTPB 3UHOA 4B4VA 3KKNA 2AC2A 3K0HA 1E4EB 3C24A 2JS7A 2YMLA 1DARA 1MDFA 4J0DA 5T6BA 4AYTA 3C7KA 4BMVA 3GCXA 2R1VA 2W6IA 1KNXA 4TUYA 2EFEB 1IXKA 1C80A 1CUBA 1QQ7A 2O3QA 3UHJA 1DDOA 1KAOA 3V1KA 3A7DA 1A71A 4G0NA 4ASUD 4D9BA 3CH6A 4YDQA 4P93A 3B5IA 3F8SA 3ERCA 1NYTA 3FPSA 3JSAA 3L8HA 1R9NA 1IHPA 3A3PA 3AHJA 4MA5A 2FGKA 1Z7BA 4FBMA 4A27A 2O14A 3TW6A 1EAYA 4D79A 3BEOA 3WLIA 1L1FA 1S2MA 5K3EA 4MKRA 1YJAA 2PX0A 4FJ2A 3ADKA 4Q00A 2WF9A 3ZR4B 2QL7A 4XPIA 4UBOA 3TB6A 2HDWA 3B51X 2BM1A 3GCGA 1SVLA 3OZSA 4KX3A 2QRGA 3VSEA 5KYVA 4DMCA 2DHQA 2AD1A 4WNAB 1FDWA 1THTA 3ABZA 4JFRA 1MO4A 4JJIA 2C4HA 4ILKA 4WHMA 4YRJA 1E9AA 2GM3A 1CWUA 4QOSA 1U8AA 2VZ0A 1E1QD 2BAGA 2PZLA 3PPIA 3CRW1 1EP9A 1SIBE 1ZJYA 3A3NA 2WUVA 5TR9A 1SA0B 4OQPA 3ZXXA 2A5DA 1T2UA 1KAGA 1KOFA 3BJZA 3RVPA 3CWZA 2G63A 2ZE7A 1KVTA 4CIDA 4J76A 3FG9A 4KCGA 1N7IA 1W59A 3SJBA 4LRXA 2I2FA 3NHZA 5HMLA 1FSPA 3LBNA 2FR0A 1MRNA 5BN4B 1LH0A 1BIFA 3BK7A 2GAFA 1ZBQA 3CJTA 4GSKA 3W5VA 3GLUA 1SHLA 3LFUA 4DLYA 1NFFA 1EIWA 1I10A 1YR2A 3QU9A 5FA6A 1ZNYA 2VXBA 3C3DA 4BX2A 1K7YA 2RBKA 1FMJA 3LCUA 5EXDA 1RXEA 2IHZA 3NR2A 4NBWA 1ZNXA 5K45A 4C4PA 3B9RA 3S8EA 3IQWA 5B2ZA 1TLTA 2I3AA 3V4PB 5LN1A 1E18A 3OMXA 2C4NA 1GIAA 4JS0A 5EJMA 5EIAA 3SMQA 421PA 2FQYA 4ND5A 4JP1A 1UPBA 1IK4A 4EL0A 4RPHA 2QHXA 4RJJA 1T4GA 4R9RA 1QHNA 5B6IA 3KP1A 3WL3A 3NV9A 4BQQA 3MERA 2IXTA 1QGDA 4FYXA 4PZPA 5ADHA 3FDJA 3R3VA 3WXBA 3Q8KA 1M1UA 3RYIB 4R31A 3GWZA 1RVV1 4EF5A 4HWPA 4YIHA 1CKEA 1QYCA 3JYOA 4KNVA 1P9LA 3EVTA 4OU4A 4EGAA 3SZGA 2R68A 5F78A 2HV8A 3JALA 4L9RA 3LYUA 1XUOA 1RWVA 2CLKB 4KR7A 2RHBA 3W1VA 3HS3A 4KXMA 4K6MA 4Q01A 2CL6X 2NT4A 5KQPA 1XLUA 2QTVB 3U2QA 4LXYA 1UZUA 3ANXA 4G4SP 1BXRA 2XUQA 4G0VA 4BX9A 2UVPB 5JPDA 1UBJS 1PZHA 1ZI9A 2MINA 3T5DA 1JLRA 1YOVA 2JHPA 2VFAA 3COVA 1IULA 2WMNB 3MCAA 4UHJA 1B74A 3KRTA 5CFZA 5JH7A 3GQVA 2BKXA 5CIWA 5M7EA 2GI4A 4ROTA 5F4BA 5DI3A 2WT4A 5G2OA 3HWSA 3W6OA 1TIBA 2C1EA 2VF4X 4OUDB 1E5LA 2BD0A 5I5EA 2BEKA 1JGTA 2VNSA 2Z5VA 1QZUA 4P08A 1APBA 1H2RS 3U4IA 1RC0A 3SR3A 4YRFA 3ZHCA 1FXWA 3M5CA 5BSWA 1THGA 1RPJA 1KYQA 1QRDA 3DMRA 4D5EA 5JNVA 4DV1B 3LT5A 5DN9A 1GZ5A 4D9IA 4QO8A 2JVIA 3G7NA 4ZVSA 3ZIDA 1FSSA 8MHTA 4EY7A 1XNHA 2B7BA 1L7VC 3RS4A 1MFZA 5BSEA 2PWPA 5HW0A 5DULA 2VZ9A 1NVAA 4O4JA 4P7JA 4F0JA 4A0RA 1ZOIA 3FWNA 2Q8NA 2WYWA 3HLKA 1EE2A 1QK5A 2Y68A 1Z5VA 2BR4A 1SZPA 3SBOA 5AK0A 2W2OA 5K0LA 4J16A 1VMEA 2WG0A 1VI6A 4JOSA 4W1SA 2VJLA 5P21A 3W77A 1HFKA 1U2EA 4XA8A 2D1TA 1P6UA 3BXXA 1H85A 1VP3A 3S28A 3EQ6A 1KZ1A 1QBKC 3NTLA 4B3XA 2QUJA 3ZWNA 1WHTA 3M3HA 1LQUA 3B7WA 3QBJA 5M3BA 2IHVA 3HUTA 3EEYA 5A4AA 4MPRA 1FU8A 1ZGBA 2B99A 5HM8A 1KQOA 4ALNA 1G5TA 3JQGB 5DXJA 2D5AA 3EVZA 3LP5A 1B8PA 4EKNB 2KHZA 3KT8A 3SS9X 2YOGA 3D4PA 5EESA 1U0NA 2RBEA 4CM1A 1OVMA 3K20A 4LJ9A 4RYDA 3C14C 5JEEA 3AF5A 5KCZA 3IR5A 1G16A 4OHZA 2PZFA 1WUHS 2IA5A 2AKEA 3H0CA 3RC3A 4PQFA 3ANLA 1BX0A 4LHWA 4C3ZA 5JT1A 5JANA 2VZEA 4GOJA 2L19A 1EKXA 5ILQA 3K70B 2P7IA 1ZD5A 3PJFA 4UUOA 3WHIA 3F6CA 3W5DA 1BKSB 5U9CA 1Q14A 2YY6A 3FCXA 5E3IA 2B8NA 3ELDA 3T3IA 1LI5A 3K4QA 1BHO1 2KQUA 2WJGA 4EI8A 4HVLA 1MX5A 4NNJA 5B1YA 4X6XA 4JYPA 4KIUA 5AVVA 2JG3A 2AC4A 1CEEA 1EBUA 4MW4A 4YWJA 3DAFA 1GZUA 1KMMA 1KI8A 1YQEA 2QGZA 4NYIR 4HV4A 1HZZC 4YRDA 5ILGA 3CVUA 1U7ZA 1V3TA 3EJ6A 4P2GA 1E6WA 1T8TA 4YROA 5IG2A 3AKZA 3SSAA 4EGFA 4ID3A 4A6PA 2Q0HA 3LQYA 3CCCA 2IBMA 4FEAA 4D3YA 2WNHA 1EGMB 1XYYA 3AWDA 3FJ1A 4QBTA 3THSA 2A9VA 1OZAA 2AD5A 4FGZA 2IH4A 2C57A 4NFLA 1H3NA 1H9BA 1AKMA 5HFAA 4P9NA 2CV0A 1ZC4A 2R85A 2WDZA 2XGMA 5LQRA 4J03A 5CGQB 1RI5A 2FPPA 1PLKA 1QHGA 1R12A 2EKPA 2H57A 2VXCA 1AMUA 2W2LD 221PA 1KYZA 2QP4A 4PLTA 5DBEX 1RQPA 4FZVA 1JIQA 3TRJA 4PG6A 3RPEA 1ZCJA 4EDHA 2AOWA 3D6AA 3Q5EA 3GQBB 3QFRA 3C7TA 4LQ4A 1UBFA 4MWZA 2JGEA 1VECA 1XF9A 1VJRA 3OHMA 5C18A 1J9GA 1NC1A 1SUSA 4P0TA 3A3YA 3ZHBA 5A5VA 4KXLA 3AR9A 5KYUB 1USGA 1GL3A 4JUCA 1QH8A 4Q1DA 4ISBA 4EITA 3A4LA 4YN3A 3NUQA 4FIZA 4LXXA 5TEWA 1ILEA 2ECFA 2YXLA 5B7PA 2AW5A 3KSDO 4WN9A 2BFBB 3NASA 3EZ7A 4E5NA 4LJYA 2GHIA 2QX6A 4IDEA 4JLVA 3A3KA 3L0BA 1D3AA 2WAOA 2XF8A 4YPFA 5DX0A 3PV0A 1F20A 4BNVA 4ZGGA 1WM1A 1KXZA 2V4MA 2ID4A 1UJMA 3MXTA 5FL7D 4GX2A 4RZ2A 3SSMA 3QGMA 3RNOA 4I4IA 2A5YB 3QPWA 1JG3A 3N28A 1X1QA 4HKTA 4JLOA 4A10A 3V4ZA 1SGWA 3UFXA 1VSUA 5IX8A 3UJNA 3V7WA 1MW8X 2G04A 1CY1A 3ESQA 1F9AA 5LP1A 1RAGA 2VP2A 2X76A 2RJOA 3PL1A 1X1SA 3HLTA 2GH1A 4ZARA 4I1PA 2UDPA 2AZ4A 2QTMA 2E87A 3KJNA 3P2IA 4L1KA 5IHXA 4UHDA 4K8OA 4FGJA 4Q18A 1X7YB 2C7BA 4MQ6A 5H83A 4D25A 2HF8A 4PFJA 4FGWA 3IXQA 2G25A 2MDTA 3KSZO 1F2UB 4ZI3A 3ZCUA 3U19A 3NG1A 1JJFA 2GCGA 4DBLC 3OX4A 1YJ8A 4LDQA 2OC9A 2XUJA 4BLVA 4F21A 2FDCA 3WLTA 1WXEA 4XX0B 1SVWA 3HN2A 1BEUB 1TA4A 1YQQA 3KHSA 4RADA 3S68A 6PFKA 2Q1XA 3X2EA 1M2HA 4DR7B 1PYDA 3QWFA 2GF2A 5A2GA 2QW0X 1G98A 2P65A 1OHHA 2QDXA 2ZJ7A 3DR3A 4M3NA 3V33A 1V48A 4DQ0A 4UBIA 2W2KA 1TAHA 1TM7E 5G41A 4MYSA 4BUCA 1C30B 3K1YA 1G8HA 2D1SA 5CLLA 1DEXA 3TQSA 4D0RA 4EUHA 5I8PA 2QLFA 2I6QA 3H05A 3RAPR 5C51B 3ZVRA 3WMGA 2Q2WA 4UCQA 2ATVA 1M2FA 2YR0A 3B2QA 4WVFA 3JVIA 5F35A 3ZEAA 2V6BA 1KSGA 4H1VA 2UZAA 3IYLW 4EHHA 4YCBA 5LQCA 3D1LA 3TLYA 3HO8A 3CURA 1PSDA 3RS8A 2QKYA 2BHTA 4R1LA 4I99A 3RR2A 1W2GA 3VC7A 3T5MA 3JU3A 2H9AA 4TS9A 4D8XA 2HC9A 2QPLA 3HGMA 1T0IA 4C2BA 3RU7A 5JO0A 1GTSA 4OIFA 1ARZA 1POWA 3CPEA 2OY0A 4MR9B 4R16A 1I5RA 1IXRC 2VUIB 1AB6A 4XJSA 3VHXA 1YIAA 1JJVA 4RWEA 3EXIB 1QB8A 1TO1E 5AOAA 1NASA 4HNRA 5CB4A 1RJGA 2JPDA 4DJJA 4X20B 3RUCA 3FKSD 3USZA 2AOUB 2VDWB 4ZV7A 1MNQA 4TMZA 3IBCA 4P7FA 3Q10A 3NJ8A 3MIIA 2A94A 3K5IA 4B7AA 3OECA 2GX6A 2YV1A 5IMSA 2GEKA 4LZOA 1ZVVA 1X0XA 4ND2A 4XQGA 5D8DA 2BTEA 3HY6A 3BB3A 2W4IA 4PO9A 3WZ2A 4EJ6A 4QOEA 1U9ZA 1SXQA 10MHA 3NHRA 4B43A 4Q7JB 5NULA 4XWKA 4D45A 3WTBA 1EVKA 1ZGJA 4XQ9A 3AKDA 4ER5A 1GQ2A 2JIDA 2ASVA 2HJRA 3D4NA 1D9ZA 2Z83A 4D9GA 1UH5A 2QPOA 3L84A 3T3NA 1WCV1 1SOWA 1W7AA 5I3ZA 4FT2A 1M2JA 3Q6NA 3DAOA 2GF0A 1NPDA 1ZVMA 2BY4A 1JBKA 9GPBA 2MSLA 3DZJA 3WKDA 1O0SA 4LK3A 2VT7A 5JROA 1L7DA 1NVXQ 1T3ZA 2IVFA 1WXXA 3K6JA 2QE7D 1J39A 3O4JA 4J16C 1SC4A 1ZM9A 5FQOA 3KSAC 1KO4A 2RGWA 1W9HA 3Q3HA 2X0DA 5FLEX 4DLLA 5FLXA 1WUTA 1Q5PA 1QFYA 1QZTA 3QENA 1FP4B 3AY6A 4QBFA 1WBBA 3KJGA 1AGXA 4I4TF 4BO7A 1QVRA 2OLJA 2VF8A 4WERA 3S44A 1EFLA 3I23A 4Z6KA 1UP7A 4M0KA 1MUUA 3CXRA 4R9SA 2IELA 1SXJD 2VPYA 3C3JA 3W6UA 4CDGA 4W9MC 3C1TA 1KEZA 4X1KB 3IOYA 1IWPB 1FNBA 2YJZA 3EGDB 4I5IA 4Y2HA 4M7OA 4YQEA 3J81k 3MAJA 3SMVA 1T4DA 4M22A 4B9AA 4ZQGA 1R6BX 5KWVA 3CFYA 1OT3A 5F9HA 4O0LA 3VJRA 1JEQA 1SUPA 4X3CA 1FRFS 4NBUA 4Q12A 3QSGA 3ONVA 3WDMA 1YFLA 3HVKA 1SVSA 1E6MA 1T0PA 4UBJA 1J90A 1DQPA 4CR7A 4GRIA 5IWCA 1FMFA 4E5VA 1DJQA 2O9JA 4QGFA 3QVOA 2BFBA 2Y9MB 1MO6A 2EYUA 3L93A 1WXGA 2F64A 3MSCA 3JQ6A 2QRHA 3NVMB 4P32A 1NBAA 3RU9A 1QKJA 1BE6A 3ASVA 1GPNA 3CF0A 1Y5LA 5HG0A 2NUAB 1Z8HA 3Q9UA 2ZQYA 2WHPA 4RQTA 3HB9A 2R62A 4J2OA 4E5PA 2ZJYA 3IEKA 3QFSA 4GKKB 1QFMA 3DGEC 1P7CA 1TMYA 1O5IA 2GKGA 3DLAA 4P4SB 4TTPA 3OEED 5BURA 1R0WA 5JQGB 3CLVA 4FBLA 4L9WA 2ZANA 4JKIA 4BHTA 3EX7C 4MARA 4LC1A 1WBDA 1H65A 4IGKA 4DJEC 1ADYA 4G5XA 2Q9AA 4E5SA 4G36A 1QGED 4XTRA 1VJTA 2LGJA 3CW9A 1Y9JA 2WUGA 3QYFA 4HAXA 1JFLA 2WT9A 1N5DA 4ZVVA 2PL1A 5C37A 4B79A 1FFXA 2GO1A 5K0JA 1F17A 5CDHA 3KHTA 3MGCA 4I5DA 2GN1A 1I80A 5DISB 2UUOA 1E1DA 3THYB 1W5EA 2XIJA 4WRRA 4F3CA 1X7WA 1QH1A 4H7JA 1DCMA 4A2PA 2XE6A 2FHSA 1EEHA 2QT1A 3D6TB 3CXUA 3L49A 2R65A 4N6GA 1ZUD1 1DAMA 1QO9A 1C50A 1JEJA 1T8RA 3IQHX 3MT0A 4KG7A 2NZYA 3JRWA 1ZN2A 2DPLA 3WB9A 5BNIA 4QQNA 1OB2A 1SHJA 2P4UA 3GRYA 3HXLA 4R9VA 3TJMA 4QASA 1NUSA 5HIJA 5DM70 3OJLA 1W4CA 2AS0A 2JKZA 3MG9A 3WWCA 4GUAA 4MVJI 1G7TA 4BKOA 4F12A 3WIUA 3R8FA 4G8JA 1FFAA 1UM9A 1CVRA 2DR0A 4G01B 5CTJA 4F3YA 1G3RA 2JFBA 2JEOA 3FN4A 2QXTA 3PRYA 4GOLD 3BRCA 3ILHA 2W2LA 3FI0A 3NM6B 3ACCA 4OL9A 4PXSA 5KKAA 2ZWMA 1LNSA 1SELA 1XVVA 1Y4SA 5CCXA 1GP2A 2QR2A 3SC4A 4BXOB 2ZBVA 1YOBA 4IFBA 2JLSA 1EVJA 1OWMA 4YMTA 2G4CA 1M54A 2BUCA 4L5JA 2WYUA 4G4SO 4LOAA 1Q1ZA 3ABOB 3GLKA 1K9VF 1U3TA 4O1HA 5TGZA 2ZBUA 5EIBD 4EKIA 4OX9Y 2GBLA 2J9FA 3NDPA 5AW1A 4GU5A 4DSOA 1RFGE 1WPXA 4HI0E 3BGIA 2O4CA 3OUTA 3SPXA 1QDLB 1O57A 2ZWPA 1AHPA 5JJ5A 4WLNA 2BHNA 1R8YA 4N03A 3COZA 1KVSA 5EYPA 4M1WA 1XMQB 3PX2A 2YYZA 2AJ8A 3QU2A 1JHPA 4ZVTA 2BM0A 4MO2A 1QP8A 2KBEA 3WKCA 3COWA 3P94A 3S1LA 3VH2A 3GLTA 4ZCPA 4CKZA 2VJPA 2PUTA 4I8DA 5DB4A 1E5QA 2Q6LA 2R00A 1CR1A 1S8OA 1JJ7A 1COWA 1C1HA 1ISRA 2OP1A 5E1DA 2G08A 3LUFA 3S1AB 3T9DA 1WUIS 1ZD4A 2O5VA 3NHAA 1E9VA 1ZPDA 1Q0LA 3W5BA 2CXTA 2JIOA 1C8KA 2F9FA 2ICAA 2IOFA 2G40A 4ZQEA 1F1JA 1KMNA 4P3XA 4QXRA 4TV9B 4AW9A 1F9EA 4L2IA 4J9VA 4KN5A 4ZEXA 1G8GA 2EFGA 2GILA 2CVOA 3ROXA 3WLHA 2D4AA 3MTAA 3WADA 4EI7A 1Q2UA 1WLSA 1HE8B 1NLFA 2ZYIA 1RRKA 3LLVA 4ZQFA 5M2QA 1E6UA 1J5PA 3E70C 5E6UB 4WJLA 1ZR2A 3B2NA 5EQTA 1LU9A 4KQEA 1QQTA 3BCUA 4CKBB 3HP7A 1P6XA 1TJYA 2K2QB 3KKQA 2OFFA 4KITB 1HG1A 2FZ4A 1RDFA 1M3SA 2O52A 4MPDA 4O08A 3VNSA 4XGNA 5AK6A 1IB0A 4B46A 3ISTA 1G9TA 4JBGA 2C29D 3R5KA 4Z1OA 2EZUA 1DOHA 1YQXA 2FZEA 3MNFA 4U8HA 3G1TA 3QPDA 2JARA 3N2GA 4JQSA 1W36D 3HU1A 1PG2A 4KE7A 2DKFA 5SV2A 5EKDA 4LJLA 1NF9A 3K94A 3FYUB 4HQ0A 1HE4A 4JL8A 1T2VA 1UKYA 1Z33A 3TTUA 3U4GA 3V8MA 1KI6A 4KH0A 3OMWA 1TEXA 3FRIA 4DDTA 1PR0A 4XDZA 2X0NA 4M1YA 5BVHB 2VEOA 3GJTA 3K0EA 4HDSA 1U1EA 2QT9A 3RQSA 4W1RA 2FUG6 2GBFA 1P0PA 2VSXA 3GT4A 2ATXA 2Z1MA 2Q4TA 1NRJB 3QMVA 1GV1A 4LHZA 4MQLA 4ZO4A 4E7PA 2YC2C 3RU3A 1TVKA 3KVVA 3CH5A 7GPBA 3A2MA 1DWPA 5D51S 3BXPA 3AIKA 2VJKA 2ZRQA 3L40A 3ONDA 1NSFA 4PSDA 3PR2B 5AO9A 5IAJA 4FOSA 3OPMA 3L8EA 3HDHA 4ZAXA 1RZRD 4KQCA 2NSJA 3AQIA 4E7OA 2Q6VA 4QGBA 3R7FA 3KTFA 4GZ5A 1CULC 3RHFA 4M7PA 3O2JA 4DW8A 2DSNA 4GMKA 4IEIA 5HILA 3NHSA 2J5RA 2BR3A 2Y0PA 3PPXA 4HDQB 5AUPB 5FL7A 2BEUA 5E4TA 1ND6A 1OE0A 1HYQA 2O3JA 1M74A 1Z5OA 2VP0A 4IV5A 1CHDA 2DHDA 3OHSX 3VX3A 3HI6A 2AMLA 1WKBA 1YZVA 2N46A 1U4OA 2VP4A 2C07A 4KH1A 2XQVA 4WFKA 3QWAA 2ZJ3A 3BWVA 3I0ZA 1ZRHA 3LQ2A 4YRAA 3GLGA 1VJ0A 2CUNA 1OWOA 1HM5A 3G9QA 3RRNA 1LSJA 4FTWA 4HUJA 4N0DA 2P9QA 3WIVA 3ZE6A 2AX4A 1E0DA 4E30A 3OFJA 5BVHA 1SKYB 1K4YA 2WUWE 3OFKA 4QA9A 4TMVA 1AKWA 1EUCB 2PUJA 3HN6A 3LY8A 3IR6A 4EUSA 2XQIA 1P1FA 3EXAA 1DIHA 2D2VA 3M8KA 4FHCA 2ZW9A 4JX9A 4YT5A 4O25A 5JSYA 3G1UA 3WMFA 2VJDA 4F04A 1J00A 4J91A 3GT7A 3RI3A 3EDQA 5FWYB 3V8PA 1I5OA 1XTRA 4IZ6A 4KUEA 4YRQA 4KOEC 5LQKA 2CNOA 1FVXA 2G4LA 1B43A 2BI4A 1JNYA 1H3FA 3H1BA 5EIOA 1QDUA 3NXSA 3ZHUA 1HNWB 1JDJA 2OO3A 3P52A 2K7FA 3T7JA 3UVEA 3T06B 4LHXA 1S2OA 4UAUA 4HDOB 3N74A 4UDNA 1JIIA 5JBIA 1DC4A 3EY4A 1BW9A 4L3OA 5CAEA 3FHOA 3C8UA 4ZJZA 3V8EA 1LRLA 1TCAA 2H2GA 4BUJA 3UTCA 3WZMA 4KJXA 3PIRA 4KRXA 5I8WA 5INTA 2V7VA 2QXUA 5HIKA 1ZI6A 1B3RA 1IIRA 1MW9X 2CL7X 2G4VA 2O8VA 2VP3A 3HDGA 3JQDA 3PNKA 3SEAA 1E5VA 3L7DA 2AQIA 4G97A 1OV6A 2XBLA 4JLWA 3IMEA 4PLCA 2VYND 4TV9A 4ZJUA 1NSTA 4I66A 1CQZA 5DGTA 5LVAA 4JUBA 4N0EA 4WXHA 3SBXA 4CMGA 5IAOA 5TQ0B 2X15A 3QTBA 4P4TA 1T1GA 1P2GA 3K70D 2OYSA 4EO4A 1NUUA 3RC1A 2JCSA 1Y5RA 1T2CA 4ZPJA 1CEXA 4DCUA 1Y1PA 1DIAA 3PLNA 2TS1A 2X9QA 2WJZB 2ZI3A 4KWIA 4MI6A 3ZNOA 4PG7A 4GX1A 4CTKA 4OREX 4Q21A 2OXTA 4ZVKA 1ABBA 3NGLA 4TX1A 4C22A 1HORA 1U3VA 1KL7A 2CK3D 5EZYF 4EFMA 3B1VA 5L6MB 4U2EA 3TAHA 1PWXA 2A14A 4R9UC 5EYPB 1XAHA 1WUKS 3NIGB 4C0XA 4DTCA 4PTLA 3ONWA 2QUHA 3WAGA 3Q0TA 1L8OA 2I2CA 1FRVA 1X1CA 3HKEA 4RD1A 1NIJA 2D3WA 4CTJA 5KOHB 4DA4A 4QHYA 1E79D 3E81A 4TWAA 3W9BA 1ZKDA 4RAOA 4NCHA 1G6HA 2XVMA 4H18A 4HNVA 1RLJA 2IUTA 2Q7XA 1K6IA 2YV3A 4MRRA 4AMBA 1XTUA 2VQSA 1EYZA 2W2VA 3E3LA 4NI5A 1R4ZA 2BKLA 4QQ8A 3VUFA 3OLVA 2A1TS 1K0FA 1CR6A 1LI7A 3G9ZA 4CLDA 4JH0A 1TD9A 1BQEA 3H11B 1M1ZA 4TKZA 4U39A 2PMBA 5CTAA 4A8JC 2PVPA 3CB4A 2F2TA 4E4RA 4ETNA 1ZNZA 3CPHA 4P7KA 4FM9A 2OVFA 4CCWA 4F45A 2CVHA 3NORA 3E8XA 4LI3X 2FOXA 3ZD8A 4DYHA 2PLFA 3B7GA 5IARA 5JCOC 3LIPA 5B7NA 4KYVA 3BIOA 2QE7A 5LMZA 1KTVA 3QOXA 3SDSA 2ZTVA 2CW5A 4FWIB 1N3IA 2XEDA 3LP8A 2YWFA 1Z2NX 4HFJA 1CPYA 2XUKA 3W3AA 4RKEA 4EFKA 4QSHA 1LVHA 3KPWA 5CLIA 2XEXA 2IEDA 1UBCA 4OQ4A 3A0UA 4I3FA 4FZ5A 1BA2A 4Y2PA 1X7WB 2OP0A 3HABA 4PSUA 5HX7A 2E2WA 3IHTA 4NS4A 1OFGA 2PGJA 1CLEA 2XA2A 1FFXB 2J32A 5E1MA 4QJBA 5G4KB 2H2IA 3VYWA 3HVRA 5HKOA 2F17A 1CE8A 3PTAA 5T4HA 1GRRA 1SCIA 2W6JD 4Q9NA 2VR1A 4BB0A 1C2TA 1YU6A 1VZ3A 2BBTA 4V0SA 2EKBA 2XMQA 3WQBA 2OD9A 2XGJA 2EATA 3NQ41 2HYDA 3A9SA 4YALA 2TSYB 4P4SA 3O8BA 3WLLA 3TKAA 4D9KA 3RTDA 5FUVA 4NLLA 2QZZA 3P96A 2B0CA 4NOLA 4EL5A 3G9UA 2D3TA 4QDUA 5MGBA 2FKNA 2I8AA 2Q4BA 1KFBB 4QPJC 2PXHA 1N5LA 1P4HA 1Y34E 3B9PA 5LQSA 2ZJAA 1HNZB 4B2LA 2Z4TA 1VHLA 3UUFA 1ZP6A 4BRUA 1EGQA 3FF1A 5BV1A 2H6EA 4NIMA 1WVIA 4LHSA 3NHLA 3NHMA 1NAIA 4U8GA 5IWAB 3DE2X 5TY0A 3U7JA 2IDZA 2I55A 3JQFA 1V43A 2QBYB 1LC3A 1M6HA 4G1EB 4G0ZA 4ZI7B 5MGNA 1FDUA 4DDVA 4AJEA 1G6KA 1D7AA 2AEJA 3M4JA 4GMXA 4FYIA 3HO6A 5J1TB 3NDBB 1UPTA 2V54A 3FF4A 5BT9A 3SBEA 3KK0A 3FRJA 3K35A 2HU5A 2YIMA 2FSHA 2QIPA 3RFFA 2DP4E 2GR9A 9ATCA 3C2QA 2EX4A 1XXHA 5HJEA 4Q3DA 3IURA 3C6KA 2H29A 4NPCA 4KTTE 1WTAA 1Y9ZA 2DJIA 1K7EB 4BMSA 3ETDA 1A8PA 1C4OA 1L5OA 1JLMA 2WD7A 4C0JA 5EXXA 1RFLA 4HQKA 3GL9A 4JYMA 4MIKA 4ZYZA 5AVXA 1KQFA 2CV1A 2HT1A 2D2EA 3PCTA 4C6HA 3L06A 2CDBA 2CLOB 1H69A 1SUIA 1ACLA 1R8XA 1V11A 4HPXB 1R0LA 4LECA 2F8SA 1J8DA 2XUHA 1UT8A 1JLKA 3CEMA 3UKJA 1QZ3A 1ABFA 2NO9A 3FH0A 3QWHA 4YA6A 4Y6PA 5IYZA 1MPXA 2PLWA 3W2EA 2C5HA 1VTKA 4N0MA 2INGX 4NJMA 5HJ2A 5P8WA 2O1SA 2WSYB 2IPLA 2V7WA 3N2ZB 3M1AA 3KB2A 3U3XA 4NQZA 4HWTA 2HMWA 1R4NA 2G5GX 2ZUWA 1EEXB 3INGA 2V7XA 4P4LA 4WNYA 5EJ4A 3Q3CA 1DRUA 2RHWA 4G1MB 2ZATA 1QBGA 4K0KB 3MVEA 1U8ZA 1CQXA 4BP9A 3B13B 5CM2Z 1AGRA 2GK3A 1JAXA 1ZUNA 5IYZF 1LPBB 3ORYA 4Q9HA 1JQJC 3OIVA 1CHNA 4YVFA 2HMVA 3HNPA 2PKRA 4LFCB 1QQ5A 2XZOA 3N76A 1X9IA 2HOQA 1I14A 3K09A 1JFRA 3UMSA 1JKMA 1QOPB 1SC6A 5HGXA 1SXJC 3WRVA 1R5BA 3CT6A 3KSBC 1ZWKA 2OVBA 1Q7BA 1W52X 1WKCA 1C3LA 1GL6A 1AKNA 1OAOC 2N9UA 5JWHA 5I4BA 1DT3A 4GEGA 4OHKA 4AK9A 1W0JA 3OJOA 1SKYE 1YB7A 3I9LA 4GVPA 3AUJB 3LT4A 4CRWB 5J4VA 4YY3B 2PRSA 2WWTA 3W2IA 4MA4A 3ABRB 2Q3LA 3D8TA 1R0KA 3F9RA 4XXHA 2CE2X 2JW5A 3BGSA 4LY6A 4M6WB 4PSCA 2LDBA 3MJHA 3AKCA 4MR9A 2JGIA 3IOMA 2IHNA 1H0SA 3RARA 2F43B 4IXNA 1SXJE 1PSZA 1U2RA 1KK2A 3G6WA 3NHPA 1F2DA 2AJLI 3C3XA 5HA5A 4XJXA 3P4UA 1U7WA 4C01A 1FUKA 3FCCA 4PLPA 2HEGA 1VG8A 3SEFA 3J80A 3CIOA 3FLBA 1L7NA 5DGHA 1EUDA 3A58B 5LZ8A 2XVYA 1YZUA 4E5MA 5E4FA 2CCGA 3NI2A 5C8YA 1QPGA 4X54A 3IHKA 2H48A 3QI7A 5AK4A 1KAHA 1OYYA 3IEPA 3LCRA 4RJTA 3GEHA 1M33A 2EEPA 4NZZA 4D4HA 3FPHA 1JQBA 4PHFA 3U0BA 3ZD9A 1CQJA 1U8CB 1Z83A 1NXSA 4MW7A 3TLBA 2FW7A 2QTBA 3CT4A 5CMLA 4QZVA 1JHAA 4H17A 4GC5A 2PWYA 2P0EA 3E22B 1QR6A 4I4LA 3VAZA 1OAAA 4ND1A 3ZHOA 3DB2A 5KOJA 1NF2A 1ZIXA 1FP6A 2P7HA 4A82A 1CZRA 1UK7A 2LR0A 5DMXA 4P0QB 3FHLA 4XX0A 2AN4A 3GIWA 2HQBA 1T35A 4UMEA 2G6BA 2PRKA 5TV2A 4DCMA 4MV3A 1M1NB 4QTXA 1URPA 5FP0A 4Q1BA 5BW6B 5IJ9B 5C8YB 5AHKA 2GTPA 4B3BA 2VNHA 1PU2A 1IBKB 3MOSA 2JFVA 2JLQA 2QJTA 3IELA 4NJEB 3TIXB 5KSPA 5CBPB 5CDSA 2FUG1 2FW8A 1FB5A 2QRMA 4G1BA 3NMUF 3ZDAA 2FPIB 2W58A 4FIDA 4AZVA 2YIJA 5K2MA 1ADCA 4OAQA 3HZHA 2X5OA 1H6CA 4N6OA 4OHCA 1J06A 3ZJVA 4BAUA 1EVZA 3IRVA 4F92B 3EH2A 2D6FA 1IBCA 1OT5A 4HCJA 2IEIA 4IJUA 3DZIA 5AI5A 4B44A 3L41A 3LC1O 2Z5LA 2Z2YA 1ZSNA 4CLXA 2J6CA 1P2SA 1Q1AA 2PS9A 2R7LA 1Z08A 2CYAA 5D86A 3T4PA 3UK0A 4LQDA 4TN5A 3ZDEA 4BU1A 5JRJA 5HZGA 5DVZA 4BNYA 3QYPA 1QYDA 5ECGC 1Z28A 2Q6OA 1JEEA 3FUCA 4OTZA 1TUBB 1X42A 3FNFA 2ZXEA 1A9XA 2ZAMA 3BH7A 3EGOA 2BYTA 4IF4A 4Y2UA 3NTQA 3CKYA 4FYPA 3OCJA 5DGIA 1MT3A 2GPAA 1EZZA 3L8YA 3MOIA 1P3Y1 1KYIA 1QHIA 2C58A 4MVCA 2XMBA 4QPZA 1ENZA 1TYBE 4TMKA 2PH7A 4TV9F 4PVDA 5D7BA 2B6NA 5A62A 1MT0A 3AVPA 2Q07A 2FFQA 1PKXA 3FZYA 2BZ1A 3G6KA 3M5PA 3QE4A 3TTVA 2GEBA 4ZAZA 3M6AA 2WU4A 3PPWA 1RW4A 3F47A 4GI7A 2W6QA 4W9NC 2ZTHA 1D2HA 3NJRA 1G4AE 3G85A 1T8SA 4HQRA 2PO5A 3M83A 1ODJA 3PUIA 2XY4A 3KV1A 1XKXA 1RBMA 1SVKA 1RLTA 1UK8A 2V8BA 2WZQA 3KEGA 3X1KA 4MHTA 2OPBA 1YULA 3ZI4A 3EWSA 3SI7A 2CXHA 2GFHA 2XYPA 3DJFA 3MWFA 5JWRA 1EDEA 2I1WA 1FTNA 2F8LA 5LOVF 2WHRA 4MWGA 1OFTA 3TPFA 4ZOEA 2G1JA 4WSOA 3ZPXA 4P0PB 4JLUA 1PT7A 3BK1A 3L1IA 3PUVA 4JXKA 4FMCB 4D0NA 2BOVA 4RTKA 3PX7A 4GNRA 2O8NA 4JJ4A 5EI5A 4D92A 2JGFA 1WHSA 1Z73A 2QN1A 1A8UA 1MOSA 1WB6A 2Q5HA 1PGQA 5JASA 2DUUA 1PLJA 4JK3A 3CVWA 1ENYA 3AU8A 2XZDA 3EXG1 4MJXA 3ROQA 4ECAA 2IVZA 2Q6TA 2M9MA 3OU7A 4CMEC 4DQKA 1S01A 2YQZA 2J4CA 3HA2A 3RUFA 2C2XA 3AONB 3Q1LA 4DE5A 1UKBA 1ZMXA 4RSRA 3VQTA 2IYQA 1P4JA 3TBFA 3FNRA 3ZIAA 2YUTA 2HXSA 4MW2A 1RACA 1LEHA 1TF2A 3JXEA 3UJ6A 4WNCA 1KJIA 1A77A 1L7AA 4BWVA 3GU3A 3KFVA 5E6SA 4IOLA 1U2QA 4RZQA 1PR5A 3LHIA 1CUFA 1GWNA 2GNPA 2X14A 5AW2A 1S2IA 1XD9A 1T0BA 1NJSA 3FFBA 3PD7A 4K28A 5CXSA 3SOZA 5ELXA 4QOGA 2P3OA 2K7ZA 2E21A 4LF9B 3DAPA 1RYMA 3T15A 2AWNA 3UATA 1Z2EA 2W6ZA 5EHNA 5AOVA 5SYMA 3G8YA 1G5RA 1RKQA 5LD2B 2YV5A 3PVZA 4K1XA 3ZWQA 5CGZA 3CUSA 3F7OA 5IAEA 2FMUA 4URHA 3IUSA 2RGGA 5DYTA 3ANNA 1U4SA 2IOHA 2ID8A 4PC3A 2XCRB 5HFNA 4M0MA 3HQ4O 5ERGB 4IOKA 2QMYA 4MV7A 3W8DA 1JMVA 4HEQA 3O73A 2OXCA 1YQWA 3DV2A 4R1UA 4RKFA 3ZK9A 2RGRA 2FFBA 3B36A 3GGSA 4YRIA 3N0TA 2VZLA 3PD1A 3WNDA 4EECA 5K51A 1CUDA 4E88A 4MDFA 4J1NA 1T15A 3WNZA 1E5TA 5CR9A 1KERA 1QIKA 1PD0A 2FU5C 1E7SA 5BSGA 5L95A 2F55A 2VBIA 5JYDA 4DLAA 2ATEA 4XFDA 2W42A 2AK2A 2OCBA 1L5LA 5FF9A 3RVSA 3ZYZA 4DKXA 2OBNA 3FTCA 1ES9A 4FNMA 4HLNA 4C6TB 4HWOA 1ZHHA 5HQTA 3VTKA 2BMEA 3IUBA 4LJAA 1VE3A 1Z2DA 3R5TA 1W4RA 4FWBA 2ZB3A 3NVAA 1BN6A 3WYBA 4JNKA 4RS3A 3KZOA 3WHKA 3T9FA 4GQAA 3W6ZA 3N3BC 1EAMA 2PD3A 5LLDA 5BVGA 4IS3A 1ULZA 2I6UA 2NN3C 2YVKA 5KPDA 4CLHA 1FXUA 2ARKA 3ROMA 1BGXT 4DNXA 3IQGX 4LHYA 1YJQA 4BNIA 1RLUA 4DHWA 3TOVA 4LMPA 4Z86A 1KDZA 2YHBA 3ZE0B 3C6MA 2ETVA 3PFCA 2JANA 2NO7A 4XM2A 4HXYA 2W6ID 2FJ0A 5T4FA 2UUCB 2BGJA 2MYPA 3OZIA 4L72A 1JQAA 1TI7A 3HKEB 4LJ7A 1X7ZB 1O03A 1S2DA 3ZKAA 5EIXA 1U90A 1ZK4A 3CC8A 3JPWA 5A3SA 4BRZA 4WKCA 4CKXA 4DYVA 1VHTA 3DE7X 3HJUA 1PTJC 3TNDA 2AMYA 4HH4A 3VISA 3UCEA 5JXGA 1GZ4A 1B76A 3OCXA 4LVNA 1GUFA 1GR1A 2DQSA 3V00A 3OM8A 5F7XA 3RFXA 2QTGA 3UCXA 4F2GA 2OCAA 1DAOA 2VHZA 4C7OB 3H5OA 2BEWA 2C5GA 5DN6D 2BGGA 4IXTA 1WNTA 1VA4A 1VIAA 2Q2QA 3HR4A 4GWGA 4IMPA 4ETMA 2CJPA 1A27A 4DAEA 4C5AA 1GNPA 1MU0A 1JB1A 1K88A 1DX6A 1SOUA 3PCXA 4TUYF 4JA2A 5E3JA 5K0NA 5G0WA 4ERXA 3GLIB 1M8FA 3UT0A 3HRIA 4M87A 2PUEA 3SLRA 2ZT6A 1Z5UA 1GUYA 1FDSA 2M2IA 2VDMB 3E9RA 3F4KA 3HCRA 4ARSA 1NBHA 2GEDA 1E62A 3ZY5A 3DCYA 5ADUS 2O57A 2EJBA 3TIVA 1QVAA 4JCCA 3T1OA 1AZSC 4RXUA 2IKSA 3ZH9B 1ZM2A 3EHDA 1JAYA 3OZCA 3ZWYA 1OF1A 1KDOA 4PHTA 4UNSA 5K2OA 3C8HA 1G8YA 5CAEB 2BGIA 1B1AA 1AXGA 2Z5FA 4XDHA 3Q8MA 1NQAO 1JEAA 1U5CA 3I1JA 3E7FA 3VZPA 5BXQC 4QTYA 1S8FA 1JEDA 1PX2A 2PKWA 3T1YB 3JD3A 1E99A 3E9CA 3HCCA 1MJGA 1SA0A 2DFVA 1EVQA 2HRDA 3PKZA 3OTWA 3UICA 3G5TA 1D1TA 3E84A 3HV0A 4V3BA 1X8XA 5EWMA 3UMFA 2LPMA 4EO9A 4F6RB 4Q03A 4J7XA 2QSZA 4NENB 3M6MD 4YJFA 4MUKA 2ZIVB 4Z2YA 3EGCA 3T94A 4CF4A 3DL4A 5HDBB 3U7EB 4QUEA 2ZBRA 3DFIA 3CINA 4IILA 2OK8A 1NE2A 5KC8A 4O1MA 16PKA 1EUCA 5KQSA 1SU6A 2C2BA 4MMYB 3AIIA 4BDTA 3H4MA 1ISJA 2V7BA 3O0TA 4GSYA 1U3DA 4ENTA 1HK7A 1G59A 2JBAA 2D8AA 3L9XA 4QU0A 1ONSA 3GFQA 3V7YA 4EP1A 2WWWA 1N6HA 1Z5GA 2J4DA 2WR8A 5AIAA 1IN6A 2YXNA 4OJQA 4D8WA 4PSVA 3TD9A 2QK4A 1ODSA 5DSZA 1IVYA 4FOTA 1CZNA 5C4IA 2OCIA 2LUOA 1UPCA 1W4LA 4IDAA 3SD7A 3KPVA 3LT2A 1LLCA 2ZSAA 3TBKA 4EUNA 1RBYA 3SZOA 4CF3A 3K0FB 4DR5B 4QYXA 2X7JA 3H9BA 2ZIUB 4RQAA 4NDZA 4BYGA 2BONA 2BCEA 1IOVA 3M6VA 3HBMA 1BFUA 3JAWA 3O8DA 3QQPA 4JWKA 4D5GA 4RHFA 5ITSA 5J2UF 4X71A 1L4LA 3PXAA 1Z0KA 4CU2A 1UMKA 1ZYUA 4DARA 4QREA 2ADFA 3A2NA 3BTUA 4C7OA 1TVKB 4BFSA 5HKBA 4QGGA 2HO4A 3DE1X 1R6TA 3NGMA 4H7EA 5HZKA 3SR4A 1C9MA 3WGHA 3DLCA 4KIFA 1RKVA 2VT3A 1BDBA 2XDAA 3AR7A 3OIWA 4LJ4A 4TQGA 5CDFE 3ZVNA 5D00A 1D4ZA 1ICEA 5FORA 4BKUA 4C0LA 5IVKA 2P4QA 1YU9A 5D3KA 3I39X 4CXMA 4I9HA 1KI6B 1RE1A 4FLFA 3PC6A 4FR2A 3C6XA 3ROTA 1MOQA 3Q85A 4HH0A 5MFZA 4JP2A 3OETA 2E0IA 2CXXA 5G3ZA 3V1YA 2EFHB 3W79A 2Q6KA 3ZW9A 3VYUB 3Q4GA 1XA4A 3N86A 1T5HX 1X7ZA 3ZNQA 2XCSB 4JT2A 3L7YA 4KAXA 4R2IA 3D7KA 4OK3A 1VMDA 3AERB 2OBFA 4YUZA 1U98A 4IIDA 1M1YE 4P5EA 4KACA 5LD2C 2Z98A 4V0QA 1J33A 2QSYA 3NIDB 3N6XA 3NCHA 5TC4A 4B0PA 3UHFA 3I2JA 5BVGB 3HN7A 2B9EA 3VYRB 2WYHA 4LXTA 3B3FA 5C5IA 5BO5A 2GZMA 3CTPA 4EY6A 1CSEE 2VKTA 4LC9A 4GPD1 1M2NA 1FPMA 1FYEA 4GZ6A 1H8HD 1J2TA 2QUKA 4HZUA 3G7UA 2H1LA 3V42A 2B8JA 5TE9A 3RVNA 4NYJR 2CMDA 2BRUA 3C1AA 4BCDA 1GQQA 1QO0A 4GQBA 3JQBC 4UVIA 4IMIB 1C81A 3PRKE 4FYKA 4J4HA 5DBHX 1JSLA 1YDWA 4D9CA 4PPQA 1Q7TA 4LRSB 4BGIA 3ND5A 1UAGA 4FEEA 4HO1X 1SQSA 4OO3A 4QAQA 4QVIA 4QYIA 1O0CA 2G5TA 1PGNA 3B78A 3M6XA 2W43A 4GPIB 4DMHA 1K8YB 5DHTA 1USVA 3U9SA 5AW3A 4CR8A 4REQB 1XLTA 1VPEA 3ME5A 1TAGA 2PRYA 1RM0A 2F67A 3MB8A 1II9A 5DM2A 4JAVC 4M8LA 4ARBA 2IUFA 1X1RA 3IP9A 4IO0A 3UWMA 3REQA 2E5WA 4MAFA 4MITA 4JLSA 5IC5A 3N8DA 3DZBA 1BU5A 2GZ1A 4HY3A 5FBRB 3DO8A 1L7EA 3E03A 1D5WA 2Q4RA 5L7TA 4MUBA 4GOND 5TMEA 1NC3A 5LZ4A 3ZN2A 2KWIA 3ZU2A 4XRGA 2ZE6A 5AI9A 1ISIA 3THXA 1HY3A 3X2SA 1AGNA 1VB5A 1X1AA 4B45A 4INOA 5JFTA 1GT91 3NHKA 3PQ3A 4BE9A 3LD9A 2JIBA 2A9QA 1XT6A 4AS1A 1U2PA 2WEKA 3B82A 3TDNA 4JLNA 2JFUA 3C4JA 1FU4A 2H51A 3WB2A 1GAXA 1E7QA 4A6EA 5CFQA 3AO0B 4H7IA 3SFVA 2GFIA 3GRKA 4KR9A 2G7MC 3LZDA 3UMCA 2VTBB 4KSCA 1G55A 2QN8A 3B70A 2C5SA 3FYSA 3U9TA 3Q6MA 4D41A 2IXDA 4R2JA 1ZMRA 2OCDA 3WFJA 6CHYA 3ESAA 1WXQA 4DKJA 3DXXA 2B98A 2NYAA 4UBLA 1AKVA 1Y89A 2EQ5A 4HC4A 3FUWA 3W90A 4MUGA 5C7IO 1D09A 1QHFA 4BRWA 2R4TA 1WO8A 1XF1A 4EA9A 4IJ5A 2VF7A 3PR1A 2AKAB 1N5OX 2YVAA 2VRBA 2VYVD 3FCEA 2I99A 2JATA 5IXYA 4ZT6A 1L7OA 3CONA 3TB4A 3WA7A 4YP0A 4INPA 2DFPA 4MWTA 3HXTA 2WHQA 3TD6A 5IMBA 4L4RA 3WAKA 1SB9A 3RYCB 1QH1B 4FLEA 4LIPD 4IRMA 5FOXA 1JQEA 5IK2D 2PQ0A 4KXXA 3KJFA 3X1YA 4QEZA 3RJZA 3E5RA 4EDFA 3L5OA 3WHLA 1P9WA 1X8KA 3A37A 2CE7A 5A3QA 2B1IA 2XOXA 4BNUA 1GZVA 3O8NA 1DJOA 4PG5A 1PS9A 5JAPA 3L79A 4EVSA 1IDOA 3FETA 1JDVA 5FFMA 2MSCB 1BYIA 3AY7A 5CVDA 5B7GA 3VJKA 4PYLA 4DYDA 5HF8A 5KNDD 1VYUA 3C5HA 4NCNA 2IEGA 2A1UB 2H17A 2LRHA 3M6UA 3UJDA 4I1IA 3TL3A 3TLXA 4ITRC 2P9EA 2X1LA 6NULA 4PQRA 3DQPA 3IDFA 4DM7A 1V95A 4LF7B 3MGKA 1YS1X 3BAZA 1AGYA 3B38A 2HCRA 4PXAA 4YJ2B 2QXYA 4XUDA 3TM5A 5GIPE 4CM4B 1KARA 1YZHA 1XCMA 3HNRA 3S29A 1XP8A 3I61A 1DWQA 1ZFNA 3AUSA 1H05A 3BHNA 4Q9DA 1QU3A 2ADOA 1O9BA 1N7JA 3QF4B 4OXKA 3T35A 3TRIA 5L7WA 2JFWA 3CE9A 1Z8DA 2O05A 4DLZA 1SWVA 4OLFA 4QUKA 2X8JB 2Q0SA 2YNMA 5FOUA 3PDCA 4EH1A 4ALMA 1RU3A 2BKUA 2QL6A 3L46A 1KH3A 1PX0A 2ACKA 2O7SA 3OQ1A 5G0TA 1Q1EA 3V8NA 1YD7A 5JI2E 1YZ3A 4BFCA 2QJRA 1Z4IA 3ZGXA 1NZDA 2WPNA 1LD3A 4M46A 4HN9A 5E1BA 4AKGA 2YFQA 1DTEA 4BLRA 2B8WA 4BPRA 3CB2A 2JJYA 3WBFA 4G0WA 5KQLA 5JUWA 7MDHA 2ZWIA 4XGQA 4RY8A 4BZXA 1OYOA 1R37A 2ERXA 1L5QA 1N6PA 4X1KA 8ATCA 1MQ8B 4U2KA 1RWMA 3RK0A 5ELMA 5LWHA 1TMGE 3OZRA 5HE9A 3CTMA 3SYRA 1RKBA 3R77A 4DEXA 1JLSA 5TS3A 4YUVA 1O4WA 3MJFA 4IG4A 2QRLA 2QV7A 2QY9A 3A28A 2FN4A 3HYSA 4GM1A 4RA6B 1R2QA 5EE1A 5KWEA 4OIMA 2ORIA 1FRQA 1HLDA 1CUGA 4FDUA 1WZNA 4R69A 5KVVA 5DZSA 3LXUX 3SC3A 2GLTA 3UAGA 3PK0A 2IZ5A 3TAUA 3P0RA 4YT2A 4HNTA 2OMEA 1CW2B 1NM5C 2VJAA 1T1IA 3HY3A 1KU0A 2VL7A 3EEFA 5T41A 5H0IA 1RTTA 1EE9A 2AR7A 1WABA 2LZ0A 3CR8A 1YJXA 1LSUA 3IRUA 5FOWA 1IDN1 2EFCB 3MUOA 1NOKA 3MS7A 4LWZA 1H6AA 4FSXA 2WYOA 4RK1A 2JKYA 1JLLB 4RNDB 5L7YA 3IIMA 2ZYSA 2FJUA 4LZJA 4NOJA 3DT6A 3BFXA 4C4RA 1CQJB 3HJRA 1GSOA 1ZD9A 1A04A 1QGZA 2D0DA 3BXOA 1IOZA 3INTA 3OZGA 3AX6A 1W73A