4UHFA

Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
278
structure length
278
Chain Sequence
b'AQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELCDEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKENRRRVAERVRREGPGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGHLPPMEQPERVTQAIREWLRKVHTEAGHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
molecule tags Hydrolase
source organism Planctomycetes bacterium r1
publication title Structural Studies of a Thermophilic Esterase from a New Planctomycetes Species, Thermogutta Terrifontis.
pubmed doi rcsb
total genus 107
structure length 278
sequence length 278
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhfA00
3LLCA 3CN7A 3DD5A 4AO8A 3R3WA 3VKFA 3WKAA 4DNQA 4BAGA 3ZWQA 3JYHA 1DQYA 1TKRA 1CEXA 4LXGA 5IVIA 3IIIA 3BWXA 3R41A 2J3QA 4UHDA 3QPCA 2WJ3A 5BOVA 4H7HA 4UHFA 2XMQA 1DX4A 4UBJA 1BCRA 5AH0A 1XRPA 4ITVA 1U4NA 5K3BA 3RLIA 4BZZA 5HZGA 4W1SA 1W75A 1YAJA 1CRLA 2WJ6A 3QMWA 1UOQA 3BIXA 4JYPA 2ZJ7A 3WK7A 3WKEA 3G0GA 5HF8A 5K3DA 1ZD3A 2HU7A 3V48A 2XT0A 5A62A 1CUXA 4L0CA 4HRXA 1D07A 4KE7A 3YASA 4AX4A 4OYLA 1U2EA 5HFAA 1DT5A 4GW3A 5K5EA 1XQXA 1AKNA 5HQ3A 5IKXA 3VVLA 3U1TA 4H18A 1CUHA 6YASA 1CUZA 4PSDA 2OAGA 4B0OA 1XKTA 2DSNA 1LPMA 3DLTA 3ZV7A 2WU3A 2GBCA 5I9IA 5KBYA 1UK7A 4GXNA 3I1YA 4DLNA 4GI1A 1CUAA 1H2WA 4FFWA 4P92A 3H2GA 2XQJA 1VE7A 4KE6A 2OQVA 1H2ZA 3WWDA 1GT6A 4L9AA 3WQHA 5HK8A 4E14A 3ANSA 1UK9A 4G4GA 1CUUA 3CXUA 1GPLA 1YA8A 1UKCA 2WUFA 1UFOA 4IH9A 1P0MA 4UBOA 1IZ8A 1CUFA 4FNGA 5JAHA 1QIMA 5AI5A 5JD4A 5HFNA 3WWEA 1NX9A 4K6GA 1TCBA 2QJRA 1TRHA 2JBWA 4J7AA 2JIDA 1ZOIA 3R0VA 1XZMA 4HXEB 4XX1A 1UK8A 4AXBA 5JASA 3EF3A 1ZICA 3IUQA 4BATA 1R88A 3X3HA 4MQLA 2AJCA 3B5EA 1XRNA 5A7GA 4XVCA 5ALUA 3WWOA 1W52X 3DKKA 1BN7A 1K5PA 4Y2VA 4HXGA 4DNPA 4TPKA 4X71A 2PU5A 2C5GA 4H7KA 1EDEA 1N5RA 1QGED 1WB4A 4GECA 2I3DA 1DINA 5CTAA 3W05A 4I4CA 5CURA 5E4TA 4Q34A 4BP9A 2JEZA 2Z8XA 2HL6A 2RGUA 4PO3X 2XMBA 4AN0A 5ALGA 4MWTA 5ALVA 4WCVA 3GBSA 3C8DA 3SK0A 3H2KA 1YAHA 4FWBA 3OG9A 2OG1A 4PW0A 2QJWA 2XMRA 4QWWA 3STVA 2EDCA 1QTRA 4FTWA 1K63A 4WJLA 1J06A 2E3JA 2EEPA 5JD5A 1EI9A 5AHXA 4V2IA 5I8PA 4E46A 1EX9A 3O4GA 4G8BA 3RARA 1XQWA 4MYDA 3F67A 1VLQA 5ALTA 3O0DA 4FKBA 5DNWA 5SYMA 1YASA 5LP1A 4WFIA 1AMNA 2AJDA 4MWSA 3I6ZA 3PF8A 1E66A 4PNZA 4UBKA 1ZI8A 5LLSA 1AGYA 3R3ZA 5ALDA 1GGVA 1OILA 3TGLA 3UUFA 4B81A 1ZIYA 4X6YA 1GQRA 3Q8WA 5FV4A 4QLAA 3HSSA 2BGNA 2OQIA 3W06A 4DMFA 4MJ3A 2IITA 4G8DA 2YYSA 5DYWA 2I3ZA 4ROTA 4K6KA 4FBLA 3WKDA 1Y7HA 3O4IA 5AP9A 4LXHA 2B4KA 4QEKA 5T4EA 4ARAA 5LZ8A 3B12A 1H2XA 2ROQA 1BROA 1EVEA 2V96A 3WK6A 4BC1A 3I2KA 3ESAA 5DJ5A 1E8DA 3FOBA 3DDUA 4ZGBA 3B3QA 4QDXA 4FHZA 2LIPA 1Q84A 3D2CA 2QVBA 5K3FA 1UT6A 2Y2VA 5ALJA 5CXXA 4X97A 4FNMA 3NUZA 3BIWA 4ZXFA 3VJMA 1XZHA 2R11A 2QXTA 5E2IA 2CKMA 3PICA 3QITA 3GUUA 4CI9A 4G4IA 5FPPA 1B41A 5ALEA 4Z49A 1QIJA 3N2ZB 4DMKA 5FPQA 2JGFA 2JF0A 3HJUA 4G9GA 3HZOA 4GBGA 1FFCA 4GEGA 5AKLA 5DYYA 1XLWA 5AOCA 4PSUA 4W63A 2WSLA 1AX9A 5A7FA 1VZ3A 4OB6A 1F8UA 1NU6A 1LPAB 1TAHA 3A6ZA 2HA3A 3WJ2A 5JZBA 1BCSA 3H0CA 5HKAA 1E8NA 1ODSA 1ZD2P 4U2DA 4F21A 2QKYA 4JYMA 5HKBA 1SCQA 2OXEA 3CCBA 5FXMA 2QOEA 5DWDA 5FKJA 1LPPA 3A2NA 3WK5A 2W22A 3C5WP 1TCCA 1K4YA 1CUCA 3O9MA 5AK6A 2WG0A 1QLWA 3A2LA 2CEKA 1VXOA 3GFFA 2DFPA 4XWGA 2XLCA 1CFJA 5EFZA 1CUSA 4QA9A 1EINA 4X6XA 1H2YA 4GDMA 3C6BA 2WHQA 3M81A 4CCYB 3FLBA 3W2TA 2WIJA 3JWEA 2AXEA 2WUDA 2Z3ZA 1X2EA 2HIHA 3GELA 5LZ7A 3EQ8A 4IHAA 2ORYA 2QRUA 3VXKA 2ECFA 4RE6A 2XUHA 2XUGA 3H19A 1ZIXA 4OU5A 3PFCA 3G02A 3WL6A 1EHYA 2BCEA 4BTVA 5JAUA 2Y6UA 1Q0ZA 1L7AA 2O2GA 1DQZA 4OSEA 5DLPA 4X95A 2OLEA 5AOBA 3G8YA 4ARBA 4J0CA 1FFEA 5K3CA 4DYHA 2HFJA 3GROA 2RAUA 4UBMA 5FRDA 4BAZA 3AFIA 2QM0A 1YR2A 3FCYA 2H7XA 1DT3A 3K2IA 1T2NA 4Y2UA 4C4XA 1P0PA 4U2GA 1DWQA 3WMRA 4FLFA 3HYSA 4Y2SA 4FLEA 4G4JA 4H7EA 3A2MA 1HDEA 1ZGBA 3VISA 2OGSA 2VJDA 5HCUA 5D3ZA 5AKXA 2B20A 4BBZA 5JYCA 3DYIA 4UHEA 1BRTA 5EIAA 2V9ZA 2PPLA 5JZSA 4EY7A 1N1MA 2XB6A 5AM3A 2OAEA 5CT8A 3L1HA 4PSCA 2WFMA 3AUKA 3WIOA 2WU4A 3MGAA 1C4XA 4H7DA 3ZLTA 3FNBA 4B0PA 3QVMA 2FJPA 1QIHA 2G5PA 4I19A 3ZPXA 1QFMA 3WKCA 2QXUA 1ZD5A 1CUGA 1UOOA 2CJPA 3DJYA 3WK9A 4HAIA 4M0EA 4B7ZA 3EBLA 1XLVA 2PBLA 4N8EA 2CBGA 2RHWA 1Q83A 5EIHA 3ESDA 5IVKA 2XUPA 4P08A 1N5MA 1LZLA 3QMMA 1KU0A 5A71A 3GA7A 2DHDA 4X6UA 2EDAA 4X7BA 2XI4A 3R3XA 2O7RA 4BE9A 2WUGA 2HU5A 1XFDA 4KE9A 2B61A 2XMDA 3QMVA 4LHEA 3SX4A 2RI6A 3HXKA 3TRDA 4UHHA 3BJRA 1IUNA 5IVHA 2HADA 5EHXA 3AILA 1ZJ4A 5A2GA 4K5QA 4RGYA 4UHCA 4BVKA 5K3AA 1ETHA 5AM0A 1CUJA 2D5LA 5HQ3B 3I2FA 5DNUA 4F60A 4N8SA 5D3KA 4FFVA 4BAUA 1CUYA 4WY8A 1HQDA 2HU8A 5FDFA 2DQZA 4ZREA 4A5SA 3STYA 5FP0A 4AO6A 2BJHA 3WA6A 4G5XA 1XQVA 1WPRA 1UKBA 2XQFA 4ZV9A 4E15A 3FSGA 4BB0A 4L72A 1W4LA 1TQHA 4CIAA 1SC9A 3BDIA 1MX5A 4QE3A 4Y2RA 3FWHA 3IURA 3PUHA 4MEAA 4C4YA 3DOIA 1R9NA 4Q3LA 5DYTA 2WHPA 3DCNA 3LS2A 4IH4A 1ORVA 3C87A 4C4ZA 5JADA 3STUA 4J0IA 1A88A 2GYVA 1F6WA 4BVLA 2J4FA 1A8SA 1QO9A 2DCMA 4QLOA 3RM3A 2WTMA 4H7IA 1WB6A 2ZSIA 3WZLA 3EQ9A 2DR0A 1EK2A 2BUCA 1HPLA 3WK8A 1J1IA 3T4UA 4CCWA 5BWCA 1EB9A 2WIDA 3VJKA 5AICA 4WFKA 3EIOA 2HA2A 1XZFA 2OGZA 1CVLA 4AMYA 1XKLA 1SCKA 3SC2A 4W9RA 5C8VA 1LZKA 4TVKA 1SOMA 3G0CA 2HDWA 4N5IX 1XZKA 5JAOA 2Z8ZA 1UZAA 1XLUA 3E4DA 2OGTA 2XMZA 2IIVA 3I2HA 5EHQA 1YS1X 1ODTC 1VJ5A 4CG2A 4U2CA 4WFJA 1VE6A 2VATA 2JGKA 4I3FA 3RKSA 2OCLA 4QDUA 2WFLB 1PJAA 1WCYA 3FYUB 1T4MA 3KXPA 3FLAA 4UBLA 3O4JA 2HA7A 1CPYA 4LIPD 1CIJA 2QR5A 4F0JA 3U0VA 3H1BA 1LLFA 3OPMA 3PDCA 2BAGA 1W6RA 5ALQA 2GYUA 1R50A 5AKGA 4Q3OA 5CBKA 1JU4A 3AINA 4YASA 5LIPA 2HRQA 4FBMA 3F9CA 1Q0RA 4FLMA 5JIBA 2GBIA 5CT6A 5ALRA 1MNAA 4MXDA 4XIIA 2Y6VA 4Y7DA 1JMYA 3CN9A 3C8HA 4H7FA 3C6XA 4LKOA 4J0DA 2IX9A 4X91A 4H35A 3BDVA 3FBWA 1P0QA 2O7VA 4QDTA 1WHSA 1JJBA 2JGMA 4GHWA 3MUOA 3BE8A 4C88A 2XUIA 5JANA 2WM2A 4GWLA 1K6EA 1R3DA 3Q0TA 3WIBA 3WA7A 3H1AA 2DHEA 2Z5GA 1EB8A 4CG1A 5ALFA 5LZ4A 1R1DA 4A23A 4EA6A 4X00A 1XZIA 4KRXA 2WUEA 1HLGA 3C70A 3OTQA 4UPDA 5T4HA 1EXWA 1QONA 1XRQA 1UK6A 4RNCA 1VKHA 7YASA 2XMGA 1EDDA 3T52A 3WZMA 2HFKA 3ICVA 2YH2A 3NWOA 1X2BA 4BCCA 5CRIA 2PVSA 4G1FA 4IQ4A 2WJ4A 1THGA 2XQKA 4B9EA 1W76A 2QZPA 2X8BA 4OYYA 4M0FA 1X70A 5KWJA 2WLSA 4BRZA 5LYYA 1WPXA 4KE8A 1J2EA 4KEAA 4B84A 2R8BA 1HKHA 2G4LA 2H1IA 1BU8A 4B82A 5CH3A 1JJFA 1KEZA 1CUIA 1E89A 1EA5A 5EIEA 3G9XA 1QZ3A 3VJLA 5HF9A 3D2BA 3G0BA 3V1NA 3PF9A 1J07A 4Y2XA 3V1LA 2VEOA 4QZVA 3QH4A 1RYYA 2H7YA 4X3CA 4INZA 4KRYA 1ORWA 4BDSA 1YS2X 2QTBA 5ALZA 2JEYA 1XZCA 3IULA 3G9TA 5CW2A 3M82A 5AK4A 3SWWA 1OCEA 4BTLA 3DOHA 5AI6A 1U65A 2ES4A 3C5VA 3BXPA 5AKZA 5ALWA 5AM2A 2JGEA 2XUJA 5ISMA 5SYNA 2VJBA 5ALOA 4J0JA 1DTEA 3FCXA 4EY8A 2V98A 2Y2UA 1GXSA 2GBGA 5HF6A 4YK7A 4Y2PA 1G4HA 2OPHA 1IUPA 3V1MA 3TEJA 2P8SA 3OURA 4OB8A 3D5EA 3MUNA 3N0TA 3AIMA 1QFSA 1MPXA 3DNMA 1MNQA 1IMJA 1QIDA 5IVDA 2ZYRA 1YSCA 1AURA 3AIKA 1H22A 4U2BA 4BZWA 2PU7A 4N8DA 5AK3A 1A7UA 1RWQA 5AIAA 4EY4A 3H18A 2G5TA 2ZVDA 5DTJA 4OD0A 5LZ2A 4Q1VA 3D2AA 5ALPA 2WIGA 2ZYSA 4KAJA 4KAFA 2ZSHA 2QT9A 1GKLA 3H17A 1LPNA 3QPDA 5C8XA 2CB9A 3BL8A 3G9ZA 5FOQA 1CUDA 1JI3A 4UBIA 1CUBA 2WKWA 1GKKA 4E11A 5AI8A 1QIIA 3IVMA 4AB1A 2HM7A 4C01A 2HA5A 5ESRA 1GZ7A 4O08A 2O2HA 2RIPA 3H2IA 1XRLA 4H77A 5E4YA 2XUAA 1MU0A 4OUKX 1USWA 4N5HX 2GYWA 4MEBA 2DQYA 4KACA 3KDAA 5DNVA 1VA4A 4DNFA 4BYMA 4B83A 5HK9A 1H23A 2UZ0A 3W9BA 4AO7A 5FLKA 2PUHA 4FDMA 5AI0A 1JU3A 5IH7A 3F97A 1CLEA 2WQZA 4K2AA 5AKYA 2PL5A 4JUIA 2OCIA 1IUOA 2VJCA 3E3AA 1SCIA 3QM1A 4H7JA 5CT9A 1YB7A 1LBTA 4B85A 5T4FA 4DSZA 2BUBA 3G9UA 1Y37A 1CUVA 3EQ7A 1BE0A 2QS9A 3HC7A 5D7BA 3I2IA 3LIIA 4CIBA 1EH5A 1JJIA 2GZSA 2C58A 2BUAA 3KD2A 4AZ3A 1MAAA 5CT4A 4P93A 5AKJA 1ACJA 5ALLA 1W1IA 4Y2YA 2VAVA 1XZJA 5YASA 5JARA 5ALKA 1L7RA 4H0CA 1XROA 3HACA 5A6VA 2GBFA 3K9BA 2WHRA 3W9UA 1EDBA 4UHBA 5EHZA 2AJ8A 5DTIA 2FJ0A 4HVTA 1CQWA 3R3YA 4J0GA 2XMSA 1PV1A 3PE6A 3WKBA 1ZI6A 2PSEA 3AJAA 3STXA 3UUEA 1WB5A 4ZWNA 3WL8A 3R3UA 2VA9A 5CH8A 5JALA 2I03A 4FOLA 4QDOA 3G0IA 5ALMA 5KREA 1ZD4A 4UBNA 4X94A 2YXPX 4KAAA 5FUMA 1DWOA 3KOOA 5I7UA 3HI4A 3LCRA 4FMPA 3NOXA 3WLAA 2XQIA 2PSJA 2QUAA 2ACEA 2J4CA 2V97A 5JATA 1UXOA 3FSGD 4PF1A 2WIKA 3KWFA 1AUOA 5AO9A 5CMLA 2XMCA 3BF8A 4G9EA 5JZ9A 1ZGCA 4QWMA 4Y9SA 1OXMA 3A70A 4G8CA 1U8EA 4HS9A 4QDZA 4CG3A 3WWCA 2ZJ6A 3WYNA 2B9VA 3PI6A 3HRHA 4NS4A 2VQ6A 4DMHA 3KWJA 1WHTA 3F96A 3AIOA 3ESBA 2GZRA 2C7BA 3OOSA 4X93A 2FX5A 2WFZA 3NGMA 3G0DA 5KWIA 3BF7A 4GLBA 1BEEA 1DWPA 1XZAA 4LYDA 3LIPA 2HRRA 3DS8A 3FYUC 2PSHA 3D3NA 4WDQA 5C81A 1G66A 3FYUA 5K3FB 2WFLA 3FLEA 4C89A 2XUDA 4HTAA 1E3QA 4PQEA 4C87A 4S0XA 4AQDA 1MT3A 2Q0XA 4BCBA 1L7QA 3C45A 4LXIA 1SFRA 3AZPA 5JAPA 1QOZA 4ZI5A 3MVEA 3F8SA 4DMCA 2ZYIA 1XRMA 2H7CA 2XQGA 1GPNA 3G7NA 2WG2A 1VOTA 2H9YA 3WYDA 4B80A 1MX9A 2VAXA 1EK1A 3H04A 2PSDA 5HF5A 5K3EA 1QTIA 3I28A 2W6CX 1P0IA 3D7RA 2K2QB 1XQYA 3FVTA 2O2IA 4D9JA 5LKRA 5AKIA 2XUFA 1FFAA 4X92A 1VZ2A 3FYTA 4J3JA 2NW6A 3R3VA 2C0PA 5LZ9A 3WJ1A 1KU6A 2JGIA 1BS9A 1A8QA 1HL7A 1JKMA 4JEIA 1Y7IA 1UOPA 1ZJ5A 3FVRA 3E0XA 2ZYHA 4UFNA 3OC0A 3ZLVA 2VT6A 2VT7A 3STWA 1M33A 4CFSA 4RPCA 4U2FA 2CMFA 3V1KA 3IUMA 1UKAA 1TCAA 2WHPB 4EY6A 5CXUA 2BFNA 3STTA 1VXRA 3W04A 4DNOA 2G63A 4XJVA 4DM7A 2AJLI 3I1IA 4QNNA 1FJ2A 3I6MA 4UFOA 4EZIA 1NU8A 3DL4A 3PUIA 3IUNA 4BDTA 1IVYA 1IZ7A 3CCCA 4OCZA 1LGYA 1QIFA 1QIGA 1ZI9A 4P9NA 1ODCA 1XZDA 1F0NA 1RP1A 5C8ZA 4OB7A 4UFPA 2C0QA 3QBJA 4L3WA 5AKHA 2JGLA 1PFQA 3UMJA 1XZLA 1AQLA 1BEZA 1LBSA 2XLBA 4J0HA 3H2JA 5AI9A 1CUEA 3WI7A 2JGJA 2BGRA 5ALIA 2AJBA 4BP8A 1QE3A 4Q3KA 2HA4A 1MAHA 1XZBA 3DQZA 1BN6A 2PX6A 5BWBA 3WK4A 2QUBA 1MX1A 4ETWA 1MN6A 1LPBB 2FUKA 3LP5A 3L1JA 2BKLA 5LZ5A 4Y2JA 4F5ZA 3C6ZA 2C4HA 5ALSA 2DHCA 4EB0A 4BC0A 5AM1A 4W1PA 4DTCA 3WL7A 1I6WA 1YB6A 4NVRA 1AC5A 1QIKA 1R9MA 5E4JA 5EGNA 2PM8A 2XE4A 4MQMA 1C7JA 4YX9A 1THTA 4M0MA 4X85A 3ICWA 2WG1A 5ALHA 5AI4A 1AZWA 3DKRA 3K6KA 4EHBA 4W1QA 4WY5A 1XZEA 4AZ0A 4B6GA 5AKEA 1XZGA 4BVJA 5J3JA 4KR0A 4OPMA 4MYSA 4BE4A 1YCDA 1ACLA 3M3DA 1LNSA 2RHTA 2WILA 4OU4A 3VDXA 3V9AA 2VJAA 3AZOA 1QIEA 4ZV7A 1EVQA 1YA4A 5LKAA 1E8MA 4Q82A 1MO2A 2CUTA 2XUQA 1LPOA 4DIUA 3HEAA 1CUWA 4A16A 3PFBA 2RONA 2Z3WA 4AN1A 3QZUA 4JH0A 4YPVA 2J3DA 3IDAA 1QJ4A 5AJHA 3WL5A 4DGQA 3OM8A 1DU4A 2XUKA 5AIBA 1XRRA 4X90A 5AKKA 2I78A 4AMZA 1ISPA 4IO0A 3ANTA 1HBJA 4NMWA 1FSSA 1G5FA 3IUJA 1MJ5A 5D6OA 5H3HA 5ALNA 3S8YA 4CCYA 1CR6A 3D59A 1DX6A 4KJXA 3QPAA 5AM5A 4EBBA 1R4ZA 2YASA 1K8QA 1O6GA 1GQSA 3L1IA 3RK4A 3S2ZA 3D0KA 1F0PA 1CQZA 3DL7A 3FAKA 2WTNA 3ZLUA 4Q05A 2HA0A 4HZGA 3QYJA 1O6FA 2ACKA 3D4LA 4NZZA 3TJMA 2VF2A 4U2EA 4Y2QA 1TIBA 5A7HA 3I2JA 1S8OA 2WIFA 5ALXA 5JD6A 4HXFB 1FFDA 1N8SA 3JW8A 5CT5A 3M83A 1JFRA 2QMQA 5EI5A 3IA2A 3IB3A 1QO7A 1GPKA 3HABA 2XUOA 1WM1A 3ESCA 3ILSA 3O9VA 2ONCA 2PSFA 5EHNA 3ED1A 2VSQA 4PV7A 2VTVA 1WOMA 2X5XA 4UUQA 5F4ZA 3C6YA 3GZJA 4TGLA 1JMKC 5AK5A 3E1GA 2ZJFA 1A8UA 4J0KA 4HRYA 4EY5A 4Y2TA 4B9AA 4BCDA 3C43A 4K6HA 3HLKA 4W1RA 2CZQA 2OCKA 4IH1A 1TK3A 4ZRDA 3VVMA 4C6HA 2X76A 3O4HA 1LPSA 1UWCA 5CH5A 2PUJA 5AM4A 1C7IA 3R40A 5ALYA 1MTZA 3DEAA 2XDWA 3IBTA 5T4BA 1JT2A 3H2HA 1CV2A 3DYVA 4BRSA 4J03A 1FFBA 1B6GA 4KYVA 2C5FA 5AOAA 3WWPA 5C7YA 1G42A 1Z68A 4JNCA 3I6YA 3KSRA 1E5TA 3P2MA 5BV7A 4RE5A 2HA6A 3F98A 3ZI7A 4DSAA 3O95A 4EUSA 3I2GA 3AZQA 1VA5A 4WDRA 2PKYX 2Y1KA 4LYEA 2OCGA 2HHAA 3BJMA 2D0DA
chains in the Genus database with same CATH superfamily
2EFEB 2GB4A 5GV7A 3BFJA 3U60B 4LWPA 3WRXA 4HYQA 2BRUC 3ZD9A 2ZB8A 1DBIA 4JS0A 4YH1A 3DD5A 1XNJA 1UFKA 1PI3A 2NAFA 3DVLA 1SQFA 4YVFA 4B3FX 4ACBA 3QLJA 4NRDA 1PVOA 3ZHYA 3L02A 3AEXA 3BQMB 1MD9A 4U39A 1AB6A 2FE1A 4B40A 3SQWA 1ADBA 3ADKA 3TBFA 1BJKA 2E1PA 1QZUA 4ONEA 3FOWA 2M32A 1PT6A 2GCEA 3FPSA 4LXGA 1SU8A 3U2QA 2RGBA 3BMOA 2RDMA 1TNDA 2G09A 3BIOA 3IRVA 3QPCA 1Z82A 4R3NA 1CJMA 4OL0A 4XUDA 4EW2A 2G40A 5KNCH 2EIHA 2ORED 4PAWA 1DC4A 4KSCA 3SLGA 4PZDA 5JI3E 2BR4A 1NF8A 2W6QA 3G2PA 2HTEA 4IRXA 4KYUA 3EODA 3TMYA 2IUYA 4RF3A 4F5ZA 1U4NA 5K3BA 3RLIA 5HS6A 4RKWA 5HZGA 3HDTA 1FYFA 2VJOA 3NM5A 2YYZA 3FDZB 2Q7XA 1RHMA 3PC7A 4NBTA 5CCBA 3TH5A 1UBSB 2VDKB 2VK8A 1SWWA 1Q7GA 3EC7A 1UOQA 2AT1A 5DX1A 5F5LA 1AG9A 1P2TA 3H11B 1MG5A 1WXDA 5KZMB 4X5OA 3UH0A 4FGJA 1CIPA 4JYPA 4FZ3A 2P9EA 1AZLA 121PA 1H8HA 1RFLA 3LYHA 4W7HA 3H5WA 3L40A 2G67A 4HQRA 1NL3A 3G0GA 1IDN1 5HF8A 5K3DA 4F5WA 5HNKA 4IVQA 1KBQA 4FKMA 3ASYA 4N5DA 1DCKA 5MGNA 5EKUA 4ZARA 3SYKA 4A8JB 5J58A 4CTMA 1WZCA 3A6GA 1JYSA 3F78A 2QN7A 1HDIA 1QHYA 2PX8A 4D4HA 2V1XA 4FEGA 4B7AA 3V1UA 1UPAA 3CG0A 3I09A 4KE7A 5JWOA 3LL4A 3CF2A 4AWAA 1EUQA 1L4EA 2ZFUA 4AX4A 5FQOA 2JHAA 2R1VB 3AFOA 2C7QA 3QHQA 2N9UA 3UN1A 4IGIA 5HFAA 5GJWC 2YXLA 1G63A 4U7JA 4EQ6B 1EWRA 4GW3A 2JFFA 1PDOA 4BIMA 1JXOA 1XQXA 4ZYTA 5TXGA 4J1TC 3TQHA 2A9KA 4IRUB 3I12A 2YXEA 1QHFA 1D9XA 2CVHA 4OXXA 5HQ3A 1DDGA 1JLSA 1GKIA 1SKBA 1L4KA 1HM5A 1UXIA 1U7HA 3DLAA 3P32A 1K5GA 4J1TA 3RIYA 4AJOA 4DR5B 3GJ3A 1Q7CA 4URVR 3UOWA 4BNTA 3LTNC 1DQRA 6YASA 2G25A 3PZBA 4JV5B 1KDYA 1T5HX 2IZZA 1IHUA 3SMVA 2ZB3A 3NBQA 1NNEA 3E61A 4TKVA 3DLTA 5LD2B 2X1VA 1B76A 4OSOA 5EN4A 4BGDA 3ZJ5A 2WU3A 4F1KA 3F6SA 1IRIA 3NHPA 1N3LA 3DO6A 3MWDA 3DEIA 3GP8A 4FZVA 2E48A 2FP3A 1JPNA 4KP7A 3A6FA 3IQZA 1L9KA 1A8IA 3CKLA 2ZWMA 1Z47A 2B34A 2IP1A 2VHEA 3AFNA 1SVNA 4KNVA 2OZLA 3ICCA 4FFWA 1TM5E 1YFJA 1MTOA 3WBKA 2GCPA 3U13A 4DEVA 4DJDC 1H4VB 2ZI3A 5AW7A 5JQWA 3HY6A 4YRPA 5DX0A 5KINB 3GHYA 4DANA 4YDRA 3GGPA 4EA9A 3KYDB 2OQVA 3TCNA 1KQNA 1RM4A 2OENG 2PUVA 1JA1A 3CLHA 2VYND 3O31A 5CVDA 3FKSD 4YBZA 3N0RA 4I0WB 2Y4OA 3B7WA 4TSFA 4E14A 2Z2YA 5JWRA 1A4XA 3CUTA 5D1NA 4G4GA 3GLGB 1CUUA 2W2LA 1ML3A 1TVCA 3IEIA 3R7NA 4NEGA 1KYYA 2YC4C 4BJ1A 2Q62A 4D99A 1D1SA 4YCSA 5TF4A 3R2JA 4UBOA 3SZGA 3OOJA 4Q3CA 5DTMA 3UJNA 1IZ8A 1JKJA 1PWYE 1WE2A 2B5OA 2V0NA 2ZT8A 3CURA 5FQNA 5IEJA 1T9CA 1N4DA 5KJFA 5HFNA 1ZFNA 2R5NA 3GRUA 3IQWA 3OJCA 4MJXA 4HSGA 4K6GA 4ENQA 5GV8A 4W9NA 1KY4A 3GLKA 4LSGA 2JCXA 4HDKA 2Q3HA 1W8DA 4J7AA 1E2MA 1YDWA 2FGKA 5A9SB 2W58A 5IXYA 1H4TA 3NBUA 2PN1A 3CZ5A 4F46A 3WSTA 1YRBA 2VOEA 3C1AA 3O5AA 4HEJA 1PR0A 5KSYA 1HV8A 4HAZA 4H60A 4XGQA 4EH1A 1GHTA 1JG4A 2ZT5A 1J56A 1ILEA 4DAEA 2ORIA 2Z2XA 1VMIA 1PHPA 3HBJA 2QN6A 1QRTA 3K5HA 3T61A 4E5DA 1OH8A 4ZIRB 4XX1A 1PWEA 4HMPA 3PQ2A 2JGDA 4QBHA 4XOIA 1AK9A 3D4NA 4BATA 1U1IA 1R88A 4DMUB 1SUWA 2AJCA 1SVUA 2CJYA 2DPMA 2GK3A 1CP3A 1UZLA 3EXIA 3GGOA 3IO5A 5DYNA 5IF3A 4MYHA 4ZQEA 3AR4A 2IH5A 3S8EA 5JBIA 1W4CA 4N9WA 2WWRA 4P80A 5IC6A 4MDEA 1BSVA 4KGDA 4RANA 1L8LA 4I55F 4C20A 4Y2VA 4I9NA 1IJKA 1JL3A 2OBLA 5THXA 3A4YA 1RWVA 2AEEA 1EEHA 3PNSA 4R2KA 1PE0A 3RHFA 1V7ZA 1G1AA 4IAOA 3IOMA 2PU5A 2J85A 2O23A 4NFYA 2BDUA 3B2NA 3TIIA 1XTIA 4MRPA 1G0OA 1XD9A 3TZLA 1YR3A 1W85B 1NV9A 4H1WA 2XT9A 4TVBA 3HE3A 3VPSA 3RLFA 5KPJA 1KTIA 2WB2A 1EJ2A 4J1SA 1USVA 2W6ZA 3DFKA 3E5HA 1PSZA 4AT1A 4BO9A 2IUEA 4G5GA 4H08A 5T6BA 4RFSA 4EARA 2ZXUA 1XG5A 3GDWA 4Z8YA 5E4TA 1VL5A 3E8SA 4BP9A 1Y33E 2UYYA 1Z13A 2CFRA 1MB9A 3ICOA 3KJXA 3SZRA 1JR6A 5LNK1 2Z8XA 4Z2YA 1ZRSA 1U3TA 2EKZA 3KZKA 4H4CA 3NHMA 2PGAA 3KSUA 1MX3A 3PPVA 1WR8A 4HSEA 3SSMA 4DQDA 1RQNA 4P4LA 4FCVA 4TTAA 1MUUA 3Q2OA 3SE0A 3NBZC 2YMLA 3BL5A 3OEYA 4PO3X 4ZJYA 2Q5HA 3W4KA 2WHEA 4B3BA 1XV5A 3AUFA 3RUDA 1YB2A 3GC6A 1W34A 1S0UA 2OZLB 4AY2A 3FGOA 1KQOA 1SVLA 4PRKA 2NUAA 5K4HA 3OCXA 1U8XX 1XD2A 3KVRA 1NVMB 1RQPA 3D1VA 1K3FA 4JLJA 5AHKA 4WOBA 5ALVA 5KOIA 3D0QA 2ZIFA 4HOYA 4LVCA 3GIDA 3OIVA 4PYMA 4BMSA 2PG3A 1D2NA 3F4LA 1Q11A 1Z45A 1XJWA 3MRSA 3C8DA 2IZ5A 3R7LA 1HTWA 1NNSA 1W29A 4WZBB 3ZDXB 2AFIE 2EWWA 2DWUA 1YNOA 3OETA 4KQWA 4E2XA 3BHJA 1OZHA 4ZRMA 3IELA 2GN8A 2OG1A 2VYFA 3VR6D 3AJ8A 4G5SA 3VKGA 2I7CA 1QQ5A 1QGDA 3J81A 4GPD1 1GDHA 4EFDA 3JVVA 1M2KA 4FT2A 2O50A 5HGJA 3SZMA 2HF2A 1QTRA 3WRYC 2HMYB 4FTWA 4WPGA 2P2SA 2OFFA 1DZ3A 3SVZA 3AT1A 1PHRA 1PR1A 4KTTE 1NJ8A 4XYMA 1FJXA 2H1OA 1Q3HA 4ZI3A 5KQPA 2EEPA 1E5LA 4QJ3A 3A9WA 1KRXA 2O2EA 4JJ8A 4JOCA 3LWBA 2WB4A 4NONA 4P38A 4JJ6A 3O3NB 4E7PA 5I8PA 1EESA 3ZU4A 1P5JA 2UZ1A 1OH7A 4QOHA 1GRRA 5GADl 1DO8A 3GPLA 1LW6E 1Y4ZA 4HZUB 3RIXA 3VU9A 1G3QA 4E46A 4MUIA 5JCOC 3O4GA 3ZGYA 3GUZA 2IYAA 2CXTA 3ZHOA 2FKNA 1EFDN 1R0CA 1SUFA 2Q21A 2ZIXA 4FINA 4H6XA 3F67A 3CNLA 4GP6A 1W8IA 2EF1A 4TLEA 4M0DA 1VJCA 2BZGA 3E5MA 3EB9A 2WOJA 4JJIA 1BW9B 3BPSA 3S1AB 5JDIC 3RAFC 1LD3A 4A2PA 2VRNA 1ZUNA 3D1LA 3HU3A 1SKYB 4GMGA 3PF8A 4HX9A 4MS1B 4AMVA 4BBAA 4I1PA 3P2EA 4FMDB 2HK6A 4KCGA 4DW8A 2BGUA 4MW2A 4XR9A 4F3TA 4Z8XA 1AGYA 5ALDA 4B87A 3KG2A 2E85A 1QHGA 4FNOA 1PFGA 4RVFA 4CV3A 3K1AB 4NFHA 3UUFA 3FPJA 3KAJA 2G1KA 4EBFA 4DB4A 4K9QA 1ZIYA 1BYIA 1YVUA 2B7CA 4MWEA 5A4DA 2CY0A 3AVXA 4ZO7A 1GD1O 3P9PA 2PSSA 2HMWA 2EIXA 1QRDA 2Z9DA 1GJRA 1XAIA 4OM8A 4YT2A 4RA6B 5L53A 3BXEA 3GLVA 2ZLBA 2BGNA 2HRCA 2QTHA 4MJ3A 3OQIB 2IITA 1GZSA 3VR4H 3GJ5A 3GLGE 1EIWA 5JY6A 2K5UA 2RGGA 3RFCA 4MVWA 5G3ZA 1J0EA 1NVWQ 1PUJA 2OSVA 3PE4A 4BQRA 4CLHA 5I7FA 2FR1A 2PX5A 4DA7A 2Q27A 3WB0A 2QTFA 2YZKA 3PS9A 1YE5A 3NEYA 5JR3A 4LXHA 1H3NA 3CBQA 1ZK0A 2B4KA 4IYJA 3VPAA 5KNCD 1ZJZA 3ZYZA 5F73A 4EG3A 4QEKA 4LBYA 2YFHA 3EUWA 1MQ9A 2VWQA 3FCSB 3JQBC 3MJHA 1I80A 2ID8A 1GG8A 1ZU5A 3M6UA 4YEDA 4CM8B 2QE6A 3F6BX 5LZ8A 2CDRA 4KO4S 4GSKA 3HWWA 3WV5A 4F9TA 2ROQA 4KN9S 5DSZA 3WK6A 1TT5A 2VDWB 2X2FA 2G6TA 3ESAA 1GLNA 3VI3B 5C1OA 4OA8A 4NJMA 3DDUA 4ZGBA 5KQMA 4J16A 2Q9AA 4GKAA 3B48A 1QK4A 4X1IA 1TZCA 3T5BA 1BDHA 4IIFA 4RIGA 4TS4A 3F46A 2FOXA 3ROTA 2OP0A 5IM4F 1Q84A 4UPVA 3T5TA 2D2IA 3D2CA 2QVBA 4LZAA 3KQMA 3TUZC 1KA9H 2XBLA 2D62A 3GBPA 1UT6A 2DQ4A 2P7HA 3UCFA 4J7XA 3A9RA 4X97A 3W3ZB 3KOMA 1MKYA 1BEUB 1QOQB 3BIWA 3ETNA 3MOGA 3RCBA 3VJMA 3HA5A 1XZHA 4S2UA 5EIOA 3W8NA 2QXTA 2RGEA 3L06A 5AVUA 3Q41A 1Z38A 2DPYA 1X7YB 2W98A 3GUCA 4LUCA 4X8HA 1T0JB 5FBRB 2WOOA 4G4IA 3N0WA 4ZQCB 1V71A 3N2ZB 3WIEA 2JF0A 3C3AA 4RETA 2WVHA 3ZCQA 2CL6X 1BD3A 1WEHA 2QAIA 3FTDA 3QU7A 4MINA 4MUAA 3RI3A 3FRIA 1FFCA 1KYQA 1NVTA 3V4RA 1NXOA 5WRFA 3LGSA 1HWYA 1YACA 3R7WA 3BGOS 3INGA 2VK4A 2ST1A 3SIXA 5AKLA 5AW1A 3RPEA 3DNFA 5LXTF 1N7JA 4UM9B 3HZRA 4ZCMA 4JP1A 3OJOA 2X42A 4B8YA 1E62A 4P3YA 2R7MA 2XB9A 4W63A 2O8BB 3IAFA 3GV0A 3GT3A 1AX9A 1L5HB 2D1YA 5IBQA 5LDDC 3PUXA 1GSIA 1G8MA 1F8UA 1NU6A 2QF7A 4FYXA 3HXQA 1L5QA 1TAHA 2Q6TA 3BREA 2HO5A 4M3NA 1Z5GA 2YY5A 4C04A 3SF8A 4BEVA 1FFHA 2EX1A 2Z6VA 3WJ2A 1JIKA 1YUMA 3PITA 1GNVA 1HE2A 2GMWA 3SHQA 3ZZTA 5KOHB 3EZ9A 1Z2EA 9LDTA 4LG1A 3ER9A 3DEKA 3BCSA 3U1BA 4MLCA 2HQSA 1ZD2P 1TQDA 5IEBA 2MSKA 2W70A 1U04A 4BFCA 3LT5A 4WKNA 1JEJA 4JYMA 1WXXA 2WIAA 1JHZA 4N6NA 1O3YA 4FCTA 2RHCA 1AUVA 3CCBA 4IV8A 4U7FA 3EVFA 4IZHA 3SJUA 2QOEA 1G8AA 2XA9A 5T41A 4BUJA 4C7MA 4GKBA 4B2IA 3NVKI 2DMRA 3L07A 4ZXPA 2IY8A 4NZPA 1O7JA 2CYAA 2FPPB 3NCTA 3EFOA 1S2DA 4NAUA 3WK5A 3C5WP 3RTAA 1ZVKA 3GPDG 3W5CA 3AHIA 5DIZA 4B6EA 1DCTA 2PZLA 4FYYA 3EEYA 4BB9A 4X44A 3IEVA 2NAPA 5EZYF 3VOTA 3T1HB 5A02A 4WXYB 4ZTUB 2KS6A 2KPOA 3BWVA 2FEPA 3S99A 5EXEA 5EPEA 3I04A 3LKBA 2XIQA 1WCV1 1J0CA 1QRAA 2VBIA 4EVIA 3GZNA 1E1MA 1GUAA 3QJ5A 4XGKA 1D4FA 5H0IA 2ZU0C 1VDZA 3A3OA 3DF7A 1RAGA 3I8SA 3BMCA 3NHAA 3ND8A 3OE5A 2G82A 4CLOB 1B42A 3MCTA 4BZPA 1ORIA 3BB3A 1D6SA 3K15A 3KSMA 3UMYA 2BH2A 1FE8A 4KYIB 1II8B 1U9IA 4WNCA 3MEQA 3CUUA 3GRCA 1GUZA 4BVHA 1H2YA 3TRJA 1XSEA 4JZKA 2FRDC 4GDMA 3ZIUA 5ITWA 3NWJA 3C6BA 3NKFA 4NBSA 1QH8B 1U9IC 3M81A 3ZJVA 4Q66C 4CCYB 3AW8A 3QE2A 1OZFA 3D81A 3OI7A 1PGPA 2OCXA 1A4UA 3OLQA 3W2TA 1ZITA 2Q0SA 3UTCA 3DLIA 1EBFA 2WUDA 3J7AC 4DV7B 1Z34A 2EXXA 5CHEA 1FS4A 1MA3A 1YT5A 2Z3ZA 1X2EA 3PEFA 3M70A 3QVSA 3VKWA 3VO1A 5L45A 2HIHA 3T41A 4BFSA 3QY0A 5HW0A 4ESOA 2HLHA 4D4MA 2OORC 4BKOA 3O8CA 2JLSA 3IOYA 2G28A 2Q3CA 3GAMA 4IQFA 1E1RA 2Y05A 3PDWA 2QTRA 4WA7A 3NBKA 4PIVA 3ZDFA 2QRUA 3PHJA 2OFWA 5CK4A 4LYAA 4BJ5A 1N2GA 2AXPA 1PK9A 3IR7A 3V4LA 1UIMA 1NR7A 1RPAA 3ONNA 4LJ7A 5EL0A 4LF7B 1BS2A 5FPTA 5HQJA 3SU8A 2EGUA 4YMGA 3LFUA 2C77A 2ZJ4A 1XRJA 3PTAA 1ZNXA 3H19A 1X14A 5DMXA 2B4RO 3W2GA 1JSCA 1Y3FE 3ACCA 1JHUA 2HQ1A 1EM8A 1SD2A 2XOXA 3IV9A 3QXGA 1U8FO 3G02A 3V8VA 3WL6A 4MVJD 1ZISA 1BQEA 3FUWA 4GE0A 1F8XA 4N8SA 4BTVA 3FFWA 3B1ZA 3N5KA 5JAUA 4E0BA 1R6DA 4J4TA 1KARA 5F9MA 4FYPA 4AG5A 1SELA 2BMVA 1Q0ZA 1VLZA 5FO1A 3K71B 1JE1A 1WLSA 3CF0A 1V95A 1HG1A 4OSEA 4TZ0A 3AF0A 1J00A 1HNXB 4OMDA 3SJ7A 2O8DA 4J0CA 2A0FA 1ZK2A 3E3MA 2BF7A 3MTEA 1Z5NA 3HCEA 5D5HA 1FFEA 4JBGA 4PXYA 5HJEA 3LOUA 4GI5A 2DR2A 1XDSA 3RU7A 4M86A 1KEVA 2HFJA 4UE6A 2ZRMA 4W5HA 1E6CA 3DLCA 3KDPA 4NX2A 4EL0A 2UZIR 1M0TA 1USKA 5A1TA 3MN1A 4Z0NA 5F51A 1EWYA 1ECBA 1M1NA 4ZCQA 5AYVA 2HWWA 4MKZA 2AKEA 2EKQA 1B3BA 5EHIA 5HJ5A 1HDOA 1B26A 2ZCJA 2VH5R 5B64A 1U28C 3GY0A 2XDAA 2XR1A 2JZOA 1WMBA 4W8OA 3SLKA 3D7MA 4DLUA 1UDCA 3MSXA 2QUZA 4I6EA 4U2GA 5AW8A 3RVOA 3TPFA 1Z88A 3WMRA 2IXGA 2JJYA 4CQMA 3CVYA 3HYSA 5BR4A 4JB8A 5DM60 1HOXA 2ZTHA 1SHKA 2PKQO 3GEBA 3NYQA 4QEZA 3AH8A 3MSCA 4AP9A 4POOA 1TEHA 3B9QA 5JCOA 3E4CA 2BPOA 3O92A 5KX5F 2QN1A 2QGNA 4BFZA 2O8FA 2FWBA 5GWXA 3R8XA 1EM6A 3TGWA 1VG1A 5K0GA 5FEUA 5DGHA 2VJDA 3OFKA 5HCUA 3PNPA 5HKOA 2C59A 4L02A 4MQ6A 1PSWA 1Y8RA 2B20A 4F06A 3Q3CA 1W44A 5JYCA 4PZEA 1EVIA 1LLCA 3BORA 5G0UA 4D8XA 4D9BA 4TV9F 5AD1A 1WXEA 2YJ3A 3B7GA 5KNDH 5EIAA 2LGJA 2V9ZA 2PPLA 1QC5B 4FE7A 3LO5A 4Z4CA 3TAUA 4MGZR 1ZN2A 5KYGA 1QQTA 4KVAA 3CPSA 3H9QA 3SHOA 1LDGA 1WXGA 1WD5A 3CHYA 1DCFA 3MFYA 5AHRA 5AW3A 2I22A 4CM4B 4ICIA 5AM3A 1AQUA 2CMDA 2YJNA 3I5AA 5CLHA 1JLLB 2B7LA 2XRMA 3BWBA 4V0SA 4NDZA 1R0WA 1QPGA 4JMLA 3DEFA 4M1EA 2VDLB 3BE5A 1JH8A 4I5FA 2QK4A 4R31A 4ZIRA 4H7DA 2VUIB 3ZLTA 2ZJBA 2W6JA 3FVWA 4AZ0B 2ZM5A 1RXEA 5DK6A 4JUFA 5B55A 5ILQA 4KZPA 2FJPA 3H5OA 1QIHA 1IY0A 3RUHA 4I19A 3SDSA 4PGFA 1LLQA 4XEHA 3ZDCA 1OZGA 1TJYA 3K3PA 2QXUA 4R7GA 4C2TA 1CRQA 1AXEA 2JCVA 4F2DA 2FLKA 4BXOA 4XE5A 1ZHOA 2PD4A 1JQEA 3Q2KA 4O5AA 3OMLA 3FZEA 3RRBA 1S8FA 3P2IA 3AM4A 4BX2A 4E12A 4EKIA 1N8KA 3B1VA 1Q16A 4P35A 4P4SB 4M0EA 4YMHA 1JAXA 3COJA 2JJ8A 3EBLA 1UM9A 4L1KA 2F8MA 2F1IA 1TVEA 1WDKA 1AOXA 5G41A 1W19A 1NQXA 4NNJA 4ZP1A 3VBEA 3WHKA 1NFFA 1NX6A 2GR9A 2CBGA 4YECA 3VR0A 2JIZA 4D9KA 1R6XA 2R6FA 5JJLA 4OYRA 1WV1A 4F5YA 4ZTZB 5TPZA 1RXWA 1E1DA 1LZLA 1N5MA 3O1IC 1TX4B 4W6ZA 3QMMA 3R20A 1US8B 4EFKA 1H0KA 3G49A 4YJFB 1GU7A 4TTSA 4NBUA 1MRZA 5A71A 1KI2A 4LE0A 1Z17A 3HN6A 4TROA 1RYHA 3LFTA 1OXKB 4YRBA 2WJWA 1SBTA 3DB2A 5E6RB 3V7WA 1UBMS 4B45A 2PFGA 1WW2A 3BE4A 2WUGA 1U3GA 1XFDA 1J0AA 2B61A 2HU5A 2GVNA 3ER6A 4KE9A 4PYQA 4KU4A 3V80A 4GL2A 5JCJA 3GF4A 3L92A 2GDJA 3TB6A 2JPDA 5ARCA 2EV9A 3PLNA 2ZT7A 4WN3A 3KVOA 1Z7GA 3W6PA 2IH4A 1XD8A 2JFZA 2ZTVA 4BN0A 3KUXA 2SCUB 4Q7QA 4X41A 4EPTA 3AEUB 3QX8A 3LL7A 3ZNQA 2A2ZA 1BVHA 1EUZA 1EFPB 2QB5A 4BVFA 4CM1A 2GFQA 1PZEA 4K5QA 4ZEOA 1T4CB 4DC9A 1UDRA 1DAKA 1XPJA 1D03A 4HDSB 4L85A 4LMRA 3IQDB 5IHPA 1JUDA 4FE3A 2JRLA 3F6PA 5AM0A 1XWIA 4GAEA 2PJZA 2R6GA 3G13A 3LTEA 1UQUA 3AV0B 1ZBQA 3FPEA 4YIKA 5DNUA 3VVBA 3GFTA 4IKOA 1VBFA 4MV8A 2DUNA 3VUEA 1I2ZA 4KO3S 2WABA 1NQTA 1ZYUA 3ENWA 1ZIPA 3EUFA 4FFVA 2HEGA 3VZDA 1EVLA 5C1DA 1J9ZA 3C3DA 2XWJI 3LUKA 4G09A 3TD2A 1LSUA 3B6EA 2WV9A 1JQLB 3WLRA 3BIFA 1KOGA 1BKDR 4JI0B 1I01A 4D0RA 1V7PC 3ONWA 2Y1LA 1IWPB 3QRWA 3UAGA 3HNRA 2OK8A 1VBNA 3GNLA 1CR1A 1NRWA 4KG7A 1GPUA 4PVDA 3SC6A 4QOJA 4A5SA 4HUTA 2BE7A 1U8AA 5TRTA 3A3KA 4EELA 1ADGA 1RYMA 2HSEA 5FP0A 4PPYA 4UULA 2FPGA 2IU3A 3G8CA 2GI4A 3O47A 4G5XA 1XQVA 2PGOA 5IN5A 2LCQA 4CT4B 5LDHA 2OBXA 3WLFA 3GPIA 4ENPA 4IDOA 1WPRA 3ZWOA 1UKBA 3A2KA 4BO7A 1RAEA 3HTXA 1W4LA 2P9JA 3LRXA 4CIAA 1YDMA 1FNBA 1PJLA 1OREA 2FPLA 3DHVA 3KLPX 4DPLA 721PA 5ARDA 4I8XA 2BGTA 4X60A 4Y2RA 5EE1A 4O0LA 2YJ6A 2UZAA 3PUHA 2CE7A 4KQHA 1BCRB 2C2XA 1W49A 4FIZA 4Q3LA 3OQHA 1H6BA 1DC8A 4Q12A 6ABPA 2UZ3A 2WHPA 3OTHA 4GKVA 3PRJA 4OHOA 2J59A 1DRJA 1IEVA 3M9WA 4IH4A 5BOSB 5FFNA 1JDTA 1ECJA 1F20A 1QYDA 1UT5A 1TT7A 1ZO8A 2HJSA 2IYEA 1X8KA 3D2LA 3F9RA 3KFXA 2R4UA 4LWOA 4URFA 3STUA 3DDHA 1G3RA 1HXHA 2HNBA 1YBAA 2IL1A 1M10A 1R74A 1Q1BA 2OO5C 3GA5A 3R3JA 4NWIA 5H83A 3LCUA 3LLVA 4K81B 2C96A 4ZAVA 4QLOA 2DCMA 1I3MA 1GV0A 2Y1FA 3T9CA 4UEJA 1EKXA 1E9EA 3MF4A 4B09A 1U80A 3IMKA 3TOXA 2C7OA 3OECA 3D3KA 2JLUA 1TYAE 5CPFA 3TK1A 5KTMA 1C0IA 1FMLA 4K1LA 3D64A 1CNFA 2YZ2A 2H06A 2CUNA 3HL0A 1QR2A 1ENZA 4JK3A 3OEHD 3WZLA 3EQ9A 2OSBA 3OFND 1T5TA 1M2OA 1HPLA 4E5MA 2ZXEA 2ZUUA 4NG5A 4YMSA 1E4VA 2R68A 1IK4A 3M1IA 4Q16A 1KS9A 4K8OA 2PRJA 3SOPA 4E1AA 4EKYA 5ADHA 4CDNA 1VIMA 2HV8A 2WA2A 3KE8A 4MWGA 3BD8A 4XW2A 3SXPA 3VH4A 3FBGA 3A14A 1FJGB 4EF5A 2OD2A 5AICA 1VL1A 2F1JA 5JNTA 1GNQA 2FOLA 4OMCA 2HT1A 2VTEA 4G8JA 5CLLA 4WLOA 2UU9B 2GUGA 4YXWD 5L3RA 2SECE 2A9PA 4P5DA 1XKLA 1SCKA 2KM1A 3SC2A 1R6UA 1RWNA 1J1UA 2FWRA 3FBTA 4K40A 4LOIA 2GESA 4UU8A 5EYPB 5T8KC 4DBLE 4H1HA 2AW5A 1LZKA 4DV4B 2WHYA 2ZKIA 4TVKA 3R74A 2IRWA 1ZXBA 1ONBA 2HDWA 1DOHA 1GFWA 3OZAA 5U9CA 4N5IX 2VBCA 1ZKMA 1E2QA 2Z8ZA 4HEA1 3E4DA 1ZESA 4GM1A 2OGTA 2QMOA 4K87A 2LXNA 5BQFA 3AKZA 1ODTC 1Y8QB 2J9XB 1H42A 2I66A 4TKUA 5A0VA 3OE4A 2QSZA 1YZHA 5T6MA 3X2FA 4CGZA 5L7YA 2E5LB 2CLSA 4R9SA 4B31A 1FFXA 3RVQA 1YJCA 1MJFA 3WIUA 1PJRA 2BTQA 5F21A 2X0EA 5KSOA 3GCGA 1FTQA 2NNWB 2VDJA 5CNKA 3RJ5A 1QX3A 1KK0A 4AY5A 5EJ5A 2VO1A 5I7AA 4QDUA 1V16B 1KZ7B 3RT1A 1MC1A 4XUCA 2H00A 3HNOA 3Q5GA 4DBZA 5GTDA 2AFIB 1SUCA 4JJZA 1R4NB 4YUXA 4DWOA 4ZKDA 3ZW7A 3FW1A 3VR1A 3I6IA 4J07A 4CPDA 2JHCA 1CQJB 1C0PA 2AYXA 2BH9A 3H3JA 4HRAA 3RSLA 1QU2A 2GZ3A 4L74A 1CY0A 1RWWA 4LIPD 4Q9IA 2BHSA 3OCJA 4R6WA 4QJIA 1RNLA 1KKLA 1FNDA 1JSRA 2EBHX 4H0FA 3X1DA 3H1BA 1Y5RA 4BLRA 1D8TA 1LLFA 1H5NA 3PDCA 2BAGA 5REQA 2IUUA 1F6DA 2GYUA 5B1SA 1H2EA 4QXRA 1IZ9A 4LHYA 4YCMA 2J5QA 2BKEA 4CL0A 4O2AA 1YZFA 3N9IA 4AJKA 4XYLA 4R41A 3JQ8B 1UDBA 1V96A 3NH9A 4LZZA 4XX0A 5J43A 4DFDA 2D2FA 1U2SA 1GOTA 1P4JA 1W4AA 1WHTB 3C7KA 3F5MA 3HQ4O 3TNFA 3VNBA 4AD8A 5MF6A 2E55A 2X5KO 2YINC 1NVEA 3ND5A 4GZ5A 2VDMB 4TTTS 5LIPA 1QK5A 2EKBA 1KQ3A 1PRYA 4FUQA 3KB2A 3F9CA 3FTEA 2X1LA 1Q0RA 2RH8A 1RABA 4RM2A 4M1OA 4FLMA 1NXSA 3KJIA 7REQB 4JROA 3PGVA 1RU3A 5IKEA 1S7CA 3W4IA 2I4OA 2YMMA 2GBIA 5CT6A 2QTVB 3GT0A 4E4RA 1MNAA 2W6PA 3B1XA 3UWDA 1E0AA 1UWLA 2AG1A 2X4IA 2H48A 3EHDA 5CW1A 4B8ZA 2YIDA 1TL7C 1V7QA 4NHEA 4B47A 3ZXUB 3C6XA 3BA1A 4JBHA 1HOTA 4KLNA 5FBHA 1XTVA 2NXEA 2O3UA 1D5CA 2PS9A 5EZ6B 3AP1A 3QHPA 3TSCA 5IPFA 4K9NA 3E9YA 1BNCA 3EZGA 4X91A 3L77A 1NYRA 3ADOA 3EF0A 3GAFA 4DTIA 1XIVA 3E22A 4U9UA 2B99A 4MCHA 2B82A 4R0VA 3BDVA 3FBWA 5JRJA 3CC8A 2VJMA 3KAQA 3LXRA 5K2OA 4QDTA 4IJMA 1BO6A 4HZIA 3D8TA 3MUOA 4YRZA 4R8MA 4C88A 2QA5A 2WYHA 4GSLA 3RYHB 1ZVVA 1FQJA 2OILA 1LVHA 1YWGO 4ISBA 5K3SA 2K7ZA 2FDCA 1TQ4A 3EH2A 3VYTB 1K6EA 1HLFA 2B3TA 3ZR4B 1E6EA 2PL1A 4NYIQ 1LVUA 1OLXA 4ZODA 4ZT7A 2YHIA 2PT6A 3LPLA 4JC8A 4L3OA 4YIHA 1H2HA 3WA7A 3AJDA 3A27A 3EIEA 4N03A 2Z5GA 4RKQA 1GTRA 2I2FA 3IV6A 3NC4A 4URYR 5CJPA 4A03A 3HJNA 4G24A 3WMEA 1K7XB 5FPHA 2ZZMA 1SOAA 2OESA 5F76A 1MJGA 2WUEA 5KOYA 1HLGA 2A94A 3C70A 4BL5A 1G8YA 3DHEA 3QK7A 4P86A 4YCAA 5A6SB 5CBPA 5KX5A 2VTBB 3HCWA 2G17A 3NDRA 1YTUA 4LFCB 4COOA 3IT2A 5JV5A 4PSKA 1ISHA 1XEFA 1RBMA 2GILA 1UP6A 2QAGC 3OZ7A 1DPFA 2DGDA 5TS3A 3LDUA 2UXDB 1V2HE 3H75A 1G98A 4MUJA 3EZXA 4REOA 3T52A 1GLVA 1D6NA 3RFVA 1JE0A 1NF3A 3FMFA 3RJ9A 3WDKA 1ZH6A 4BWVA 5GZ1A 4YJKA 3QX3A 1O9HA 1NXPA 5EFOA 1GRNA 3CNEA 1OFHA 2DPGA 2YH2A 3NWOA 1IWOA 4OKSA 4QTXA 4YUZA 1AA6A 3EEFA 2V8OA 3RSQA 1MB4A 2OK7A 3IESA 4B7UA 1FPQA 2VN8A 4EHIA 4E2WA 4IOKA 2PVSA 1XEWY 4G1FA 4DXDA 4WXHA 3THXB 3HG7A 2WJ4A 1AVTA 3T7CA 4CF7A 2XQKA 1QGOA 3O8OB 3LBYA 4X6LA 3DO8A 3RK0A 3PJDA 1D09A 3WMWA 4B9EA 4ZYYA 1P1KA 5C32A 4N3NA 5KWJA 3KLOA 3MS4A 3ILHA 4O4HF 1T13A 2GBPA 5CIYA 1OA0A 3WGYA 2EJTA 4A2QA 2VA8A 4C1NA 3PQ4A 4E88A 5IT4A 1G18A 1SXJD 3LMKA 1T5SA 1GARA 3QXXA 4Q4JB 3O4FA 5FIUA 4A4DA 1R9JA 3H1FA 1HT2E 2IEBA 4BVAA 3DPUA 2Y68A 3FI0A 5EKSA 3GGGA 4JELA 1U8ZA 2AE2A 3HKDA 3ZNPA 3ITKA 3I9MA 3HR7A 4EO9A 3CO5A 2X9LA 1J24A 3EZ2A 3H84A 3DLHA 3TVTA 1ZNWA 3MD0A 1YFKA 4CHGA 4BV2A 4F2PA 2P3QA 1VHDA 2GLUA 3LQKA 2X0DA 1OWLA 2BP7B 2CWWA 1QHHA 1RHQA 2J1LA 1S2GA 1B8PA 4FONA 1QZ3A 3VJLA 5JMOA 2C3OA 3SYMA 4IDNA 4EQZA 4OREX 4BMXA 4PO8A 1YJBA 4MLZA 5HIMA 2PUGA 3QWIA 1WXQA 1OPXA 4KI0A 4C5CA 1T3HA 4Z4FA 3QH4A 4YLEA 1KJIA 1TMOA 3B5JA 3KKOA 1H65A 1WCIB 3F6YA 2JH9A 3P9CA 4IUDS 4Y3UA 3RUEA 2CSXA 4OQZA 1NXWA 1ORWA 1Q74A 4UJ3A 5COAA 5EPOA 1SCNE 4MGKR 4BDSA 4DLKA 1VE3A 2QZZA 3ABSB 4G0ZA 3VZPA 1YS2X 3EGDB 1G60A 4XGIA 2F67A 3QENA 1PQPA 3LPMA 4OHCA 1XZCA 2PNJA 4M6WA 2A9JA 3M6VA 5I7EA 2A14A 1XMIA 2ORWA 5AK4A 3SWWA 3P9KA 1B3RA 1OCEA 3IAM1 4XJXA 5D84A 2IHNA 5F5XA 5ERXA 2ES4A 4INPA 4DCJA 3HVUA 2CLLB 3QEMB 4MGHA 5H1YA 5AKZA 5FA8A 3TM4A 4C0KA 4CMAA 4D3DA 5AM2A 2CXNA 1E2GA 3LOPA 4J0JA 2NVBA 1QH9A 3FGNA 4JLPA 2GRUA 1FZTA 3VJRA 3WY9A 3ZJYA 2QD3A 2XCLA 5FWNA 3KJHA 2PX2A 3L0IB 3N5CA 2P8JA 2BDEA 4EY8A 2V98A 3AB7A 4RESA 1EFVB 3VAAA 3KCQA 1KDRA 2GBGA 4YJ2A 5A1JA 5HF6A 3DM5A 2Z1DA 2C57A 4XXHA 5IX8A 1M0EA 1Z63A 2OCPA 2OVFA 3IPRA 3IP5A 1KP2A 2NU9A 1Q0HA 2W2OA 3P9NA 3RGWS 1BXZA 2G9VA 3CLSD 3OURA 5KMGA 2IYQA 2QM8A 1NC1A 3PXCX 4M4SA 3KETA 4CLRB 1QS0B 4MGEA 1H3EA 3FA2A 2R5FA 1IMJA 1T4DA 3S28A 1AO3A 1I3KA 4FKZA 4KQ1A 5J63A 1GZ6A 2VBGA 2Y0DA 2YFYA 4LV8B 2WJJA 4R1TA 4TZTA 3WGHA 2C2HA 3Q7PA 4FMCB 1QIDA 5FL7A 4BB6A 3GLIB 2NO0A 2ZYRA 3KD3A 4MR9A 1F7UA 2GKGA 1H05A 4DDKA 3EX7C 4BS9A 3ZDEA 2C31A 4E2YA 3LZ6A 2CF6A 5P8WA 4BZWA 1U8CB 2I0FA 3DF9A 4QYMA 1EP3B 3B1FA 4F6LA 1GPJA 3QSYA 1QTQA 1W2WB 3RC9A 3LUPA 3UG6A 3U56A 4EMTA 1IHPA 1RWQA 1T3ZA 2VRCD 5AIAA 1OKKD 1FDVA 5I01A 4M1MA 3RFXA 3Q6MA 5LP6C 2QY9A 1DQNA 1ZH0A 3RADC 1KC1A 1I2CA 1PZFA 3D2AA 4KAJA 1JHAA 2Q41A 4KAFA 3Q7IA 4ENUA 1Q57A 1HYHA 1IJBA 3AKEA 2FEKA 3LCJA 4MPJA 4B4VA 4URXR 3QFFA 4TN1A 2VSFA 1G20A 1KIAA 4ARIA 3AR8A 1C1XB 4XASA 3ZN2A 4RX1A 3EVNA 1IN7A 2IA5A 2QENA 3HY3A 1WNFA 1E3EA 1Z74A 5IC4A 2QDXA 1W7AA 3M6FA 5BPHA 3R1IA 2EARA 4KC0A 4L9WA 4Z9YA 2EVWX 3EDQA 4X20B 1CUBA 4HLUC 2P0EA 2WKWA 4Q1FA 3R7DA 3GLIA 4P83A 4EG1A 1HLDA 3I9FA 4HQ6A 1JZSA 4P4NA 1QIIA 4R3UC 1DEXA 1USUA 3IVMA 5AI8A 2CV1A 1CRWG 3ER8A 4X8LA 4HVAA 5E6SA 1YOVA 4C01A 4DLBA 2NSLA 3DEJA 4NU8X 1CTQA 1IBRA 1SBHA 2RFLA 4FK8A 2AXQA 3AKYA 4TTPA 5ESRA 3EUAA 3L3BA 2UKDA 3LJKA 3C8MA 5DRYA 4FYIA 1LB1B 4N5NA 2ZAOA 3ROXA 5L6MB 2JBAA 1T26A 2RIPA 1X7XB 3VR3D 1V5FA 3D9QX 4RK0A 3COPA 1O2DA 3DBHA 2E2WA 4LYFA 4MWBA 4OV6B 5IBPA 4NCHA 3RVRA 4BFLA 5CVJA 2R00C 4H77A 3HO8A 4J1QA 2NM0A 5JH7B 4G56A 2VBFA 3WFJA 3AF4A 1L1EA 4L4XA 2XUAA 5E4YA 1V4VA 3K32A 4EW1A 5K05A 1MU0A 3DE0X 3QNMA 4N5HX 1PJBA 3LUCA 4IV0A 5K2MA 4KR2A 1A9ZA 1QJCA 4HEQA 1XZNA 4KVGA 2QTGA 4XB2A 1QBKC 4R2XA 2NVOA 3OSZA 4P33A 1DHRA 2PUHA 1AS0A 2RHRA 3UOAB 4BFWA 3DFMA 1L5SA 5AI0A 4GX0A 3V4PB 3VOAA 1QHSA 5H70A 1KEPA 3E7PA 4FC7A 4INAA 1CLEA 1XXLA 2IYFA 3WLMA 1A71A 2F1RA 3JQBA 3HWSA 1N4AA 3UIEA 1MJGM 3KSBC 2XVZA 1V1MB 2HHLA 3BXOA 1QNLA 4K3VA 3PX2A 4FDVA 3SHWA 5K8TA 1BDIA 2Z4TA 3ICPA 3IPYA 3ZDDA 2WD8A 1YQUA 3HV0A 3K8ZA 3P4UA 2L2QA 5E1MA 4TSKA 5KYWA 1PNRA 4HDNA 4TYWA 2A58A 3TIGA 4KK3A 1KJYA 1Z6AA 1Z6TA 3THXA 1H4SA 1YB7A 2KYRA 2Z4SA 1XRSB 3AHFA 4DF3A 3FHTA 2G7ZA 4B85A 4DSZA 1MC5A 1L4MA 1TC2A 1K7EB 1Y37A 1RQXA 3G9UA 3EQ7A 4NE7A 4ZVSA 3T7IA 1SXJB 1HEYA 1ZLXA 4F6RA 1RXSA 3K09C 3ETLA 3CUKA 1A9TA 4MUGA 4RUKA 5DHAA 5EY5B 1FF9A 4DE5A 1K08A 3A9VA 5JBQA 1IN1A 2GZSA 2HLPA 4HTFA 1HMPA 1II0A 4LWQA 1G64A 4NF2A 2X86A 3VPHA 1RWBA 2HDOA 2BUAA 4FS3A 4AZ3A 1KMHA 4R83A 3VPCA 2FVXA 5AKJA 2R8PA 1K27A 1DAPA 3HHPA 5C8YA 1VB3A 1NSTA 4JUAA 1RTTA 2QLBA 1OWOA 3K4PA 4G3XA 1X1RA 4RENA 4YQZA 5BSRA 3SBOA 1FTYA 2HXSA 3EG9B 2I33A 1RWMA 2VAVA 3IH5A 4NJOA 2O0JA 1JRLA 2AL7A 1CHDA 2GEKA 2ZBQA 1H0HA 3CPHA 4OHUA 5CGQB 4ZZ0A 5HSGA 5KNDA 1W47A 3PHIA 3RSZA 4HGRA 3HUTA 1NLMA 1OOEA 3T7JA 5LUAA 2QL6A 2JCGA 3I4FA 4HF7A 4OMUA 3O8RA 1LC3A 2D0PB 2Y0CA 3C7DB 4G0QA 3L4BC 4TT3A 3GFQA 4KPFC 2QLNA 3LZCA 5LJLA 2WSSD 1GN8A 5ALKA 3EQ6A 4NE2A 2OP1A 3DOJA 4PXSA 3O1LA 2AKYA 4B3JA 1L7RA 4H0CA 4JQYA 1XROA 3HL4A 4C0QC 4DQLA 1VRWA 5FA6A 2OOSA 4ZC8A 3AETB 5BN1A 5LP6B 3B13B 2GKOA 1B0AA 1RMTA 3W9UA 5LYJF 3ZKWA 3SYRA 4UVGA 3WP1B 4R2LA 2X5OA 3ABZA 3AUUA 2O8CB 4MVCA 4N54A 4YAJA 2GHRA 5A05A 5EHZA 1W35A 3K72B 5AW4A 1XZPA 5DTIA 2FJ0A 2O8VA 2OEPA 3FETA 3OZIA 4HVTA 2NSHA 3R3YA 2YHBA 2C00A 3OHPA 3HUFA 1G3UA 1GTVA 1VYTA 1W5FA 1Z8HA 2OCBA 3WKBA 4K28A 4MI9A 1NNUA 1NTOA 1XTRA 2R25B 3LCMA 3E9QA 1KAOA 2OGUA 3LUBA 1L5YA 1KJQA 1VL6A 3LV8A 4MVJP 5CH8A 1C1YA 1V47A 4HNAA 5IH3A 4BWGA 1PWHA 2JANA 5JALA 4DUGA 2ZB7A 4G6ZA 3B1JA 3TI7A 2W0MA 3ZU3A 1LS1A 1KJ8A 1Q17A 4Y98A 1ZD4A 4BV3A 3FN4A 4RMJA 2GGSA 3KJEA 1Z2AA 1KMCA 4KAAA 3A10A 1DWOA 3HFSA 3JZDA 5I7UA 3WTCA 5FPSA 2EP8A 1CJCA 3AR9A 2E4YA 2ID4A 4HGPA 4BMYA 4QUBA 1BFKA 3FDIA 2PMDA 3NOXA 2IV2X 4F3KA 3AUSA 3FPFA 1N9GB 2VNSA 2XQIA 5ECWA 4MPTA 2QUAA 2L18A 4AKTA 4LZJA 1WHSB 4GIBA 1KC3A 3ULKA 4A15A 2UVPA 2GAJA 1BDMA 3F6CA 4Y67A 3THOA 3TLCA 3NQ41 4ZVQA 3ZW8A 1KPIA 1XCBA 3FSGD 5FAXA 3KWFA 5JPCA 2O59A 1RAHA 2WSIA 3QW4B 3VR4A 3WHLA 1ZG3A 1AUOA 2HAEA 5AO9A 3VA7A 2QL7A 1ZS9A 4OBEA 2JEOA 2XMCA 4OK5A 5UKDA 1BGVA 3E7WA 1T8TA 3HMKA 3WMXA 1TVKA 5D5QA 1W36C 3KQHA 2FW9A 4Y9SA 1PQUA 1QZXA 3TF5A 3A70A 1BZYA 4YV0A 2GTIA 4PTYA 3IQEA 3KTFA 3BL6A 2B83A 2OV6A 2FSUA 1EWQA 1B8UA 2QJFA 1VRVA 2OC4A 3IVXA 1TQ6A 4PLFA 4LJAA 3B9BA 4MW6A 4F4CA 4OATA 1KVRA 2NP6A 1N5KA 2RHGB 1NI4A 4M8SA 4CW7A 1DC5A 1TZJA 3V9PA 4CR7A 4QOIA 3KZNA 3WYNA 1JDPA 1KEEB 5CX1A 4CM5A 3S29A 5EERA 2FG7C 2WJPA 3HRHA 4AJ2A 1I94B 1ULBA 2KLHA 4NS4A 2Z2ZA 3LPAA 4YRLA 3RVDA 3MS2A 4UVIA 4DMHA 4DM3A 3I01A 1AN0A 1TM3E 1SIOA 2WRZA 4CCAA 4LJRA 1JDJA 3CLTC 1SD5A 1WHTA 3G8AA 2DJ5A 3T3OA 2PZ8A 3DNPA 3Q6IA 4BO1A 3MJSA 2GZRA 2CJFA 2BFOA 3U48A 1Q1GA 3QA9A 1E4YA 4A6EA 2HSWA 1ZDMA 2R8EA 4ZO8A 1OLUA 4BMOB 5FLEX 2IHKA 1A95A 5REQB 1HTBA 4CM9D 3S8MA 2EFDB 1E0KA 2PNFA 4AAYA 4GLBA 4HHEA 4JEUA 1USGA 1GKYA 4ZVTA 3MQ4A 4LYJA 3LIPA 3B3FA 3DS8A 3D6VA 4XLTA 3HADA 1QHIA 1OTHA 2PSHA 4KPYA 2PWYA 2X6RA 5IP5A 4LF6B 2OECA 5JNWA 1XEXB 2YYAA 3VYWA 3P8ZA 4QATA 4KQ6A 1G66A 4KIFA 1Z0KA 4HDCA 3RTDA 2OTCA 2G9QA 3INYA 1WULS 1GFIA 4D4IA 2JFNA 3ZKWB 1YD7A 4E1VA 4AURA 1VSBA 4S0XA 1MT3A 4JD5A 1EG2A 1TJ3A 2Q0XA 3TTSA 4RXMA 4MAFA 1KKUA 2NWQA 4DZZA 3PRYA 3BVPA 2PGXA 3MMPA 5E9AA 1UEJA 4K8RB 1SC6A 1QOZA 4D96A 4PR0A 4G0UA 1Y8QA 3AB3A 4XPZA 5EP4A 3ZE7A 1Z26A 4M89A 4LVNA 2K7FA 5T5QA 1DG9A 1WABA 2R96A 2FMTA 4IQ0A 4ZOLF 2IEGA 4HGNA 4U7GA 4I3GA 1VIYA 2C82A 4RSMA 1R00A 4HLUA 2HF9A 2IUFA 2H7CA 2FG6C 2ZZNA 3G7NA 4J2TA 5DBOA 1P8AA 2Y1CA 4Q3DA 2EW2A 2W90A 3WYDA 1O6BA 4PG6A 1KI1A 2IQ5A 2VDNB 3BRWD 2AXNA 3KKPA 2QX6A 2HMUA 3C85A 1PVDA 5FNZA 1JFFB 3PDJA 2PSDA 3SZ3A 6CHYA 3NYWA 3GW8A 1KAQA 5HF5A 5F1PA 2D1QA 5K3EA 3B8EA 3EW7A 3QPWA 1DKMA 1Y6QA 2J6IA 4JI2B 3D7RA 1XFAA 1XQYA 4A3SA 1C7FA 3U31A 4AYWA 2O2IA 3VGPA 2IEIA 2F4NA 1DEAA 2B30A 1C3OB 3EEBA 1MV8A 3K0EA 5CB4F 1M1ZA 1LW7A 4ZFNA 1V5GA 2OL4A 4XVUA 4UCFA 4QQNA 4RKFA 4X92A 1VZ2A 5KQLA 1F8YA 3C8UA 3UV3A 3FYTA 2H29A 2Q0QA 1TPYA 1YCGA 3C6MA 1KI6A 3RYIB 2IBTA 3PEVA 3R0XA 3GEMA 2YZMA 3HN7A 4EUHA 3WJ1A 4RS4A 4PYRA 3U49A 4IJVA 3BE6A 4C21A 4D8YA 1OTYA 1IXZA 1R37A 2JGIA 1BS9A 1A8QA 1GN9A 3LF2A 4YTEA 4HEA6 1D7AA 2EKLA 4Q15A 1KIMA 1C1HA 4QU8A 3ZBTA 2PKEA 2BFWA 4Q6WA 1CQIA 3E0XA 1CWUA 4LCEA 4L3VA 3I73A 2QIOA 5DNEA 5LWHA 3TLJA 4OGGA 3OE7A 3NONA 2FW7A 3DMYA 2JB9A 3LYUA 4FIDA 3SYNA 4D3SA 1MDBA 3A0UA 4I08A 3JSXA 2VT6A 2NN3C 1M2GA 4RMNA 1G3IA 1TKBA 2CFOA 4MUMA 4K1XA 4YQFA 1I3LA 3NPMA 1MVOA 1WU8A 5FBQB 1JDNA 3KHSA 4QUGA 1NVFA 3JATB 2Q8QA 5ULLA 3IUMA 2XCQA 3NFRA 2C2YA 1UKAA 3V1KA 4AS3A 3B9PA 1HLPA 2BFNA 3KDSE 3RWBA 2EOAA 3L9XA 1EAMA 2CXRA 2X0KA 5DO9A 4WNAA 3STTA 4DSNA 2O2CA 1OQAA 3W04A 4WESB 4XJVA 4DNOA 4UMEA 4FYMA 4R2WA 5ECYA 3CLRC 3C3KA 4MW7A 1XK6A 4DM7A 4RDCA 1A7JA 4RAQA 5BV1A 2GPNA 2AJLI 3VZBA 3I1IA 3ZHQA 5HUQA 3ROZA 3BC1A 1XUOA 3I6MA 3ZDRA 1OGIA 1T4CA 3C3PA 4QG3A 1LU9A 4OK3A 1N2CE 4LOAA 4TN5A 2E18A 1C3EA 3PUIA 1RLIA 3BB1A 1XQ1A 2V7GA 2NTJA 3MAJA 3NPAA 5G53C 4NZOA 2PTGA 2Q3EA 3L7DA 2BFCB 4OCZA 1WPQA 2HWXA 1Z25A 1THZA 1GGKA 1Z16A 4XQ9A 2BHRA 5FUQA 1I7DA 5EXDA 2BM1A 1HDZA 3AERB 3FZNA 4H2DA 5C8ZA 1Z3IX 3EWSA 4UD6A 1CYEA 4U5XA 1C9DB 4ZDJA 2FQWA 3EZFA 4AJEA 1YMVA 1NURA 2XGJA 1RRGA 4O63O 3UKOA 5KU1A 4RJIA 3QEAZ 1U8UA 2PLNA 5GONB 1TGVA 2V7EA 1Z2NX 3DW3X 3QLUC 4GGOA 3UMJA 2A9QA 1NN1A 3ETDA 2O0LA 5LBTA 4FDLA 5F1KA 3K9WA 5FD8A 1KO8A 1DKPA 2H2IA 4JASB 4QU9A 5LQUA 4FZ5A 2MSEB 3JQRA 4G5OA 5EP3A 1R5JA 4YRAA 5AVVA 2DTEA 2PMCA 2X1MA 8ATCA 1A1VA 1WETA 3ICQB 3ZHBA 4A73A 1O8CA 2C7PA 1LH0A 4GI3A 1LC0A 1ZWKA 3DP7A 3UVEA 4CETA 1E3JA 1N92A 4G5HA 2AJBA 4BP8A 3S7TA 4CFZA 4E3ZA 4II7A 3VNUA 4BIIA 2HA4A 3ZXSA 4II3A 5F52A 1J9EA 1RJ9A 2BBSA 5BSMA 3KT8A 1NLYA 3U5ZB 4B3TB 3ZY4A 2Q8NA 3N7AA 4WOKA 4MW9A 1BN6A 2G1UA 3WK4A 1T1IA 4ZHSA 3IEKA 4JX8A 2QI9C 3GJ0A 4DIKA 3RQSA 3L1KA 1ZSNA 2I9PA 2ZIAA 1U0JA 1XXHA 1T9DA 1FRFS 1MX1A 1SA0A 4IHJF 5DB4A 4DLXA 2QUKA 4KH1A 4CLRA 3D5QA 4PX3A 3MCUA 3V2GA 3LP5A 1WVIA 3EQ2A 2XWSA 5LA6F 2CFSA 4HH0A 1RBYA 2RC5A 5DI9A 5KCZA 1NM5C 2BKLA 2ZI5A 3PT9A 4Y2JA 3SQNA 4N5LA 1UBCA 5JSQA 3H2YA 4LOLA 1YR6A 2I2BA 1LI5A 2FW8A 1D4AA 1UPCA 2HD4A 3K0BA 2FHPA 3EC2A 4PWZA 4BC0A 3AL0C 1E1CB 1YDHA 2ZRDA 3H9BA 1DAEA 4RADA 2PYDA 3CWCA 4AFNA 2FPOA 1YB6A 3I30X 1TQ2A 1KE1A 1IN6A 4NVRA 3I9NA 3BWDD 4FR5A 2G72A 2YRWA 4KMOA 1UXHA 1G8PA 1W0KD 2O3TA 2PM8A 1Y7PA 4P4SA 2NZVG 4Z0TA 1E3DA 1IOWA 2JAWA 4O1IA 1M8FA 2ANCA 5CX4A 2P9HA 1QFJA 4G9BA 2HTFA 4Q4DA 4FYVA 2ZAYA 5ALHA 3RU3A 5DLDA 3IDQA 8OHMA 1PNTA 1AZWA 1JG3A 2Z6AA 3HDJA 4EHBA 2G4VA 3FR7A 1J2TA 3GVPA 5JS8A 3Q8KA 2J31A 5BW8A 5AJZA 5AQEA 3AOEA 1K2WA 1XU9A 3CZ9A 2KI5A 1CFZA 3L5OA 4HQNA 4UZFA 4RBNA 5MN6A 3GEHA 3ICEA 2GAAA 1IBKB 2A5GA 4Q6BA 4Z51A 1SK8A 5IARA 1A5ZA 2PJRA 1QQBA 2O5VA 3N05A 2Z4RA 4B6GA 2C99A 2NT3A 4FFLA 5J3JA 3U3KA 3WHPA 1SGWA 2H5IA 3CZRA 4OPMA 1N75A 1KS2A 2W4QA 4TOIA 3FZGA 2O54A 1A5SB 2O3SA 2EW1A 2GFHA 4MYSA 5DN9A 4BE4A 4QM7A 1NY5A 1E99A 2HXYA 3C6QA 4KX5A 3M3DA 2ZDGA 4E6PA 5IJWA 3GEEA 2YJ4A 4LSWA 1X8JA 1NN0A 1RYFA 1D4OA 2JI7A 3MD9A 4NECA 2BYTA 4QYSA 3TS1A 1OAKA 2AUTA 2CMKA 2P79A 4XR4A 4J2HA 2H0AA 3RFUA 1NWHA 5CDHA 4Q9NA 3CW2A 1YJAA 5HEKA 4IEIA 3QA3E 5ILGA 4NU6A 3UW1A 1E8MA 3KZMA 2QX9A 4GLFA 4ZMSA 3W2HA 1FX0B 4U0JA 4ZCSA 3ZW9A 1SHTX 2CUTA 5JNVA 2HU2A 2AEJA 1ZWLA 3ROGA 5J4KA 1L5KA 2O8DB 3W5VA 2PX3A 1ITZA 1AGPA 4IIUA 4F9FA 1CUWA 3ZCRA 1XU7A 4KXQA 3PFBA 3IJRA 4UMDA 1HA3A 4AN1A 4EI8A 3QZUA 1F2VA 1GFZA 2WWFA 3DW1X 2ZRCA 4MMZB 2Q9UA 3Q7TA 3FB4A 2PZKA 4DGQA 4B2LA 4EIWA 4O3MA 3FNFA 3LLSA 1DU4A 4HXYA 1BVYF 2FA9A 2VQDA 2XUKA 4RU1A 2Z3VA 2UZ4A 5AVRA 1ULAA 4V2UA 2GBLC 2JJ2D 2HI0A 2I6QA 1BFDA 2PH1A 1NAHA 1MGOA 3ASZA 4X90A 1LBEA 1CY6A 4RZIA 3FTQA 2EFJA 4S04A 4EUEA 3FJOA 4M7RA 3S2IA 2B8NA 4QHSA 3S2YA 2FSFA 4I36A 1ISPA 1E0SA 2RSLA 3ANTA 2FFRA 4PFQA 4KN8A 4AM8A 2GN9A 4NP6A 1L4BA 1N6HA 4NMWA 5D3QA 4C1BA 4CKBA 5AK0A 5LUBA 2F6RA 4JJ4A 3IDZA 3EXFA 4E21A 5KDOA 3IUJA 3LRTA 3TNDA 4GOKA 1S5PA 5D6OA 3ZE6A 2OWDA 3HKCB 4JEMA 3GCWA 4NOJA 1H8ED 5DM0A 3E3NA 1Z7EA 2R87A 4LN1A 3EXG2 2HT6A 2OV2A 5DCLA 3KIPA 1FB5A 4XLZA 4KWEA 2AUNA 3D59A 2ZTMA 2MINB 1CHNA 3TLKA 1SXQA 2VQFB 3HP1A 4C03A 3QKSB 4ZEVA 5AM5A 4EBBA 5CEEA 3OY2A 4O8ZA 1W30A 3FDZA 3LK7A 1CC1S 1GCOA 1P2DA 1K8QA 3E5NA 3OQPA 3P0HA 3H4TA 1YE8A 5HRCA 3L1IA 4S1VA 4HWRA 4D98A 2Z5VA 4UEOA 1F0PA 2DSTA 1NW5A 1PJSA 1ISJA 4N82A 4R2HA 5DCYA 5CDFE 4DR3B 2DLCX 2CC2A 3A1TA 2V7TA 4Y6PA 3OKFA 3HUUA 3T7SA 3GDFA 3PWSA 2H1HA 1NQ5A 3PFKA 4O4IA 4HLNA 4Z9BA 5FPYA 4KXLA 3RAEC 1GZHB 1E2JA 3OPVA 3QMPA 1ZKDA 1JKFA 2QEQA 2C07A 5NULA 2D5BA 3UA4A 4MVJM 1PZXA 4BTEA 3D4LA 3EGEA 1OXUA 1Q1EA 1UXKA 5H5JA 5BVHA 3QOXA 2QQFA 1KFBB 1IOLA 1X7DA 2MSNA 4JBWA 4KN6A 5JI2E 5E6UB 8ABPA 2REBA 2WTEA 1S8OA 1Q1NA 1SU6A 1V6AA 2EG5A 3C6KA 2POCA 4N39A 3TNYA 5MN4A 4CT5A 1S01A 3CFYA 2V8BA 1U7PA 2Y0PA 2CZGA 2WIFA 5KYYB 2Q9CA 3E82A 5LQDA 3S44A 1U99A 3ZZ1A 3JW8A 5CT5A 2F9MA 4KI7A 5FLXA 1S2NA 4DCNA 2V9PA 5FDFA 3MJDA 4CVNA 4A10A 4ALLA 4BLVA 3TPZA 1ISGA 5KQSA 5H16A 7REQA 1RHUA 3NH6A 2YXDA 3QWFA 3KQVA 1L5HA 3LH5A 3PC4A 4G63A 4J4BA 3ESZA 4A6PA 4ZT2A 3MOIA 5FYDA 1QV6A 2VSQA 3L6DA 2PXHA 3CKKA 3IOCA 3AUJB 1PZMA 2TMYA 3I4LA 5F4ZA 5B3JA 1YU9A 3C6YA 3AVVA 1USIA 1L9XA 2UUAB 3UT5A 1U81A 2XZPA 2FWAA 1HMYA 3F47A 4PINA 4OK6A 2V7UA 3GDGA 4WQMA 2X8JA 3CPEA 3VO9A 2RCYA 3D6FA 3MGBA 1VDMA 3EWIA 2WMOB 3L6OO 4LSZA 3DE6X 3LLMA 3D6TB 4WN9B 3C74A 9ABPA 2XW6A 1JALA 1WBBA 3SVTA 3VNAA 3FMGA 1HFEL 3VHQA 3THWA 3MCAA 4G5QA 5EUCA 4Y2TA 4L5JA 2VHZA 3NHBA 1DIAA 4OHMA 1UQRA 1NUAA 2WJIA 4NFSA 4NK5A 1BCSB 4BCDA 4WUTA 3ZI0A 3HLKA 3MWEB 4IOMA 4Z5XA 3DMGA 1E7QA 3T3EA 2GN4A 1P19A 3GEGA 1V3QE 3MRVA 1BVUA 4B3CA 1NDUA 4AI6A 3PCTA 3TECE 1TK3A 3F4KA 4ZRDA 1IEQA 4ZJZA 3EZLA 1HSZA 4E5SA 3CTPA 3IC5A 2DBRA 3HCFA 4G0PA 3U81A 3G2KA 4Q1CA 5BY2A 1I9CA 1FNSA 2X76A 1LPSA 3AM3A 3QGMA 2P90A 1C9YA 1SWVA 4AK9A 2H4HA 3KU4A 1V11A 4KDFA 4DZTA 4PNEA 1XN1A 1HNNA 2PUJA 2W4MA 1W5EA 4BO8A 5BURA 5AM4A 4JVOA 5DWQA 4NI5A 5FWAA 1MTZA 1G5QA 5DTEA 1Z15A 3G82C 2B25A 3M4XA 3MWEA 2X8LA 4RFLA 3UWOA 2ZSAA 4FMCF 2BTOA 4QU5A 1V5IA 3SDBA 1G8JA 5IUNC 2PV0A 2JA1A 1W94A 4KDRA 2WNIA 4LPKA 2H5JA 3NVAA 3Q7EA 5JCPA 3U7HB 1FP4B 1X1DA 3DZJA 1FFBA 3OC6A 4EEZA 1ECCA 4Z3KA 5A2QA 4FN4A 1IBCA 1SUDA 3EGOA 3FCOA 3PP8A 4FMBB 1XEWX 4HMQA 3MGKA 5AOAA 3U9SA 4O1HA 4RH0A 5ETJA 1J8YF 3DZKA 3K05A 3UFBA 1VTKA 3RBAA 2A88A 2CBXA 4M22A 3NX4A 2OHVA 2RCNA 1ZZGA 3A1CA 4NCIA 4LTNA 5F5NA 3E23A 1Z37A 2BMDA 4MV3A 3RWMB