2Y6UA

Peroxisomal alpha-beta-hydrolase lpx1 (yor084w) from saccharomyces cerevisiae (crystal form ii)
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
379
structure length
366
Chain Sequence
QNRFKKETKTSASWPRAPQSTLATDRLELTYDVYTSAERQRRSRTATRLNLVFLHGSGMSKVVWEYYLPRLVAADAEGNYAIDKVLLIDQVNHGDSAVRNRGRLGTNFNWIDGARDVLKIATELGSIDSHPALNVVIGHSMGGFQALACDVLQPNLFHLLILIEPVVITRKAIGAGRPGLPPDSPQIPENLYNSLRLKTDHFANESEYVKYMRNGSFFTNAHSQILQNIIDFERTKGPVRTKMEQAQNLLCYMNMQTFAPFLISNVKFVRKRTIHIVGARSNWPPQNQLFLQKTLQNYHLDVIPGGSHLVNVEAPDLVIERINHHIHEFVLTSPLQSSHIPQLTLEERAVMFDRAFDSFKNEALVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL MEMBRANE PROTEIN LPX1
publication title The Unusual Extended C-Terminal Helix of the Peroxisomal Alpha-Beta-Hydrolase Lpx1 is Involved in Dimer Contacts But Dispensable for Dimerization
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 127
structure length 366
sequence length 379
ec nomenclature ec 3.1.1.-:
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y6uA01
2AJDA 3STXA 4HXEB 3O4HA 2PU5A 1UZAA 4FLEA 3I2KA 4KEAA 4HRYA 4CG2A 1YAHA 2BUBA 3STYA 1OILA 3WQHA 5CH3A 1LPPA 3QVMA 3R3VA 5JAUA 2JF0A 3HEAA 4QLOA 4BDTA 2WG0A 3L1JA 1YA8A 3VJLA 2VT6A 4ZREA 4ZI5A 4W1RA 3VVMA 3WA6A 3STUA 3W9UA 1L7AA 4B6GA 4INZA 4UBNA 4FDMA 4RPCA 4BTLA 3EQ9A 2ZSIA 3R3YA 5ALJA 3ZV7A 5AI9A 4EBBA 3WIOA 2JBWA 4LXHA 1ZIYA 1CLEA 5HKAA 4DIUA 4X85A 2AJBA 3G0GA 4HXGA 4DM7A 3KOOA 4XIIA 5AK3A 4UHFA 5AI5A 2OG1A 4KE6A 1VZ3A 5CBKA 1CPYA 1HLGA 1CRLA 2C5GA 2Z8XA 3HC7A 5ALEA 4MXDA 4W9RA 1MAAA 1WM1A 5LZ4A 3VISA 3OM8A 3C6YA 1CUIA 1XLUA 1ZOIA 4NVRA 4GDMA 1R88A 1J07A 1WB4A 4OB7A 4UHEA 4FOLA 4PW0A 5CURA 2BGNA 2WM2A 2J3QA 2WFLA 1H2YA 1XROA 5FP0A 5AKYA 2HU5A 3M82A 1N1MA 3C45A 1WB5A 4XX1A 5A7HA 2WSLA 3DOIA 1ZIXA 4L0CA 1BEZA 1YA4A 1H2XA 2ZSHA 4W1QA 5JZSA 1VE7A 3QPCA 4GECA 1HQDA 1FFDA 1R50A 3PF9A 4UBJA 3IURA 4A16A 1DWOA 2JEYA 3DNMA 3WKDA 4FHZA 3K9BA 4AO7A 2O2IA 4PQEA 5AKXA 5AK4A 1UKBA 2W22A 1JJBA 2RAUA 4ZV7A 4J0IA 1N5MA 2XQFA 4BCDA 4DYHA 2VATA 1IUPA 3AIKA 1Y7IA 4FFVA 5JANA 2XUGA 1VJ5A 2WIFA 4LYDA 5D7BA 4L72A 1IZ8A 4YX9A 1ODSA 2DFPA 1VXOA 1QGED 1DINA 4N5IX 2ROQA 4P9NA 5E4JA 1CUXA 1ORVA 1QIIA 3WWOA 4CCYB 1EDBA 2XLCA 1TCBA 2X76A 4U2DA 3WL8A 4BCBA 3ESBA 2WU4A 3WK9A 4B9EA 3F96A 3QZUA 3PICA 1QIHA 3QMVA 1H22A 1TKRA 3C5VA 2C7BA 4UFPA 3O4IA 3A2LA 1F0NA 2Y6VA 3L1IA 3JWEA 1DQYA 1YR2A 3FCXA 1L7QA 3WZMA 1YS1X 4GW3A 5ALKA 5ALRA 5K5EA 3EF3A 4D9JA 3BJMA 3BDIA 1CUAA 3ZLVA 1GKKA 4IH9A 4KE7A 3SK0A 1CUZA 2C58A 2OCGA 1THTA 4X3CA 1E8DA 4TPKA 1UOQA 1IUNA 1X70A 1ZGCA 1DTEA 2HU8A 2EEPA 2J4CA 2QUBA 2DR0A 1W4LA 1K63A 3U1TA 4AX4A 5CXXA 1XZAA 2OGSA 1ODTC 2QM0A 5DTIA 3FAKA 4F0JA 2WQZA 2GZSA 5AK6A 1K6EA 5IVHA 4PNZA 3DOHA 1CUFA 4I3FA 2B61A 2C5FA 4Y2YA 5DNVA 3F67A 5JD4A 1PFQA 5EHQA 5E2IA 3OOSA 4OD0A 5T4BA 3Q8WA 2OCLA 4KAJA 4HVTA 5YASA 1CUYA 2H1IA 5SYMA 3MGAA 3E4DA 4OU4A 4Y2TA 4J0DA 1XZEA 3ZPXA 1XZIA 2HA5A 3GROA 3C6ZA 5AH0A 2B20A 1SC9A 1VKHA 4G8CA 1ACLA 2QKYA 4FTWA 5AJHA 4Y2QA 4B80A 1FFBA 2BAGA 2DSNA 3H19A 1TIBA 3C5WP 5CRIA 2OGZA 5LZ8A 1ZI6A 2G5TA 4UFOA 2OQIA 4MYDA 4KE8A 1K8QA 5BWBA 4B82A 3SWWA 4Y2JA 1FJ2A 4N8SA 2OCIA 1WOMA 1IUOA 2OLEA 4HZGA 3FNBA 4M0EA 3BF8A 5J3JA 3F97A 4C88A 5JYCA 3S8YA 3DLTA 3WZLA 3WYNA 4X7BA 4MEAA 5AKEA 4DMHA 1G4HA 4TGLA 2OCKA 4G4IA 2BUAA 4CFSA 2O2GA 2RIPA 2HADA 2HA7A 3W2TA 1E8MA 3I2GA 3ZWQA 2VAXA 4PSDA 4KRYA 1EH5A 5ALIA 5E4YA 3HI4A 4RE6A 3D2CA 1EXWA 1FFCA 3WI7A 5IVIA 2PSHA 2Z3ZA 4MYSA 1SCKA 4ZV9A 4H7EA 3B12A 4I4CA 5I9IA 3G9XA 4QDOA 2XMGA 4CCWA 1MTZA 3MVEA 1EDDA 4Y2XA 4EHBA 5JADA 3PUHA 4UHDA 3C6BA 3DDUA 3PDCA 4J0JA 3NWOA 1K4YA 1UK9A 5HQ3B 4H35A 4FBLA 4AXBA 3PFCA 1QONA 2YYSA 1ISPA 1QOZA 3ZLTA 1LBTA 5BWCA 1CUDA 1HKHA 2XQKA 4G9GA 2C0QA 4WFJA 2HHAA 1Q0RA 1UKCA 4FKBA 5AKZA 4QA9A 4AN1A 4XWGA 3WLAA 2QVBA 5HF6A 2RHWA 5AIAA 1BU8A 2XI4A 1CIJA 1XZBA 1UOOA 2P8SA 1BS9A 1XLWA 2WILA 5EHZA 2K2QB 2R8BA 4H0CA 4WJLA 1WHSA 3BWXA 3W9BA 4Y2UA 2WU3A 3CXUA 5CW2A 3H2JA 4Q34A 3RKSA 3IB3A 4ARBA 4WY8A 3STTA 4AN0A 1JMYA 1LPBB 1JKMA 5KWIA 3QYJA 4P08A 4XVCA 1CQWA 2ZVDA 3O4JA 4X97A 2WFZA 1ZI8A 2V98A 2Y1KA 1QTRA 3GFFA 2WJ6A 4QWWA 4BBZA 5AOCA 1QJ4A 5CTAA 3D59A 1LGYA 4QLAA 1P0QA 3H04A 5AHXA 2J3DA 1JI3A 4B0OA 4DNPA 1USWA 2DHDA 4PSUA 5EIEA 1DQZA 1PV1A 3H2KA 4GWLA 4CIAA 3NOXA 2XUQA 3MUOA 2H7CA 1XRRA 3CN7A 4ZRDA 2FUKA 3E3AA 5ALQA 4W63A 3ESAA 3AZQA 5HK8A 1EINA 3STVA 3PUIA 1JJIA 4UBLA 4FNMA 4RGYA 1HL7A 4ZXFA 4DMKA 5HFNA 5ALYA 3SX4A 1UOPA 5I8PA 2XE4A 2QJRA 1Z68A 3OG9A 3QBJA 4YK7A 3H1BA 2VSQA 3HACA 2XT0A 1DU4A 3BIXA 5A6VA 1U8EA 2VT7A 3VDXA 3KXPA 4W1SA 4P93A 5EFZA 5FV4A 4QDUA 1MAHA 2ONCA 5EGNA 3AJAA 4QE3A 4S0XA 4G4GA 3WKEA 1C7JA 5FLKA 4AB1A 5JALA 1UWCA 2CJPA 3F9CA 2HIHA 2PVSA 2CUTA 3T52A 2WHRA 3WA7A 1XFDA 1C7IA 5T4HA 5JZ9A 3FVRA 3B5EA 3G9ZA 1BRTA 4BDSA 3W06A 4BAGA 4BE4A 1CUEA 4J03A 3D5EA 3WWDA 4QDXA 3WK7A 1ZD3A 4BE9A 1DWPA 3DYVA 4AZ3A 2WIDA 2D5LA 5HZGA 2J4FA 5DLPA 2WUGA 2UZ0A 1P0MA 3R3WA 4FBMA 1BCRA 4IO0A 2X5XA 3H0CA 4IQ4A 3R41A 1UK8A 4DLNA 2GBCA 1GQRA 3ZLUA 2Z3WA 5AKLA 5ALMA 4PO3X 5KREA 5C7YA 1FFAA 1XQXA 1XZGA 3O9MA 2DHCA 4JNCA 2JGKA 1GPLA 4NS4A 4AO8A 4CIBA 4KAFA 1RYYA 1C4XA 3HRHA 2XMCA 4FLMA 4UPDA 4RNCA 1ZICA 2QRUA 2HU7A 1QIFA 5AKIA 1YB7A 4BRSA 2CB9A 2ZYIA 4ZGBA 4BVLA 5FDFA 5HCUA 3WWEA 5LP1A 5K3AA 4MQMA 2WIKA 3HLKA 5AI0A 3WWCA 4K2AA 1XRLA 2G4LA 1AGYA 2OAGA 1GGVA 2PSDA 1A88A 1N8SA 4WFKA 2ZYSA 1XZDA 4HTAA 2HA2A 1ACJA 1ZJ5A 4QNNA 5JASA 1PJAA 5FPPA 4MQLA 1CUHA 2XQJA 1DT3A 3QMWA 3FCYA 2GYVA 4X6UA 3NGMA 1B41A 3AZOA 3WL7A 2XQIA 4A5SA 3V1NA 3WK6A 2B9VA 3E0XA 2DQZA 2JGMA 4BVJA 2VQ6A 3ESDA 4LYEA 4BCCA 2XUPA 1NX9A 3BE8A 3CCBA 3WJ1A 3H2GA 2WUFA 4ZWNA 2XUOA 5CT6A 1VLQA 2QT9A 4PSCA 3M81A 2AXEA 4DGQA 2EDCA 5K3BA 1XZCA 1YAJA 3IVMA 1SOMA 2QOEA 5AKKA 4GBGA 1AZWA 1WPXA 3F98A 4BP9A 2H7XA 3UUFA 5C81A 4E15A 3U0VA 1F6WA 1IZ7A 3D3NA 2YASA 4G9EA 4H77A 5LZ5A 2PX6A 2VTVA 3WK5A 4X6YA 3R40A 3EQ8A 5KWJA 1KU6A 2EDAA 1QIJA 1H23A 4J3JA 1GPKA 1DX4A 4BP8A 3LP5A 3S2ZA 1MN6A 3HABA 3KWFA 1AURA 1QFSA 4OUKX 2C4HA 2GBIA 4K6KA 1W76A 3M3DA 4Q1VA 3DD5A 1RWQA 4UUQA 2QR5A 3NUZA 2ORYA 4AMZA 2IITA 3I2JA 3GA7A 1EB8A 2BGRA 5ALUA 3W05A 4G5XA 1KEZA 2XLBA 2O7VA 1U65A 5K3CA 4V2IA 4DNFA 3IUQA 4KACA 2R11A 3A6ZA 2XUAA 3FLEA 4DSAA 3G0DA 4BZWA 1ORWA 3OPMA 4Y9SA 3RLIA 4DNQA 4P92A 1XKLA 1J2EA 2PSJA 2H9YA 5FPQA 4OYLA 4KYVA 1VXRA 1G66A 1W6RA 2DQYA 2GYUA 2XUDA 2I78A 2QUAA 4F60A 2BJHA 1LPAB 5DJ5A 3OURA 5CH5A 5LLSA 3KSRA 4WDQA 2VJCA 4KR0A 3VJKA 3QPAA 1BN6A 1QLWA 5IVDA 4X00A 1CUUA 3H2IA 1F8UA 2WUDA 4PF1A 4X93A 4HAIA 1QO7A 2HFJA 2PKYX 3ICWA 4GHWA 3G8YA 4B83A 5EIHA 3PFBA 5EHXA 1XLVA 4OPMA 2E3JA 3E1GA 4WFIA 4W1PA 2PBLA 4CI9A 2B4KA 4CCYA 1R1DA 3G02A 1GXSA 1D07A 2Z5GA 4N5HX 1TCAA 3EIOA 3G7NA 4LHEA 2WHQA 2FJ0A 2RONA 3AINA 2HRRA 3FYUB 4H7JA 4BC1A 2BFNA 1H2WA 1TQHA 4UHBA 5AI4A 2QS9A 5A2GA 1QIKA 5JAHA 2QJWA 1U4NA 3I1YA 4QZVA 4KAAA 3WKAA 4M0FA 4BB0A 5E4TA 2ZJFA 1VE6A 3RARA 4G1FA 4H7HA 2GBGA 5AICA 5HKBA 1UK6A 2LIPA 3DCNA 1XZFA 3IUMA 1X2EA 4BRZA 3LCRA 1R4ZA 3C8DA 1B6GA 4N8EA 3UUEA 3CCCA 5K3FB 2WJ4A 4FFWA 4O08A 5FOQA 4MWSA 1R3DA 5AKGA 5HF8A 1EVEA 2HA3A 1XRMA 3CN9A 1CUGA 2IX9A 4BAZA 3TJMA 4YPVA 1XQYA 5D3ZA 5ALSA 2C0PA 4X71A 2ES4A 5FXMA 1ZGBA 3DL7A 1VZ2A 3EQ7A 1ODCA 2I3DA 2CEKA 5LKAA 1XZMA 1ZD4A 1AMNA 2ZJ6A 1Y7HA 3I2IA 4U2FA 5AIBA 1AKNA 1JT2A 2G63A 2XUHA 3H17A 2VJDA 3HXKA 3YASA 1Q84A 4C4YA 4GEGA 3PE6A 4BAUA 2HDWA 3V9AA 5CT9A 3DL4A 4UHCA 2V96A 1XRPA 3R0VA 4F21A 1HDEA 2I03A 1W75A 3I28A 1AUOA 1QIDA 1XRQA 2HA4A 5JARA 2WHPB 4GXNA 1FSSA 2CKMA 1QZ3A 1LPOA 1J06A 3W04A 4Q3KA 3AUKA 4KE9A 4G4JA 2VF2A 4EY4A 1AC5A 1EK1A 3HJUA 5C8VA 5LYYA 1DX6A 1JFRA 2WIGA 1TAHA 1CUBA 5ALDA 3FYTA 2BCEA 3BIWA 1CUWA 1XRNA 3FYUC 2VA9A 4UBIA 4AQDA 1G5FA 3BDVA 3WKBA 5D3KA 1W52X 4ITVA 2V9ZA 4WDRA 3IUNA 3I6MA 3IIIA 3ZI7A 4LKOA 2W6CX 1QE3A 1ZI9A 3ESCA 4AMYA 4OU5A 4Q82A 2XB6A 4KJXA 1M33A 4GLBA 3C70A 5JAPA 3BXPA 4Q3LA 1BCSA 4UBKA 1THGA 3WL6A 4FMPA 4HS9A 1W1IA 2CZQA 4Y2RA 5AM5A 2JGFA 1IMJA 3FYUA 4WCVA 3VJMA 3G0BA 4B85A 1TCCA 2WLSA 4XJVA 2WKWA 3FWHA 1R9NA 1QFMA 3V1LA 1Q83A 2AJLI 1YS2X 1UK7A 3A70A 2AJCA 3I6YA 2RI6A 4EZIA 2O7RA 2XUIA 5K3FA 2JGJA 5ALWA 3VKFA 1N5RA 2ACKA 5CT8A 4TVKA 3WL5A 1E8NA 3GELA 4LXIA 4X92A 5AM2A 4ROTA 4Z49A 1E3QA 5SYNA 1CUJA 1VA4A 4BTVA 1GT6A 5HQ3A 5ALZA 5HF9A 4YASA 5LZ7A 1LZLA 4J7AA 1A8SA 3GUUA 3HSSA 3L1HA 2Q0XA 2Y2VA 5AM4A 1XZHA 2QTBA 2WJ3A 5ALVA 4JUIA 1ZJ4A 5A7FA 4GI1A 3G0IA 3I2HA 4U2BA 4IH1A 5T4FA 2YH2A 3OTQA 3ANTA 3D2BA 3FBWA 5DNWA 4B9AA 3PI6A 4BVKA 3ANSA 3FLAA 5AM0A 5CXUA 1WPRA 1CFJA 2WHPA 4E46A 2RGUA 3A2MA 1S8OA 5K3EA 1A7UA 1XQWA 1GPNA 4UBMA 1OXMA 3WKCA 1AQLA 2XMQA 1MX9A 4UHHA 3DYIA 1YASA 1WCYA 1K5PA 4JYPA 3BF7A 3WMRA 4EY7A 5ALGA 4JH0A 5JAOA 2V97A 3I1IA 3KD2A 3V1MA 4OCZA 1ZD5A 1LBSA 4U2GA 2PSFA 3QITA 4E11A 4L9AA 1MO2A 5KBYA 3QH4A 1JU4A 3DS8A 4K5QA 1DWQA 3JW8A 1YCDA 5D6OA 1LPMA 2G5PA 5ALXA 1FFEA 2PL5A 1UXOA 2OXEA 1JU3A 1WB6A 5IKXA 4JYMA 5JD6A 4OB8A 2Z8ZA 4F5ZA 4Y2VA 2FX5A 3D2AA 5AK5A 5CT4A 3WJ2A 1EX9A 4B7ZA 3IDAA 5ALTA 5AKJA 1BE0A 2I3ZA 5LIPA 1VOTA 1Y37A 2HL6A 2XUKA 4C4ZA 5ALPA 3D0KA 5ALOA 4N8DA 1WHTA 1A8QA 3HYSA 3DEAA 3SC2A 2OAEA 4DNOA 5AM3A 2CMFA 3IUJA 1AX9A 2ACEA 4X95A 3C6XA 3DKKA 1XKTA 5AOAA 2HA6A 3IA2A 4BZZA 5CH8A 2XUJA 4OSEA 1E89A 3O0DA 5AI8A 2PUJA 3DQZA 4NMWA 1A8UA 5JD5A 4H7IA 4FWBA 3M83A 1EVQA 3R3ZA 5ALNA 3QMMA 4EUSA 3H18A 2VJAA 1SFRA 4QWMA 5ISMA 4EY6A 5C8ZA 3DKRA 5JZBA 3TGLA 3C8HA 2AJ8A 3D7RA 3WWPA 3N0TA 5F4ZA 1JJFA 2XQGA 4B84A 1E66A 3JYHA 1QO9A 1BEEA 2PUHA 2WTMA 3P2MA 3C43A 4B0PA 3R3UA 4BC0A 1GKLA 1CUCA 2Y2UA 4DMFA 4HRXA 2FJPA 4J0GA 5ESRA 5EIAA 3HZOA 1CV2A 4Y2SA 2O2HA 3D4LA 2YXPX 4LIPD 4LXGA 1I6WA 2JGIA 2XMDA 1U2EA 1OCEA 3O9VA 3BL8A 4M0MA 4Q05A 5LZ9A 4A23A 5AKHA 3KWJA 1HBJA 5FUMA 4Q3OA 3KDAA 5DTJA 1MPXA 1EB9A 2QXTA 3O4GA 4C89A 5ALFA 2WTNA 3VXKA 5C8XA 1LZKA 1MJ5A 4CG3A 5T4EA 2GZRA 5LKRA 5LZ2A 5AM1A 4KRXA 4BATA 2XDWA 3EBLA 4C01A 4E14A 5IH7A 2PU7A 1EA5A 5ALLA 5JIBA 1BROA 3TRDA 2JEZA 1LNSA 1MNQA 4WY5A 1LLFA 1GQSA 3G9UA 4QDTA 1MX5A 1KU0A 4J0CA 4U2CA 4IHAA 1UT6A 2OGTA 1XZLA 2WIJA 4G8DA 4QDZA 3Q0TA 1UFOA 4H18A 4B81A 5JATA 2Y6UA 2PM8A 4MJ3A 4K6HA 1UKAA 1EDEA 5CT5A 4C87A 5IVKA 2NW6A 5HFAA 3LLCA 3ED1A 4NZZA 5AOBA 4AZ0A 3K6KA 1ZD2P 3F8SA 2HRQA 4MWTA 1QIMA 2GYWA 1XZKA 3UMJA 4X94A 2XMRA 1QIEA 7YASA 5HF5A 2XMSA 3C87A 5FKJA 1X2BA 3T4UA 1P0IA 1VA5A 1T2NA 1ETHA 2PSEA 4CG1A 1MX1A 3G9TA 1NU6A 1CVLA 3QPDA 3BJRA 4X91A 1NU8A 5EHNA 2D0DA 3WYDA 4ARAA 1MT3A 1DT5A 2BUCA 3V48A 4Y7DA 5BOVA 1CR6A 2WFMA 4DSZA 4U2EA 1TRHA 2GBFA 5DYWA 6YASA 1BN7A 4EY8A 1MNAA 5K3DA 4EA6A 2X8BA 3H1AA 3VVLA 5A7GA 1CUVA 2VEOA 4QEKA 1SCQA 3I2FA 4C4XA 4ETWA 4PV7A 3TEJA 3O95A 4J0KA 1HPLA 4IH4A 2VAVA 4OB6A 2HFKA 1XQVA 2OPHA 3RK4A 5ALHA 1CEXA 3FLBA 5H3HA 4AO6A 4H7DA 3STWA 1G42A 2JGEA 3R3XA 1EK2A 1QTIA 3GBSA 1TK3A 4L3WA 1XZJA 1T4MA 1QIGA 2BKLA 4EB0A 3WK8A 3RM3A 5FRDA 3AIMA 3K2IA 3AILA 3LIPA 3FSGA 1JMKC 1LPNA 2H7YA 2WUEA 3B3QA 2JGLA 3I6ZA 3DJYA 3WIBA 1EI9A 1O6GA 2XUFA 5DNUA 4K6GA 3MUNA 1R9MA 1Q0ZA 4OYYA 5AP9A 5A62A 1E5TA 5DYTA 5AI6A 5HK9A 2ZYRA 3IBTA 5I7UA 5EI5A 3LS2A 1H2ZA 1RP1A 3OC0A 2PPLA 4BYMA 2ECFA 5DWDA 4HXFB 1YB6A 5BV7A 4RE5A 3QM1A 4DMCA 1EHYA 3ILSA 2OQVA 2QMQA 3H2HA 3A2NA 4UBOA 5AO9A 3FVTA 4MEBA 1F0PA 3AZPA 2WFLB 3AFIA 2QZPA 1O6FA 4DTCA 1J1IA 1CUSA 1SCIA 3WK4A 1L7RA 1LPSA 1YSCA 3PF8A 4J0HA 2HA0A 2IIVA 2XMBA 3N2ZB 4X90A 3ICVA 4JEIA 3V1KA 3G0CA 2ZJ7A 4G8BA 2HM7A 1IVYA 3IULA 4FLFA 5CMLA 2JIDA 2WG2A 1CQZA 3AIOA 2QXUA 4EY5A 4X6XA 1P0PA 2XMZA 4FNGA 4C6HA 2RHTA 2WG1A 1MU0A 2DHEA 4H7FA 4I19A 5A71A 3X3HA 4UFNA 4H7KA 2ZYHA 2DCMA 2CBGA 5DYYA 3LIIA 3GZJA 1GZ7A 3FOBA 3FSGD 2VJBA 4Y2PA
chains in the Genus database with same CATH superfamily
1VFPA 5JO9A 4E31A 4P81A 3U1VA 3T3PB 2HMVA 4HXEB 3CB4A 3O4HA 4LMBA 1YE8A 1EJBA 1T34A 4QYIB 2XB9A 1M0TA 2WEKA 4A8HA 2PU5A 2FN7A 3EWAA 8OHMA 1T2FA 1U2GA 5LBUA 5A3VA 4FLEA 1PD1A 4EKIA 5C7IO 3WAGA 3V7FA 2IU4A 4DQUA 1O6BA 2Q8PA 5BR4A 1I6KA 4DIBA 4ZA2A 3CX8A 1J2YA 4BO2A 4F9EA 3FETA 1T0IA 2P4HX 4B45A 1G2OA 2ONYA 3RIGA 1T3GA 4JXXA 4X1KA 2H65A 5TPWB 3W7VA 1MB0A 1V7ZA 4CEIB 3WC4A 1E6MA 4MUEA 2SKDA 4N3NA 3QKSA 4R51A 1Q1AA 1LPPA 4BQOA 1B4DA 3KL4A 1JJVA 4KXYA 5JAUA 1K7SN 2JF0A 3FXAA 1C8VB 1MGPA 3O47A 3QEJA 1NVBA 4NHEA 4QLOA 1ZN9A 1HYGA 5FD8A 5FO0A 5HIAA 5H83A 2M2IA 2XB2A 1ST2A 1YA8A 1IRXA 1UXJA 2EX0A 4WINA 2C9CA 1NY5A 4FUQA 3ZY5A 3RRBA 2XVXA 1Z15A 4PBRA 2VT6A 1D4ZA 1E3EA 1BS1A 1FCJA 2YYZA 2PE5A 1XD2A 2ORVA 1AOXA 1TO1E 1YBAA 4ENWA 4ZCSA 2P9HA 4CKEB 1VECA 2O2XA 5E8RA 1CJTC 3VVMA 3QNUA 5KVVA 3IKLA 3IJRA 1XF1A 1KK2A 1RWMA 3MT0A 3DMFA 2JFZA 2OLKA 3O8QA 4KO2S 5F52A 3V8EA 1L7AA 4CLDA 5ALUA 3DV2A 2GCGA 2YIMA 3K09A 4CLHA 4Q66C 4OK6A 2YV3A 3WIUA 3BCSA 2FWIA 2XEDA 4Q18A 4PYLA 1IQRA 4EBBA 5I47A 4Z0HO 1VHDA 2JBWA 4D0GA 3E3OA 3U9LA 4JUDX 4MGIR 1ZM3A 1ZIYA 1CLEA 2DJ5A 2I6QA 3SE0A 5SZJA 3U2QA 4F4UA 2ZJZA 1RPTA 4ZZ0A 4OTZA 3G0GA 5A9RA 1ZZGA 1WDTA 2G9VA 1IB6A 5CFOA 1N0IA 1Q57A 4OJMX 4C3VA 3VJRA 1SVOA 4FCTA 3KV1A 2QG6A 3TVTA 2X15A 4F46A 1F3OA 2EIHA 4RMNA 5KVSA 5G0VA 1U2RA 3HN7A 1U7PA 1XE3A 2SKEA 1ZUNB 3H42B 4YAFA 5ERYA 5CDUA 2CNWD 2ZYUX 4YMHA 4DIFA 5C53B 1VZ3A 3B1KA 1NLFA 1X87A 3SJZA 3HY4A 5L7WA 2NZWA 1CRLA 1X14A 2B1JA 1DPFA 2C5GA 2PANA 3RC3A 1S6YA 2I6XA 3E9QA 1V2HE 2HSGA 2MHCA 4MXDA 4PZLA 4RQBA 3KHUA 5C46F 4RIGA 3TTWA 2VP5A 3OM8A 4KMSA 3W5HA 4R9UC 1XLUA 4L3VA 4LECA 3LDFA 4TT3A 1IWPB 2WE7A 2GB4A 3TLMA 4EL5A 3Q5EA 1ZOIA 3FMOB 2QP9X 3NRJA 2P65A 3OKPA 4ERNA 5ADWA 4OB7A 1AGRA 1WB4A 3AMVA 3JD1A 5HUHA 2WNIA 1MLDA 4UARA 2VJMA 5TNXA 4RA6A 2DBRA 1BG6A 5GONA 4LMRA 3T0IA 2YR0A 4B34A 2CSUA 5EPEA 3IEVA 3D31A 3FZNA 2UYYA 4R69A 2B21A 4HDOB 2G83A 2P7HA 4R2LA 7MDHA 3FF1A 3CZ4A 4TX1A 4DEYA 1AA9A 2E1PA 1UDAA 2HZBA 2G3YA 2PNFA 2QAJA 4NDAA 4XX1A 2VT3A 5IDQA 4I2NA 1QG0A 2XWPA 3TFOA 4ARUA 3JQFA 3HDVA 3UW3A 3DCYA 2LUOA 3BA6A 3GXOA 3H0KA 3Q3HA 1U0TA 4U39A 4BO7A 4MWDA 1Y8RA 3QW2A 4NCBA 3AF4A 3G5MA 1I3OA 1C9MA 3G5LA 4MUNA 1M6EX 3P9ZA 4F6RB 3JRNA 4GECA 1DV2A 1FFDA 1F0YA 1W59A 2GK7A 3RVLA 4O2BB 2IU6A 4ZP1A 1DTSA 4NE7A 2A35A 2ZXEA 4RZHA 4U5QA 2RI1A 3X2FA 1BWQA 4XI9A 2P9TA 1GHTA 2LZ0A 1J00A 2FRDC 3IURA 3AW9A 2QR3A 3PR3A 3B78A 2IE0A 2L18A 4CTKA 1M0EA 1DWOA 5HBRA 5AHKA 3HP7A 3ENNA 3AJDA 3CZ5A 4FHZA 2QTZA 4KGXA 4A26A 2W6NA 1RW4A 3NDIA 3O4RA 2FP4A 4X0EA 4CMGA 5GIPE 1YL6A 3HY6A 1TO6A 3OY7A 3ZXSA 3T95A 3T5GA 1QGUA 4PQEA 5AKXA 3TIVA 3SFTA 3E03A 4A2QA 2W22A 2O6HA 1X1TA 2JH9A 1WCWA 1M10A 5CVVA 2G5CA 1R5BA 2RCYA 1L8XA 2TECE 2R8OA 1OAOA 1OBVA 3CWCA 1DBWA 1Z36A 1I14A 1Q3KA 4GSKA 3A9RA 4NNPA 3VPGA 4UEKA 1IUPA 1ULSA 3BH7A 4MUYA 4S1OA 4N6OA 3T7DA 3ZCVA 1VJ5A 3EDRA 3WHLA 1MR3F 5IBRA 4GOOD 4FZVA 3AVTA 5D7BA 3OCVA 1IZ8A 3USES 3I5MA 3W4JA 2YNMD 3PWZA 1NXXA 3VR4A 2GZAA 4FIZA 4HFRA 1VXOA 2YVUA 3PA6A 1I2AA 1QGED 1U8YA 2YHBA 5F12A 4DBLC 1DINA 1WQ3A 3A4LA 3AHEA 1G5QA 1TA4A 3A3YA 3NBKA 4N5IX 1M7BA 2GVDC 3BWBA 4JVLA 2ROQA 3G1TA 3QELB 5E4JA 4U7PB 2CJWA 1O87A 2VAWA 4AY5A 2CLEB 1P3JA 3ZQJA 1EYZA 1V1MB 5DXJA 3T9AA 4S0ZA 1EE1A 3Q12A 2Q9AA 1EGQA 4CUJA 3U6BA 3FGZA 4JI4B 2JBHA 3L1UA 3V4ZA 3WL8A 4ZOBA 3GLGE 3TEFA 3O8DA 4C3ZA 3HNRA 2X23A 1CFZA 1HORA 4NBVA 3U7EB 4YQZA 5ES3A 3WK9A 3ANXA 4OM8A 2NX2A 4X7PA 1UJ6A 4DREA 3TAHA 1EPUA 5DHQA 4BQQA 4HDMB 1RAEA 1WD7A 1TT5A 4PHFA 3DBRA 2EQBA 4K81B 4ZMSA 1IBLB 1N25A 3UC9A 1TKRA 2C1XA 1TE2A 1CW2B 3LNTA 4KH1A 3SYNA 4D1YA 2V1XA 5A1TA 3PGLA 3IQHX 3RJ5A 4LWZA 3COZA 3NOQA 3Q3VA 3H4TA 3W8RA 2C3OA 3HWRA 2X8AA 2ZB7A 5K2MA 3GVPA 3ZHZA 3NIBA 2GD1O 1NJSA 5K0SA 3PHHA 2QDKA 2ZIXA 4JQSA 3RD5A 4W5NA 3JWEA 4MVJH 3IXQA 3CH4B 4WN9B 2VP2A 3FCXA 1V11A 3T4XA 1HDIA 3VYVA 4WBNA 2GESA 1HOXA 2OBFA 2YC2C 3A58B 3CINA 3G2KA 3H9QA 3ORFA 1KRHA 2Y0EA 3JQ9A 1U2SA 1Z2OX 2P6OA 3GPDG 4YQEA 2JIMA 4ZZ1A 2X9GA 1X7ZB 1XN1A 3BDIA 3BJMA 1E9SA 1PGJA 3D4OA 4MAAA 2NP6A 4TLAA 3X1JA 2JAUA 2C61A 2QGZA 2C58A 1DEXA 2DPLA 3RIHA 2Y76A 3RUCA 2PX3A 3SYTA 3BFXA 2D7JA 3VI3B 3WLMA 1IZZA 1Z88A 4KSCA 2PPVA 3JYPA 1KYIA 3HCOA 4Z4GA 1JAXA 3OCYA 1DTEA 3Q3EA 1UWVA 2J4CA 3FBTA 1ABFA 4JOSA 4LXYA 4Y8VA 5DBEX 4WA7A 3ZHUA 2CL6X 4AX4A 2RGDA 5F33A 5HQTA 1JQ5A 2VTKA 3AY7A 4FSHA 3BWDD 4HGYA 1MABB 4DR6B 2OGSA 2VG8A 2FU5C 3FNFA 3ZZ0A 3DCIA 4ARZA 1KC1A 1QBKC 4IHJF 4X7MA 2HCBA 3H1GA 2Y1OA 5TS3A 5IZ4A 3EEBA 1SXJB 2VHYA 3NT2A 4Q39A 1YUBA 2B5WA 2QQFA 3W3AH 2Q2OA 2QRJA 1K6EA 5AK6A 2WAYA 3WGKA 4PN3A 4ZICA 5JDIA 1M2WA 3G88A 3GG2A 1SZPA 4KUEA 3WADA 4PNZA 2QYSA 3BQ9A 3EC7A 2RHMA 2HK9A 3N2GA 4Z1OA 1ID1A 5KYUB 3KQKA 2F48A 1B0ZA 4M0PA 4DV1B 3H97A 4B8YA 1UBFA 1W2WB 3ORSA 1CDEA 3FTDA 4YJ3B 1Y1RA 5AVRA 3E4CA 2HIAA 3F67A 2GKGA 4HYYA 4IIVA 4WCFA 4D9CA 4IF4A 4FHEA 2A1IA 1WXFA 2D62A 5JD4A 2FEMA 3ZWXA 1T8TA 5J2UF 3KT8A 3PUYA 5EHQA 3KAQA 3X2SA 4N5NA 1W36C 4MUJA 1VIMA 4YJ3F 4CE6A 4BGEA 5J4VA 1U7DA 1R6BX 3G49A 5T4BA 5TV2A 3T3IA 3VPFA 1KS2A 1NDHA 2TRSB 2YWJA 1HRKA 3NPAA 2JGDA 2G9NA 4HZUB 4CLOB 4YCCA 1GZHB 3LUFA 3G2NA 4D9BA 3B9PA 1Z0SA 2IZOA 5J5CA 3RSZA 3ZI0A 4M9QA 5J1TB 1Y1KE 2AL7A 5B1YA 3MGAA 3SQMA 1DBIA 3C1UA 3AOGA 1KWKA 3DXXA 3KB8A 4GEKA 2UYOA 1T6YA 1X7XA 1NBIA 1M2OB 2ISSD 3B1JA 1IG0A 2LXNA 4XTRA 2E4YA 2HA5A 1CNMA 1JHXA 2RARA 3O9ZA 4LJ7A 1MC1A 4RFSB 5JZOA 3THXB 3PTZA 1PP4A 2Z1NA 2V7PA 3GROA 1YTUA 2R85A 4Q4JA 2LP4Y 3C6ZA 5AH0A 2OHXA 5CDGA 2B20A 1T3SA 1EFCA 3GAFA 4KKVA 4OQPA 5L45A 3MTIA 3OTWA 2WF9A 3PNQA 3FMIA 2FRVA 4K9SA 2QKYA 3BS4A 5JXHA 3NUQA 5AJHA 4NMLA 5HGXA 1E32A 4LBZA 4IIHA 4EGSA 4HGRA 4ND5A 2OV1A 4B80A 1FJGB 1YQUA 2O19A 5EPOA 2J07A 2ZSFA 5D3MA 3FNIA 1ZNYA 3TZ6A 1I01A 1KQGA 3DP9A 2PIAA 5CRIA 2EG5A 3K30A 5K51A 1DAKA 1JEAA 3B13B 1IIBA 2BMWA 1AS0A 3LC2O 4RH0A 2BGWA 3IX7A 1NTRA 3H05A 2OQIA 4ON9A 4GM0A 5GJWC 1JLMA 1YDMA 2QPLA 3RBXA 2VS1A 4YCSA 4UXJA 3PIIA 4B82A 3U3ZA 5BWBA 1P4HA 3MJSA 3NU1A 1EG7A 3CCFA 1W44A 5TX7A 3DDOA 4N8SA 1N8KA 2X2FA 5T7BA 4J29A 5AUQA 2I1WA 4MCJA 1S89A 1PJTA 1Z06A 3DAPA 3EW9A 4HATA 4LK2A 2AMFA 2XCSB 3LT5A 2OLEA 3DLCA 2QD5A 1UKYA 2IELA 3ZBPA 3ENQA 1N2JA 1Y80A 3DMHA 4EPRA 1RKUA 2GAOA 4M0EA 3ROZA 4LWPA 2Q5CA 3F7OA 1LBIA 3H8WA 4EI9A 2RB4A 2QN3A 1GN9A 3SC6A 3W2HA 2QVGA 1KVTA 5JMTA 1P4AA 3FJ1A 4YCNA 2L2QA 1HLDA 3GUVA 1ZCFA 2PIDA 4NOLA 3ZLBA 1EP9A 4V0MA 3BG5A 2WVAA 1GQOA 1KFKB 1QG2A 4KN6A 2F4VB 3LC0A 1SD1A 2YXLA 3NT4A 4ZOQI 2NTVA 4M21A 2F7SA 1CRZA 2AR9A 3GJTA 3NHBA 3KE8A 2PQ0A 4MLDA 3VTKA 1RWPA 4KZPA 1Z8NA 1VB3A 5K8IA 1FMLA 3A1DA 3KAKA 5UKDA 1Y89A 4EO9A 1JFSA 4FSDA 4M9XA 4M0DA 1RBQA 5LPNA 5FL7A 1USVA 3G8BA 5C1BA 3R8XA 5JHHB 2HA7A 3UA3A 4BMPB 1PWZA 4N65A 5C34B 3I2GA 3DCJA 2NWQA 2FPGA 1E7WA 1VM6A 4HX2A 4BX2A 2Z1MA 4HFMA 1IEWA 1HTBA 3H5VA 5TPZA 5E4YA 3BMOB 3WB0A 2ZQ5A 5EZQA 4NBNA 2HWKA 4KUHA 3EXFA 3DR3A 3VMMA 5K4GA 2WSSD 3FHJA 3HR8A 3V32A 4Z1MD 3SS7X 5ECYA 1II8B 1FFXA 2PYDA 2X0KA 5IVIA 2Z3ZA 1KORA 2OILA 2QRZA 2AX4A 1TM2A 1VRVA 1FUKA 1ZEMA 3S29A 2R6JA 2A9FA 4H7EA 5JEEA 2HYIC 3GGSA 4F56A 9LDTA 1YKFA 3B12A 1HNWB 1LRKA 4YQYA 5I9IA 1YR9A 2II6A 1QH8B 4X1YB 3RT1A 1QWSA 3VZPA 4L4SA 3LLMA 4CT5A 4KWCA 1BWSA 3R0ZA 3D6HA 3LQRA 5TE9A 1Z4KA 2FG5A 4PC1A 3PXGA 2B4AA 4M0LA 3NXSA 4BX0A 5JMOA 1K5DA 5JSHA 3TQHA 3GFBA 2HSDA 5ERGB 3FF4A 1OLXA 3NIFB 2EERA 4MR8B 5ARCA 4HJRA 4KX5A 4OATA 4I81A 2NU9B 3C6BA 2NO4A 4ZVQA 2NSYA 3ELUA 3ZV6A 1I5RA 2LBPA 2R86A 2R8ZA 3LY8A 3L6CA 3PCTA 3JAMA 3HFSA 1U81A 3NVMB 1YZLA 1F9EA 3VX3A 4E30A 1IATA 3MW8A 3HDYA 2Z2IA 5H7XA 4IG9A 5HQ3B 3B51X 2FUEA 2GEUA 4D6XA 5E1BA 5LR6A 2GPAA 5KQGA 1L5VA 3ORQA 3MAJA 1R7RA 4A10A 1CUDA 2O7SA 3TTTA 3SBEA 1C3VA 2JFBA 7AT1A 2BF7A 4NBLA 1YOVA 1BDHA 4QPDA 2XQKA 1IMOA 1BFKA 1VG1A 2JHCA 4G9GA 4YJGB 5L8VA 1T5TA 3SFVA 1RC1A 4KWHA 2OV6A 2Q5OA 1OC2A 1UAYA 2Z2ZA 4IIJB 4LF9B 4LN1A 1SBZA 2HHAA 2X5KO 2XR1A 4O02B 2I54A 1I1OA 3ZR4B 4FKBA 4ADSG 3CNNA 4IIJF 5L3SA 1U99A 1ESCA 3F6BX 4EGQA 1OJLA 1HG0A 1L7MA 3OLQA 3KPYA 1JJ7A 1CS0B 5GVRA 1HLPA 3PDHA 4FFNA 4DDHA 1GDDA 1PL7A 2RHWA 2XGGA 3S1AA 5AIAA 5EERA 3VDQA 2ATIA 5CIYA 4G26A 4TTSA 1CIJA 2CWWA 1I36A 4DJ5X 1G4UR 4XRGA 2TYSB 2CXHA 3LO8A 3VR6H 4OSOA 3K4QA 1NI4B 4IKPA 2D6FA 4HX9A 3AM3A 4QJIA 1WF3A 2JJ1D 1SG0A 3WGJA 3SEZA 4A1FA 1SHLA 1D5CA 1VJ1A 2IEDA 5DO9A 1I94B 4TLLB 4D9FA 5F64A 2EGUA 4HYTA 4XGRA 3U4CA 2P8SA 5K0BA 2EW2A 3X1XA 1QE0A 2OR3A 2GCEA 4KN8A 2P77A 2EF1A 3GQBB 1GRCA 4HWOA 1IAVA 4H4DA 4TQ9A 4ER3A 2CUZA 2R8BA 4KGZA 3ZDEA 4NG5A 3B5JA 5JANA 1ZDMA 2PUGA 2Y68A 1ZJJA 1FNBA 1V35A 4G0YA 1WHSA 5ITZB 3HG7A 1GM5A 1EFRD 1YZHA 2VT2A 4DA6A 1SWVA 2V6GA 1LY1A 2WU3A 2XYRA 3ANNA 4U9IS 3ADDA 1BCRB 3LBAA 5GQSA 2NZJA 1SO8A 5LDGA 4BX3A 3ZCXA 3VNVA 1HQKA 5DCLA 4FFDA 3LPNA 3IB3A 4INPA 4II2A 4QVKA 1E9FA 1G64A 1U1DA 4U8GA 4WY8A 4ZYUA 3DB1A 3UMSA 4EUKA 1YR1A 4N3BA 3IO5A 2BV3A 3QYJA 3OQVA 3HV0A 1CQWA 1GCIA 1JQAA 4M6WA 2WAOA 2ZVDA 1I2DA 3PFKA 4A8TA 2HXGA 4WERA 4DUGD 5CG1A 1H3EA 3GRVA 4TUYB 1QTRA 4DYDA 1PW5A 1U5BB 4K87A 4F91B 4CUZA 2HNBA 4ZYVA 1XTPA 1WUHS 5DBOA 2W0MA 4XGIA 4O8ZA 4BLTA 2BGUA 4PCAA 3TFQA 1B6SA 2VUHB 4TUYF 1RMQA 1R0RE 1OROA 1ESMA 5CTAA 5JJBA 2AR0A 2ZM6B 4M1EA 1HLFA 2AWNA 1LGYA 3A9VA 4MRNA 4A36A 1OTYA 4QLAA 3TJZA 3STHA 1P0QA 3V8BA 4E1AA 4F2HA 2ADFA 3RANA 1NBMA 1ZHHA 3A26A 3H04A 3HJTA 4J9UE 1QU2A 4DQVA 2JFGA 1Z4MA 2ZSAA 1V39A 5GY7A 5A4AA 3IHLA 1K7XB 3RW9A 3UWOA 5C7LO 5KB3A 3W5CA 2FEWB 2H5IA 1SCUA 1NASA 2PD3A 2DHDA 4J49A 1EMDA 1OXBB 2QRPA 5BVHA 3DF9A 1RWOA 5EIEA 3WWZA 1IBMB 1C1XA 1PV1A 2PKXA 3ES9A 4CIAA 3H8JA 5EMMA 1ZJYA 1BJKA 3WLTA 3HCPA 1GP2A 3GT7A 2C84A 2Q3CA 1HFEL 3JYNA 4HYQA 5DBHX 2QNRA 4OF4A 5DOVA 4WGGA 3E3AA 5JU6A 2YRXA 4D0NA 4HEA1 4N0PA 5T8KC 3TKLA 2NYAA 1AQIA 4ENUA 3PHBE 1GAJA 4JC5A 2VA8A 2YBEA 1NSTA 1IY1A 1SXQA 1XP8A 2CXPA 1L5SA 4WNCA 2C4VA 2GA9A 1QQAA 1FUYB 1GA1A 4FNMA 4HMOA 3C3BA 3SIWA 2GTIA 4RGYA 4ZAWA 4OHWA 4MLPA 4QRDA 3BXEA 2CLDX 6ABPA 3KOWA 1U90A 1B15A 4A6EA 3AFOA 1VJDA 1AUVA 1X74A 2GJKA 1JYFA 1PQYA 2FPIB 2UUBB 4JL8A 1PS0A 2WZDA 3FJYA 1Y5IA 3Q3GE 2XE4A 1J1ZA 1U2QA 4IUDS 5H16A 1CF2O 1N3IA 2P67A 1Z47A 3BORA 4W8OA 5KHOC 1Z68A 3JALB 5I48A 1PG0A 3VZSA 1X3LA 1TA0A 2ODEA 3HA5A 3OG9A 4R8RA 4QUGA 4ETNA 1AZTA 4YVFA 4CF5A 4RSMA 5F23A 3KHKA 2D1RA 2HJRA 3TECE 2Z6QA 2OECA 3DHWC 1EDOA 4WOJA 4F04A 1O0SA 5FADA 4RBNA 2XZLA 2HWWA 3BC1A 2HEGA 2WOJA 3RFCA 1YS9A 1V3TA 3L5KA 5FOTA 2GO1A 2W7TA 1J2JA 2FPOA 5HW0A 1JMVA 3K35A 4LF7B 3SIPA 1NMSA 1ZD9A 1VIAA 3EIHA 1U8EA 2A30A 4HLUC 2C5AA 3I6BA 2VRBA 4A0RA 4RPKA 1M6VA 4P22A 3VDXA 3R9XA 3X1WA 4E09A 3HU5A 4NBTA 2VF4X 1EWKA 5AVVA 2XY4A 1OTXA 2QB5A 3IKVA 3LNCA 4GM1A 3CZQA 1BIFA 3MFQA 4MQEA 3ONWA 4H3HB 5EFZA 5KSPA 1OX5A 3K0AB 5CJPA 1FMJA 1NURA 4QDUA 1SUBA 1HUQA 3NIDB 2IIQA 2ZATA 3ILHA 5IASA 5TC4A 2ONCA 3OY2A 3HL4A 1E3WA 4MQFB 2H2IA 5EGNA 3I4LA 5EQJB 3OZEA 4H15A 4BIIA 1AN9A 5IULC 3DZHA 5I9BA 2E89A 3IC5A 4S0XA 1LJ8A 3OQJA 3A14A 4KXQA 4Z99A 3V46A 3WKEA 1C9NA 3GFTA 4AB1A 4NZYA 1HYQA 4FZ3A 3VR6D 1TZKA 2WV7A 4NY1A 4B3FX 3PQ4A 4ZAGA 3ABIA 1P1HA 2B8WA 4XH9B 5DEOA 5LMCA 2QRQA 2O8NA 1QFJA 5HZMA 1XVLA 2PRYA 2V03A 3VNQA 4F6LA 2CUTA 2BZSA 3RVRA 5BNIA 1N3YA 2PMFA 3E48A 2WHRA 4Y6LA 1XFDA 4GFDA 1NBOA 1NG1A 3TGWA 2VOJA 2AK3A 2QMOA 3D6NB 4ZRNA 3A6DA 5I4IA 1HX7A 2HRZA 3OAAA 3C1OA 3G9ZA 3EGEA 3TZLA 3CPHA 2ZRBA 1MAVA 1NPTO 1YK0A 4ALNA 2BCGY 2AN3A 1T3TA 4KHZA 1F2DA 3NVDA 4XYEA 4D42A 2DFLA 4CIWA 3GR6A 2MMCA 3B9BA 4QBKA 5CU7A 3QLVC 2GRJA 4IDEA 4FFRA 1T9DA 2A0KA 1CJKC 2X8LA 4FFPA 1OASA 2AT1A 4QU9A 2IZ7A 4FI3C 3ZQ4A 5AW7A 4C2TA 4GVLA 4QDXA 3JQDA 3WK7A 1CQIA 4BE9A 1DWPA 1VSQA 5F4BA 4FMBB 1YOBA 4DJFC 1U02A 1VIDA 5BXQC 2J4FA 4RGBA 1GLVA 1RU3A 2YZGA 5DHSA 1SC6A 1DAOA 1Z34A 4D4MA 4QT4A 3EFBA 1QK5A 1DBRA 3IAM1 3V4PB 3WRVA 4IO0A 2BJWA 4OGGA 4QTYA 1E2IA 4PXYA 4B74A 2HBZA 3R41A 1OZGA 2BHTA 5C18A 1W96A 5I4KA 3ZLUA 3QLUA 5T3UA 1ORIA 4JKOA 4PO3X 2OORA 5KREA 4P35A 1TMKA 4TXJA 1ZFNA 1X1RA 5F9FA 2C7QA 4TMTA 3FMFA 1VGVA 2D5CA 4KN5A 2H1VA 3MS2A 3D7MA 3IMGA 3MMSA 1XNRB 2JGKA 4KIJA 2NSJA 3ROMA 2VRCA 4NS4A 2DWCA 3D4BA 2H1FA 1NUAA 3I23A 1C4XA 5CHYA 1JN0A 1L7EA 3WAJA 2IUFA 3Q72A 1AKRA 4UNSA 4KIWA 1ZICA 2HU7A 3P5BA 4M49A 1E7RA 2QL5A 4K1XA 3CS3A 4BRSA 1AKYA 3QTBA 4IWYA 4LCBA 3HN6A 4BP3A 2HMAA 3I52A 4L4ZA 4CG0A 4ZGBA 4B4OA 3M4XA 3HI6A 1P2GA 1D1QA 1TU4A 2RK3A 5DU2A 4BRWA 2O8BB 2M1XA 5LB4A 4D3DA 3UO8B 5HCUA 4B3TB 5B4VA 1S0UA 4B5LA 1TKAA 4QUHA 5K3AA 1ZESA 4DWJA 1F1JA 2HB6A 3HLKA 1DEAA 2YVKA 1Y6RA 4YAOA 3E7FA 5LC1A 4J0FA 4YGXB 3CKLA 4E88A 1C0KA 2PZJA 3LPDA 2KLBA 2ZE6A 4PLCA 2YWHA 3ROPA 2G4LA 1J24A 3VDRA 1Z8FA 2I66A 4TMVA 1K8ZB 3LCVB 1AGYA 1EVLA 1J2UA 3MINB 5DMXA 1GGVA 4YP1A 3GLIA 3ZYCA 4TYQA 2DYKA 1PQWA 3UB3A 4JVNA 5HGJA 2WR8A 3L7YA 4KFRA 4W5HA 2X9LA 2VTBA 4M87A 1YU6A 2E37A 2F1RA 4IDNA 4NZPA 2JI9A 3QV1A 2AXQA 2Q4OA 5EE0A 4ICIA 4QNNA 4C0XA 4CM8A 3F3KA 4FCCA 4XCVA 3V8QA 2IX3A 1OI2A 1UJ5A 1V5GA 5FPPA 3LWDA 1CUHA 2XQJA 5L53A 1EVZA 1RQLA 5TDHA 2VBCA 1ZJWA 1UDBA 3NGMA 2QPOA 1T1SA 1B41A 5TQ2B 3WL7A 2C2GA 3SY8A 5DM4A 3NM4A 3FOWA 2XQIA 3R77A 1YVDA 2CL0X 3BXXA 3GIWA 3CGGA 2ZS7A 3CUSA 2DGDA 1A7JA 1GTL1 1GTVA 4D9GA 4ZI2A 4DR4B 1ZKMA 2NUBA 2V0NA 3DFKA 3JASA 4QULA 3MSXA 1WZEA 2B9VA 3L82B 4GI2A 1E3JA 2DQZA 2VTEA 2Y99A 2NTEA 1E3SA 1FYDA 2C3PA 4ZOLB 5F73A 3DO8A 1A5SB 1HMPA 3ESDA 3D8BA 1NX9A 3BE8A 3KQWA 3MWDA 3R3HA 4FYPA 4W7IA 3USZA 5AW1A 3MTEA 2GPSA 3TNDA 1ONOA 2H2AA 4ZOLF 1IPEA 4BLQA 4GPD1 4Y6SA 3T5AA 3L4BC 2DX7A 4I9GA 4JBLA 2F59A 4EJ6A 3HCEA 3C14C 1VLQA 1RTKA 2QT9A 3DHYA 1BQ4A 3EQZA 3RV4A 5DXFA 5JCOC 4I55B 2CXQA 4PSCA 4CM4A 2Q6LA 4AJNA 4IJWA 2JZCA 2EP7A 1LQUA 1Y9ZA 1WETA 2RHOA 2IP2A 4NONA 2Z0MA 1HYHA 4PYMA 5DGHA 3JYOA 4I55F 4WLVA 4L02A 1Z28A 2WTBA 3IVMA 1SOMA 2QOEA 4N49A 3WLFA 1JR3A 3KJGA 4LNUB 4Y18A 3RYIB 1CZUA 3GCDA 3F98A 4GX5A 4DXHA 2WM9B 1IBSA 1O95A 2O7NA 3UUFA 2BFEA 3EXHA 3LYHA 4LOLA 3NGLA 4WEOA 2ID4A 2XYVA 4EA7A 4HX5A 3PVSA 4WXHA 3WXBA 1WUJS 3KPUA 2P9JA 2A84A 3LQ2A 3PXEA 4YJ2B 5HTOA 3C3DA 1NW5A 2HCTA 2VDWB 4M7OA 5LZ5A 3DTVA 4W5JA 5TIIA 2CT8A 3ZGOA 1ZGHA 2AJTA 3MLAA 3I9NA 1X15A 4RUKA 5K0LA 5BN3B 2FFBA 2GZ1A 5KWJA 2VXOA 4BPBA 4YJ2F 1Y4AE 2B83A 2BMJA 2QJFA 3FKJA 3PL1A 1MFZA 2Q6IA 4R3WA 1KEKA 1QIJA 1NOIA 2BGLA 4S1WA 2ZWIA 1IFXA 3KQTA 3LP5A 4I7EA 1IOZA 4DV6B 4V0KA 2GXSA 4GDFA 4CGYA 3DVAA 3T7IA 3WLJA 3CRW1 3TDMA 2OPBA 3NNDA 1IU9A 4KUGA 1GGJA 3B52X 3GJ3A 4BX8A 2GR9A 1AURA 3L7KA 5CDTA 4R16A 1YFJA 2C82A 4J7UA 2I2BA 2FR8C 3ABOB 3JARA 3BWVA 4OUKX 2GBIA 3HU3A 4JXZA 5L51A 3MWEA 4IUBS 4K6KA 2I99A 1K06A 3GCXA 3M3DA 3AF5A 16PKA 1H66A 3CXRA 2J6HA 1H9AA 4TTAA 4CKBB 4CQMB 1E2KA 5LXTF 2CNNA 2GF2A 3NUZA 2FZ4A 4QXQA 3GL9A 5A1JA 5FTKA 2H07A 3I6IA 1JG7A 4WD3A 1ID8A 2H7VA 3DFIA 4EZEA 2QE6A 3HKEB 4ENRA 3AM5A 2Q3JA 1U28C 3JX9A 4E4YA 4ZAXA 1KDZA 4D0RA 1I5EA 3GA7A 2BGRA 4FOTA 1EKXA 3CR7A 4PZCA 2HF2A 2F9MA 4QPCA 2OZKA 3P2IA 3L40A 2EF0A 4URVR 1W29A 1BH2A 4MA4A 4KYUA 1YGPA 3M0EA 3EFOA 1KE1A 1E9RA 1C81A 2R11A 2C7RA 4NV3A 2W90A 4KWTA 2QL9A 4AUMA 1QZXA 1L3CA 2ZBVA 4DSAA 2B1GA 1FEZA 4UVGA 1U8UA 2Y0DA 4MPRA 4Y9SA 4C0KA 5HRUA 1YS4A 3RLIA 3KSBC 4ED9A 5L3ZA 3LLSA 4IOJA 3R5JA 1J2EA 8ADHA 4F2PA 3QG5A 1TQ8A 4OYLA 4WXEA 2NVUA 3PKZA 5DPMA 5EXPA 4BQPA 4F2DA 2H52A 4AYXA 5JWHA 4ZMRA 1ZXXA 4GX0A 4XGNA 4OG2A 1S1CA 4RDXA 4V0RA 2XUDA 4Q9KA 4EUNA 1NQOA 2Y1GA 3PG5A 3PXAA 1YFLA 2XXAA 2IK8A 2A94A 1ISFA 4YJFB 1ZXBA 4F60A 4TTTS 4YRGA 4HB3A 3SOPA 1KNXA 2YVQA 1VHWA 1SQFA 2HLHA 5EJ8A 3R5KA 2GJ9A 4IWXA 1NVXQ 5FWXB 4KLAA 1S8AA 3QJ5A 2VXCA 4FHDA 3UGJA 1U0EA 4QU5A 4OHYA 2PY6A 2YS7A 4CMIA 3IHWA 5JJ5A 1CRQA 4N5MA 2GXUA 3QXJA 4AF6A 2X4LA 1BN6A 3WS7A 2SKCA 2V0CA 2WYIA 1KJJA 3CRZA 4QFCA 5KHAA 5KYKA 1XTJA 2PD6A 4DB4A 3H2IA 1Z2DA 4X20A 5F7ZA 5BSGA 2V1UA 4M1QA 1T2UA 3M6IA 3K9HA 5DCUA 3O4FA 3DEFA 3VDMA 1S8NA 5BW5A 4ZKEA 2A5JA 4HO1X 2PH7A 3ICWA 1XCBA 3VH4A 1ULTA 3AJ8A 3DV9A 3MAGA 2GN6A 3O7WA 3ZKAA 5KX5A 2IHVA 1FYFA 4OQFA 3G8YA 3KJZA 3PFBA 3VHQA 4BNKA 5DNAA 5A3QA 4NCAA 3PX3A 2VHTA 4RZ2A 1EEXB 2BTOA 3QWHA 3E1GA 4RH3A 4PRZA 5CIQA 4I2VA 4BB6A 1C3EA 4WLEA 2PBLA 4CI9A 4WZAA 4EYQA 1KP3A 4NDZA 4Q4LA 1GNLA 3OH8A 4YRAA 4RU1A 1SHUX 4G1EB 5KYGA 4OFZA 3QWBA 2VDJA 4IINA 4UEOA 6REQB 2Z4RA 3WYGA 3KYIB 4L5AA 2PCJA 1LCIA 3D6TB 3S0JA 2COKA 1GAWA 4MVJI 3KEGA 4BMVA 1J5PA 1LK0A 4LYGA 1QVRA 4N5HX 3TTYA 2ZSJA 4LHEA 2O54A 3D7SA 3T7JA 2RONA 5AW9A 1XXHA 2YBDA 4BNWA 4YJHB 3IOCA 3P0HA 2HRRA 1TEHA 3TRJA 2P2YA 4BQRA 3GT3A 4F3CA 1OXSC 3D7KA 3FYUB 4RELA 2AS0A 3CVUA 1K8YB 4BC1A 1IIRA 3KTOA 3OOJA 4RPLA 5AVKA 2IDZA 5GIOE 5AI4A 3TMYA 1JLHA 2OYCA 5ICEA 2Q4DA 2B2CA 3ZUGA 2I2DA 5IF3A 4TMFA 3N5KA 1X3SA 4N54A 1TLTA 4XEUA 2CEAA 5EKDA 4Q9AA 4PRKA 1WCXA 5E4TA 4ZDWA 8ABPA 3WL3A 4XWWA 4IAOA 3WBFA 3RAPR 5CA1B 1VE6A 3LQFA 2QMHA 4G1FA 3TZKA 1UADA 3O26A 3DH0A 1I0ZA 4AYWA 1QMPA 4MW1A 1XZFA 2IDJA 5LWHA 4XEHA 5CA1F 1W48A 1W581 3C8DA 4QGFA 2J7PD 4E51A 4LHYA 1IXSB 1EZZA 4CHTA 4JP3A 4JENA 4RKQA 1H8ED 4NZ9A 1FIUA 2O8EA 1GSOA 4G4SP 3CCCA 4YRQA 2O0KA 2VZLA 2WJ4A 4ZC1A 3WRXA 3UMBA 2O2DA 2OMKA 2Q3HA 3SP1A 4EEZA 1PZEA 4HPWA 4MWSA 1W73A 4DBZA 2JLYA 4XB1A 1DDOA 1GNTA 2B98A 2Z57A 1YHYA 4P8RA 4DT1B 1I6MA 3CN9A 3OT1A 4PVDA 3EGDB 2P41A 2EJCA 3N9IA 1WXWA 2X42A 3NBYC 3VQTA 5DP2A 1PEAA 3CLKA 5JJIA 4R2IA 1GEEA 3IPYA 4UEJA 2OBBA 2VYVD 2CXUA 1GNSA 1Q0UA 3K0BA 1T6XA 5ALSA 1C30B 2ALJA 2C0PA 3FVQA 3EXEA 2NTYC 4MVJP 5ITSA 2C7GA 2PS1A 3IJEB 5EZYB 1GKUB 4B43A 2OXFA 2ES4A 1JIXA 4QHTA 5FXMA 3RF6A 2O8FA 3AV0B 3SNKA 4BQEA 4D8YA 1MQAA 3ZHVA 1EA7A 1OMOA 4IG4A 2FW9A 3NNSA 4DSUA 2NMVA 4MIKA 5EZYF 1EP2B 3MWJA 4C6TA 4CMAA 1M54A 1E1CB 2RGXA 4P2BA 2BFDA 3KX2A 4DCTA 1JHZA 2HJWA 5HJ2A 3ZBTA 5IAOA 3QUSA 1KL7A 2Y1DA 3GFGA 4D46A 1ZD4A 3KJEA 4MR9B 1ZHFA 1FU4A 4NENB 2J0EA 3F90A 5IZCC 3CVJA 2IYOA 3E2IA 1OVGA 2G67A 3CJRA 3ZUPA 1SEPA 2XUHA 3PPVA 2VJDA 3SXUB 3HXKA 3M7IA 1X1BA 2G8LA 3ZHRA 4ASUA 1FOEB 5B30A 1OIVA 1I5OA 4GEGA 1E99A 1JEQB 2XJ4A 2CZCA 1AK1A 1WW3A 2W6OA 5F2OA 5B37A 3UTCA 3A37A 3W2FA 1ZNQO 3ITNA 1G9SA 1PK7A 2V45A 3AQ4A 4MWGA 3MC1A 4PO9A 2O20A 2RG1A 1XRPA 2W6ID 4DMMA 2G4VA 2ECKA 1XMIA 2FZEA 4F21A 2ZWOA 5H9WA 1O2DA 2JVJA 1A9QA 2I03A 3H5IA 1AUOA 1XRQA 3MWLA 3LUDA 1YJAA 2BR3A 4UDOA 2WHPB 3SS9X 4G5GA 4GXNA 1WOYA 2H1RA 3TXAA 1S3SA 1QZ3A 1LPOA 2H48A 3TQRA 1J06A 1N2EA 2QTWB 4IM7A 1BXGB 1E3LA 3HVKA 4AROA 3RTGA 4JVOA 3EJ6A 1NLUA 4OHBA 4REQB 3K0FB 4LZNA 2FMUA 1RJEA 1YDFA 3AUKA 1PZFA 2N1BA 2FP3A 1DQNA 3C3AA 3GZ4A 4G4JA 4U63A 2E5WA 3KAJA 3RUIA 4LOHA 1NSYA 1EK1A 4Q16A 1LSUA 5CXSA 4KRFA 3A11A 5EINA 4Y6OA 3PNBA 2JJ8A 2GX6A 2GF9A 5ECWA 1VSTA 2XHEA 4KK3A 2QM3A 4TKUB 2PKCA 4C3UA 1RAFA 1P81A 1OBFO 3JAWA 4I9NA 4I4IA 3EEOA 5KTRA 2BCEA 3BIWA 3BXGA 5B2ZA 3NOOA 2C8VA 1CUWA 1XRNA 1M8FA 2CXSA 3RIMA 3U09A 2Q0SA 3EF1A 3BSSA 5DBFA 3ZK9A 2ZJ2A 3Q0EA 1TQ4A 3MJHA 1D03A 2BEUA 4NAHA 4KDEA 3GDHA 4Q6BA 4IIXA 5K0GA 5D3KA 2NSLA 4D7AA 4M46A 4WASA 1WJGA 1UANA 4NBWA 3FHTA 2IYSA 3KOUA 4DV3B 4LKOA 3AR3A 1QE3A 2IEGA 1RWNA 4XWTA 5H02A 1P4RA 1L4UA 3PR1A 4E6EA 2F8SA 1L5WA 2NO1A 5AOVA 2GPTA 2A6PA 1R0SA 4KMOA 4EFKA 1H4VB 4NAVA 3QHQA 4DCVA 4NJMA 2AG1A 4BLVA 3TUZC 4INJA 3VHXB 4FHFA 2C4TA 1Q92A 1WE2A 3Q8XB 3VFDA 1JDBB 4NV0A 5DNYB 5B53A 1V4VA 3RYTC 1T8RA 4ZO8A 3SR4A 3QPVA 2OD7A 3V4VB 1GWNA 4PYQA 3C70A 4BNYA 3UMVA 2NXJA 3CRMA 1AGPA 2AYXA 2I9PA 2IODA 1FRVA 5JAPA 3TLZA 4G1VA 3T7KA 2AG8A 2R8PA 2XADA 3L8FA 2VZ8A 2WPNA 4ND4A 1SUIA 1JR3E 5DSXA 2Q1YA 4TZKA 1SPXA 1C7QA 3HJBA 4HS9A 1W6UA 3B2EA 2CZQA 1TMOA 1IOLA 4OHMA 2ASEA 4Y2RA 5AM5A 1HETA 3KKPA 1WB9A 2BKVA 4TTJA 5DTEA 2PXXA 3EGCA 4XLLA 3TIGA 3L77A 4WPGA 3IAFA 3VJMA 3LQ4A 3PYXA 1DC5A 2X19A 5BN4B 1U1FA 3DKIA 4L6CA 4LGYA 4UREA 5HP4A 2EWVA 1JKJB 4HB2A 1SXJD 1RHKA 2C96A 1OLUB 3FWHA 4ZEOA 4YYEA 3C6KA 4NJEA 2L17A 4D6PA 4E4TA 4PLGA 1J4AA 4PICA 4TZ6A 5EIOA 4M76B 1EUCA 3C8ZA 1SQ6A 1E7MA 4C7VA 1LI4A 1N7GA 2YHSA 5HIIA 3L41A 1HFKA 2BD0A 1UK7A 3A70A 2P90A 3ZVNA 1CNEA 1H2FA 1U8AA 1E4VA 3K0CA 4UHKA 4H1TA 5CFMA 3AR5A 1BOFA 1WCV1 1JFFA 1Z16A 3FFTA 2AJCA 3OE4A 5CGQB 5DSTA 2RI6A 2AMJA 1AZSC 1MCZA 1W7AA 2CVFA 4Y0VA 5BSTA 3KB6A 2X6TA 4W9NC 1LNQA 5LYJB 2O7RA 4I50A 3MQFA 4ZALA 5K3FA 4G0NA 1PFGA 4DQLA 2P62A 4FD2A 2JGJA 4RJIA 3MA0A 5ALWA 1B1AA 3LPLA 4QJ4A 1ZSVA 1H6CA 2JK0A 1TJ3A 4KPEC 1E8NA 4BNUA 2FZKA 1R0CA 1N9GA 3FE2A 1B6RA 3BREA 3GELA 3U3OA 4HQ6A 4JEUA 5AM2A 1ZN2A 3AC0A 1FLDA 4Z49A 4ZQFA 2WKRA 3Q7QA 3DE1X 3JZIA 1OE0A 4RJ2A 5SYNA 1LWNA 1CP2A 3ZDQA 2HLDD 7REQA 5HJ7A 1G8MA 3CE9A 5H0IA 4RV4A 3EVTA 1QYIA 3RHTA 2Y71A 3VHLB 1W1UA 2HJVA 1GT6A 1GUZA 5FTNA 4C21A 5K6AC 1Y33E 1V1RA 4KH0A 4RTMA 2CFOA 4FYMA 4J75A 5G2OA 5HF9A 4YASA 1OFUX 2MYUA 3QQPA 5MFZA 2SNIE 4RL4A 2K7FA 2UUAB 1YKSA 2E21A 2VHUA 1LZLA 4IRXA 3N2KA 4J7AA 1H94A 3MGBA 3B89A 1H2EA 2DE0X 5F21A 2YRFA 4JVSB 2KB0A 2P1ZA 4IVPA 4NIMA 1N2HA 4XPIB 2QSYA 4GQBA 1B73A 4CM1A 3U61B 4I66A 5IAEA 5AM4A 4D45A 1PJQA 2FDXA 3BD8A 8AT1A 2W2OA 1L6IA 4FE3A 1RKQA 4YJKA 5GP1A 3CB2A 3VAAA 3CJTA 3CW8X 5ALVA 1KO7A 4FGZA 4NZMA 4Y2HA 2QW1A 4Y9UA 5DK4A 1G55A 1C1DB 4Y9RA 3R75A 1ZJ4A 1S2MA 3VNSA 5A7FA 1F17A 4GI1A 5LU9A 2WHEA 3MWGA 4C0BA 2FF7A 3I2HA 1YV9A 4IH1A 4YY3B 1NMXA 1ZVKA 2QM7A 5IT5A 3R9WA 3ZS9A 3KZXA 1HNNA 4EMTA 1GPDG 1YJCA 3HYNA 3BHIA 5DNWA 3E81A 5IT9A 3SKYA 5TGZA 2C1EA 4ZODA 5PNTA 4BVKA 1V41E 4IDDA 5JY6A 4U6SA 4CR8A 3AWDA 4KI7A 5CJJA 1ZA2A 4E08A 3A31A 2OCXA 4P3PA 3FFWA 2Q8QA 2J45A 4OHKA 3AJEA 1V16B 3K1AA 1C9JA 3UM9A 5A03A 3QA9A 1URPA 5JROA 3SZGA 4LQCA 4QJ3A 4PAWA 4TSFA 1A7UA 4XXHA 1XQWA 2Q50A 1GPNA 2PXAA 4FKMA 4QHYA 3S5UA 3NBAA 1NWHA 4JUCA 4OKSA 5LQAA 3CU5A 5IJ0B 5KOJB 3MSCA 4RIHA 4G0MA 4PXSA 1NW8A 2XMQA 2Q3BA 3KYCA 4R5HA 1O6ZA 4WKPA 3WKCA 2B4RO 2O3QA 1ESEA 4NTZA 1HZJA 3R6WA 2C8JA 3JQFC 5TF0A 4UQPA 4JC8A 3JQ7B 4BCDA 5KQSA 4R1TA 3L6EA 3UFXA 4EI2A 5K8UA 5TMDA 1J8MF 2LRHA 3L7LA 4JYPA 2DPXA 4G5HA 1N2IA 1N4DA 2BGJA 5B1DA 2YW2A 5IKMA 4HH4A 3T8YA 2LCIA 4RYDA 3QEKA 1HSZA 3DE7X 2IC5A 4K9LA 4LZPA 1XHEA 2O6LA 4LKRA 3A9WA 2WM3A 3N28A 3BDAA 2FMHA 2J9YB 3B70A 1JS1X 2C3YA 3F7MA 4GUDA 2V6JA 3E9ZA 2CLMB 3MYRA 2JFYA 4U2GA 1ZNZA 3EQ2A 4YROA 4ZCQA 2ISQA 1FQOA 2D06A 1OGJA 2E4VA 3D8UA 1QDEA 1X13A 3EG5A 4EPXA 2PSFA 4WZAE 3H0EA 2WJZB 5CYPA 4X7RA 1Z74A 5DZSA 2AEFA 2CHFA 4RY8A 1TVCA 2EL7A 5K0CA 1ZKDA 2B1IA 2GBLC 4FGLA 2WWFA 3OZ7A 4PX3A 2EKLA 1BC5A 3WY9A 4I46A 3BMNB 2FY8A 1S7GA 4DRZA 1F38A 3ZV3A 4R1QA 1TM3E 1XR3A 4Q9NA 1OAOC 3RBVA 2PKWA 3OF5A 1RE0A 1EK5A 3JW8A 4A8JA 5D6OA 1C1YA 1XXHE 1Z6GA 1O77A 2GCOB 2G5PA 3RS0A 3T35A 2Z8YA 2HWYA 4V39A 1KAOA 3AO0B 4G41A 1JEOA 1UXOA 1G20E 3PA8A 1OREA 1ODKA 2Q6KA 4DEVA 1JB1A 1AXEA 2I7VA 1QGDA 2XWBF 3A7DA 1KMMA 1UMDB 1VCMA 2XRFA 5NULA 4BASA 3ZWWA 5E1OA 4QICA 5FAKA 4CUKA 2IP4A 1EFPA 1NVVQ 2F62A 1IHYA 2XECA 2AQHA 3B6KA 3MWYW 1HT0A 3D2AA 6NULA 4R7ZA 3H6HA 3RYHB 1F2VA 5CT4A 2CWDA 2GKSA 2I9KA 2QN1A 1YB5A 2ZRLA 4ES6A 2F1IA 2W0SA 3TM4A 4RZIA 2VHJA 4BNDA 5M5BA 2JA2A 5AQ1A 2J3KA 2QN7A 2I3BA 3K70B 1BE0A 2I3ZA 4MRSA 2PQ6A 1RHMA 3I72A 2VNKA 3EVDA 2CK3D 5TVKA 4ZO6A 5AT1A 1QHFA 3RADC 4QO7A 1ZK1A 3JYLA 3VR4H 5F5LA 3D0KA 5ESDA 4LPSA 4CM9A 4B8ZA 3H7IA 1WHTA 3Q8MA 3O2NA 1E3DA 4XPZA 3DEYX 1A8QA 2V7VA 1FYWA 4RSGA 3VOAA 4OIFA 3SC2A 5BP7A 5MN6A 4C0LA 1N0VC 5EIWA 4JI1B 4L9RA 4GR4A 5BSWA 4RVSA 5LL6P 1AX9A 3PUXA 4Q1CA 2V8OA 1IVSA 3BPSA 3PC6A 1NQVA 3O03A 4G1CA 4S35A 2QX9A 5JNLA 2QQGA 1XKTA 3IA2A 1ESNA 1G4AE 3ECSA 2UZAA 2O7QA 3L8CA 5GOZA 2RMKA 3RREA 2WF7A 5CFPA 2H63A 2H3HA 5K3OA 2XYPA 1U98A 2ZCUA 4OSEA 1T2EA 4O1IA 5K09A 2VQFB 3E5RA 5KTTA 4Q3CA 4UMVA 2HOQA 2HK6A 1R9JA 3ASVA 1MVOA 3HO8A 2QQ0A 2H4JA 2DXIA 1IM2A 4HLQB 1QU3A 5EP4A 1I1QB 2CY0A 3DQPA 3SLKA 1KC3A 2P69A 1K4MA 2X40A 2XCOA 3BB3A 4FWBA 4DE5A 1Q14A 4U5XA 4OHVA 3TTXA 2ZTHA 1HDYA 1H69A 2WKPA 2I6SA 2PL1A 2EEZA 2IVFA 4E5PA 1EHIA 1JIIA 2QX6A 3H18A 3L8EA 4FBGA 5BYJA 3U49A 3URMA 5B36A 5CM8B 1LV8A 4FE7A 4JJEA 2YDXA 4PQYA 2CLLB 3W05A 3FRHA 5FBRB 1EXNA 3WL4A 3JQAB 2B78A 4OKIA 3RJ9A 2AJ8A 3GGCA 1HT1E 3WWPA 3N0TA 1GQQA 1MDFA 2ZI4A 4FXPA 5D86A 3Q4GA 3RO7A 1B76A 3A1VA 3VNBA 2J30A 2PLWA 2X41A 3QVUA 1I1NA 2KWIA 3HXTA 4R40A 3LUKA 1E62A 1DEOA 4RDHA 2AD1A 1NJ6A 2QGNA 1B00A 1KMCA 4B0PA 5J4KA 3R3UA 1Q19A 1WKVA 1S2NA 1Y7PA 5HS4A 1E58A 5JDIC 3I9JA 2AFIE 4LDQA 1CUCA 1UPBA 1FNMA 3HEMA 3VZCA 1UBKS 3AETB 1WLYA 2I91A 4S2UA 5DBIA 3MERA 2CF5A 1K4KA 3OKCA 4I1RA 3NP7A 4EHJA 4UMEA 1OX4A 5E7JA 5EIAA 4DLTA 1OA0A 5EA2A 1CV2A 4Z0PA 4JJAA 4QGHA 1RI3A 2AN4A 2VYFA 3O3CA 4Y2SA 3V7NA 4DHWA 1EVKA 2WM8A 1T5LA 2YXPX 5TB5A 1CE8B 3I5YA 1V5WA 3NTOA 3PNSA 1IY2A 3NHUA 2FLWA 1D9XA 2YX1A 4P53A 3BAZA 3A28A 1I4TD 1GPYA 1KZ7B 1QRRA 1SOVA 1T1GA 2WFAA 2X5JO 3QJGA 1F12A 4L8LA 3NEJA 3NETA 2BEWA 2A9KA 1U6IA 4FT2A 1Z0UA 4M0MA 4A23A 1XJ0A 4MKFA 3R7NA 1HBJA 2OHVA 2VVTA 3NDRA 5ED0A 3U3JA 1RHRA 5DTJA 3UZUA 4WIAA 1WW8A 1AMUA 2X3FA 3P0FA 2QXTA 1Y0BA 1M1XB 5FORA 4BO4A 4PWYA 2WTNA 4WVLA 3GLGB 2DTEA 4JBYA 2FPPA 3DMTA 1D2HA 5H68A 1AUQA 1JVNA 1JQKA 5F3WB 3COYA 1NDQA 5E9QA 3TOZA 3AYZB 1ECLA 4RAOA 2YJNA 1FMTA 5LZ2A 5AM1A 1N4AA 5B6JA 1MAUA 3DMRA 4Z0NA 3ZEAA 2JBAA 4V02A 2W48A 3DL0A 2B82A 5I5GA 1E2DA 1F0KA 4HWPA 4L22A 2REXB 2XDWA 3FYDA 3HCRA 1Y9EA 1D2GA 2DZDA 4KIUA 2Z5LA 2MJLA 4L51A 2ST1A 3VNAA 2RAFA 1X86B 3FKSA 3IUPA 3OLYA 4RA9A 3J80A 4PHTA 1ZSYA 1QKIA 2FN9A 1NLMA 1P9WA 1INLA 5L3QA 5CAEB 1ZK3A 5HKKA 2HGZA 4NBSA 5JIBA 1U9YA 1P7CA 2TMGA 4H31A 3WMWA 3RWBA 721PA 3TRDA 3T9CA 5KEIA 4JI8B 2BY4A 1N2SA 4GMGA 3ZJUA 3PNLA 5LMNB 1I33A 2D1FA 3ZJYA 3DZGA 3ICQB 2J31A 4BLPA 1DAFA 2E85A 4QOIA 3KKZA 3G9UA 4YCLA 2H08A 5IDXA 3W2GA 2AQ8A 1KU0A 4WK4B 4BKOA 1L8OA 4J0CA 5K8VA 4LW8A 1I30A 4ND8B 2WDZA 3PT5A 3RI3A 1DNPA 4QM7A 2EJUA 3AG5A 4G36A 4IHAA 4M8IA 1G3RA 3HCCA 3GHYA 2JFWA 2R5FA 4Z7JA 3I83A 4YRTA 4EJ0A 2JZNA 3TXYA 2WIJA 3PDIA 1DKPA 2C00A 2B6NA 3Q5DA 4FYKA 4G5FA 1AQ6A 4O4JB 3T1QA 1BGXT 1UFOA 3ON5A 4HAYA 4UNQA 4WNYA 2HQSA 5ECGC 3NHSA 5ILQA 5LLDA 4OP2A 2HMWA 3QKIA 4O4JF 1O8CA 5D7NA 5JATA 1XNGA 2Y6UA 3VOBA 1OH6A 1ORTA 4ZYTA 4F1KA 2IPOA 4K6HA 1P73A 3BXOA 3ER6A 2WSMA 3WYAA 4C87A 4ZEVA 2JLUA 1YZTA 4HGNA 2PKQO 1TTPB 2FB9A 5HRCA 3CLTC 4FX5A 4UQLA 4F86A 3O3MB 1WQ4A 5AOBA 1ZVJA 3MD9A 2WB2A 2D3TA 1MA0A 2X1LA 1N7HA 5JMWA 1CZRA 3CUUA 5LBIA 2BFAA 4LZOA 3NEPX 3RSQA 1SOWA 3GJQA 4R9RA 3DAFA 3TR6A 1Q1GA 1FVOA 3V3TA 5HA5A 1DJPA 1GNPA 3C97A 3I3OA 3F8SA 4LYAA 4B47A 4LBWA 3AR8A 1SG6A 1T9BA 3NBMA 3PNMA 1QS0A 1Z6ZA 1B0UA 3GLHA 2UVDA 3L0ZA 3KTAB 3JY6A 5HF5A 3I30X 3UWSA 4TOIA 4BQFA 5T67A 2J0UB 1Q7RA 3C87A 3ZNOA 1KJNA 2FSFA 3CG0A 1C1HA 1X2BA 1Y4DE 2FMFA 1P0IA 3N87A 2GHRA 4PBTA 4RLQA 3T4UA 3BKWA 4JB3A 3T9DA 3V4SA 1E69A 1T2NA 2GJ8A 4TVBA 1BHO1 3DE3X 2WBLC 5IW8A 4QDJA 2XTNA 1COZA 3KS9A 3PEVA 4H1VA 4CG1A 4TTIA 3RS8A 5D8DA 2OWDA 1NU6A 2IQIA 2QLBA 4W9MC 2PQMA 4JIGA 4LCJA 1NDUA 2OHIA 4G1BA 3BJRA 1YU9A 3EOAI 2W98A 3GEEA 3KKMA 4X91A 1F8GA 5EHNA 4C4PA 4W5TA 1CCWA 4PX9A 1KBZA 2VPPA 2YOHA 2HRCA 1NZFA 3AQIA 1WULS 3B82A 3BCRA 2PH3A 3R6DA 1DT5A 2YQZA 4CWAA 1MQ8B 3NYWA 1CJMA 1WKBA 3K0EA 3F47A 4G2NA 1DTWB 1JPJA 1C50A 4MHOA 1PFKA 3PQ7A 1DCTA 1PJ2A 4FYIA 2YFKA 4G63A 4ENTA 4KR2A 1RMYA 2CDNA 1DCFA 1TRHA 3QVSA 1EFTA 5IBPA 3OICA 3N2EA 3VR2D 3Q7TA 3PXBA 4HGZA 1R6DA 2W11A 3OKFA 2X8BA 4EA6A 3FPGA 1K3FA 3H1AA 4REMA 3P9CA 1CUVA 4UOZA 2IY8A 1YE3A 3QVOA 5DM60 3IESA 5JBQA 2QVCA 1NF3A 3C7DB 3O1LA 4I5FA 3E05A 1A72A 1D1PA 1W0KA 1REQB 4I4TB 3ZIUA 4H16A 5KYXB 1VBKA 2DHQA 3T5CA 3LC7O 3WNZA 5AJZA 1WEKA 1C4WA 4PV7A 1TOAA 4UUMA 1OKKD 2ZJ5A 3TEJA 3OT4A 3H2ZA 4DPKA 3IOMA 5CDSA 3IEKA 3ZEIA 4UJ5A 3PQ3A 2A88A 1NKTA 1NYRA 3BGWA 3QUQA 1L5HA 1E6LA 3RB8A 1XKQA 1P5HA 2MSDB 1UR5A 3LBFA 3QWIA 1SQSA 4JC0A 1XIVA 4CEHA 4MHTA 2OPHA 4MR7A 3LT2A 3RK4A 2RHBA 1NM5A 1Y1TA 1Z6AA 4OIMA 2MCFA 3GLFA 3FLBA 4QPZA 4Y30A 5CNIA 4AO6A 4YAIA 2GZMA 4KFTA 3T5TA 1TADA 1U3CA 3CNLA 2ERYA 1RI4A 1BWPA 4L78A 5CR9A 5THXA 3U26A 5KNCD 3GBSA 1TK3A 1WZUA 5BN5A 3MTAA 2QUKA 5H82A 1Z07A 2HSWA 1T4MA 4BVBA 5MGBA 4BQNA 2XXJA 4RF4A 1KMNA 3QKSB 1J8DA 4FYWA 4K6MA 4MV1A 3RS2A 4BFYA 3D0QA 3MK31 1QGOA 1XALA 1QIGA 4GICA 1A0OA 2AOUA 4CXMA 4NK4A 1FVFA 2BFBA 3WK8A 3LAWA 1AUPA 4GLLA 1WRBA 1K5GA 2AOTA 3NLLA 5FRDA 4AS2A 1P91A 4BNJA 4B3DA 4RF5A 3WX0A 1V5IA 1QAOA 2G5GX 1O4VA 1XD2B 2C2KA 3FPKA 3IV7A 1T24A 3NBFA 5JTUA 3GD5A 3EZ9A 4K3VA 1P17A 2H7YA 1U9ZA 3LECA 2QRHA 1A8IA 3MQ4A 1A97A 1YIDA 2E4ZA 3Q7PA 2IYWA 5G1PA 4CDGA 4B3SB 1LBHA 4CL8A 3I6ZA 2Q5JA 2EX4A 1Z2NX 3WIBA 3QIVA 4AAYA 1CJVC 4ND2A 1TU0A 1ONPA 4Y98A 3KQUA 4K6GA 2O1EA 1Q0ZA 2XKAA 2XTMA 4OYYA 1QF6A 1DL5A 4KDFA 4UKDA 1E5TA 1UQTA 5EC8A 3LXMA 3TLBA 4GNRA 2V74B 4S12A 5DYTA 3VH1A 4DLXA 1MZPA 5IXYA 1EVJA 1P2TA 1JQLB 3DWFA 2FG6C 3AT1A 2ZYRA 5SY6A 3JYQA 4EG5A 3IBTA 1LF5A 1XVUA 3GMDA 3OU7A 4OXQA 1RLIA 1YQDA 1PD0A 1GCGA 2CHUA 1M8KA 3G5AA 3UFBA 2WHXA 1RYEA 3QFRA 1U3UA 4OAQA 2OXRA 5D51S 3W2IA 2KW5A 1CD5A 4CMEA 3PX7A 1L8QA 5B1SA 1WBJB 4TUYA 3E3NA 1VGQA 7ADHA 1LNZA 1E1QD 4Q02A 1SA0B 3EVCA 3K5PA 1YB6A 2IPAB 3QX9A 4HXFB 4RD0A 5F3RA 5EJ4A 4BFLA 3MLEA 4RE5A 1FUEA 3BFKA 3QM1A 4CL0A 4YRFA 1NFFA 1OIXA 3T12A 2NUTA 1XRJA 4FEYA 3V2HA 3ENVA 1GV0A 1XJWA 3L4EA 1WKCA 3P2KA 2UUPA 1R16A 1E2EA 2F90A 3P9QA 4MEJA 4RHFA 4RMIA 4C0AC 5C35A 1J8QA 2ON6A 4RY2A 4NPHA 1VMIA 2UVQA 5FJJA 4RCYA 5BR7A 3CO5A 4BXOB 3I3SR 1MOQA 3A2NA 3L02A 4UBOA 5JCXA 1ILEA 1NRWA 2G9QA 4GPZA 4M2LA 4LSMA 4JELA 5LD2C 1UZLA 2ZEJA 2Y9MB 5GONB 5DULA 1TK9A 3EXIB 4LSZA 3HB5X 3ZE1B 2QAGB 2ZR0A 5HRAA 3AZPA 4D25A 2WSBA 1O6FA 4BU0A 1GUAA 2HKIA 3PFHA 5GONF 3M6UA 1IOVA 1K7CA 1SCIA 3IQIX 1NY6A 2JFUA 2QX4A 2J5XA 2ZR7A 1YSCA 2K5UA 3PF8A 4P34A 1IONA 3NRBA 3DDWA 2A5YB 3GPLA 1X42A 2E82A 4AQYB 3SSMA 1IXYA 2CNWA 2QTFA 3IOYA 1Y8RB 2IDKA 3W8DA 1C8KA 4L74A 3WISA 2FKAA 3DLPX 2C7PA 1YZKA 2P2GA 4V0QA 2V59A 4HDNA 1ZC4A 3V1KA 3G0CA 3PWKA 2EJVA 5HILA 3WG9A 4BYGA 1IVYA 4GUAA 3IULA 2FGKA 2H2GA 3IAS6 2NUAA 3B1YA 3OX4A 4IX9A 4O2AA 4UE6A 3OE7D 1BKYA 1WDMA 3ZZUA 4EEKA 2E4XA 4B3GA 3DFFA 1AB5A 3QF7A 5KJFA 2JIDA 3K5HA 4A2WA 4R54A 3WLLA 3CC8A 2FETA 2WG2A 5KOIA 3K9NA 1X77A 3BCHA 3LMKA 1NXQA 4I14A