4UHFA

Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
278
structure length
278
Chain Sequence
b'AQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELCDEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKENRRRVAERVRREGPGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGHLPPMEQPERVTQAIREWLRKVHTEAGHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title Structural Studies of a Thermophilic Esterase from a New Planctomycetes Species, Thermogutta Terrifontis.
pubmed doi rcsb
source organism Planctomycetes bacterium r1
molecule tags Hydrolase
total genus 107
structure length 278
sequence length 278
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhfA00
3FVRA 4FLFA 5AM2A 2XLBA 4LKOA 1XRPA 3S8YA 4EB0A 2HA2A 3NOXA 1THGA 4E46A 1P0IA 3D7RA 1MNAA 4MYSA 1Y37A 2QXTA 3FLAA 1UK6A 5AO9A 1MNQA 1TIBA 5AP9A 4NMWA 5A7FA 4C4ZA 2FUKA 4OSEA 1XKTA 2VJBA 4QWMA 4F0JA 5AI0A 3MUOA 1C7JA 3LIIA 5IVIA 2VATA 2GZSA 1YSCA 2HL6A 2XUFA 5LZ5A 1X2EA 2JIDA 4DYHA 3G0DA 3HZOA 5AKZA 1OCEA 2HA3A 4X7BA 3WK6A 5EIAA 3ESDA 2OLEA 5EHQA 1EK2A 3C87A 4L72A 1AC5A 4C4XA 4F5ZA 1XROA 2Y2VA 2QUAA 3FWHA 2DHCA 3C6BA 3WK4A 4B9AA 4JUIA 2VJDA 4PW0A 1EA5A 1GPNA 1VZ3A 3K9BA 4Z49A 2QRUA 4G8DA 5YASA 2QUBA 5IH7A 2GBIA 4JNCA 5ALHA 4G8BA 4QE3A 4C4YA 3PF8A 2VT6A 3TRDA 1AUOA 3WK8A 1QIEA 4X6XA 2VTVA 2H7XA 3G0CA 2XDWA 3N0TA 1E89A 1DT5A 3PE6A 4AQDA 3KXPA 1ZIXA 2WIKA 3GA7A 1ACJA 3PF9A 3YASA 4FFWA 5DWDA 3QMMA 2B20A 3HC7A 3AZOA 3FSGD 3FLBA 3H2GA 3G8YA 2B61A 3PDCA 5ALIA 5D6OA 4N8DA 5CURA 1BS9A 1YCDA 2BJHA 5AOAA 2PVSA 5CBKA 1A8SA 4UFNA 5AI5A 3C45A 1CUJA 1VKHA 3WK5A 1CUIA 4OD0A 3SWWA 1QTIA 2ZJ6A 4AO7A 2WUGA 3D3NA 4WFIA 3EQ8A 5IKXA 2OCIA 5DLPA 2FX5A 2HRQA 2XUOA 4KE8A 4Q3OA 3HRHA 1XZMA 2GBGA 4MXDA 2ZSIA 2R11A 1BE0A 2PM8A 3BWXA 5JYCA 1RP1A 4Q3LA 3OPMA 2JGEA 1HKHA 4LHEA 1VXOA 5AIAA 1T2NA 5JZBA 4KAJA 4BDTA 5HCUA 5EGNA 3BDVA 5JAHA 2DFPA 3EF3A 3WL6A 3M82A 3W05A 5ALGA 4Y9SA 1QIHA 4BP8A 3WIBA 1FSSA 2K2QB 4A16A 2PU5A 3EIOA 3O9VA 3B5EA 2O2HA 5A6VA 5ESRA 1U2EA 3WL7A 4INZA 5ALTA 4E15A 4AMZA 2D5LA 2DQYA 2DCMA 2JGFA 1XQYA 1VXRA 2CJPA 3GUUA 3OTQA 3BE8A 2WTMA 4JYMA 3IUQA 4C88A 1Q0ZA 1ZGBA 1USWA 5HF5A 1JKMA 1K6EA 1R88A 4YASA 2BFNA 1BRTA 4WY8A 5AKGA 3RARA 3WMRA 5T4EA 5CT5A 1ZJ5A 3FCXA 3I1YA 1AMNA 4GW3A 5CW2A 2PKYX 1AKNA 1CUDA 1H2XA 1MX9A 5EHNA 2WJ3A 3QYJA 3VJMA 2BGNA 5CRIA 1CRLA 5EFZA 1U65A 1IZ7A 1N5MA 3M83A 1QONA 3I6MA 3CN9A 2BGRA 3GROA 4LYEA 4EA6A 4H0CA 2HU7A 2Y1KA 1SOMA 1Z68A 3FYUA 2PSHA 1YB7A 4MQLA 4DMFA 2C7BA 1G5FA 2LIPA 2V97A 2RI6A 5LZ7A 3TEJA 2WIJA 1W76A 1QIMA 3WA7A 3DNMA 4BE4A 1JU4A 1QZ3A 5AM3A 5I9IA 5HFNA 2VJCA 4H7DA 4KACA 5LKAA 2OG1A 3WI7A 1FFEA 1R50A 3Q8WA 4H7HA 2ACEA 1A88A 2QJWA 4JYPA 4D9JA 5HKBA 2XUAA 1W1IA 3A2NA 2E3JA 4J03A 5HKAA 4UHFA 1CUVA 2O7RA 3I2KA 2O2IA 1XLVA 1P0MA 5FOQA 1QO7A 1UOPA 3B12A 2BUBA 2XUKA 1LLFA 3W06A 2YH2A 1A7UA 3UMJA 1LNSA 3OC0A 4EY6A 5A7GA 1CUHA 2AJBA 2HA0A 1MPXA 2IX9A 4PO3X 5AKEA 1XZEA 2ZSHA 4EY7A 1BEZA 2OAEA 4KR0A 2CMFA 4FOLA 1R9NA 3QPCA 1ORWA 5AKJA 1VLQA 5AICA 2HIHA 4PF1A 4KYVA 1XZGA 3AUKA 4CFSA 1JJIA 6YASA 4X93A 4J0JA 3I6YA 1XRNA 1RYYA 3UUEA 4CG3A 5CH3A 4NVRA 3ANSA 3DJYA 1WB6A 3HSSA 2DHDA 2WU4A 4HRYA 5FRDA 2ECFA 4GHWA 2QJRA 3DL7A 2OCLA 4GECA 3HXKA 3GFFA 2JGLA 1E8MA 3A70A 1KU0A 1HQDA 1XRLA 4BBZA 3P2MA 1TRHA 1JFRA 2GZRA 3WKAA 5ALFA 5EIEA 2RAUA 5E4JA 4P08A 2ZYRA 5LZ8A 5J3JA 1CUYA 1ACLA 3F67A 2OCGA 4TPKA 4QDOA 4XJVA 1MTZA 1TK3A 1MX1A 4AN1A 5D7BA 4PQEA 1UWCA 1VA5A 3DEAA 1T4MA 2G4LA 2X8BA 1QGED 3NGMA 4Y2JA 4Y2UA 2QKYA 4MWSA 3V9AA 1J1IA 3OG9A 1R1DA 1E5TA 2Y2UA 3H18A 5AI9A 4I4CA 1C7IA 5FUMA 1YS1X 4X3CA 1IVYA 4RGYA 2BUAA 2WFLA 5AI8A 3WA6A 2QOEA 2H1IA 3DLTA 1TCAA 1XQVA 3E4DA 4HXFB 3WYNA 3DD5A 3ANTA 3BJRA 4KAFA 2HM7A 1XQXA 2WHQA 2WKWA 2C5FA 1JU3A 4A23A 5AM0A 2XE4A 1DWPA 1CQZA 3WL8A 4GI1A 4C89A 4DGQA 4DNFA 1JT2A 2JF0A 1ZD4A 3O4HA 4GBGA 1NU6A 1BCRA 3C8HA 3O4JA 5CT6A 1CUEA 3O0DA 2ORYA 2WTNA 1Y7IA 1GZ7A 3AFIA 1CUCA 3MGAA 4W1QA 2IITA 4Y2XA 2XLCA 1YB6A 3FYUC 4H7FA 3AIMA 4J0DA 3QBJA 3WKBA 4U2DA 3U1TA 1IMJA 1XZLA 2Y6UA 3PI6A 1GQSA 3STTA 5FLKA 3QPAA 1H23A 1FFBA 5HK9A 3WKDA 3G0GA 1ETHA 5HF9A 1J07A 5JARA 3KWJA 4HAIA 2QMQA 1QE3A 2HADA 1YS2X 4W63A 3C5WP 4BE9A 1XZBA 2VF2A 5DYWA 2JGKA 4X92A 3FBWA 1E8DA 3PUHA 3CCBA 3L1IA 4AXBA 3F9CA 1A8QA 4OU4A 4B7ZA 1QIGA 4U2CA 4BVJA 1ZIYA 2AXEA 1THTA 4WY5A 1OXMA 1QIIA 2ZJFA 1WOMA 5BOVA 4X95A 4BZZA 1DX6A 4OB7A 3G02A 3E3AA 4LYDA 3ZWQA 4H7JA 4UBKA 5HQ3A 1N1MA 4MQMA 4XX1A 4BC0A 1LBTA 3G9ZA 2XB6A 2QT9A 4B80A 5K3EA 4IO0A 1DT3A 2G63A 5SYMA 3RLIA 4H7KA 1IUNA 2CUTA 5AM5A 4UUQA 3WKEA 4C87A 1H2WA 2XMSA 4LXGA 1F8UA 5LZ2A 1DINA 1VA4A 2QTBA 4UPDA 4B6GA 4G1FA 1ODSA 4P93A 2PL5A 1LBSA 2W22A 3FCYA 5ALOA 5LZ4A 1UKBA 4TVKA 1CVLA 2VEOA 5A7HA 2ZJ7A 4JEIA 5HK8A 5CXXA 5ALNA 4U2BA 4Y2PA 1MU0A 1SC9A 5AKYA 4W1SA 4TGLA 1WB4A 1AQLA 4WDQA 3A2MA 5ALEA 3STWA 1GPKA 2I3ZA 3BIXA 4LIPD 4BAZA 4B0OA 2H7CA 4O08A 1K4YA 3H2KA 4L3WA 2G5TA 2HA4A 2GBFA 4B83A 3KWFA 4PSUA 3TJMA 4HVTA 3O9MA 1UKCA 1F0PA 1O6GA 5CT4A 1HBJA 3WWOA 2EDAA 1EVQA 2XMQA 2HFKA 4UHDA 2XQIA 4CCYB 2XQFA 2XUQA 4FLEA 2Z8XA 1CUAA 3WWPA 3WZLA 4W1PA 2WJ6A 1M33A 1JMKC 4GEGA 1ORVA 1CLEA 3C6YA 1GKKA 5K5EA 4BVKA 1XZJA 3WJ1A 2HA5A 4K6GA 4X97A 2HRRA 4Y2RA 1SCIA 2QZPA 3IBTA 3WZMA 3R0VA 5DTIA 4NZZA 1WHSA 4UBNA 1UT6A 1LPAB 1TCCA 1WPXA 4KRYA 1PFQA 2V9ZA 2H9YA 1CUSA 1LPBB 5ALUA 1Q83A 3U0VA 1FFDA 3FVTA 4F60A 2EEPA 3E0XA 4ZXFA 2WHRA 5ALLA 3WJ2A 4EZIA 1LGYA 5ALSA 5DJ5A 4Q05A 2UZ0A 4DNOA 4I19A 4WCVA 3OURA 3STUA 2WSLA 2J4FA 4KJXA 3F96A 1BEEA 3DCNA 5DYYA 3UUFA 4HZGA 3ZV7A 4AMYA 4DNPA 1QIJA 1XLUA 2PPLA 4ZGBA 4X90A 3PICA 3EQ9A 4Q82A 3I2JA 3R41A 1CPYA 1GT6A 3DKKA 1JJFA 3K2IA 5T4FA 3KSRA 4W9RA 3D5EA 1JI3A 4N5IX 2BUCA 4GWLA 4WFKA 3WYDA 1CUZA 4UFPA 1YA4A 2GYVA 5AM1A 1LPMA 3ILSA 1ZI8A 4IH9A 3G7NA 1TAHA 3H2HA 3AIKA 3SK0A 1CUUA 2OGTA 1R3DA 2QS9A 5HZGA 1XZFA 2XT0A 1EB9A 5ALZA 3ZPXA 2WQZA 2WG2A 4AB1A 3RM3A 2HFJA 4EBBA 1WHTA 5C81A 4H7EA 1VE6A 3F8SA 3I1IA 4QA9A 4ITVA 5AKXA 3IA2A 4UFOA 4M0EA 4FBLA 4BYMA 4Y2VA 2WU3A 2PBLA 4N8SA 1TQHA 5K3DA 1EDBA 2YASA 3QPDA 1QTRA 4E11A 5T4HA 2AJDA 3MUNA 2ES4A 4C01A 4BRZA 4ZI5A 5ALPA 1MO2A 5ALYA 2I78A 1LPPA 3AZPA 1PJAA 3SX4A 5AK3A 4XVCA 4X91A 2CZQA 3ZLTA 5LKRA 1XZIA 1R9MA 3DOIA 4MEBA 4UHEA 4K6KA 3HACA 4Y2TA 3D2CA 3R40A 1QO9A 5ALXA 1BN6A 5AKLA 2FJ0A 5E4TA 2C4HA 5SYNA 4V2IA 3GELA 3KOOA 1DTEA 2Z3ZA 3BJMA 3D2AA 2I03A 2W6CX 1E3QA 2GYWA 1GQRA 5CT9A 4H18A 1QFMA 4DMCA 1NU8A 5KBYA 5D3KA 1VZ2A 2HU5A 5ALDA 1JJBA 1U8EA 1R4ZA 4EHBA 1P0QA 1YA8A 4B9EA 2DSNA 1D07A 4BCBA 4B0PA 1HPLA 4FLMA 3VXKA 5K3FA 1EXWA 3C43A 5FXMA 4RPCA 1YAHA 4Q34A 5CH5A 5A62A 4BCCA 2OQIA 4G4JA 4C6HA 4GXNA 4HXEB 4OYLA 4BCDA 5CMLA 2ZYHA 2ZVDA 4DLNA 3G0BA 1E66A 4M0MA 4L0CA 3FSGA 1ZICA 5LLSA 1L7AA 3TGLA 1MN6A 5JALA 3ZI7A 3V1MA 4BB0A 3ICVA 2VA9A 1UOOA 4ARBA 2WG1A 5FPPA 2PSDA 1N5RA 5EHXA 5LIPA 4KE9A 4RE5A 4J7AA 3FYUB 1QIFA 1RWQA 2V96A 3C5VA 4FNMA 1PV1A 1XKLA 4UHBA 2Z3WA 3HI4A 3JYHA 1ODCA 2J3QA 2ACKA 4G8CA 4CIAA 1UK8A 4IH1A 1ZD3A 2XUPA 3BIWA 4UBJA 3IIIA 1XLWA 1UK9A 1A8UA 2XMCA 2O2GA 4ZWNA 4QEKA 2XMZA 1ZJ4A 1GPLA 3RKSA 4N8EA 3C6ZA 4U2GA 1CFJA 4MJ3A 3ZLUA 3WWDA 1L7QA 4P9NA 4X94A 5EIHA 5DNVA 3VISA 2XMBA 4J3JA 1E8NA 2VT7A 2XMRA 3OM8A 2JEZA 3I28A 3BXPA 1UXOA 2XQKA 2Z5GA 3R3YA 4AN0A 4GLBA 3NUZA 4UHCA 2WFZA 3I2IA 3D4LA 3PFBA 3DDUA 5K3CA 2QVBA 5E2IA 3V1LA 5K3AA 1EINA 3ICWA 3AILA 3VKFA 1EHYA 2H7YA 4H77A 5AK6A 2IIVA 5AI6A 2JGIA 5JD6A 2EDCA 3H1AA 4BC1A 5AM4A 3WKCA 4PSDA 4BZWA 3IULA 1W52X 2PUJA 2CKMA 4DSAA 1IZ8A 1O6FA 1KU6A 1KEZA 1ZGCA 2PSFA 2RIPA 4X71A 1IUOA 1LPSA 4FWBA 5IVKA 1GGVA 3WK9A 4BATA 2YYSA 3IURA 5K3FB 1MAAA 4YPVA 2D0DA 4BDSA 4AO8A 4OPMA 4W1RA 3QM1A 1QFSA 4S0XA 3V1KA 4ZV9A 3R3XA 2BAGA 4OB8A 5DNUA 1MX5A 2JGJA 4I3FA 3CCCA 1WB5A 2NW6A 3LS2A 3L1HA 2ZYIA 1DWOA 5H3HA 1UFOA 5LYYA 3A2LA 4HS9A 4FKBA 4DTCA 1DWQA 3G9XA 5AK5A 1N8SA 1EDDA 1ZD2P 2DR0A 3JW8A 4ZV7A 4Y7DA 2J3DA 3V1NA 5JADA 1XRRA 4FHZA 4KE6A 7YASA 5FPQA 1EDEA 4Y2QA 5ALJA 4X85A 4OCZA 3H19A 1WM1A 2ONCA 1Q84A 1GXSA 3HLKA 4CG2A 4NS4A 3WQHA 4G9GA 4Y2YA 2WFLB 1DU4A 3R3UA 2WIDA 2C0PA 2OCKA 5DTJA 5HF8A 4J0GA 5A71A 1UKAA 1U4NA 1LZKA 3G9UA 3R3WA 3FYTA 5KREA 3V48A 5AKIA 2B9VA 5AHXA 1BROA 4X6YA 5IVDA 3WLAA 4BTLA 2V98A 1MT3A 3I2FA 5CT8A 1HLGA 1UOQA 3O4IA 3AIOA 1MAHA 2QM0A 2FJPA 1AX9A 2G5PA 1YASA 4CCWA 4B82A 2R8BA 5KWJA 1NX9A 2RONA 4KE7A 4H35A 1HL7A 4DMKA 2C5GA 4YK7A 5AI4A 5EHZA 1HDEA 3KDAA 3A6ZA 5FKJA 4KEAA 5LZ9A 3VVMA 3WL5A 1TKRA 3SC2A 1W6RA 1QJ4A 2WUFA 4YX9A 2C58A 4H7IA 1OILA 5JD4A 4K2AA 4DSZA 5T4BA 3KD2A 3ED1A 3F97A 4FBMA 3DKRA 1DQYA 2CB9A 4KAAA 5F4ZA 3I2HA 3PFCA 1LZLA 4CI9A 1AGYA 3C6XA 1H2YA 2XUGA 3ESCA 4UBIA 4BP9A 5JANA 3CN7A 3I6ZA 2RHTA 4MYDA 4P92A 4N5HX 3G9TA 2WILA 1SCQA 2AJCA 3BDIA 2CBGA 3HJUA 2OPHA 1EVEA 2WG0A 1L7RA 2B4KA 3O4GA 3H2IA 5C8VA 3QMWA 3MVEA 5BWCA 2QR5A 4OUKX 4EY4A 1G4HA 3S2ZA 3VJLA 5JATA 1BU8A 2XUJA 2C0QA 3RK4A 2WLSA 4JH0A 4UBMA 5C7YA 5FDFA 1GKLA 3FNBA 3GZJA 3LCRA 2JEYA 2Q0XA 2WFMA 4K5QA 2VSQA 1G66A 3STVA 3VVLA 3I2GA 5JASA 2RGUA 3NWOA 1WPRA 3T52A 3FAKA 1EI9A 3R3ZA 3LP5A 5HQ3B 1ZOIA 2Y6VA 3E1GA 4KRXA 5AK4A 2HA6A 3W2TA 3WWEA 4WFJA 1ODTC 1X2BA 4G5XA 4K6HA 5C8XA 4GDMA 2RHWA 2VAXA 3H1BA 5A2GA 2WIFA 5FV4A 1XZAA 1CUFA 2OXEA 1XRMA 2I3DA 5AKKA 1CQWA 4BAGA 3B3QA 1ZI6A 2YXPX 3R3VA 4OYYA 3W04A 3QH4A 2WUEA 3H17A 1CUWA 3Q0TA 5ALMA 4LXHA 4QDUA 3WK7A 4EUSA 5K3BA 1ZD5A 1Y7HA 2ROQA 1DX4A 1K8QA 1JMYA 1VE7A 2HDWA 5BV7A 2JGMA 4BAUA 2OQVA 5JD5A 3IUNA 4AZ0A 1I6WA 3H0CA 4EY8A 2XUHA 3QMVA 4OB6A 5ISMA 4FTWA 4MEAA 5JIBA 4QNNA 1BCSA 1S8OA 2PX6A 2AJ8A 1QIDA 3D59A 4E14A 4QDZA 3D2BA 2GYUA 2XUDA 4ZRDA 2XUIA 4CG1A 1P0PA 1TCBA 3LIPA 4A5SA 4G4IA 3H04A 3QITA 3HEAA 5EI5A 3PUIA 2WUDA 4B81A 1K63A 2WHPA 1AURA 1F6WA 3FLEA 5JAUA 4Q3KA 4AO6A 2P8SA 4WDRA 2J4CA 4J0CA 4AX4A 1XQWA 3F98A 1CIJA 4X6UA 1QLWA 4PSCA 1VJ5A 2X76A 4EY5A 5CXUA 3G0IA 3M81A 1ISPA 2WM2A 3VJKA 4ZREA 1G42A 4UBOA 3AJAA 2PSEA 2XMDA 2XI4A 1CV2A 2OGSA 1CUGA 4X00A 5HF6A 2QXUA 5LP1A 1J06A 1AZWA 4FDMA 1MJ5A 4DIUA 4DM7A 4QZVA 1EB8A 2O7VA 2XQJA 1XZCA 1EK1A 4DMHA 5D3ZA 3IUJA 3IUMA 3JWEA 4BVLA 5JAOA 1X70A 4J0HA 5I8PA 1J2EA 3OOSA 1LPOA 3W9UA 3C8DA 5ALWA 3BL8A 1C4XA 5C8ZA 2Z8ZA 2HU8A 4XIIA 1IUPA 2WJ4A 5ALVA 4ETWA 2VAVA 4G9EA 4J0KA 3AZQA 3DYIA 1UK7A 5ALRA 1B6GA 5AOBA 2JBWA 2XMGA 4MWTA 4UBLA 4IHAA 4Q1VA 4BRSA 2XQGA 4ROTA 1QIKA 4PV7A 5ALQA 4IQ4A 5AH0A 4WJLA 4QWWA 1SCKA 3CXUA 4BTVA 3L1JA 4HRXA 4F21A 2GBCA 3GBSA 2PU7A 4B84A 4FMPA 1W4LA 4AZ3A 2BKLA 4PNZA 1ZI9A 3EBLA 1B41A 3DL4A 1SFRA 1QOZA 4B85A 2VQ6A 2HA7A 1WCYA 4M0FA 3ESBA 1XFDA 3QZUA 3WIOA 5I7UA 1LPNA 1YR2A 2VJAA 1FJ2A 3T4UA 2CEKA 4IH4A 2PSJA 3IB3A 3N2ZB 1BN7A 4UHHA 5AKHA 4OU5A 4RNCA 5CH8A 1CR6A 3STXA 5AOCA 3STYA 5BWBA 5CTAA 5JAPA 4QLAA 3DQZA 4CIBA 2BCEA 3K6KA 1VOTA 3WWCA 3ZLVA 1XZKA 5E4YA 2HHAA 3C70A 2OAGA 3HYSA 3LLCA 4XWGA 5DNWA 2PUHA 3BF7A 4G4GA 1XZDA 4LXIA 5IVHA 1YAJA 4J0IA 3IVMA 3H2JA 3HABA 4U2EA 1CUBA 4QDTA 4DNQA 5JZ9A 4FNGA 5AJHA 3X3HA 1UZAA 3QVMA 4U2FA 5ALKA 1EX9A 1FFCA 2OGZA 4ARAA 1F0NA 5DYTA 3O95A 1Q0RA 3D0KA 3ESAA 3EQ7A 4RE6A 4Y2SA 5HFAA 2WHPB 3BF8A 3W9BA 4L9AA 1W75A 1DQZA 1EH5A 1H22A 5FP0A 4FFVA 4HXGA 4HTAA 3VDXA 5JZSA 2DQZA 3DYVA 5KWIA 3DS8A 1XZHA 2WIGA 2ZYSA 3AINA 4QDXA 4QLOA 3FOBA 1CUXA 2X5XA 3M3DA 1K5PA 3DOHA 4CCYA 2DHEA 1H2ZA 3IDAA 5AIBA 1CEXA 2AJLI 1XRQA 1FFAA
chains in the Genus database with same CATH superfamily
3BGVA 1I1OA 4KYUA 2A9VA 5F77A 1ECJA 4PWZA 4C1NA 2BR3A 3PGKA 3LZ6A 4NJEA 1ZM4A 1T6BY 1XRPA 2GZAA 3M2PA 3S8YA 4BQRA 4EB0A 4A5OA 4AG3A 4BNJA 2HHJA 3K0KA 3OJFA 1JR2A 5CLIA 1U9IC 4AKGA 2FSPA 1ZR2A 3LL7A 2IP2A 1P0IA 1VCMA 2P7HA 4O3FA 2CJXA 3PFNA 4NEGA 4P36A 3IPRA 4ZD6A 1CZOA 1LTKA 3SN6A 1JFFA 1WU8A 3JZDA 5FA5A 7REQA 4KFCA 3FLAA 3RTAA 3RGGA 2PMFA 4L51A 1NXVA 4RANA 4MKRA 5TV2A 1E59A 5AP9A 2NM0A 4I66A 4GDFA 4NMWA 4LFAB 1JHDA 3IP3A 1Z0DA 2CLMB 4RM2A 4O4HF 3CH4B 3K0BA 2B1GA 4BASA 5BQFA 5AJYA 2IUSA 1IU9A 4COKA 4EA7A 3HKBA 2XF8A 1EJ2A 1V3QE 3KSDO 4JJEA 4I50F 4DEXA 5IJXA 2NO0A 1K06A 2VRCD 2XYPA 4JLSA 1KJZA 4IO1A 1F4VA 4GX1A 4LEIA 3WDSA 1QHHB 3QKTA 1NV8A 3W6PA 3AV3A 2NUAB 2FRDA 2WA1A 4FVTA 2VNSA 4JQOA 4IJUA 3G1TA 1FFGA 4GMXA 4TMTA 3KKOA 3TW8B 2JJ1D 1JAZA 2REXB 2GPBA 5LZ5A 3MOIA 5DT9A 1XJQA 4GI3A 3MQ2A 4NEQA 5FQNA 5KAPA 3J81A 2ATXA 2ETVA 1A3CA 3GZNB 2X4DA 2WMNB 1OCEA 3LOUA 3Q1KA 1T9GS 4B4OA 4C14A 1R66A 1EJ0A 5EIAA 1EJ6A 5TE9A 1JHPA 2WHXA 4Q3DA 1EK2A 3EW9A 3VR5A 4A10A 1PWXA 1RRGA 2JFGA 3OECA 2PJRA 2WSSA 3JRNA 3Q7EA 5DX1A 2N1MA 2RAPA 1D6SA 1H94A 3ANMA 3THOA 4C4XA 4TXJA 3UO8B 1FMCA 1DX9A 4ECEA 3NDRA 1XZNA 3NO4A 3OHSX 3INYA 3L6CA 1N1GA 3PEUA 1HM5A 5HTKA 1Q0LA 3RVLA 2IBMA 3H11B 1VBMA 3HWSA 5CP8A 5DE3A 1KRWA 3M6UA 2AZTA 4X24A 4JUIA 2J59A 4Z8XA 4X8HA 3P71T 2QW0X 4YFYA 4FP9A 1YVEI 2QR3A 3KQTA 4D9FA 4PX3A 1I3KA 4FFMA 5FBRB 5CDUA 3QFHA 1MHTA 3CNOA 1Z0JA 3IB6A 4PAWA 5CNJA 1E0SA 2CYAA 5F2KA 1TM3E 1HUQA 1KSFX 1Z82A 3PDHA 3OJCA 5G53C 1RI1A 5BT9A 3WIEA 5LWHA 4Z9XA 1Z7EA 4XSHA 2QLLA 5K0NA 5F2OA 1THMA 5IBCA 4PNHA 3SVTA 1U8FO 1V35A 4JVLA 2ETXA 1GZ5A 1ONSA 3EJWA 4G8BA 1K0UA 4WBNB 3V6MA 1KBQA 5HKKA 1G18A 4G5QA 2OORA 3VPXA 3HBAA 3S27A 3A0RB 1IY0A 1YV9A 4QL3A 1BDIA 1UZNA 1F4PA 5HJ7A 5E3HA 4FUQA 1Y8ZA 1KMQA 1T5TA 5FWYB 1AQUA 1QIEA 3U7RA 1TJPB 4F92B 4UNSA 4WKCA 1A04A 2H7XA 4UTNA 2XCQA 3S1AB 1IG0A 2F55A 3M5PA 3N0TA 2FN8A 3O74A 4TWRA 5I47A 4UE3S 2H1RA 1XAHA 3UF0A 4YR7A 1Q3HA 1MV8A 3X1WA 1V5FA 1ZIXA 2WD8A 2V1UA 4LXQA 3UATA 2SKCA 3IE1A 2CL7X 4KWCA 3C97A 3QMMA 3ZHVA 4ZT3A 3TDKA 4CV1A 3RV4A 5D01A 3HC7A 3EX7C 4MLPA 1ZH4A 3GYBA 3MWGA 1T8WA 2FWJA 2IU6A 2PZBA 5HUJA 1FUKA 2H00A 2P6NA 3G8YA 4XIFA 5AESA 5D6OA 3OPYA 3G13A 5CURA 1BS9A 1UBUS 4EVRA 3CYFA 1G8SA 1YE5A 2MSEB 4HGPA 3B2EA 1QU2A 3T3OA 1L5NA 1A8SA 5TVGA 2BFEA 4UFNA 5E1DA 2VLBA 4LDPA 2JAOA 4RZ2A 3KVNA 1A1VA 3C4VA 3EVAA 1I14A 4RLQA 4TWAA 2DPLA 3D6VA 3E82A 3T7DA 4RS3A 3ZGNA 1DC7A 1LK0A 2VCEA 4JI0B 4JJ7A 3FETA 2OLJA 1B42A 2QX7A 2YBDA 4MV9A 3KHKA 1Z4KA 3D3NA 3EQ8A 2XZOA 1NN5A 1JLLB 4HMPA 5IKXA 4YRTA 2D4HA 3NALA 5E9QA 1LB1B 1KVUA 1NZJA 4IAOA 4PGGA 4LJ7A 2P5TB 2WJAA 4G97A 3HRHA 3VZPA 5LLTA 1XDZA 1XZMA 2YQ5A 1ADFA 3OPXA 4TKUA 3V5NA 4XARA 1POWA 1FPMA 4D9HA 3EH1A 3LK7A 2P2ZA 4C3OB 3FR8A 3PA6A 5BYBA 1BH2A 1D1PA 3K0CA 2GLUA 2J0VA 1R8QA 2F59A 1EFRA 5L3RA 2PK3A 3AM4A 4YJ2F 4WSOA 3IBYA 4ZIRA 1PV2A 4K86A 5LXTB 3ETHA 1HKHA 4FN4A 1JKFA 2AFIA 4C4PA 4CMJA 5H83A 4LHEA 1VXOA 2PKXA 1HTTA 1G8JA 4NJEB 2P79A 3RS0A 5JAQA 2PIAA 2VRBA 5ELLA 5F23A 1W46A 3GNQA 2RHJA 4NONA 2A67A 2HCTA 4NPAA 2X5NA 2PAFA 3E9CA 5LQJA 4EB8A 3OZTA 3F7NA 1L6IA 2GAAA 2QTGA 1WX1A 7REQB 1JFFB 1I33A 1UP6A 5M5BA 1GYQA 2ZXEA 2DFPA 3GLKA 2OHJA 3IOMA 2AOXA 4QJ4A 4AF7A 4DBZA 7ADHA 8ATCA 2H07A 1BMDA 3H13A 3EF3A 3L7CA 3UCFA 3V1UA 4QO8A 1L5SA 1PL0A 1R0KA 1V16B 3P2EA 3DBRA 1BDJA 1CIPA 3ZHBA 2JGNA 3EDOA 1UJ6A 2Q46A 3IJRA 4MW4A 3B1KA 1J8MF 3D64A 2FPUA 4HN9A 5DWVA 3REQA 4BP8A 3WIBA 4KX3A 3UOAB 4J4TA 2MOKA 1RVV1 3CR3C 1I9CA 3AKDA 4TL6A 2PZEA 1P5ZB 4F11A 5C46F 1L4LA 4FCCA 4M1KA 4PFSA 4QU0A 5F1YA 1U63A 3PR1A 2F62A 5ESRA 2VDQB 2WNHA 3OCVA 1S89A 1ZN9A 1FA9A 1PSWA 3AYZB 2GAIA 2WKPA 4HGOA 4CKCB 1GHTA 4XGNA 1FQKA 1OXXK 1OX6A 1L3IA 3KS9A 1KSGA 3CX3A 3KBBA 4H6XA 4BZPA 4E15A 5CA0F 5LNK6 2IS2A 2XV1A 2X15A 3OP4A 3V4VB 1XK7A 4AS2A 1UMDA 4ZI2A 4J0EA 4YRSA 1C4OA 1JSZA 2ET6A 4KG7A 4EK9A 1XFAA 2JGFA 4FZRA 4ZEVA 1VXRA 1HEUA 2QDXA 1XHEA 1U31A 3M6MD 3TNFA 4X8OA 4ZC8A 3G8BA 3QQPA 4GP6A 4J2OA 3EE6A 2XA9A 1KI7A 1NZFA 2A9RA 3I9LA 3TJRA 1C1XA 2VNKA 5J43A 2C8KA 4CF3A 3N87A 1Q0ZA 4MPTA 5CXQA 1IK6A 1USWA 2AI2A 5HF5A 3WFZA 4IZ6A 1SG6A 2GMWA 1LFAA 1EAMA 2BFNA 4FYYA 5TGZA 3ZDZB 1RZRA 3A1UA 4E94A 4YP7A 2G04A 3LXMA 1OIVA 4LV8B 3VPDA 1CQJA 3ZDYB 3JAWA 4B3RB 3S55A 1K7XB 1K92A 4KBGA 3OUTA 2PKRA 1U7UA 4NC9A 4G89A 2Z6QA 1AMNA 1VC2A 1X3SA 2B30A 4G0VA 2H92A 4GW3A 1Y1RA 4MLZA 2PKYX 1H3FA 2C1XA 2C8LA 2PX4A 2VN8A 2DR3A 5ADVA 2D06A 4E4YA 3NMUF 5GZ1A 3G5LA 3U7FB 2FN7A 1QHXA 2WY2D 3U39A 5B36A 4JX9A 1PS0A 3SF8B 1P1RA 2CFOA 1ZVVA 2VH5R 2XEXA 4DF3A 3VJMA 4FR0A 1VIYA 3PIDA 5DPMA 3AY3A 1PP4A 1YE8A 3BFXA 3B48A 3N7TA 4J6EA 4A8PA 2X8WA 1N5MA 3M83A 3OQJA 4BVAA 5HJEA 5F3RA 2GOYA 4XH9B 2QRJA 1ZHHA 1I4OA 2DBZA 4HDNA 3S8MA 5KTOA 1GUDA 1I10A 2F1IA 3FPLA 4HEA6 5DULA 1V95A 3ZY5A 4EMSA 1DTWB 1X1BA 3I6MA 4AJOA 5IEBA 3GROA 5HEKA 4FEYA 3NJ8A 4MS4A 4LOAA 2PS3A 3H6HA 2HU7A 2FPKA 4H0CA 2ACWA 5LA6B 3V4PB 3OTOB 2PZGA 4BGDA 3OZIA 3EY4A 3PHLA 4MQLA 2YJNA 4YUYA 4S3MA 2C7BA 5L3QA 3CRMA 2X22A 3VZRA 2V97A 4DV2B 1GCGA 1NJ2A 2CBZA 4BGVA 1IHOA 2FU5C 4LNHA 5LZ7A 3K1AB 2ZM6B 4AS1A 4ILEA 3TEJA 2WJJA 3TECE 1J0BA 5L3SA 1HI9A 1RQGA 3IBFA 3RVPA 3WA7A 1NI4A 3DNMA 1IPFA 4PCLA 2P78A 3TFOA 4R8KA 3T5PA 4I1YA 4Y6GB 4R8RA 3C3JA 4D45A 4HT3B 3D8NA 4AY2A 3ZY6A 3HCPA 1JR3E 5BVGB 5LKAA 2OG1A 2AX4A 2ZIVB 1VJGA 2QRMA 4MLDA 3B36A 2J7PD 5BUZA 4CM1A 2IY9A 2WTUA 2DBVO 1HTBA 1D2GA 3U26A 1FYVA 1HZZC 1PVDA 4BKOA 3PNPA 1KDZA 3WHIA 1QYIA 4OYRA 2Q3DA 3TM4A 3UJAA 4KQ1A 2DWCA 2H48A 2QJWA 3HCEA 5EWMB 1XK6A 2XKBA 3ENNA 3UK1A 4UNRA 1VDMA 1T9ZA 2ZAIA 3ONWA 2DBRA 2OHGA 2XUAA 4JJ8A 3GR6A 1RP7A 2IZ1A 1E2IA 4NOJA 4MQEA 4DQXA 3A58B 5CB8A 3VR4A 3B1WA 3G0HA 1Q95A 3A2NA 4HDCA 5EZYF 1K1EA 5KCZA 1CUVA 3EODA 3ME5A 1JR3D 3I2KA 2NZXA 1PZFA 2ZTLA 3CEMA 4CHGA 4ES6A 1XLVA 4HQLA 5BWNA 1FDUA 4JD5A 4YHBA 1ZJYA 5CX1B 1Z4OA 1V7QA 1H6BA 4V0LA 3AVPA 3RYHA 2CXTA 3DZ8A 4JKIA 3SYKA 5CB4F 2QMHA 4HLDA 3O21A 5KZMB 5KVCA 1BHO1 1EE9A 1VP3A 2FEOA 2Z0MA 3GVXA 3G2PA 4ZU3A 3THXA 3NV7A 1MJFA 3IAM6 4NH4A 2W70A 2ZRGA 4OVKA 3QKWA 2HAEA 1FEZA 2XUKA 4ZIRB 3MFYA 1AQ6A 1NF3A 3GJ3A 1Z35A 2YH2A 1OY1A 1DAPA 5BSMA 3TLXA 3TRJA 3UMJA 2Q6KA 1GDHA 1OAAA 5H81A 3VZSA 3KD3A 1ZN2A 3K0HA 5CIWA 1P4RA 4DWVA 3ROTA 1LVHA 1MB4A 3DOUA 3FH0A 4YJHB 2KBEA 2NG1A 3OHPA 4L6CA 4DZTA 5TY0A 3SLRA 3ZWMA 4CL0A 2A7XA 5J63A 3L3BA 2IX9A 1CQIB 1DFHA 1GR1A 1NM5C 1Y8QB 3EDMA 5BV8A 2Y1XA 1SOWA 5CVUA 5KWEA 2QENA 2PKEA 1YCFA 3PDWA 1N3IA 1X7DA 1KNQA 5IAKA 3CRZA 1SIUA 4B7UA 3Q9NA 1BEZA 1ML4A 3E3LA 3NTVA 2JIQA 4KR0A 2OB1A 4IDNA 4WZZA 3H8VA 3Q2OA 1E3DA 1EGAA 1LJ8A 2WWRA 1R9NA 1ISFA 1QK3A 2FSVA 3K5WA 3QPCA 3QPWA 2PXCA 1NVAA 5L45A 1VLQA 1W85A 2V03A 2CHFA 2C8VA 3D6AA 1P2TA 1FQJA 2HIHA 1SG9A 3REQB 4KYVA 1B26A 3WYEA 1EM8A 1UP4A 2HKIA 3AUKA 4HQKA 2CHGA 2BCJQ 4US2R 4GF5A 3GUYA 4Q9AA 1JJIA 3KPWA 2CLDX 4YH1A 1ST2A 4X93A 5E3JA 3B9QA 3I6YA 4R2XA 1QX3A 1LI7A 1N5DA 1XRNA 4TT3A 3F5QA 1TB4A 2NQ8A 3G68A 4GLLA 1JQBA 1OFUA 2INGX 3R5FA 2OSBA 3K73O 3U7JA 9LDBA 2IHBA 1D0IA 2I62A 3UMSA 3UUEA 3WNZA 1SK8A 1YBFA 5JWRA 4E5VA 4R3UC 1ADYA 1GCIA 2W7TA 3AHCA 1JBKA 4NVRA 4PWYA 3DJYA 3GMIA 1SD1A 5T8KC 3L1VA 3AKZA 3TB4A 3ZGLA 5ENZA 4PTYA 5LP6A 3V8MA 1G4UR 2ZRFA 3F9RA 3KPVA 4L85A 5TPZA 3SJ7A 1X1DA 2O48X 5F9FA 5FRDA 4IG4A 4BVBA 1T15A 2OCLA 3LY8A 1UWLA 3VHXA 1AS0A 1PIWA 4X20A 5DNAA 3P0RA 2QM8A 2FFRA 1X80B 2NZJA 4NENA 5GMOA 4YMLA 1E8MA 4LYYA 3ROQA 3UCXA 2PXHA 1JTFA 4ANFA 5CCXA 1QYDA 2VK1A 1HQDA 1SCDA 1ZJWA 1KZ7B 5M34A 1QNFA 1Z0ZA 1JFRA 4PHCA 3U1VA 1SGWA 1RQXA 3WKAA 3G82C 3UXMA 4BX8A 5CA1B 2CNWA 2JPDA 1VJ1A 1XB2A 5DI3A 2IT1A 5ALFA 3TSAA 3L8EA 2GM9A 2A5YB 1PQ4A 2QD5A 4JQCA 3LWBA 4OLJA 3PBKA 4Q1FA 5COBA 1V3TA 3LT2A 3ESQA 4XUDA 1UPTA 3CTMA 3KCQA 4JFAA 1YVRA 1V6AA 2BZSA 4MROA 2ZYRA 1Q1AA 3DH0A 5DXAA 4RDXA 1FFSA 1ACLA 1KPIA 1MABA 2BGUA 4MSUA 4ONEA 1SA0B 2NGRA 2W8BA 3UMGA 5KDOA 4UXHA 3UXEA 2KI5A 4J29A 1U1DA 1JTVA 3SM3A 2JH9A 4YRRA 3WQRA 1EFUA 4D8UA 3L18A 2JFNA 3DEKA 1KAHA 1PG2A 1TK3A 1XMIA 3IH5A 3KYDB 4WXMA 5D7BA 4EZEA 1UWCA 3PJFA 5FJIA 1WNFA 4BKRA 1G6Q1 5KJFA 4RK4A 1D6JA 5FLEX 3F0TA 2Q07A 4B6FA 1T4MA 2RCYA 4FFLA 3VNUA 2CLLB 2QLMA 2G4LA 1KWKA 3NPAA 4CEJA 1Y3HA 3R5SA 1YZKA 4IVQA 1V8ZA 4UASA 1T0IA 3GLGE 3V7WA 3K9NA 4LYGA 3M6FA 4QYIB 3F2IA 5ILQA 1J1IA 1YR7A 1SHTX 4TLAA 3PC8A 5L3QB 1R1DA 1E5TA 5K4AA 2NACA 1D2CA 4I4CA 3ZHOA 3RAGA 4RTKA 3LUFA 3AOGA 2RGYA 2Q9BA 1YS1X 2P1RA 5ED0A 5FWDA 3OQOA 2UYHA 4ZPXA 2NUTB 3QYFA 1PR6A 4TSKA 4BV3A 1XU7A 4S1NA 3ERCA 5ARCA 2BUAA 3A3YA 1EFTA 2G76A 2WFLA 5AI8A 5DM60 4YRPA 5KOIA 2RGGA 3QU5A 1M5TA 4JOQA 1Y3BE 3SQOA 3J81k 1G5QA 4LC1A 1ZLYA 2BISA 2ZRDA 3EC2A 1RPJA 3LX8A 4I4TA 1SPXA 2OFFA 2D2XA 5F52A 3DWFA 4AAYA 5IZCA 4XYEA 3ICPA 3Q0IA 2WWXA 3E4DA 4PZ0A 2YTZA 4Y1EA 4JA0A 2ZS9A 1PWEA 4GC9A 3EVZA 2VDLB 2XADA 4MKXA 2ZWPA 2FETA 4JYCA 4YVFA 5EZ6B 5HCNA 3ULKA 2FGKA 2PMKA 2XSZA 1X1RA 1YI0A 1M2OA 3BJRA 3IQZA 3OUUA 3NC0C 2J4DA 4FOPA 4RWEA 4PRLA 1ENPA 2KSQA 2WHQA 1QPZA 4MVJA 4MQEB 3VI3B 1SHJA 1K7EB 2C2WA 1UAGA 4Z8YA 3BHIA 3TXAA 4HAWA 3U62A 1Y4AE 3C6KA 3L4EA 1ZVKA 5HX7A 4ND8B 2LR0A 1QMPA 4C4TA 1VSQA 3D3EA 3ZD6A 1E63A 2HT1A 1CLUA 1Z15A 4F4DA 2OM2A 2GM4A 4AJLA 1Q0HA 5AM0A 2IOYA 2V7BA 2RGWA 3JXEA 1DWPA 5A4KA 2RDMA 5AVSA 3WGGA 1KP2A 1JHUA 1QZXA 4WN9A 4URXR 1U8AA 5KSWB 3QLUA 1CQZA 1RHUA 2H17A 4GI1A 3SYMA 1CZNA 2CHUA 1SU4A 2Q3MA 3BIJA 4C0QC 2P1ZA 3HJAA 1JS1X 4Z9AA 3VOTA 1PFYA 4IIUA 4CEHA 4TMVA 1SQ6A 1NDUA 3PYMA 4M0DA 5B1EA 4QNMA 3L0ZA 3GCZA 3KTDA 4RIFA 2I67A 1KC1A 3C4QA 1VMAA 1NU6A 3A31A 5LQKA 3IAFA 2C83A 5TX7A 5I4BA 2G1AA 1O9HA 3SF0A 5JDCC 3GN1A 2D1QA 3LAWA 1BE6A 3NOVA 3C8HA 4YCAA 1GOTA 4GR4A 2FRXA 4YI5A 3TQSA 2H2IA 3CH6A 1R6XA 2GFQA 3B1JA 4EQZA 3F4KA 3HVIA 5K1ZA 2WABA 3E6AA 5H70A 2PE5A 4P3YA 2NPIA 4O4HA 1GZ7A 3M4ZA 4KUEA 5SZIA 2UUAB 2DG2A 2YINC 3AFIA 3IILA 1COWD 1CUCA 4IV0A 1NUAA 3RH0A 4FMCF 3F6BX 4W1QA 2NWQA 3OZFA 2OUKA 5JW6A 3AESA 3T5GA 2IY7A 3BJZA 1JVSA 3N2IA 4HFRA 5ARDA 4S1WA 3WO0A 1T35A 1RLTA 2ONJA 1VKNA 2BFDA 2H63A 1JHAA 1RI5A 2JFUA 2NZYA 4ZAWA 3AL3A 3WKBA 2ZWIA 1WUYA 4U2DA 5C4GB 2UUCB 4YRNA 1ZS9A 2WBLC 3N8DA 4FDLA 4Q1EA 3WBJA 5I9SA 4A7PA 2P1DA 2D8AA 2OECA 4KGZA 4U6SA 4FNOA 2FUNB 3U17A 4QQKA 4YEDA 3GL9A 2WINI 4JEUA 1XZLA 4HX9A 4D9NA 2G77B 1DIRA 3LCJA 5JCXA 1THZA 4DS3A 3CX7A 4YROA 3PI6A 4L15A 4YRQA 2FWBA 2ABWA 4B2YA 1K6MA 2KQUA 1FFBA 3LD9A 4TZKA 4JT8A 3B89A 1DAHA 1WULS 3WKDA 4HB2A 4M7OA 1F3OA 3JQDA 1N6PA 3G0GA 4KPGA 4D8VA 5LP6B 2FMIA 3HYCA 3GRKA 4E5KA 4LKRA 3AR9A 3ZHYA 4G37A 4LGCA 4WXHA 3HDVA 1QKIA 3HU5A 2AI1A 2QMQA 3AVYA 2P2GA 1KEUA 2JJMA 2VXCA 4HNQA 3CLUD 4TN5A 4BE9A 2ZVQX 3EWSA 2F9LA 3ADCA 4L57A 2RD2A 1NL3A 4XD7A 1ZU5A 1GAXA 5FYQA 1JSRA 3NM4A 4YP0A 3UW1A 5ELXA 3LHFA 3LRTA 4INOA 2WOJA 4QJBA 5B4TA 5B6JA 5G40A 3VQTA 1N6OA 4F5YA 2P4UA 1O03A 1ADBA 3FBWA 1E8DA 3OHMA 4CTNA 3Q0EA 4H3KB 1ULUA 1R6BX 3EXFB 4KOAA 4M0UA 1MENA 4PNPA 3ND6A 5H1YA 4RH0A 4OU4A 4E0BA 2FR0A 4KK3A 1Y42X 1SQFA 1TAGA 3RSHA 1PBTA 1QIGA 2UYYA 1ZNXA 1HRDA 4M98A 4NU5A 2Y0BA 1JPVA 1ZIYA 3IDOA 2OHFA 1GAWA 1QK5A 2M2IA 3FM9A 2NYRA 4YRDA 3UHAA 2WYOA 1MABB 3UAOA 2W8BB 4AZ3B 3NAMA 2HLDD 2ZJFA 2I7DA 4NG4A 1DKQA 4QECA 5LB2A 3LECA 1XHLA 4C6TA 2R5FA 5JRZA 1ORDA 4LG1A 5B7NA 1CZHA 4LQCA 3H9GA 3OE5A 3LC0A 2MMCA 4PIVA 2W6ID 3BRQA 1J97A 3HCAA 4M9SA 3ZWQA 1N0VC 1MC1A 1O7JA 3OZ7A 5KTPA 4UBKA 5DISB 1LDMA 4MQMA 4XX1A 2HU2A 5DMXA 5KJCA 3SS9X 2AOTB 4MV8A 1BW9B 3G9ZA 4JLDA 2XB6A 4IXMA 1S1CA 5C5IA 5L95A 3JQAA 4B80A 1HYEA 3UT5A 3QF4A 4K9LA 3A32A 3KT3A 2G9ZA 2YOGA 3WAKA 2ZIFA 4DSTA 5JLAA 5KUTA 3LM8A 2ZVJA 3GX1A 5SYMA 2YWDA 4Y9TA 4F9TA 1NI3A 3IKVA 2HTEA 4RL6A 2B5OA 2CUTA 4FEEA 3LFHA 4ZQIA 3RRNA 3G7SA 2JLBA 3IODA 4HJRA 2PLFA 4C87A 4B3GA 1E3IA 3WIVA 3OZDA 2QVGA 1RM5A 5CFMA 5DLDA 4FEGA 5CIQA 3EIXA 4A26A 4DDHA 4B6GA 2GD6A 4L5BA 2X13A 3TVDA 1WR8A 2XW6A 3BTOA 4KLNA 1I2AA 3EG9B 3LK6A 3NFRA 4ZU1X 3VYWA 5I7RA 2PKQO 2B69A 2XE8A 3PGXA 1LBSA 4BNZA 4KVFA 1S02A 2W22A 2EWWA 3EH2A 4LY6A 4DV1B 1SEPA 4ND6A 2VOJA 1C8BA 3NVKI 4D9EA 1FK8A 3CF2A 2G9UA 1JBQA 2CFSA 1UKBA 2FWMX 2I99A 4TTRA 1T5IA 1FMFA 1YTUA 4TVKA 2R4UA 2JKZA 2OZLA 1A4UA 3KKZA 3DE1X 2I3GA 3K1YA 1A4IA 3BXEA 3OTGA 1NWHA 3EA0A 3P9KA 4YAJA 5JRJA 3DCJA 1E1YA 3R23A 2DWUA 1GEEA 4CKZA 4YT8A 5ALNA 3LQYA 3CZCA 7AT1A 4U2BA 4IHQA 5MFPA 1B23P 3NTOA 5B3JC 3OCJA 3A1FA 3PNVA 2XNDD 2OYCA 5AKYA 3DDNA 3W6OA 4V0OA 4W1SA 2F64A 3GEMA 1V5GA 4TGLA 4B4VA 2E6UX 1ORIA 4C08A 3CE6A 1V9LA 4WDQA 4YJ2A 3U9TA 3STWA 2ZWOA 4F8JA 4QICA 4B31A 3PGA1 1OTXA 3OCZA 4LWZA 4MGYR 1IAVA 3HJHA 2IVZA 5KIAA 4D25A 2ZB4A 4BAZA 1VQ1A 1I01A 4B0OA 2H7CA 4PBTA 3TVYA 4P4NA 4UULA 4BQPA 2ZZMA 5C18A 3H2KA 1SWWA 2V8BA 4CEHB 3LFUA 2WM3A 4DIDA 1D4FA 1E9CA 4M38A 4O4IB 1GPAA 2OBNA 1YJCA 2Q9CA 5EY5B 4B83A 5DN6D 3TJMA 2ADOA 3O9MA 4D2IA 4ZYWA 2ILTA 1KY4A 3N5CA 1F0PA 1FUYB 3PEEA 1O6GA 3AU8A 2R6JA 3R0XA 4J4HA 4EECA 2FEXA 4KO3S 1USKA 3FPJA 4PZEA 4HNVA 1MGOA 3MBOA 3MLBA 1AUPA 1CRWG 3QJ5A 1Y98A 2QRHA 3ZE9A 3TRFA 1KYYA 1A9XA 4B3CA 4C7OB 1RD4A 5LJLA 3FWYA 3WMXA 2PMDA 3PIRA 1QFXA 4YRLA 1VLJA 2O59A 1I3NA 2WJ6A 5KYXA 2BRUA 2Z3VA 1JMKC 4DZRA 3VFDA 1GRVA 2EFCB 2IYVA 2VDUE 1Q22A 3L6EA 2YWCA 2VYND 4O4LB 4JXXA 2ODBA 1OLXA 2IU4A 4J1NA 4J94A 3I0ZA 2A6PA 1D0SA 3BFJA 4FCWA 1WIWA 3U2QA 1UFRA 3GRVA 2I8LA 5BN4A 2PD3A 4RQUA 2VPWA 5CA0A 5K8UA 3D6FA 5IJ9A 3MMNA 5TQ0B 4CIDA 1FTQA 5DK6A 4B09A 4NFHA 5B12A 1P77A 1IHDA 5L9AA 2ZQ5A 2HRRA 2YHUA 1HSZA 2OWEA 2O3QA 4Y2RA 2IU0A 2AS0A 3CUEF 5KQPA 1J39A 3NBAA 4KIJA 4I36A 3IBTA 4OLHA 4RYLA 1NY5A 2CYCA 4FCVA 1SCUA 3SZMA 2QL9A 2O20A 1CETA 5BVHA 2NUBA 2QTWB 1XWIA 2H52A 3B3AA 2G1JA 2WICA 4PPQA 1ODKA 2JHPA 1OH7A 1K9SA 3EG5A 4J2TA 3RRMA 1GITA 1LPAB 4WPGA 7MHTA 1X39A 1G9TA 3I9NA 4M8SA 1WPXA 4KRYA 3UICA 1IOZA 5TLSA 4GYJA 2C82A 4Q4CA 3ROEA 3JQ9A 4NPCA 5KNCD 3KDSE 3QOFA 3TOSA 4UOEA 1G6OA 3EPJA 3TOXA 3JD0A 1O89A 3GJ6A 1N4AA 4PSKA 1JA9A 2Q3EA 3BFVA 4CDNA 1DMSA 1DP4A 5FOXA 4K2HA 1TL7C 2EEPA 4F2WA 3WAJA 1W0JA 5DCYA 2YVLA 4HNUA 1BS2A 5C7IO 2H4FA 3E0XA 4K1LA 3S29A 3A9CA 4E2XA 1T3ZA 4OMFG 4XFDA 4TYNA 5C8YF 1P1JA 5KNBA 4AQYB 2P5UA 2EU8A 3LQ1A 2UZ4A 2BFCB 2NU6B 2IEIA 4WEOA 1XGKA 3SE7A 3ADPA 3I73A 3VH4A 3VR2D 4JP3A 2BGGA 4DNOA 2GHTA 2ERYA 4WCVA 1W5SA 2I4LA 3KKPA 2NO4A 1KKLA 2ZTUA 3FF4A 4O2LA 3SBDA 2M98A 3OURA 4JUBA 5H4HA 3MCUA 3KV3O 3P9QA 1SQ0A 2L82A 3NEPX 4HEQA 4X44A 4DN6A 2CWDA 2WSLA 3A28A 2IYUA 3P32A 2G9NA 1QVWA 5FTKA 1TVCA 2FMUA 2B5VA 4RJ2A 5EMMA 1HR0B 3F96A 2JLYA 3WLSA 4DT1B 3IJ5A 2ZSBA 2NZ2A 4YDHB 3H2YA 3L2OB 2EJUA 1DMRA 4UZSA 1YOBA 3EWIA 5DYYA 3UUFA 4EG3A 1RPZA 1JIXA 2I7TA 2CNDA 1LI4A 1QIJA 1V8FA 1Q91A 3M6IA 4NV1A 4IDOA 1VCIA 1PWYE 1WLYA 1XLUA 2ANBA 3JQAB 5CEFA 1F1JA 4MA5A 3RIMA 4X1IA 2JFWA 3EQ9A 3I2JA 1A5BB 4OATA 5C8DA 5K8JB 2C7RA 1OXVA 3DVRX 4ZTBA 1V47A 2PDAA 2FUG1 4TKVA 2PT6A 3G5AA 3KSRA 1O6CA 1Y7TA 2OMKA 1NFFA 2PAAA 2EYQA 3H1FA 2R86A 1IQRA 1JI3A 4BMOB 4QEZA 3I05A 3ZKWA 3TZKA 4AN4A 4M2LA 2QRVB 1ZPDA 2FKNA 2I4MA 1QK4A 2GYVA 3A0UA 2ZGVA 1SBNE 1LPMA 3F78A 3WL4A 5MF6A 3EAQA 4IH9A 1GYRA 3G7NA 1TAHA 4TRJA 5J1TB 1IEWA 1QG4A 1IZ9A 2YHSA 3B85A 1MLDA 3MXTA 3SK0A 1MB3A 1R3DA 4L9RA 4YAUA 3RC3A 4FKMA 3ZCPA 1ZUD1 3LC2O 2X6QA 4TVSA 5EZYA 2XT0A 4Y18A 2PS1A 1K7FB 2IPLA 2QL6A 4NBRA 3AUFA 3IV6A 4YRFA 3TOCA 3QEBZ 1SKYE 2EV9A 1E2EA 1QHYA 4QXQA 1T24A 3MWJA 4N0EA 1QZTA 4JS0A 4RADA 3B2QA 4DV6B 1M7HA 1R4NB 4DWJA 4OLAA 2NO7A 2VIIA 2VPYA 2YVAA 3VR5D 4BNDA 3I04M 1JJ7A 1VE6A 2WSSD 2GZ1A 3Q3GE 4Y30A 3IBCA 3KVVA 4Z4HA 2L0XA 4AZVA 4MV4A 1TIPA 2X8AA 1V96A 2O0MA 1T2VA 2Y1EA 2ZIAA 4L16A 3VBCA 3ZS9A 4A03A 3EASA 1Z5GA 2N1BA 1L4HA 2FCAA 1ECPA 4FBLA 1E32A 1RE0A 4AW9A 4BYMA 4G0ZA 4Q4AB 5D6NA 3EC1A 3H6KA 4GPD1 1EBBA 1LF0A 4HN4B 4TXLA 1ABEA 2XGGA 1YD7A 4INJA 4MNTA 2FQXA 3M5CA 1E9EA 5ITZA 1L7XA 4DE5A 1T2CA 1A8HA 3I32A 1Z6XA 1AB6A 1NUPA 1N6HA 1Y1PA 4EABA 3RS8A 2FA9A 3KKLA 4R2KA 1T34A 5EHGA 4P2GA 1NKTA 2FPGB 3KETA 2YN2A 4ZO9A 1F14A 1VFPA 4PNEA 2B9EA 5JS6A 3CONA 4C01A 4BRZA 3HDHA 3IUBA 3HCNA 4C04A 1T13A 2HIAA 4B34A 1V41E 5ALPA 1KVRA 1IOLA 5HKKD 5KYXB 4EAAA 4ZO8A 3G5TA 3AYXB 1KR5A 2BMVA 2I78A 2Q99A 3AZPA 4F7DA 3GWZA 1FU4A 2UU9B 5JCJA 4QUEA 4BE7B 1RZVA 1YRQA 3AEQA 1JG7A 1XU4A 4Y2GA 3RU9A 5CDTA 1GLNA 3FY4A 1GKYA 4CQLB 4CMIA 1OLXB 1Z28A 3R5HA 1OC2A 2OV2A 4AF6A 4M0CA 3QF7A 4GMKA 1DRWA 6NULA 4GUAA 5CU7A 5FHQA 1OIWA 2NIPA 3ZLTA 5FQOA 1T5DX 4JZKA 3DFFA 5CA0B 1YB1A 1R9MA 4JR0A 5JEDA 4CLXA 3N3AC 3KJEA 4LTMA 4UHEA 4ZVVA 3LHKA 3HACA 1FRFS 3FGOA 1DCMA 1FTSA 5LMNB 4YDRA 4HH1A 4OHZA 3D31A 3OX1A 3IT0A 3ZH9B 4O5AA 4B45A 1JIJA 2BF7A 4ZJPA 1S96A 1BN6A 5AKLA 2RBGA 1CJSA 2ATEA 4ND1A 1SUSA 1KAEA 5E7JA 3O47A 1QPGA 1Z6ZA 1SCUB 3IIMA 3CEPB 1XLTA 5SYNA 1WRBA 2P0EA 3MWEA 4J3NA 4M9QA 1OLOA 5BVHB 1DTEA 1V7PC 1J8YF 5KTSA 1BYUA 1N34B 2XPCA 3IJPA 4XQEA 2RAVA 1DUIA 3FTQA 2H06A 3I8OA 1ZO8A 3I04A 4PXYA 4B33A 4N0DA 3USZA 4JHLA 4CT4B 3VKGA 1Q7GA 5EE0A 4G2TA 4OK3A 1NQVA 2NT4A 2GYWA 4Q9IA 4YWHA 1H5NA 1EA7A 1HNZB 1WTCA 4KQFA 1U1GA 2OP0A 4IIDA 3UH1A 4KOEC 2WDZA 4FXOA 3E9RA 2A1IA 4EM6A 3VH3A 1O5IA 1L5LA 4Z1OA 2YHAA 5SV2A 5D5HA 1JL3A 3F6PA 2HU5A 1RIIA 2QJTA 3LF2A 1VYVA 2PRYA 4EHBA 4EP1A 3QXGA 2AFIE 4WNIA 3B1ZA 3R7LA 3UGJA 2J1LA 4B0PA 4Q48A 3A1WA 1I5EA 4WERA 1ZNZA 3ZUPA 4S04A 2TSYB 5DIFA 3SEQA 1EHIA 3KZCA 2IYEA 4JKOA 4LJ4A 4OH7A 4OBWA 2JIZA 5BXYA 1AH2A 4GRDA 5K3FA 3VI4B 1L7VC 1T8YA 1QCZA 4N0QA 3C43A 3O31A 2CF5A 4KXXA 5IKEA 1X94A 1QNLA 1EFRD 4LRXA 1CF9A 2OQIA 2C2KA 2ZIWB 2O3JA 1OVMA 1RLOA 4CIWA 2PUEA 1EFLA 3MLEA 1PJCA 3W5DA 1E1CA 2FW7A 3MK31 4OYLA 4TYYA 2O05A 3C5EA 5TPWA 1F3LA 2JZOA 4RZ3A 1KYZA 1TUBB 2DTDA 2Y77A 4KHZA 5BQ5A 2AVDA 3L40A 3ZV3A 4R1OA 3ZN2A 4W5NA 5JCZA 3EPLA 2ZYHA 1QDUA 3PC7A 4G4SP 5BNTA 1LUAA 5JJKA 2HZBA 1V37A 1NRWA 3BBPA 1QV9A 5IF3A 5KEIA 2A0UA 2UVPA 3C3WA 2IEDA 2Y66A 4JITA 4DR4B 4NRDA 4X1IB 3EDRA 3GDOA 5DM1A 5HTOA 1ZHFA 3CH7A 4L0CA 1BXRB 1G4AE 1QHNA 5E0KB 5FR2A 3TNLA 1E6EA 1HQKA 3DEFA 3PR3A 4CF5A 4E5YA 2IEZA 5A5VA 3KQUA 1MN6A 1NKVA 3MA0A 3A25A 1C7RA 1UJBA 2GN2A 3FMIA 1ZJ6A 3ICVA 2M1ZA 4X8MA 3RYCA 3DAGA 3E35A 1Q50A 5I7AA 4G0QA 3T99A 1G8KA 2XXBA 2OG2A 3WHLA 2WG1A 3NWBA 1RPNA 3ZR4B 1OZ0A 1BJKA 4H1VA 5HQTA 1FZTA 2PSDA 4R16A 4GI2A 1B16A 4KE9A 4RE5A 1K8RA 5LIPA 2QTZA 4PU0A 4CHTA 3DFUA 3FYUB 4QTTB 1R3UA 3DR3A 1RWQA 3VYUB 1TW2A 2JAHA 4NU0A 1XWFA 2EGUA 3FNGA 4Q01A 3WADA 1X19A 1XP8A 2V96A 2FE4A 2YRFA 2OHHA 4M55A 1XKLA 2QUKA 2Z3WA 3WGTA 1R37A 3L7KA 3F5DA 2QRQA 1SUDA 3E48A 3GU3A 1OAKA 3JYHA 4KLAA 5J4LA 4G8CA 3DR5A 3DZIA 4RVGA 3W7BA 4TZTA 3OWXA 1R16A 1QVRA 4IZIA 3UJBA 5JNLA 1N3BA 3FDJA 3LDFA 2ZS7A 1ZD3A 1K3UB 3AXSA 4KL8S 4D6XA 1RC8A 1KJIA 1VL0A 2NUPA 3BIWA 4MW9A 3U7QA 3U4QB 3LA8A 3IT2A 2O2CA 3I83A 2XCUA 3IIIA 3KALA 2W5UA 3VPSA 5LPNA 1ZOLA 3VMFA 3O7MA 4GSKA 3OMXA 4Q37A 1H8EA 2Q4OA 2R6AA 1O4VA 2NP6A 4O2AF 5DXJA 3DDCA 3WL3A 3A4NA 2B98A 4KV9A 1GPLA 2J87A 1HE1C 3PVCA 4N8EA 3RKSA 1KBZA 3RQIA 2Y9MB 1A2QA 1RZRD 1KOLA 4REOA 1RTTA 3Q15C 1K66A 1U8YA 1CP3A 1CFJA 3AEYA 2XA1A 3LKDA 4U2GA 4P81A 3DDZX 2J0UA 1W8IA 1WQ4A 1KVTA 3UQYS 4AI6A 5TEVA 1UC5B 4DDUA 1Z0AA 4MUHA 1CT9A 5CFQA 1PR5A 2OAQ1 5DHQA 1ZC3A 3FPGA 1IY1A 1JIVA 3M4NA 1J9EA 4P9NA 5H02A 1L5OA 1QYRA 1V4VA 2E18A 2X7XA 1XC7A 4CN8A 4HR7A 2CKDA 4NYIR 4TQUS 4QT4A 1OU0A 1H5UA 1QQ6A 4F3RA 3C7TA 1F51E 4I4LA 1E8NA 2RB4A 1U99A 3RIXA 4NR0A 1H66A 2NU8A 3WGLA 3I28A 5EXEA 1ZC4A 4EGSA 1W36B 4YDSA 4F3KA 4O6VA 4CQMA 2PL3A 2LDXA 3ZXSA 1KK2A 3NUZA 4UHCA 2QNBA 5L3ZA 3QENA 2WB4A 2WVJA 2Q8NA 3JD3A 4YNBA 2EW8A 4UAVA 4KGXA 4LVCA 1IRXA 2IW1A 3DDUA 2EWMA 4NZPA 5K3CA 2GCPA 3ZCRA 3WS7A 3WLNA 3UMMA 1U2GC 2ZTHA 4YGYA 3IDQA 1YS4A 4KQMA 5HYVA 1Z56C 2UV8A 3E8SA 2VKQA 1JKXA 4XLLA 4Y6OA 4N9QA 3TQTA 3UYKA 1VRVA 4LC0A 4L22A 5MGNA 2QZZA 4RA9B 1AXGA 2CSUA 2E4VA 5AK6A 4LY3A 4DHWA 5DNCA 1T36A 3I1JA 1R9JA 2IIVA 4MMZB 3MPOA 1OBFO 4AULA 4DC9A 3RYHB 1BZYA 2EHJA 3HUDA 1WD7A 3MWEB 4HQOA 1QPBA 1EVKA 3H1AA 3V1TC 4BC1A 5EVCA 2AKAB 4LRWA 4D9CA 4E09A 4I9UA 1QF6A 1Z63A 2WW8A 1P8AA 2FOIA 4DAEA 3D4PA 3WKCA 4KGVA 2JK1A 3QVSA 3T95A 5EXDA 4ZZ0A 1KI1A 2PUJA 4ER7A 4R1UA 1GY8A 3RHTA 4DSAA 1PW5A 4ZKEA 3ZYZA 2F8MA 3AWDA 1SXHA 2FMFA 2O6HA 3TVTA 4B8WA 1G59A 1JFVA 2Z4SA 2DPHA 1HV8A 3BUSA 3E4CA 1ZGCA 3GPCA 4RULA 3U5ZB 4MHSA 2FPXA 3W5IA 4LF6B 3NBXX 1ZM3A 1PVOA 1IUOA 1RM4A 2QVLA 1LPSA 2C4VA 5KNCH 4FWBA 3U9SA 3NDJA 3VR4D 1EQAA 1GGVA 2JFBA 1WCXA 1P1BA 3BCHA 3S68A 3ETDA 4L76A 4BATA 2ZWAA 1N2XA 2CLOB 2XCIA 4I14A 2CL0X 3NEJA 4MAFA 4YYZA 1NP6A 1AZLA 1NQTA 3O94A 4TXNA 4QX6A 1MAAA 1S4QA 5K3FB 1Z6AA 3G79A 2E1PA 3ELYA 1DO0A 4RK0A 4WFQA 2M6KA 1OBOA 3I4CA 5DHSA 3TKYA 4OI4A 3ZUGA 4BWVA 2AZDA 4BLOA 2C2XA 1TC1A 1DC6A 1GU1A 1XEFA 1YRHA 2D0DA 2G1KA 3IVRA 4MOWA 4MX8A 4YR9A 5JS8A 4DR7B 1WU7A 4K8OA 3LUJA 2SKEA 3NUGA 3QM1A 1XQ1A 3HLYA 1SC6A 3QFFA 1QFSA 5JVDB 4C0JA 1C81A 4RVDA 5K2OA 4ZV9A 4OFZA 2C97A 3EDCA 3EXHC 5GVRA 1O9BA 2Z98A 4I7EA 2E37A 4WVFA 2VJNA 2F90A 1DBWA 4N49A 4JI5B 2JGJA 1ZK2A 3LVBA 4I3FA 3DFZA 1ZA1A 4NBUA 4XB6B 4YY3B 1YUNA 3S70A 3FNFA 1IFXA 5LD2B 4FB4A 3KQNA 3DMTC 4ENSA 4GYKA 4L5IA 4MDFA 2DRIA 4FHEA 3UQZA 3TSZA 1DWOA 1PJBA 2GD1O 3AGQA 4NKRA 4R3WA 2JLVA 4G5GA 5CVEA 1SBCA 3HO1A 3A3OA 2ZPUA 1NBHA 1N8TA 2C54A 2VHYA 3A2LA 4PS0A 3RC9A 1NNLA 2Z2YA 3MGBA 2V6IA 4FHCA 4D80A 1RJDA 4FS3A 3MW8A 3NOQA 4G63A 4HGQA 1N8SA 1DG9A 3KELA 3ZBPA 4ALIA 4BFTA 2GBLA 2DR0A 5C5CA 5JD5A 4ZV7A 3JAMA 1VG8A 5JECA 5TGDA 2VWGA 3WE7A 1S2OA 2JLQA 4MQFA 5TEWA 3DL2A 4D0NA 1TZCA 2W6QA 4XGIA 7YASA 5D3MB 2BF4A 3ONVA 4IMRA 5EKDA 1J2YA 2H16A 2JJQA 1SC4A 3PGMA 4Y2QA 1GFSA 3UMFA 4HWSA 1D2HA 1UJ5A 4LDAA 2WU8A 1QDLB 1BMFA 2QRGA 4TT3D 3R7AA 4A0GA 2GEDA 2B4AA 3B53X 1J23A 4Z3OA 1T9AA 3IQXA 3ZI4A 2FDCA 1XF9A 3IMCA 2V6BA 3WSWA 5BORA 3FN4A 5J2UF 1FP6A 4X5OA 5TGTA 3K05A 3HRKA 2O50A 1KH2A 2JI4A 4CG2A 4RSMA 4TMXA 1YONA 1FDIA 1ZINA 1RNLA 4G9GA 3GFVA 1OXBB 1YBAA 1QH1A 3HB5X 2W0MA 3IALA 4PC1A 1KRXA 3CCFA 3KKEA 2FK7A 3F7OA 4HLQB 5TPZD 2WIDA 3GP3A 3QYPA 2N47A 2PA0A 4XW2A 1A5AB 4BO6A 3OQVA 4JL5A 4RFSB 3Q7RA 1SK9A 2HXGA 1S3SA 3UAVA 2PN1A 1QLHA 4PFQA 1D5CA 4NSNA 4FNAA 3FYTA 3OVMA 5HMLA 3VR5H 3OJEA 3BMQB 1VIAA 1WB9A 5JJBA 1B1CA 5AKIA 2P9ZA 1M1NB 5D86A 3B3JA 3JQ7A 1OIXA 2C98A 3KVOA 3BIFA 1KJWA 1VMIA 3L0YA 1ABFA 1L7DA 4LJ8A 4QU8A 5COAA 2WTEA 4B6EA 2CNWD 2H18A 5CVTA 4GVPA 3QELA 1KYXA 4CGYA 1Y6FA 1SCJA 2BC9A 2P9JA 3R77A 1K75A 3GWGA 2PH1A 3W9YA 1SR8A 3NDPA 4JXZA 2QM0A 1FPQA 1VL2A 2KX7A 4IWYA 4G2NA 2G5PA 4P4TA 3VPCA 1YQXA 2ZROA 3IUPA 4L28A 4F72A 2PMEA 3LBNA 4QVKA 5BSGA 1QF7A 4KE7A 3WO1A 2Z5LA 2ZUBA 3H2BA 4OG2A 4WLFA 2ZSDA 4H60A 4LOHA 4M0PA 4RCYA 3L05A 2UYCA 5FKJA 4KEAA 4C4RA 1NBMA 1TMOA 4KTTE 5GONF 1RXVA 3G2KA 3RO7A 1BWSA 4U3JB 1EVJA 1J21A 1HKUA 4HNGA 4OO3A 1A69A 4X66B 3OA0A 2BBOA 2IW3A 1U7ZA 1BCRB 1FMTA 3GNSA 3RNOA 5CFRA 4W5QA 1JALA 3VO1A 4DV4B 3H2SA 1RWXA 3T0GA 2OBFA 2BOVA 1KMNA 1TQ4A 1NYQA 3GAMA 3HR4A 1HFWA 2X6TA 3MJEA 4DV0B 2BGIA 4B6SA 1P9OA 4WOPA 4WADA 4BGIA 3BILA 3ZK8A 1WSWA 1HQCA 1T36B 1OPRA 2GN4A 2IDMA 2Q5LA 3F97A 3PQ8A 1AKUA 3M5DA 5FBQB 4CLDA 5AUOB 4BLPA 4EHFA 4MVJE 3SCZA 1VL5A 3R09A 5FL3A 2RHDA 3M70A 4YXFA 1G5IA 2CB9A 3LBAA 1S2DA 4J1TC 5LOVF 4WECA 1C8LA 4NWIA 1LZLA 5A9SA 2EBWA 2PWYA 3HY6A 5M29A 2II6A 1ZONA 1U6KA 2NU7A 3C6XA 3E9MA 1CY4A 3KJXA 4GLJA 1SC1A 4YRIA 1BOOA 1IOVA 3U6KA 1B0UA 2O0JA 4EB6B 1EWQA 1D1SA 4E5MA 1QCCA 3OFKA 3ESCA 2VQ3A 4H4EA 3P94A 1SXJA 1ZNYA 3RREA 3V00A 1C4KA 1UMKA 2HREA 1DI0A 1BE8A 2OHVA 2PA3A 3CN7A 3GEDA 3JVEA 3OSZA 4YQEA 4GM0A 1AQNA 3O93A 2XSZD 2RHTA 5C8YA 3RRFA 3QUCA 3IAM1 2PT7A 3KUDA 3A1TA 3ZDCA 4MVJD 4JN6B 4MKIA 2P65A 3PGLA 3BDIA 1SVLA 4IEIA 3IVGA 3IAEA 4IDDA 4KQHA 1MOPA 1B0ZA 1S2IA 2EWVA 3EZ6A 4IEEA 3BL5A 5DBGA 2OPHA 1FMLA 1UM9B 3H2IA 1FUUA 4K9SA 4MARA 3SEFA 4WBNA 4DWOA 3I3OA 3QMWA 1UBOS 3MVEA 2A1UA 4NZ9A 4HKTA 1HX7A 1TLTA 1CBUA 1K7SN 4DJ5X 3KQKA 3K0FB 2I4TA 2QU8A 1PGOA 5HG0A 2V0NA 3HKEA 4OUKX 3SVLA 4XWYA 3RYIB 2CYBA 2HWXA 3FOWA 1OPXA 4RJLA 4BXOA 1G4HA 1U1CA 3A6LA 2B8NA 4BY9E 4NMHA 3LLSA 3AHGA 2R6HA 3WBFA 5ICGA 5JATA 3ABIA 4M9XA 5ES4B 2MSDB 2A57A 2HJ9A 3F6CA 3V4OA 2HRCA 3RDPA 1I7PA 2BHSA 1BS1A 1TGVA 4UBMA 5FDFA 3Q8KA 1YFLA 2EBUA 1PF7E 3SBOA 4HAZA 1NI5A 2CXNA 5DP1A 4EHJA 3PYLA 3GZJA 1LSUA 3GLUA 5BQ3A 1HDOA 3HUTA 3IRUA 1X0XA 3TMAA 1R0XA 4AJ1A 2KHZA 3B78A 2K5UA 2YZKA 4JYBA 4IOKA 4BLWA 5H59A 1JDUA 5HKLA 1K88A 4ZCPA 4EKEA 4BNHA 4DJEC 5LDGA 2FFBA 4F45A 1L5MA 4D4LA 3FI9A 2JAPA 3ZWKA 1F9EA 1GEGA 1ONBA 3SJZA 3FAKA 3Q3CA 3TX6A 2VF5X 3GF4A 4GBED 3S99A 5LSAA 4AUKA 2GEUA 1ZOIA 2QD2A 1Z4LA 2PYIA 3FMVA 2WWWA 4MQFB 3KVRA 3V3KA 2ORED 5K3OA 3ZJTA 3B6JA 3H83A 5A1JA 4BVFA 2GKGA 4L74A 3WV5A 2CGEA 2HA6A 1ZUIA 2O3SA 3O4FA 4L8WB 1RRFA 1KMCA 2WR8A 4IQGA 1GUYA 1WETA 2ZI9A 3RKUA 3I01A 2CBXA 4M9UA 4NE9A 4WFJA 4CLOA 2WZQA 4FR2A 2A86A 2IS1A 3JPWA 3AUYA 1R4AA 2YZNA 3M3HA 4I1VA 5IDVA 3ROGA 1F20A 2A3NA 8ABPA 2J0QA 3HLTA 3LLVA 4RMIA 4QVGA 4Q00A 2YXEA 2F43B 1EYZA 3H1BA 1XZAA 3EQZA 4S1TA 3H87A 2WRZA 1RQPA 2AD5A 2IYLD 2OXEA 5ECDA 3PX7A 1QG0A 1CQWA 4BAGA 3B3QA 3DQQA 1P2SA 3LX6A 3ON5A 4FINA 3Q8XB 4FYWA 3WTCA 3CGWA 2MDTA 2QSJA 4OJKA 2HMVA 1NVXQ 3TN7A 2WUEA 1NF2A 1Z7WA 3OKCA 1X1CA 4XD7D 4QDUA 4C4AA 3X43A 3MTJA 4YAFA 2DQSA 3FDXA 4QBKA 2V5UA 4LN1A 3WK7A 1RRCA 4LF7B 5K3BA 1A9OA 1ZD5A 1Y7HA 2R25B 4PXAA 2ROQA 4IDQA 1W5TA 4AUMA 3ZXIA 2PBZA 1JMYA 1V11A 1VE7A 1ZISA 3A4VA 3Q41A 1X1QA 2XODA 4UJ3A 3ZNPA 4BO2A 2FG5A 4P3XA 1EP2B 3OMWA 4W5JA 1RAAA 4PS1A 1QWSA 3TZEA 1P3JA 4OHFA 4OQNA 1Z7BA 1U9IA 2OGWA 4ESOA 4ZFNA 2DT8A 4AZ0A 1VLLA 1KY3A 2V5VA 3ETLA 4MIYA 2AYYA 5LQSA 3PRYA 4FQ7A 4KI7A 1RT9A 5TXGA 3ZNOA 4DANA 4G07A 2DYKA 3ASUA 3SD7A 1RBYA 3WDMA 2QM7A 1AO0A 4DQVA 5J5VA 1ECBA 1FBNA 4IIXA 4TKZA 4QNNA 2ICAA 2SCUB 5E8RA 1BDHA 5DBEX 4JXKA 1CJBA 1S8OA 4IIBA 5B1SA 821PA 3Q85A 4FIZA 1QIDA 2R6DA 3OH8A 4ZJZA 5FFFA 2QQFA 1KO5A 4QYXA 4BPRA 4YCLA 1F7VA 4LQLA 5K2MA 2ZT5A 3D2BA 3KM0A 2ZWVA 1HDIA 1T8RA 2TMYA 1YWGO 1Q74A 4WLUA 1M2NA 4EIWA 2DWQA 3P4XA 3JQAD 3FHLA 2QTHA 1YRWA 3KTAB 3QSGA 3RANA 1XMXA 2ZULA 5A4AA 1TCBA 2C31A 3EYWA 1ESEA 2NN3C 1ODIA 3GJSA 3LIPA 4GKAA 4YCCA 1QJCA 3DO5A 1C1DA 5EUMA 1CY2A 3BGDA 3PE3A 3QITA 3HEAA 5D51S 4AIIA 1RHMA 5F5XA 1T6XA 2IH5A 4BNIA 1RMQA 3EZ2A 1ESDA 2C5AA 2PO5A 3BREA 3GUCA 1DRUA 1RCUA 3L8YA 3QVLA 4RZSA 2UAGA 4M8IA 4B81A 5A9SB 2FX2A 4UE2A 2NU7B 2RHMA 3BFPA 4BB5A 1F6WA 3FLEA 3ST7A 1FNSA 1NP3A 3TUZC 3PVSA 2W4QA 5I8WA 3B9RA 3MYYA 1NURA 1T8PA 2O07A 3AVQA 3HPRA 4LV5B 4R98A 3T5AA 3GLRA 2R8ZA 3F98A 1BO6A 4AX4A 2GFHA 2VT3A 2D00A 2I8AA 1QH9A 4AWXA 3UG7A 3V8PA 1I7LA 2ZBPA 3P4YA 3VU3A 4CMEC 4UD2A 1F8FA 2WV7A 2DEUA 1PZMA 4AG5A 5HIMA 2WM2A 2ZZNA 1P7CA 4EJFA 2GA9A 2HSGA 4MRNA 2C3OA 3RFXA 3E9QA 1MF7A 3AH8A 2V6JA 4JI2B 4P5PA 3ELDA 2OBYA 1GT91 4ZEWA 1L8LA 3RABA 4D79A 1V7CA 4EYEA 4CF6A 1UFQA 2CD7A 4L75A 2HF9A 4OQYA 5F7ZA 4ZVMA 2A1UB 3W6NA 4PG7A 1H2BA 5BSFA 1A71A 4X00A 1OX4B 1YF3A 3ND5A 1AIPA 2QMYA 1OYWA 1TVEA 2KPOA 3QUTA 3AHDA 4KXMA 5ECYA 4BVHA 2PMBA 1JB1A 4OXQA 4EELA 4PO8A 1MJ5A 3AVUA 4IRUB 1D2AA 3G5UA 5I5GA 4I6GA 3WRXA 4DIUA 2P68A 2E1RA 2XQJA 3JY6A 4HG2A 2CLHB 1G3UA 2EP8A 2PZMA 1GFIA 3L6DA 3GEBA 3ZC3A 1E1KA 5GZ3A 3H4IA 4BVLA 1TM1E 2FR1A 1ATIA 4QTYA 4PHGA 4TS3A 1RXSA 1FBTA 1T0UA 1UBFA 4Q3AA 3BK2A 4GKBA 2G4VA 1ZFNA 3P27A 1AE1A 3C8DA 5ALWA 3P9RA 5EPEA 2ZRJA 3L7AA 4ZVNA 1W29A 2ZR8A 3JVVA 3D54D 2XB9A 2HBZA 1V5IA 2Z8ZA 3QVTA 3R6GA 1ZCFA 4P5EA 2J3KA 4WACA 5ALVA 1ESNA 2DLDA 3EGDA 3R9XB 2W11A 3RSCA 4V0NA 1FZQA 1C7FA 4XVUA 3C98A 2HSWA 2R60A 2YJ6A 4M0KA 2LKDA 5NLLA 1XOIA 5BR7A 2B5WA 4ALLA 3I5AA 1IB6A 4RMHA 4YXWA 1UK7A 4D44A 4CG0A 4NTZA 1F5SA 4TTQA 3N39C 1DEHA 1VL8A 1B6GA 1PLJA 2HDNB 4K81B 6Q21A 1KQOA 3FSEA 3LUKA 4UBLA 1GUFA 2MIIA 4KBYA 1U11A 4KWEA 1TVKB 4NFLA 1OX5A 2C96A 2E4XA 5EG5A 5DSZA 1YR1A 3LMKA 3SBXA 4X63A 3FYHA 4ROTA 1HFJA 4P98A 3OJOA 5KJ1A 2QVZX 1QIKA 4NE7A 3QX7A 3ZCVA 3P2IA 5E3IA 4F1JA 4J4BA 2YICA 1IXRC 3ILYA 2G40A 5ALQA 5JY6A 3DF9A 2UXDB 3CW8X 3X1YA 1C1YA 4O63O 4CLOB 2PGLA 2GO7A 4WJLA 2QXYA 3EPPA 4D0SA 2XBMA 1SCKA 1EUZA 1JDPA 2OLKA 3C16C 3C3EA 3BMNA 4EPYA 1HE3A 2AN9A 3A9UA 4YN3A 3CS3A 2IELA 5E38A 4E70A 4GLOA 3H6GA 4HGYA 4B6PA 2J5RA 3N0VA 1I0LA 4O2AA 1I1HA 2DM6A 3QTLA 6REQA 4P54A 4TXMA 1Q7TA 2JH8A 5L7TA 3SR3A 5F64A 1O94C 2CY0A 1VMDA 2QP9X 3DMHA 3EEBA 2DKNA 3ECSA 2V45A 2I2FA 1FS6A 4FMDB 3EF0A 3PPYA 2IBTA 1VLVA 3UMVA 1B41A 2XB2A 1TOAA 4J07A 2CL5A 3FWKA 3E8MA 5K8IA 1SFRA 5EFOA 4CV2A 1KI8A 2QUZA 2W2VA 3OQPA 2JB9A 1QOZA 1FFHA 4GMGA 4MV3A 5DVZA 1QP7A 2GH1A 2HA7A 1U7DA 4MUBA 4QBIA 1KK0A 1W0JD 1PX0A 1LPNA 1YR2A 1V11B 4OX9Y 3ZE2B 3UOWA 2ZDQA 2QI9C 2DBYA 2CEKA 2G1UA 3BEOA 2V6GA 3WLTA 5KNBD 1QCDA 3N2ZB 1BN7A 3NAQA 4FD3A 3DV2A 2O4CA 4HEJA 3DV9A 1ADCA 2PS0A 5FIUA 3WNDA 1IY9A 3QBEA 1VE9A 4KN6A 4QLBA 4OU5A 2NTVA 4XRGA 2I65A 3DKVA 3STYA 3UGQA 2C3MA 3CX6A 4LF8B 1CR1A 4QLAA 3GH3A 4CIBA 4K26A 2ODPA 3BWDD 3QX8A 4FFPA 4PFKA 3WSVA 2YBEA 3RJTA 4ECAA 1T2UA 1H9BA 2ZREA 4L8FA 1KSHA 1N2EA 3GAFA 5AFSA 1E3SA 1DJLA 4DDVA 3F4BA 5E4YA 3B3GA 1JR4A 1J24A 1KIAA 1P17A 1M6VA 4KVZA 1EUYA 1TK9A 1UKYA 4BGUA 2AC2A 2JA2A 4D4MA 5KTTA 3DE0X 3VR6A 3BF7A 4G4GA 5IVHA 3T1NA 1XPUA 5LR6A 1XTJA 4TQGA 5LIRA 4J0IA 3I9KA 4QHSA 4AYTA 3QV2A 5AW9A 5KYVA 1GP2A 4DB4A 1D2EA 2G3YA 2MSLA 4YP1A 1GM5A 3P5SA 1Y3IA 1E20A 4QDTA 3LW8A 3HCRA 4ZTZB 1CHDA 5AWFC 5AVYA 3MC1A 5GVSA 5I3ZA 3RCBA 4XQCA 3GQVA 1DDIA 2ISQA 2JFYA 5KSYA 1CEEA 5JXIA 4NK5A 1TYZA 2QAIA 4D4IA 2WQ6A 1UZAA 4V38A 4BFVA 4U2FA 4EYQA 5M7EA 4L1KA 4N12A 3RTCA 5G4KA 4RQAA 3JWIA 1TQ6A 5DYTA 2VQEB 3O95A 1Q0RA 3M6XA 4RIGA 1MB9A 2QBYA 3RS4A 3EGEA 5CCDA 2EJCA 5HFAA 3K6SA 2ZOSA 3BF8A 2WAAA 2P67A 3A26A 4RHYA 4NCXA 1UBLS 4L9AA 4MI6A 1W75A 4CKBA 3K4HA 5D1HA 4MAAA 5LQCA 2NAFA 1EH5A 1H22A 5JYDA 5F76A 4G0MA 4FFVA 1NG9A 4KR2A 2OYSA 1OGIA 1Y89A 2GN1A 4HTAA 1JEQB 4LRQA 1XA3A 3HGMA 3MILA 3IKMB 5BSUA 4BX3A 2RH9B 4KW7A 4JVOA 3VDXA 4M86A 2KW5A 3KFVA 3LTNC 3KQYA 3VZBA 4CM8A 5KWIA 3LL4A 2VAPA 6ADHA 2NQTA 3DS8A 4ISBA 5KKNB 4J7UA 2XTMA 3D43A 4DIOA 2OFWA 2NSJA 3NTQA 4O3MA 4JZYA 3S1LA 2EP7A