4UHFA

Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
278
structure length
278
Chain Sequence
AQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELCDEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKENRRRVAERVRREGPGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGHLPPMEQPERVTQAIREWLRKVHTEAGHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ESTERASE
publication title Structural Studies of a Thermophilic Esterase from a New Planctomycetes Species, Thermogutta Terrifontis.
pubmed doi rcsb
source organism Planctomycetes bacterium r1
total genus 107
structure length 278
sequence length 278
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhfA00
3W05A 3O0DA 5AKGA 4KE6A 1MX5A 1ACLA 3WWPA 1GKLA 4Y7DA 4RE6A 4C89A 2OQVA 1ODSA 2ES4A 4EY5A 3DLTA 4HS9A 3DD5A 4LXIA 1CLEA 4WY8A 1F0NA 1GGVA 1A8SA 2XMDA 2OLEA 1E89A 1T2NA 4FLFA 2WIDA 1HKHA 4P08A 1SCIA 3AIKA 5CH8A 2HA2A 5T4EA 1WB4A 2I78A 2J3QA 2GYVA 2XB6A 1R88A 3WL8A 2PSEA 3MUNA 3C70A 2PVSA 2HRQA 2WG1A 1BN7A 3IULA 2ECFA 4FWBA 3QYJA 5E4TA 2WUFA 2WUEA 5FPPA 3LP5A 1S8OA 1H23A 5HKAA 3QBJA 4NZZA 4FTWA 3QPDA 2DCMA 5JAUA 2IIVA 4JH0A 4AB1A 2OAEA 3H2KA 4DGQA 3WK7A 4KE8A 2XLBA 1HL7A 2I03A 4L3WA 2CZQA 5EHNA 5AI6A 4DIUA 4QDOA 3B12A 1PFQA 4IH1A 1XFDA 3PI6A 4NMWA 5ALHA 3VXKA 2WJ6A 1FFEA 5IVKA 1E3QA 2YXPX 2XI4A 1CUDA 3PFBA 1UZAA 1DQZA 1UK6A 4CCYA 5DTIA 2DHDA 2ACEA 4OB6A 1ZD4A 2GZRA 4EB0A 1TAHA 2G5TA 4J0JA 1L7QA 3G9TA 4EUSA 4PSCA 3WK4A 1QIMA 4C4ZA 1WOMA 3IIIA 4FLEA 3WWDA 2HFJA 4C4YA 5DLPA 1BEZA 1GPNA 4Y2XA 5DJ5A 5ALGA 5ALXA 3BJRA 5ALMA 4Q34A 3O4HA 4F5ZA 3H2JA 1EVEA 1TCCA 1WB6A 5ALRA 4QLOA 5HZGA 3A70A 4GDMA 4B7ZA 2J4CA 2VT6A 5ALYA 2CJPA 2ZYSA 3UUFA 4BRSA 2HA7A 3M82A 4W9RA 2ZYRA 1EDBA 3PUHA 1LPMA 4AO6A 5T4FA 4OYYA 4GXNA 5FOQA 5JAPA 3IB3A 1R1DA 4O08A 1QE3A 5EHZA 1EB8A 3DKKA 5K3FB 2K2QB 3NWOA 3H18A 2HA0A 1XQWA 2PSDA 4UBNA 2CBGA 1WPRA 5JALA 5LIPA 3DYVA 4BE9A 3RK4A 1LLFA 3I1IA 4QEKA 4MEAA 3PF9A 1AX9A 5ALIA 3V9AA 1MO2A 4BVKA 4BYMA 1VOTA 3RARA 1B41A 3DYIA 3DOHA 3BWXA 3C5WP 3HYSA 2BFNA 1IUOA 1YS1X 3FVTA 5HF6A 4IHAA 5HK9A 1P0MA 5DYYA 2O7RA 4W1RA 4J0IA 3V1NA 5CXXA 3C5VA 1DU4A 1T4MA 1A8UA 5ALLA 4EY6A 2HM7A 1H2ZA 4DMFA 1ETHA 4UHDA 5HCUA 2V9ZA 2XMGA 3G0CA 5K3BA 1W52X 1JU3A 1YSCA 2B9VA 3FCYA 3UMJA 1EHYA 5I8PA 4BAZA 2H9YA 3BDIA 4I19A 2C0QA 4X6YA 3WL5A 4DM7A 2OGZA 3KSRA 4PSDA 3PUIA 4J0DA 3C6ZA 5F4ZA 2QOEA 2QXTA 2JGIA 5JZBA 5AKIA 3HRHA 3BXPA 1UOPA 4H7HA 4BB0A 1A7UA 2PL5A 2PSJA 1JKMA 1MJ5A 3ED1A 5E4YA 1OXMA 3PICA 2WIJA 3GROA 1AMNA 3WK9A 2DHCA 3DQZA 4C4XA 4X6UA 4AN1A 4K6HA 3QMMA 3DKRA 5AOCA 1XKTA 4DSAA 2CB9A 5LKRA 1LZLA 2Y6VA 2EDCA 1BE0A 2XMRA 5CW2A 5EIEA 2VQ6A 2OXEA 3WKAA 2RGUA 1AURA 4HTAA 5AK4A 5FDFA 2AJDA 4ZRDA 3ZV7A 1HQDA 2QKYA 5AJHA 5BWBA 1TIBA 4Q82A 3KWJA 3V1MA 2WU3A 1RP1A 4PSUA 5ALWA 2QUBA 2D5LA 3PDCA 2XUIA 3KOOA 5AIAA 3W06A 1VKHA 1XZBA 4KRYA 5JD5A 1USWA 5AHXA 1AUOA 3GZJA 3V1LA 2HU5A 5H3HA 5AM4A 4F21A 3S2ZA 1GQRA 2H7XA 1I6WA 4WJLA 1MU0A 4KRXA 4Q3LA 4AMYA 5AM5A 3MVEA 1OCEA 1Q84A 7YASA 1LPSA 1H22A 5EIAA 1UK9A 3IBTA 3IUNA 1HDEA 4X85A 4C88A 3A2MA 1LPAB 3QMVA 3D59A 4BE4A 3O4JA 4UBMA 4OPMA 3STXA 5AIBA 2GBIA 1DWQA 2V97A 4YASA 2D0DA 3OURA 3M3DA 1W75A 2C7BA 4AQDA 5JATA 2QR5A 4BBZA 3O4GA 3M81A 5I7UA 3BF8A 1MAHA 3WJ2A 1J1IA 4BDSA 3ESBA 5D7BA 2WG0A 3IA2A 3D0KA 4B0PA 4F0JA 3STUA 1JJIA 3IUJA 3GFFA 4RPCA 2B20A 5JAOA 2HRRA 2ZJ7A 1K63A 1CUUA 1X2EA 1CVLA 4PQEA 5K3AA 3FOBA 1Z68A 2Z3WA 2WHRA 3BE8A 4B9AA 3ZPXA 1QFSA 2WUGA 4ETWA 4ZGBA 4BCBA 1F8UA 2WG2A 3OM8A 2QMQA 4HRYA 4BP9A 5AKXA 3K2IA 5AI5A 3I6MA 2J3DA 2XMZA 4CG2A 5HFAA 2FX5A 4J7AA 1GKKA 3K9BA 2C5GA 3WK5A 1AGYA 4MYDA 1CPYA 1DX4A 3LLCA 5LLSA 4MQMA 4LKOA 3WL7A 4J3JA 4XWGA 1G5FA 4Y2PA 2BGNA 3E1GA 5KWIA 4JUIA 2JGFA 2XUGA 3SX4A 1H2WA 4I4CA 4UFOA 2RONA 4LXGA 5ESRA 2CEKA 5C8VA 1BCSA 5K3FA 5DTJA 1QO9A 3H04A 4UBLA 3DL7A 3C6YA 5ALOA 3U0VA 3QPCA 4PW0A 2XQIA 5KBYA 2XUKA 4RNCA 1F6WA 2BKLA 3EF3A 4WDRA 2WIGA 4N8DA 2HA4A 4QNNA 3QMWA 1XZKA 4CCWA 4Y2JA 4ZI5A 3D7RA 1CUZA 4X95A 1UOQA 4G8DA 1XZCA 1ZJ5A 2BUAA 4DYHA 2WTMA 4HXFB 1QFMA 5CH5A 3R3XA 4DMCA 2O7VA 5HF9A 4GI1A 3VKFA 3BIWA 1UWCA 2WFMA 3WQHA 3FBWA 4FNMA 4AZ0A 4KAAA 3CN9A 1X2BA 3DOIA 1BU8A 5I9IA 4UHFA 3G9ZA 1L7AA 1CUIA 1GXSA 5AOAA 2CMFA 4AO7A 4A5SA 2XMSA 3F97A 1XZDA 3F96A 3HACA 2PUHA 4WFIA 2HA6A 1KU0A 1YCDA 5EI5A 2XQKA 5D6OA 3KWFA 2WKWA 5ALSA 3PF8A 4LYEA 3V48A 4CG1A 4OCZA 3WI7A 2VF2A 4UBKA 3G0IA 4B81A 1E8NA 3EIOA 1CR6A 3TGLA 3FVRA 1EINA 4UBIA 4ZXFA 5CH3A 1CUXA 4PO3X 1QIGA 2WFLB 4EY8A 1VZ3A 3F9CA 1U8EA 1D07A 2OCLA 3RM3A 2XUJA 1R4ZA 3L1IA 1LPNA 4HZGA 1LZKA 1F0PA 5JASA 3OOSA 4UFNA 1XZLA 5CT4A 4RE5A 3E3AA 4OYLA 5EHQA 1FFDA 2HA3A 4Q1VA 3L1JA 3N2ZB 4J0KA 5CT8A 2X76A 3PE6A 3WYDA 1L7RA 1VA5A 3KD2A 2ZVDA 4QE3A 2WHPA 2G4LA 3FLBA 4BC0A 4Y2RA 3T52A 1A88A 5DWDA 4FMPA 5FPQA 1IUNA 2CKMA 5EGNA 1TCAA 1GQSA 4C01A 1VXOA 4LXHA 2WM2A 1YAJA 1VE6A 2PSFA 2AJ8A 3JW8A 3DS8A 2Y2UA 3WIBA 2XQGA 3WA6A 3WK6A 1JMKC 5ALJA 4U2GA 3RLIA 3LIIA 4D9JA 3PFCA 2WJ3A 5LZ5A 5C7YA 1CRLA 1MT3A 4H7IA 3MGAA 1J06A 1THTA 2EEPA 3IUQA 2XUHA 1LPOA 2RHWA 4QDZA 1VA4A 1C7JA 2OAGA 1IZ7A 3LCRA 4QWMA 3I6YA 3O4IA 2QXUA 4X91A 2OQIA 2BJHA 3BF7A 3ZLTA 4ROTA 1DQYA 2RI6A 5LYYA 5LZ8A 1ZJ4A 2BGRA 3GA7A 2DFPA 3TJMA 3UUEA 2OGTA 3CN7A 2ZSHA 3I28A 4PF1A 2GBFA 1EDDA 1EVQA 4UPDA 2QS9A 2VA9A 2PPLA 1N8SA 1QIJA 4FLMA 4ITVA 4BAGA 2ZYIA 4DNOA 4H0CA 1K6EA 1ZOIA 1JJBA 1GZ7A 3V1KA 5KREA 1DT3A 2WIFA 1MN6A 1TCBA 3WA7A 3R40A 2WUDA 2QM0A 4W1PA 4FNGA 5LKAA 1NU6A 2OCGA 3H1BA 5ALQA 4OU5A 5HQ3A 5LZ7A 4N8SA 3ZLUA 1KEZA 5LZ4A 4KYVA 1CIJA 1SFRA 2WQZA 4PNZA 2Q0XA 5ALZA 4LHEA 5ALVA 1QIEA 4BATA 1ZICA 4HXGA 2PSHA 3W2TA 1THGA 2IX9A 1EX9A 5JD6A 4BZZA 4KR0A 4CI9A 4KEAA 4YPVA 1U2EA 2PBLA 2Y1KA 3BL8A 2R8BA 3DNMA 4J0HA 4X00A 1MNQA 3LIPA 1E8DA 5JD4A 5CXUA 4J0GA 3C6XA 1IUPA 5BV7A 3R0VA 1IMJA 1ZGCA 5HF8A 3WKBA 3ESCA 1Y7IA 1FSSA 4Q3OA 1CUWA 3AZPA 3QH4A 2FJPA 4FOLA 4GECA 2JGJA 3FYTA 3W9BA 5CT5A 2E3JA 4X93A 2WFZA 3WZMA 4G5XA 4F60A 4JNCA 1YR2A 5DNVA 1JU4A 3EQ9A 4FBMA 3U1TA 3WKDA 4UHBA 3VVMA 2PKYX 3AUKA 3QVMA 4HVTA 4Q3KA 4FFVA 4ZV9A 5AK6A 1TK3A 1LBSA 2VJCA 5AICA 4G1FA 3ESAA 4MWSA 2PU7A 4OUKX 1EK2A 5EIHA 4XJVA 2NW6A 3G02A 3T4UA 4H77A 4DMKA 2WFLA 2ZYHA 4OU4A 4K5QA 3KDAA 4ZWNA 2O2HA 3WWEA 1DX6A 3R3WA 1YA4A 2ORYA 3G0DA 5JYCA 1XRMA 2WHPB 5FP0A 1XRNA 3NGMA 3QITA 3OC0A 5D3ZA 4WY5A 4AXBA 1YA8A 4LIPD 3ZLVA 3D2BA 1OILA 1JT2A 5K3DA 4H7DA 3QZUA 3AFIA 2JEZA 3P2MA 5ISMA 1EB9A 2I3DA 4DLNA 4ARAA 4UFPA 3L1HA 1CUEA 5JZ9A 2AJBA 4XIIA 4U2CA 5BOVA 3FYUB 3EQ7A 3DL4A 1H2YA 6YASA 4B82A 2XUAA 5E2IA 3TEJA 4X71A 3D2AA 4J0CA 4B0OA 1RYYA 4CIBA 4DNQA 2VAXA 3R3VA 1QIKA 1QGED 3G0BA 5D3KA 2X5XA 3R3ZA 4E15A 3BDVA 5DNWA 1WCYA 2WLSA 4M0MA 4TPKA 4MQLA 1VLQA 4V2IA 3FSGD 3AJAA 4BTLA 1BCRA 1CQZA 1DT5A 3A2LA 4BZWA 4B84A 4K2AA 3I1YA 3X3HA 4U2EA 3I2KA 1R9MA 3FLAA 1ISPA 2WIKA 4B6GA 3ICWA 1UXOA 4JEIA 4GEGA 4UHEA 3RKSA 2WJ4A 1KU6A 4AZ3A 2PM8A 5AI0A 2V98A 3HEAA 5AP9A 1IVYA 3SWWA 4L0CA 3S8YA 5CT9A 3C6BA 3HZOA 1GPLA 2XE4A 4MYSA 1DWOA 1R50A 5HQ3B 1J07A 4UUQA 2DR0A 1YAHA 4X6XA 1NX9A 1XZJA 3FNBA 5IH7A 2JEYA 4W63A 4KACA 1QONA 4LYDA 5AI8A 1PJAA 1VE7A 3WIOA 3VISA 4KE7A 1EDEA 1QIFA 4G4GA 1BROA 4CG3A 4BVJA 1ODTC 5A71A 3NUZA 4WFJA 4P9NA 4QLAA 3C43A 5HF5A 4H7FA 2ZJFA 1XZHA 2BCEA 4UHCA 2H7CA 1O6FA 3SC2A 3O95A 1CUSA 1WHTA 2ONCA 5AM3A 5AM2A 3H2GA 4Y2VA 3AZOA 4U2DA 4WDQA 2O2GA 1XZMA 2VAVA 2XUDA 3FLEA 5FUMA 1U65A 2AJCA 3DDUA 1MTZA 4EA6A 5AKEA 5CRIA 4BP8A 1XLVA 2W6CX 1SCKA 1UOOA 4MWTA 2B4KA 3WL6A 5FRDA 2BUCA 4FKBA 3NOXA 4OSEA 4X92A 3STTA 4Y2UA 5T4HA 4E14A 4N5HX 4Z49A 2C58A 1CUCA 1IZ8A 1XQYA 1MNAA 5JANA 4X90A 5CTAA 2QJRA 1LPPA 5BWCA 1HBJA 5ALDA 3OTQA 3W9UA 4XX1A 2DQYA 4H7EA 2QVBA 1R3DA 2WTNA 1VJ5A 2GBGA 1QTIA 4FBLA 1TKRA 4BVLA 1ZI9A 4OB7A 1CUBA 4H35A 4S0XA 3ZI7A 1W1IA 3IURA 5LZ2A 4G4IA 5AKLA 5ALNA 1UFOA 3GELA 3F67A 5J3JA 1G4HA 1HLGA 1AC5A 4ZREA 2XUPA 5ALKA 3G0GA 2VJAA 5JADA 2WILA 2YASA 4GW3A 1SC9A 1WB5A 5AM1A 5LP1A 4AMZA 1WM1A 1X70A 3FCXA 3I2FA 3G7NA 1EXWA 1XQXA 2HA5A 3B3QA 4OB8A 5IVDA 1XRPA 4IQ4A 1QOZA 4G8BA 3H0CA 2JGEA 1K5PA 1JFRA 1XZGA 3R3YA 1C4XA 2HU7A 2O2IA 1ZIXA 3MUOA 1CEXA 3AZQA 1QIDA 1XROA 2HDWA 4M0EA 4C87A 3FAKA 1ZD3A 3STYA 1XQVA 1LBTA 4MEBA 4K6GA 1H2XA 3VDXA 1ZD2P 1FFCA 4W1QA 3WJ1A 3CCCA 1EK1A 3FYUA 2VTVA 2DHEA 5A7FA 4IH4A 4B83A 5C8XA 1AZWA 2HIHA 4BCDA 3QPAA 5ALFA 2ACKA 1K4YA 2GYUA 1ACJA 4E46A 1QZ3A 3DCNA 2H7YA 1GT6A 4L9AA 2RHTA 5A62A 5C8ZA 2VJDA 4QZVA 5K3EA 4BRZA 4OD0A 4TVKA 4ZV7A 4XVCA 1QO7A 1JMYA 2R11A 2QRUA 1JI3A 3C8DA 3JYHA 3H17A 4UBOA 3N0TA 4P92A 1ORWA 1QIHA 4EZIA 1VXRA 5DYTA 1QJ4A 3W04A 1M33A 2C5FA 3G9XA 4Y2TA 4GBGA 4Q05A 1CUHA 2QT9A 1CUFA 2XMBA 5CURA 1N1MA 1WPXA 1G42A 3HI4A 5IVHA 2CUTA 2Y2VA 1Q0RA 2DQZA 4Y2YA 1UK7A 2OGSA 3WLAA 5AK3A 2Y6UA 4G4JA 5AKJA 5AI9A 4KJXA 1FJ2A 1Q0ZA 4X97A 4I3FA 1XKLA 1K8QA 5DYWA 3WMRA 4HAIA 2JGMA 5JARA 2VJBA 3H2IA 4B80A 1DINA 1CUYA 1Y37A 4EY7A 1ZI6A 4U2BA 2B61A 3E0XA 2YYSA 2JBWA 4C6HA 2X8BA 2Z8ZA 2HADA 4MJ3A 3I6ZA 5IVIA 3OG9A 1E8MA 3QM1A 4EHBA 1QIIA 3F8SA 4GHWA 2HFKA 3WKCA 5KWJA 2XUQA 1WHSA 4YX9A 2JGLA 5YASA 2XMCA 3CXUA 3EQ8A 3R3UA 5DNUA 4QDUA 3KXPA 5K5EA 2OCIA 1YB6A 3GBSA 3I2GA 5K3CA 2EDAA 2GYWA 5AKZA 1XZFA 1FFBA 1E66A 1CFJA 3D5EA 1N5MA 5FLKA 4DNFA 3SK0A 5SYMA 3K6KA 2RAUA 2G5PA 2RIPA 2BUBA 5JIBA 5AKYA 2AXEA 4E11A 2WSLA 4M0FA 4KAJA 1XZIA 4G9EA 5IKXA 1XRLA 2Z8XA 4RGYA 5CBKA 1SOMA 3BIXA 1MX9A 5A2GA 1ODCA 1P0PA 2OPHA 3E4DA 1B6GA 3STWA 3YASA 2IITA 1EA5A 1W4LA 2JGKA 2P8SA 2XDWA 4W1SA 1W76A 4QWWA 2PX6A 5C81A 4B9EA 4A16A 1QTRA 4FFWA 4BAUA 3ILSA 2DSNA 2OG1A 4QDTA 2AJLI 2C4HA 3HJUA 2I3ZA 3LS2A 1QLWA 4QDXA 4PV7A 1A8QA 5JAHA 1CUAA 2HU8A 5HFNA 2HL6A 3VJMA 4G9GA 4GLBA 3STVA 2H1IA 3WWCA 4H7JA 4NVRA 5AOBA 4INZA 3C45A 2ZSIA 1YS2X 2VATA 4BC1A 1MAAA 4J03A 3WK8A 1VZ2A 3VJKA 4HXEB 5T4BA 5HK8A 2XLCA 4B85A 5LZ9A 4G8CA 1ORVA 3HC7A 4U2FA 4BCCA 2XQFA 4DNPA 4KE9A 4A23A 4IO0A 1CV2A 3WZLA 1UKBA 5SYNA 4N5IX 5HKBA 3M83A 1ZIYA 3ZWQA 3ANTA 2BAGA 1TQHA 4HRXA 4QA9A 3H19A 1MX1A 3ESDA 1LNSA 1EI9A 1TRHA 3FSGA 1J2EA 4GWLA 4DTCA 5AK5A 2OCKA 3DJYA 3IDAA 2LIPA 3R41A 5E4JA 4YK7A 1XRQA 4UHHA 2YH2A 1DTEA 3HLKA 4X94A 4NS4A 3WYNA 2ZJ6A 3HABA 4K6KA 2XQJA 2WU4A 4WFKA 4CCYB 4CIAA 1UT6A 4N8EA 1MPXA 5FKJA 1CUVA 2WHQA 4IH9A 2XUFA 1W6RA 4MXDA 1AKNA 2PUJA 2VT7A 3AINA 1E5TA 2HHAA 2JF0A 2V96A 3O9VA 1UKCA 4H7KA 3AIOA 3HSSA 4TGLA 4WCVA 2QUAA 1RWQA 5AH0A 2PU5A 3OPMA 3VVLA 5JZSA 1CUGA 2FUKA 1UK8A 3CCBA 1FFAA 1AQLA 4Y2SA 5AKKA 4L72A 3I2HA 3JWEA 3HXKA 3BJMA 4BDTA 1LGYA 1Q83A 2VSQA 3O9MA 3TRDA 5ALUA 2XT0A 1HPLA 3H2HA 1P0IA 4BTVA 4Y2QA 4H18A 1XZAA 1SCQA 4JYMA 3AIMA 3IUMA 1XLUA 3A2NA 4AX4A 2W22A 1U4NA 5FXMA 1NU8A 2J4FA 3Q8WA 1XRRA 3EBLA 2VEOA 1UKAA 3C8HA 3ANSA 1YASA 5A7HA 1BS9A 5A6VA 4UBJA 5A7GA 2XUOA 4JYPA 2ROQA 3H1AA 1C7IA 5AO9A 3D4LA 1LPBB 1EH5A 2FJ0A 3ICVA 5CMLA 1ZD5A 4X3CA 1DWPA 5EHXA 1BRTA 4ARBA 2QJWA 3I2JA 3GUUA 4AO8A 2QZPA 4Y9SA 4EY4A 1BEEA 2QTBA 3Q0TA 1N5RA 5AKHA 5AI4A 4KAFA 4DSZA 2GZSA 2Z5GA 1YB7A 1O6GA 3D3NA 5FV4A 4FDMA 1ZGBA 3AILA 2G63A 4P93A 1XLWA 1G66A 5ALTA 1Y7HA 4EBBA 1R9NA 3C87A 3WKEA 1JJFA 2JIDA 2GBCA 3FYUC 4DMHA 1CQWA 5AM0A 3I2IA 1ZI8A 5ALPA 3G9UA 3IVMA 3VJLA 1GPKA 3F98A 1CUJA 4FHZA 1XZEA 5EFZA 1P0QA 1BN6A 4X7BA 3WWOA 3FWHA 4AN0A 2Z3ZA 5CT6A 5ALEA 2XMQA 3A6ZA 3DEAA 3D2CA 3G8YA 2UZ0A 2C0PA 3B5EA 1PV1A 4CFSA
chains in the Genus database with same CATH superfamily
3P9RA 3AK4A 3TLEA 3TS1A 2YIVX 4N9WA 2ZYAA 1V47A 5AKGA 4B5KA 1JHZA 2IZ0A 5M29A 4OQDA 2I4LA 3IT0A 1IN1A 3GJ5A 2E5WA 4RE6A 1NVKA 3MTDA 3W3AD 2A5JA 4KN6A 2QUZA 2RHMA 1ZRNA 3WXBA 3PFNA 2FPWA 2P4SA 3GW8A 2D1TA 4C03A 4YAOA 2E87A 3GRYA 3NCTA 1QO0A 3P0HA 2X41A 3AFGA 1A98A 3HVIA 3TQCA 3V5NA 4C43A 4WBNA 5AW7A 5LYJB 2OV1A 4GI5A 5EQJB 3TCNA 3TMKA 5DULA 1V3TA 4HS9A 5EPEA 5B4VA 1W94A 4D8YA 5LVAA 4UJ3A 4LXIA 4K26A 1LLDA 4TN5A 3GG9A 4JEHA 3UK6A 4UQPA 4ZARA 2ONYA 2VDQB 2ODQA 4C7MA 3BK1A 1TZ2A 1M54A 1A8SA 2DT8A 2GFIA 1KKUA 2ORED 2R97A 4MRVA 5K0LA 3WGMA 1ZHOA 1KDZA 5B2ZA 1M5TA 1PVVA 1P31A 2YDXA 2ZSEA 2XMDA 4KQHA 5FWDA 5B1HA 1FDSA 3SBXA 1PR2A 1T2NA 1YDGA 5EVCA 3RVMA 2Q5QA 4PS1A 3RS9A 1NKVA 1EXNA 4FLFA 1GUFA 1N2EA 1Q44A 4ADSG 2C7VA 3FE2A 4CUKA 1XMPA 3EMVA 2IU6A 2PGAA 2PKWA 3K0HA 4JC4A 4IFEA 1P9LA 2JLQA 1QG4A 3HKEA 4PBRA 5JDCC 3SQOA 2I78A 3SZGA 4F5WA 2ZWOA 4YQFA 2WIBA 5AVZA 1D2NA 2ZRKA 3M34A 4PANA 4UUAA 5B1DA 3RUFA 5BV2P 2GYVA 4GNRA 3D8RA 2C5BA 1MOSA 1DAKA 3QPVA 5DW3A 2E37A 1OX4B 3WL8A 2QMYA 3PD1A 5EESA 4KV7A 1JTVA 1RC0A 3QQPA 4AVYA 4BWFB 1QO0D 4CV1A 5LJLA 4KP7A 1G8YA 2QUIA 3CJQA 1E92A 1GL7A 3N0WA 3OFJA 3RIYA 4D79A 4F3CA 4XB1A 5T3UA 3A6LA 3F46A 2AE2A 4LNUB 1AV6A 2PQ2A 2QNBA 5EHGA 2YOFA 2PA3A 3U4CA 4DR4B 1NNUA 1X77A 3DMRA 3LGAA 2DFNA 2ZAYA 3ZCQA 3U4QB 3GY0A 5FPPA 2H1WA 4F4UA 3NNSA 3P2JA 2YJ5A 4BFWA 5ITZA 4DR7B 3QK7A 1CE8B 1E20A 1H23A 3QI2A 3R9XA 3JATA 4KUHA 4GIBA 1YC2A 2NZUG 3SJAA 1J8DA 1XD9A 3C3PA 1JB9A 2HXSA 4N18A 4WXMA 5KNBH 2POCA 1Y4DE 4RNDB 4I66A 4PYNA 5TVKA 5JAUA 2IIVA 4MDHA 2FE1A 4Y9DA 3WRWA 2OAEA 4DGQA 1Q22A 2G0AA 1I7DA 1FU8A 1KZGB 3SVLA 1QP8A 1E3SA 1HLPA 2IBSA 3IAS1 1OZHA 3GAFA 1Q7TA 5DGDA 2WWRA 4D42A 2ZJYA 1HT1E 4XJXA 3VU8A 2IJGX 3IC5A 4BO5A 3HWRA 3JYOA 4RLFA 5EHNA 4YJ3A 1NDUA 2GPBA 4LC9A 2XZLA 1XVTA 3DB2A 5SICE 4A03A 2DJIA 4C0XA 4W6ZA 5FWNA 2QTNA 3AOEA 4BNLA 3B12A 1E0JA 2PUWA 3P2YA 4XQ0A 4ZJYA 2C4WA 4PG8A 1I7SB 1JBEA 2D0PB 3HJTA 3UJDA 3UJ9A 4CWAA 3DF7A 3COVA 4WCFA 2TMKA 4U7JA 5FORA 2QP3A 3TIFA 3CZMA 1EWKA 1JDTA 1GITA 5FNVA 5HSGA 2WJ6A 4CU5A 1OLSB 4MGIR 3NRBA 5JVDA 4JJZA 2V7WA 5E6RB 1E3QA 4HDCA 4YP9A 5ENDA 2OM6A 2XI4A 2V3CC 1L5RA 3JVIA 3TH5A 1D04A 3PKIA 3V2GA 4HV4A 1I2CA 1RM3A 2X7HA 2ONKA 3QUSA 2YXEA 4EX6A 2QTMA 1Z2AA 2FWIA 2JLBA 3AR3A 4CCYA 5FWXB 2RAVA 3AHHA 3CSDA 4IICA 1V9CA 2PANA 2VRNA 3CZRA 4GXQA 5TMDA 2W2PA 1NIPA 2CVHA 2C8KA 3GWGA 1TJYA 4IEIA 1TAHA 7ABPA 2RGYA 3KE9A 2H4FA 2HY7A 5CCXA 5EFOA 3RVSA 2FF5A 4O0MA 3OZXA 4GX0A 4PLVA 3AUYA 5E7MA 3LDHA 4YHBA 1V39A 1S3IA 2P4EA 3KVOA 4BQNA 4D3FA 4JOCA 4H4EA 3BSYA 1L5ZA 4PNPA 1YC5A 2EL9A 3FOCA 2P5TB 5A0FA 3GD5A 2R1TB 1XNHA 1YJ8A 1JQEA 3FW1A 4FLEA 2CUKA 4Q5IA 4TSRA 4CI0B 1TMGE 4I1RA 1PFGA 1XEWX 1HEUA 2CLIB 421PA 3GUVA 2EBUA 2OBBA 2R00A 1KAEA 3GRPA 3OCUA 2YYAA 3A32A 1ZL2A 4K46A 4ZYVA 3ASZA 2GVDC 2Q21A 1I2AA 2IEAA 4HY3A 2OHOA 4HNVA 5JISA 2P9HA 1ZIOA 5K03A 1AHNA 3AR8A 1CYDA 3EUAA 4BASA 5DJ5A 4Z2AA 1DKUA 1GPMA 1VG0B 2Z4TA 3FSEA 1FNSA 1Z6QA 2BF7A 3EGWA 4O4JA 4ANFA 3BJRA 5KYYA 2HQOA 2FK8A 1CF2O 2PKQO 2A86A 5ALMA 4B09A 1EQ2A 2E6KA 4OHPA 4Q34A 1SOUA 4EMSA 4FMBB 2C99A 4F5ZA 2Q6OA 1ZMXA 3WDLA 3RSOA 1PLLA 5AOVA 3LX6A 3ER8A 3S1SA 3AKZA 4PPGA 1MIHA 3I9FA 4FSXA 3EDQA 5ECDA 3QWBA 4ZEWA 3UMRA 3AUSA 3OVMA 2W4QA 2YZMA 3VYWA 3A70A 5JEEA 1ZA2A 2VPZA 4KZPA 3S4YA 4PGGA 4B7ZA 1L1RA 8ABPA 4WOBA 3PXXA 2Z2ZA 2PEYA 2O14A 1LSSA 4JBGA 1IEQA 4CPDA 3JR3A 3K0AA 2IVFA 4PZYA 4F9EA 2VT2A 3I9V1 4GKJB 3G2HA 4ZAFA 2PGNA 1PFVA 2Y1FA 3AVOA 2ZYRA 3ONNA 3QFFA 4RQTA 2G71A 3PUHA 2YZKA 1LPMA 1Z6AA 2E55A 1PVOA 4FP9A 2AFRA 5BUZA 2HHLA 1XRJA 2C4NA 1NXVA 5HJEA 5I8WA 2I99A 2CMGA 1N5LA 5IDVA 3FTNA 4EGCB 2A3RA 4GOMD 4Q02A 3NHAA 4WNAA 3IB3A 1OQAA 3F8TA 2H5EA 2LD4A 4R9SA 5TQ0B 1TFUA 1PLKA 4J1TC 5B1YA 2L19A 2VRBA 4OP3A 5G0TA 2CFOA 2OA0A 1FMJA 4TL7A 4QJIA 2YFHA 1PHPA 2YXDA 5B3JC 4BU1A 3AKCA 4QHSA 4RTMA 3Q0EA 2Y0BA 3H18A 3TLZA 3VC2A 2QDKA 1OBFO 4F7WA 2CFRA 1RYZA 4UBNA 1WXDA 3RANA 3I12A 5H1YA 5A6SA 3WO1A 3WLIA 3LPAA 2HT1A 3C48A 3DYVA 4HHEA 1Z4NA 4ZIRB 1P2BA 4RLHA 3C74A 5DM0A 5FF9A 3O84A 3TTSA 1NLMA 3K1AB 1QQ7A 1LSUA 1WCV1 1E2HA 1CR2A 1LRLA 1AX9A 3GVCA 3KLMX 4FFLA 4BGDA 3SVTA 5KMGB 2QI9F 3CG0A 3FY4A 1ECFA 4V3BA 4YRRA 3T3IA 4BYMA 1D1QA 4P5DA 4RCZA 3DZBA 3U44B 1H3EA 4Q3BA 5BQPA 1NRWA 3E7WA 3NAGA 3RJ9A 3GFGA 1G3MA 3CNNA 1FUKA 2ZUDA 2HPZA 4JB0A 3O03A 3KT3A 2DWOA 3HN6A 3SF0A 1ARZA 3LUGA 4PYKA 4TUYB 5TX7A 2DP4E 3UFXA 4LRSB 3CH4B 2O9JA 2YIJA 3R6LA 4IHAA 2WVJA 5HE9A 2JGRA 3WFIA 2ZQZA 5AM3A 5HK9A 5DYYA 3BCSA 4LQCA 1Y9JA 3T3HA 2O7RA 1QBKC 3A9VA 3H75A 4U3JA 4WZ6A 5AXCA 3VO9A 3ZJTA 2N3ZA 4BJ3A 2J0VA 1Z39A 3C3XA 5DX1A 1T5DX 3SYNA 1HDIA 3DAOA 3L79A 1S3FA 3WJAA 2DBVO 1BDMA 2GRUA 3FCAA 5CEJA 2WNSA 3H5AA 4YJHA 1Y9DA 4EY6A 3ADCA 2HM7A 1H2ZA 1G21A 4DMFA 4BVGA 2GBLC 1E32A 1LV7A 2C9CA 1OA0A 4JUCA 1KFCB 5HCUA 4NE2A 1B16A 1P7YA 1SVSA 2XJ9A 1PTJA 1ZGJA 3BGVA 4UUNA 4RJTA 2X15A 2H4JA 4DG8A 5BN4B 2CXXA 2BDEA 2GD2A 5C8DA 2V1UA 4CLXA 3U60B 5C7OO 5HE8A 4JDPA 4QFCA 3D1JA 4B8YA 2B5VA 1EHYA 1XMOB 1HDXA 2H9YA 4DWOA 2PUVA 3JVDA 4X6YA 3WL5A 3CH7A 5KU1A 4DM7A 2OKGA 2QTVB 2JB9A 1E9VA 5JI3E 3MYYA 1IY8A 1GXSB 1CY2A 3F2VA 3TVTA 1J49A 4PZAA 4POOA 1GR0A 3EBOA 4XUEA 2G77B 1KK3A 1KI6A 3HRHA 4PX5A 2A0WA 2W2QA 4IIYA 4C2TA 1L5HB 3I1FA 1MJNA 5CM2Z 4RA6A 3BXPA 2W6PA 2FZ4A 3LQ4A 3DAFA 4H7HA 3T7CA 2GNAA 1AKYA 4FYHA 3UPTA 3G8DA 1R6BX 2DTEA 5ULLA 1WKBA 2OHHA 3OQBA 4OO3A 1GZHB 2X22A 5B58T 1L4MA 2Y1LA 3F47A 3NNDA 1MUUA 1NQUA 2LVBA 1EVLA 2X0FA 2F64A 2FXIA 4F4IA 1XX6A 4CMKA 1K9SA 3KJEA 5HZKA 5IPFA 2OYRA 1Z0AA 1Z34A 1ZX1A 1D2EA 3R1IA 3RE1A 4BXOA 5KX5F 5CB6A 4BEBA 3O1LA 1L4NA 3GROA 1PT5A 3ZXXA 2FHSA 1UJCA 1M0EA 5GPBA 4TT3A 4BNXA 3ZQUA 4CM6A 3QA3E 4AN1A 5KIAA 1V45E 2H5LA 3V8RA 4K6HA 2OFPA 5C1IA 3L43A 2ZIXA 3I0ZA 1SKUA 2WD9A 3PC7A 2ZUFA 2PJRA 2FSVA 2I2XB 1E79A 5AOCA 4JJKA 3N70A 2NIPA 4BLRA 2YNMA 4DSAA 1DL5A 3MGCA 2CB9A 3LUDA 4Y18A 2QX4A 3GJSA 5LKRA 4HYTA 1N75A 2XVXA 2JIZA 2C7PA 1OH7A 3CUEF 2JCVA 4C0HA 1V3UA 1V8PA 2AFHE 3F74A 1AMOA 3WC4A 1ST2A 1MF7A 2BTOA 2DPLA 2RH8A 1H8HD 3N6RA 5KTOA 4LBWA 2XMRA 4MICA 4EPYA 3H7AA 4JXJA 5CW2A 1DS6A 3ZOKA 1GDTA 1CRWG 2V0NA 2XF8A 4DJTA 1AURA 3D4IA 4HTAA 4QULA 5T6MA 4M9SA 4BNJA 1U6JA 4NECA 4UU1A 1X0VA 4FE4A 3U4AA 1ONPA 1UDWA 2GESA 2I7CA 2QRMA 4Q9NA 1TIBA 4HATA 5HYVA 1V5EA 2QPOA 1NVAA 4YQZA 3KWJA 2PMKA 3L6CA 2Q4DA 3FDZB 5DPMA 3RB8A 4KIUA 1JQAA 3C7CB 3L1VA 1Z2CA 4AMUA 4H9GA 2QUBA 3RHSA 4E6PA 3TZHA 4JQYA 4EHLA 2RBGA 1MFZA 4TT3D 4IJKA 4MR7B 1ZH6A 1V16B 1JHDA 1E3WB 1TUBB 1U5CA 1AQUA 2GK3A 3W9YA 4NBWA 2ZJ5A 2E0IA 3KYBA 3ZCTA 3S55A 1VKHA 2O8FA 2VK1A 4KRYA 3LQKA 1RFGE 1EP3B 1E79D 1F06A 3CR3C 1AIPA 3TQTA 3PGXA 2C83A 4LSMA 4DHWA 4C20A 3WRYA 1DOHA 2YN2A 2IXGA 1VIDA 4OHCA 4AICA 1GNLA 1PNRA 1NBME 4YV7A 4MUNA 2BI7A 3ILXA 4CM8B 1VGVA 3F5QA 3URMA 3TTTA 2HU5A 1ZOOA 4LHVA 5H3HA 3NVDA 2AOTB 1T2UA 2O8VA 4XARA 4EHJA 5KOHB 3ER9A 1A9SA 1M2OB 3UH1A 2A5DA 2NUTB 1EZ4A 2FP4A 3B8EA 4QTTB 3S2ZA 4F21A 5HUQA 1MU0A 1QQTA 4NCKA 2DECA 4KRXA 4OMCA 4M76B 5GOZA 1GCOA 4IFIA 5DGXA 1B3BA 4O4HF 2UAGA 5CFPA 2GZ3A 5DN6D 4AKEA 4I3GA 1N2CA 4X8OA 1Z73A 2HV8A 4R0MA 4KXUA 5BWNA 2XZOA 3DL0A 2JLZA 3A9WA 2VDRB 3G79A 3FM9A 1G38A 3PR3A 3DFUA 4AZVA 4EATA 3QFHA 1LPSA 1X1TA 2GZMA 1FMLA 1VIVA 1BG6A 3SJZA 4LMAA 3ENNA 2RGNC 1QNLA 3A1DA 5ADHA 1VCMA 1RQGA 1CZOA 2OB1A 1XA4A 4HMQA 4Y6LA 1X9GA 1UWVA 2CNDA 4RLSA 3ZDRA 1MFPA 1FDOA 2N9UA 4XI9A 4UBMA 4G07A 3ZKAA 3RTEA 4OPMA 3DZIA 4MMYB 4GOKA 5A05A 3ZVKA 2WB4A 1EK0A 3LKVA 4OUDA 3UCXA 1DWQA 2V97A 5HMMA 4YASA 3U19A 5HBGA 3WOHA 1H1LB 2G7MC 3L5OA 3P19A 3H97A 2ARKA 3GLHA 2FX2A 3OH8A 2QR5A 3WGGA 1XTQA 3TQHA 1V95A 2OAQ1 4OHKA 4Q4JB 3UKJA 2YVQA 1R8XA 1YQGA 4BBZA 1TTTA 3O4GA 1GRRA 4WZAB 3MMSA 1G7RA 4DJ5X 1XMSA 2CNOA 1MAHA 1WD5A 3HY3A 4NX2A 2WG0A 3D0KA 4F0JA 5DGTA 3ZVNA 2X5JO 3WFJA 3B6ZA 3TKYA 3TL3A 4ZICA 1DKRA 3OTWA 4XYLA 4QREA 4I1SA 5JYBA 4CM9A 4HLDA 4YNBA 4ZT7A 5JR3A 1SZJG 1GARA 2YHIA 1K63A 1P72A 2YRXA 3OJOA 2NTYC 5K45A 4R68A 1X2EA 2VHEA 4BO3A 2VDLB 4HH1A 2OLJA 4LGVA 1FMCA 1C14A 1VHTA 2P0YA 2PRYA 3AU8A 3FVVA 3GLKA 4NCNA 4PGHA 4XJSA 4B9AA 4LKRA 4ZGBA 1Y7PA 1Y6GA 3R6DA 3RRJA 4MDEA 3RAJA 1F8UA 3I05A 3OM8A 521PA 2E4VA 1CQJA 2Z1MA 2ZKLA 3SX2A 1WXGA 5CUQA 5AKXA 4JCCA 4OXQA 1DJLA 1SBTA 5DCWA 2J3DA 2XMZA 5I7OA 5TIIA 2IQIA 2XMPA 1BKSB 3BTOA 4GRDA 1PQPA 1WABA 1NBIA 3KEOA 4QYWA 3WYGA 5K0ZA 4HNUA 3R3SA 1SU6A 4JUDX 3C3JA 1SZCA 3DE1X 3JVVA 1N77A 2FX5A 5AW1A 5TF4A 4KODA 4DCUA 2IXTA 4R1UA 3TQRA 3BXFA 1V8BA 1WUKS 2C2GA 4ETIA 1M67A 1NV9A 3E5MA 2VJPA 3LT0A 2ZJ1A 2X9LA 1GSIA 1PT9A 5E9AA 2B69A 2WP0A 3D6HA 5B57C 4GUDA 4FYXA 2NO0A 4MQMA 5IAGA 2FLKA 4MGHA 3I5AA 5TQ2B 3UMGA 3K3PA 1B0PA 2R5NA 2IWHA 4LZOA 4EO7A 4YRIA 4PSKA 4UOZA 2WWHA 4FOSA 3E1GA 1SCUA 1EUCA 1RT9A 2JFHA 5EJFA 4HEA1 1XDSA 3HBMA 1TO6A 2XUGA 3R09A 5IWCA 3B20A 2P6RA 1U3VA 1JUDA 1P5JA 5BWOA 1H2WA 4G2TA 5FBQB 3DT6A 2RONA 4URXR 1PJSA 1ZU4A 1S96A 1Z0IA 2REQA 1J2UA 3G89A 3KXKA 4X7MA 4A8JC 4TROA 2REBA 1KRWA 2ZUEA 2BHNA 2Q4BA 1HEYA 2C9MA 4GICA 4WK4B 4ZJPA 1FYXA 5K0EA 1RXWA 3OEEA 2IUEA 4II7A 3HSKA 1B0ZA 1XMQB 5CX1B 1KP3A 3HZZA 4RYDA 3EY9A 2EC5A 2E89A 1XAIA 4LOLA 4P58A 5KVCA 5FLXA 3ESZA 1PQWA 2NO1A 5H16A 2WYVA 5K3FA 1NVBA 3AR5A 4YRTA 1T15A 1V7ZA 1WU7A 3H04A 4GKAA 3U3OA 2FDCA 1AQYA 2AWOA 2XHZA 1KIFA 4KLCA 4LJAA 1P62B 3HZRA 3OPNA 4AJLA 1I4TD 2Z0MA 1PWXA 1Q0PA 2QE7D 3EFEA 2QLNA 4FOOA 1H2FA 4NENA 4EEZA 3P9QA 4EYGA 1HT3A 1C9NA 1KXJA 3D8TA 4Y9UA 2DKFA 1P7WA 3QPCA 4B33A 3VR0A 3LM8A 3FWYA 4YP6A 2PMDA 4BJ5A 2NVWA 2XUKA 4U7DA 2B2NA 3DBHB 1ZDMA 4C78A 1U5BA 3EF3A 3H9EO 5HQTA 4HC4A 1VPWA 3WG9A 2BEVB 2WC1A 2GHRA 1F2DA 3U4HA 2VP6A 3DVAA 2MSLA 4IHJF 3ILVA 4MS1B 4WEOA 4AKSA 1DRWA 3E9EA 3BCHA 3L7OA 3VO2A 3NHYA 4XOUA 3GEIA 3EVTA 2YVLA 3HUFA 1XZKA 4CCWA 1TU3A 3N7TA 1MPTA 3R0ZA 3MJSA 1K7XB 1PG2A 4GZLA 4WT7A 5JJ5A 5JPCA 5K0GA 1Y42X 5BQXA 2YWXA 4KI7A 4X95A 3DNPA 1ZNZA 3HB1A 4EO9A 1UOQA 4G8DA 4RA9B 4PAOA 3NBAA 2DPHA 5JDIA 4YGYA 1PYOA 6Q21A 1ULSA 4INJA 4FYVA 1M5RA 3R24A 1DLJA 2I71A 1QVVA 2FPOA 1C7ZA 4ZEVA 3IQGX 1T34A 1IXRC 2JNWA 2X0KA 3MJ4A 4IRMA 2YZNA 3IP7A 4CEIA 4YXWA 5JNWA 2AI2A 2A59A 1QKJA 4ZD6A 5KJFA 3G5UA 3R3XA 2DPXA 1BE8A 1VI2A 2XXJA 4LRQA 1KSJA 5HF9A 2NZXA 1E6EA 1EAYA 5LQAA 2AI3A 3O75A 1UXIA 2HSDA 4XFKA 4BPBA 2W11A 3ZZMA 1QZUA 1L5WA 2AIRA 1POWA 2CHGA 2IEZA 3NLLA 2A0YA 1ZM9A 5IN4A 2M1ZA 2NAPA 5G53C 2IV2X 1MAWA 2WD7B 2OQRA 1PAUA 3ZGYA 4XX0A 3NNNA 2HK6A 1M2JA 1PR5A 1XTZA 3DOIA 3NHUA 4H31A 4LJLA 4YFYA 1E94E 2VNIA 3V32A 3K9NA 4BTEA 3LY7A 4OXRA 2XB9A 1CEEA 4KRFA 4IEFB 1P3DA 5AOAA 2CMFA 2FUG6 5BOSB 1KKMA 2IA5A 4A5SA 2VUHB 1Z25A 3DBRB 3RVJA 1R6UA 3OQNA 1SEVA 5AW2A 2MHCA 5IT0A 3TSWA 3ZDCA 2DERA 4ML3A 4US1R 2R751 4LDJA 1XZDA 1XLTA 1JG4A 3HACA 4MV8A 2CJXA 3NYQA 4US2R 2HA6A 1ADFA 4CEHB 5KNLA 1MQ8B 2ZDGA 2E9SA 4E08A 4K9DA 1JG6A 4G1BA 4WMLA 1GCGA 1Z56C 1YL7A 2IY8A 3R7NA 4YXFA 2CL5A 2OVFA 2WKWA 4NJEB 5EE5B 3PF8A 4A0RA 5I4BA 3O4VA 3X1JA 2ORWA 1KJJA 3FNIA 4YMWA 2Z5VA 3W8DA 2XTZA 3ZGXA 5HRAA 4OVKA 1XAJA 4X93A 1OVGA 3LCMA 2RGEA 3F5SA 1TVEA 2QUHA 4FFOA 4PLFA 2CN1A 3NG1A 2WM3A 3PLRA 4FS8A 4G4SO 4OQNA 1WVGA 4B81A 1X1EA 1TNDA 1TVKB 3TVDA 1EFVA 3IERA 2FUEA 4ZXFA 3L9XA 1SC3A 2IZ7A 2BM9A 4H3KB 5HA5A 1EWVA 3UB2A 2QAIA 3VU0A 3IR6A 2OCLA 4D4HA 2QG9A 3PDIB 1KWKA 4EFKA 3RM3A 3NM5A 2XUJA 3TMAA 3BGOS 2F90A 3IFSA 3TKLA 4AAYA 1FVHA 2QR3A 1LZKA 2I8LA 3NIBA 1F0PA 5JASA 4QUIA 1NNI1 2IYAA 4JJFA 4KO2S 2QRQA 5C8YF 3P9ZA 4Z0HO 4B5LA 4BMSA 3EG9B 4XUGB 1C3OA 2I6FA 2OBMA 3GFVA 2B35A 4OTZA 4DMGA 4JITA 2PT6A 1YS7A 1E2UA 4L57A 3GLGE 1Z83A 2VC2B 3PA6A 1I4EB 4OGWA 4JC8A 4CCSA 5K6AA 3KVYA 1LLCA 1FFDA 1VMDA 2HA3A 2SCUA 2HD4A 3F4LA 3H1GA 4RPLA 2B2CA 1N6HA 4CU2A 4EA8A 2UUAB 2M98A 2B4AA 2FYTA 1CZRA 2C3PA 4H4DA 2IUTA 3PE6A 5KYNA 4J0EA 1ABBA 1KDRA 1KZ4A 2QTHA 4ND2A 5AXAA 4NQRA 1Z2EA 1MJGM 1X1AA 2HPVA 1SELA 3CLUD 4I7EA 3RNOA 2OY0A 1TM3E 4QE3A 5JH7B 1ZU5A 3LVRE 4PC6A 2WHPA 1QGAA 3M1YA 1H1DA 3H2YA 2NUAA 1PS0A 1P4HA 1HFWA 3KZNA 1T8WA 4BQIA 1A88A 1GV0A 2A35A 1AUXA 2F48A 4LJSA 3C3CA 2EKDA 3QEOA 4B3RB 1F3LA 1MRNA 3IRUA 4RVCA 4EJ0A 1R4MB 3BAFA 3SEAA 1DKQA 2CKMA 3T7AA 4OFXA 3ADKA 4C01A 1A7AA 1OYVA 1VXOA 4HAYA 2BD0A 4LXHA 2WM2A 1YAJA 1VE6A 3D8NA 3JW8A 4PLZA 1OLUA 3ANMA 5DU2A 1NOJA 4EO4A 4ASUD 3KB1A 1X13A 3DKPA 3HWX1 1NG1A 3LMKA 4N5NA 5MFPA 5EINA 4LEIA 3WK6A 1FNBA 1TYAE 1EYZA 4DXAA 1PWHA 4FM9A 2JHGA 2ZB2A 5ALJA 3ZWVA 5E1BA 2FK7A 1ZM4A 1NI3A 3LCVB 3ODGA 2MIIA 3MWGA 5JCXA 4D57A 2HQRA 4K6FA 1NQTA 4GR9A 3ZCVA 4D9JA 2ZRQA 4MJXA 3KQSA 4PG7A 3HQ4O 1MT3A 4U9HS 2P2DA 3MGAA 9ATCA 4C0BA 2FRDA 3AXTA 4YCSA 2EEPA 4PAQA 3IUQA 2HYIC 4NCIA 3ABQB 1V5FA 4J7XA 4BV2A 5EPUA 5L3QA 3BFVA 2EJTA 3H86A 2UVPB 1C9MA 3ITEA 5JTTA 1U80A 1R10A 2GEFA 4ZGGA 1VA4A 3KX2A 3MINA 5EQFA 3A10A 4YUWA 1QH8A 3LYUA 3O4IA 2G5GX 2IS1A 1FCJA 1EXVA 2G7ZA 2QM3A 2R6AA 4HLUA 4X91A 2XBUA 3HCWA 2ZETA 1G8JA 2OQIA 4N3AA 4MIOA 1W1WA 3N8GA 2W58A 4O2AF 4ROTA 3OKPA 3ABIA 2PIDA 2D1FA 1IRIA 2CVPA 2I2BA 4JL5A 1Z2NX 4D92A 2PMCA 2ZRIA 4QTZA 4RQBA 1DKPA 1RJGA 1HE3A 4MV6A 1XYVA 1ENZA 3GA7A 4NV0A 3DLHA 2A3NA 3CINA 2D5IA 4C04A 2Y1XA 4ZQEA 4IVPA 1Y4UA 4TL6A 2GM3A 5G4KB 2HK7A 3W6PA 4DILA 3W4IA 3ZXYA 1OBHA 5J5CA 3MJEA 4F3NA 5KO2A 2Y77A 4L8WB 1U3WA 1DQRA 1GG2A 2OGTA 2Z1NA 2JFNA 3LDUA 4X1YB 4ZI7A 2MU1A 4G36A 4MRPA 3PHJA 1DAHA 3L7LA 4QFDA 3NHJA 4JX9A 2TRSB 4FGUA 1GDDA 1II8B 1QHEA 1UKEA 1S9HA 2FMKA 4GC9A 4JLSA 5FLEX 1BFDA 3EXHB 4LZLA 3ZE1B 1MOQA 2VA9A 5F2NA 4DDUA 1PK8A 2HWWA 3BHIA 1N8SA 1Y4ZA 2HUNA 3LSTA 4X65B 3OTIA 4OBWA 1GPUA 5EIOA 1BJRE 3EYAA 1LI4A 4KGDA 5COQA 2ZYIA 4CMIA 3DLBA 1VCNA 3VX4A 1K6EA 4HLCA 1JJBA 4C3VA 4HQOA 1HE4A 4M37A 2Y76A 3ZBTA 4Q6WA 5FULA 4F86A 4GDFA 5KREA 1DT3A 1J0XO 2XAUA 2BGKA 2OHJA 3ADPA 2F6RA 1TCBA 2IXEA 3BK7A 3QBTA 1QGZA 3KDSE 3IR7A 1F9AA 4QXQA 3D3JA 3CYFA 4G81A 4R8MA 4XVQA 2AXQA 1GR1A 2EV9A 2J30A 4RD0A 3O8QB 1GYRA 4CMAA 4FNGA 1ZESA 5LKAA 4RAOA 1NU6A 4R40A 3HTXA 1BCSB 3E0QA 4E94A 1H5QA 5HQ3A 1N8TA 3EASA 5AVQA 1CHNA 5KAMA 2ZSDA 2GA9A 2GS9A 2NTJA 3UK0A 1YKSA 4FJ0A 1FTSA 3ZLUA 3ZS9A 1KEZA 2LW7A 2IPOA 2XY4A 1UBJS 2B1IA 1SB9A 2IYSA 4M1YA 2WYHA 1CIJA 1SFRA 4NYMQ 4EH1A 3OLWA 2QN6A 4J1QA 5DM1A 1SHLA 1XA3A 1RCUA 1DV1A 3EFOA 4HWGA 3GGGA 5ALZA 5G0WA 1G1AA 1DC3A 1SO8A 5F2KA 4FK8A 1J5XA 2ATVA 3WYNA 4AUNA 1HEIA 5ALVA 3B82A 4Z0TA 4KO3S 5HJ2A 2GD1O 3INGA 4HXGA 2ZAOA 4RIGA 3MCAA 5JCJA 4TT8A 1SCNE 2E48A 1CRPA 5BXYA 2W2VA 1XL0A 2QN8A 3IPLA 3V46A 3IUPA 4BE7B 3H5IA 5JD6A 4R5MA 4RMJA 4B2YA 1JLKA 1QYCA 2QLLA 4RVUA 2ZRCA 4QT0A 1O94C 5GONA 3I0NA 4EKDA 2W6IA 4KR0A 4NEQA 2ZBVA 1W88B 1P2TA 3GQBB 4FDVA 2O05A 4GSYA 4DC0A 3EEFA 1HLDA 2GAFA 2IHBA 2PBLA 2Y68A 2MCFA 3T7EA 3UG7A 4FN4A 2BEJA 4QSHA 3UOGA 3VSCA 2R1VB 2Y1KA 4BWGA 1CYEA 1I80A 4KGVA 1GQ2A 2CE2X 2GFQA 1B76A 4QTUB 4ZOBA 1TZCA 4RVHA 4WK2B 1WPQA 2R8BA 4L7VA 2BF4A 1AKQA 2GSWA 3ZU2A 2GVNA 1O54A 3NJ8A 3SN6A 4I1YA 3G9QA 4DA7A 1F4LA 1Q5PA 4KWIA 4TM7A 4JP5A 5AHRA 3KO8A 3TZBA 3QI7A 2C42A 4JLWA 3WGJA 5A9RA 3C6XA 1DWUA 3QE9Y 4OLAA 4W9NA 1FMTA 2VPXA 3RC9A 2Z4RA 2PGJA 1OSNA 4ZO6A 1A0OA 1U1GA 2ZSBA 5JCJD 3ESCA 3OY2A 4CKYA 1Z62A 2VF7A 1UZMA 2XCQA 1FSSA 2WI8A 2H31A 2MSWA 1RQPA 3WNCA 1JXMA 4IGEA 4C1BA 4J4BA 2BFBB 2P7IA 2HWXA 3SQDA 4NONA 4PYRA 2XSZA 5K0NA 4F3RA 4FOLA 1DFIA 4FZ5A 1XF1A 3MB8A 4IJQA 4RZXA 2CXTA 5D51S 3U16A 1OZ0A 2VTBA 2W6ID 4GOJA 4IJ5A 2H1FA 4ZC8A 3J80A 5LYJF 4TXNA 4C4RA 1AB6A 3PNSA 5CNIA 4LHWA 1ZK0A 2VLBA 2XODA 4OHBA 3ET4A 4TV8A 2X6RA 3R23A 1DJOA 1QE5A 2ODBA 4OI2A 2VAWA 2E3JA 5FNZA 5U4XA 4PFSA 5T67A 1PV4A 5C51B 1JWAB 3FNQA 3CR7A 3QIVA 5IH3A 4A6PA 2VNHA 1R8SA 4IJVA 2WVHA 2ZJ3A 4XB2A 1I51A 1A4XA 2WJHA 2X40A 4OQPA 1WUTA 5GAJA 2WFZA 4JIMA 1EE2A 3RG2A 3N2LA 1NTOA 2QORA 5CK4A 2VCHA 3ZS8A 4A2WA 4B8ZA 4L2IB 1FQOA 4EI2A 2IH4A 1E2KA 1JU4A 4IFTA 4C6TA 2VPTA 2O8NA 1W0CA 4JI8B 4YO8A 1WRBA 3U1TA 2EWWA 2PXAA 2DBQA 3WKDA 4XPZA 4HWPA 1PUJA 3PQEA 5MDHA 2DZDA 3GFSA 3EXHC 4YCNA 2QN9A 3ENKA 3H83A 1HNXB 4I9NA 3BB1A 1BMQA 5FHRA 16PKA 1UBGA 3A4LA 2GASA 3NJ4A 5IAKA 2XCTB 4IGIA 1PFWA 3W8RA 4DM4A 3G7UA 3WAJA 1ZXBA 2NZ8A 1NKTA 3MJCA 3N0RA 4MVJA 3EW9A 4E5SA 1JKJA 1GKIA 1TK3A 2QK4A 4PHTA 1M1UA 3D5QA 5AHWA 2AFHA 2R5WA 1SD5A 3T4XA 1FNDA 6AT1A 4QYSA 5AICA 3QXHA 2HEIA 3ESAA 4KBYA 3BMCA 4WA7A 1JN0A 1QAMA 4JL6A 1W9HA 2D3WA 2ZI4A 3NBFA 4M9RA 2B1QA 1Z7WA 4TTQA 1XALA 2F67A 5EIHA 5TPWB 4E51A 4FDTA 4L0DA 4UU7A 4BKOA 4KOEC 1RADA 1BXRA 5IJ0B 3H5TA 2JGDA 3I01M 4QEZA 4X1IB 5ITVA 4K86A 3V8NA 4WNCA 4DMKA 2CFCA 1USGA 2BL4A 2ZYHA 1TEVA 4OHVA 3ZHTA 3T1QA 3DKIA 5AXBA 3SXPA 1ODFA 1Z35A 4LZZA 2W4MA 3UXYA 2F00A 2FR1A 1E77A 4G97A 4P0TA 4CYMA 4FD2A 1DX6A 4JT4A 3G2JA 2W2TA 4Y8VA 1MHTA 1PK7A 5SZHB 3UFBA 4DDTA 3SPXA 3QWAA 1Z6YA 4D9NA 2QRVA 5FP0A 1RWOA 1BIFA 1KMCA 2G4CA 3QITA 1NBMA 4ALMA 5IKEA 3PQ2A 4MVJD 5D3ZA 5MF6A 3ITDA 2HLDD 4S2EA 5E6UA 3IAM6 3DEKA 4EB6A 3ETEA 3EC7A 1WMAA 4AXBA 1G59A 1DUVG 4XA8A 1R0BA 1GYQA 1FRVA 1QHGA 3LFTA 5IKPA 3ZWAA 3TXAA 1QBGA 4RZIA 4UXHA 5EWLA 3D2BA 3KJQA 1C1DB 3ZV4A 2ET6A 4BMDA 1KBQA 4HN4B 1C8LA 1L1FA 4BMNA 5B55A 2DE0X 1RPZA 3SSMA 1MAVA 2NXWA 2VRWA 2WHEA 3KQTA 3B51X 3C7KA 5K8UA 3CEJA 4IIEA 1HH4A 2JEZA 5C1BA 3P2MA 5ISMA 3UPUA 4DLNA 4MI9A 4LXXA 4BNTA 2F1KA 3GU3A 4FJ1A 2XWQA 2VP4A 3IAUA 5EWJA 4CXMA 1G5HA 4EOGA 5CNKA 2FSSA 4TMWA 4X8MA 2VJQA 5EE3A 2JFUA 1IEXA 2AS0A 3GOHA 5BYKA 2H54A 1V96A 5KQRA 1EFPA 2QW8A 1NF8A 1RWKA 4RH1A 5WRFA 4MGKR 5I7HA 3P9SA 3COPA 1W6UA 4LBZA 4PLPA 3SDSA 3IP3A 1VDZA 4G0QA 3FFWA 4CKZA 2KJQA 2FFRA 4RU1A 4BNDA 1N5OX 3QEMA 2UZAA 2H1RA 3BOSA 5KHOC 1UAAA 3MOSA 5IS2A 4QX6A 5LQRA 5DX8A 1E7RA 1N5IA 2R9VA 5JJLA 3V4ZA 3A1NA 3KWMA 1M6WA 3NAZA 4ZYWA 3B5JA 2G9QA 1T2DA 1U31A 3TTVA 4C07A 2JL1A 2ZT7A 3JARA 3TUZC 2ZTSA 5G40A 3ECCA 3RVBA 4MO9A 3QKRA 4INPA 1U1EA 4O4HA 1P2SA 1HYBA 2RGWA 3FSJX 3KUKA 5G1OA 3VAAA 1TAUA 1E7YA 5F35A 3QWIA 1VJ0A 1ZD9A 3R3VA 1GOTA 5E3HA 2YN4A 5EIBC 2FNAA 3D1VA 4LY6A 2WR8A 3HEBA 5CEEA 1YQEA 2O52A 4NEGA 4E15A 2NADA 2WJYA 4K03A 3MBKA 1KTIA 2J6BA 2WLSA 3I58A 4ESEA 2H4YA 3A6JA 4MEJA 4U7GA 2VRCA 3OQHA 4ECAA 5TS3A 2JFYA 1BCRA 4DB4A 3QJ5A 5REQB 1NQVA 1UZNA 4TKVB 4ABYA 4LN1A 3LUCA 4ZKEA 2YFKA 3AUUA 4UNRA 4LJ6A 2BFOA 2OO5C 3A2LA 4TMFA 3WDMA 5BNIA 5DXJA 3L5KA 2UYOA 3NQ41 2J3JA 4V1CB 1ORRA 2Y0CA 5LMUB 3TL6A 2BFEA 1NVDA 3MT7A 4KTVE 1OR8A 3IKMB 3K16A 1WNTA 3W90A 2WNHA 2WRZA 3KFLA 3URKA 3Q11A 1ZC3A 3TFOA 2P9ZA 2D1RA 4HAOA 4CR7A 2W9XA 3BXHA 1BGVA 3EGDB 3GJ4A 4NU6A 3I2KA 5H80A 2HPHA 3UNXA 3M6AA 1DHTA 2CJWA 1H0KA 3ICWA 3RBVA 2ZJOA 1H5UA 1WU8A 1YKFA 2YWCA 5B3LA 4JEIA 4XDGA 3RWBA 2J5QA 3Q8XB 4NOJA 3IKJA 3RKSA 1KU6A 2CLMB 5DH9A 4CM7A 3O93A 4N48A 1F1BA 5L3ZA 1RWXA 5E8RA 3GF4A 3FTCA 1IATA 4LYHA 4ZRNA 3X2SA 3KIPA 5JBIA 2VRCD 4MCIA 4L8YA 3HWWA 3IMKA 4D5EA 5NULA 3NIGB 3W1WA 1JLRA 4F1WA 3S8YA 3HM9A 3C6BA 2YW9A 4N41A 3VZPA 1C0KA 4MYSA 1JEDA 2PD3A 2YZGA 3HYNA 3IRVA 2ZR0A 1KQFA 1SEPA 4EFMA 4Z4FA 3BL6A 5KYTA 1QYVA 3JZDA 2ZYUX 3HO8A 2IUUA 1WXIA 5K4AA 5BN3A 1AKWA 3UV3A 4EKYA 3A0UA 1VIMA 2O7NA 2PGDA 2PWZA 4J16A 3HXQA 3OHMA 2DR2A 4FFSA 3L4SO 3F71A 1QONA 4LYDA 3EAFA 2IOQA 1KETA 3H1EA 5AI8A 5DHQA 5KTPA 2NMVA 1E2JA 3KZVA 1EBUA 5ABPA 2UV8A 5LQJA 1E0SA 1FFSA 1W4RA 3IKVA 1ODJA 4YFVA 4N5DA 3PC6A 3VYSB 4DQXA 1FSZA 1OFVA 1Q0UA 2B6NA 2YFYA 3BWVA 4F84A 3PDJA 1QIFA 3ZY4A 3R7AA 3LV8A 2HJVA 1CJKC 4I55A 2ZPUA 1K8ZB 1LNZA 4EJSC 1SM4A 3KKOA 3OZCA 5JQGA 1F38A 5FO1A 1C3VA 2JLVA 3H6KA 4QLAA 4AF7A 4ZJZA 3AJRA 1GRQA 4WKCA 2FAXA 2ZCVA 1QKIA 1RZVA 5KTYA 3M89A 3ZVLA 1RTKA 3EQZA 1D2MA 4H7FA 4QOEA 4WASA 1RACA 2ZJFA 1XZHA 3CBQA 1QK4A 2IK8A 2VDWB 5AW3A 5B58C 1LK5A 4TUYF 4UEKA 5EJGA 1EFCA 2XBMA 3EFBA 1YONA 2BCEA 4R8KA 4TWZA 3IPRA 1X6VA 3TQIA 3RCBA 1Z5UA 3PVZA 5CJPA 1O6FA 3ETHA 3SC2A 3CVJA 2WINI 3QOYA 1YI1A 3E70C 1CUSA 4AY3A 1RJWA 2NZYA 1WHTA 3X1YA 3QRWA 2CNLA 5KOYA 4PG4A 2NTVA 5TEWA 3K32A 1TX4B 1BJTA 1VIYA 2EARA 1J33A 3AV3A 4YDQA 4Y2VA 4WY2A 3PTAA 3QHPA 1OLXA 2QQGA 1CQIA 2VCEA 2UUCB 2FWBA 3ETCA 4U2DA 1Y5IA 2EFJA 4FC7A 5K7SA 4I1PA 1L5NA 1ZO8A 1J8QA 1NVTA 2WSIA 4GI7A 2IYTA 3CHYA 3VI3B 1Q21A 3RU2A 1UH5A 4GYKA 4B6QA 1EBFA 5CXSA 8ATCA 2QL5A 1JFTA 4XQCA 1U65A 4CQLB 3DBLB 3DDUA 2YUTA 2HMAA 3DDZX 3MCWA 4EA6A 2KB0A 2VOJA 1N3BA 2QQFA 5AKEA 3RVPA 4HNRA 1UDRA 2IHUA 2YS7A 2H1SA 4OQYA 5FQNA 3HG7A 4E4TA 1ECJA 1JU9A 3MMXA 1UOOA 4H08A 5DNEA 1GAEO 1KJYA 4AG6A 5KTMA 2QRPA 2Q6KA 2ECPA 3HR4A 4KNWA 4RY0A 2JGNA 2G0NA 3OT4A 4GH5A 3G2PA 1MDBA 4W5QA 4ON9A 5EYPB 3WL6A 3SIRA 4FB4A 3EIXA 5CFNA 3SQWA 4OSEA 3SNHA 1UMKA 1UBHS 3ZUGA 5CJJA 2BTQB 2VKQA 10MHA 1WF3A 3TZCA 3UWSA 5CFMA 3DBVO 1CX9B 5E0KB 3NX4A 1U7UA 3RVQA 5D00A 2Q62A 4N5HX 5J59A 2C58A 2HWUA 4I2VA 5M5BA 1EX7A 1C3JA 4MVYA 1MNAA 1LTQA 1WZ2A 3R7FA 4X90A 3VVCA 4GPAA 2AUNA 4GSLA 5BWCA 4HKTA 3FOEC 1HBJA 1QRDA 3EZFA 3TRJA 3RAEC 5ALDA 2E4WA 5E8JA 2WYIA 4ZCIA 5EKDA 3OTQA 2VXCA 3VZBA 3EVBA 1Z0JA 4RZ3A 5DGIA 2H2HA 2PA0A 1QAOA 3CEHA 4D4GA 5FEMA 1AQ6A 4WKOA 4PYOA 3IP1A 4KFTA 3PUXA 4BLQA 4WKPA 1Z08A 1R3DA 4G26A 3PWSA 2WFAA 2XDAA 4L8GA 3BFPA 3VNVA 1MEJA 4EW1A 3NPAA 1X7YA 5F5XA 5C35A 2HX1A 3RIGA 1TKRA 3PCTA 4BVLA 3I30X 1NQ5A 1PJ3A 4FEYA 4OB7A 4OYHA 5KVAA 2MYPA 3U0BA 2ATEA 3IOCA 2XV1A 4LK2A 4RV9A 4V24A 3KAPA 3LC7O 4DIEA 3DHWC 4A6DA 4JIGA 2Q6VA 3HA2A 3IQXA 4ZANA 5K0JA 3ZI7A 2OKCA 1U8CB 3N6VA 3RTAA 1TKAA 4DRZA 1W36B 1KNXA 5E3IA 3EXG2 1KHHA 2MJLA 1J5PA 3QX9A 3DV2A 3PC4A 1NQAO 5DEOA 3VKGA 3S7TA 4E12A 1PW7A 4LY3A 3W0LB 1W30A 4CIBA 2BFCA 4JLMA 3BD8A 1U3GA 2WTAA 3FZQA 4MVWA 3PENA 1EFDN 3KQHA 2JJMA 2XUPA 1U8ZA 2EFEB 1XMXA 3BZBA 3EMKA 4D3ZA 2VJAA 1N57A 3HCDA 5JADA 4HN9A 2R7KA 3K35A 3T3GA 5B4TA 1KQOA 1LX6A 2ZBEA 4S3MA 2VTKA 4MYTA 3AC0A 1RAHA 3B2EA 3IEUA 1AKEA 3BRQA 1JIJA 1SC9A 4IDBA 1JKFA 1VG8A 3UOAB 3GLGA 3BM5A 3IQFA 5AM1A 3E23A 4DBLC 2E4AA 2X7XA 4K9NA 1SWWA 1YJ5A 1JQDA 3VUFA 1LY1A 1XTPA 1VBKA 1WM1A 4JGBA 1GTSA 1VDMA 1N8KA 1FJHA 2KM1A 3K5IA 4Q39A 4Q7MB 3OOJA 2IEIA 5HTKA 3FUCA 2BR5A 2GKOA 3KALA 1LC0A 3C15C 3Q2OA 3FDFA 3GPCA 5BQ5A 1PS9A 1MO3A 1IJBA 1TM7E 1M9NA 1SXGA 2NACA 3A4MA 3KPWA 3LPMA 4X7PA 4N7JA 2RARA 1E0DA 1RKVA 3BIOA 2ZUBA 4OB8A 5CLGA 1G64A 1I5EA 1M34E 5H3LA 2XVZA 2ZBFA 4MW7A 3SAJA 1N4DA 3T5DA 5JSZA 3IOMA 4L73A 4UC0A 5GZ6A 1K5PA 3Q3GE 2PLFA 2FOLA 3NYRA 3GN1A 1ZIXA 3F8WA 1Z16A 4HEHA 3AZQA 3AHEA 4Y2GA 4DLBA 3CWZA 5JJBA 5CDUA 2QP4A 5EZ6B 3ZTYA 4C87A 4PCLA 1ODKA 2JDIA 3DXZA 4OP1A 5ERYA 3S5JA 4MKZA 1N3LA 1ZD3A 2QTFA 4CFYA 5HUHA 2B1GA 2Y1WA 3OEHA 2BFDB 3QLVC 1Z7GA 1X14A 5T57A 3T1OA 5I9BA 4FHCA 4AJKA 3RF7A 4ZOQI 3BE6A 3FRJA 5FPTA 2FMUA 4O29A 1LBTA 3TZEA 2A0XA 3S2IA 5TPZA 1PHRA 4D3XA 5LMZA 1H2XA 3VDXA 2GVZC 1FTNA 5DM2A 3S2UA 5IC5A 2I6QA 5LM3A 2UZ4A 2Y0PA 3KCNA 1L7XA 3A26A 4NBVA 1KNQA 1XYYA 2Q50A 4OGLA 3W2IA 9MHTA 4L85A 1IE3A 1P6UA 2P9CA 4RZHA 4ERXA 1NBOA 3KZMA 3S2SA 5I4CA 3ULKA 1PNVA 1CDDA 2A88A 2G9RA 2VTVA 1LCIA 5IXYA 5L4SA 3KHTA 5EHIA 2DFKB 3FBTA 3FFTA 4L28A 1AZWA 3Q2IA 4UCWA 4LTNA 3HADA 3CWCA 3BH7A 4B2IA 3A6EA 3QPAA 1MDFA 3JQ8B 3D7KA 1ZONA 5B1EA 1CB0A 1FZQA 1UJNA 2P9QA 2F7SA 1E96A 4M1SA 4BNZA 2R6R1 1KO8A 2AQKA 2GYUA 1O5OA 4Q9KA 3I2YX 5DKFA 1Z5ZA 2ZIGA 1BFKA 3F6SA 4K2HA 5E2AA 4E46A 1EXDA 1L0BA 4E21A 2JDID 3GRVA 3IQIX 3DCNA 2MSEB 3DVRX 1ZMTA 1JQKA 1NZJA 1PO7A 2PQ0A 3PYXA 5I48A 2JKVA 3HDVA 3KJGA 3RT1A 1Y6FA 3P2IA 4B3BA 2X0DA 3OX1A 1ULHA 4L9AA 5FCDA 1GU1A 4JGIA 2HJWA 5AVOA 3ZH2A 3ROXA 3QP9A 1XTTA 1VBMA 3ZDAA 4P84A 5K3EA 1EVIA 2C61A 4G23A 4TVKA 1LXCA 1QHYA 4ZV7A 4E2XA 1E2BA 1H4TA 3N8KA 2PZGA 2P69A 3WGYA 4QTYA 2R11A 2WM9B 4NG4A 4REOA 1B23P 1FP2A 2O2ZA 2QRUA 3IV9A 1ODIA 2FZEA 1NVVR 2EU8A 5ENVA 4PBSA 4CT4B 3VOTA 1AH2A 1U2RA 3HFJA 4HTFA 5LBIA 5CA1A 2IP1A 1WD7A 2CUNA 4ND6A 1ORWA 4P92A 2I6GA 5J2UB 5IG2A 3FBGA 1B8PA 5D5PA 3B1FA 1VXRA 2GEKA 2HI0A 4M53A 3N5CA 3Q3JB 5HEKA 1CZNA 1M33A 3S40A 5FBHA 1O6CA 5B5SA 1YIAA 2EIXA 2WF8A 3ZWKA 2GGSA 1OH6A 1W36C 2LCFA 3JR7A 4X8HA 3SI7A 3LHSA 1P1HA 1U4SA 2NQ2C 3EN0A 5DHSA 5FFNA 4D5GA 3LXMA 1DCMA 1FPQA 1U3FA 2AQIA 2XMBA 1G9XA 1Q3TA 5CURA 1CZLA 3NXKA 3DXYA 1V11A 3E3MA 1NUAA 1G42A 3EIQA 3I39X 3K2QA 1N32B 1GEEA 2J67A 1CJCA 3OZFA 2CUTA 4MJ7A 5FTNA 2FY8A 1JIIA 4EHKA 4KC0A 3Q0IA 2YJZA 3WR5A 5AJYA 1THZA 2DQZA 3K9WA 3MTGA 3QELB 4LOIA 5CJ2A 1P7VA 1UK7A 3BKWA 1UR5A 4YROA 3USCS 5BMVB 2OGSA 5LIRA 3KLBA 1WULS 1EMDA 4QPZA 4ZT4A 4HADA 1H2AS 3VPXA 5GIOE 2GXUA 4UVDA 3U3ZA 1Y3BE 2EF0A 2P79A 3AF3A 1E2NA 3I8XA 4C7XA 2Y6UA 3N2KB 4FI3F 2I3GA 2HJSA 4G4JA 4BX2A 5FWYA 1RCFA 3FDJA 3HEMA 2J8ZA 1X1RA 2FEOA 1SOWA 1VMEA 2O3SA 3VTAA 4F5DA 4JU8A 4G0YA 4KJXA 3PA8A 4NTZA 4C3OB 5LR6A 4FX5A 1IZ0A 2TS1A 1OV6A 1N4AA 4DVGA 1Q0ZA 3OPYA 5FL7A 1N6RA 1ZKDA 1LLUA 1XKLA 5JDCA 1QORA 1T36B 2AZ4A 1ND5A 4A4DA 1YQDA 4XKJA 1PT6A 2QIPA 1G7TA 4AWAA 4HFRA 1QGYA 1ZCZA 3U7QA 1HNWB 4PIPA 3UF0A 1ZCAA 2ZTLA 1YBHA 3VHRA 3DFFA 3QFCA 1RZRD 1RYFA 2DJ5A 4DT1B 2J6IA 4FC6A 1WCIB 3CW8X 2HADA 4FNOA 4KQ2A 4PNHA 4NH4A 1M2KA 4YJ2B 2G9VA 4BO4A 4W5NA 5JY1A 3UC5A 2FW1A 5EZYB 1DE0A 3I6ZA 3NHMA 1GUYA 1KJNA 3CLSC 3OG9A 3QM1A 4IOMA 1N0IA 1RQLA 3KYCB 4EHBA 5DI3B 1QLHA 1NW3A 1I1OA 1J8VA 2PJZA 3HPRA 1TU0A 3F8SA 4NHOA 4XWTA 5FIUA 2HFKA 2F55A 1YBMA 1J09A 1NVFA 3H2SA 5D7NA 3NANA 4YN3A 2Q5JA 1YMQA 4OIFA 4O8ZA 4TMZA 4JENA 2ZIAA 4NU5A 2I6UA 3D6MA 3N2GA 4YB8A 1RBMA 1P7ZA 4Q9JA 3W5JA 4DLKA 2VG8A 3QKSA 1GVNB 3CY6A 3V8MA 1UPAA 4P5EA 2C2WA 2B34A 4ZTBA 2BFAA 4RACA 3EWSA 3KSUA 2PNJA 4DUYB 3NH9A 4IRUB 3VFDA 5DNUA 1IPFA 3RYHB 4ER7A 1OREA 2CLCX 3KXPA 2OCIA 1UBEA 1RLUA 2G9ZA 4P6VF 3EPPA 4QBFA 4O3FA 1ZMRA 4WKGA 1YB6A 4MW9A 3GBSA 3I2GA 1LDMA 1O9HA 1GZDA 3ECSA 3HGQA 3L7IA 2EDAA 3LP6A 2O8DA 2P2ZA 1NY6A 1O6BA 4CUZA 5AKZA 3WNDA 1FFBA 2WV9A 2XKAA 4EWLA 3ONFA 1KTVA 1NI4A 1U1CA 1N5MA 2CHFA 3B6JA 1F6BA 1XVLA 2XGMA 3PDWA 1A9ZA 5KI6A 2AG6A 3UAZA 3OICA 2HQBA 5KJCA 3MG9A 3CUVA 2RKBA 4ND7A 3ORRA 4ER5A 2G5PA 1LKZA 4HUQB 1CEQA 4KDEA 5LN1A 2D59A 3IP9A 3K6JA 4LZAA 1FP7A 1SVMA 3EDCA 3GH1A 3HNOA 4ND4A 4S1PA 3TSCA 1CY1A 2NQTA 1RKQA 4I4IA 2WSLA 4M0FA 3RAFC 4M55A 1OUMA 1I2MA 3C0KA 4UCFA 5AJVB 1YS4A 2W8BA 1XRLA 4WBNB 1TF2A 3F49S 2ZRGA 2AYYA 5CBKA 1U3DA 3AR7A 1A1SA 1SOMA 1M7GA 2WNIA 1RPJA 4HVLA 2PIAA 3GB9A 4KXXA 1SXJE 4CIWA 1NRXA 1SHZA 3DMFA 4TQUS 1B15A 1JHYA 1LI5A 2IITA 4L4SA 4UOEA 3KQMA 1R8YA 1I3KA 1EA5A 3MTQA 4L16A 4MUYA 3L7NA 4R2MA 2AW5A 2ZS8A 3HKDA 4S05A 2RH4A 1O95C 1FP4B 3CGGA 4DYVA 3U1VA 2J09A 2PLWA 3HGMA 4PIVA 2PX6A 4QWWA 4UEQA 4BKRA 3MIIA 2EQAA 4FFWA 1DOZA 1P5ZB 1PJCA 1S1CA 4ZZ0A 1HDGO 4EPRA 3WMXA 2GN0A 2R6GA 4BZPA 2XZDA 3OZRA 1Y89A 4QDTA 4TTAA 1JYEA 4V0OA 4QDXA 2VA8A 5JO9A 1S0UA 1NFRA 4II3A 1JG3A 1NXPA 4DNXA 1B2RA 1Z5NA 1XDGA 2J3LA 2OC4A 2ZUCA 3D0QA 4GPIB 3V2IA 1LBQA 4DZZA 3B6IA 5JLJA 4YRCA 4X24A 3P96A 1ZK3A 1ZOLA 1TYZA 2YZ2A 1HA3A 4FGSA 4BO7A 3QF7A 3AIIA 2P7HA 1GN8A 3WWCA 1S2DA 2Q1WA 4WA8A 2POQX 5JYDA 1N2GA 4NBNA 1TIKA 1VE5A 1ADGA 1BDIA 1LQ2A 1P2GA 4D8XA 2IZ6A 3E2PA 3GJ7A 4BBJA 5L9AA 5J5VA 3WMGA 2QJOA 1SUIA 3HCRA 3IHLA 3G1UA 3ZWNA 2YWDA 3CKLA 3MRXA 1VHQA 4J03A 5ITZB 2EQBA 2FZKA 3GIWA 5AVJA 2VEDA 3G1TA 3H2ZA 1VZ2A 1QVZA 2XNKA 3G8AA 4IDGA 4KX3A 4MWCA 3SZUA 1ES9A 2B5OA 3R5FA 5DOZA 3PKZA 3HBFA 4HXEB 3IVCA 5EUCA 1UWLA 5HK8A 3RADC 5JH7F 1TPYA 2WYOA 3ETDA 1ZWLA 5LZ9A 2ZM6B 3HC7A 4KQIA 4ALIA 3U3MA 1HXHA 4TQGA 2CUZA 1YDHA 3JD2A 4CLHA 3MWEA 4J1SA 5LBUA 4RTQA 4OI0A 1KIMA 1YDEA 4Z8YA 3FTQA 2Q7DA 2VHYA 3GV0A 5FD8A 3F5FA 5PNTA 3WZLA 4QM7A 1PL6A 3AR9A 1Q7GA 4EFDA 2JI4A 3T5GA 3TD6A 3M83A 5J4LA 3HFRA 1FXWF 2RGBA 4RLQA 4OMUA 3PIIA 3ZXIA 1B0AA 1CE8A 4YJ3B 5KSOA 4NMMA 1QF6A 5BYAA 4MVJG 1OOEA 4QJ5A 4N54A 4PC2A 1JR3D 1EIWA 1AD2A 5ADVA 2Y92A 4LE0A 2BAGA 3L82B 2ECKA 5AYVA 4J1TA 2ZKIA 1C30B 1KMNA 3TO5A 3B7PA 1P6XA 5K2MA 4NXNB 5K8LA 4RJIA 1U7WA 2FSPA 3O8NA 3QX8A 1LNSA 5B3JA 5C4IA 3TQQA 1WBBA 1F0YA 4IINA 4LRXA 2W6ZA 3TFQA 5JU6A 4DTCA 3ZZNA 1RPNA 2LIPA 1K4MA 4UTOA 3QW4B 3RVOA 2FXVA 1NNSA 1YU6A 1GRCA 3ZW7A 1ZHHA 4YK7A 1ZCJA 1W5EA 1P7CA 2WWFA 1DTEA 2BSXA 2RI1A 1HK7A 3Q7PA 4KXVA 4R54A 2CL6X 3HABA 3ND8A 4E2YA 1GVHA 1GTG1 3G49A 4CCYB 3RRZA 5CITA 1B1AA 6ADHA 3SM3A 3MMNA 1YFLA 1V4BA 3T7RA 3AW8A 4LPSA 4WINA 2H16A 1ORDA 3NRCA 5FKJA 1XNRB 1RRGA 3SIXA 5J23A 2QVLA 1LFDB 3VC3A 3DTVA 2I55A 3EB9A 2IRWA 3HKCA 4IH9A 4M8SA 5DHAA 4ATNA 1M1NB 4IW3B 5SY4A 7REQB 1L4KA 3MUEA 3SHVA 4B3DA 4ZVRA 2PUJA 1JSRA 3W7VA 1YBFA 4FXPA 1WZIA 2V8BA 2GEUA 1CR0A 4RSMA 3TSOA 1DAFA 4L6AA 5IYZA 1UKCA 4H7KA 1QS0A 1C80A 2JAHA 2O3TA 3SXUA 5CP8A 1Q0HA 5J2TA 1GPYA 2GM4A 5MGBA 1YR9A 1V41E 4UTZA 3V2UA 2QUAA 2VJYA 3B1YA 1RWQA 3BA1A 3FI0A 5EEGA 1Q0TA 1XTJA 4ZHSA 4TKUB 3RBZA 2PU5A 1Q3HA 2D2IA 3RGWS 4V02A 3VVLA 1NHWA 4E3WA 5BORA 2Z2IA 1SMKA 4AUKA 3L8DA 3GVIA 2GBLA 1KOGA 3W5DA 2H07A 1A9OA 1TM4E 2PJUA 4O4JB 1VYTA 2PNFA 1AQLA 4N5LA 5AVVA 1IH8A 5CVVA 4P3KA 3DOOA 2HJGA 1DBIA 2GTPA 3FWNA 3I2HA 3JWEA 2V7PA 3KUUA 4I5IA 1PL0A 4KK3A 4P86A 4FYPA 4CDMA 4TTPA 1KI2A 4BDTA 4CV3A 4JQOA 3O9MA 3DL2A 3LQ1A 3CH6A 2QGFA 3CLTC 5BT9A 1B6SA 1HPLA 1WUJS 4J7UA 4D96A 3WQSB 3ZOZA 3VJRA 4GL2A 1LUAA 2OK8A 5DK6A 3R3HA 4AL4A 3A6DA 4B3JA 4UQOA 3PNVA 2X6QA 3EVZA 4JSRA 1BX1A 5DZSA 1ZKMA 1ZNWA 2YRFA 3TF5A 3VC1A 1KYXA 4RJJA 4YWJA 5ARCA 1R5OA 3RYIB 2FN4A 4NICA 3D4PA 1WTAA 2HIAA 3W5CA 2RB4A 2C1XA 1N6LA 1XRRA 1PGOA 4JYCA 3HJAA 1UKAA 3PHHA 3M5WA 3C8HA 1LS6A 3LX5A 4W8HA 3B9BA 3O8OA 3ZQKA 1YASA 1RAGA 2AG5A 2REOA 3B36A 3O31A 4MITA 4GYYA 4J4TA 1D1TA 1VFPA 2GZ2A 1G20B 3BFXA 3O2SB 3QVGA 5C0OE 2EZUA 3CISA 3WGHA 4BKPA 4E7PA 5AVRA 3KKZA 4IDEA 4WNAB 3H1AA 4Z1MA 3RTGA 3JQGB 1C1HA 3IJEB 4O2BA 4BO8A 1X7WA 4P7KA 2FJ0A 3D3EA 4GSKA 5DOVA 3RBAA 3L6DA 1D2HA 3BD7A 2XJ4A 5G0VA 1SKAA 3TINA 4FMCB 3CZQA 4ZDWA 4O8CA 1UMBA 1XZ8A 3A9CA 2HMWA 3M49A 4X3CA 3RTDA 5EHXA 2FG7C 3DHVA 5H82A 3WSWA 1KEPA 2QRJA 4ARBA 1U2TA 4RPIA 1JEOA 1EJ0A 1QRAA 3HU2A 5A6SB 1FP1D 1SIWA 3H7IA 3JVUA 3P9CA 5T41A 4AO8A 4YIHA 2A14A 3W3ZB 3NBKA 5EUQB 1F12A 1KARA 2D8MA 3I45A 4HLNA 1QRUA 1AU9A 1TTHA 1J4AA 4KAFA 4PGFA 1UBKS 5LBTA 3TSAA 2FETA 3T8YA 3VTFA 1SBYA 3K94A 3NHSA 3HSYA 2GCIA 3RVNA 3OSZA 2LNDA 4V0MA 1G2QA 2PMEA 1WMBA 1ZGBA 4C4TA 1TF7A 3VDQA 2C2YA 2CYCA