1DBSA

Mechanistic implications and family relationships from the structure of dethiobiotin synthetase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic implications and family relationships from the structure of dethiobiotin synthetase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biotin biosynthesis
molecule keywords DETHIOBIOTIN SYNTHETASE
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1994-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dbsA00
5FPKA 1R2QA 4NCKA 4Q9LA 4ZCLA 3HR8A 3RSOA 5JI3E 2OAP1 5CJPA 1P4SA 1LS1A 4ZI3A 1NIPA 1P6XA 5J5CA 2WJJA 1XMSA 1XWIA 3K1JA 5BYKA 3C4JA 1E9FA 2OFOA 3EZ2A 3RS5A 5FOVA 4OI0A 2ZJYA 2PMDA 4IEEA 1E2GA 2A30A 3I8XA 1QHGA 2GEDA 4DKXA 3I61A 4US1R 3MMPA 2ZJAA 1JECA 4AYXA 4DSNA 3THXB 4B35A 1KO5A 3DKVA 4HLDA 4CT4B 2Q9AA 4TMWA 2BEJA 4NONA 4OQLA 2WTUA 5LB4A 2VSOA 4A15A 1W36D 2FEMA 5L3SA 5FOWA 1ZYUA 2ZI9A 5J4HA 2VPPA 2ZSBA 3SBDA 4HB4A 4DLTA 3AKDA 2KB0A 1D2EA 3I32A 4EPXA 4YLGA 5DI9A 5KNCA 4S35A 2JAQA 4US0R 4RVCA 5DH9A 4EFLA 4MDEA 5G3ZA 3PJRA 4FMBB 1TEXA 3T5GA 2ZU6A 4BRWA 2ZI7A 1N0WA 2OCBA 4EPVA 1XJ0A 2QU8A 5CB6A 5IF9A 3R8FA 4JBXA 1XTKA 1IY0A 2QEQA 3A1VA 4DEYA 4JT2A 3UKDA 3SFZA 1E1RD 3A58B 1E79A 2E9SA 3EPJA 4KYUA 2O0JA 2FV8A 3FHCB 4D82A 1N6HA 1XB2A 5EE0A 2JLUA 2ZXUA 4DCUA 2KWIA 4JVNA 4QFMA 1KJWA 1Z2AA 5B2ZA 2XJ4A 1YU9A 4EIWA 3K9GA 2VA8A 1TF7A 2QM7A 2ZUBA 5EQTA 4CDGA 4DHEA 5CYPA 2ZETA 1CRQA 2CHVA 1SKYE 3HU1A 4Q48A 3KKQA 3QKRA 5KDOA 1W7AA 2AX4A 1OFUX 3B85A 4EJSB 3U3KA 4Q1FA 3RYTC 1IY1A 1JAHA 2OV2A 2OXCA 4D81A 1QHNA 2KE5A 4UNRA 5JFGA 3GP8A 2VHUA 4AC9A 1AKYA 4B3CA 4IVQA 4G0NA 4DT1B 4HZIA 2BMJA 4B3FX 1G19A 2ZI4A 1SZPA 3BORA 3VKGA 2QRZA 4N3NA 3VAAA 4KLZA 4PSAA 2CK3A 5AUQA 2R6DA 3MCAA 2NOAA 2W58A 2XITA 3GLIB 2X2EA 2P0EA 2VHJA 2IHBA 4BGDA 5FI1B 4O2LA 1NSTA 1ZC4A 3S1AB 1IOZA 1KI3A 5HPYB 1OE0A 1GNQA 2GWHA 1GL6A 1KAGA 2ZRGA 3X1YA 4Q66C 1OT3A 3UG7A 2O8CB 4WXRA 4QXAA 3QKRB 4NYJR 3IPXA 3EZFA 1T8UA 1Z47A 4B34A 2Q9CA 2H1LA 2AKYA 3Q3JB 3KB2A 1OXXK 2DFLA 1TTTA 2O8FA 3B2EA 1S9DA 4LBYA 1G4AE 2A7QA 1E3MA 1J8YF 1S96A 3GLHE 4DCVA 3SHFA 4MGYR 5TY0A 1ODFA 1XEXA 4PHGA 2O5VA 1OYWA 1XXHB 2VP6A 2ZI6A 4RD0A 1TF2A 5J40A 4NU0A 3W3AA 1K5DA 3A4MA 4K46A 4TMXA 2OT3B 1BYIA 3LV8A 1DOAA 2ATXA 3CX8A 2IYUA 2EYUA 3HWSA 4HAZA 4Q4JB 2ZU0C 2CXXA 4Q9JA 1KO7A 3U3RA 1OXVA 5KPDA 2HLDA 3ZIAA 2QGZA 5CM8B 4EJSC 1AJEA 3VX4A 1EFCA 4BFWA 5M04A 3GJXC 3V00A 2JJ2A 2WOJA 1AN0A 1S8FA 4B3BA 2C9OA 5JRZA 2O8EB 1MABA 1E1QD 2RAPA 5UKDA 4JT4A 3I62A 1XPUA 4G1UC 1E2NA 4GRAA 3BOSA 4A0HA 3P4YA 1TQ6A 4HAVA 4LHVA 4C3ZA 1XD2B 1OH6A 4CT5A 4DRZA 2WKRA 1RJ9A 4LPKA 3TR5A 1R0YA 1OXUA 3DL0A 3AH8A 2IXEA 2Z43A 4HSEA 2WJYA 4TTQA 2ZE6A 5E3HA 4AYWA 2GXAA 4F7WA 2RGCA 1RE0A 4I1SA 5JHGB 4LBWA 3NHAA 2JASA 2ZJ5A 2ATVA 4ZCMA 4NH0A 2NO7A 2JLWA 2PJRA 1IONA 1NMYA 4EAQA 4LUCA 4JVLA 5FUVA 5EE5B 1VPLA 4C30A 2WWXA 3FWYA 5EE3A 1UDWA 4I1VA 1KK0A 4MRPA 1M7HA 1XJQA 1P75A 2QMEA 3B1YA 1AKEA 1RRPA 3UIEA 2EU8A 2GXUA 2QTHA 3SBEA 4TMVA 4B3DA 2ZYUX 3TKLA 1VCIA 2FFHA 3LX5A 2F43B 2VYFA 3IHWA 5DO9A 1MH1A 1WA5A 1G64A 3DEFA 4LZZA 2GEVA 4E5UA 5K8IA 4R71A 3FMPB 3QI2A 2ZI5A 1NP6A 4A8JC 4XTRA 4URWR 1E9RA 5JHHB 1U94A 1D8TA 1N6OA 4P33A 2NMVA 2ODWA 1DVRA 1I4TD 2WPDD 3K0AA 4MYUA 2J0QA 1XEWY 3H4MA 3PUYA 3GJ6A 4KFSA 1FOEB 4TL9A 4B33A 1SHKA 2W2TA 4YXWA 1COWD 2IEYA 4TL7A 3TIFA 1GOTA 2BMDA 4DSTA 5FL3A 3ZS9A 3VFDA 3WBKA 4DDVA 2ECKA 3T1VA 4FXPA 1L8QA 1GRQA 4TT3A 5LPNA 1JPNA 4YDSA 1YR9A 5KO2A 2KBEA 2ZRHA 2F55A 1RYHA 1GG2A 3B1XA 2C2HA 1NVWQ 1ZIOA 2F6RA 1DAFA 3BIFA 2AR7A 4JJKA 5JS7A 3ADDA 2PZGA 2DFTA 1KI1A 3EC1A 4F4JA 3PEWA 4LHYA 1EWQA 1WDTA 2QAGA 1E4VA 2WBLC 4E09A 1OFHA 4RY2A 1ZAKA 2J9RA 5AR1A 4DDWA 3OF5A 3SYLA 2C9CA 2CNWD 3FKSD 2OBNA 1G18A 2IA5A 1G4UR 1RZ3A 2I1QA 3P32A 3WMEA 2CMKA 4V02A 2B8TA 2DBYA 1SVMA 1GVNB 4QG7A 3Q5EA 1ZM3A 3SYKA 5CYOA 4V0LA 2GBLC 3ND9A 4W9MC 1VIYA 4LV5B 1R0WA 2N46A 1DAMA 2QY9A 4G3XA 3TQCA 1D5CA 4PZZA 1Q44A 2XTNA 5BN3A 3VU9A 2GNOA 2P6RA 2PL3A 3SN6A 1NN3A 4Q1AA 2D74A 4PQFA 1ZUNB 4GZLA 3KUCA 4TMTA 3L0IB 3I4LA 4CEIA 1UKEA 3C41J 4C0LA 1MRNA 4TQ9A 3W8NA 5CM9C 1G3UA 1C9KA 3IEUA 3H1TA 3HPQA 4OBEA 1U9IA 3K0FA 3LFUA 1FX0A 3OE7D 3ONWA 3RWOA 5IK2D 2PX3A 3K9LA 2ZE5A 4RZ2A 4D80A 2ZJOA 2CVFA 3B9QA 1CR1A 2OLKA 1HE8B 1GRNA 1ONBA 4FCWA 4MRVA 4HLUA 1VYUA 4JMPA 2ZE7A 3DKPA 1K6MA 4NCHA 2HXYA 4UNPA 3R9IA 3TLXA 1QVAA 5DN6A 1LFDB 5K8TA 3VTKA 4CF7A 2PJZA 4TYQA 2ZM5A 2IUUA 2LKCA 1KK2A 5HZKA 2ZSAA 3VKWA 4BUJA 3SNHA 1M6NA 1X8KA 2OFXA 4D4KA 4YMTA 4UJ5A 3MRSA 1BMFD 4P4SA 1TADA 2VP0A 2HXSA 3AF3A 5AJYA 1KY2A 4XJXA 4I4LA 1FNNA 2H18A 3QVUA 4CYMA 2IXGA 3KQKA 3GEEA 4GOKA 4IFEA 2CL6X 5JJIA 2DB3A 1ETUA 1D2MA 5DIFA 2RB4A 1HH4A 4JYBA 5LDDC 2ANCA 3C7KA 5DI3A 3ASYA 2NIPA 5BW8A 3QY0A 5EZ6B 2J7PD 1GL9B 1Z0KA 4XD7A 1VHTA 3O8DA 3QXHA 4C0QC 3U4QB 1XJCA 2DPXA 3QOFA 4B75A 2OHFA 4US2R 1NG1A 3AP1A 4PHHA 4EKDA 1S3SA 2WJHA 4MUAA 1G5TA 4RCZA 2ZE8A 3H86A 3AF1A 5KSYA 3P1JA 2PMKA 3P26A 4ZKDA 3PQCA 1VIAA 1JJ7A 1VTKA 1W47A 3DOEA 1N6IA 2ZSDA 1L2TA 3HP1A 4PQYA 2G1KA 4HB0A 1UEIA 2YC2C 3FFAA 1U8YA 4XSGA 1M8PA 1E32A 1KI7A 4GI7A 1I2MA 2YC4C 4LC0A 1Z08A 3WHLA 3JZAA 4X8MA 4WZAE 2XB2A 1GTVA 1MABB 5J4VA 1NNEA 3FTQA 4Z1MA 1W0KD 1XCPA 2IK8A 2Z4RA 5KPJA 1LF0A 1KO1A 2J41A 3DOFA 5KSOA 3CONA 2EQBA 1MOZA 1F2UB 2ZRMA 3HPRA 4MGZR 2G77B 5GADl 1SKYB 1EK0A 3HDTA 2ODNA 2UZIR 3RC8A 3QF7A 3AQ4A 3MJRA 2JDIA 4DSOA 5EUQB 1XPOA 3CPEA 4TT3D 4MRSA 3CNOA 3QKUA 1P62B 4Q4AA 5CB8A 1QRAA 3U7HB 4JVMA 521PA 1HY3A 3W6OA 2IYLD 4OK5A 4QC2A 2JATA 1JQLB 4M1YA 3SDZA 3LXRA 3MWYW 1PLJA 1RRFA 3SEAA 3AEZA 4BFYA 3R9WA 3B9PA 4BLPA 4RJLA 3CNLA 1SHZA 5AJXA 4A1FA 1GAJA 2DY1A 3BH6A 4NYMQ 2XAUA 3EA0A 1Q57A 1DADA 5BYJA 4TSFA 1CR0A 2DYKA 2DWOA 3V4FA 4F4CA 2A2ZA 2O8FB 2OM2A 2ZITA 1NMZA 3QVVA 5CDFE 2JLVA 1CU1A 4W7SA 2IS2A 3BB4A 3AGQA 1TUEA 3PENA 4JJZA 4LGMA 4Q7LA 1DG1G 2A3RA 1Q3TA 1CRPA 3SC3A 2YINC 3U3MA 3FKQA 1W36B 3QPVA 3C5HA 2OCYC 3LBNA 3F5FA 4Q1BA 2G1JA 1T0JB 1Y63A 4C7OA 1NKSA 3LXXA 1ZINA 3OIUA 3HR7A 1C1YA 1M2OB 5CITA 3Q9LA 4ZDKA 4DLXA 4N1AA 1DO0A 1G3RA 4AG6A 1H65A 2Q3MA 3WMGA 2NO6A 5AK0A 2XTMA 1VG8A 4M1KA 3AVVA 4XVUA 3RABA 1W4CA 2NPFA 5FTLA 4TLBA 3A1TA 2J7KA 1HV8A 2OZEA 2QUZA 1W2GA 4H1VA 4LBVA 3GQBA 3A4LA 3PR1A 1P2VA 5IDVA 5E4FA 4AWXA 3ZH9B 2XNDD 1SQ5A 4CEHB 1XD8A 3QENA 4CEIB 2GKSA 2JJ1D 4LYAA 1RC8A 1E1QA 3QSYA 1U0JA 4LV6A 4PPGA 4KFUA 1WXQA 2EWWA 1FUKA 2G3YA 1Q22A 4MITA 3TAUA 4EDHA 1E94E 1L4YA 4MYTA 4KAXA 3GCGA 3QE0A 1OIWA 5B30A 4BZPA 5F98A 2V6IA 5ELXA 4V03A 1GSIA 3IHLA 1IM2A 3BH0A 5F2EA 4OI1A 5KDDA 2GJ8A 5FOTA 1XNJA 3QG5A 2V55B 2F1RA 1JALA 4XD7D 3DMDA 1NN1A 2A9KA 4ERNA 2GEUA 1ZCAA 3CZPA 4FD2A 1P72A 4LJ4A 1ZNWA 3TUIC 1QBKC 2BDTA 2YWFA 1ZU4A 2RCNA 4QHTA 5HE8A 3W9YA 1XTIA 2P67A 4FN5A 3OFNA 5JWOA 1GRRA 1NLFA 1W0JD 4JLKA 2Q0HA 1HT2E 3IGFA 5FUYA 3GLHB 3O8BA 1OKKD 1YZGA 3EWSA 1XP8A 3ZZUA 4MRRA 1IQPA 1Q0UA 3KUDA 4V0MA 4HAXA 4NE2A 3JVVA 5C18A 2QRNA 2QAJA 4POAA 1CULC 1G7TA 1NJGA 2OO7A 3GJ5A 1KHTA 2J45A 4LOAA 1AGPA 3QQ5A 2HT1A 1DAGA 2NZJA 5JEEA 1IN6A 2NO9A 1AGRA 1R5NA 4H1UA 1Z0DA 4MGIR 3GLGE 2IYQA 2RKOA 3MLEA 4PFSA 4QBGB 5FUWA 4TYNA 1EFRD 2ZAOA 3NXSA 2JEOA 4D25A 3W8RA 2QQEA 2AFIE 1SKQA 1UPTA 3UG6A 2IUTA 3SR0A 3JVUA 4RFVA 1N6LA 3BB1A 4KCGA 3EX7C 1CEEA 2BIFA 3SJAA 3K70D 2FA9A 3VHLB 5BXQC 1Z5ZA 1YZQA 2FX3A 3N5CA 5FL7D 3ZYCA 4ZDJA 4LJ5A 5AJVB 4DSUA 4JL5A 2VBCA 4LJ8A 3CNNA 5JRJA 3QXCA 1D2NA 4JLBA 2X8AA 2GDJA 1JEDA 3RNLA 4CVNA 5H8WA 1LW7A 2ZRLA 2Q6TA 1SVSA 3KTAB 1UADA 2OAQ1 4FMCF 1S1MA 3LAWA 4D2IA 3WP1B 3B1WA 3WRYC 5J4YA 1HUQA 5C1BA 3AUYA 1DAHA 1X6VA 1FW6A 1G3MA 1P7CA 3AKYA 3W90A 4HB3A 1U8ZA 1JQJC 1Z8FA 4DIDA 4MKFA 2XXAB 3LO5A 2V8OA 2W0MA 3B6EA 1S0UA 4O2RA 5DHAA 3KQNA 2KJQA 4L15A 3JZMA 4QGFA 3FPAA 5K8LA 3FE2A 5FPTA 1ESMA 5FTMA 4M1WA 1GM5A 3MWKA 3TH5A 3A1UA 4LHXA 2QPOA 2ZQ5A 4URUR 4ZIRB 3A36A 1KK1A 4WZ6A 3NBFA 4R98A 5J4KA 3THWB 1XCGB 2QENA 4TLCA 3K0FB 3GPLA 3CWZA 2UZ3A 3QXXA 5SZHB 4YQFA 1F5NA 1EXMA 1U0LA 5FR2A 3SQWA 2JJ1A 5J4LA 2A5YB 1SXJD 1GNPA 4ASUD 2REXB 4OHXA 4QGGA 4ZKEA 5SZIA 1IJEA 1EFUA 2BCJQ 1RRGA 2VL7A 4NYIQ 2VF8A 1II9A 4F92B 3IIMA 3PEUA 1Q1ZA 4RFSB 2GF9A 2VP4A 4CEJB 3EIHA 5DISB 4IXNA 4R7ZA 4W5HA 4JLMA 1EG7A 1KI2A 3NBZC 5L3VA 2IC5A 3THWA 4YMSA 1JR3D 2FNAA 2WIBA 2CLSA 1ZMXA 2R8RA 4B47A 2QMHA 4OHYA 2WZQA 1GIAA 1AA9A 4GOXA 1G21E 1ZRHA 2AHOA 3NDPA 1TAGA 2G0TA 4IRUB 5CLQA 2IYTA 4S2EA 2IWRA 1M7GA 1M7BA 1NI3A 2P5SA 1ZNXA 2WIAA 2WWWA 1F6BA 4DUGA 2V3CC 4LBZA 1FQJA 3E5HA 2NO0A 2WVJA 4JLAA 4HAUA 1F2UA 3CX6A 1DELA 4I99A 2BKUA 4C0SA 2RH5A 5TARA 2V1UA 4A36A 4OYHA 2ZRKA 3QPWA 5KYKA 4CEHA 1UBFA 2F9MA 4HUQB 2JDID 2ZAMA 2QT0A 4XOIA 4RD1A 3SJZA 3THYA 5DE3A 4GT1A 4BLRA 2GK6A 1N6RA 4BLOA 4ABYA 1M1YE 2GZHA 1KMHB 2BMFA 4JL6A 3QF4A 4B73A 3D7MA 1MKYA 2FFQA 3CPHA 1G5RA 1P3JA 2ONJA 3KB1A 3KKMA 3RS2A 3QG1A 3L0SA 2ZSFA 1XZPA 1LV7A 1GKYA 1V5WA 1FPMA 3KDSE 4YMUA 1HURA 5JJKA 2NTYC 5JSZB 5KNBA 4RZUA 1YZTA 4PAMA 5LB2A 2PX0A 3I72A 1DG3A 2XNSA 3M4YA 1N5JA 3E2IA 4HAWA 4DLSA 1W0KA 4C0BA 1DBSA 2G9NA 1A82A 4JS0A 2UVQA 1YE8A 1N2CE 3G5UA 4WIAA 4R2IA 2IL1A 4LRWA 4FI3C 3LQQA 1ZM9A 1AK2A 3CF0A 2H16A 3KJHA 1CBUA 4DJTA 1QHSA 1Z0IA 4QGHA 1KDTA 5EP3A 3MSXA 3PVSA 1QG4A 3R20A 3GLHA 4Q4LA 5HE9A 2RGGA 2ZYTX 1TF5A 3F0TA 3CWQA 5AUNB 2R9VA 2VEDA 4ZV4A 2I1VB 5L3RA 3OZXA 1K5GA 4A0RA 3K0SA 3EPHA 3HJNA 2EFGA 3GJ3A 1HYQA 4JLDA 4B2IA 1G17A 2FPLA 3VR6A 2VRWA 1UKVY 1X1SA 3IBGA 4NBSA 4ARZB 4BWYA 4JKYA 4ZDIA 1G8PA 4JVSB 1QHYA 4OK3A 5CK5A 3LW7A 4ON9A 3W6NA 1Z63A 3U44B 2VIIA 3ZZTA 3ZD7A 4PC7A 2BJVA 1S4QA 1NLYA 4IEIA 2E1RA 2IYWA 1R10A 2ZREA 3RRZA 4ILEA 3OEEA 4M9XA 4TLDA 4PX9A 4M1SA 1TPZA 2DHRA 4Q03A 4AI6A 5DGXA 2HF8A 3ZQJA 2BWJA 3OFND 1O87A 1ELOA 1FQKA 1OHHA 5JZVA 1G1MA 2CCGA 1R5OA 2NZ8A 3MFYA 2HYIC 2GXQA 3AV0B 1ESNA 4L9SA 4WW0A 4A92A 3PG5A 4BZQA 4D4MA 3SJBA 1YZNA 5EE9A 2ONKA 1E98A 3CRW1 4A0GA 3DDCA 1OIVA 1TMKA 2W0SA 2ORIA 1NKTA 1AS3A 4KV9A 4KITB 2N1BA 2XNDA 3LLMA 1V43A 3OIYA 1IXSB 1NN0A 2ERYA 2GZAA 2VP2A 3CLVA 1E79D 1KI6B 1P2UA 2XTZA 4FMDF 4IDQA 4LYJA 4DUGD 5KHOC 1T3SA 1U8AA 2C99A 2FEOA 1A5TA 2QZ4A 4MH0R 1E2KA 2UKDA 1G7RA 3B5JA 1CJTC 5FOUA 4RKEA 4BFUA 1ZM2A 1JI0A 3FDIA 5D3QA 3TBKA 2XGJA 1KKLA 1LVGA 1VHLA 1FFHA 2BJWA 1KO8A 5H68A 3VMFA 2GAOA 1PZNA 3QIAA 4A8JB 1LB1B 2RGDA 1AS2A 4QL3A 2VP5A 3IKJA 3BBPA 3EIEA 3RVBA 3QKSA 3W3ZB 2NG1A 1W4AA 5HKKD 1YZUA 1LF5A 2EWVA 2ZRBA 4QBFA 3UMSA 1JXOA 1WE2A 1QF9A 1GKUB 3BGWA 4JZKA 1OIXA 3T12A 1DAIA 1J7KA 2RGAA 2P6UA 2YNMA 2ZYVX 2GK7A 2CVHA 1OXSC 4OI2A 4NMMA 3SZRA 4W5JA 1T5IA 3IUYA 1TU3A 3EIQA 4ZDWA 2P2LA 3RLFA 3FMIA 4DLVA 1CR4A 4DDTA 4Y0AA 3LQRA 3AVXA 2D7CA 3BAFA 1SVKA 2D62A 2RGXA 221PA 1DAKA 3LY5A 1ZM4A 3SE0A 4B74A 5LD2B 1SXJC 1F48A 4OQNA 1AQUA 5EP4A 3U7FB 4TYWA 2VHCA 4DCTA 4WBSA 2WMNB 2PH1A 1PJRA 3BXZA 2O8BB 3BS4A 5G53C 2IYVA 2C5LA 2OSBA 2EFEB 4HYYA 2CL7X 3FMOB 4UJ3A 5TV2A 4PC2A 2WWYA 3ZZ0A 1NSFA 1KSGA 2EW1A 1NRJB 1WF3A 4O0MA 1G8YA 4DBLC 2QP9X 4O25A 4A9AA 2HV8A 4PPNA 2QN6A 4YMWA 4BE7B 1ZP6A 3LRPA 3H84A 2HYDA 121PA 3RS7A 3U4QA 2G88A 4DC9A 1PLKA 3AUXA 1WBDA 4U5XA 1S9HA 3CRQA 2ZI3A 2GZDA 1GFIA 4Q18A 1JNYA 5H1YA 4GDFA 4PXAA 3UANA 4NTZA 1XTSA 2AD1A 1TUIA 1IN7A 1ZD9A 2XZOA 4BQSA 5JS8A 1XX6A 1D9ZA 3NVAA 4XWOA 3ADBA 3GEIA 1Z2CA 4JLPA 4HZUB 4PAOA 1KDOA 4L5BA 3TMKA 2WJVA 3GFOA 3O8CA 2RHMA 2L0XA 1JXMA 4NKRA 4B32A 3FMFA 4KXFB 2YOFA 3QJYA 4LK2A 1E4YA 4TLEA 4IDNA 5E95A 2FSHA 3SS8A 1PLLA 4C9BA 2ASEA 3NC0C 1BOFA 1SVOA 2LCFA 4YMVA 1ZBDA 2ERXA 2WHXA 3ZGXA 1KI8A 2FF7A 4HLUC 5DYIA 3EZ7A 1NG9A 1Z6GA 3ASZA 5EZ5A 3CR8A 1TU4A 2GCOA 1ZC3A 5GVSA 3DVLA 3A8TA 4IOLA 2Z83A 2FPKA 2ZUCA 1FMJA 2J7PA 2AWOA 2HJVA 4AYTA 4Q7JB 2QP3A 1XEXB 1N5KA 1AQYA 3RWMB 4JIMA 1UFQA 1II0A 1VG0B 1ZUHA 3CRVA 4XVQA 3U44A 1CJKC 3F8TA 3BH7A 3NC1C 3S1AA 1SXJA 4ASUA 3PCRB 1E0KA 2PT7A 2C04A 4PAQA 1E2JA 1P2SA 3PUWA 1NVUQ 2KBFA 1OYYA 2QTFA 3T1OA 4EUNA 1TEVA 3IEVA 2O8DB 1R8QA 1AIPA 2J3EA 4FIDA 2QP4A 4KLNA 4XWKA 1T4GA 2A78A 2GBLA 3B8HA 4MA4A 3N2EA 1FZQA 5EUMA 4I1OA 1AS0A 4K8OA 4Q1EA 5EJEA 4JBWA 3RRYA 4RFSA 4G5QA 1NBMD 5G3YA 2B8WA 4QHYA 3T15A 1WB9A 4R2HA 1H8EA 2VHQA 3N2IA 2ZRAA 2WAXA 4KJZA 4NHOA 4TMKA 2PLRA 5KUTA 4KO8A 1YR8A 3C16C 4Q4JA 4TYPA 3NBYC 1WCV1 3O47A 3UPUA 1R4AA 2PEZA 1UDXA 4U02A 5FTNA 2J87A 2QGNA 1US8A 2CLCX 2K5UA 2QI9C 4DLWA 5DYGA 1Q21A 4TZ0A 3PUZA 3UK6A 4JSYA 5KU1A 1EX7A 3PITA 1MO5A 1SGWA 4D4JA 3MAAC 4DIEA 1G3IA 2R62A 4URVR 5D3MA 4B71A 3BFVA 1R0ZA 5TB5A 1OH8A 3RSLA 1XD9A 1J99A 4LCBA 4Q9IA 5DN6D 3GJ7A 5A5GA 3LD9A 4MDFA 3ZS8A 4M0LA 4ACBA 1OH5A 3WBJA 2B6HA 4I1UA 2F3RA 2QBYB 3TUZC 4BFSA 2J0SA 1KJZA 4AIIA 3OE7A 4NCIA 3D6TB 1Z83A 5IK2A 2QE7A 3AF0A 3PFIA 4OJKA 1G8GA 1KI9A 2FOLA 4EFMA 5AUOB 5GJWC 2CE7A 2OESA 5CDFA 2BHRA 3TE6A 3BFKA 4NYMR 3UMRA 3BFXA 3ZLJA 1E9AA 4MKIA 4LJ9A 1U0HC 2PT5A 4EPRA 5CLLA 3GJ0A 2XXAA 2ZR9A 1U99A 5BWMA 4LY6A 2ODBA 3BWDD 2MMGA 821PA 1U9IC 4JYCA 3X1WA 2OEPA 2ZANA 3B7GA 1QHIA 3BRWD 4GBMA 5TDHA 4CZ2A 1S2MA 2R2AA 4KBGA 2YWEA 1WBBA 4BPBA 1OPXA 2WOOA 1HA3A 3K09C 4LC1A 1OHHD 4A6PA 2VSXA 4QM6A 3C5CA 2MSDB 3TAHA 1JAIA 1G291 4AD8A 4ZO4A 1DO2A 4M9SA 1CP2A 2C03A 1I4DD 2HDNB 3KJIA 3CB4A 4X8OA 1RVDA 2Q3HA 5EP1A 2XJ9A 3Q8XB 4ACAA 1LTQA 1OKKA 3MD0A 4P32A 3E1SA 2QA5A 5FBQB 4BLSA 4C4PA 1KOFA 2BEKA 1ZVQA 1MT0A 2I3BA 4TL6A 4D4LA 1DEKA 3L8YA 3U7EB 1N5LA 5EP2A 5F9FA 2F3TA 4JL8A 1NF3A 3EASA 4A6XA 2H17A 4DDUA 2N42A 4NZYA 2V6JA 1E69A 1JR3E 3GLFE 3QKTA 4P3YA 1W5TA 4PZYA 4LJAA 4H9GA 3P27A 3SHWA 3Q72A 4B43A 2QAGC 2BVNA 2FFAA 5C46F 2QL6A 3QKSB 1H8HD 2RGNA 2XSZD 2B21A 2FN4A 1X3SA 3GFPA 4TZ6A 2VF7A 5F9HA 1K8RA 1E2MA 3PEYA 2FZ4A 1E2EA 3ND8A 3X2SA 2OUKA 4B44A 3ZJYA 4CGZA 1PVOA 1C4OA 2LWIA 5EXPA 2GTPA 3QBTA 3GLFB 1BO6A 2Y8EA 3K70C 4XTCS 4Q7KA 2JLQA 4GSYA 4B76A 3R9XA 2QSYA 3KXIA 4FWIB 2XZLA 4Z51A 2F43A 3LH5A 1DPFA 3A4NA 2GXSA 4PC1A 3LX8A 4AY2A 2WWGA 1XFAA 2PBRA 3ZD6A 4A8JA 4Z1MD 3THXA 2H8KA 4QNMA 2WKQA 1DE0A 1CXZA 4M2LA 4OHZA 2ZS8A 4V0ME 1ZD8A 1G9XA 1A4RA 4OKSA 2GCNA 3IILA 421PA 2V4ZA 1KDRA 3DM5A 2V7QA 1QHHB 2GHIA 1MRSA 3IQXA 4U00A 1NY5A 2FSFA 2O8DA 1IN5A 2O8CA 3T1QA 1KMHA 3C15C 5BN4A 1CKEA 2HUPA 3K53A 4NCJA 2HCJB 4W5WA 1Z0JA 2ZRNA 4B2PA 2FSIA 3ZVNA 2QG6A 5JSZA 4P4SB 2DWPA 2CHGA 1TQ4A 1A2BA 3GJ8A 2R6CA 4BLQA 2C98A 2QSZA 2H92A 1B0UA 2W6ID 2OE2A 2VLIA 2ZJ8A 4DLUA 4NYIR 5BN5A 2JLXA 1XTJA 4Z8XA 2NQ2C 4HUTA 4DZZA 2JLRA 4DCNA 4L8GA 1DARA 2Z6VA 3SU8A 3GLIE 3KJEA 3QNUA 2AXNA 1ZNZA 4MYCA 4BFTA 4RD6A 2OBMA 2O0HA 4UXIA 4M1TA 2MSEB 3KFVA 4GNKA 2OG2A 3ZVLA 4UXJA 4ZPXA 1LY1A 3ZDQA 4EJSA 2ZRDA 2D2FA 2J5XA 8OHMA 1UJ2A 1EGAA 1IHUA 3TSWA 2F1HA 2FH5B 2ZJZA 5FBLB 4BFZA 1BH2A 2ZSEA 2C78A 2Q21A 2WV9A 3M1IA 2ZVQX 1IXRC 1KZ7B 3LW8A 1NL3A 4CEJA 2WAYA 3VNVA 3VR5A 1KGDA 2IBMA 1EWRA 4MUBA 2GVZC 3OESA 5F3WB 2WKPA 3EPKA 4Q4AB 4URZR 1OW3B 3D8BA 4OK6A 1VMAA 1DS6A 4NL4H 4C2UA 2QM8A 2YHSA 3AKEA 1FX0B 4AKEA 1N0UA 3NH6A 2IYRA 4FCTA 1UM8A 4BASA 3THYB 2XOKD 1VECA 3B13B 1TL7C 1E99A 2HEIA 1PUIA 3K70B 3QF4B 1OXTA 5DSZA 2BCGY 2G83A 3R7WB 3OEED 1YRAA 1G5PA 2V9PA 3LNCA 1JEEA 3LDAA 4PR0A 4A82A 5FR1A 4F91B 5HTKA 2F1IA 2GCOB 2BBSA 3NEJA 5LBIA 4QBIA 4Q02A 2CNWA 3FKSA 3U3JA 2B92A 2PZEA 1HQYE 1KO4A 1KSJA 1BKDR 3BB3A 4Q01A 1E0AA 1N5IA 4HUQA 2W6JD 1LNZA 4LYHA 2FJUA 3RHFA 1E2QA 3TVTA 1HE1C 1CIPA 3AVUA 1KSHA 1Q1EA 2ZS9A 4M21A 3CM0A 4C7OB 1MO3A 3KQUA 2XEXA 3AVOA 5DI3B 1WQ1R 2WWIA 4TWZA 1E2HA 4NCNA 4TQUS 2V7QD 3CKLA 4RZXA 3NKVA 1Q3HA 1YKSA 1ZD1A 1Z0AA 3K8YA 2ZROA 4ESVA 2MSCB 1RFLA 1P5ZB 1E0SA 1SXJE 2QQ0A 5HCIA 3TW4A 2EFCB 3TRFA 3AB3A 1ZJ6A 1NBMA 3EXAA 3DHWC 1E9EA 1IAQA 2AD5A 3EC2A 5AJZA 3UWKA 3VQTA 2GILA 1W4BA 1GKIA 1EFRA 2YKGA 3DPUA 3OIVA 3KZ1E 1SVWA 1D9XA 1SXJB 5FPSA 3K9HA 4DEXA 2R65A 1A1VA 4Q9KA 3P4XA 4GL2A 4X8LA 1M34E 2D06A 2GVDC 1RKBA 1US8B 4TL8A 3MG9A 2EFHB 3NWJA 4TMZA 4TQAA 3GEHA 1D6JA 2WSSD 1UBCA 3IDQA 2PZFA 1XMIA 4UKDA 1TQ2A 3QUSA 1E2LA 3OHMA 4QJ3A 5FOXA 3A6PC 2AFHE 2BBWA 3K9NA 3X1XA 5FL7A 5FTJA 5EE1A 3Q7QA 4IOMA 3UXMA 3T35A 3T5DA 1XTQA 1HTWA 1GILA 4C0HA 2IYSA 4N0DA 1G6HA 3ZVMA 4G5GA 1Q1QA 5GJCA 1VG1A 4DCSA 3U61B 1CTQA 3FFBA 4HB2A 1E2DA 2DR3A 2R6AA 4Q9HA 1JJVA 3SYNA 3I92A 3DZ8A 4Z8YA 3UATA 3MUFA 2D7DA 1N0VC 1XMVA 3H2YA 5AWFC 4DWJA 4OQXA 5GVRA 3CF2A 2G6BA 2J0VA 4HEJA 4JLNA 3AF4A 4Q1DA 2AWNA 2ZRJA 5DLQC 3DZDA 5KOYA 3TGPA 3IPYA 2XOKA 2Q3FA 3LA6A 3FYHA 3MWLA 1OLOA 2CDNA 2JJ2D 1VCNA 2ZTSA 4QBHA 2IS1A 1E2IA 4BFVA 1Z29A 4PSKA 3ZQ6A 1O3YA 3CIOA 1QDEA 4D26A 4B2LA 4KSCA 3AP2A 3VU9B 1T0HB 4XSHA 4MQBA 4V0OA 2YZ2A 2PCLA 1W49A 1JB1A 5KSZA 3BE4A 4Q4HB 1XCMA 1XRJA 4X8HA 2CCKA 3KTAA 1M74A 2E87A 1T3LA 2BOVA 3I3SR 4P4UA 1I4LD 2CJWB 1N6PA 5FPHA 5L8VA 5EXTA 2Z0MA 1G6OA 2CCJA 2W83A 5JJLA 2X2FA 5KTYA 2BBTA 2OFWA 4WXPA 1UEJA 2EVWX 2X19A 3IIKA 2IF0A 2IHYA 2QE7D 4GP7A 1CLUA 4HI0E 4EPTA 4EQ6A 2RMKA 3V4RA 3AM1A 1QHXA 1VYTA 3U3OA 1XF9A 4LI0A 4E07A 4B6EA 1SVLA 3GLGB 3CZQA 1PUJA 2ANBA 3B1ZA 4Z54A 1II8B 5GJBA 4B3GA 2JA1A 1VYVA 2JIZA 4GP6A 3EW9A 4NP6A 3GMTA 2LKDA 3SI7A 3KKOA 1NVXQ 1A2KC 4FMDB 2J59A 1E0JA 2QMUA 3K0CC 5HKKA 2R6GA 4M9QA 2QROA 1KSFX 3PUVA 2X1VA 3AF2A 5IT5A 1FP6A 2QTVB 4TYYA 4M1MA 5CIWA 1W0JA 2B7CA 2YJTD 2GJSA 1R8SA 1WP9A 4EQ6B 4IHQA 1JR3A 1CJUC 4OL0A 1NN5A 3L2OB 2CE2X 3WHKA 3GLFA 4KVAA 1OH7A 2VQSA 2JLYA 2IS4A 4LPSA 2IS6A 3WNCA 1Z6XA 3GLGA 5IHPA 1XMJA 3B78A 5FBVB 4URXR 2BM0A 1X8JA 1AZSC 3KX2A 4DLZA 1T9HA 4LSGA 2CLDX 4ZI2A 2W2XA 5FUXA 5B58C 1WRBA 3LWNA 3GJ4A 4LV8B 3VR3A 5TXGA 3OEHA 2Z5FA 1J70A 4RSGA 4PQRA 2AKAB 2B7BA 2PCJA 1FNMA 4PC6A 2J0UB 4IOKA 1LS6A 4F93B 1GNRA 1QHHA 2C77A 2H5EA 3WNBA 4JKIA 1NMXA 2P5TB 2OCAA 3ADKA 2NPIA 1UAAA 3QBVA 3CBQA 3CF6R 3C14C 1W46A 4J0QA 3CRMA 3QPUA 2ZS7A 5G41A 2FGKA 4UNSA 5D3MB 1HT1E 1JBKA 3ETLA 4QNRA 2FWRA 2ODEA 5H70A 2Z4SA 5L3QB 2FFBA 1YZLA 5HR5A 2J0UA 2OILA 3CRRA 2OLJA 4Q7MB 3VKHA 5LD2C 5JCZA 3FB4A 1XXHE 1NLZA 2GCPA 1R0XA 2EFDB 3EA5A 4KBFA 4LYFA 1PV4A 1NVVR 3CUEF 4EPWA 3NIBA 1F60A 2IYZA 1BMFA 3CO5A 1GDDA 4PZLA 4Q00A 3U6BA 1VDZA 1BS1A 2IF2A 2QORA 4LDJA 2AK3A 2HF9A 4DB4A 2FZLA 3WY9A 2W6IA 4A2WA 3RAPR 1GWNA 4K81B 2YOGA 1VKJA 1QVRA 3LBHA 4HLCA 2GETA 3KQLA 1OB2A 4KI0A 3TW8B 4QM7A 3GLIA 1G7CA 1UKZA 4LX0A 3MGCA 1P9NA 1KMQA 4G5SA 3RANA 4BLTA 4GOJA 2IUSA 2JJ8A 5CK4A 2CEAA 4C2TA 3L0PA 3Q7PA 1YRBA 1Z6AA 3IIJA 3EZ9A 4PHFA 3OAAA 4O3MA 5SZKB 4EPYA 1UBEA 2NO1A 5B64A 3REFA 3EZ6A 2D2EA 3I5YA 3WYFA 3CW2A 4KODA 4B6FA 2DCUA 1G8HA 4E03A 1KAOA 3W5IA 2IYXA 2W6JA 4TTPA 1X86B 2V1XA 5FFMA 4GPTA 4HDCA 3TJZA 3G0HA 1TX4B 3HYRA 4P31A 5FOSA 3R8CA 3I8SA 1E1RA 4M8NE 4OQMA 5P21A 2VP9A 2YOHA 1MO6A 1MV5A 2O52A 1P73A 2WWFA 5FH9A 5B57C 1H8ED 4BEBA 2WPDA 4B48A 5CIQA 2C9YA 4MGKR 5FPYA 4LJ7A 1E9BA 2C8VA 3CH5A 4M1OA 2ZIAA 2YYZA 4XIGS 4CIDA 3M6AA 2G0NA 4UQOA 1HEIA 1RYFA 2F7SA 3P20A 3SQXA 1E9CA 3B82A 4Y0VA 3B1VA 4GMDA 3TUJC 3IO5A 5CJ2A 1SVIA 1NVVQ 3T61A 4D0NA 2REOA 2AL7A 2KI5A 2R44A 2ZEJA 1IN4A 1UKYA 4PHTA 5EXXA 3RRNA 1ZU5A 3DM9B 4QJ4A 4OQFA 4PO1A 4P4TA 2J46A 3Q5DA 3LVRE 1CF4A 4C0KA 3QEOA 5K8UA 1RIFA 3WYGA 2RGNC 4TTRA 1YVDA 1T91A 1U2RA 3G82C 2A5FA 5JCPA 2F1JA 1XZQA 3X1DA 1F3OA 2VTKA 4URYR 4DLYA 3J81k 3VNUA 3HYTA 2HT6A 1F2TA 4D0LB 2QBYA 1W2HA 4OI4A 2KSQA 2Q9BA 3IQWA 4GFDA 4C0JA 2GA8A 4IVRA 1FTSA 4OHWA 3X1ZA 2RGEA 1EESA 1KDPA 4I81A 4CW7A 3QXSA 3CH4B 3T34A 1MR3F 1KI6A 1KNXA 2ORVA 2IW3A 2QNRA 4M4SA 1N3BA 4RCYA 6Q21A 2FDCA 1XTRA 3DO6A 3A37A 3I1FA 3C8UA 4V0NA 4XH9B 3W34A 2W2VA 3EG5A 3UMFA 1UBGA 1FMLA 2GESA 1XBTA 3LBIA 3B60A 3AVPA 2MMCA 1P9WA 1FTNA 4NPHA 2ZRPA 2XX3A 4PC3A 4ARZA 1G8FA 1L4UA 1T5LA 2ZVPX 1W44A 1II8A 2FGJA 5JBQA 3TK1A 2WSMA 4JLVA 1G3QA 1IJFA 2BC9A 1ZM7A 3K09A 4LHZA 4OJQA 3TR0A 3KXLA 1W48A 4A0FA 2ZR7A 2HJGA 3WYAA 1Z3IX 3D3QA 4BFXA 1OFIA 4DXAA 2RGBA 3TQFA 1W5SA 2DFKB 1VG9B 3I5XA 4BZXA 2H57A 1J90A 3FVQA 4FINA 2R6FA 4BEJA 5JLJA 1S1CA 1CR2A 1OFTA 5DHFA 3WRXC 3CPJB 3KKPA 1J8MF 3E70C 1NIJA 4Q19A 2IX3A 4RD3A 4DVGA 1YR6A 1UF9A 1OSNA 2WM9B 3REGA 5KDLA 4LWZA 4IW3B 4UNQA 1KIMA 3I73A 2VSFA 3SOPA 5FI0B 1E96A 2QPTA 3EPLA 1E6CA 1QZXA 1T6NA 4EFNA 2CHQA 1WMSA 3THOA 3GFTA 1S3GA 5JMTA 4ZIRA 4MKHA 3NBXX 4TN1A 1YHNA 3AVYA 3MWJA 5AJWA 4II7A 3L43A 3NH9A 3FOZA 3IBYA 2BMEA 3WXMA 5JWHA 3L0OA 5A0FA 3PUXA 3AVTA 2REBA 5FTKA 1G41A 3RRMA 3R7WA 1XEFA 2YV5A 3NTUA 4FCVA 4UNNA 2GRJA 1W1WA 1U90A 3KJGA 5C4MA 1SULA 2AK2A 2JLZA 3PXGA 1OF1A 2IWHA 2P3SA 1R7RA 1XEWX 4XWAA 2JIZD 2QT1A 2C96A 3WNDA 4JSTA 4F4IA 2NGRA 3WP0A 3AP3A 3EAQA 2CBZA 1TNDA 1GZSA 3IO3A 5C4GB 3W5JA 4E22A 1ANKA 1Z0FA 3QXJA 2WICA 3D31A 2FE4A 4IDOA 2FU5C 5ANRB 1JPJA 5JEDA 5C2JB 1RPZA 2BM1A 2WJIA 3PV0A 5L3SB 3SFVA 3DMNA 4P0TA 4NYJQ 1Z6TA 3WMFA 2A5DA 2F9LA 3EARA 1EX6A 5GJVC 2A5JA 1Q1BA 3TSOA 2JCSA 1KI4A 4MKGA 2IYYA 4RD4A 3FHTA 2P6NA 3U6KA 4LJYA 2IEZA 3M0EA 3VX3A 2VH5R 4C0AC 5L3QA 5E7MA 4AKGA 3AKCA 4IFBA 3AVWA 3BC1A 1QG2A 1T3HA 2ZJBA 1ZCBA 4A2QA 3OEHD 2ORWA 4KVGA 2GF0A 4XVRA 2GJAA 2OCPA 2XZPA 1VCOA 2OBLA 4AKIA 2D4HA 2ZPTX 3TSZA 1RW4A 2BV3A 1AZTA 1NY6A 3GD7A 1T8TA 1Z28A 1N6KA 1Z07A 3Q85A 5E7IA 1KYIA 5A4JA 621PA 3TVDA 3MJHA 4PTLA 3N70A 3OIWA 5FBRB 4HAYA 1YR7A 4QJ5A 4G5RA 2HLDD 3W6PA 4DLRA 2JGNA 2SHKA 2ZR0A 1RRCA 4HATA 3KKNA 2AN9A 1Z22A 2WMOB 1RJ9B 4Q5IA 2VO1A 5IRCD 2O8BA 2BKEA 3SJCA 4MYHA 3EWAA 1YQTA 1ZIPA 2DWQA 1DTSA 4AK9A 5TVKA 3HU2A 4A4DA 2CL0X 4L16A 1XPRA 1YJ5A 3PIRA 2HCBA 3UWOA 4FMCB 3ICQB 1R6BX 3ZIAD 721PA 3KQHA 3VHXA 4KYIB 3V9PA 5DNYB 4KSBA 1OB5A 1E9DA 2XB4A 1N25A 4V0KA 4QRHA 2JLSA 1G20E 4WVFA 2O8EA 2GJ9A 1E9SA 4JBYA 4PPFA 2YWHA 1OJLA 4A2PA 3O8RA 3L82B 3TNFA 4IXMA 3A1WA 3BJIC 3ZVRA 5J47A 1BYUA 1G7SA 2FG5A 1U98A 4ITRC 5EXSA 1I2DA 1GUAA 1JR6A 1XXHA 1P60A 2H7VA 3VR1A 2QAGB 3KXKA 3CX7A 1Q12A 4HLQB 1FL9A 4N0EA 3NHBA 4PANA 2X77A 1FP7A 2C95A 4CRWB 4GZMA 1BIFA 4YDHB 4YONB 2YWGA 4IOJA 3T1TA 3NDBB 2YVUA 5FBWB 3LLUA 1W4RA 4KHZA 2O0KA 3K0EA 5HCNA 4WOPA 3FGNA 1L7VC 4YC7A 3BK7A 4DT1A 3U5ZB 2GJKA 4LHWA 4R9UC 2W00A 5HZHA 3QEJA 5JECA 2ZYWX 4M53A 3U2QA 4G5OA 1GL7A 4RZ3A 3PEVA 4HZUA 1TQDA 4WZBE 3BERA 4NDZA 4KFRA 4Q21A 2V54A 2I4IA 3KFXA 3A1SA 4KU4A 4BECA 4F38A 4FWTA 4M9ZA 5JWRA 5BQ5A 2QPAA 3LVQE 2D3WA 4YXWD 1E2PA 4LJ6A 1P9RA 3FHOA 4D0GA 2OXRA 1IBRA 4GMXA 5G40A 4ESHA 2A5GA 1KY3A 1R5BA 2IT1A 2WSSA 4AKHA 3BD9A 4ZCIA 3OAAD 4FW9A 3NEYA 3ECCA 1H8HA 2XSZA 3RC3A 3AVQA 4OHVA 2J1LA 1P2TA 3ICEA 2QMOA 4AURA 1U81A 2FPMA 1YZKA 4PO9A 3U60B 4B3XA 1XD2A 3F3YA 1NJFA 4MRNA 4WA7A 1GITA 4PSVA 1MO4A 3K0CA 4G01B 4U7DA 4PO8A 3NG1A 1X8LA 4M22A 3RS4A 1E2FA 1X1RA 1Z6YA 1AM4D 4RD2A 3H0KA 1COWA 2DFNA 2RHDA 3RS3A 1XU4A 4IDHA 5SZJA 4UXHA 1IN8A 1F2TB 1FUUA 1EFHA 2ZUDA 4IVPA 4JLOA 4Q4HA 2ZRFA 4QHSA 3K0AB 5AUPB 1DAEA 1KTVA 5JI2E 1B23P 3U7GA 4HDOB 4L9WA 5E7JA 3RDPA 1KJYA 1G16A 1Y3AA 1CJMA 1Z06A 2TMKA 2VHTA 2WJGA 5KNDA 1ZUIA 3ADCA 2CJWA 4Q1CA 1KZGB 3CR7A 2WWHA 1XDBA 5KSPA 3VR2A 4KFTA 2ZRCA 4TSFD 1A7JA 3RS0A 1NBME 4BRUA 1KK3A 1Q20A 4IDPA 1IXZA 4QOSA 4AG5A 1P61B 4JLJA 1CS4C 1KKMA 2BBOA 3L8ZA 1GP2A 1OV4A 4DB2A 4QGAA 1N6NA 2IXFA 4L4UA 1CJVC 2CK3D 3HU3A 4HDQB 4QKQA 2PLFA 4Q47A 4IKEA 1EFTA 1IY2A 1W36C 1KNQA 3AGPA 4WAUA 2FMXA 1ZNYA 2FSGA 3KL4A 1J2JA 3VR4A 2P65A 2GAAA 3T06B 1VCMA 4IJMA 4RKFA 4TLAA 2EYQA 4PPQA 2ZJ2A 2ZRIA 5TMPA 1HQCA 1ZW6A 4D6PA 2AXPA 2PEYA
chains in the Genus database with same CATH superfamily
1I24A 3K31A 1R2QA 3MHTA 4CM8A 3UT6A 1WNFA 5HFNA 1J07A 4XUCA 3V2HA 1P4SA 4XVHA 4QVIA 2CJPA 3UYLA 1P6XA 2WJJA 2ZT5A 4NR0A 1XMSA 1Y1RA 3R23A 3UA4A 2VQFB 1E9FA 2OFOA 3RS5A 1IMOA 5FOVA 3T7EA 1W30A 3U09A 1KYQA 2ZJYA 2QX4A 1KGSA 4YV1A 3OZVA 2HSDA 2GEDA 3L0ZA 4US1R 2WJ6A 1GGVA 1KJNA 3COVA 4AYXA 4DSNA 2D1TA 3ETNA 1JNXX 3DKVA 4N8EA 3T3IA 4MUXA 1E8NA 4D8UA 3Q15C 3AHEA 4Q3DA 2I78A 2BEJA 4NONA 4OQLA 3H5VA 3P97A 2VSOA 3TL2A 4RJIA 3TRIA 5SV2A 4KQWA 2ZBQA 2R7NA 5T57A 1QIKA 2J31A 1DCMA 5FDFA 1D8AA 2GQ0A 2JW5A 1DOZA 1NVDA 2QWXA 2ZI9A 3D4IA 4AZ0A 2ZSBA 4ZCSA 5IJAA 3ZTTA 2PDAA 3AKDA 3I32A 4X6YA 5KNCA 3O0DA 4YHBA 3FBGA 3AQIA 3FI0A 2Y76A 1MRZA 3L07A 1DXYA 3PJRA 1TEXA 4GYWA 3T5GA 4FXOA 3TW6A 4DY4A 2ZI7A 4B87A 3R8FA 4DRYA 5LMCA 1VMKA 2CVOA 2QEQA 5B2EA 3A1VA 1ULBA 1Z7YA 2P4SA 4JT2A 1TT5B 3L8FA 1T9KA 4BO5A 5JH7A 4P35A 4CLDA 1OX4B 3O93A 4MV4A 5EE0A 1N92A 3NQ41 3NAMA 3B3FA 2ARKA 1Q11A 2ZDQA 3NUZA 4FFWA 4QFMA 2VH2A 4BU0A 1U1FA 1CDZA 3SXJA 3E03A 4EIWA 2H7YA 4MEBA 3Q9NA 1NKVA 3MRTA 3HJUA 1GUFA 3L4EA 3BBLA 2D0PB 4ZZ2A 5KJ6A 5KQPA 4CDGA 1BWRA 2DR2A 1IWOA 3SZMA 2JBWA 5KYVA 2CHVA 3DBIA 1DWUA 4Q48A 3A6KA 2WSBA 3QKRA 5ITSA 4BVJA 4P5DA 4L5AA 5BSVA 2P75A 1FFAA 4G9EA 5EFZA 3DEIA 1ZZGA 1IY1A 1HE3A 3BIXA 3GP8A 2R5WA 3C5WP 4XWTA 4CPDA 3OSUA 3Q7TA 3KZKA 1YB6A 3MC1A 2PX6A 4Y7DA 4ZQCB 2FK8A 3UB4A 3VAAA 1MNQA 4BVBA 2J5KA 2CK3A 2R6DA 1NFRA 3MCAA 2NOAA 2W58A 3GLIB 4RK6A 2X2EA 1GAXA 1QOPB 1PQPA 1W8IA 1YRHA 1Y5IA 3DZHA 3TRKA 2CLFB 2WB4A 4B9EA 3PQ7A 1T5SA 5L95A 2FI1A 3W8DA 3ZDDA 2PBFA 2GCGA 1GNQA 2OQ2A 1G63A 3BGSA 3W79A 4V3CA 4MV7A 3TZEA 3X1YA 3U7IA 4X92A 1OT3A 3HCPA 4UM8B 3UG7A 3PXCX 2O8CB 2HZ7A 1H3FA 1KFEB 1JHMA 3MM4A 1Y4SA 3EZFA 1Z47A 3IP5A 4FZVA 4XIIA 4ARBA 3TZQA 2ZUWA 1H0RA 3P9NA 1ZPDA 2QTBA 5JDCC 1YNSA 3Q3JB 3BCSA 3INRA 2IELA 3DQPA 2DFLA 1R0RE 2R4QA 3AU8A 1N4AA 1TTTA 1H4SA 1O1YA 4WOCA 3ZX4A 2O8FA 1S9DA 4LBYA 1G4AE 1HQDA 5BRNA 3WV5A 1B93A 1J8YF 1VL8A 4DCVA 4YCMA 1N9GA 2P27A 2O5VA 4RV9A 4G1BA 3ZJUA 3RSCA 2VP6A 2J07A 4ETNA 4RD0A 5BVHB 5AVXA 2OECA 2BFBB 4AP9A 4A6DA 3N75A 1L4FA 1E7RA 2ENWA 4K46A 4X9XA 3NNNA 4NFHA 3E8MA 1ZKDA 3ON5A 4LHEA 4Z9YA 1XZHA 3CX8A 2IYUA 2EYUA 4HAZA 4LE1A 4Q4JB 4D9CA 2ZTMA 1Y8ZA 1H1LA 3QVWA 3W5VA 4MI3A 2CXXA 1ADYA 1ISMA 1Y8CA 3KD2A 1OXVA 1V4VA 1XDZA 1OLXA 3V8MA 5KPDA 2QGZA 4RMIA 1C0PA 5CM8B 4WESA 5TJ9A 4JB8A 4JZYA 1ODCA 3LZDA 3D7RA 3QITA 1WD7A 5JXJA 3W5AA 2C9OA 5KEIA 1MABA 1MAWA 2AC7A 2X8JA 3I62A 4JT4A 4AUEA 1U0OC 2AIRA 3EY4A 3PDIA 4R1QA 3OKCA 4A0HA 4AURA 4K2HA 3ZDQA 3S2IA 1L4HA 1U1EA 3KWLA 1AV7A 1N0IA 3K6KA 1SM4A 4H59A 4MJXA 3D3NA 3GCWA 1I0ZA 1OH6A 3VPAA 4DRZA 2OBFA 3D4BA 5F7ZA 2WKRA 1RJ9A 2B0CA 1LLCA 2XXBA 4N76A 5B4VA 1LH0A 3AH8A 1ODJA 2IXEA 2WJYA 3JATB 2ZE6A 3JU3A 1S8NA 4TTQA 2RGCA 4I1SA 1XP5A 3LA8A 4MIEA 5JHGB 1VE9A 1Q1NA 1PQUA 3QVOA 4HAIA 4DS3A 3JQPA 2JASA 1XQWA 4NH0A 2I8AA 3KAKA 4CT0A 2PJRA 2JLWA 1DNPA 1IONA 1NMYA 2I3DA 4JR1A 4JVLA 2PZJA 1UMCB 1VPLA 5EE5B 1RLMA 4C30A 5A2GA 1UDWA 5IEBA 2G67A 4I1VA 1XJQA 2J9YB 2IEGA 1VKNA 1PJZA 3IMGA 1IZ0A 4TUYF 3UIEA 5ITWA 4MVJF 3K30A 2GXUA 3KD3A 3VZRA 4I9GA 3N8IA 3GZNA 5AKLA 1PDVA 2RKBA 2R8ZA 2Z8YM 2ZYUX 3LX5A 4EJ0A 3G2LA 1BE1A 5DO9A 1MPXA 1RWKA 1Y5RA 4L3VA 1G64A 5K8IA 2IOFA 2GEVA 4RU1A 4DTCA 4FUTA 3RG8A 4R71A 5BW5A 4WLUA 3F2VA 4A8JC 1JEQB 1U94A 1F51E 1DVRA 3EPRA 3TTVA 2WPDD 3NBUA 4IFIA 3M81A 2CV2A 1FYEA 3KLMX 3GJ6A 5KTOA 4ROTA 3USZA 3PXXA 4WLOA 4B4VA 4YXWA 1UIRA 1COWD 2IEYA 3HFGA 3QU5A 4I4CA 1K7YA 4U2KA 1LVHA 5DTRA 1JKIA 1GOTA 2O23A 3TIFA 2AMJA 3SLRA 4BHTA 4NFYA 3SLGA 5B1DA 3FPHA 2FRXA 4XB6B 2ECKA 4F3YA 1PZGA 3CISA 2NYVA 3D2BA 3TQRA 1E6UA 4LF9B 3BTOA 4YDSA 5AM5A 1AMNA 3ZHBA 2ZRHA 1FEZA 2WJAA 1GG2A 1KDVA 4HDSA 2O1SA 4YGXB 1LPBB 4PQGA 2NU8A 2V3VA 3ONVA 1NVWQ 2Z8YA 1S2GA 2F6RA 4JJKA 3L1IA 3AU9A 4R1LA 1G59A 3ADDA 2FSVC 1HEYA 1KI1A 1L7AA 2PZGA 2RHGB 3EHDA 3KSUA 4F4JA 1UBRS 2VSYA 2VPIA 2WBLC 3HDHA 2AFRA 4IBOA 4E09A 5EZQA 4RY2A 2FQ1A 4JYAB 5AHWA 2J9RA 1V11B 4KLCA 2YCBA 2PWAA 3D0OA 4DMLA 4OX9B 4II3A 2CNWD 1KQOA 3FVWA 2OBNA 3K2IA 2YNMD 3N8HA 3OQ6A 2D1QA 1AGXA 4KZPA 4DYHA 3WMEA 1CVIA 4NK4A 9ABPA 2Q62A 4CTMA 3KQQA 4TWBA 1GVNB 3K5PA 5KNDD 4QG7A 4GSLA 3Q5EA 1ZM3A 1ZL0A 2ETVA 4PGHA 4YJHA 5CYOA 2PS9A 3GNQA 4HMQA 5CA1A 3RF6A 3M7IA 2O7QA 3MVEA 2NVUB 1JMKC 1SBZA 4W9MC 1GL3A 4XQCA 2I55A 3FYSA 3P71T 3OCWA 3Q41A 4INPA 2N46A 1DAMA 2PL1A 3DV9A 4G3XA 4OQ4A 1G6KA 2H2DA 3MTAA 3NOXA 1HFKA 4BVKA 5BN3A 3O74A 4BY9E 3FCXA 2O3QA 3N3BC 3QFRA 3SN6A 1NN3A 4PQFA 1Y80A 2PZBA 4A8TA 3L1VA 2WW8A 3MWFA 4CUZA 3S5UA 4L5YA 3QE3A 4M8SA 1IVYA 4REQA 3S2ZA 1VM6A 3SCZA 3EVNA 3TZHA 4D3DA 4YCBA 3HEBA 4IPTA 4E6PA 3CLSD 4DPMA 1Z4LA 2BP7B 2CZGA 2ZIXA 5A1JA 1GGEA 2OHJA 3H1TA 4PGMA 3K0FA 2C4VA 4TS9A 3L01A 5B3JC 4IMJB 5IK2D 1ZVJA 4PLVA 1JJFA 5K6TA 4JHXA 3QWIA 4JT8A 2FHSA 1HE8B 3RYCA 2X9VA 4MWOA 4DILA 2YHAA 3E48A 4NARA 1YWGO 5HKOA 1QVVA 1V1RA 4NCHA 4KR6A 1WCWA 1QIDA 1OV6A 1T2AA 1QH8A 3Q8WA 3R7SA 1WABA 2ZM5A 2PJZA 4TYQA 5DK6A 4H2DA 1KK2A 3PFWO 1C4WA 4OYRA 1WUIS 5HZKA 3SNHA 1M6NA 2OFXA 4YMTA 2GFIA 1WCIA 3MRSA 1BMFD 4UJ5A 2RHHA 4P4SA 2VJPA 3TXXA 4DRXA 3DXXA 1MX1A 3GFBA 1H85A 2VP0A 2HXSA 3EXEB 4G6ZA 5D3ZA 4BGEA 5KYYA 1WULS 2Z8XA 1J0EA 1TIBA 2H18A 1GHTA 4AJKA 3NGLA 4J3FA 1NA5A 3MBIA 2YMPA 3KQKA 4Q3KA 1DKLA 4LOLA 5AI9A 3GEEA 1QIIA 4HH0A 3EIXA 3T7DA 1ZR4A 3V4VB 6GPBA 4K2AA 1RYYA 2HIMA 3IJPA 4JBHA 2RB4A 1HH4A 4NULA 3C70A 3M1YA 3DHYA 3KHTA 2ZSJA 4FYXA 1WY5A 3ZU4A 3ZCTA 4C7VA 5I5EA 2NIPA 2X8LA 3LHDA 1SXPA 5EZ6B 4CR7A 5DLYA 4CQJA 3CRNA 3JQCA 3QXHA 2XT0A 4XD7A 1N3YA 2Q8NA 5CCEA 3QEBZ 5IAGA 3W1EA 4YUYA 1NG1A 2HWXA 1KFJB 2DX7A 4RANA 3AP1A 4X5OA 5EIAA 4UCFA 2A0FA 2CC2A 3OLQA 1GG8A 3ZY6A 1JU9A 1QH1B 2B2CA 2N1MA 3TKAA 2AE1A 2PMKA 1Y5LA 3IEIA 3KVRA 3PQCA 1W1UA 1QV7A 2WT4A 4IIBA 3SC2B 2IZ7A 3DOEA 1N6IA 5CFMA 2G1KA 5ILQA 1Y6GA 4EHDA 3OPXA 1AXGA 1UEIA 1UZLA 2HGSA 4WZAB 2YC2C 3I9MA 3OMWA 4QU5A 3BK2A 1P1RA 2W93A 3SSOA 1E32A 4DUPA 4CV2A 4UE2A 4Y9DA 5L6LB 2BF4A 5TT0A 3TI9A 1KI7A 4P4NA 1I2MA 3NT2A 4GLOA 4LC0A 4MLDA 1O97D 1U7HA 3JZAA 5KC9A 3SBXA 4XAQA 2XB2A 1O0SA 1NW3A 1VBMA 3A3OA 3TL6A 5CBKA 5J4VA 4OH7A 5ILGA 4AMGA 3FTQA 1MB0A 2YNMC 1W0KD 1RT9A 2HLPA 2EW2A 2IK8A 2Z4RA 3GUYA 1CUCA 1KO1A 2J41A 3D0RA 3DOFA 3IAXA 4NOJA 1V96A 4X95A 4ENRA 1MOZA 2B94A 3HPRA 1YT5A 1APBA 2G77B 2JVIA 4FQ5A 2YBDA 5GADl 1EK0A 1PX2A 3HDTA 1JYFA 3CCFA 3MWEA 4B6PA 4BN4A 3FDFA 1HOXA 3RC8A 2OGSA 1T3TA 1U02A 2JDIA 5EUQB 3RIHA 4DIMA 4BQIA 4DSOA 1J00A 3ABIA 3CPEA 3PNSA 4TT3D 3WA6A 2GLUA 4OHFA 1QH0A 3QLUA 2JK0A 4Q4AA 3E8XA 1NBOA 3G8AA 3OEWA 4IWYA 1QRAA 4TLMB 3FDZA 4CIYA 2O3RA 5CU7A 3WDLA 4QC2A 4EGQA 1TTHA 3DAOA 1RRFA 4RVHA 1CZRA 3SEAA 4I9NA 3HXKA 2CUZA 1EFVA 1OX6A 1Z74A 4Q24A 3R9WA 4ID3A 4BLPA 4MPJA 4R2KA 3VAYA 3EIWA 5IKOA 4DR4B 2G08A 4NAVA 3SPXA 4IILA 1QPGA 1R18A 3GQVA 4FILA 3HBLA 2DY1A 3PC4A 1I94B 1C1DA 3D4OA 2MINB 3CEAA 1V8OA 4WFKA 1DADA 2DBQA 3FF4A 1QK5A 3FYUC 5D1NA 2Z56A 5BYJA 3ZLBA 3AR2A 4BB9A 2AG0A 1R6VA 2G8LA 5ALKA 1FYWA 5BSGA 4R83A 4W7SA 2O2EA 3AEUB 2WQ6A 2GPBA 3Q87B 1HQKA 1T13A 4NMXB 1TAUA 4NZZA 1P91A 5REQB 4MINA 2ZUSA 4YT5A 5KINB 4ZAYA 4N7JA 4M0MA 4W5NA 2FMIA 2DPMA 2P9EA 2ZWVA 3QPVA 1W36B 3HKCB 3C5HA 3FB1A 4I66A 3GRYA 3FVVA 4I4TA 2YJNA 4V24A 5ARBA 4WERA 1Y63A 1V0JA 1IHYA 2NU9B 4L6CA 1O58A 4A8HA 3PQFA 5DW3A 1M2OB 1NVFA 3Q9LA 4KPYA 3K0BA 4HGNA 4N1AA 3EGXB 3RVJA 1H65A 2Q3MA 3EDYA 4BO7A 3UB3A 1VG8A 2AJLI 3O2QB 3I2KA 4PZAA 2VNSA 5CUQA 1GLGA 4XVUA 1W4CA 4DMUB 1AKNA 2QUZA 1W2GA 1CIVA 4LBVA 5I9TA 1X1EA 3CNBA 4FJ2A 4F3RA 3A4LA 3IVRA 5E4FA 2G82A 3ITEA 2EJCA 3PD0A 5IN4A 5HXAA 1GTRA 3HI4A 1UZAA 3D6UA 3IPRA 2GKSA 1H05A 4WGFA 5B3KA 2JJ1D 2Z2KA 5D86A 1E1QA 3QSYA 1U0JA 3OD1A 3URKA 2W6CX 5C8ZA 1U04A 1AKQA 4ZZ0A 1QFSA 4KFUA 5EKDA 2H2GA 3WZLA 1DQNA 3TIXB 1CQJB 5B2FA 3ASUA 5LU8A 2RHCA 4MMYB 3SVTA 3A06A 1XMQB 1JHUA 1AT1A 3TAUA 4EDHA 3JR7A 4O2BF 4QODA 3WOVA 1PJAA 1C8KA 1YS1X 4D0SA 4D4GA 1JEYB 3U4IA 4BZPA 1LK0A 1N7GA 2JF0A 2XA2A 4R51A 1CRWG 5DDIP 2V6IA 1ZSVA 1VKZA 3JZFA 3LC1O 5CT6A 3GZJA 3ZI7A 8MHTA 2XR1A 1IM2A 1TTQB 4LWQA 3FTEA 3O4RA 1VZ2A 4Y98A 2G28A 1L9XA 4LYDA 4RAQA 3F78A 4OI1A 2I91A 4IICA 2DAPA 2WFLB 1Q3KA 3HSKA 2GHRA 3UCXA 4L72A 4XD7D 1NF9A 3KFLA 2GEUA 1UJMA 3D6FA 4GQIA 4LJ4A 3UJHA 5JYBA 1DP4A 4HWKA 5DLEA 2BDTA 2YWFA 4YLYA 4AJEA 1QZTA 2RCNA 3BD6A 2JKYA 3DULA 4FC6A 4LGCA 3VR6H 3W9YA 3OFNA 3KZVA 4HPWA 1DTWB 5DTIA 2HDWA 2NP6A 4P9NA 4GM0A 2VLBA 1CQZA 4IVNA 2OENG 4ZCRA 3JWIA 5H8WA 1KRXA 5FUYA 1ZRSA 3O8BA 4AUMA 4Z7QB 3ZDAA 2G5TA 3PFKA 4DQDA 8ABPA 2R1VB 3ROPA 3PHCA 3T3EA 5J3JA 4O2AB 1FNDA 3Q8LA 3E1KA 1IQPA 1Q0UA 4ZEOA 4HAXA 5CFOA 1NBWB 4FOPA 4KUGA 5AIAA 4BB5A 2JFUA 3PL5A 4CLRA 2FY8A 5KKCA 1NULA 4ZOLA 3IQGX 4W7HA 4QG3A 2O3JA 2V98A 3C85A 3DO8A 3GJ5A 3SK0A 2Y99A 2BONA 2J45A 4OIFA 2BFEA 4LJRA 4HN4B 2NZJA 4WCDA 2R4TA 5T4HA 1IN6A 4Y6QA 5F9MA 2WM3A 4R2WA 2NO9A 1BQ4A 1N1DA 2B37A 4KQHA 3ZI0A 1Z0DA 1B76A 1VRCA 3CO0S 4TV8F 3HYCA 3GLGE 3G23A 4FR5A 2IYQA 1UANA 2E6UX 2W4MA 2OVFA 2NZXA 2Y2VA 2ZAOA 4G1VA 3LUBA 1PQ4A 3UT5A 4KYVA 5ICGA 4D25A 1YBMA 2QUAA 4KMRA 4FIZA 2C00A 3W8RA 4CXMA 4DCGA 1DBRA 4DFDA 1DEHA 1O4VA 1UCFA 1E5VA 3LK7A 4UUMA 1T0BA 1OZAA 2JCGA 3OHSX 4D5GA 3DZJA 4K6CA 5C4IA 3JVUA 4RFVA 1PYOA 4N5IX 4ZOBA 4WVLA 5JZOA 2BIFA 3AHGA 4YT8A 3JD3A 3N58A 1P81A 1I4OA 2D8MA 2FA9A 4UD2A 4ZO9A 3SF0A 3VHLB 3WDSA 1YZQA 3N5CA 2HA2A 4TXHA 4Y9RA 4JI8B 4BNUA 2GN4A 5FL7D 3Q4GA 1MDFA 4N41A 2AG6A 5AJVB 1ECBA 4DSUA 3TDKA 1W76A 3QXCA 3WK8A 1MAAA 1QH1A 4GX2A 1PR6A 5KNBD 2WD8A 2GDJA 2QZ9A 5JCOC 5TY0A 3T7KA 1B43A 1LW7A 2OYSA 2IEAA 2ZRLA 2FP4B 4JASB 4KLAA 5AK4A 2ET6A 4FMCF 3TMYA 2V0NA 4O4IF 3WP1B 5J4YA 1HUQA 1LC3A 4WQMA 5ECWA 3M3PA 1Y82A 1G3MA 4DUYB 1P7CA 3CUTA 3AKYA 3NGMA 3PCXA 1NJ2A 2YW9A 3P9PA 5DGCA 4CMHA 4CU5A 3M5PA 4EA7A 1JQJC 1CRZA 1CY7A 3A7DA 2GCEA 2NVUA 3O3NB 4KACA 2DBRA 4NENA 1CG6A 3WZMA 2V8OA 1N0HA 1PX0A 1NW8A 5DHAA 3TFOA 3C6ZA 3JZMA 1DC3A 1EPUA 4L15A 3FNQA 2QTTA 4MP3A 1XRPA 1L5MA 3NOQA 2C2WA 3FPAA 4N4AA 1Y5NA 4E5SA 2C7PA 2XKKA 2XF8A 1M2WA 1BDJA 5ENZA 2I80A 3SWWA 2IIVA 2YWCA 4EYKA 4UPEA 3AEQB 3WYNA 5DN9A 3RAGA 1NASA 1NC1A 1E3SA 2CBXA 3I0NA 1XRRA 4JODA 4W6QA 2YX1A 4AO8A 1M2NA 3QU7A 1QGOA 4ZIRB 4X6UA 3BD7A 3BGVA 3A36A 2X3UA 3NBFA 3EF0A 4CM1A 1J2YA 4TLCA 4FFDA 4AJ2A 5C34B 2X0JA 3FYUB 1WW8A 2QYHA 2UZ3A 3I58A 3CSSA 3LWBA 1X8XA 4B6JA 1WG8A 4HX9A 1LTHR 5IKXA 1V2GA 5I9SA 1NMQA 2DLDA 3I9KA 1RI4A 3T99A 2JJ1A 3JQ8B 1DRKA 3CGWA 1OX5A 3WYCA 4EG8A 1ZJ4A 1GNPA 4N5DA 2REXB 1H9BA 3ZLUA 2HZBA 3E84A 4EW6A 4ZKEA 1DIRA 4UQLA 1IJEA 3NUQA 1GTMA 1ZRNA 1TKAA 2X6TA 1RRGA 1WZCA 4ND5A 4NYIQ 5D85A 3TRDA 1V7PC 2EOAA 4DHWA 3ORHA 2Q6LA 5B6PA 2GF9A 4CM4B 5KYUA 3EIHA 5EZYA 4DGSA 1K3UB 3MQ4A 4Y2TA 5A0VA 4XGRA 4IXNA 5JCOA 5HQ3B 4W5HA 3W7VA 4UFNA 4PG8A 1XROA 1EG7A 2XECA 3NBZC 4H60A 2YXDA 3GDOA 5CG2A 2W6PA 1JR3D 2Z3VA 1XAGA 1TFUA 4GRIA 3DR3A 4QU8A 3E9NA 2AOVA 3INTA 4RAOA 4K1LA 4D3SA 1ZMXA 2R8RA 5IVKA 1WPGA 4S1NA 2XGOA 1DCTA 1IRXA 2P4UA 5I7HA 2XUJA 3G6WA 4CL3A 1EFVB 1ZRHA 3C3YA 1N2HA 1JDZA 2BTOA 2YTZA 3H4VA 1X1QA 1B8OA 1NF2A 1SHUX 2LE0A 4QOGA 4D0RA 3ZCVA 1L7QA 2WDZA 1UBSB 2PA0A 1KYVA 2WWWA 4MS1B 3OQNA 1SCNE 4P7BA 1LQ2A 1QQBA 2BFCA 3E5HA 4PNZA 5HVNA 1I7DA 3OIFA 2FSSA 3M6LA 4E08A 3ZCPA 3ZWNA 3COJA 1F2UA 3RC7A 3FUUA 4C14A 3LFTA 1CVLA 3JWPA 3GUCA 5JDIA 2L82A 4QO8A 4QTTB 5HQ3A 5TARA 2V1UA 2RCYA 5A9SB 2ZRKA 3QPWA 2JHAA 2AFHA 4HUQB 3KSRA 3UA3A 4F3TA 2OO5A 1C1XB 2FOXA 4XOIA 4MQ4A 5AMXA 3THYA 5DE3A 4BLRA 1E1MA 2HIHA 3GAZA 1U7ZA 3P52A 1PSZA 4ZYWA 2ZYSA 4ABYA 3OTQA 4BUZA 1IUPA 4IUYA 5FKJA 4B73A 3E9QA 1D03A 1GLVA 4H3KB 3CPHA 3A26A 3QHAA 4D46A 1LUAA 1P3JA 1VJ5A 3CZRA 4N12A 3BGDA 2ONJA 3RK0A 5KTKA 1KVTA 3H11A 3HZZA 1LV7A 1Z82A 3AWDA 1EMDA 4ND8B 4UU8A 4AJHA 4BBJA 3QOWA 3SP1A 1QCZA 1DCFA 4QSHA 4ZK6A 4RVSA 4BEVA 3UUEA 5JJKA 1DQYA 3HA2A 4AO7A 4RZUA 5HCUA 4R68A 4RJ2A 2V4UA 1I7QB 2A88A 4QLBA 2IQIA 5D5HA 4H7FA 4HDMA 4BO9A 1N5JA 4JCCA 1DBSA 1U0GA 1USIA 2UVQA 1YE8A 3Q7SA 3IUPA 4R2IA 3CE6A 4EGAA 4YQYA 1A50B 2FUKA 1L7MA 2AEFA 2X58A 2QM0A 4I46A 1JWLA 4L5IA 2H8GA 3TIGA 3JWGA 1CBUA 2RIRA 4RK5A 1VE5A 1O96A 2YHUA 2ZBGA 1KDTA 1EM8A 3D3JA 3WLIA 4OMDA 3T9FA 3NHZA 1E4EB 2YDYA 3R20A 3ESAA 4XYMA 4L85A 4KMSA 2IBTA 1PO7A 2NTEA 2I71A 2Q5HA 4KXYA 4L2IA 1ICEA 1XCOA 3K20A 1RKXA 4XDGA 4UVEA 2FW0A 2I1VB 3J7AC 2BELA 3STTA 3I6MA 4Y7CA 3MS4A 5BV7A 3C3KA 3VM6A 2G70A 5LXTF 3HGQA 4YUWA 3IDZA 3VR6A 1GNSA 3RAFC 2UUAB 4BWYA 2V58A 4JKYA 3BCUA 5G4KB 4NMLA 5CK5A 2DTXA 3LGXA 3LW7A 4Z5XA 1PG0A 4QFCA 5IM4A 1ADBA 2F90A 2VIIA 2I87A 1A76A 3EODA 3K2QA 3L49A 4J0KA 3E22A 2PH3A 2JIOA 5D6NA 3T0FA 2NZUG 1NLYA 1EXNA 1SU6A 2DJ5A 5D6OA 2YJGA 1HFWA 3V6MA 1L5VA 2RFLA 3C3MA 4RELA 3RRZA 4GPAA 2BGMA 3OEEA 2PPLA 3RUFA 3DMHA 1EP1B 3QEKA 4PX9A 1FS6A 1GGKA 3DHNA 1DAPA 1H9AA 1ZMRA 2OORA 2ONCA 2LZ0A 4IL5A 3ZQJA 2WAOA 4D44A 3I6IA 1BGWA 2PKWA 2Y0DA 1W94A 3AESA 4DLLA 4XWWA 1J22A 2CCGA 4JDPA 2QQ5A 2HYIC 2XB9A 4R1UA 1VIMA 2W6ZA 5I7FA 1ESNA 3PG5A 4BZQA 3OE1A 1EGQA 2E5WA 3DG9A 4LFBB 4AMYA 4WKGA 1Y8AA 4CM3A 1M2FA 3VYUB 1PK8A 1OQAA 4HFMA 4MARA 3T5MA 1CF9A 1Q77A 3JQ7A 4BLWA 5FBKA 2DQZA 4NIMA 1QGUB 1CNFA 3VO2A 1L8AA 3JR3A 3ANXA 1MVLA 1FX1A 4RZSA 2XNDA 3WR5A 1EQAA 4JQCA 1UR5A 2GZAA 3UB2A 1E79D 4KR0A 2RG7A 3I8OA 3FYUA 1EBUA 4NSNA 2W42A 4IKOA 1T3SA 4FLMA 1U8AA 4FHFA 2I6XA 3T5PA 1E2KA 1SCKA 1ZK4A 2CLEB 1NRWA 3IMKA 2Q3DA 3C98A 4TKVB 5C1DA 4AXXA 4CLRB 4B3MB 2GN6A 1C8VB 1LX6A 2B6NA 2Z2YA 2WAMA 4ZT7A 4CMEC 3KNZA 1ZGAA 4L27A 4LFAB 1RQGA 3Q3GE 3V8PA 4IRMA 1R5JA 4MW7A 4OHKA 4HQ0A 4WN9B 4C20A 4DAOA 3FBWA 5BNIA 5GIPE 1KO8A 3WL7A 2NYUA 1KE1A 2RJ3A 2WWVD 5JNRA 2BFNA 1LB1B 2PQ2A 2V0CA 1AS2A 2OV4A 3GLSA 3PRHA 4JVOA 1R64A 3B6ZA 2YQ5A 4H7KA 3RVBA 2VDLB 3RT1A 3QKSA 2Z95A 5C52B 5BN5B 2PGNA 3TRJA 4DR3B 1YZUA 1LF5A 2A9RA 2ZRBA 3NDIA 3A6GA 4B8YA 1PS8A 1QF9A 1WE2A 3ONDA 4CM7A 1NXVA 3GT4A 4JZKA 3GDGA 3KC2A 3GGDA 4QXQA 2GK7A 4F56A 4OI2A 1QWSA 3ZVKA 2AJCA 3DCJA 4W5JA 1CY1A 1TU3A 4ZDWA 1AMUA 2P2LA 5JYDA 4DDTA 1QQ7A 2ZWIA 2O7VA 3S8YA 4TT8A 4Y0AA 4ZQBA 1QCDA 3ANTA 5LQMA 3BAFA 1IZZA 2A94A 2OD9A 3KJNA 3LY5A 4CLHA 5U4XA 3SE0A 4OQNA 1AQUA 2VHCA 4AS3A 5AIBA 3CVXA 1IOLA 4WBSA 3OZIA 3KLOA 3Q8KA 1PJRA 5I48A 3SKXA 3H2HA 3RIEA 3UICA 2FAXA 3I0ZA 3AIKA 2IYVA 2OSBA 3EBOA 2EFEB 2Y1EA 3FMOB 4UJ3A 1X9HA 3BICA 4LE2A 4M0UA 5H7XA 4C5BA 4XCVA 4OATA 1W85A 4TYMA 3WS7A 2GKGA 4GGMX 4P1ZA 3RRXA 1E18A 1C2YA 5KWIA 2BGUA 2LV8A 2PIAA 3I4CA 4O0MA 1I2ZA 1ECJA 3IVGA 3KOZA 4O25A 1A2OA 3KEMA 1YDFA 2P2SA 4DOMA 3OFVA 1RJWA 4BE7B 5KU7A 4RZXA 2XCIA 4J90A 4RS4A 4QTYA 1AG9A 3CVOA 1BVYF 4KE6A 4S1OA 3RS7A 1N5RA 4EX7A 5C0OE 3MMSA 2QK4A 1MTOA 3IMFA 4HUJA 1S9HA 2NZYA 3T3MB 2BH9A 1ULAA 1TB4A 5H1YA 4P34A 1ODSA 4EP1A 1JDUA 1PWHA 1XTSA 1V41E 2AD1A 4J0DA 3O38A 3EXIB 3TEFA 2B99A 3F7OA 3HB0A 1HZZA 3LOUA 5A9SA 1D9ZA 4XWOA 4Z4EA 3GEIA 4BTVA 2I9PA 4PAOA 3K70D 4L5BA 2Q7DA 2L0XA 4LX8A 4EITA 3F5QA 4KX3A 4NKRA 2LP4Y 4B32A 1XDUA 3FMFA 4KXFB 3QJYA 4ZTZB 1L5KA 2IP1A 4X60A 4TLEA 5C7IO 3IMCA 4IDNA 4NH4A 4ZMSA 1SKMA 1Q0TA 4PCUA 1R50A 1YH3A 3IURA 2WHEA 3NC0C 3ZNPA 1BOFA 2FZKA 2Y93A 3VVBA 1OROA 2LCFA 1FDTA 3EISA 3VNBA 3ZGXA 3UMYA 5D51S 1NLMA 5EZ5A 1QYRA 1TU4A 3MAGA 2GCOA 1ZC3A 3DDNA 1TPYA 1J2TA 3C5VA 3A8TA 3NP7A 4HQFA 4OXXA 1KOGA 1FMJA 5EEHA 1NHGA 1DTEA 2AWOA 2Z3WA 3E0XA 3JYLA 4Q7JB 4F6RA 1GDTA 3WC4A 3G2OA 1AQYA 2O50A 1ENOA 2VG8A 5HHTA 3LM8A 1II0A 4MW4A 4AZWA 4IQ0A 2CXQA 4CF4A 2I8CA 5CT9A 2HUNA 4XVQA 1C41A 2P1RA 5EZYF 3IIEA 3OCVA 1M5UA 1YQWA 3CS3A 2F59A 3F8TA 3NC1C 4MQMA 1SXJA 4AX8A 3PWSA 1W34A 1YA8A 4E2WA 5ICEA 4N3CA 3WSVA 1R8JA 4UU1A 3L02A 5J58A 2QTFA 3IEVA 2O8DB 2OMKA 1P7WA 3X1JA 1R8QA 1PR0A 5KZMB 5F23A 1AUPA 3C3AA 4NJMB 2WIGA 3W4IA 4QUBA 2A78A 1HF3A 4J7XA 3N2EA 1FZQA 5EUMA 2VWGA 1E62A 4Q1EA 1EHCA 3E3NA 5EJEA 2EX4A 5D2CA 4UCWA 2XUQA 5G3YA 2WPNA 3KT3A 3KT0A 2VHQA 3N8GA 4R2HA 3ZWWA 4AB1A 2O5RA 4EGFA 5I3CA 1HX7A 5I9LA 4PE5B 1EXWA 2VT3A 4NHOA 1ESZA 1RHMA 4KO8A 1ENPA 5E1BA 5I8ZA 3SICE 2C61A 2IYNA 1QANA 1K0UA 3NBYC 2BZ0A 2GSWA 4XGKA 4FSHA 3G1TA 3ISTA 1DXHA 4YV2A 1ZR2A 5ABPA 2DLNA 4BJ6A 1R4AA 2PEZA 1UDXA 4U02A 5IF3A 1US8A 1H22A 4R2LA 1EB9A 5DYGA 5IBQA 1NE2A 3PUZA 3U13A 2F9FA 4NHEA 1D2CA 5CAEA 4B4WA 1SGWA 3M6VA 5B7GA 2FUCA 3BG5A 3UK2A 4MMXB 1THTA 1QP8A 2J4CA 3SMQA 2YJZA 4NZPA 5ELMA 1R0ZA 2WLTA 5TB5A 4K1XA 3RSLA 4IX1A 1K4MA 2AT1A 1F9EA 2NVBA 3HVIA 3GEMA 1C9YA 3SQNA 4DIOA 3GJ7A 4UBJA 2C4TA 2XADA 3UY4A 4U63A 5TQVA 1O5OA 4Q05A 1DJMA 3ZS8A 1VPEA 1F4PA 3M4NA 3BD8A 2C3YA 4RPIA 4RVGA 4TN5A 3RVDA 1OH5A 1VSQA 5CD9A 4I1UA 2F3RA 2EKDA 4JEMA 1ECFA 1RS0A 2CZQA 3O2SB 3T52A 4MVJG 1KJZA 2V45A 4AIIA 5IK2A 3I9V6 3GVCA 2Z1DA 3AF0A 3ZHXA 2XWJI 1UXGA 4ALJA 4Y1RA 1WQ4A 3KVYA 4ZAXA 2OCLA 1RI3A 2FQXA 5H59A 5GJWC 4CG0A 5HIKA 4RETA 1U31A 4FE4A 3AR9A 2F3UA 1C3OB 2DPHA 1E3WA 1JQ3A 3W6UA 1RWMA 3BFXA 3IDAA 1E9AA 1LJLA 4MKIA 2PT5A 3SQLA 4D92A 1ZW1A 2R8PA 3BMCB 3OUZA 1U99A 4CHTA 3W9UA 3WQBA 3ZHSA 5BWMA 4PWYA 3BWDD 4MW1A 2MMGA 3CG4A 4IXTA 1V9SA 1ZOLA 3FPJA 4JYCA 5DYYA 3VZDA 4NQZA 5GOZA 5TDHA 3HC7A 3VU1A 1Y4DE 3MCVA 1C3XA 1OPXA 2WOOA 3OFSA 1HA3A 5FNVB 3LJKA 3ZXYA 3OO1A 4YCAA 1GT6A 4LF8B 5EJ6A 1M1ZA 2A0WA 2VSXA 3AZPA 3C5CA 2J0EA 1JAIA 2G9ZA 4M9SA 1YUBA 3VPCA 4ZT6A 4G0WA 4MVJE 3UHPA 1Q0SA 2Q3HA 3Q8XB 1DC7A 1LTQA 1SBTA 2Q5JA 3NJRA 1Z8HA 4MUHA 1PS0A 3MD0A 2QA5A 5FBQB 4C4PA 2EXXA 3ISVA 3HMKA 4YP9A 5DT2A 4TL6A 1OI4A 1S8OA 1T2VA 1XKTA 4D4LA 5JW6A 2FP3A 1KEKA 3N2GA 3VV2A 3L8YA 3T41A 5JJBA 3IOEA 2F3TA 3ES9A 4H17A 3S8EA 2HA0A 3EASA 4CODB 1W1IA 2B4RO 2H17A 4A6XA 4NZYA 4DDUA 4JGBA 4PV7A 4J0GA 1VPTA 1ZJWA 2GAIA 4PZYA 4LRYA 1JVBA 3RV4A 3Q72A 1M6EX 5EIWA 3HHPA 2EP8A 1P7VA 4FX2A 1F06A 3HVKA 4DWOA 5KJFA 2PRYA 2XUAA 3L92A 4N3GA 2Z30A 1PKEA 2RGNA 4LF7B 4ZVLA 4B4KA 3WKEA 1R1DA 4B0PA 3DLHA 4Z86A 4FGUA 3W1VA 3PRJA 1DRUA 2FZ4A 3H7AA 4KGVA 5JDCA 1GQFA 3ZJYA 2LWIA 3VDNB 2V4MA 4J7UA 4BKUA 4IH9A 5EXPA 3WGHA 1I5EA 3LKBA 1V6SA 1YBAA 4EARA 4GBJA 4EB6B 3TJRA 4NBNA 4JP8A 3I5AA 3LUAA 1LPMA 2X76A 1K89A 2D54A 3UHOA 5JIBA 1HORA 3R9XA 5CRIA 1G8SA 2F43A 3LH5A 2FW7A 1B73A</