4JKOA

Crystal structure of a catalytic mutant of axe2 (axe2_s15a), an acetylxylan esterase from geobacillus stearothermophilus
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
219
structure length
219
Chain Sequence
MKIGSGEKLLFIGDAITDCGRARPEGEGSFGALGTGYVAYVVGLLQAVYPELGIRVVNKGISGNTVRDLKARWEEDVIAQKPDWVSIMIGINDVWRQYDLPFMKEKHVYLDEYEATLRSLVLETKPLVKGIILMTPFYIEGNEQDPMRRTMDQYGRVVKQIAEETNSLFVDTQAAFNEVLKTLYPAALAWDRVHPSVAGHMILARAFLREIGFEWVRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
publication title A unique octameric structure of Axe2, an intracellular acetyl-xylooligosaccharide esterase from Geobacillus stearothermophilus.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 87
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4jkoA00
4JHLA 4OAPA 1BWRA 1DEOA 1J00A 4NRDA 4XVHA 4JKOA 3HP4A 1V2GA 5HOEA 4TX1A 1PP4A 4H08A 3MILA 4K7JA 2WABA 1ES9A 4M8KA 4JJ4A 1FXWA 4IYJA 5CD9A 3DT9A 1BWPA 2Q0SA 4I8IA 3PT5A 2WAAA 5B5SA 3SKVA 4JJ6A 1Z8HA 4K40A 2HSJA 3BZWA 4PPYA 2VPTA 5JD3A 1BWQA 4K9SA 1YZFA 5BN1A 3DC7A 3DCIA 1DEXA 2O14A 4RSHA 4Q7QA 2APJA 3C1UA 4JGGA 2W9XA 3KVNA 1VJGA 1ESDA 1FXWF 1IVNA 1K7CA 3SLRA 1JRLA 3RJTA 1ESEA 3U37A 2WAOA 4RW0A 4Q9AA 1VYHA 4LHSA 3P94A 1WABA 2Q0QA 1ZMBA 4K3UA 4HF7A 4OAOA 1ESCA 3DT6A 1U8UA 3DT8A 5A4AA 4HYQA 4S1PA 3W7VA 4DEVA
chains in the Genus database with same CATH superfamily
1R6BX 2R85A 1RCUA 1J0XO 4Q4CA 4ZRMA 2J3JA 2HDNB 2OOKA 3KKZA 4RM3A 5FI0B 3V2IA 4BJ3A 4D57A 3M7IA 1JMVA 1UMBA 1UKZA 4I5EA 2RG7A 5EGSA 4UU8A 4I99A 4O1MA 4MW6A 4KR0A 1C2TA 2NU6B 2W5UA 1L7AA 4OP2A 1BEZA 3TLXA 3BFKA 5AQ1A 1SHLA 1T43A 5IC4A 4L16A 2WYVA 1GFZA 1WDTA 4QLAA 1NI3A 4DBZA 5HOEA 3IAXA 4PWZA 3N75A 3BUSA 4GPTA 4MVJP 1XMPA 3GD5A 5FL7D 1IUNA 2ZWIA 4PG6A 4K6FA 4ZXFA 4TLEA 5FHQA 5LWQA 2IH4A 3DE6X 3RNOA 5L7TA 3B1VA 3DO5A 4JOCA 1A9PA 3CM0A 1W1UA 3OFJA 4M49A 3OCCA 2FG7C 1OZHA 2JGIA 3HCEA 7ABPA 3VVCA 4ZYVA 5B1DA 1EFPB 1PKEA 2F3QA 2O8EB 4FFSA 3M9WA 2DT5A 2VDWB 1H5NA 3WRVA 2BTOA 1BROA 1DX6A 2G36A 2WYIA 3Q2OA 4QC2A 2IC5A 4PSDA 3W78A 2KPOA 1L7MA 2X8WA 4FK8A 5KMGA 2DERA 4YCCA 4BLWA 5EL0A 4BV2A 4MYDA 2BZGA 4FE4A 1YKFA 3GMIA 3PHIA 3GOQA 4I5GA 5HF5A 3IMFA 2FQQA 3NI2A 4PRYA 2C4MA 2TMKA 4U2DA 3R7AA 3KK0A 1NVVR 4I4TB 4B3FX 4EB6A 1DCTA 1F8GA 1ONSA 2R00A 3ITDA 3FKSA 2WJIA 2CL5A 4E6PA 2QN1A 2O9JA 4N49A 3GC6A 4IUYA 1FUKA 3HYNA 1T8YA 4PV7A 1EUDA 1PS0A 1VMIA 2DVMA 2G1AA 3LKBA 3BL8A 3MXOA 1IEWA 3H2HA 4K9LA 4JI3B 3WQRA 5IJWA 1RWWA 2NACA 2WJGA 1E20A 2Y92A 5F52A 3T99A 2AC2A 2J4DA 2Z30A 4YJHA 5AUQA 1QONA 4H0CA 1E8NA 3MW8A 1KO5A 1JT2A 1DS6A 1MMFB 2IPNA 2X0NA 4DSTA 3FDJA 4IQ4A 4R1UA 2P40A 3FNIA 4L5JA 1EFKA 2Q50A 2JFOA 4I1SA 4NJOA 3NGXA 2P2NA 4F38A 3GLHE 1E2MA 4QD3A 2IXEA 3JWHA 3ZY3A 3PHJA 2O54A 4IZHA 3BEDA 4Y67A 3TD6A 3ZHCA 2IOYA 3FDXA 4BMYA 5F7XA 1OIWA 5HIJA 5LA6B 3UF0A 1TYEB 3ENVA 2A2ZA 2L0XA 4UUPA 1G8KA 3DEIA 3OE5A 2VZ8A 1BFKA 3WB9A 1PNOA 1WUYA 3VQTA 1MX1A 1T25A 4MW7A 4AMYA 1RIIA 4TTJA 4B44A 5IJ9A 2V7WA 1PTJA 3WNDA 1ZONA 1SXPA 3PJGA 4MQMA 3EGXB 5DCUA 2A1TR 2MWMA 4LDZA 5JJCA 3NV7A 1GU0A 3BH6A 4GT1A 4MZDA 1XL0A 1PGPA 2R96A 3G23A 4CMIA 4ZJYA 1Z0JA 4ZZ1A 5D5PA 3DWEX 1II8B 5D5HA 1C30B 2BR4A 3A36A 2J46A 1MJGA 1XSEA 4F9GA 1S4QA 3E81A 1H1LB 2ZYRA 4GBJA 1K6MA 4LZOA 4DJEC 2VPZA 1GZ5A 1U02A 2AXPA 2YYZA 5DHSA 1CF9A 2Y2VA 2YOFA 3KQLA 1QIMA 1E1RA 1JWBB 1RI4A 3NHKA 3I62A 1UBSB 3LYUA 4G1BA 5B6IA 1OFUX 4L5IA 3HB9A 2X58A 4P3NA 3OOYA 1CUZA 1C9YA 1I30A 1CS4C 1C8BA 4EA9A 1HBJA 1E99A 1M76A 2EQAA 5KTPA 2D00A 2PCLA 2D1TA 2DQKA 1HUQA 2HPHA 2ZDGA 3LT0A 1NY5A 4UOQA 3BILA 1JNYA 1PR2A 1USIA 1TJNA 2C9ZA 1E0JA 2R87A 2WM8A 4I4NA 4NBUA 2N1MA 2V7XA 4YQZA 4AC9A 4E4RA 1NY6A 1JDJA 3ZS8A 1K3FA 2H18A 5EHGA 1UMCA 3DZIA 3X0DA 4D97A 4WJLA 4WESA 5BOSB 5CEJA 5HKKD 3GAMA 5FWYA 1H0HA 2QUHA 4ESVA 2Z95A 3EXHC 4KO4S 4DCCA 2G6BA 1Y8QB 2ZR7A 2WF5A 4NICA 4AD8A 1OASA 1NM5A 1ZYUA 4DVJA 3OZXA 3NHUA 3RUCA 4EB8A 4BXOB 4D9HA 1UFQA 3SZ3A 2A0FA 4R1OA 2OHJA 3OKAA 5AWFC 4BNUA 2IP4A 2GEFA 3QX7A 4M0EA 4AN4A 4EJ6A 1OXKB 4PPGA 1XF1A 2PIAA 2BP7B 2OCAA 3M4YA 2CVFA 5FUMA 2E48A 3M8KA 2VEOA 5TF4A 4NBNA 3WGGA 5JCXA 3LCMA 3MMZA 2R8ZA 2XAUA 2HK7A 3IMKA 1PR0A 3AH8A 3QZUA 5KI6A 3PPWA 1RHJA 1SXJC 2QT0A 3VKUA 3MJDA 4OQZA 1SWVA 4UE3S 3WLJA 1K7XB 5LQRA 3K0EA 3CZAA 3P19A 5FBQB 3T7SA 4F4HA 5ALLA 1U1EA 4YRPA 3LPMA 3W7BA 4EX7A 2OL4A 3SHVA 3WGHA 3CVUA 4V0LA 4PQEA 5EXXA 2H52A 3TWOA 4IH1A 2YY6A 4F93B 3G02A 1J2RA 1RZUA 5LBTA 2IY8A 4EFKA 2JI4A 1RRFA 2VJAA 4GZMA 4CR7A 2CUTA 4O2AB 4L4YA 4IJVA 2NU6A 1DJQA 4M9CA 3RT1A 2XCRB 1N8NA 1W25A 4J4BA 5HZGA 3MFQA 2E4UA 1VXRA 4OSEA 4FS8A 1CUVA 3QPUA 3QQ5A 3A3YA 2JD0A 4HQ0A 3SLRA 3LHIA 3GG9A 3RTBA 2IHNA 3LZ6A 4GOND 1PT6A 3BJZA 3X2SA 3KD2A 5J5VA 4RCYA 4L2IA 4KIGA 3UPDA 1CVRA 2QM0A 1CVIA 4V0MA 2D3TA 4PINA 3R7FA 1G20A 4FD3A 1ECFA 4KFRA 4RABA 3O8QB 3ABQB 4CUJA 2C3PA 1C81A 3STTA 3ZK8A 4MDHA 2YWRA 1AXRA 1E1QD 4JB8A 4G23A 3IIEA 3DDZX 4L08A 3JRWA 1EFPA 1IN7A 1QLJA 4ZVLA 4D3SA 2O8EA 2O8BA 2ZTSA 3GJRA 2V7QD 2WM3A 1JJFA 1IQPA 1ZISA 3QVSA 2BGUA 3QKSB 2R5FA 4TN5A 4WZBB 3EAQA 3HB4X 1J56A 3ORQA 4ZT6A 3W1EA 3DYVA 4OU4A 2GM4A 1RYBA 1GZUA 2VK8A 1JR2A 3ZDQA 2R1UA 2IS4A 4NS1A 3M6WA 1T8UA 4L72A 2IBSA 1C8VB 13PKA 4HEA1 4UZFA 3D31A 3OLZA 4K6HA 5E1MA 4I4TA 1K5HA 4XSVA 3O94A 1PRYA 3TI7A 2BWJA 2OCKA 2P6OA 2FPMA 4FCWA 4Q00A 3PXAA 2FMIA 4F2WA 4F4DA 1XZKA 3ZVKA 1EM6A 3C5WP 4URHA 3GJQA 3MWYW 1N3YA 2AX4A 4UMEA 5TGZA 4F9TA 2G0AA 2BZ1A 3EZYA 3FNHA 4P2GA 1QO0A 4IHJF 3SYMA 5K3OA 2WTNA 2YOHA 4KBYA 1WSAA 3EGVA 4B4WA 4DWOA 1ZIOA 4I6GA 1PDVA 1S8OA 2ZJ7A 3LFHA 1C7ZA 2VRWA 1FUIA 5EJ8A 1UMKA 3F6RA 3MD0A 2HUPA 2YWCA 4RMGA 2QD2A 4R16A 3GLIB 1OR8A 2YYSA 1UXJA 2YRXA 3B6IA 1R0XA 4YACA 3GAFA 3H9GA 3WC4A 3LXUX 1DCMA 4BVJA 3BHIA 3PSAA 4UNIA 4DCOA 1YIOA 1EI9A 1MCZA 2DSTA 1S0UA 1GUBA 2HLDD 3A9TA 1UJ4A 3SNKA 3DQQA 5BQOA 4IDHA 5LBIA 1VCMA 4QFDA 4W9NC 1K6EA 4CNBA 3OY2A 3GEIA 1DUIA 1V5GA 3B6JA 3IIJA 1Y63A 5A3SA 5IM4F 4QIHA 3HI4A 2Z56A 4N12A 1ZRSA 5ALZA 3G68A 4TGLA 5CPBA 5EZ5A 4BZZA 5ADUS 3TRFA 3L7IA 4B84A 1E18A 4GU5A 3SX0A 4EHAA 5T8KA 1IPHA 1CEQA 1QKIA 3EGXA 4KE7A 4D9KA 1ADFA 5AJUA 1WPGA 2E4YA 2H11A 4GICA 1W52X 1TTQB 2WINI 3MMSA 2VPTA 3VU9B 2DF8A 1W2HA 1II8A 5LUBA 2XCOA 1C30A 4F3KA 3R4VA 3VYWA 8ATCA 3V1LA 1KI8A 2QW1A 2F8SA 1H1LA 4WUTA 2R11A 5EMMA 1NZFA 3KKLA 4YP6A 1XCGB 3K8ZA 3KSRA 2BMWA 1YJCA 3EZ7A 1DXYA 3TMAA 2LGJA 4YR7A 3EC2A 2B1JA 4HH0A 2MSCB 2VWGA 2K6GA 5AUOB 1TMKA 1W5SA 4R54A 1E98A 1VIYA 4ZEMA 4E7PA 4OFXA 2XB6A 2GJKA 2OB1A 2Q3LA 4DHWA 1JN0A 2VT3A 1TCUA 4IZ6A 4OPMA 4XWKA 1SQ6A 2IBMA 1OGYA 4JLWA 1NA5A 4X94A 4X8MA 2B8TA 3L77A 4P3KA 4HGPA 3RROA 5JO0A 4WIAA 1U8TA 2CL7X 2ZRAA 2WOJA 4OSPA 4A73A 3FCOA 2CNNA 1ESNA 4XFJA 4BO3A 5LQJA 1DELA 2C9CA 1YR3A 3NC4A 4NYJQ 2W2XA 5BOSA 3S70A 3U9TA 1HTWA 5JZ9A 2PJUA 1B93A 1JFRA 3N8NA 1D6MA 1T4BA 3TTWA 4L50A 1Y8QA 3NO4A 3KSUA 3KOXA 2HIMA 4X93A 4DZZA 3IOMA 1ISPA 4FP9A 1FNBA 2JIOA 3NHWA 3OO0A 2I80A 4LRUA 4NSNA 4S2EA 4YAEA 4GX0A 3UNXA 4UQLA 4DB4A 1IEXA 1XAHA 4EYKA 4DLRA 4J7CA 4YCDA 1ODSA 1ZH4A 1X7ZB 4HLDA 1BMQA 1BOFA 4RPIA 2PM8A 1JECA 1ZO8A 2BP7A 2OHIA 1WXQA 3KQMA 4GNKA 4YDHB 5EJFA 1XWIA 3Q88A 2ASVA 4TYMA 4TXMA 2O23A 1IWBB 3AC0A 1SFRA 3HPRA 4Q34A 3LT4A 1BFUA 1TW3A 1V1JA 1SVUA 4FBGA 3ICQB 4H9GA 4V0NA 5LD2B 4UJ3A 1L4NA 2HTEA 5CTJA 2VBFA 5ER9A 2QMUA 2XJ4A 4EGFA 5ALXA 3HDHA 1HT3A 2BY4A 3FVTA 3IAHA 2HEGA 5KNLA 1LNSA 3LBFA 4RULA 4K3VA 4JYCA 2O3SA 3AKEA 3AHDA 3DMTC 3OJCA 4K46A 3SJCA 4OX9B 1MRNA 4OJYA 3UCXA 2YJ3A 3R6LA 4BMOB 3MYRA 3H1BA 3WBJA 3KZCA 4O2AA 4V2IA 1F0PA 4BNFA 1B1CA 1KF0A 5CT5A 4MWEA 4BJHB 2CCGA 1YRLA 3QWFA 5KYWB 5AW1A 4K6GA 4ZD6A 3TFOA 2HJVA 3V1UA 5JANA 5BR1A 4ICIA 5EXEA 4P98A 3K2BA 5JS6A 1LI5A 4A16A 3TTUA 3S1AB 1CJVC 4KIWA 5A7FA 2PUWA 3EAGA 3KYDA 1XC7A 3HBAA 2M6SA 3C6MA 5DI3A 2QX9A 3WFIA 4EO4A 4KV7A 5IDWA 1QLHA 2JFWA 1PO7A 3AVPA 2WWGA 3HLYA 3O8QA 3N2ZB 4JJZA 1Z37A 3COPA 3AVQA 1P7CA 4DL9A 1LTKA 1T3LA 4MV4A 2W8BB 2RB4A 2AEMA 1Z6PA 1KQOA 1S2NA 3OJ0A 3GLFE 2FX2A 3ELDA 4WZBA 1FXUA 2JCGA 2WYWA 3FMIA 3QKSA 2Q27A 1I24A 2C9DA 5D6OA 1RCTE 4II3A 2XEXA 4O5OA 3DLBA 4LKRA 2GPYA 3GNTA 5K0CA 5L4LA 1BEEA 3RRMA 2NGRA 2R25B 4MINA 3HJNA 4JJKA 4NCNA 1S2OA 2GVNA 4AM8A 4HWPA 1OT3A 2AFIE 2C5BA 4OXKA 3C6ZA 3M9LA 1Y7PA 2QRLA 4DIUA 1D2NA 1IB0A 1FFCA 2J87A 2ZSUA 3JYQA 3PDCA 4CCAA 1SCIA 3JR7A 5JMOA 4KC0A 1S5PA 5JJKA 3TMKA 1P0IA 3OF3A 1U9YA 4KFTA 5LQMA 2YWJA 3O26A 3SQWA 3TUJC 1T34A 4EHLA 1L8XA 1TU4A 2AR7A 4MIEA 1MDBA 2NV6A 3M6FA 3ZLTA 1KMIY 4BVLA 4DRZA 5C46F 4R9VA 3KCNA 3SY8A 1FJGB 1P6UA 3PFGA 1TCBA 3K30A 2HT1A 1LLCA 3NU1A 4E6EA 3Q6IA 3GLIA 2BKXA 3QWIA 2Z98A 4UAGA 3IALA 1N2JA 4BUJA 4D9IA 5C52B 1M8PA 3RVBA 1V3VA 4CWAA 1TO2E 4BYGA 5G0UA 2O6HA 3FNGA 2C98A 1RM5A 2AMVA 4R1NA 4E22A 1ETUA 4QRIA 4KX3A 3FIJA 4HH4A 1I2DA 1BW9B 1JS1X 2FYTA 4ILEA 1X8XA 2EZ8A 4JBLA 4BMXA 1T4MA 1C4XA 2WIBA 2YS6A 1S9DA 1ML3A 3EG9A 3SR4A 3I53A 4LFCB 2NZWA 4AP5A 4BFXA 2ST1A 4LF7B 4G4JA 3HJRA 1ZM3A 2J1LA 1HZZC 3FUCA 4EJSA 3RF7A 3NVAA 4GP9A 2UYGA 4KH0A 4MCJA 5F12A 4BB6A 5I7SA 4ZQCB 1X42A 4C2TA 2Y77A 1GKKA 1LDMA 3AFMA 3N6VA 4GYJA 3SC2B 1ZJZA 3ZV6A 3AF6A 1TTTA 1I4DD 1MO5A 1XMJA 3E5HA 1SC4A 3R2JA 3VU9A 1U7WA 4MROA 1JEQB 3QVJA 4Q5IA 5BNZA 4PANA 2XF2A 1DC4A 1G4HA 5HFAA 4HDSB 3AHJA 3R3WA 1SXHA 3TD2A 1PTKA 2VT6A 1X3SA 1GLNA 1TM3E 1Z8NA 4IDEA 3HP4A 1IG3A 2W2MA 4NU8X 1XDGA 3GP3A 1DE0A 1AGYA 1TRHA 4IGFA 4CCWA 2RI0A 5AVRA 5KNDA 2OHOA 2WJ6A 3V1YA 3L41A 1NBHA 5E3IA 4OL9A 4B9AA 1ZEJA 1C7QA 1EAMA 1JILA 2GN2A 2YZMA 3Q41A 4ZVRA 3W5CA 3SZLA 1Z74A 3RU7A 2XUDA 1MJHA 1L6IA 1CUWA 1QTRA 3MQ4A 4N54A 2IS1A 5FBKA 4JLNA 3B8EA 4KTVE 4YMGA 1II0A 1JXAA 1EDDA 3A04A 5FI5A 1U5AA 2HWXA 3L0CA 4NZYA 4BB5A 5CDTA 5JS1A 3WWPA 2LP4Y 4BNZA 1IU9A 3A32A 1K63A 3ZCUA 4BRWA 2HEIA 3EMBA 4RVNA 3FVWA 3KJGA 4YRSA 1KJQA 3FMVA 5CJ2A 5GINE 1ISRA 2R7KA 2J3HA 4OIMA 5E9JA 1QOPB 5FTJA 5FBVB 1TTHA 2OHHA 5CYFA 1XT6A 1WBJB 4QNMA 4TLAA 3C4QA 4U6QA 3IB3A 4NBLA 5CPFA 5SZHB 2CHUA 2RHLA 3GJ8A 3EUFA 2AJDA 3THWB 3HHEA 4CTMA 1D04A 2UYOA 1X7ZA 3VMMA 4U2KA 4BUCA 3D3KA 1ORWA 3H1TA 3TW0A 4EY4A 3S81A 1WCWA 2D59A 3F1LA 1O95A 4IF4A 1A9XB 4MEJA 1YRHA 1I1HA 5K99A 4POAA 4EW3A 1JU3A 4BOYA 4BFVA 3K20A 4AX4A 1Z6TA 3LKZA 3SYNA 1KQ3A 1EFDN 3OOWA 1SQFA 2Q28A 4DBVO 4UAJA 1Y5IA 1W0KD 1WW8A 3GN2A 1DKNA 2ETXA 2HH9A 3TSAA 1NGSA 4EUEA 4D3FA 2P9FA 2C4KA 2PU5A 4FSHA 4PONA 2F1JA 3AOGA 2QVBA 5J47A 3WIUA 3DEFA 3OM8A 4HQLA 4JUAA 3RVOA 4YCNA 4DY6A 4YQEA 3HKDA 5GY7A 2A9RA 4LAFA 1EJBA 1ZC3A 3FPGA 4D82A 2B6NA 1F38A 2W6OA 1U1IA 2F1HA 4Q9HA 5KREA 1QCCA 4D46A 4WXEA 3D8SA 3E7DA 4KQWA 4KPFC 4IO1A 2WU8A 4J76A 1GKUB 3DOFA 1OLXB 4RMHA 3FYCA 4QPZA 3R3UA 5KYWA 5AW9A 3INTA 1D6SA 3V4VB 5LZ4A 2BE9A 1WDKA 1WLYA 3CRNA 3P96A 3K31A 3P9IA 4YPVA 3KR2A 2VC2B 4KHZA 4MJ3A 4U5XA 2ZI9A 3OP4A 3VDQA 3WB0A 3WRXA 1Q1AA 1QHGA 3PC8A 2GSWA 5FIUA 2GPTA 2QRPA 3NH6A 2Q45A 1QU2A 3RC9A 4CKZA 5KCZA 1MOPA 3JV7A 2OFFA 4BMNA 2DJ5A 4I55B 4AQDA 4TWRA 3LHSA 1KJWA 2VHJA 1TYCA 2VCYA 1T9AA 3IUEA 3KOWA 3QBDA 3THOA 5LNK6 2W8BA 1KVRA 4G37A 1CQWA 5A4AA 4CZ2A 1PGNA 2I2CA 1IPFA 2PFKA 3EXAA 4KHPB 1R3UA 1TZKA 3EQ8A 4KFSA 3QFSA 4WOPA 1ZMOA 1N2IA 1E3LA 1WZNA 3IUBA 1G7SA 2VSNA 2CGEA 3GUZA 5AIBA 4IWXA 4GLLA 4DJ5X 1AQNA 2OZLA 4IMIB 4ARCA 3IUSA 5DTRA 4Q3CA 2RGBA 2R1TB 4G6ZA 3ZS9A 4DV7B 1SKYB 4PGMA 1ECPA 4JKOA 2AX3A 1NF8A 3BWYA 4XVRA 4R8SA 4MVCA 4C43A 3M33A 4H3VA 2QTBA 2XCSB 2ZWOA 2X8BA 1YI0A 4UE6A 3EZFA 2LDXA 1AKWA 2VSQA 3PWTA 4A1FA 1F8UA 4DTIA 4L95C 3RYFB 5KJ6A 2PUCA 1MOSA 1JPVA 1CP2A 4X41A 2EBWA 1MR3F 4XJVA 1JXOA 5FPPA 2A84A 4RDIA 1GGKA 3FAKA 1K3TA 3LA6A 5CMLA 2Q2QA 3VDXA 3D7SA 2WDPA 1W6RA 5FUYA 4V1CI 2JAOA 1G4UR 3ESCA 2IYPA 3ONEA 4XYEA 4Z7NB 2O50A 4KOAA 2FDRA 3HVRA 2FLKA 2FPXA 1H8EA 3NXKA 5K0LA 5TMDA 2RAUA 3IEKA 1I0IA 1B8VA 1NUHA 2X76A 3AILA 4TQAA 2X1HA 4X66B 5FR1A 3QUTA 5A9TA 3NDPA 3S0JA 4CN8A 2PN1A 4EDHA 4W5RA 1RNLA 2WM9B 1K5PA 3L1HA 1GRNA 2ZU0C 3LZDA 4KWCA 5TVKA 1YS7A 4NQZA 4D96A 3OQNA 3C8UA 4Z3KA 5A3RA 4I4TF 3OZGA 3K0CC 4HYTA 3LF2A 4QOFA 5GM2A 1MC8A 4YUVA 5JJ5A 1JLSA 1Y1QA 1DQYA 4ID9A 2AF4C 3O90A 1Z6AA 1GCIA 1NNLA 3HKBB 1TKAA 4R1PA 4DLKA 3MCVA 1PIWA 3SC2A 5MN6A 1Q19A 1G20E 2BMDA 2BM0A 4LYGA 4RPHA 4WGGA 1BN7A 1PDWA 4N5NA 1ISSA 1O97D 1JEQA 2XOKD 1WR8A 5A05A 5LXTB 3UAGA 1GRVA 5KSPA 4BFCA 1CRQA 4JB2A 1LI4A 4MCIA 2G1JA 3Q6NA 4RD4A 4Q4JB 4HDSA 4MV1A 3K70D 2YX1A 4OQYA 1JG7A 1L0BA 2JGJA 2ODNA 2VUTA 3Q8WA 5AQEA 3LXRA 4YRGA 3MA0A 3PRYA 3H2JA 1O0SA 3TRJA 5JFOA 3N0WA 2EQBA 4P86A 5KEIA 4TOIA 2BGGA 5ARDA 2VBGA 1UPXA 1T8RA 3A0UA 1DQNA 4PO8A 2VAMA 2EX1A 4F5YA 1ZK3A 2J3IA 1XNHA 5LA6F 1I2ZA 1NR1A 3BB1A 3CLUC 3BD8A 4R1LA 2IUTA 4XWGA 3SIWA 3AY6A 1J2YA 1KZ6A 2ZRHA 4R8KA 1GPMA 2P2ZA 2UZ1B 4TMFA 3KQUA 1DCFA 1N5DA 4HDQB 4MRVA 1R16A 5L3SB 4D3ZA 4MUIA 1OYWA 1GP2A 1UANA 1MD9A 2OLKA 1Z8FA 1BX1A 2H06A 2RAVA 2HA5A 4N40A 5E4FA 4IMJB 4HN4B 2G28A 3ETEA 3N59A 1DKPA 3GVIA 4XQ0A 4C6SA 4YASA 2BW0A 4L5AA 4I4LA 4J1QA 5BT8A 1U98A 3KR0A 2UZ0A 5IVIA 3WS7A 1WCXA 1W4LA 5HR5A 2G72A 2CVHA 1YV9A 2G8NA 3F2IA 3C3CA 3OTHA 4F7WA 1ISFA 3THWA 1NX6A 1IE3A 1DIAA 1U3VA 3DR5A 1MA0A 3EXFB 2I7DA 3PDJA 1L4EA 2W42A 3R4CA 2QTNA 1A9XA 2ZYUX 4KGDA 3RB8A 5FOUA 3E8XA 5AM1A 1GG9A 3HV0A 3AM4A 3LPAA 5A6VA 1IK6A 4FKMA 5HKBA 4JYAB 3DGFC 1RWBA 3PEVA 4JROA 4CF7A 1Z16A 4ZVUA 2JZNA 3AIIA 1O3YA 1WU8A 4EG5A 1JWLA 1VPDA 3F47A 1UL1X 2ZSDA 4X95A 2P68A 2XBUA 3E22B 4M7WA 3ERCA 1XRQA 1FBTA 3LP6A 4JQOA 3ANXA 5F1KA 2G0TA 5I7FA 1VRWA 1EHIA 1S4MA 1PBTA 3W8FA 4AIRA 2RE8A 5GMOA 3W8EA 3SPXA 4I1IA 4ZAYA 1J90A 1OLXA 4MNTA 3AI7A 1BA3A 1VHWA 4HB3A 4V0KA 3MM4A 1X8LA 3AVXA 3RG8A 2TRSB 2W00A 4W1SA 5DB4A 4ZO9A 4AKIA 4Q16A 4FGJA 1LH0A 1FLDA 1XCOA 2B37A 2I1WA 2NTJA 2XUHA 3DUFB 4NF2A 4J0JA 1DIRA 4B3IA 2PEZA 2QN6A 4LS3A 5JJLA 1QHYA 3COYA 5LP6C 3W9UA 1UJBA 4ILKA 1PWZA 4FEAA 1GNLA 3DWFA 3EFHA 4I55A 4D9MA 2WUDA 1I7NA 5JZSA 3LUCA 4JLOA 2RI6A 2NIPA 2QVGA 5AW4A 1GY8A 2OGUA 1NDHA 4WY8A 1HE2A 3SYRA 4AJKA 4AUEA 1EWVA 6PFKA 1YS6A 1X77A 3ZNOA 2C2WA 2ZBRA 3EEFA 3O31A 4Q7LA 4TS3A 2QYTA 3QU2A 5K3AA 2VYCA 2DECA 3VAZA 1U7XA 2OBLA 3TO5A 3VBCA 1FYDA 1H4VB 5KOJB 3WWZA 2NU9B 4ZYWA 5D1HA 2F62A 2JZCA 4O2AF 3W6UA 3ZEAA 2R1TA 1X92A 4JOQA 2V98A 3JQBA 3KXIA 1MRSA 3PT9A 3GX1A 1L4FA 2Z2KA 5H4HA 3V8VA 3UXYA 1SIBE 2Y93A 4BRUA 4U3JB 4K03A 5IT4A 1OVMA 5EIAA 1MNQA 4E30A 4URZR 4QA9A 5DEIA 3IA7A 3IP5A 1PZMA 1H3FA 4WXRA 1R12A 3PC4A 3L2OB 2DUNA 3D5TA 4MW5A 2EG9A 1EFHA 3E2PA 3RYFA 3NZEA 1AMOA 1SG0A 5LM3A 1Z22A 5EIWA 2VPYA 2YRWA 4ZAXA 1N1EA 2PKXA 3ONVA 4FEEA 4MLZA 2X2PA 5E6SA 3R3HA 9LDTA 2YUIA 1QVVA 2DULA 5FRDA 2Z5VA 4DNXA 4RHYA 2E49A 5BR7A 1GLGA 1Y34E 1DC3A 2VF7A 4G9EA 3NIGB 2PUGA 5IASA 2IEBA 2QQFA 3A9VA 4I7EA 3S28A 4YRBA 3W9SA 3EF3A 1K4MA 2YV5A 3HZOA 5JCOA 4XWYA 3G5LA 4P0PB 1P39A 3DD1A 4OXQA 3H16A 4BXOA 1NVTA 3HA5A 3EGIA 1GPNA 3WGUA 2EJVA 2GNOA 2G7ZA 3BE6A 2HD4A 5HS6A 2BEKA 5JSUA 2KHZA 4CETA 3FY4A 4FVTA 3HKBA 3C6YA 3OSUA 5AH0A 3ZX4A 3DEJA 1OFVA 1U65A 2H7XA 4IAOA 3SI7A 3EZGA 3NTQA 4Y2SA 1V8ZA 4IIFA 4BZQA 3SBOA 1QIHA 4F06A 3B51X 1GNSA 5HUQA 2C2MA 2R7AA 4BO1A 1HYBA 5E7JA 1NW4A 2HC9A 1PBNA 3JY6A 3CSUA 2GPWA 1O94D 2J9XB 3KKQA 2H51A 3NS7A 4OYHA 4Q4JA 5DPMA 2IHYA 2VPPA 3CGGA 4CFYA 1FFYA 1GNTA 1S8FA 3EGWA 1MQSA 1BCRB 4WZBE 4HH1A 5IT5A 2HM7A 3B13B 3R3XA 1U8YA 1C0EA 2NO0A 3PQ6A 1SUSA 5P21A 1R6AA 3T9EA 4BEJA 3SYLA 1IJFA 5ES3A 1W47A 2BELA 3JAKB 1NUSA 2RMKA 4TVBA 4RJIA 2D2XA 3IRUA 3JSAA 4JJ6A 2VUUA 5IZCA 5F2OA 3PX2A 3U2QA 2BAGA 2YYYA 4F04A 3L1JA 1LBEA 1UZAA 2UZ1A 1E6LA 5K03A 4F96A 2OP0A 2RBGA 4DSUA 3KTOA 3THSA 5L3SA 3L40A 3QEKA 1FUUA 5K1ZA 3FFBA 3R9IA 3LXMA 4OHVA 3KFLA 4YONB 2VJKA 1Q0HA 4CIDA 1N5LA 1WF3A 3DLPX 3GFVA 4FBLA 5J40A 3WR5A 5J2UA 3U09A 1O0BA 4UNQA 1JW9B 2V96A 4FOOA 1UPUA 2HPVA 3R41A 4IIHA 4Q1VA 4TKMA 1IY0A 3USZA 1T9KA 2Q8PA 4ND4A 4RD0A 1L5QA 1HDEA 1LFAA 1YDFA 3GLIE 2RHOA 1TQ2A 2N47A 1NBMD 2YIDA 1ZX1A 1UP7A 1EVJA 3B53X 3GDHA 3RS8A 5KTYA 3TDKA 1WXGA 3ZCXA 3JD3A 4KLAA 3G0HA 2WW8A 2NUTB 3X2FA 4QFMA 3NX4A 3TD9A 3ZHOA 4GPIB 1MX5A 1T10A 4ZTUB 3E9YA 8AT1A 3DMNA 3A9WA 3AEZA 2FDXA 2P4UA 3AONB 5DM2A 2VBIA 2R1VB 1Z56C 4M9RA 4R0MA 3CNNA 3C74A 4XZ3A 4HRVA 2P5TB 2C59A 2YJGA 4C3ZA 2ZBDA 2F8TA 1ZK1A 3SEAA 3D8NA 2NAPA 3W9BA 2HA3A 2NADA 2REXB 5AK3A 4H7KA 3JVIA 2DBVO 1YAHA 4KYIB 5BWMA 4ZHQB 3E22A 1XTBA 2H4WA 3ZQ6A 1QF9A 3WG9A 3J7AC 5H83A 3WLNA 3DOOA 2FVYA 4UUOA 5BYBA 3CA8A 2JJ8A 1X9IA 4FMCB 5D3MA 2GN1A 5KU1A 3DE0X 4NU6A 3TR0A 5C8YB 4QFCA 2HMUA 4DNFA 4URXR 1N5JA 2QPLA 3WKAA 4QXAA 3H5NA 2DY1A 5DLDA 5DBFA 5E9WA 2AEFA 5LZ8A 3GYBA 1LJ8A 5BV0A 4LN1A 3GRCA 4K9DA 1KYZA 2ZS8A 4KQMA 3BEOA 3GU3A 3DUFA 4MR7B 5KKAA 4LJKA 2GEBA 3T3MB 3GHHA 1P8AA 4OHZA 5HWSA 1QG4A 3TOZA 2QENA 2A67A 4HXYA 4INOA 5K8VA 1NKSA 4MJ7A 1SXQA 2Q5FA 5CLFA 1QP7A 3UTDA 2IEDA 2RKBA 1FF9A 3L43A 2X14A 3NAQA 4OU5A 2VS1A 2GO7A 3R7LA 3QMVA 4KZPA 2W6QA 2OYRA 4C01A 2EZ4A 4KO2S 1MAUA 1SQGA 3GIDA 3KEOA 3ZJTA 3OD5A 2X1LA 5EJ7A 2FEAA 4N3AA 3GNSA 3K15A 4FNMA 4KO8A 5L3ZA 5E1BA 4O0LA 4K6OA 4Q82A 4QU9A 3K1YA 3RIGA 4CFZA 5KOJA 1UM9A 1FW6A 3OE4A 4HNHA 3G0DA 2Z43A 4JDPA 3IAAA 1KAHA 4XGKA 4RTPA 4RA9B 1HSZA 1UH5A 3FPJA 2GZDA 3CRQA 4PRZA 4U3JA 4BVKA 1KIAA 3I6QA 3FI0A 1Z28A 1O1YA 2VRCD 2YH2A 3H2KA 3QLEA 1W7AA 1KK2A 4GRIA 4I5DA 2PUTA 3IDZA 3OA0A 4TYYA 1VBFA 2ORVA 1AKTA 5TT1A 3EISA 5E3HA 5JC1A 1DXHA 1IMJA 3NAMA 1FU4A 2I78A 4G89A 1R6TA 2F1IA 4PYLA 4Z8YA 3DJFA 1YKGA 4RH1A 3VR4D 2NV2B 2E18A 1EVZA 1W0JD 3RNLA 1IN1A 3CLRD 4NK5A 3OWXA 4X20B 2R8BA 3HUDA 3UJBA 2VTVA 1CB0A 4NOKA 4PS0A 5LQSA 2H8KA 4CLHA 4HLNA 5TC4A 2R8PA 3FTPA 4EELA 3CVVA 3BMNB 3FR8A 1JG4A 4AMZA 2JBAB 3DEHA 2A30A 3D4LA 1EX7A 3LECA 1KSFX 1TUEA 3PDIB 2HUNA 4NL4H 3H2SA 4HZGA 4W8GA 3Q8MA 5JPCA 5J2TB 2R44A 3IP3A 1Q83A 4QL3A 2O3UA 2J45A 4ON9A 2C1ZA 2BGKA 2EATA 2HJSA 4XJXA 4MSUA 4KEAA 3RW9A 2XMQA 1GG8A 3EGCA 2P30A 2POCA 2REBA 3IJRA 4KXUA 1JDSA 4FYVA 5TJHA 3W3ZB 5BMVB 5C8VA 4PC3A 5BSKA 1N2HA 4KWEA 1PZEA 2FZ4A 5IULC 2PBRA 4TTRA 2Q99A 3ELBA 3F3KA 3IIMA 3N7AA 4NG4A 5DTIA 2WP8J 1XRSB 1V25A 4ENWA 4MIKA 2GN4A 2ZXUA 8MHTA 1RP1A 4TL8A 2XYGA 1GUYA 1YK1A 3WTCA 2OM6A 3MJRA 3ADBA 1ORDA 3ADCA 4ZZIA 3UB3A 3VTZA 2B30A 3IKMB 1X15A 3HZZA 2WHPA 3UJDA 3UMGA 5ALIA 1D0VA 2VKTA 1OW3B 1W9MA 3DONA 4TMZA 3BH0A 4QSMA 2BF7A 2YMMA 1BCRA 1IUPA 1KQFA 5JLJA 1EFUA 3B7PA 4W63A 4N8DA 4OSOA 4J0FA 4BV3A 4EOGA 5AHXA 4P22A 4RKQA 3LRXA 1IWOA 4LXIA 1ZM4A 1C0IA 4ZMSA 3JAKA 4Z2AA 5CCXA 1CJKC 1NLYA 1QX4A 4DQVA 2G8LA 4CKWB 1HK7A 3DBRB 4H1WA 5U4QA 2UYCA 2QTFA 1AA6A 4GWLA 3DEZA 4U6SA 3QA3E 1Z0AA 4IUDS 1W88A 1MAAA 3B7WA 3QPCA 3V1NA 4U63A 4QQKA 4IZIA 3BYZA 4WJZA 1KZ1A 3T3EA 4D4LA 1JFTA 4ENTA 3D6VA 3STYA 2XZLA 4LECA 1GKYA 4FLFA 5MGBA 1M83A 2BCEA 1JBKA 2HLNA 2I2XB 4LF8B 3BFXA 4BB0A 4P35A 4M88A 1R4MB 5EIOA 1KZ9A 1E32A 3X1ZA 1T1EA 3CE9A 4DCTA 4Z4GA 1RPNA 4NZZA 2BMJA 1AS0A 1VLJA 3P8ZA 4UFPA 5LBUA 1K27A 3TQQA 2DHRA 4EY3A 2OESA 2WAMA 1FYFA 3BQ9A 3KKPA 1ZP6A 3L0YA 3OZBA 4O59O 3EOBI 4NRDA 1O7JA 3A2LA 1THMA 3PIIA 3RF6A 2VQEB 1FK8A 1TRKA 3U3JA 4TX1A 2BH9A 4YY3B 3LY5A 3INRA 2HLDA 4QUIA 4FDTA 3G9UA 2QX7A 1R15A 2R1VA 3JAWA 1TJPB 2GFHA 2O3RA 3D54D 1Q7CA 3RYHB 3U7FB 2HSEA 1UK7A 4LHWA 1W6UA 3CRRA 2DCUA 5INTA 1H6DA 1NFQA 2V9PA 4LXTA 1CDEA 4ZHQA 3RAJA 5KPDA 2W4IA 3C7DB 1MFPA 4GI1A 1VJCA 1ZL0A 2DPLA 2R1ZA 4KQGA 4LGCA 4ZJUA 1YAJA 3B3GA 4GL4A 2PE5A 3BGWA 1S3IA 5D6NA 5C8YA 1MJNA 3QEOA 3IOCA 1YMVA 4BE7B 2OHGA 4MV0A 5T3UA 3MTAA 3TJRA 4DC1A 2R6R1 3EFOB 1D2CA 3TW4A 3ZI4A 2I4RA 4L1KA 4RHFA 5LZ7A 4C0AC 4JMLA 2GK3A 3BGSA 2CV0A 5FV7A 1C3LA 3H8JA 1GGMA 1NULA 1K1EA 3AZOA 4MR7A 2IV2X 2JIDA 4BQRA 5FEUA 3DVRX 2MSWA 2WJWA 4OLFA 4EO7A 4YAWA 1YR7A 3ESZA 5JPIA 1QZTA 1GSOA 2I54A 3I6MA 3IYLW 4HFJA 1DHTA 1A8QA 3G1UA 3T9AA 4V0SA 2V9CA 3SIXA 1E2FA 3QKRB 4PYOA 2FFBA 4Y1RB 3V1TC 4ALMA 4NLLA 3EBPA 4NJEB 4OQFA 3MUNA 1X1DA 2VP9A 5EKSA 3I04M 2PO7A 3QJ5A 1XPJA 4JJ7A 2IZ1A 5LQAA 3IVCA 1GNVA 2VPWA 4LXUA 1T5LA 1DL5A 1S02A 1I4OA 4YP1A 1Y37A 4EA6A 1PEDA 2ASEA 1HLDA 1FU7A 3IS3A 4DLUA 3AIOA 2QUZA 5L3VA 2WHXA 3P52A 3RVNA 4RA9A 2H4XA 4HEQA 3N3BC 1YUBA 4KG7A 2D0PB 1L3CA 4GM4A 2C61A 1CNFA 1T2EA 3NIFB 1SN7A 3UMBA 3WB2A 3X1YA 2X7JA 1YIAA 2EW1A 1ZJYA 4C0BA 2VQ3A 4GLFA 1FL9A 2IDMA 5JTTA 1UOOA 3L7CA 3UOGA 1SURA 4LQ4A 3WLKX 4BYMA 4OHFA 4XM2A 3UEOA 1D09A 4DYDA 3L84A 1J0BA 4QPCA 4A8TA 4YXFA 2P11A 2YHIB 4I55F 2AVNA 3O3CA 1D9XA 5CX4A 2BEWB 1W0CA 3PNVA 3OLYA 1UXKA 4GI3A 5J63A 4C0QC 2O8DB 1NIJA 3QVXA 3M4ZA 5EIHA 1A3CA 4EG7A 2H65A 4X20A 1IZZA 2QZSA 4PLWA 1K8XB 4TKLA 1Q22A 3W7VA 1FVOA 1ZIYA 3GRUA 3PRJA 3WLAA 4DDKA 3EPLA 3FTDA 5U1PA 2PLFA 5GOTA 3WZMA 4BC0A 4BO9A 1VYVA 3G8AA 3GEHA 3BMNA 1RI3A 2Q9CA 5FFNA 3V2UA 5BXQC 2JBAA 1AQLA 1L5VA 4HX5A 3VA7A 1FMTA 3NHSA 3PDIA 3RFVA 4G3XA 2HFJA 1OMOA 5CVVA 5ARBA 5J2TA 1I6WA 1HFWA 3UG6A 3UQYS 4CF4A 1XVTA 5CVUA 4NCBA 5KTTA 3A10A 5JCJA 2WICA 4KUEA 3IT3A 1MDFA 2I6XA 5L40A 3IUNA 3G9TA 3GXOA 1NQTA 4D45A 4RTRA 4QBFA 1KY4A 5DYWA 3OHSX 4W1RA 2W83A 2W6ID 1Q0TA 1P74A 3WGYA 2KM1A 4Y8VA 5DU2A 3A70A 2G4VA 4Y2QA 4IPTA 1AJEA 5DK4A 1FP2A 1ES9A 3RBVA 4B5LA 3RTDA 4QPJC 2RGNA 4FT4A 4N5HX 3RC3A 2FMXA 3OT4A 1Y3FE 5EKUA 4X1KA 1T2NA 1U6IA 1P5HA 1V11B 2WD8A 3KKNA 3MJ4A 1GGFA 2YNMA 5HMLA 2BGLA 1NYLA 4QJBA 1A9ZA 3W5IA 3KQYA 4MCAA 2CVZA 4G2NA 3JS5A 2A8YA 4F5DA 3ZY6A 5LJIA 4L22A 5KKCA 1BDBA 2O3JA 3JQ7B 4UJ5A 5FOVA 5IKMA 2GGSA 2DUMA 2YZ2A 4K6MA 1TA0A 1RHRA 1Y1SA 4DDVA 4GL2A 2JIRA 1AT1A 2H9AA 4CKWA 3DBRA 3ZBTA 5IN4A 2HJGA 1GPAA 1JXQA 2WY2D 2FEOA 2IYOA 1R64A 3QOYA 1EK0A 1I9CA 1SKYE 1CUAA 1TM1E 5CVEA 2IXDA 4NOLA 5LKRA 4UE2A 4BO8A 3AJ9A 3BXFA 2V7PA 4K9SA 5CAEB 4BE4A 4G4SP 4F91B 3EW9A 3OCZA 3EDRA 1RYHA 4ZGGA 3T3NA 2H5JA 3PJEA 4IHQA 1AV7A 4Y9SA 5EHNA 4E3WA 1PX2A 2VT7A 3R0XA 1XNRB 2JFPA 2XTNA 4HGQA 4BLTA 3WGOA 3WWYA 4ECAA 5LXTF 5EHXA 1P61B 4UBNA 1J7JA 1JTVA 1RLOA 1E2KA 5JNVA 1J25A 1FY2A 1KGSA 4B4OA 2WB2A 1YB2A 1NJ6A 3A05A 1G18A 1NJSA 5CJPA 4XB2A 3QJYA 3TFQA 3K5WA 1VKJA 4Z9FA 1XLTC 4B3GA 4R51A 2LE0A 3WMWA 4A0GA 1M6NA 4QU5A 4CIBA 5KO2A 1NQVA 1RRVA 4KE9A 1ESEA 1JALA 2JHGA 2VDLB 4KXVA 4P5PA 3TIFA 3PC7A 4BKOA 2YV2A 4MV3A 3RYHA 4R4JA 2PWZA 4UXIA 1CIVA 1RCFA 4X54A 2QD4A 2HK8A 2J07A 4RPLA 5EE9A 1TLFA 3HE3A 2Y1GA 1SELA 3PYLA 5ALJA 3TPZA 3D6JA 3E1SA 5EKXA 3Q40A 4KUGA 3D6FA 3PITA 3T5GA 3M89A 3PF9A 4EB3A 3B2NA 2QG4A 3A1EA 2QTAA 4BTVA 5J9FA 2Y68A 3UHOA 5C8DA 4FHDA 1BS1A 1V6CA 4FCVA 1V6AA 4GOKA 2IPMA 2QDXA 1OWNA 1XTTA 3SSAA 2QU7A 5H68A 5BQ3A 3UM9A 3DAFA 1NC1A 4ZQIA 5JTUA 3KRTA 4LCEA 3HY3A 2B8EA 4FR5A 4NG5A 4YUXA 3E8MA 3EFOA 3UFBA 5DNCA 2Y0EA 1P60A 2C4HA 5HDQA 1VKRA 1X7YB 2C2ZA 1C9NA 3G5TA 4OXXA 3SC6A 1MZVA 1Y7TA 4GMGA 1EFTA 1JYFA 1KFKB 4XUCA 4DA8A 4DXDA 1V3TA 4FJ0A 1PK8A 5JBNA 6REQB 1QHNA 1P1RA 1QF7A 1RKBA 4NBWA 2XX3A 3OKFA 1XU7A 3RK1A 2MU1A 2DHEA 2CWDA 1JTFA 1XELA 3LYLA 2Q3HA 3MWEB 3M1AA 4KL8S 3KELA 1E92A 4M2LA 1LK5A 2D62A 4Y1RA 1AQYA 3FOZA 1VSBA 4KW7A 3UTCA 4AO8A 1K92A 1RJDA 3I5MA 5DGDA 3WGVA 1DO2A 3LLSA 3L7LA 2QW0X 1J8MF 2XPCA 2DPMA 4Q4AB 5KPJA 3UCEA 1KPHA 2LKCA 3EZ2A 1ODJA 1VYTA 2DR0A 3M1YA 4MQ4A 4P81A 5DVZA 3UK0A 4G8DA 2A86A 3LI2A 4R3NA 4D6XA 5HMMA 3E27A 1DLIA 4CL3A 2B0CA 2QX8A 4WCDA 3PR3A 3CTPA 5ALGA 5DGCA 1NT4A 2VNJA 4RH0A 1I4LD 1W581 1X0VA 2OV2A 1A9OA 2GBCA 1ZKDA 4AJEA 2ZUFA 1VG0B 1O03A 2QRJA 4YVFA 4XJSA 2YHIA 3EMKA 1QGZA 5IPFA 1WUIS 3P2YA 4WZAB 2B5OA 5E2IA 2BEWA 2AMJA 3JQAD 1Q6YA 4IYRA 2O8DA 1LY1A 3K0FB 1WF6A 4IV0A 4LMAA 4YCSA 2VHZA 3V33A 1KI1A 4DUGD 1GQSA 3LX6A 4BBAA 1TK2A 1Z0DA 4GUDA 5KVAA 3DTTA 3C6XA 5TARA 1PN3A 1HKHA 2GCOA 3URMA 1UDBA 4FFRA 5LLSA 4AS1A 4R2JA 3KIPA 1ECLA 2FOIA 4I9UA 2IWRA 1K7FB 4GRDA 1JJ7A 3UYKA 4US2R 4B0OA 1Y9ZA 2AI2A 4AL4A 4LBYA 5B58C 2V6GA 4JVOA 3HI6A 1WA5A 4RMIA 3NTLA 1ULHA 3PJDA 1EEXB 4L78A 4UBJA 1ZR4A 3WV5A 1IM8A 1TJ5A 2CLCX 1E8MA 2GZMA 1EE2A 2B8NA 3ANTA 3CZ4A 2CNLA 3HJTA 3N05A 4GXRA 4IVNA 4A4DA 4EA8A 4FWTA 3B7GA 3NIBA 2WJHA 1L7XA 3ZZUA 1M2KA 3JVDA 5DGIA 4AZVA 4O1IA 3R5HA 3O2SB 3GFPA 4N7MA 1HTBA 3I32A 4LJSA 4YRKA 1RZ3A 2R62A 4FMDF 1IJBA 1U7TA 4IVPA 2SICE 2VXOA 2P6NA 2IYLD 3H0CA 3L07A 1PFWA 5EEHA 4C20A 3CUEF 4FFLA 1M1NB 1X39A 3WLSA 3M5CA 2GM5A 2QA5A 3CW8X 1V11A 4GX2A 1JQEA 3RGGA 4K88A 4UVEA 4TVSA 2B4YA 4Q48A 1DIOB 1E7YA 1V4VA 4BWFB 1LUAA 1XALA 1U5BB 4QBKA 4P33A 5AW7A 3DT6A 3JQ7A 4OHCA 3E1KA 4RK5A 2N42A 3LO8A 3OD1A 3QVTA 2RHHA 1FYEA 1LNQA 4HYQA 4A9AA 6AT1A 1KEPA 4FFPA 5BSHA 2QKYA 4Q39A 2YJNA 2P78A 1YB5A 2Q2NA 3IVGA 3VZPA 1OIXA 2GDJA 2COEA 3I37X 3L8MA 4LDPA 1E66A 4E5YA 2CDCA 3F3YA 5DHAA 2JLCA 3QBVA 4FXPA 2DBRA 1UZLA 3PR2B 4JEMA 4R5MA 3ZIDA 1E0KA 4OM8A 2QP9X 4WLOA 2ZUTA 5CAEA 1KERA 3NANA 4S1VA 1HOTA 2G82A 2WSMA 3BWVA 3MVEA 3FD8A 3LS2A 4G9GA 5CVCA 3RQSA 1S3GA 3OX1A 2R48A 3NEPX 4LBVA 4A5OA 1R74A 5KTKA 3KOMA 4RTOA 1QDLB 3B6MA 3JRXA 5JRJA 3I1FA 2OO5A 1JDBB 4D3DA 1E89A 3VU3A 2XTAA 1FFGA 2PUBA 2NYUA 1PGJA 1SKUA 4D98A 5E2AA 1STOA 2P3LA 3HGTA 2W6JD 5EMJA 3SM3A 4KXLA 1Z5PA 2D4AA 3OIVA 3W3AD 3ANYB 4GMXA 2B9VA 5HK9A 3EUEA 3IMCA 3P0JA 1P2GA 2ICAA 2IU4A 4MW1A 1GZ6A 5EE5B 3CNEA 5ALWA 5GPBA 2Z4RA 3EZLA 3MUEA 4BLVA 1ZQ9A 1NYRA 3VR6D 3L6UA 4UHBA 3OIWA 4NATA 1TKRA 3W1WA 2WUFA 1W36D 3L8YA 4L27A 3VPHA 5LSAA 2QE6A 2XYRA 2HGZA 3OM0A 3WIEA 1Z2DA 2Y76A 4MUGA 3IERA 2C5GA 3EIQA 1ZBDA 1KAGA 1JE0A 3AIKA 4A6XA 1DMRA 3S3TA 3IAM6 2BBWA 3MAGA 3O75A 4FHFA 4YRRA 2XA1A 4M98A 3PPYA 2C2GA 3VJKA 4AI6A 3L7JA 3FI9A 2PLNA 4PQFA 1WB4A 4W6QA 4PYKA 5EE0A 4EH1A 1Y1KE 1H8HD 1ZM9A 5CDHA 2ZJ6A 2XOKA 1G8JA 1SCQA 4Z0PA 4JXXA 2H59A 1H0KA 1JTEA 1Z08A 3OCWA 4LJ7A 3IBYA 3UKOA 4A26A 4CQLA 1CDDA 4I6EA 2AFRA 4Y6LA 4C7OB 1AF4A 5FX2A 1C1DA 4HGZA 1T1IA 1M7BA 1TW2A 3GVCA 3I45A 3WIDA 1PL8A 1KDYA 4JVLA 1IZ0A 4CIVA 2QVZX 4X90A 6REQA 4J6EA 4OATA 3VSEA 2ECFA 1LVGA 3GLRA 3M4JA 2J4CA 3HEAA 2EU8A 3MWEA 2V45A 4M54A 4PF1A 4CG0A 3RODA 3DL2A 1X1QA 1ISMA 1UJ2A 4FSDA 3TIXB 1NVEA 7MHTA 1RJFA 1V7ZA 2D8AA 2O2GA 2IRWA 3HYCA 2D54A 4XSGA 5DM4A 1VSQA 1T9GS 2IYTA 4ITVA 3QUSA 3W8RA 4FMCF 2O5VA 4Q4AA 4EFNA 4XFDA 2LZ0A 4TKUB 3WVNA 1DEKA 1T6BY 4U7JA 3WWCA 4C6TB 4KGVA 5A4FS 5C8YF 1YD7A 4A0SA 4KFCA 1YVDA 1RRPA 2R00C 4UW9A 5TDHA 4WADA 2J9ZB 4Z5XA 4PN7A 4FN5A 1U2SA 3O73A 4M22A 4MI3A 1DAHA 4L7QA 3F4KA 3IDOA 4CMJA 5A5VA 1X7HA 3KR9A 5DMXA 1ZSVA 3IE0A 4Q66C 3T8YA 3UWPA 2WD7B 3NT2A 5THXA 2XODA 2GRAA 3I9FA 3KU1A 4XDHA 5IYZF 5P8WA 2AR9A 2DBZA 2XA2A 4J16A 4EZBA 2VXYA 1AKEA 1OZ0A 3CN9A 4WZAA 5JE8A 1T5TA 4MWTA 3TLKA 3VM6A 4HWSA 4QHSA 2ZI6A 5B37A 1DFGA 4LHZA 2O4CA 1BKSB 3IODA 2H00A 1IG0A 4REQB 4WK2B 4YI5A 3T9BA 4B6FA 4UOZA 1OH7A 2O3TA 1QDEA 4PLFA 1YBAA 4NABA 3VOSA 2FCAA 3DR3A 2FPLA 2J9RA 1CP3A 4V0OA 2XUPA 5CFLA 1PV4A 1BWRA 2YN2A 3E58A 2VSFA 4QECA 3EVEA 4G8JA 3D6NB 4C05A 2BPOA 1A8IA 4OFWA 4EGAA 2C5HA 4QQ8A 3OM1A 1QXSA 4COKA 1RM4A 4XDYA 3TLZA 3AU8A 1MGPA 4ZU1X 1JSRA 5AW2A 1PTJC 2G09A 1Z0ZA 4LPSA 3QSYA 4DLXA 4HQKA 2CLEB 3ZCTA 3TZQA 4DCNA 4TWIA 3EWAA 4D5EA 2CXOA 5KJFA 4WLVA 4NEHB 2AJTA 4I36A 1E2NA 4J6FA 4HMOA 4OI2A 4BL5A 1MO4A 2EKQA 1O9HA 2D5IA 1YE3A 3K9GA 4PYIA 5CFRA 5IWCA 4LGYA 4YT2A 6Q21A 1F1JA 1W59A 1NXWA 1IUKA 4RD6A 5B12A 5MN4A 2OENG 3VAYA 1UQTA 2JI8A 3D81A 4JX9A 4BZWA 2P0EA 2YJ6A 1WQ3A 3K0HA 3TLEA 2QR3A 1QHFA 1OLOA 2A4MA 2OHFA 1ZJ5A 2AJLI 1O8CA 3M70A 5AI5A 4W82A 4DJJA 1BG6A 2PGAA 3MPOA 4ZV9A 1YL7A 5CUQA 1MABB 4OQNA 5GV7A 3I8SA 5IS2A 4LY6A 3CUVA 5JH7B 2X9GA 1J0AA 4IMPA 3KCQA 4UBIA 1U5BA 1ZUD1 3H11A 1I13A 1KJZA 2VYVD 1QPGA 4YNBA 5BN4B 3T35A 3UKJA 1YJ8A 2VJNA 2PMCA 3EE6A 4XIJA 5I9NA 1RQPA 4RBNA 2AN5A 1A77A 4Y2GA 2FPWA 1J21A 4X65B 5J2TF 2CSXA 3KZ1E 4QM7A 1M8KA 2HSWA 2F3UA 1JHQA 4KXYA 4RMNA 1JR3D 2BLLA 5H3CA 5SZKB 3I23A 4R69A 4PYQA 3KBBA 3ZU3A 1ORIA 2C7GA 2QLTA 1WS6A 2ZYDA 5BMVF 4IDAA 2HA2A 1K5DA 1U0NA 1UC8A 2ZEJA 3MRVA 4GQBA 5K0ZA 3GQBB 3UO8B 1EAYA 1NM5C 3S5JA 4XLZA 1DARA 1A27A 1CUFA 3ETHA 4Z4EA 3MCAA 3DXFA 4TLMB 2QRVB 2YXBA 3O6VA 4TRMA 4E14A 5AVQA 3CIOA 2XGOA 1BVUA 3KUUA 5TV2A 1GGEA 2HA4A 2JK0A 4RS4A 1BFDA 1I32A 3QNMA 2AMFA 3HU3A 1QV9A 3B1XA 2AKYA 4OJKA 3ZNPA 1KY5A 3VNRA 3ZDAA 1QP0A 3EVCA 3AFIA 4TS4A 3MS7A 3NNNA 2OBMA 4Q6BA 1KXJA 1GD1O 5BP7A 3H1FA 4PNEA 5D8DA 1M8FA 4KWIA 3V7FA 3DAOA 1UF9A 4OUDB 2FPPA 1U3GA 3IEPA 1CUJA 3IHTA 5TF0A 1ODFA 2J31A 1ECBA 3P0FA 1GCUA 1WPRA 2CLLB 1IBLB 4K6CA 4MP8A 1RXEA 2MYNA 4QHYA 3MWFA 2PS3A 1QZZA 2LIPA 3FAZA 3I8XA 5A1JA 4UNPA 4K1XA 4HDCA 4MW4A 3MT8A 3CLTC 2H7VA 1Q3KA 3GI1A 1FYWA 1LLDA 4FFWA 3TPCA 3TQIA 2WU4A 2ZXEA 2N46A 3LK6A 4CGYA 3U4CA 5K3CA 4YBRA 3DAGA 4C7OA 2PFSA 1P9LA 1OB2A 1K5GA 3AJDA 5AI6A 3LUKA 4P58A 3RBXA 3AB8A 2I03A 2XGJA 4HAXA 3PFCA 4EP1A 3DLHA 3I0MA 1BN6A 4UAVA 4BVFA 3COJA 1EESA 1YQXA 3E23A 2GCPA 2HN9A 3OQ1A 4K7JA 4Z9YA 3VPDA 1IHOA 2ZVDA 1AN0A 1E9AA 3K09C 1Z25A 3RSZA 4HDAA 3ZD9A 1JQAA 3JWIA 4OLJA 5D00A 5L8VA 1ATIA 5IT9A 1IZ9A 1BU5A 2SECE 2M6KA 3OJLA 3ZCVA 1NRWA 4MAMA 1S01A 4D4KA 2IY9A 4YWJA 1WXWA 1LW6E 1QO9A 1ZD2P 2NXCA 4LWOA 4DV3B 2ZRQA 1JHRA 3FYHA 5KJCA 4TKUA 4WA8A 2ZRGA 2FG6C 5GWXA 2JI6A 1M3SA 4UPVA 2F2TA 1T9DA 4F2DA 1YQTA 1S2MA 4HNSA 3KT3A 4G5RA 4P4SB 4X71A 1FTQA 1BKYA 1WP9A 1F9AA 3OECA 3M6XA 2PS9A 2HIHA 2XVZA 4D8WA 5M2QA 4OHUA 5GJBA 5ILGA 1IN6A 3PXDA 4PX9A 4RF3A 4X44A 4CEHB 1XZGA 2MCFA 2A9OA 4MS3B 3EA4A 1FUEA 3TRDA 1WBDA 4F3NA 1T3ZA 2PBFA 3QHAA 2FP3A 3SKXA 2QAGB 3UMYA 5FA5A 5JQWA 4FGUA 2J0UB 1ZGBA 8ABPA 1QDUA 4B8WA 1V7QA 1Y6JA 4EVIA 1QRSA 5JAIA 1XDDA 6ADHA 5JFGA 4FDAA 2IYVA 1A7UA 2WR8A 3P26A 4AS3A 3AVTA 4REQA 1KRHA 3HNRA 5B3JA 3EMDA 4L85A 2Q8NA 3PA8A 1V48A 4C08A 4G0QA 2X2OA 2NPOA 2CLSA 3HO6A 1WZCA 4HNGA 4D9NA 1TA4A 1HNXB 3CB4A 2YJZA 3LQ2A 3WJ7A 1FLAA 2ZOSA 3T7JA 2PANA 3Q3GE 1B8OA 2R8RA 4M60A 5T8KC 2ZTLA 3AWDA 2LKDA 1QAQA 2LBPA 4B34A 5J1SB 1JG2A 1JSXA 2EYUA 2OAQ1 1KK1A 1AKVA 2OBYA 3BCHA 3F78A 3K5IA 3NTRA 1O77A 4PBRA 3BXOA 3V8MA 4N8SA 4DMFA 1DXOA 1C9DB 3W6OA 3OT5A 2FW1A 3CPJB 4FDUA 2IFTA 1RXIA 1Z7BA 2JVIA 3LY9A 5DT2A 2VQDA 5F9MA 3WWDA 4ARZB 5E0KB 4YCLA 1CULC 2HXGA 3GIWA 2PUFA 1OLSB 4CQMD 1QVWA 4EL5A 4H18A 2H1FA 3H1GA 1U8ZA 2ZIWB 4AJ9A 4DLAA 1MABA 2R5WA 5ANRB 3W77A 4GF5A 4OQ4A 4AY4A 3VPSA 2HK9A 3ZWPA 3JD1A 3WE7A 9ABPA 1YBMA 5BN4A 3GCWA 2PJRA 1EX1A 4A2QA 3HR7A 3M34A 3L8EA 1N92A 4G86A 4RY0A 4H7DA 4ARIA 5E0OA 2RGWA 2RK3A 4JT4A 3U7HB 1U6JA 5BYJA 1W8IA 1QMPA 2EKLA 3IPAA 3R09A 5CDFA 3RIYA 1FRVA 4GLBA 1ZUIA 4TM8A 4WXHA 1P1KA 1V5FA 2GSDA 2WTAA 2LCFA 2X3UA 4AN1A 5D51S 2L19A 2VRCA 3GQBA 3ZWVA 1AOXA 4DDMA 1W9HA 2GZ3A 2TMDA 3N1UA 3WHPA 4XYMA 1D1QA 2O5RA 5COAA 3KXPA 1SK9A 2B8JA 4MR8B 5BYKA 1KY3A 5TEWA 2QRVA 4GW3A 4OMDA 2CLIB 4DLLA 2W58A 1JVBA 2QROA 1SZPA 3OFSA 3T9DA 1MIOB 3VR4A 3E9DA 4N8EA 4CDNA 1VKNA 2R8XA 4ZHSA 4QZVA 2ZIXB 3KUKA 3R76A 3ONDA 5KDDA 3OFVA 4L8LA 5EERA 1AKYA 1FVXA 4RLQA 2PWPA 4A0FA 3K9WA 4KXFB 4KOEC 5KSYA 4JITA 2NT4A 4BU0A 4BS9A 5L6LB 5LIRA 4G0ZA 1ORVA 1KDRA 3BD6A 2WZQA 4OUDA 3UYLA 3WLIA 2HSJA 3PKZA 4MUHA 3TAHA 6YASA 2JLUA 1R50A 2C04A 1VBKA 2JAQA 4V2UA 3P5SA 4O0MA 1EK5A 4GX1A 5CEFA 1XDZA 1SC9A 2QT9A 5C80A 4PFQA 1UQRA 4XQ9A 4PN3A 1QR2A 3ZWWA 5C7LO 4RQBA 2VATA 1GNPA 3L9WA 4IDBA 4P38A 1E9SA 3IRVA 2J3LA 2Z58A 1VJRA 2XD9A 3FMOB 2ZB2A 3NHFA 4HZUB 4EVRA 3OZRA 5C51B 4BP1A 1VPWA 2C20A 2R6CA 2XB8A 5AKYA 2R66A 1IY2A 2V4UA 5TMEA 4UU1A 2OFOA 3OPVA 2W9XA 1L7OA 4LXQA 3OM9A 4RNDB 2OZEA 3PC6A 3SZRA 4RPJA 3AR2A 3KVNA 3WFZA 1A82A 5JQGB 1IXSB 2VTDA 3E2IA 3O4IA 4CMBA 4OHYA 3DNPA 4QBHA 1CJCA 2EX4A 3QX9A 2GTPA 4ZEXA 1L4KA 5HE8A 3S2YA 4ESEA 2ZM5A 5TGTA 1BWSA 3DO8A 2XWBF 3I64A 4KQ2A 2JJQA 4L8VA 4P84A 4U7GA 3OX3A 3VR4H 3HVHA 2OPHA 1IHYA 4EI8A 1UBTS 1UK9A 4QBTA 4AIIA 2D1SA 4B2LA 1TKBA 4PZ0A 1IDOA 3WYDA 4H7FA 3IQWA 1ISIA 4C4SA 4EBFA 3IXLA 4JBGA 2JGNA 4F4CA 2JC3A 2VP2A 3GFGA 1LPOA 1L7DA 4X1IA 4B2PA 5JWRA 4P4SA 4WEOA 1UFRA 2P91A 1F7VA 2QB5A 1EXDA 3VZCA 2G25A 1E9RA 1GRRA 1PEAA 1PJTA 5BNFA 1RYNA 1E2UA 3M6MD 4CEHA 4A7PA 3PGMA 4MS3A 1YU6A 1G8GA 4KAXA 5HRCA 1DIGA 1WL8A 3GJSA 2Q5IA 4LEIA 1IB6A 2QAGA 1W93A 5FPKA 2J0UA 1Y4AE 2X0IA 1G55A 2VHXA 4AX8A 3OQJA 4YCJA 3QF4B 5B7QA 3CH6A 3CBQA 1N2SA 1YDWA 3QX8A 4KMMA 3JYLA 4C30A 3RUEA 3URKA 2ZJ5A 4BTEA 3P0HA 2P41A 3ITKA 4Y7DA 3JW8A 2MYPA 1A5TA 1OY1A 4WOKA 1BHJA 5CB4B 4RACA 3WGTA 2MDTA 3A06A 3ZWDA 1GNQA 4BVGA 4NMLA 4E2FA 2ZITA 4RCVA 1T1SA 3OMLA 2ZJ2A 3C87A 1X7WB 3R6GA 2ZR8A 3TNDA 1CC1S 3F49S 1JA1A 2BLNA 4R6WA 3ASVA 3B20A 5FPSA 2ZYVX 4NBKA 4NWIA 4EJSC 1T9BA 2ZKLA 4G25A 4MTCA 3RDPA 3U4QB 4ND5A 1J8QA 4TWJA 2ERXA 3S4YA 5CFZA 3V7YA 4OHKA 2H6EA 2R0QC 1TT7A 1TYDE 2C3OA 2O0JA 4I1YA 1E60A 3OCJA 1LQ2A 4RO0A 4TXLA 3MJCA 3UOAB 3O84A 4AT1A 1L7QA 1RQXA 5K2MA 1W4RA 4ZT5A 4M1QA 3IKJA 3EEYA 3KPVA 4ARZA 2W11A 4AYXA 4OJQA 1IYZA 2YL2A 1OGIA 3CISA 3KWLA 5LN1A 4RHCA 1UDWA 3BK1A 1T5BA 4HPWA 3NBAA 4NARA 2IL1A 1OLSA 3JQRA 5K6AA 3L0PA 2XQJA 1CQZA 4IIJB 2FSSA 5EE1A 3QELB 3TSCA 4X24A 1AZWA 3II6X 3U5TA 1BXKA 1B0AA 5L51A 1KJ9A 3IOYA 1HDCA 2WHRA 3S7ZA 2QD5A 3V4PB 1GZ7A 1DC6A 3CPSA 4FJ1A 1DAEA 3C3PA 4XA8A 2OXTA 2OAEA 3UGKA 1GFWA 5HUHA 2IZ0A 2VYFA 4IWNA 3E48A 3C1OA 1B7GO 2O8FB 1O5IA 2QYOA 2WJJA 2M32A 3N2EA 1EK1A 2ZUEA 1BMFD 2Y1DA 5DNEA 3SS9X 3TGWA 2PGXA 4WERA 2CF5A 3BOSA 5EI5A 3LVBA 3P9YA 5JAZA 1KJ8A 1IIBA 3LV8A 2R5NA 2A0KA 3VO9A 2HWYA 5ALTA 3L1IA 4GG1A 4YRTA 2FZCA 4UEOA 2GD6A 4ZT2A 4DB2A 1SHKA 4LCBA 4MR8A 3SEZA 4WZAE 2NP6A 3IKLA 3M9XA 4MUAA 3IX7A 1DDIA 3MWJA 4XPZA 1MIOA 1V39A 4WK4B 2QMQA 2JDID 2Z8YM 1HMPA 3JQAB 4DCPA 3IQIX 3UHJA 4Y2TA 3HU2A 4KK3A 1NXQA 3DM5A 1U8EA 4AO7A 1O95C 1S8NA 1QG6A 3QE2A 1KFCB 1YDEA 2FLWA 2WIAA 3KHUA 2ZIXA 1F3OA 1QGED 4GZ5A 8LDHA 2AMYA 1KAOA 2AN3A 3AR4A 3OJFA 1TAHA 5AKEA 2JIPA 4ETIA 5JPDA 1NLMA 3LNTA 3IXMA 1C3EA 2BI7A 4DARA 2B1RA 1W96A 1XEWX 3CF6R 3FXAA 4F92B 1X8JA 1ZK0A 2WTBA 2BFMA 3FPCA 2P27A 1T35A 2PVPA 4NOJA 3W5DA 1SVLA 2AUNA 1K0FA 3E6AA 2W71A 2A5JA 2PMFA 4JP5A 4LZAA 1P5ZB 3IDSA 2PGDA 1UBKS 1HURA 2E87A 3BL6A 3SVZA 5LC1A 1B4DA 4WNAB 1FFSA 1EXNA 3OMXA 1XDUA 2J6IA 4HAIA 5G0SA 1CRWG 1NPTO 1N1MA 1YB1A 1YCFA 2JS7A 2W6IA 4G8BA 4HZUA 4YAUA 3ZKAA 1NP3A 5LLDA 1KZ4A 1SEPA 4EITA 5JV5A 5FLKA 3WRXC 4FTWA 5T5QA 2P69A 3PTLA 1IPEA 3PC8C 1QFSA 5JYCA 5KOIA 2IUSA 3LPNA 3QVGB 3DHWC 4R81A 4KV9A 1VCNA 4UTOA 1U4SA 2G9ZA 2FY8A 2H4JA 2BRUA 2G9VA 2PRSA 3QYPA 1KMQA 3VNAA 3ZE0B 3L46A 4TXJA 3EVNA 4KO1S 4DV5B 4HI0E 4PCLA 5KINB 1AQIA 1XJQA 1CUBA 3IELA 4LWQA 3ILHA 1QZUA 1J9ZA 5ALOA 1UBEA 2HAEA 3L7YA 4X3PA 3IQFA 1VE1A 1NV9A 1O6BA 3DFFA 3GD7A 4RORA 4I6JA 3UT5B 3UUFA 3TSOA 4DV4B 1TF2A 3K9NA 3FR7A 4BNIA 1AXEA 2D5LA 5HW0A 3OEED 4CJXA 2Z5LA 2NNWB 3NONA 2QNBA 4WVLA 4NU0A 1JAYA 4DV6B 2II6A 3MOSA 1QF6A 4JCOA 1FSSA 2P2YA 4JEUA 1RWVA 2I34A 3MTQA 4HLQB 1FXSA 1ZD4A 2IODA 2Q41A 3IURA 4JR0A 1RVDA 3AB7A 4POOA 4ZGWA 1HLPA 2H2IA 2HV9A 2AE1A 2QY6A 3CRMA 1QVRA 1X9HA 3ASYA 3UIEA 5JARA 1QYIA 1IH8A 1CUSA 2OEPA 4MRAA 4Z3DA 2CV2A 4PX3A 3T7EA 4W6ZA 3K9QO 2EKDA 3STVA 3TQHA 2HYDA 4DQ0A 4RIFA 3PQ7A 1U7OA 4LTMA 5A62A 4LQLA 1G7CA 5JO9A 2HB6A 2BFCB 3D7RA 1Z33A 3FSGD 3L1UA 4MKHA 2F3RA 3N0TA 3QXGA 4RVDA 1VSVA 4EVSA 1UR5A 5BQFA 1DZ3A 1NDUA 4AAYA 1OIVA 1OKKD 1GG5A 1R0SA 1W4AA 1YRBA 1NOKA 2PX6A 3QVKA 4KQJA 4B7AA 4Z54A 5K8TA 3QF4A 3GMSA 2ZW9A 2A33A 5K51A 1DB3A 1QHEA 2UUBB 3I92A 1QNLA 3M4XA 4K2HA 4EEZA 5KQRA 1W36B 1IZ8A 4AKHA 3TK1A 4LE0A 1BE1A 5CB4A 1PZXA 3EIUA 2VP0A 2DFPA 3WQHA 4GP6A 1X7WA 1HEYA 2NP7A 4DA7A 5ADVA 1J23A 2AKEA 3SHWA 3SP1A 4CLDA 5TMPA 1Z2PX 1ADJA 4MS4B 4WACA 2V3CC 4RNCA 2O1SA 1MN6A 4PC6A 2W37A 3FETA 2ZBFA 4PZUA 4RZUA 2ZSAA 3KQQA 4D8VA 4M0PA 3U4QA 2G67A 4QELA 1VLMA 3PEYA 1V9SA 2OAGA 1ZMBA 5F3WB 1R9MA 3R7BA 1F6WA 4Z86A 3GDWA 4GQIA 4GI7A 4IFBA 1K8RA 4L0QA 1DG9A 3Q9SA 2ROQA 3ES9A 4NY1A 5JRZA 3HN2A 3WMGA 1MEJA 1GSIA 5DSZA 2WTUA 4ZAWA 3QUCA 2JLYA 1T9ZA 3WBBA 3GH3A 3D7KA 3DKKA 3IP7A 4RVGA 3INNA 4F9FA 2JLVA 3AERB 2LTAA 3GF4A 2P9HA 5TB5A 1SC6A 2HRRA 3OZWA 1WAMA 2I3AA 1Z6QA 2XNKA 3C6BA 4IIJA 4EGSA 3QELA 2EZTA 3QH4A 4ZOCA 1Q91A 4EHKA 4WA7A 4AKGA 1NSYA 3R6TA 4KVFA 1V9CA 4IM7A 1DPFA 4RA6B 1N2XA 1ZNYA 4CT0A 2EIXA 1NNSA 2CLMB 2FW8A 1DO0A 4LY0A 2RI1A 1Z5GA 2ZVQX 3Q0EA 4URUR 2IITA 1JHOA 2VHCA 2O8FA 2YBEA 2A1UA 2CFSA 1G3QA 2PMKA 5LKAA 1IN4A 4XEUA 1GWNA 4N3GA 4D9EA 2ZG6A 3W2IA 4GZ3A 1WRBA 1AZTA 2FZKA 1JKJB 1XJCA 3IR7A 1GNRA 1Q57A 1ZOIA 4BRSA 4CT5A 1YONA 3G1TA 4YMWA 3WLTA 4K9PA 1BU8A 2X9LA 1XQ1A 1O58A 4KXXA 2OM2A 4D44A 1GQQA 4JI1B 1NSTA 4NNJA 5LUAA 4NECA 2FWPA 4XAQA 1NV8A 4ZPJA 2QTLA 5T64A 3OZCA 1G6KA 4HUQB 1AHIA 1E94E 5HIAA 4FD2A 4R2KA 3PB3A 4QKQA 4MGZR 3HJAA 2ATIA 4CLXA 3NTXA 2D0IA 2PAAA 1PGQA 3JQAA 3MJSA 5EJAA 2W70A 3T3PB 4AWXA 1QTNA 3R9KA 3ZI7A 2QG9A 5EP4A 5JH7F 2A9QA 2K7FA 1EFAA 1N78A 5F51A 3M6LA 3TZLA 3K6SB 2H0AA 5DHUA 2PPLA 1JDZA 1OI2A 3T4UA 1NZDA 1WW2A 2VN8A 5CG1A 5C3UA 2DHQA 4BASA 1NT2A 3PP8A 1KK3A 4BV9A 1QCZA 1KKUA 3CUSA 2BUCA 1AZSC 2AEEA 2NO5A 2GK7A 4CXMA 1KSJA 1PHRA 3DW1X 2O2JA 3N2KB 3QKUA 4G5QA 4GOXA 4JXKA 3VH3A 4C4OA 3TQCA 3ZHYA 4TRNA 1EU1A 1XJ5A 4I4CA 3UUWA 4INAA 1T5DX 4WNAA 2O2HA 4NCIA 3UJNA 3GJZA 1QGYA 3KWJA 4QDKA 2GWHA 1YI1A 2V55B 2YIJA 4TTAA 1XVIA 2QL6A 2RAPA 1C80A 2PZJA 4LIPD 3TIVA 3JZAA 1J07A 1FPMA 3DE5X 2IV3A 3WIVA 4E4YA 5B4VA 4PHCA 3SWWA 3BN3A 3VU1A 3AKZA 4KLCA 2A5DA 3QVGA 5IJXA 1Q92A 1R6DA 3CW9A 1XZAA 3RJTA 1XTPA 1NVBA 4M8IA 4EG1A 2QE7D 1RKVA 1JI0A 2GETA 4ZEOA 3JVUA 1K86A 2A9KA 5AK6A 2C3MA 2MSKA 4XX0B 2XMBA 1OC4A 2QJWA 3GB9A 4P5EA 3PVCA 4Y6GB 4V24A 1RZVA 2A35A 3AZQA 4PLZA 4HMQA 5AVYA 1UFOA 5G4KB 1KBQA 4GLJA 5CDFE 1G8HA 1FTSA 1I3MA 1XJ0A 3C5HA 3FZGA 4MI6A 2YXLA 1NL3A 5DYIA 2WPDD 3U17A 5BSTA 4BO6A 4LF4B 4FYKA 3FNRA 4DCMA 5BWCA 4DXHA 4QTTB 5M7EA 3BM5A 2OTCA 4S1PA 5DTQA 1B00A 1ZITA 1FA9A 1UOPA 3PR1A 3AU9A 3NKLA 4KK4A 1KEUA 1OYVA 4FI3F 4Q4DA 2CLKB 3ZGOA 1NVDA 1PHPA 3FTNA 1Q3TA 3UATA 4RVOA 3AP2A 1L5HB 4FYIA 1EHCA 1RAAA 4ZCMA 4GKAA 3V55A 1Y7HA 1IULA 2W6JA 2G1UA 3N07A 1ZMXA 2OUIA 5FT9A 2O8CB 4FLEA 2L2QA 1N1GA 1Z68A 1MC1A 1F2DA 2QSJA 3I3OA 4L0CA 3K71B 4E7OA 2PQ0A 1YXMA 3COVA 2E5WA 4QG7A 4RF4A 4ROSA 4W5JA 2VDPB 1DKLA 3ICOA 1XWFA 2BGMA 2HRBA 4NNOA 3AIMA 1FQOA 3UBMA 1I5RA 3A1TA 3ZXXA 2XCTB 1GR1A 3BA1A 5BY2A 3DL0A 1OXXK 4JYBA 5DKFA 5E9QA 1CIPA 4IDFA 1XK7A 4ZT3A 3SJUA 4BE9A 4CF6A 4CM6A 3QTLA 5CFMA 2W2PA 4GR9A 3WKEA 5H8WA 1ZU4A 3D0QA 2E82A 1P7WA 4X00A 3VOAA 3IDQA 5ALFA 3PT5A 2RJNA 4KMSA 4N9QA 4Z51A 2UXBB 4KWHA 5B2FA 4UDYX 2CZQA 5I8WA 2KYRA 4MS4A 4UULA 4DMUB 4S04A 1WHSB 2PYDA 3LWBA 4GVPA 1DLJA 4YRNA 4LJ5A 1H8HA 3EODA 3WZ2A 3BQMB 3QXCA 1UZUA 1U11A 3SMVA 1JQDA 5SY6A 3HCDA 1RQ7A 2CXHA 2HNAA 3B2QA 4JP1A 1PQ4A 1KZYC 3GJ7A 4NDAA 4Z0HO 3M0EA 1W76A 3HR4A 3WGJA 1SRQA 4A8HA 1EA5A 4I1RA 4YRAA 1YQDA 3KLBA 2GBIA 3HXLA 3JZFA 3GUUA 4REOA 4BC1A 3I34X 1K0UA 5HIIA 3QFTA 3ZWNA 4ENRA 3SKYA 1Z13A 3ANSA 4C06A 3AERA 3FKJA 2VK2A 4Q9NA 4QYTA 2R97A 4PQRA 4JNKA 1B43A 1N75A 5F21A 1RZRD 2XITA 4CLRB 2IT1A 1UIMA 2FQWA 1P4GA 3V46A 1D0SA 4B3HA 1TC2A 3LBNA 3OFND 1TX4B 1I80A 1XZHA 2FUG6 1DBRA 3GCGA 5LB2A 5H4GA 3L6BA 1V5IA 1DP4A 3ZLJA 3VPXA 2GF9A 1AS3A 4OLBA 5BWNA 3QMWA 5LVAA 1IONA 3W3AH 5IZCC 1TADA 4ENPA 2Q7OE 2I62A 2ZSKA 2ECQA 4RY8A 2WHYA 5CFOA 3BERA 4B0PA 3SC4A 1FJHA 3V8EA 1E2JA 3H18A 2QX6A 3PNYA 3VR6H 1X87A 1ND5A 1X74A 5DTMA 3VR2D 1JKJA 2ZU6A 2CLDX 1X70A 1Q0LA 2PD6A 5BSFA 3EPKA 1E6UA 2WAOA 1J06A 1MHTA 2HA0A 3FRIA 2V8OA 1M0TA 1PSWA 3FNEA 5F64A 1GGNA 1CY0A 4MR9B 1D6NA 1NTRA 4TUYB 3UH1A 4UUMA 3WGLA 5EXDA 4A6DA 2EDAA 4WOCA 2D6FA 4X6YA 3RS7A 1YHZA 5K3SA 1KC1A 5ARCA 2RHTA 4HUQA 1ZJWA 3E2MA 2QTWB 2C77A 1KP9A 3RJ5A 3DBIA 3SSMA 1NRJB 1VYUA 1C7RA 1G9XA 2XKBA 1LBHA 4IDPA 5FBWB 4WTOA 1R0YA 2PSHA 4QE3A 1Y3HA 2CZGA 2OGZA 2IV7A 1OFGA 2PV0A 1ZN2A 3VR5D 1N8SA 4X97A 4GPZA 1P2UA 2ZS9A 3B60A 4NFSA 4EL0A 3H84A 4NV1A 2ATVA 4C3VA 3K6SA 5DX8A 1W46A 4D26A 5FD8A 1X1CA 5BUZA 2QL9A 4ND2A 5KWSA 1KO1A 1W4CA 5H70A 2GZAA 1Z47A 4HZIA 1XVUA 3DBHB 3NC1C 4LRQA 4RFLA 3WQSB 4M9ZA 3VZBA 1RJEA 3N2KA 3BULA 4IXTA 5LQDA 4JLVA 2OORA 1J22A 3IUYA 4N0QA 2GTHA 2ONKA 3FSJX 4JLJA 4D81A 3PQDA 4BAGA 5BR4A 1BD4A 4Q4HB 1TZ2A 4AY2A 3A9CA 5B7GA 5AD1A 2JK1A 3BB4A 4DW8A 1ZN8A 4E15A 6LDHA 2WNSA 4UAUA 2E1RA 3QMPA 2ZS7A 1VE6A 2AW3A 1XVLA 2Y0PA 1R2QA 4FX5A 2VZ9A 2VJDA 3AI1A 7AT1A 3LBAA 3H5TA 4CQMB 2REOA 1HEUA 3V42A 1WETA 2JKZA 2R47A 3ROKA 5EJGA 4ZI3A 3IJEB 2ZCUA 3VJLA 3CKLA 4LVUA 4XX0A 4LJRA 3KB1A 2VYVA 3T7RA 1E9VA 1X1BA 2VAPA 3L05A 4K40A 2GUGA 5KQMA 2QLMA 4DCVA 5CTAA 1GRCA 2R6HA 2VKQA 1DI0A 4MVYA 1NN0A 3L6RA 2HK6A 4Y2YA 5F2EA 4B80A 5G4KA 1ZG3A 3L8GA 4ZQBA 2FMHA 1U0EA 5TMBA 3OJEA 3JQCA 3SHFA 1Q7EA 1Z2CA 1H0RA 2WIGA 4I50B 1YFLA 2NU8B 3I9JA 4Z7OB 5B7NA 1R4ZA 3ABZA 3WQBA 2XTMA 3M2TA 4CMEA 3HMKA 1MORA 2IOQA 4KI7A 2GHQA 3JVVA 1Y0BA 1D3AA 4LRYA 4TTTS 5LDGA 4C0HA 2A0YA 2IY7A 1P1JA 2GWRA 3GZNB 3E4CA 2I4TA 2ZUDA 3DVAB 3OZSA 1L5HA 4GGMX 3G2QA 3F90A 3LKVA 1DG3A 3NT4A 1WQ4A 3O38A 2YRFA 2O8CA 5JQGF 2VPXA 3CZ5A 4DR7B 1VHJA 4PO9A 2GK6A 2DLCX 4PHTA 1EFRD 5SV2A 3WMEA 4W5NA 1F7UA 3BFVA 1HY3A 2ZAGA 2CKDA 1CZKA 1IXZA 1CNMA 1TZBA 2CY0A 1A76A 2R6ZA 1CEXA 3QF7A 4G5SA 2P4EA 2Z8XA 4F11A 2PT5A 3CV3A 2QIPA 3QUAA 2G70A 4DC0A 2FR8A 4Z0NA 2GEUA 5EJIA 1JR4A 2CB9A 3P94A 1SVOA 1DBSA 5F7ZA 3W2GA 5DNDA 3WI7A 1SVMA 4CIYA 5CA1B 5C3MA 4Y6OA 1BC5A 3CVOA 3V4ZA 2H92A 5E7MA 1E79A 1PSDA 1VE3A 2E3JA 3OJOA 5IKPA 2AF3C 3OKCA 4EEXA 4NMXB 1S1CA 1VOTA 4KP7A 1DDGA 1MVNA 1WHSA 3OAAA 1Y9AA 3L6CA 3U7RA 2I2AA 1FYVA 1KDVA 3WJ1A 5AMXA 3B3AA 4OEHA 4BP8A 3RRYA 1XRLA 3TLGB 3OTWA 4GMDA 1ZNXA 1JP7A 2PGIA 5TT0A 3TQSA 2D2EA 4ABTA 3LQYA 1F2UB 4DG8A 1GSAA 5HF6A 1EJ6A 1RLJA 2I4LA 3DWIA 4Y98A 1ZH8A 4P3OA 1PT7A 2FW7A 2M98A 2Z2ZA 2YV4A 3V2HA 4JI5B 3TG2A 3VGPA 3KLNA 5CT6A 1UJCA 1HYGA 3EF1A 1BXGA 1MRZA 1DDOA 3IDFA 4P32A 2IDZA 4BQEA 4MQFB 3HCCA 3DOHA 2H2GA 3KD3A 5DW0A 3FOWA 3IMEA