1DBSA

Mechanistic implications and family relationships from the structure of dethiobiotin synthetase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanistic implications and family relationships from the structure of dethiobiotin synthetase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biotin biosynthesis
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1994-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dbsA00
1VPLA 4B71A 1H8EA 1UF9A 2BEKA 3ZVMA 4KITB 2VP5A 3ZZTA 1JECA 1UPTA 1GL9B 1M7BA 2WSSA 4DLXA 5JSZA 5LD2B 1HV8A 3K1JA 2W0SA 1OXXK 4TMTA 4AYTA 2FSIA 2GRJA 1MH1A 3OE7A 4P3YA 4M9ZA 8OHMA 1OYWA 4LBZA 3B9PA 1D8TA 4JSTA 4DZZA 4IVQA 5CIQA 1G17A 2CE2X 3SJCA 4DRZA 4A82A 1OXTA 1CU1A 4A0FA 3ASZA 2GEDA 1KI1A 2ZROA 5FTLA 1E2KA 4H1UA 1GVNB 1G8FA 2HV8A 3IBYA 2QGZA 5FFMA 4B6EA 4TSFA 1F6BA 3I8XA 5J47A 1D2EA 1Z0KA 4YLGA 3ADKA 2D62A 2H5EA 2A78A 2EWWA 4J0QA 2QMOA 3LRPA 2NO9A 1W36D 2ZI9A 4BLRA 1JNYA 2C78A 4EQ6B 2CDNA 3BH6A 4C9BA 1G4UR 1XXHA 3L8YA 1IN4A 1ZD8A 3P26A 5E7IA 1E2MA 4PPFA 5FBRB 1XTQA 3PUVA 1T91A 2EWVA 5CM9C 1UADA 2Z43A 3F0TA 4P4UA 2ZI7A 4RZXA 1QHNA 4EFNA 2ZS8A 3A4LA 1G7TA 1XEXB 1CF4A 3AF2A 2V8OA 3SHWA 2YWHA 4ERNA 1Z6TA 1S9DA 1KMHB 4DDTA 2DHRA 3CZQA 5FOWA 5EXPA 3MWYW 1KK0A 4BFSA 3HU1A 2G9NA 2LKCA 1ZP6A 5L3QA 4CEJA 2O5VA 1KDOA 4HEJA 2D74A 1U9IC 2YOFA 4MITA 1IXZA 1MO3A 1WMSA 4U02A 3EC1A 1ELOA 3BS4A 1N0WA 1I4LD 3QEJA 4PFSA 2H57A 1KO7A 3UWKA 4JBXA 2NO6A 3CRQA 3L8ZA 1P2SA 1S1CA 3I32A 3P4XA 3E1SA 4HAVA 4XTRA 4XVRA 5EXTA 3W34A 3W8NA 3ZS9A 4FXPA 4DVGA 3L43A 4B6FA 4MGIR 3L2OB 3W90A 3RSOA 4DLTA 1NP6A 1R5OA 3GLIB 1RYHA 4DBLC 3D7MA 2G1JA 1XMSA 2IS4A 1P61B 4F92B 2J87A 1I4TD 4JMPA 3EA0A 5FUYA 4EPVA 2WWGA 5JZVA 4LJ4A 1D6JA 2C99A 5F3WB 1D2MA 4PANA 3QSYA 4R2IA 2ZYUX 4BZXA 1E2IA 1OJLA 2FMXA 2WJHA 3HPRA 1IM2A 2WJIA 1SXJE 3BB3A 4CEHA 2ZXUA 4NCJA 421PA 4KFSA 3KB1A 3OIWA 3UG6A 4K46A 2QAGC 4G01B 3FMIA 3K0AB 1KKLA 2ORVA 3FKQA 3MAAC 1E2EA 4GFDA 2QG6A 3GCGA 1M7GA 3PR1A 4I1UA 4HDCA 1RFLA 2O8BA 5FPHA 1JR3D 3TIFA 1EFTA 1N5JA 4DLYA 1VG9B 4Z1MA 5BQ5A 5J40A 1TU4A 2DY1A 4BUJA 3LY5A 4CRWB 5GJCA 1JB1A 5DISB 1WBDA 4XD7D 1AKYA 4BWYA 2J9RA 4L9WA 1Z0DA 1YU9A 3W3AA 1VYUA 3WP1B 4A0GA 4BZQA 2ZJOA 2QT1A 1ZD9A 3TQCA 4XVUA 3PUXA 2QT0A 3RS7A 2D7CA 2R8RA 2RMKA 3H0KA 3QF4A 4NP6A 4LJAA 1RKBA 2BBWA 4CYMA 2RHMA 3QG5A 2H92A 4TMWA 3LNCA 2ZVPX 2BVNA 3DKVA 1XPRA 2G0TA 3O8RA 2NOAA 2MSCB 4IOLA 2JLRA 1X8KA 1ZIOA 2FPKA 2ODWA 2QRZA 2AD5A 4Q9LA 3UWOA 621PA 4QM6A 2PL3A 3ND9A 4M1WA 4OI2A 2MMGA 4A2QA 1GRQA 3SHFA 3Q5EA 3Q8XB 1P73A 2PCJA 4JLOA 1YZTA 3U44A 2ERYA 4OHZA 4HAXA 1E9EA 5IDVA 5E7JA 3H1TA 3EZ2A 5IT5A 3EZ9A 4G5OA 4HUQA 3MWLA 5SZHB 3RS5A 1IN5A 5FTMA 1UBGA 1KSHA 2V6JA 3CIOA 4IXNA 2OAP1 1RRFA 1MO6A 1W2HA 2B8WA 1N2CE 3AVPA 5JEEA 1TQ6A 4JZKA 3C5CA 4MYTA 2NGRA 2W83A 3JVUA 2ZRFA 221PA 1R8QA 4QM7A 3K70D 2GK7A 4D2IA 1IY1A 2QUZA 1PLKA 2JATA 4QBFA 1BKDR 1XNJA 3QVVA 1AQYA 2XTMA 2Q6TA 5JSZB 2J0QA 1IQPA 5UKDA 2VO1A 4CF7A 1KDRA 3AF3A 3TW8B 1ZC3A 2QM8A 3LO5A 4JVMA 1TQ4A 1T0JB 1DAHA 3B60A 1VCOA 4QBIA 6Q21A 4X8MA 4JL8A 2G1KA 3TRFA 2FA9A 1OFUX 2C2HA 4F4IA 5JHHB 1X1SA 3NTUA 4HZUA 4EIWA 3HP1A 3T1VA 1EESA 3PITA 1ZNYA 3KQKA 4IXMA 4N0DA 1GFIA 1KHTA 1Q1ZA 2WTUA 1LNZA 3B2EA 3FE2A 2ANCA 2ZJZA 4Z54A 2CNWA 2OUKA 3GLFA 2QNRA 2ODBA 1G16A 1K5GA 4H9GA 3AGQA 2BOVA 2Q9AA 5TDHA 5JCPA 4LC1A 1QHHB 3BWDD 1E32A 3SYLA 2BJVA 3JZAA 3K0CC 1RE0A 3NKVA 2BIFA 4PPGA 3EPHA 1KI2A 1PLLA 2ZRHA 3B82A 3FVQA 1M34E 2E9SA 4BGDA 1XXHB 3QQ5A 4OYHA 4BLPA 1YJ5A 3WYAA 4ZDJA 5FOXA 3PUZA 3EPKA 4GOXA 4DEYA 3NWJA 2DCUA 2QP9X 2IT1A 2PT5A 1ZNZA 3P20A 2WJGA 4D6PA 1LVGA 2QEQA 3C15C 1JPJA 4HB4A 1YRAA 5HKKA 1E9RA 5AJWA 4JBWA 1BO6A 3FMFA 1XD8A 3CW2A 4FMCF 2ATXA 3T1QA 2OXRA 5L3QB 3SE0A 3I73A 3PJRA 4EDHA 1NLFA 4ZO4A 1W5TA 4WXPA 4OK5A 1W0KD 1AK2A 1U0LA 3OESA 2FSFA 2ZSEA 3D8BA 2EFDB 2ZAMA 2G0NA 3VAAA 2Q3FA 1EGAA 2NIPA 3I92A 3KUCA 4ZI2A 2ZUDA 4PC3A 3SN6A 3U6KA 3GLGE 1KYIA 2CJWA 3CR7A 3CRRA 5DI9A 3SZRA 4LJ9A 4S2EA 4G5GA 2EU8A 5JS7A 4A2WA 1CR1A 3C8UA 4V0NA 2ZE5A 5AWFC 3QEOA 4MKIA 4TMKA 3VNUA 4M1YA 3MJHA 1GNQA 2F7SA 4B43A 1ZUIA 1G3IA 2JA1A 4GOKA 4POAA 1FTSA 1UDWA 4LK2A 5CLLA 1SQ5A 4A15A 3OHMA 5FH9A 3RWOA 2HDNB 3QG1A 1Q22A 2VLIA 2X2FA 4XJXA 4B3DA 2AFHE 3UATA 2J5XA 4F4CA 4ACAA 3SYKA 4JVSB 2CLCX 3KDSE 4N0EA 3T1OA 2AXPA 1W36C 3K9NA 5IK2D 4GZMA 3U3OA 4BFYA 1N6HA 1OH6A 3PUWA 3ZZUA 2O8FB 4OHVA 2N1BA 2GJKA 1NLZA 1C4OA 3BB4A 2WWHA 3QKTA 2PEZA 3CRVA 4AD8A 3I62A 1BS1A 4HSEA 2XB4A 4NYMQ 2OFOA 4LY6A 1KSGA 1JXMA 3NEYA 1E2NA 4V03A 1HQYE 1DAGA 2XB2A 4LPSA 4YMVA 1HURA 3SYNA 1FNMA 1S1MA 4AC9A 1U0HC 3T35A 3K53A 4TL8A 4LBWA 1G20E 4Q02A 2AWNA 1MO4A 1KK2A 2AR7A 2O52A 3QF4B 4YMTA 1SXJA 1XD9A 2BC9A 4M2LA 1BYUA 3RSLA 3BBPA 2O0KA 3EZFA 4RZ2A 2ZU0C 5LDDC 4JSYA 1OH7A 2VP4A 2D7DA 1W0JA 2ZI5A 1ZMXA 4MDFA 1Q21A 1SHZA 2D3WA 2F1HA 2GBLA 3BAFA 2IX3A 1XD2A 2Q3HA 3LQRA 2IS1A 4B35A 5G41A 1Z3IX 2C98A 2ZQ5A 3U44B 4PHTA 4KSBA 1NN3A 3NDBB 1BH2A 2CVHA 2OESA 2SHKA 4YDSA 4TQ9A 4FIDA 3SEAA 1E2GA 4TTRA 4ZCMA 3CF6R 1RZ3A 1G3QA 3CNOA 3W8RA 4HUQB 3CONA 3F5FA 2UKDA 4QNMA 2FPLA 2DFLA 2JDID 1QBKC 3TW4A 3DDCA 3T12A 3ZVNA 1EWQA 1X8JA 2D06A 2ZRPA 3WNCA 4I4LA 2WAXA 4A0RA 1BMFD 3PCRB 1OFIA 3FHTA 3WY9A 2V7QA 3K0EA 3LDAA 1W36B 3UIEA 2ZTSA 3L0IB 1N6RA 2GF9A 2IHYA 1N6KA 1G1MA 4YC7A 2IUUA 2I4IA 1IHUA 1PJRA 1COWD 1PUIA 2XNDA 1KJYA 3T06B 3AKEA 1ZNWA 3D6TB 3I5YA 4ZDWA 3LH5A 5DI3A 1E9CA 4MQBA 1XJCA 2P3SA 3UG7A 4LZZA 2WICA 5C4GB 4UQOA 1XTKA 1EFRA 3BH7A 1VCMA 1OPXA 2GJ8A 3TH5A 1Z0AA 3RHFA 1G7CA 4OQLA 2C96A 1Q12A 4NTZA 4RD1A 2OLJA 1OHHA 4QL3A 1MOZA 1DG3A 3BERA 4IDOA 4IHQA 4DC9A 2QENA 2F6RA 2GKSA 5IHPA 4CT5A 3IDQA 4XSHA 3SU8A 4GL2A 2CCJA 4O25A 2QPAA 2YJTD 3TVDA 2R9VA 5KHOC 2CHQA 3KKOA 1TU3A 5DO9A 4KAXA 3ECCA 3MJRA 4LYFA 1TTTA 1CJVC 4KCGA 1NJFA 3EG5A 2CEAA 1VYTA 4WIAA 1G3UA 3TUIC 2GVZC 1WE2A 4XOIA 4PZLA 1NJGA 3N2IA 2IS6A 4M1MA 4W5HA 1DADA 1KAOA 4RD6A 1D2NA 1CJUC 4UJ5A 1A2KC 4LYHA 3QKUA 4OQMA 4Z8XA 5BW8A 5KUTA 2ZI4A 4JIMA 4B47A 4DDVA 3KB2A 4LGMA 3A6PC 3OFND 2O8DB 4FMCB 3KQHA 5CIWA 1VG1A 2YINC 5HR5A 2Y8EA 3RANA 1H8ED 3OEHA 1GILA 3R8FA 2QTFA 3K70C 2WSSD 3BFVA 1VECA 3QE0A 4KU4A 5FR1A 2QBYA 2G6BA 1HH4A 1F2UB 4NH0A 5K8LA 2YOHA 3ZZ0A 3N2EA 2B21A 2NQ2C 3OE7D 4UXHA 4ARZB 4L5BA 3EPJA 4L9SA 1U0JA 4W5JA 3SNHA 2C04A 2GXQA 4IW3B 1KI7A 4LHWA 2WBLC 4DDWA 1JEDA 1TF2A 2A5JA 2CE7A 2QA5A 3E5HA 5GJWC 1J8MF 3NHBA 4LCBA 2JLWA 3LVRE 1FUKA 1P9RA 5E7MA 2RHDA 3TUZC 3KQNA 2AXNA 4TYWA 2VP9A 1GUAA 4NYIR 4EPRA 3BXZA 4KFTA 3TQFA 4G3XA 3ZVRA 4R9UC 4TSFD 5FBQB 1HT1E 2BMFA 1N0VC 5FOTA 2GJSA 4TL7A 1DAFA 4JKYA 3FFAA 1IAQA 3W5IA 3K9LA 4B34A 3DL0A 4KSCA 1U98A 3THWB 1ODFA 5IRCD 1WRBA 1F3OA 5KTYA 3KFVA 1ZIPA 3HYRA 1SULA 2OZEA 521PA 3LV8A 4KJZA 3LXRA 4IDNA 4HLUA 4C7OA 2REXB 3GJ6A 3TLXA 2J0VA 2JJ8A 3GLGA 5KDOA 3KXLA 1HT2E 3CO5A 2OFWA 1OKKA 3ZIAD 3A58B 3PVSA 4YDHB 1EXMA 4GZLA 4MRNA 2KBFA 2W2XA 2YVUA 4TLAA 3RRYA 4JS0A 3TAUA 1Z6GA 3QIAA 3DMDA 5D3QA 5DN6A 5EE3A 2FG5A 3K70B 1RPZA 2ZE6A 1HTWA 2FFHA 4QJ3A 3OIUA 3CH5A 1XB2A 1A4RA 1CR2A 4GRAA 4QC2A 4W5WA 1IJFA 3T5GA 3AB3A 2IBMA 3C41J 1NN5A 2GZDA 1W4BA 3VQTA 3QUSA 4JYBA 3Q7PA 2QSZA 4KFUA 5J4KA 3EA5A 5LD2C 1XF9A 1R6BX 1Q1QA 5CYOA 4OBEA 5AUOB 3OIVA 3TR0A 3NHAA 4AY2A 4LHZA 2A5DA 3ADCA 2FV8A 4FD2A 1AM4D 1K6MA 3ZD7A 3KX2A 2QI9C 1IXSB 4GSYA 1XCGB 2CCGA 2AX4A 3MG9A 2OE2A 3S1AA 5HCIA 2ZS9A 1XD2B 1SVKA 4M1KA 1KKMA 3WNDA 4Q18A 3VX4A 3RS0A 2XTZA 1AZTA 2IEYA 3MMPA 3ONWA 4O2RA 3KQUA 2CHGA 1P72A 4BQSA 2ZYTX 1WDTA 2GXAA 4RCZA 2QMHA 5HZHA 1CIPA 3FYHA 4DCTA 3SBEA 4G1UC 5ELXA 3AH8A 2V1UA 1KY3A 3THYA 4PC1A 2ZETA 1FX0A 1G19A 4TTQA 1V43A 3OF5A 4OHYA 1AIPA 1YKSA 4LDJA 2GCOB 4PQYA 2IC5A 2KB0A 3K9GA 2ANBA 3VFDA 2Z4RA 2FSGA 1TEVA 2ZM5A 2DWPA 1E96A 3VR5A 1L7VC 2QE7D 4ACBA 1MO5A 4Q03A 3M6AA 3SQWA 4Z1MD 1XZQA 4A36A 2BBTA 3IO5A 1KI4A 3BFXA 5ANRB 3GLFE 4Q1CA 5JWHA 4FWTA 3DEFA 4ZIRA 1DO2A 3ASYA 1LS1A 2AKAB 3AVUA 4LPKA 4HDQB 3M0EA 2CXXA 4DLUA 1NIJA 4P32A 4EFLA 5FPKA 4YMWA 1G5PA 4URUR 4V02A 3KL4A 4ZPXA 3QKRA 1DVRA 2WMOB 1DOAA 2ORWA 4B73A 4DSNA 2BMEA 1VCIA 3EWAA 3FHOA 3UMFA 4F91B 5JI2E 5HZKA 2CL0X 4HB3A 4M21A 4DLVA 1TAGA 5TVKA 1GG2A 2HXYA 1W4CA 2ONJA 3ETLA 4Q1AA 4KLZA 4M9SA 1N6PA 1JBKA 1G291 4TT3A 1CRPA 1ZM4A 5B30A 3CPEA 3MFYA 2OM2A 2GXUA 3RABA 4JT2A 4U00A 5JEDA 4IFEA 3N70A 3K0FB 3M1IA 5JJKA 1AS3A 5B57C 4TZ6A 3CM0A 3PEVA 1QVRA 2O8EA 2ZJYA 1EWRA 3EZ6A 1LV7A 1E1RA 2EQBA 1CJKC 3QXXA 1H8HA 2GXSA 3P1JA 2P6RA 1FNNA 1E98A 3IQXA 3EC2A 2Q3MA 4G5QA 1ZM7A 4AKGA 3K09A 1B23P 3NBXX 1R10A 3T61A 3Q5DA 1NMZA 2FSHA 1CS4C 4M4SA 1Y63A 1N5IA 2AN9A 4D82A 1A5TA 2H17A 3QJYA 2QBYB 1OFTA 3A1VA 3IUYA 3EIEA 3REFA 3GJ5A 3EXAA 2AHOA 4OHXA 2A7QA 3HYTA 1DE0A 3KJEA 2JJ2A 4FN5A 4PX9A 2R6DA 4DLRA 5JCZA 3PENA 4FW9A 4FMBB 1SVOA 4M0LA 1E9FA 4DXAA 4B33A 3CKLA 4AI6A 1RVDA 1VG8A 3JVVA 4PAMA 3L0SA 5DHAA 1KI6B 2ZJBA 4Q7MB 2XSZA 1A82A 1KZ7B 2VP6A 4QHTA 1ZD1A 3IQWA 4HAWA 4U7DA 3RRNA 4LX0A 1L2TA 2CNWD 4I1SA 2TMKA 2CCKA 4HLDA 4AWXA 4GOJA 3OEEA 2BKEA 1Z6YA 2R6AA 1O3YA 2IYSA 4E03A 1W1WA 2H1LA 5EXSA 3ICQB 2KI5A 3K8YA 4IEEA 2JGNA 4IVRA 1XMJA 2FOLA 3AVQA 3H2YA 3NIBA 2GAAA 4FWIB 2ODNA 1US8A 5FL3A 5C4MA 3VMFA 2HJGA 4UNPA 2IL1A 4G0NA 1G9XA 1PUJA 1YVDA 1AGRA 4GNKA 1KK1A 5F98A 1CXZA 2HLDD 4MGZR 4BEBA 4C7OB 3LVQE 1I4DD 4A4DA 1LF0A 1SHKA 2HEIA 2OFXA 2VRWA 3GFOA 4NE2A 4PPNA 3GLGB 5JRZA 5JJIA 2VP0A 3KUDA 2B7BA 5BYJA 1F2TB 1U2RA 4JVNA 3O8DA 1EG7A 5HKKD 3I8SA 4WXRA 4ZI3A 5TMPA 2Z4SA 3A4NA 2HF8A 4YMUA 4ASUA 5AJXA 2RGCA 4CVNA 5E95A 5KDDA 1RRCA 2VBCA 1XTRA 4HAUA 4HI0E 5FOUA 4Q1DA 4C0JA 5KPDA 2JASA 4PSAA 2AD1A 4R2HA 1ZM2A 3U3KA 1II8A 4ABYA 4B44A 4W7SA 1UKVY 4H1VA 2WWFA 2B92A 3CX7A 2BBSA 4LSGA 2C95A 2ZJ5A 4PXAA 4R98A 2O0HA 3NH9A 4TN1A 2W0MA 4B2LA 5BN5A 2QP3A 1H65A 1DAKA 1RYFA 3HR7A 4OI0A 2WHXA 3CX6A 3A8TA 3DMNA 2FGKA 1G18A 2PX3A 4JLJA 4V0LA 2OILA 2WJJA 4OJQA 4CW7A 4Y0VA 2WAYA 2ZUCA 1LFDB 4PC6A 2PLRA 3THXB 4R7ZA 4OI1A 2EFGA 2ZRNA 2P2LA 3L0PA 5TV2A 1KO1A 2F43A 2KJQA 2G83A 3THYB 2ZSFA 4DT1A 5FPTA 2PLFA 3A1TA 1Z6XA 3DO6A 2IS2A 2C77A 2QQ0A 1KAGA 1R8SA 1WF3A 2W6JA 3B9QA 4TMXA 3U61B 1R5NA 2C9YA 4LJYA 2WVJA 4Q4HA 1ESMA 1JQJC 2Z6VA 3VR1A 1OXUA 2BDTA 1W7AA 2P5SA 3GFTA 2QL6A 3C16C 5KSZA 2AWOA 1P2VA 2HCBA 4Q5IA 2WV9A 4ZIRB 3AVXA 1ZUNB 2XNSA 3ZD6A 4OJKA 4P4TA 1QZXA 3B13B 3U60B 5DYGA 3ZS8A 3B1YA 1LS6A 1T0HB 1T5IA 2H18A 2CK3A 3GLHA 4RD3A 4GMXA 5LBIA 1K8RA 3AV0B 1SXJD 2ZAOA 2NO1A 1ZVQA 3U5ZB 4UNRA 2GJ9A 5H68A 1AQUA 1O87A 1R0ZA 2JJ1A 3EASA 1GNRA 4PHFA 3HPQA 1SVIA 4M53A 1W0JD 4MYUA 4EPYA 2V1XA 1NKSA 2ZRGA 1GKYA 3CWQA 4XVQA 1EFHA 3U3JA 3RAPR 4BEJA 4QJ4A 4XWOA 4C0BA 2VP2A 3B1ZA 1Q20A 4M1OA 4D4MA 4AYWA 2WWYA 4LV8B 5EUQB 2R6FA 2WKQA 2DFKB 4UKDA 5FL7A 1Z83A 4PAQA 1J90A 1TPZA 1XDBA 3IIKA 4KV9A 1KSJA 3LBNA 4NKRA 3T5DA 1LB1B 2FFQA 1Z06A 4RVCA 4DDUA 3WBKA 2NZJA 1GOTA 2FX3A 3CRMA 2O8EB 3T34A 3NC0C 4TWZA 2OCBA 1P75A 3TNFA 1R5BA 1FW6A 3ZLJA 3V00A 1G4AE 3W6OA 1YRBA 1E2JA 2EVWX 2V7QD 5DNYB 2A5YB 3PUYA 1E69A 3ADDA 1GKUB 3R20A 2QROA 4C2TA 2XNDD 1QHGA 2QM7A 4TMVA 1OF1A 4Q00A 1WP9A 3X1XA 4AYXA 1E1QA 1X8LA 2FDCA 1Z8FA 4TTPA 1KJZA 4D26A 4MDEA 3IEUA 1F48A 3X2SA 4DUGA 1XU4A 1J99A 1EFRD 1JJVA 1U90A 5FOVA 4KVGA 5B58C 4US0R 4ILEA 1N5LA 3D3QA 4MGKR 2VHQA 1UEIA 3DPUA 4D80A 4DLZA 3THOA 1CBUA 1K5DA 4FCWA 3PEWA 4CEJB 3KKQA 5DLQC 1OHHD 3PIRA 1NG9A 4MYCA 5GJVC 1BIFA 1TF7A 2V3CC 3ICEA 1ZM3A 1NVVQ 4BE7B 3LAWA 4KHZA 2WPDA 1DAMA 2ZRBA 4Q4JA 1P62B 4QGFA 3RYTC 3OAAA 4D25A 4OQFA 4E07A 4AG5A 3M4YA 5H70A 3IHLA 4CEIA 5D3MA 1ANKA 1J8YF 2J0UA 3K0SA 3QXHA 1G8HA 1OIVA 2ZR9A 1X86B 4P4SA 1P6XA 3AF4A 2PT7A 3CNNA 5FBVB 3QXSA 1N25A 4XWKA 2Q21A 2HT1A 2XZOA 1J2JA 1XCMA 4A1FA 5E3HA 2EFEB 2NG1A 1W48A 5FOSA 1S8FA 1YZNA 4HYYA 5G3YA 3A36A 2RAPA 3GLIE 2OCYC 4C2UA 3Q85A 1XCPA 1OE0A 2WOOA 4NL4H 3HR8A 5GVSA 1KDPA 1XX6A 4P0TA 5EP1A 1CR0A 3MD0A 5K8IA 2GCPA 3IBGA 3BIFA 4MKFA 3X1DA 4CEHB 2RKOA 1MABA 4LHYA 2ZJ2A 1U99A 4RY2A 1GRRA 1KNQA 5EXXA 2QMEA 3IO3A 4P33A 3LLUA 3SOPA 3J81k 1IONA 3EZ7A 3OEHD 1NBMA 3CB4A 3KXKA 2PJRA 1KO8A 1JQLB 1OXSC 3HU2A 1DBSA 1SVMA 1JR6A 2RCNA 2O8BB 5JFGA 2IYUA 1U8ZA 1X3SA 3GJ0A 3IIMA 2A9KA 3QBVA 1W44A 1IBRA 3CNLA 4A8JA 5EE0A 5FR2A 1OFHA 2IXEA 3CZPA 1KO5A 4B48A 4EJSA 3I5XA 4Q9KA 3WYFA 1R4AA 4Q19A 3TSOA 4NU0A 2QORA 4DB2A 3WRXC 3QVUA 4V0KA 4YQFA 2IHBA 1MR3F 4PSVA 1VG0B 3E2IA 4PO8A 1ZC4A 4BLQA 3AVOA 1II9A 2WWXA 3QPUA 4WZBE 4ZKEA 1MT0A 2QU8A 2K5UA 4BLTA 3AVVA 5B64A 3NXSA 5TB5A 1A1VA 1XJQA 4KXFB 2ZSAA 1G7RA 3A1UA 4Q01A 5J4YA 1AS0A 2BV3A 3AGPA 1Q57A 4L15A 1AKEA 2F43B 2IXGA 5B2ZA 3TBKA 2ZRKA 4DT1B 4UNSA 5L3VA 1GWNA 4M1SA 2OXCA 1OIWA 3W5JA 4C0KA 1N3BA 2W6IA 4GMDA 2FH5B 4G5RA 1Q3TA 4NBSA 2GA8A 5AR1A 3O8CA 2IF0A 1T4GA 3BFKA 3AVTA 1OKKD 2D2EA 2FFBA 1CJTC 2MMCA 5GJBA 3GJXC 1S96A 5DGXA 1CR4A 1XTSA 5DN6D 2DWOA 2H8KA 1ZRHA 4TQAA 3TAHA 3W9YA 2QSYA 5KYKA 5SZIA 2FZLA 4WZ6A 2ERXA 3B1VA 4NMMA 1RJ9A 2AK3A 3B78A 3R8CA 2VTKA 3FGNA 1WCV1 3GEHA 4I1OA 1WBBA 1P2TA 121PA 3I4LA 3QBTA 4DEXA 1SGWA 3OZXA 4B74A 1EFUA 2BWJA 3FMPB 2J1LA 4FCVA 2VHJA 1Q1EA 4NYJR 4BFXA 3VNVA 3LX8A 2YYZA 4U5XA 1R0XA 1YZQA 1NKTA 3AM1A 2YWEA 4RD4A 4JKIA 4HZUB 3AUYA 1XEWX 3UPUA 1E0KA 4QGGA 3SJAA 1GP2A 4WVFA 2Z0MA 3EARA 4Q1BA 2WWWA 3GLFB 2PMDA 1YZKA 4ZCLA 3KFXA 1TMKA 2V54A 4ZDIA 2ZJAA 2ZYVX 4N1AA 5EJEA 1NSTA 2R2AA 1ZYUA 4KYUA 3W3ZB 2PBRA 2VQSA 1XEWY 4NONA 2J7KA 2GNOA 4AKIA 5JHGB 4Q7LA 5JS8A 4DLSA 2GILA 1PZNA 2OAQ1 1E6CA 2OO7A 1W0KA 4KBFA 4Y0AA 4F93B 5AJZA 1KJWA 2BJWA 3L82B 1SVLA 2OEPA 4BZPA 4CGZA 2CBZA 1OH5A 2VH5R 3UXMA 1LY1A 3NH6A 4IOKA 1YR7A 3GP8A 4XSGA 4MYHA 4URYR 4V0MA 1ZNXA 5BN4A 2PX0A 2X2EA 4JYCA 5FBLB 1ZBDA 2J46A 2ZRLA 4Q4AA 2WMNB 4PHGA 2E87A 821PA 4L16A 1TF5A 4LYJA 3AP3A 2ECKA 2ONKA 2QPOA 2RGBA 4Q4JB 5CLQA 5CB8A 4TLCA 4QHYA 4DIEA 1M6NA 1VIYA 2OV2A 1VKJA 1SXJC 5C18A 1N6IA 3QENA 2CJWB 4P4SB 1C1YA 1GTVA 1QHIA 4TT3D 3OIYA 1R0YA 1Q44A 1Z5ZA 2V55B 4EQ6A 4OK6A 4D4LA 5J4LA 2OT3B 4IDHA 4LV6A 2GBLC 3QF7A 1FQJA 2RGGA 3AKCA 5LB2A 1FFHA 1NY5A 3R9IA 2XJ4A 3MWKA 4NCNA 2XGJA 3SC3A 2P0EA 4JL6A 1XEXA 2F3TA 5K8TA 1HY3A 3TSWA 1YZUA 2XJ9A 1KMHA 4E22A 5CITA 1E1RD 1MABB 3LQQA 1XTIA 4PHHA 3G0HA 1VCNA 4QNRA 2OSBA 3GEIA 4JBYA 1GM5A 5L3RA 3IEVA 1TUEA 5K8UA 4FCTA 4JJKA 4X8HA 3GPLA 2XZPA 5C2JB 2ZE7A 1SVWA 3X1ZA 3GJ4A 4B76A 5EP3A 2ZRMA 4Q1FA 1E0JA 3LX5A 5JI3E 1NNEA 4OK3A 4YXWA 2G77B 1XTJA 5KNDA 4GDFA 2OBNA 2W00A 4JLAA 2VHCA 5C1BA 4ESVA 1KDTA 2J7PA 2CMKA 2JJ2D 1W47A 2HCJB 5J4HA 1KMQA 2VF7A 4JJZA 3TKLA 4URXR 2JAQA 2B8TA 3EPLA 3QNUA 3GLIA 4BFTA 4NZYA 5CM8B 2XSZD 4JL5A 4URVR 1KK3A 2F9LA 3DKPA 2YKGA 1IXRC 2QP4A 4JLNA 2IYLD 2BBOA 5EE5B 3EW9A 2A5GA 1NVWQ 3W6NA 3U6BA 2GHIA 1SXJB 3Q7QA 3KKMA 3SJBA 2BHRA 4Q7KA 1CP2A 4Q47A 4TYYA 2UVQA 2QPTA 4DLWA 2EW1A 3IKJA 3OEED 4HB0A 1DO0A 3O8BA 3TUJC 1JALA 1M7HA 1OT3A 1D9ZA 2GDJA 4DIDA 1NLYA 5A4JA 3K0AA 2WSMA 3FHCB 1FUUA 2OLKA 3QY0A 2FE4A 4MRRA 1R0WA 2Q9CA 1HE8B 2YV5A 3BORA 4LHXA 1EX6A 4NCIA 1GDDA 5CJPA 2IW3A 2XX3A 4WA7A 2JLUA 4ZKDA 2IYYA 2IWHA 3GLHE 5EP4A 3GFPA 1AA9A 5FTJA 2GVDC 3FKSA 5AUPB 2LWIA 4TLDA 1DPFA 1DAEA 1E9AA 3VR2A 1U9IA 2V9PA 2E1RA 3SQXA 4HLQB 4EKDA 4ASUD 5AJVB 5G40A 3I61A 2WZQA 5EE1A 1E3MA 1E9DA 2ZPTX 2CVFA 2FF7A 1ZM9A 1E2LA 1T3LA 5FI0B 1RIFA 1W2GA 1G21E 4RSGA 3WHKA 4TYNA 1T9HA 1PLJA 4Q9JA 2G88A 4DCUA 3K9HA 5DI3B 2Z5FA 3ZH9B 1OIXA 3GMTA 3VU9A 4BPBA 4PC2A 2J41A 2ZU6A 3DZDA 3BD9A 1GRNA 5A0FA 3RS2A 1P3JA 3WHLA 4RZ3A 4C0HA 1W46A 3ZJYA 4FMDF 5EQTA 2FN4A 1TNDA 2MSDB 5JRJA 3GJ7A 4QBHA 3A37A 3PXGA 3VR4A 1Z2AA 1M8PA 2R62A 5HE9A 3AUXA 2P65A 4AURA 1E79A 4WW0A 3IIJA 3RLFA 3GJ8A 3V4RA 2QY9A 1TQ2A 4I1VA 1ESNA 5J5CA 5LPNA 1HYQA 4BLSA 2J59A 3VR6A 4NCHA 3ADBA 1HUQA 1IOZA 2QAGA 1M1YE 2PH1A 4IDQA 4BASA 5JMTA 4M8NE 4D0LB 1AS2A 3HDTA 4ZDKA 1G5TA 3HU3A 1T8TA 2P67A 1E0AA 4KODA 3LWNA 5TY0A 1IJEA 1SKQA 5FTNA 5TARA 2ZIAA 3NBYC 5CB6A 1E9SA 1QG4A 3VKGA 5M04A 4C3ZA 2NMVA 5JJLA 2W6JD 5FUVA 1FMJA 4HLUC 5HTKA 4MKGA 3RS4A 2Q9BA 1E2PA 2NO0A 2VYFA 2GETA 1G8GA 4AK9A 3B6EA 4D4JA 1Z2CA 4DKXA 1UAAA 4PO9A 3ZVLA 1XRJA 1CULC 3EAQA 1J70A 1GKIA 4PO1A 3U7GA 4YONB 4Q4AB 3KTAA 4G5SA 4B3FX 2CK3D 2OHFA 3WP0A 4IJMA 4D81A 1RRGA 4LV5B 4M1TA 4HB2A 1M2OB 1DG1G 1HEIA 3B5JA 4MRVA 4WAUA 5FI1B 4BFWA 3UMSA 5J4VA 2JJ1D 1A7JA 2C03A 4I81A 1QHHA 4CIDA 1JR3E 1SKYE 2KBEA 1XPOA 1GAJA 1UFQA 4XWAA 3PG5A 2GEVA 2DR3A 2F1IA 1M74A 1UM8A 4A6PA 3LD9A 4HZIA 5JWOA 1G6OA 1UBEA 1CKEA 1E0SA 3QXJA 1VDZA 3RRZA 2UZ3A 3O47A 2DBYA 1KI3A 2FU5C 3JZMA 2OG2A 5FL7D 1E2QA 3RVBA 2BKUA 1QRAA 4WBSA 4X8LA 2JIZA 3LW8A 1NVUQ 1NBME 3SBDA 3TE6A 2JLXA 2VL7A 3ZIAA 3SFVA 3KXIA 1KTVA 3V4FA 4GPTA 1E2HA 2A3RA 3VKWA 1KNXA 1GNPA 1LW7A 1Q3HA 4KLNA 4V0OA 5KNCA 2WOJA 3FDIA 5L3SA 2LKDA 3MLEA 5F9HA 3DM5A 3PFIA 4L8GA 2AKYA 3A1WA 4Q9IA 5KU1A 4QRHA 2WIAA 1KO4A 2J0SA 3LLMA 1YR6A 2VHUA 2AK2A 5BXQC 5BWMA 1VIAA 1E1QD 3DVLA 1T3HA 1JXOA 2XOKA 4DUGD 4BRUA 2PEYA 1G6HA 4LJ5A 3U7HB 2GTPA 3U7EB 1OYYA 3UK6A 3FMOB 3TK1A 2DYKA 5F9FA 4BLOA 1W4RA 5FPYA 2DWQA 2OBMA 1KOFA 2IK8A 4HATA 1NVXQ 1Q0UA 1TX4B 2BCGY 4OKSA 4Q48A 2WPDD 1FL9A 1Z29A 2ZITA 3OAAD 2G3YA 1EX7A 1NN0A 2R65A 2GCNA 3K0CA 3FWYA 5H1YA 2FEMA 2F1JA 1ZCAA 4II7A 1T5LA 3QKSA 4CT4B 4GT1A 3PQCA 3U7FB 1MKYA 1S3GA 3WRYC 1CJMA 2PZEA 4C0QC 3S1AB 4EPXA 2ZS7A 4NDZA 4BFVA 3ZQJA 4OQNA 4X8OA 1GSIA 1FP7A 2F1RA 2ZRIA 4D4KA 1G3RA 2J45A 2O8FA 2R44A 3F8TA 2QE7A 1HE1C 4QOSA 4EAQA 3T1TA 2EFCB 2QTVB 1U8YA 2JLVA 4O0MA 2DB3A 1U8AA 1XZPA 4HLCA 3DOFA 1OV4A 4LOAA 1L4UA 1UJ2A 3IHWA 2FEOA 1Z07A 1QHYA 1VHLA 4B32A 4EFMA 1TADA 3P32A 1FMLA 1EFCA 3LFUA 3VHXA 1FX0B 4PTLA 3NEJA 3PEYA 4OHWA 4URZR 1TQDA 1P9NA 3VX3A 1DS6A 1NBMD 4TLEA 4CDGA 3K09C 4BFUA 3R7WA 4F38A 2REBA 3DZ8A 4E5UA 2UZIR 4NCKA 1C9KA 5KOYA 4UJ3A 1DAIA 2QRNA 4P31A 2EYUA 3WNBA 1YZGA 2YHSA 2VA8A 3TMKA 2WJVA 1VMAA 2REOA 4TQUS 1ZW6A 4LYAA 4TL6A 2F3RA 3VU9B 2ZVQX 1MRSA 4A92A 2CLSA 2W2VA 4FMDB 2AFIE 3CWZA 4K8OA 1MRNA 5P21A 1R2QA 1WXQA 2HXSA 2ASEA 1YR9A 1XWIA 2A30A 2WKRA 5AUQA 5KPJA 4LJ8A 2RGNA 3RS3A 3SFZA 1ONBA 2W2TA 2X8AA 2HF9A 2YOGA 4RKFA 3AVWA 3QKRB 2FJUA 2KSQA 3AP2A 1XJ0A 1N5KA 2XITA 4LC0A 2XXAA 1UDXA 2O8CA 1YHNA 3TSZA 4RFVA 1G7SA 5CDFE 3BH0A 4GP7A 2A2ZA 2QAGB 3GJ3A 4M9XA 4KVAA 3H4MA 2C9CA 1KI9A 3I72A 3IPYA 2ZJ8A 1QG2A 2GEUA 4LRWA 4CZ2A 4C0LA 1FTNA 3MGCA 5TXGA 3AEZA 3C4JA 4PQRA 4RCYA 4V0ME 4MKHA 2W6ID 1OB5A 5EP2A 2QN6A 3D31A 3B8HA 3FFBA 1XMIA 2JCSA 2FZ4A 2ATVA 1KIMA 1N6LA 2RH5A 4MGYR 4DSTA 3DOEA 4D0GA 5G53C 2IUTA 3X1WA 2RGDA 2IEZA 5AUNB 4O2LA 4HDOB 3CPHA 3R9WA 2YC4C 4ITRC 5BN3A 3BE4A 4RZUA 4HAYA 5EE9A 1OLOA 2QTHA 1NF3A 3QI2A 5KSPA 4C30A 2PJZA 3NBFA 4JLDA 3KTAB 1QDEA 1CRQA 3V9PA 2OCPA 3RRMA 3B85A 4TYPA 3G82C 4A9AA 4GP6A 1R7RA 5CJ2A 5HCNA 2IYTA 3CF2A 4RJLA 1W4AA 2P6NA 4JLPA 3U4QA 2IWRA 2CL6X 1Z0JA 1WB9A 2IYWA 2ZSBA 2R6CA 4N3NA 3KJGA 1Q1BA 4AKHA 3WBJA 2C5LA 2HLDA 3U3RA 3WXMA 3P27A 5DHFA 4EPWA 4DB4A 4IEIA 3MRSA 3X1YA 3VHLB 3BJIC 4QJ5A 3LA6A 5AK0A 5EUMA 1UBCA 4C0SA 2O8DA 3TR5A 1XFAA 1T8UA 1ZUHA 1IN8A 2WJYA 3REGA 4ZV4A 2RGEA 4RD2A 5L3SB 4O3MA 3NC1C 1US8B 3MCAA 2HUPA 2OBLA 2W58A 1GL7A 5FUWA 1PVOA 3IILA 1KZGB 5F2EA 1P7CA 3H86A 5FBWB 3SI7A 4A2PA 1XPUA 1KI8A 1U81A 1ETUA 1JR3A 3L0OA 1F2UA 1NVVR 4TLBA 3BOSA 4B3GA 1UBFA 4ARZA 3AF1A 4US1R 5JBQA 2GZHA 2IA5A 1G5RA 1LTQA 3BGWA 2HJVA 2XTNA 4B2PA 3P4YA 1NIPA 1CLUA 4XD7A 2IYZA 2VF8A 4B2IA 3WMGA 1NY6A 3IGFA 3E70C 1GL6A 4TL9A 4DWJA 5LB4A 5KO2A 4UNNA 2X1VA 2WKPA 3LXXA 4KFRA 2JLSA 1IY2A 3BK7A 3CPJB 4DCNA 4WZAE 5JWRA 4IDPA 4AKEA 2RGNC 4DSOA 4ON9A 1II8B 1OSNA 1BOFA 2FFAA 2ZR7A 3FB4A 2I3BA 4MUBA 4LUCA 4A0HA 4EUNA 1VTKA 2IYRA 3FOZA 3KJHA 4W9MC 2ZSDA 3SDZA 3QKSB 3AF0A 1Z0FA 1UKEA 2ZEJA 3CUEF 3THWA 2WM9B 5DIFA 1P2UA 3FTQA 2C9OA 3UKDA 3UMRA 4JLVA 5IF9A 2IXFA 1KY2A 1OXVA 4KI0A 4LWZA 1Z63A 1E4VA 1G8YA 1WQ1R 3U2QA 2V4ZA 3SJZA 2HT6A 5SZKB 4AIIA 2J3EA 3BC1A 4QG7A 1FZQA 4NYMR 1SZPA 3GQBA 4C4PA 4ESHA 2CL7X 4R71A 3KZ1E 2YWGA 2ZR0A 1D5CA 2V6IA 2VSOA 1V5WA 4Q66C 1G41A 1NI3A 4DCVA 2IUSA 1F60A 2N42A 2D4HA 4MH0R 3ZDQA 1PV4A 1QF9A 3R7WB 4PZYA 2IYQA 5KDLA 4YXWD 5AJYA 1NN1A 4MUAA 1TL7C 4Q4HB 2VEDA 1LF5A 1AJEA 1FP6A 3EIHA 3RDPA 1AN0A 2J7PD 1B0UA 4MA4A 1S2MA 2QZ4A 3A4MA 2D2FA 2O0JA 2VPPA 3AKDA 2B6HA 3Q9LA 1Z6AA 3CF0A 4B3BA 1RW4A 2X19A 3CRW1 2QMUA 2GK6A 1T6NA 2EYQA 1IN7A 1E4YA 4PQFA 3GLHB 4JLBA 3I1FA 1G8PA 4JLKA 2I1VB 3DHWC 2DFNA 2B7CA 4Q7JB 2XXAB 2O8CB 3R9XA 4UXJA 3W6PA 2FWRA 2GESA 3RWMB 4HUTA 5JECA 1SVSA 1S4QA 4D0NA 4FINA 721PA 5FPSA 4XH9B 4NYJQ 2ZUBA 4IKEA 3EWSA 4QBGB 3VTKA 1AZSC 1Z47A 2GCOA 1DELA 2BM1A 1MV5A 2WIBA 3HJNA 1JAIA 3LBIA 1N6NA 5KSOA 1XEFA 4US2R 1NG1A 1JEEA 5DH9A 1FOEB 3HWSA 2XAUA 4L4UA 3C14C 4FI3C 2IYVA 2P5TB 2BMJA 2R6GA 3H84A 2LCFA 1YE8A 2JEOA 4RFSA 1RRPA 2BMDA 1I2DA 2RGAA 1ZAKA 3QXCA 5G3ZA 3TGPA 2ORIA 3CBQA 2YWFA 3DM9B 1QVAA 3FKSD 1BYIA 1KSFX 4PPQA 2VIIA 1TEXA 4KYIB 1IN6A 2XZLA 1FQKA 4NHOA 4XTCS 3MUFA 1HA3A 2GZAA 1E99A 1YZLA 4OL0A 2N46A 1D9XA 1DTSA 2ODEA 5CDFA 1G3MA 2RB4A 2Q0HA 4HAZA 5EZ6B 1XXHE 5L8VA 1W49A 3MWJA 5A5GA 1CEEA 1Z22A 4QFMA 3VR3A 2XEXA 3G5UA 5GADl 4Q4LA 4Q9HA 2BM0A 3WYGA 4K81B 4PAOA 3IPXA 3U4QB 1KGDA 2YC2C 2F9MA 4M22A 2KE5A 1S9HA 2P6UA 4KO8A 2ZI6A 4OI4A 4A8JC 1UEJA 2JLZA 4IVPA 4WOPA 1X1RA 5E4FA 4JT4A 5FUXA 2C8VA 4EJSC 3K0FA 3U3MA 1E79D 3A1SA 4GBMA 5KSYA 4C0AC 1E2FA 4LHVA 5DE3A 1L8QA 4CEIB 2FPMA 3PEUA 5D3MB 2AL7A 3NG1A 2J0UB 2QQEA 3BRWD 3KKPA 4IOMA 1JPNA 2ZRAA 2JLQA 3TJZA 4UXIA 5HPYB 3C5HA 1GZSA 4TMZA 2NPFA 3UANA 4AG6A 3C7KA 1XMVA 1TUIA 4PZZA 1CTQA 4A6XA 4BECA 5IK2A 2H7VA 5KNBA 2BEJA 5SZJA 5GVRA 4Q21A 3I3SR 4PR0A 3QOFA 4NYIQ 1VHTA 1SKYB 4UNQA 5CYPA 4BFZA 4BRWA 4B75A 4LBYA 4ZCIA 1JAHA 2PCLA 1UKZA 2NTYC 2KWIA 3CLVA 2EFHB 2ZE8A 3SS8A 5CK4A 4DSUA 3CH4B 2CHVA 3TVTA 1YQTA 1XP8A 1H8HD 1Z08A 2HYDA 3ZYCA 2MSEB 1KI6A 1QHXA 1U94A 4IOJA 1NMXA 5JLJA 4OQXA 3AKYA 4TYQA 4S35A 1DARA 2Z83A 2CLDX 3NVAA 2NZ8A 4PC7A 2NO7A 3AP1A 1ZCBA 5DSZA 3BB1A 2I1QA 1P60A 1ZU5A 1WA5A 3KQLA 5HE8A 1F5NA 2IF2A 4QHSA 2A5FA 4PSKA 2BCJQ 2ZRJA 2ZI3A 4A8JB 2VHTA 1ZINA 2GF0A 4EJSB 2HYIC 3WMFA 3WMEA 1FPMA 1W5SA 3ZQ6A 3ZGXA 1Z28A 2WWIA 2L0XA 1G64A 3B1XA 4MRSA 2JIZD 1RC8A 2JLYA 1NL3A 2IYXA 4LJ6A 1Y3AA 1F2TA 1XBTA 2JDIA 4IRUB 3LBHA 3KKNA 4RKEA 3B1WA 3NBZC 4M9QA 1OB2A 4LJ7A 2ZYWX 1JJ7A 1BMFA 3CR8A 1P4SA 3RC3A 2NPIA 1Z0IA 2ZRDA 1N0UA 1NRJB 1OW3B 3CX8A 1NMYA 3GEEA 3ND8A 3FPAA 4JVLA 1COWA 4Z51A 1S3SA 4QXAA 4DHEA 3Q72A 4LBVA 1AGPA 1S0UA 5BYKA 3NDPA 4NPHA 4YMSA 3RC8A 1QHSA 2PZGA 1GITA 1I2MA 2XOKD 1N6OA 3MSXA 1ZJ6A 4F4JA 4I99A 2OCAA 2ZRCA 1GIAA 4QGHA 4TZ0A 3LW7A 3GD7A 5C46F 2H16A 3AVYA 2YZ2A 2YNMA 2VSXA 3F3YA 1IY0A 1II0A 1L4YA 2GWHA 4IFBA 1E2DA 4E09A 1JI0A 2QAJA 1YR8A 2FNAA 3VKHA 4EPTA 2RGXA 1RJ9B 4Z8YA 4DJTA 1OH8A 3AQ4A 3THXA 1T3SA 2FGJA 2DPXA 4QKQA 3N5CA 2VSFA 1ZU4A 3SR0A 1DEKA 3PV0A 4MRPA 3T15A 3QPWA 1J7KA 2PMKA 3Q3JB 2DFTA 5EZ5A 2GAOA 3KJIA 2QGNA 1A2BA 1P5ZB 2ZREA 4LI0A 4DCSA 2GJAA 2PZFA 1E94E 3EIQA 1VYVA 4Q1EA 4KBGA 3QPVA 3RNLA 4GI7A 1E9BA 2ZANA 4XIGS 4B3XA 1HQCA 3EX7C 2F55A 5H8WA 4QGAA 5FTKA 3B7GA 4F7WA 5CK5A 1P9WA 5DYIA 4B3CA 1X6VA 2X77A 4RFSB 1NSFA 1UKYA 4JLMA 4URWR 4RD0A 3OFNA 1EK0A
chains in the Genus database with same CATH superfamily
1ZUNA 3OKFA 2DG2A 3DUFB 3DZHA 3ELYA 2CFCA 5IH3A 1H8EA 3ZVMA 3G6KA 3ZZTA 1K8YB 3PX7A 2JANA 3L05A 1JECA 1K7EB 1UPTA 3U7RA 1I5OA 1RCFA 2JI6A 4A3SA 3M6FA 1P5FA 4ZT4A 2VTDA 2L2QA 1OXXK 3DT9A 3ONVA 1YKFA 3D64A 5ALRA 3OFSA 2FSIA 1JBQA 1QAQA 1VE5A 2GRJA 4M9ZA 8OHMA 5E2IA 2JS7A 2GN6A 2R8EA 1I7SB 1RXUA 5DTMA 4IQ0A 5SYNA 2DAPA 4JSTA 4DZZA 4Y6QA 1C14A 3UC5A 2CE2X 1SBQA 1VZ3A 3ELBA 3SJCA 2WYUA 4FBMA 1L7AA 3UOWA 1OXTA 4JIGA 5L40A 2GCEA 3WNQA 3N5KA 3BILA 4CCAA 3LRTA 5ERYA 2GEDA 2TRSB 5DULA 1HQKA 1T9ZA 5FTLA 4OUKX 2MYTA 3CB2A 1DLJA 3H1FA 4UREA 1JVNA 1WY7A 1O6ZA 2J4FA 1E1DA 4YAEA 3QXGA 5F52A 5H5JA 1F6BA 4AZWA 1KP3A 1T24A 4WBNF 1DAPA 1VZ2A 2Z1NA 2CLHB 2P1ZA 3IT2A 2FWBA 3AUAA 4ALMA 4J0QA 3T99A 4CDRA 1E3WA 1B2LA 1SQSA 2NO9A 4H6VA 1JNYA 2IPXA 3W4KA 4BB9A 4YDQA 2CDNA 1PBTA 1ADGA 1OTHA 1E8DA 1IN4A 5DRTA 2JAHA 4GPZA 1E2MA 1XTQA 2NM0A 4IICA 4LYEA 3PUVA 4TUYA 5CM9C 2Q0XA 5LSAA 1NX9A 5J2UF 2Z43A 2O2IA 1EFVA 3LQ2A 4XLTA 2JI4A 2J6IA 3ZD6A 1E60A 3JSXA 2PUBA 1WDLA 2ZS8A 2A1UA 4D44A 2Q27A 3N53A 4NJOA 1MLDA 3AF2A 3NGMA 1ESEA 2ODPA 3SHWA 4F4FA 1Z6TA 4MLDA 5CXUA 1KMHB 2O1XA 3HXTA 4FYVA 4DDTA 5DGCA 3CH6A 3MWYW 4BFSA 3S1SA 1YMUA 3IAHA 1ZP6A 2BR3A 1DMSA 3M3HA 4CEJA 1KDOA 2I22A 3EF3A 1L4HA 2Y66A 4HEJA 3BYZA 5GONB 5T7BA 4PO3X 2VJMB 1IXZA 1WMSA 2YNMC 3NNSA 4GMFA 1ELOA 2QVBA 1DQZA 1N0WA 3CXUA 3DBLB 2P9ZA 3QEJA 2I03A 4LOHA 1EE9A 4MW7A 3EWIA 3QBJA 3IC5A 2NO6A 2QVYX 3CRQA 4GOMD 4ZI3A 4XVRA 5EXTA 3E1SA 5BQOA 4HUTA 1BCSA 4DVGA 4FQ7A 4EO9A 1BX0A 4FXPA 3L43A 4ZARA 5LQJA 4QDXA 4DV0B 4MGIR 3L2OB 2ZWOA 2PJUA 3B3GA 4NBKA 4RTSA 2WJ6A 3PNBA 5EAIA 2C8JA 2N1MA 2A0XA 2PKQO 4WDQA 3LZDA 4M7OA 3VYWA 1DC4A 1XMSA 4LZLA 4BDSA 3IKTA 3BFPA 1KH3A 1ZHHA 4JMPA 3LQYA 2DH6A 5FUMA 1EHCA 4XOUA 1YULA 3BSWA 1K4YA 4ARSA 2O0MA 4NF2A 1D2MA 4PANA 2VWPA 3KKEA 4R2IA 4WZZA 2ZYUX 4UM9D 1RQXA 1CQPA 5LOVB 4B6OA 2YRWA 4UHBA 5EWLB 1SXJE 2VPXA 4QG3A 3HWRA 5IKMA 2CLKB 2HV9A 5K0GA 3FB1A 1ULTA 4JOQA 4RZHA 2IZ6A 1B41A 3KB1A 5F78A 3UG6A 4EKYA 3K0AB 3L6EA 4K9OA 5KQPA 4Z3OA 1T8PA 1Y0BA 1GAWA 2QG6A 4QPJC 1M7GA 3KJFA 3QEKA 4EMUA 3BXEA 1QGOA 1RFLA 3GCDA 4HL6A 5FPHA 4DF3A 3QA3E 4XJTA 1EUDB 4Y9TA 3AT1A 3HO1A 2REQB 1SIOA 3ND6A 5J40A 1XRQA 4A5OA 1FSPA 2I8LA 3LY5A 2C07A 3L8CA 3EXFA 2I99A 2M6SA 2WA2A 5DISB 5GJCA 3VSEA 4TKVA 2IDZA 4XD7D 5DXFA 2K2WA 1QIIA 2VI5A 4DAEA 4L9WA 1O08A 3V8PA 2QUJA 3W3AA 1VYUA 3WWZA 1J8QA 1VXRA 2G09A 2RG1A 2VFAA 2Y77A 2BFNA 2HOQA 4L85A 5HF9A 4ZREA 2D7CA 1ZITA 2CZQA 2R8RA 4NP6A 4EJ0A 4EUSA 3C45A 3COWA 1EGVB 4HC4A 1FDOA 5TF0A 3L41A 3LNCA 2ZVPX 2DQSA 3DKVA 3PNPA 3TZ6A 3UKJA 2AA3A 5EESA 1RC0A 1SD2A 3HUUA 1MB9A 2MSWA 1V3TA 1C30A 2Z4TA 2QL5A 2QM0A 4K9KA 2QRZA 4LOJA 3UWOA 2C20A 621PA 4GPEA 4QQFA 4XGQA 3QEBZ 4CLOA 4QM6A 2MMGA 4A2QA 1GRQA 2I2XB 3KB6A 2PAAA 3AF5A 3Q8XB 3WWYA 1J07A 1YZTA 2PV7A 5BW6B 1E9EA 5DBGA 2H4HA 3A31A 3KDPA 2C1XA 3AILA 3H1TA 5HJ7A 5JAPA 4G5OA 3A1FA 4HUQA 1CNEA 4LCJA 5SZHB 3I09A 5DEIA 1IN5A 5EJIA 1DL5A 1OMOA 1N2OA 2OCXA 3U17A 1UBGA 4YS6A 3SFTA 4CJXA 2DTXA 1GPBA 2GNPA 3IAFA 4RMHA 4JZKA 3ZDFA 3DAYA 5TRTA 2I1WA 1GZ4A 1FFDA 4PFKA 4BO5A 4DIUA 4QM7A 2BYTA 4D2IA 2GARA 3EGDA 4BQFA 2ZZNA 1YBHA 1XNJA 4M83A 1SA0B 1NR1A 3EG9A 4JB3A 4HDMA 2NUAB 3ZWNA 5ADUS 2GZSA 1IQPA 3D8HA 3IERA 4CF7A 1KDRA 1TA0A 3AF3A 3TW8B 5KWJA 2XDYA 4PFJA 4YQEA 1DV2A 4MVYA 2H2HA 3LO5A 3QJGA 3MJVA 3C6MA 1S02A 2BFCA 3B60A 1VCOA 3O8NA 6Q21A 1QB8A 3RVNA 4E7PA 1QRTA 4X8MA 2G1KA 2C2BA 4A7PA 5A2GA 2FA9A 2R96A 3I4CA 3ITKA 4F4IA 4OCZA 1YJCA 2H2GA 4B0OA 4YXWD 1EESA 1PJCA 5A3SA 3W2IA 3TL6A 3CEHA 1GFIA 2YHAA 1JHVA 3MLBA 3O90A 3B2EA 3SY8A 4DNXA 5IVPA 3GLFA 1EWVA 1N2GA 4YECA 1DBQA 3F5QA 3JWHA 5FD8A 5EZYA 5ALEA 3TLBA 2RH8A 2P79A 3BWBA 3LP8A 3S55A 2XCIA 3SIXA 4WBNB 2D8AA 2CT8A 4LC1A 1R50A 2WU8A 2C5AA 1IHYA 1NF8A 2AFVA 3QELA 4FZ3A 1XO1A 3GGDA 2R86A 3S2GA 1KI2A 2WZDA 3WI7A 2C88A 3KR2A 3FVQA 4OB8A 3HO6A 4EZEA 2IUFA 3QQ5A 5J2UB 3AKZA 1A7AA 2HXGA 1YJ5A 3NMUF 1BXGA 3HRIA 3T94A 5ECWA 1SHTX 4XQ0A 3SKYA 1KZHA 3EPKA 1TIKA 4GOXA 1QDUA 2B6NA 2QRGA 4OJNA 4TSKA 1BTOA 2Q8NA 5FCDA 2DCUA 2FYTA 2P2CA 1F2VA 2QP9X 1MG0A 1ZNZA 2C00A 3P2YA 5IKPA 1J9EA 1T6BY 4U5QA 1JYFA 5HKKA 1FC0A 1J00A 3TNJA 1MW9X 1BO6A 3G1UA 1MP0A 1XD8A 3DDNA 4TS9A 3GPIA 3WMRA 3ZNNA 5KJ6A 2FKNA 4YRDA 3PFBA 2AJLI 3CW8X 3EVEA 2F1OA 3I73A 5GZ1A 3PJRA 4EDHA 1JHXA 1OREA 1AK2A 3ENQA 5AKHA 3WLQA 1EWTA 1XZDA 2EGGA 3P97A 3UQYS 1F17A 5HRUA 4BMSA 3PQ8A 1GZDA 1ESCA 4YIKA 5GWXA 1WSDA 2UZ4A 4DTIA 2A0UA 4E5KA 2PQMA 4F4HA 1TVKB 2PR7A 1L8XA 1MB0A 4CF4A 2XCRB 3TDNA 4P81A 3IP5A 4JA0A 3ZKWB 1WEHA 3CRRA 1PG2A 4ER7A 2KS6A 4X3OA 1LBQA 4X20B 4LJ9A 5DI9A 4BCCA 4G5GA 4NCBA 1FJXA 5JS7A 1Y80A 2IZ0A 4F2PA 1PU2A 1Y5MA 3PNQA 3RTCA 2V45A 2SKDA 3C8UA 5AWFC 3AUUA 4XWTA 3NOVA 5E0OA 4Z0PA 4F3YA 1NXSA 1ZY2A 4L78A 1KJJA 2Q8QA 1V8PA 2HH9A 1GNQA 2JJQA 3MGAA 3HDYA 5D5PA 4KC0A 4AO8A 4B43A 2E85A 1ZUIA 1OLUA 4YJHB 5LZ9A 1RP1A 3AQIA 2PUFA 4L76A 4POAA 2IHKA 4NJEA 4JXJA 2LCIA 2WUFA 1SQ5A 3OZGA 4L1KA 3AW8A 4GC5A 1WW2A 4ZCQA 1EG2A 2VCYA 3EZLA 2GPBA 1C9DB 4TV8F 2X7HA 3UJDA 4WKCA 3GVIA 3UATA 5CXXA 1FDSA 1L7PA 3I2JA 4PCAA 4F4CA 4AB1A 1OVGA 1FVHA 2DKFA 2EW2A 2XBUA 3KDSE 4N0EA 2AXPA 3AJEA 2QZSA 1SOWA 1UKBA 3K9NA 4NZNA 4GZMA 3KYCA 3U3OA 2IGTA 1O57A 2ZUUA 1ECGA 4BFCA 1QP4A 4WVLA 4HO1X 3CPSA 1ZMTA 1Z9BA 1KEEA 1G8AA 3QKTA 3CRVA 4IZIA 4KPGA 4KR0A 1EIZA 4J0FA 1KSGA 2VWHA 1PWZA 3BFJA 3G2MA 1JXMA 2I6GA 4BNGA 3RD5A 1E2NA 4DXDA 4ZVRA 3ZU3A 5AKXA 4YMVA 1L5VA 1PGPA 1HURA 3FPBA 4GMKA 4H4DA 3SYNA 4CMJA 1S1MA 3BWCA 2IPAB 2JCVA 2FK8A 2AHRA 3BXXA 3IPAA 4KQIA 3KEGA 4Q6BA 3ZCUA 1GNVA 5C7YA 1G20E 3BMCA 2GN1A 2IPNA 2A9QA 1ZIDA 2WWVD 2RFLA 4G36A 4P0PB 1PFGA 4YMTA 5JSUA 3GP5A 4QPCA 2BI7A 5TQJA 5D84A 1BHSA 3HZOA 2JRCA 2PKQP 4RZ2A 2DFVA 3I9NA 2PLNA 1KYTA 4YRGA 3OPYI 4DMCA 4JSYA 5B3JC 4M8KA 5FWYB 2WTMA 3S2ZA 2HTEA 1SHZA 4P53A 3WBBA 3SYTA 4P35A 4WOKA 1Q14A 1YUMA 2GBLA 1V39A 3PHIA 2NYAA 2X4LA 2XW6A 3LQRA 3DD5A 1U6IA 3AJDA 4JY7A 2OV4A 4S1WA 4XUEA 1ZD3A 2FPXA 3GXBA 1RBZA 1RKQA 2E18A 4X66B 3U44B 2VRBA 4GGPA 3X3HA 3NDBB 2CVHA 3IAM6 3ZEIA 3SEAA 2AJTA 1IZ9A 3FY4A 1VLVA 1E3SA 3O1JC 4X6XA 4XR4A 5DGHA 3LUPA 5C32A 1A9QA 4L0DA 4BPRA 1RQPA 5BNIA 1JU4A 1FDTA 4YPOA 4QNMA 1EVIA 2DFLA 2FPLA 2JDID 1QBKC 4R9VA 1SBZA 4YEDA 3DDCA 4ZVNA 5HZMA 3ZVNA 2IUEA 2VDWB 1Q7EA 4MRMB 2ZRPA 4MS1B 4H4CA 3WNCA 1OBCA 2X14A 2QVCA 1ZJJA 2O8VA 1TKBA 3K0EA 3LDAA 3VPGA 2Y71A 1Q83A 2ZTSA 2J6HA 1ZSNA 1N6RA 4MV4A 1N6KA 3EVTA 1WVIA 1IHUA 4MPTA 1KJYA 2NU7B 4LZWA 1Z13A 1L7RA 5EWJA 4AF6A 1J5EB 4GPBA 3NBMA 3HSKA 2Q5FA 5JPDA 4AMGA 1V7PC 3F6PA 4D9GA 2XE6A 2VSYA 3LH5A 5DI3A 1I01A 5IAJA 2IV7A 1V1RA 2P3SA 5T57A 5CDYA 4LZZA 4B81A 2I91A 1XTKA 1EFRA 3FPGA 2Z08A 4WASA 2I29A 1GZ5A 4YO7A 1GCAA 3TWOA 4OM8A 4A16A 1XSEA 2AOXA 3TH5A 3VU1A 4G0UA 1XNGA 5JCJA 1SCAA 2VZ9A 4FB5A 3WLAA 4BMPB 1E7MA 2IZZA 3B48A 1XZAA 3O8OB 3QVWA 2JH3A 2X5JO 3CT6A 4YAGA 1YA8A 3L7DA 4MV5A 3LOUA 1NYLA 3LT5A 2PK3A 1DG3A 1E1KA 1LDMA 2ZIFA 3AWIA 4IHQA 3V1YA 4DC9A 1Z39A 3PX2A 4BVGA 1F1JA 4P08A 2I87A 4Q37A 4F2DA 1Q0SA 1YB2A 1ISJA 1P2BA 2W98A 2QPAA 4K9QA 3SU8A 1BMQA 3U26A 3WGQA 3KKOA 4D0SA 8GPBA 4KAXA 4FFPA 2OHGA 2GB4A 2PHZA 1EAMA 3FZNA 3ECCA 1EP3B 3BKWA 2QI9F 4LYFA 1XZIA 4YY3B 1SQ6A 3D8TA 1YI1A 4I8IA 3TLGB 1J5PA 2UZ1A 1H1TA 4EY5A 1NJFA 1U80A 4M0DA 3FSJX 3EG5A 2E6UX 4H6PA 2B1RA 1VYTA 2OTCA 4WIAA 1G3UA 2YXNA 3HN2A 2FSVA 4MW6A 3WJ1A 1QGUA 4RO0A 1B0ZA 5AVWA 3FVVA 1T2CA 4O4LF 1NJGA 3SC2A 2IS6A 3KUXA 2BGLA 1YZFA 2FSSA 1TCAA 1FFEA 1DADA 4W5HA 5K8JB 1D2NA 1OI3A 4J2TA 4OSEA 3WLJA 2WW8A 4X00A 5BW8A 3F1LA 3HB5X 1X74A 5KUTA 3RYCA 4XB6B 4NSNA 4G0VA 3JTEA 1TVMA 3TQOA 3S8EA 3L18A 1RYNA 4MV3A 2O8DB 2QX6A 3AERB 3RBZA 5L4NA 3HRKA 4M99A 1DJOA 1RWBA 3IHTA 5CIWA 4F8JA 4QGSA 3RAEC 1EK5A 3EEOA 3EEFA 3JQ9C 1R15A 1SUWA 2VJQA 2GDZA 2WEKA 3MJTA 4OMCA 5EGSA 3R8FA 1Q0PA 3EOBI 3VNAA 2BGKA 2WSSD 1M10A 1J0DA 4FPXA 4KU4A 2XZTA 5DNEA 5BSTA 4F85A 2HMAA 3Q7EA 5LXTF 2F8TA 4NH0A 5K8LA 3FWZA 3VR6H 3GMSA 2B21A 3N2EA 4G23A 4UXHA 1ZUWA 5B36A 1QJCA 4L5BA 2IHVA 4RJIA 1L5FA 1AQLA 2RB5A 1CUVA 2C0CA 2AN5A 3O95A 1Z68A 3OVMA 4LHWA 3ZWXA 3R41A 3FA2A 1TF2A 1PF7E 2I67A 2A5JA 4ZI7F 2CE7A 1Y5LA 2NZWA 3DYVA 3E5HA 1J8MF 1ORDA 1HXHA 1WZCA 2CVZA 2FPIA 2VF2A 3C4QA 2Z6AA 1JWBB 1FSGA 2VDMB 3HB7A 3ORHA 3UMYA 1QHEA 3CNHA 1U3DA 5DPMA 3O2NA 4IH9A 5FI3A 4AIRA 1DEAA 4GICA 4NYIR 3VZQA 4KXXA 3TQFA 3N28A 4G3XA 4RAOA 4AZVA 4TRMA 4TSFD 5FBQB 1WPRA 1N0VC 2WUDA 1T1JA 1YJQA 3GFRA 5FOTA 4NZPA 4RM3A 2G8LA 3D6MA 4TV8B 1IAQA 1HMYA 4ZOEA 3U13A 4B34A 1I1QB 1A88A 1CS0B 2CF5A 4KSCA 2QRJA 2H1VA 4HX5A 3SJZA 3THWB 1H42A 1QE0A 3I04A 1M6EX 1YVPA 2QW8A 3H8SA 4G67A 5EIEA 4RDHA 4MLCA 4FEAA 3S27A 2WU4A 3T7CA 5C1PA 4QSHA 5I8WA 3RH0A 1HO3A 5KTNA 4RTRA 3E53A 2PZLA 1KC3A 2GPYA 3GLGA 1LVHA 1RAAA 3KXLA 3DZFA 1C7JA 4NU6A 3TTWA 3MSCA 1OKKA 4FE3A 4BGIA 3B53X 4LWQA 9LDBA 4MRNA 3I2GA 2JBAA 3WGJA 1O96B 5A6SA 3GQBB 4JS0A 3NAMA 3CCFA 5D3QA 5DN6A 3PHCA 2HCRA 1N5RA 3PC8C 4I4CA 3K70B 1NNI1 1N92A 1C9YA 3VV2A 4R8MA 3F5MA 4ZYVA 4X7BA 4S24A 2FEAA 3IVAA 1NXXA 4FEEA 1NN5A 4GAEA 4U6QA 2ES4A 3QUSA 3I39X 2QSZA 2QMYA 2PYDA 3EA5A 3Q7PA 5EJ6A 3ULKA 1XF9A 1JG6A 1O2DA 4FHGA 4MO2A 4ZHSA 1SVNA 4KRYA 5AUOB 4AY2A 3TR0A 1UMCB 1A5SB 5A9SA 2GPTA 4LHZA 3KZOA 2P4QA 4MR8A 3RU2A 2A5DA 3ADCA 3LPDA 3ZY2A 4OUDA 2FV8A 4FD2A 4RPLA 1W5FA 4YUAA 4EW2A 1K3TA 3S5UA 2YMQA 4GSYA 2CCGA 1NNSA 4NU8X 4DCPA 1XD2B 3OBBA 5HBRA 4DY4A 1EHIA 2NXCA 4M1KA 2FDXA 3LT0A 4P3KA 3KPVA 1K0FA 1ML3A 2QN8A 4Q18A 3WC4A 4BWFB 1XKQA 1D6NA 1RM4A 2MYUA 2XTZA 1AZTA 3QV2A 1Y8AA 3DAGA 4U7TB 1E1MA 1NUSA 1P72A 5EHQA 4C2TA 1KRXA 4BQSA 1XDWA 3QE3A 2GXAA 3M6WA 2VT3A 3V1TC 4CM9A 3E61A 1A9TA 1MB3A 4DCTA 3CR3C 3LHSA 3AH8A 4G1UC 4AJLA 3RS9A 4K6CA 4YBRA 1X80A 4PC1A 4W63A 2ZETA 1FX0A 4R8VA 1G19A 3GGPA 3OF5A 3S7TA 1N8SA 3D43A 1PK7A 4LDJA 3V4OA 5IWAB 2KB0A 1O94D 2UAGA 5LJIA 4WY5A 1H94A 2ANBA 1SWWA 1XQXA 3M9XA 3CC8A 1H93A 3VFDA 4D43A 2Z4RA 3S7ZA 1TEVA 3UTDA 2DWPA 4TWBA 2QE7D 2ZG6A 1QKKA 5ADWA 2LCQA 3H5IA 4MB6A 4WESB 3ZV6A 1JFLA 1GTG1 2H4JA 4PLGA 4QUGA 2WFMA 4CNQA 4ZT5A 4FWTA 3VDXA 1ID8A 3DEFA 1RXCA 4PLVA 1LS1A 1A76A 4R1OA 4AX4A 4PZDA 4U4AA 5IWCA 3K9BA 5HBGA 3CGGA 3M0EA 4BVBA 1ISRA 3P0EA 4RF3A 1NSYA 5FPKA 4O59O 1SQFA 4P32A 1U0TA 1E58A 1G5PA 3IIEA 3LK6A 5DP1A 4V02A 2P11A 1RI1A 2SBTA 1DVRA 2WMOB 3QKRA 5BSMA 3D7LA 4X65B 2GBGA 2YCLA 3RE1A 4PONA 4DSNA 4A0SA 3I5MA 1CCWA 1E3TA 1VCIA 2BMEA 1CZNA 2VKTA 2HI0A 3AYXB 1MVNA 3L8GA 4M21A 2JGAA 3ZU5A 4DLVA 5IJ9A 2A3NA 3KK0A 1U2DA 1GG2A 2A4MA 4ZQBA 3WRYA 4LXGA 3OCCA 1O58A 3FCUB 3ETLA 2ONJA 4D9FA 2HQSA 3A2NA 3M6LA 4XM2A 3E22A 1RKXA 2X0IA 2X9NA 3OSZA 3PA8A 4GO1A 1BX3A 5FA8A 3IEXA 5GAJA 1ZM4A 4BMVA 2H9AA 4ETIA 3WGZA 3DYBA 3MFYA 3Q87B 4G26A 3HWX1 5DM0A 1K7SN 2YQ4A 5I47A 2P4HX 4FQ5A 1NTRA 5I6DA 3PQ4A 4JT2A 1DC6A 1FS5A 1IBCA 3D0RA 4IFEA 4O4LB 4D1YA 5HS6A 1KYYA 2FFJA 2BFBB 1CDDA 1JQ5A 1QSGA 1YQWA 1YIDA 3DE4X 3O82A 5K2MA 4EDFA 5B57C 5JJKA 1NJ1A 3HA2A 4E6EA 3LX6A 4MR9B 4JUDX 3PEVA 3PD1A 1B14A 1U4NA 2G67A 2ZJYA 3K30A 2PT6A 1E1RA 3SLRA 1GZVA 2KHZA 1Y9ZA 2GXSA 1QVZA 1X38A 1H1LA 1FNNA 5K9ZA 1E98A 1J25A 3EC2A 1MH9A 5ARCA 1GD1O 2LP4Y 5DCLA 3K09A 5KTKA 1ZCFA 2JFZA 1UWKA 2KLHA 5C5CA 2QLJA 3PGXA 1CJCA 1R10A 1V5FA 2OP1A 3Q5DA 2FSHA 1XAGA 1XJWA 3PJGA 4BNUA 4Y0NA 3ACBA 5EPUA 3ZEAA 1Y63A 1XZBA 5E3JA 5THXA 5HRAA 3SG0A 3UWDA 5LXTB 3MHTA 3G0OA 2VPTA 3A1VA 3ID6C 4GI3A 2CUKA 3N2ZB 3REFA 4FILA 3GJ5A 4BV2A 4O2BF 4TLMB 3G89A 3OQNA 1OAKA 2JJ2A 5HQJA 2DU8A 4PX9A 4BNFA 2V0CA 5JCZA 3NW9A 1DT3A 4M0LA 1SVOA 4C0XA 3CE9A 2NU8A 3TD2A 1M34B 1YRQA 4ZI7B 1RVDA 1VG8A 1KMCA 4U8HA 3L0SA 5ILOA 2P90A 3TRJA 2GPSA 2EX0A 2ZSJA 1AG9A 3V1MA 1Q3KA 1VCHA 3SM3A 2EIHA 4HNGA 4BP3A 1KZ7B 2NNLD 2DFDA 6REQA 4EB3A 2D5BA 4YV7A 2KX7A 1NASA 1RE1A 3IA2A 1E6KA 1E7QA 3PXEA 3FCAA 1NXOA 2R6ZA 1IZ7A 2A0WA 4I1SA 2TMKA 1E5VA 4J1SA 3H9UA 3U7IA 2BKEA 2HU7A 3GFQA 3FRHA 1O3YA 4MVJP 5EXSA 2OC9A 3OTOB 1AMOA 3IFSA 2GHTA 3PF9A 2JGNA 3GF4A 2ON6A 3AVQA 1ESDA 4X94A 1YCHA 3Q0EA 5BQ3A 1E3JA 3VMFA 4HSGA 4UNPA 5F98A 2XMBA 2ZATA 3MTGA 3OEWA 5SYAA 1Z56C 3WGNA 4E08A 5IEJA 1WS6A 2B8EA 1EX9A 1ZCZA 3LVQE 3E03A 4QOIA 5A03A 5TQ2B 2P8SA 1TYEB 1UPBA 5ULLA 4NE2A 4CFSA 1I6LA 4YRPA 1TK2A 4J2OA 4CMIB 5JJIA 3KUDA 2RG7A 2B7BA 3OZCA 5NLLA 4XYGA 6LDHA 2VTBB 1F2TB 4OFZA 2E5LB 2I34A 5EIAA 1V41E 2W8BB 2I6SA 5B4TA 1EG7A 1L5QA 3I01A 1Z0UA 4NZ9A 1WXGA 5IX8A 1I3CA 3NIDB 4Q3DA 1MPXA 2Z4SA 4BO1A 2YJ3A 3M4JA 2PU5A 3IB3A 4M54A 3THRA 4ENUA 4CVNA 4YMUA 4WZAB 1DGQA 5KDDA 4N5HX 4IDDA 1X7YB 3LBYA 3L7NA 5KPDA 2YQ5A 3N2NA 4NFYA 2DH5A 3OMLA 2AD1A 2XRYA 1M1ZA 1ZM2A 1N2HA 2OZPA 3QBEA 1TJYA 4URFA 3KBOA 2IZ7A 3AJRA 2SKCA 4CODB 4DE5A 2VRCD 2PH5A 4H1HA 4REQA 1GFZA 2BBSA 2Q8PA 4KQ1A 1U1GA 4IJ6A 4LSGA 4NVRA 1N2BA 1IY9A 3GARA 5FNZA 3NH9A 4TN1A 2XKAA 2W0MA 1SBNE 3FLMA 4NNOA 4B2LA 1Z4OA 1NQXA 2PBLA 1RYFA 4YMIA 3HR7A 1ZX1A 2JZNA 1VL0A 5JXHA 1LXCA 3CVWA 2HU8A 3DT6A 4AZ3B 3AL2A 1ATZA 2FGKA 3R5XA 3OIGA 5JSQA 4H27A 3QEMA 2PX3A 3LS2A 5JQWA 2WJJA 4KLCA 3GXOA 5M7EA 2ACEA 2ZUCA 2FZKA 1HDEA 2XLBA 4HS4A 2AR0A 1A9PA 1PT6A 2EFGA 1SB8A 5HF6A 2ZRNA 3FVWA 4JR2A 4FYJA 1C0LA 3TRIA 4C2BA 4DM4A 3HZHA 4WNYA 2ZJ1A 1KO1A 1ZVJA 3THYB 4YN3A 2GN2A 2RAFA 3I2HA 2CYBA 3KR1A 2C77A 3QUCA 5CXQA 4NEGA 1R8SA 4G0YA 4Q12A 2YJ5A 1GADO 4HN4B 5G1PA 4D8UA 3ZW8A 2ZB3A 1WF3A 2W6JA 3S99A 4Y30A 1OFUA 1AVTA 3MK31 5IANA 2IPLA 3BN3A 3K5HA 4RJKA 3C7DB 4EHBA 3IQGX 2Z6VA 3HA5A 1Y1QA 4MR7B 4OTZA 3A3OA 4Y1EA 2OBFA 3GPBA 3OO0A 3SKVA 2VXCA 3UXEA 3CGWA 4IUBS 1RADA 1EVJA 3GFTA 1RKUA 1P2VA 2XH8A 5CMLA 2DUUA 3A6HA 4RPKA 4KOEC 4CL2A 1M6VA 2VXBA 4MW1A 3EAGA 3U60B 5FBHA 3M2TA 4B7XA 1LS6A 3RSSA 3FDJA 4DQKA 3GLHA 5H0IA 4RD3A 3VDRA 2P75A 1E2UA 5LBIA 1U0SY 1K8RA 2H1SA 1XVIA 2R00C 3ESAA 5CR9A 5KX5A 3OQ6A 3KD3A 3E9DA 1UXOA 4UNRA 4MOWA 4N5DA 4Z4GA 2VZEA 3QMPA 4TWRA 1GG8A 3IBSA 2GZMA 4CV3A 1UDCA 4PYNA 2D5IA 3HZZA 3BBLA 3VYTB 3STUA 2L82A 1X42A 1OX4A 5DOVA 3H9CA 4Q82A 3DCNA 3RAPR 1L1RA 4XWOA 2ZZMA 1E7WA 1V16B 4KZPA 2WWYA 4D4MA 3V1NA 4Y2TA 2NSYA 4OQQA 5FL7A 1M0TA 1M2NA 4PAQA 4YJ3A 4DSZA 3IIKA 2KLBA 3JPWA 1ODSA 1BJRE 3ED1A 2ARKA 2WZBA 3D5TA 2XYHA 2G63A 3PDUA 2FFQA 5BNTA 1OBOA 3AI2A 1XZNA 1HLPA 3T9BA 4DDUA 5J58A 1DFIA 5K0BA 3GC6A 3KT3A 3LUDA 3CRMA 3WWCA 2Q0SA 3ODPA 3W5CA 2CFOA 1PZFA 1S01A 1SOUA 3VPCA 3IJRA 3G85A 2D5LA 3H97A 4K26A 4O5AA 3KJXA 3P9KA 1E2JA 2V7QD 3JAKA 5DNYB 2A5YB 4QFDA 3FNHA 5HF8A 1GKUB 2JC3A 2QZJA 1VA5A 1ZWKA 2QM7A 4TMVA 1O94C 4H2DA 4RK5A 1D6SA 2Q6LA 4O2BB 5ICGA 1T1RA 2Q4RA 5DGTA 4D96A 1EDDA 4Y7DA 3X2SA 1TEZA 2QRUA 1R0BA 3H2GA 1RI4A 5JATA 1XU4A 4QTYA 2WMYA 1PWHA 1U90A 2FAXA 1NXWA 4UHFA 4D4GA 3FPLA 3OFKA 2RBKA 5BVHB 4MW0A 4C3VA 4MGKR 1NHWA 1ZBQA 5I4BA 4D80A 3DPUA 2ZYAA 4DLZA 2OQRA 3N6XA 4IRXA 3PIRA 3H9JA 4BQOA 2VS1A 4JEMA 4MYCA 1JX6A 1BIFA 3PHJA 4C3UA 4BE7B 1DAMA 5B7QA 1QYDA 4MP6A 1E3EA 3W7VA 1DKOA 1F4LA 4HH1A 1O95D 2Q28A 2VZ8A 1I4EB 3BXOA 4TWAA 5BRAA 4FJ1A 2JNWA 3NVMB 4PZUA 4RYLA 2Z2YA 1OIVA 2VC2B 3I2KA 2ZR9A 2Q4OA 1X86B 4P4SA 3AF4A 4MIOA 3X2FA 5FBVB 2HT1A 3QXSA 1N25A 4XWKA 2Q21A 1LBEA 1WXDA 4Q9NA 3QLJA 3WLIA 2NG1A 4DCGA 1QU3A 2JKYA 1S8FA 4A73A 5G3YA 1FS6A 5F2OA 1J9ZA 4CM3A 5KYXA 2HGZA 2OD2A 3V3TA 2OCYC 3UYKA 1PX2A 3L4BA 5K6RA 4QQ8A 2JD1A 5JH7F 5L95A 1V37A 4EYSA 1KDPA 3PJEA 4GR5A 1CR0A 2GPJA 3EH1A 5C8XA 3F3KA 2P69A 3MD0A 1NWHA 3A6EA 1TTQB 5BW4A 5K8IA 5IT0A 5K4HA 1TD9A 2RKOA 2II6A 4LHYA 3JQAB 3K6RA 3BXPA 3DBRA 5HJ2A 1YWGO 3G49A 4U7FA 1U99A 3QU2A 5GZ6A 4IIXA 1KNQA 5EXXA 1QPZA 4COKA 2NO4A 3FNRA 2JGKA 4B5LA 2NVWA 3W6UA 3ZHXA 4F5EA 3JQRA 2PJRA 1KO8A 2AJDA 3HU2A 1T26A 3AM3A 1LPAB 1JR6A 4G81A 5E9JA 3H1GA 1F9EA 3QU4A 2IYUA 4YWJA 4ZYTA 5BOSB 5J2TA 5COBA 5MN5A 5JARA 1NBEA 2TYSB 1NRWA 1ACJA 4ILKA 1M33A 1TTPB 4QUIA 2Z30A 4GZ3A 3B3QA 1CR6A 1TZ2A 4DVJA 1IM8A 3CNLA 3TGLA 1WQ4A 3LMKA 4ZAYA 3T9FA 5HGXA 3J7TA 4A8JA 4Y2HA 1H9AA 2VDRB 1OFHA 3RYIB 5LZ7A 4FFWA 4R2MA 4B48A 2XVZA 4EJSA 3V8RA 3G2NA 4Q9KA 1HL7A 1DNPA 1S7CA 2CLLB 3N86A 5E2BA 4MDHA 4AP6A 4DBZA 3NPMA 4RNCA 3TSOA 1X1AA 2ZXEA 3HEAA 4NU0A 1RLUA 3T3HA 1CVRA 3VUEA 3WRXC 5HUQA 4DB2A 2B7LA 4HN9A 1PR9A 3TI9A 3E2IA 5KWIA 3LKBA 2OHJA 3PD0A 4EHDA 5LA6F 3QPUA 3AESA 3IT1A 4ZKEA 2QU8A 3IRVA 4BLTA 1QH1B 4N8SA 3TRKA 4A23A 3NXSA 2IEBA 4KXFB 2AJ8A 1G7RA 3A1UA 3Q0TA 4FZRA 4R83A 2YHIA 1AS0A 2BV3A 3AGPA 3LOPA 3NDJA 5DT9A 4LQDA 3IOMA 4QO8A 2CFIA 1AKEA 2F43B 1IHDA 2ZRKA 3MT0A 4DCOA 4UNSA 2LD4A 1I32A 2OXCA 3UBTA 5DBHX 4Q6WA 3DR5A 5HTOA 2EG5A 2IW1A 1PN3A 2FH5B 4KQEA 2F90A 2Y9PB 3SVTA 4OMDA 4G5RA 1YI0A 4F04A 3TLYA 3EEBA 3ZDAA 5FB3A 2EKQA 2H4XA 3IOCA 1VYHA 5CA0B 4B40A 1MIOB 1RYEA 2MMCA 1SC4A 2AG0A 1K68A 2WI8A 5IKXA 5IBQA 3V34A 1AD2A 3MLAA 2R5FA 2V3VA 2QN7A 1GXSB 4KYTA 5K3SA 3RFFA 1QMPA 3VYRB 4BYGA 1T5DX 1U1CA 1O9HA 2AE1A 5JSKA 4UUPA 4BWGA 2H8KA 4ZCSA 5KBYA 1T4DA 5AM1A 1ZH6A 1WKBA 2QSYA 2V5UA 4RDXA 4JA2A 3WYEA 4UHKA 4WZ6A 2O5EA 3KTDA 1JRLA 2ZPAA 1GA4A 4AJJA 5L3ZA 3R24A 1GYPA 4YRMA 3LDGA 1XN1A 1K75A 1VL1A 1WCV1 2G5PA 3EODA 3FGNA 2EZ9A 3IULA 3QBTA 1I7QB 3LUJA 3H42B 5DHSA 1FUIA 1SGWA 2AE2A 2BWJA 3FMPB 2G9VA 3GAZA 2PUWA 2VHJA 4H6WA 4C06A 1EAYA 2Y0CA 1HNNA 1GT91 2A88A 3OTHA 2RIRA 3RSCA 3MWFA 1YZQA 3OE1A 3BKXA 3IXMA 3OQIB 4L3VA 5JISA 4CR6A 2YWEA 5F35A 2GZ1A 4XVCA 3GGCA 5BURA 4HZUB 1P0MA 4UZFA 3JTMA 5ALZA 4BV8A 3SWWA 3IP6A 4EI8A 1VJ5A 2HJHA 4O3FA 3UPUA 3AIOA 2WR8A 4KQ9A 1E0KA 2CFRA 2AB0A 1XDGA 4NV3A 1GP2A 4PVDA 5G4KA 3EARA 4LZPA 4Q1BA 4JNKA 2XCUA 4ZVSA 2QJWA 1MVOA 3W8RA 4M7RA 3HKBB 1QC5B 5DGIA 2FFRA 3KFXA 4KQMA 1IVSA 2OCIA 4ZDIA 4D0RA 2ZB8A 4K9MA 2OZVA 3KQOA 4BAGA 3AHFA 5DK4A 1KQGA 3OZ7A 3QTLA 5FQNA 4KYUA 3W3ZB 2PBRA 2VQSA 1E8NA 1JDPA 1PG0A 3DUFA 3HCNA 4JC8A 1P7WA 4UHDA 1KVQA 3V8VA 4HHEA 4JU8A 5JHGB 4U0JA 4W9RA 2GILA 2LNDA 4L4ZA 1MHPA 1Y8QA 3F4BA 3RC2A 4PN7A 2WUEA 2PRIA 4HEQA 1GYQA 4TT8A 2AX3A 4KBFA 4Y0AA 4F93B 5AJZA 1KJWA 1N2EA 1FK8A 2GK4A 2Q5OA 3V9AA 3Q3VA 4IJWA 3FPCA 1UBHS 3ODGA 1WCIB 3D1LA 3BIWA 5C5EA 4X1YB 3WZ2A 5FV4A 2PGLA 3PI7A 4KLRA 4DY6A 2O7NA 5LWHA 2R79A 1X7XA 2CXUA 4JBIA 4MSUA 4QDUA 2YRFA 4MYHA 2CLFB