1DBSA

Mechanistic implications and family relationships from the structure of dethiobiotin synthetase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
b'SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
molecule tags Biotin biosynthesis
source organism Escherichia coli
publication title Mechanistic implications and family relationships from the structure of dethiobiotin synthetase.
pubmed doi rcsb
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1994-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dbsA00
5LD2B 5HE9A 4P32A 5FTLA 1X86B 3GJ4A 2EFEB 4UNSA 1U94A 3FMOB 1NIJA 2AR7A 4QM6A 2ONKA 3TR5A 2WSMA 3QPWA 5K8UA 1KHTA 3PUVA 3W3ZB 3EZ2A 4JJZA 2HDNB 1IONA 1U0LA 1W0JD 2V8OA 1DPFA 1KO4A 3SC3A 3BS4A 3QKSA 1B23P 4NMMA 2RGNA 1NF3A 1NG1A 2ZI3A 3B6EA 2IS1A 3VKHA 1LB1B 4E03A 4ZDIA 1KDPA 1FNNA 4LOAA 1DS6A 1OFHA 1KI9A 4PO8A 2AXPA 2XXAA 4M4SA 2YWFA 4PSAA 3CB4A 3BERA 2YWGA 2ZR9A 4IDHA 2KWIA 4Q4AA 3EPLA 1P2TA 2CHVA 2G0TA 3RRMA 1SHKA 1TUEA 3BOSA 4TMVA 3EIQA 3IIJA 4JIMA 1QHGA 4LYHA 4XOIA 3R9XA 5JRZA 1YVDA 1T8TA 3EC1A 5FBLB 3U7EB 1ESNA 1GP2A 2X1VA 3OHMA 3G82C 5G53C 3DKVA 4UNPA 3A4LA 2ORVA 4EIWA 2KE5A 4A6PA 2BBSA 3TNFA 4X8LA 5DHFA 3LO5A 1OKKA 3WBJA 4GT1A 3A1VA 1IM2A 1YRBA 4GMDA 5CJ2A 3DO6A 3BXZA 4NYJR 2JA1A 4A6XA 1CRQA 2QSZA 4RD3A 2MSEB 1VG8A 4B2IA 4GL2A 4FMCB 3RANA 4EDHA 2WBLC 1YR6A 1VG0B 3W3AA 3U4QA 3UXMA 4N0DA 4HI0E 3P32A 2IEYA 2JJ2A 3HWSA 1XEFA 5HE8A 4KXFB 1EESA 3HYRA 3KKMA 2I1VB 1F2UA 2GEVA 2FWRA 5TDHA 4CT5A 3WNBA 4FI3C 2RKOA 3A8TA 3NKVA 2O8BA 4Q9JA 4LHYA 2D2FA 2DWOA 4TN1A 2IL1A 1C1YA 3L8YA 4JSTA 5EUMA 2IXFA 4EAQA 3C8UA 5C4GB 2ZUCA 4Z1MA 3F3YA 4MRNA 3GLHB 1KY2A 2C95A 2NZ8A 2IYWA 3MSXA 4RSGA 3UMFA 1YZTA 2QGNA 2ZXUA 3SZRA 1E9RA 2FE4A 2B6HA 2GWHA 4RKFA 3TW4A 4ZDKA 3G0HA 2J45A 3THOA 2IXGA 5AJYA 2DFNA 5E7IA 2IUSA 1XCMA 2O8EA 2BCGY 3KUCA 3AKEA 3AVUA 5TARA 2O5VA 5CB8A 4IVRA 2PCJA 5JRJA 1E2LA 1A2KC 4LBWA 4Q1FA 4Q9LA 2AN9A 3LBNA 2RGAA 4UXJA 2Z5FA 1SVKA 2C03A 1CBUA 2VHTA 2XB2A 2YJTD 1IY0A 4C0HA 3A4MA 4TMKA 3BJIC 3NC0C 4QC2A 4NYIR 4LDJA 5FUXA 3ZVLA 4DB2A 4Q4LA 1KMHA 1ZU4A 3CF0A 2IYTA 3OZXA 3W9YA 2CXXA 3H1TA 1GVNB 1D9ZA 2R9VA 2PLFA 4HB2A 5EE9A 4DXAA 3GLIE 3SYLA 3KTAB 4E07A 4JVSB 4KLNA 2RGEA 2AD5A 1KDTA 5KO2A 4E09A 3CNNA 3BORA 1KAGA 3ZIAD 3PVSA 4JKIA 1HV8A 1RYHA 2HJVA 2JIZA 4OQNA 5HPYB 3BH0A 5FPKA 1GL7A 3FKSD 1N6IA 3QKUA 2BBWA 2VHUA 3CONA 2CJWB 4D2IA 2NGRA 3U3RA 3U6KA 3R7WA 1XP8A 2R44A 2PJRA 2YOGA 1W36D 2VRWA 4XD7D 3ZD7A 4TTQA 1FFHA 4PO1A 1E9FA 4DEXA 2QTHA 2YWEA 3P20A 2PX0A 4RCZA 3ZD6A 4R71A 4NZYA 4RZ2A 2UZIR 1NMXA 2XTNA 2OAP1 4LV5B 2QENA 4HB4A 4Q4AB 4UNNA 1SVWA 2CL6X 4WXRA 4D82A 1SQ5A 2QTFA 121PA 421PA 2OE2A 4KI0A 2G1JA 2ZS9A 4MKGA 3I8SA 3X2SA 4D4KA 4B6EA 3H0KA 3B2EA 3F8TA 3THXA 3AP2A 3C4JA 2JAQA 3B13B 3HP1A 3PFIA 3QKSB 3ICQB 1PVOA 1E3MA 1IXRC 4DEYA 3T1VA 1ZD8A 1DARA 4URWR 4JJKA 4HLQB 1PUIA 2W0MA 3DDCA 1XTIA 2UZ3A 3EZFA 3DL0A 3A1WA 3CZPA 1OJLA 1G17A 2JJ8A 4D26A 4AKHA 2F6RA 1E0AA 2BMFA 4CVNA 1OE0A 3CRW1 3QKTA 4F92B 1U90A 3EZ7A 4CW7A 2DWPA 4DLZA 2ZJ5A 3GJ7A 1CJKC 1PZNA 2QA5A 2GXAA 4MGIR 3IPXA 2QAGC 2YZ2A 2G1KA 1DBSA 5AJWA 2JJ2D 3EA5A 4TZ0A 4Q4HA 3WP0A 1QZXA 4BLSA 3GLGB 1NN5A 3BH6A 1EFUA 2YHSA 5EE5B 4MRSA 3TK1A 4OHWA 2VTKA 1KAOA 1Z6XA 1DAHA 5DN6D 4AKGA 1TU4A 1E32A 1XXHE 3AV0B 2QPTA 3M6AA 4WZBE 1W36B 3NBXX 2QP3A 2RHMA 4Q48A 1OIWA 4M9XA 5CK4A 5FPSA 4YMTA 1VYTA 2MMCA 2QBYB 1NVVQ 1W4BA 3QIAA 2W2TA 3N2IA 3MWJA 4A9AA 1M7GA 4ZI2A 2VSOA 4Q1CA 2XEXA 2HCBA 4XSHA 1N6PA 4AYWA 3A37A 1OXVA 1UADA 2GHIA 4WOPA 5BYKA 3DMNA 4URYR 1S0UA 3KZ1E 4BZXA 1CF4A 3AB3A 3B9QA 1LVGA 1RE0A 1QVAA 2C8VA 4KODA 4M1OA 4A8JA 3OIWA 3KXIA 1WBBA 1KI2A 1E2JA 2WIBA 3KKQA 4IOLA 1AK2A 4ZDJA 4Q1AA 4OQMA 2QSYA 4TQUS 4W9MC 2ECKA 4ASUD 1XXHB 4DSOA 2OXCA 2BC9A 2WKRA 1WP9A 5KSPA 3SHFA 4DCVA 4Q18A 4GMXA 4TYQA 1MO6A 2DHRA 3BAFA 3KXKA 4BGDA 1NBMA 1XZQA 2IX3A 2QT0A 1NI3A 5EZ6B 3ASZA 2ONJA 3HR8A 4DC9A 1AN0A 4B3GA 2C96A 2F1HA 1OIXA 4A1FA 3KX2A 3QBTA 1U81A 1E79D 4M9ZA 3TE6A 1P2SA 1KMHB 3BWDD 1KSFX 2OLJA 3MD0A 4LJYA 3O47A 3C16C 3EASA 2QMEA 4ESVA 2D7DA 3THYB 4D25A 2WWFA 2R6GA 1XJQA 2ZRDA 3NH6A 4J0QA 5TB5A 2J0UB 4E5UA 2QPOA 1UDXA 1W46A 1ZNZA 3L8ZA 1F2UB 3LWNA 1KSGA 2ZYWX 1TQ2A 1EK0A 1DG1G 3W5IA 4AURA 4L5BA 1T0HB 2W6IA 1ANKA 5DISB 3EPHA 1KO7A 1W5TA 3B1YA 4NBSA 4LYJA 3EWAA 1F5NA 1LF5A 4H1VA 3EZ9A 1J2JA 3DPUA 4CGZA 1BO6A 1D2EA 3OF5A 4M1MA 1VMAA 3KTAA 2WWGA 2R65A 2FNAA 2G88A 2ORWA 2P5TB 1HE8B 4CEHA 3WMFA 1IJFA 3MWLA 1N0UA 1W4AA 4CEIA 1II0A 4PC1A 2PZFA 2QTVB 2VP4A 3LQRA 2G77B 2HYDA 2AFIE 2WIAA 2O52A 4EKDA 2NPIA 4W5WA 4JBYA 4PQFA 5BXQC 1MO3A 1ZIOA 2DY1A 1KDOA 2RGDA 3REGA 1D8TA 2DYKA 4DCUA 5LB4A 4B2LA 3HU2A 5DSZA 3TSOA 4PQRA 5CYPA 2AXNA 3SR0A 1JNYA 4LPSA 3FHTA 4ESHA 2H18A 1XRJA 2Z83A 4LY6A 3FDIA 3M4YA 3LA6A 3GLHA 3OIYA 2VP9A 4FCVA 4PHFA 3KKNA 5JSZB 3HU1A 4BZQA 1T3LA 2ANCA 3SI7A 5FOXA 2JLQA 1KK2A 4LC1A 4M9QA 3TQFA 3OIUA 1ZNYA 1W48A 1KTVA 2PEZA 1N6LA 3GFOA 3QVUA 1QG2A 2QGZA 1DTSA 4K81B 1OHHD 5JS8A 1CIPA 3K53A 2OT3B 1NSTA 1Q0UA 1UM8A 2B8TA 4TYPA 3BFKA 4JSYA 1G9XA 1XB2A 3CKLA 3RHFA 4AKEA 5BYJA 3SE0A 1Z07A 2G6BA 3B82A 4Q4HB 5CLLA 5FUWA 2OFWA 4L15A 5BWMA 3TAUA 2GJ9A 2OUKA 1OT3A 1E98A 1Q22A 1G7SA 4GI7A 4HAVA 4P0TA 3ZZUA 4Q7KA 4R98A 1FX0B 3GFPA 5FOVA 4KITB 3QG1A 3NXSA 2GK6A 3NH9A 3QJYA 3A1TA 1TF5A 1SVSA 1Z0JA 3KUDA 5HTKA 2ZVQX 4B73A 4EPXA 5TV2A 2IYLD 2B92A 4L16A 2IUUA 3T06B 2XZOA 2O8DA 1ODFA 3PEYA 1Q1BA 2H1LA 4M8NE 4DDWA 2QP9X 4B47A 3OEED 3D8BA 1E4VA 3BD9A 4BE7B 4JLVA 2ZITA 3MRSA 1MO4A 3NIBA 5SZHB 4O2RA 3PG5A 5KPJA 4FD2A 2VP0A 3VKWA 4P4TA 1OLOA 4JLDA 4QOSA 4Q5IA 5EE0A 4A36A 3L0PA 1VDZA 4P4SA 2C2HA 1P6XA 1FX0A 1XTRA 1VKJA 4HATA 4BFUA 3B60A 5JEEA 2ZYUX 3IIMA 2QRZA 3UWKA 4EUNA 2NQ2C 3EARA 2NO9A 2ATXA 4Y0AA 4XIGS 3RLFA 4C9BA 1XEWY 1H65A 3QF7A 621PA 1P9WA 4XH9B 4WVFA 1EFCA 1J7KA 2VP2A 3VU9B 3RWMB 1GM5A 1TMKA 2GESA 2EYUA 2J9RA 4MGYR 1JPNA 1LNZA 4DDUA 2F3TA 4PSVA 2LCFA 2VYFA 5G41A 1GWNA 4C2UA 1OF1A 3QPUA 2IA5A 4M1TA 1ELOA 2WWIA 4BFZA 1SXJE 5HKKD 1G1MA 3IDQA 3VR1A 3CPHA 2WZQA 1KI3A 4PANA 2ZJYA 4CRWB 2RMKA 2YYZA 3C14C 3GQBA 5EP1A 1G3RA 1HT1E 1Q21A 4FMDF 2WPDA 4HLUA 3AKYA 2VP6A 4N0EA 2V54A 3AF0A 3HU3A 1Z2AA 2OBNA 2JATA 2FX3A 4LHXA 3S1AB 4HUTA 3PIRA 3KQHA 2BDTA 1GITA 1VCMA 1K5GA 4EPRA 3WRXC 1T0JB 5JECA 1AA9A 2AKAB 2DWQA 2QROA 1EGAA 1G4UR 1M7HA 1Z6AA 1VECA 2BMDA 2IYYA 2FJUA 2JLYA 2V1XA 4LC0A 3ZJYA 1UDWA 2IUTA 2EFCB 4MUAA 4FWIB 4F4JA 1SULA 2J3EA 4AWXA 3AGPA 1VG1A 2ZR7A 2FFQA 3OIVA 3T61A 1VCIA 2PX3A 2CMKA 4ZPXA 1CR0A 1JBKA 1LW7A 4ZDWA 3AVYA 1W5SA 2HXYA 1GZSA 2ODEA 3E5HA 3W6NA 5C1BA 2UKDA 4OJKA 2G83A 1SHZA 4DUGD 2QAGB 1OXXK 3HDTA 1OFTA 5FOSA 1S1MA 4PSKA 3CUEF 4FCTA 4Q21A 5C18A 5J5CA 4BFYA 3VR3A 2J0SA 3DOFA 1E9EA 3CWQA 1MABA 4FMCF 3CR8A 1E2EA 2ORIA 4IOMA 2QPAA 1CU1A 5HCNA 5H1YA 5C4MA 2YWHA 5IRCD 1U2RA 2VSXA 4LK2A 2B7CA 3B7GA 4I1VA 2BMEA 2ZE5A 3PEWA 3FWYA 1YZKA 4NPHA 1PLLA 5FR1A 3KQNA 4JL6A 5J47A 3NDPA 1W47A 2AWNA 2RAPA 5EE3A 5FUVA 2ZANA 4NCHA 2HJGA 2BCJQ 4RD6A 1L7VC 2WJYA 1TTTA 4D80A 1RKBA 1JJ7A 1E2PA 1U8ZA 3PEVA 2QAJA 4LPKA 2GAAA 5KDLA 1HY3A 1UEIA 3QVVA 4JLMA 3R9IA 3QQ5A 3SQXA 2B8WA 4R2HA 3GCGA 3AVXA 3VHXA 2G9NA 3Q72A 1ETUA 3OFNA 3QNUA 1CR1A 5F98A 2O8CB 1AS2A 1GIAA 2GKSA 1JQJC 1VIYA 4IOJA 2GRJA 4H9GA 1KO1A 2EFHB 3T34A 3MJHA 3QPVA 3H4MA 4NCNA 3RC3A 1UBEA 2IYXA 2BM0A 2ODWA 3VR4A 1FTNA 4BEJA 1G7TA 1ZNWA 4MKFA 3IEVA 4OI4A 3K70D 3CRMA 5JWHA 4NHOA 3I5XA 4EPYA 2WM9B 1NMZA 5K8IA 1JR3D 2GCOB 2IYSA 3MFYA 1FNMA 3E1SA 1AJEA 3A36A 1QHSA 1TQ6A 2RGNC 3CF6R 1OXSC 2PT5A 4KHZA 1WCV1 4D4JA 4LBZA 2D7CA 2Q3FA 5LPNA 3IKJA 4KFRA 5AK0A 3GJ8A 2VQSA 4RZUA 5EP4A 3THWB 2AFHE 1E96A 3I8XA 4URXR 3PUYA 1DOAA 1R5OA 2F43A 3PQCA 2Z6VA 4MA4A 1G6OA 1NL3A 2B7BA 2Q3HA 5KDDA 3PJRA 1MT0A 2XB4A 4O25A 4ZKEA 2GTPA 4XTRA 5JMTA 3LLMA 3CWZA 4KYIB 2W0SA 3TUJC 5C2JB 4QGHA 2XZLA 1P2VA 3AUYA 4GZLA 2HT6A 4IFEA 2VH5R 1L8QA 2IT1A 2FSFA 2DFLA 2FPKA 4TQAA 2J0UA 2A5FA 3WY9A 4ZCIA 1Q1EA 1TEVA 1GDDA 3AVPA 1VPLA 3SOPA 5CYOA 1ZJ6A 2GEDA 4M2LA 2FZ4A 1F6BA 4HAUA 4AG5A 2IS4A 1WMSA 2GVDC 4C0KA 1W49A 1N6HA 2JLUA 2GBLC 3K0AB 4RFSA 5HCIA 2C9OA 1ZM9A 2ZRJA 2OESA 3F5FA 4QGFA 3RS3A 3SS8A 4ZCMA 1DE0A 1P9RA 1GFIA 221PA 4QNRA 5JHGB 1KJYA 1G7CA 4OI1A 4JL5A 1HUQA 1RJ9B 4AC9A 3NWJA 2XJ4A 5CLQA 1NKSA 1ZU5A 1HQYE 4LJ7A 1IY1A 1MKYA 1JXOA 2IF2A 4Q19A 5FPYA 5BN3A 4RY2A 5AJVB 1U8AA 4B2PA 2D4HA 3FMFA 4PAMA 2JJ1A 1V5WA 4PHTA 5L8VA 1UF9A 2N1BA 2Z4RA 3EPKA 1A5TA 1NRJB 3WYGA 1GSIA 4LWZA 1L4YA 2CVHA 3N5CA 1XMVA 4A8JB 2D3WA 1KNXA 3K0CC 3MAAC 3TH5A 4DLYA 1EWQA 1JEDA 3R9WA 1WE2A 4UKDA 1H8HD 1N2CE 2J7PD 4HDCA 4U7DA 2DFTA 3FB4A 2PMKA 2ZI6A 2PZEA 4TQ9A 3B1ZA 4YC7A 3SNHA 2AL7A 1W0KA 5FOUA 1E9DA 3U44B 2WV9A 4C7OA 2WWWA 3MJRA 3ZQJA 1W7AA 3TBKA 1C4OA 2IC5A 5CB6A 3IGFA 1BOFA 2P67A 3TW8B 3K9LA 1IN8A 5JHHB 5H68A 2HXSA 3WNDA 1XCPA 1EXMA 3A1SA 4WAUA 4AG6A 2K5UA 4GP6A 4X8MA 2FZLA 4LV6A 1JALA 3AM1A 1H8EA 1SXJA 1T91A 2W00A 4LJ6A 2O8DB 4OK5A 4B33A 1QHIA 1SGWA 4QJ3A 4X8HA 4M1SA 1X1RA 2QZ4A 4URVR 1FQJA 1IHUA 1QHYA 3B1XA 4I99A 2XZPA 3KQLA 3MG9A 3SFZA 2X2EA 3I62A 2W58A 3TMKA 4HB0A 4OBEA 3VX3A 4NONA 3UKDA 2R6FA 4LRWA 2E87A 5EXTA 4F93B 1R5NA 5A5GA 2ZRHA 4KO8A 5IK2D 1ZC3A 1XMSA 1I4DD 4CEJA 4ZCLA 2CK3A 1RFLA 1LF0A 3TLXA 3AVOA 2FGKA 2IYRA 2IK8A 4EJSB 4TYWA 3NC1C 1GRNA 2RGCA 4C7OB 4QBHA 2WAYA 5FPHA 4BPBA 3BB4A 4IXNA 5DIFA 1EFRA 2RGGA 1M34E 1Z29A 1P2UA 1Z6TA 1OHHA 3DVLA 2EFDB 1E2MA 1CTQA 4PTLA 3W34A 3AEZA 3MWKA 2BKEA 5FPTA 1TQ4A 3T5DA 1KO5A 3DHWC 1TQDA 1F60A 2RB4A 1YR7A 8OHMA 3W8NA 4DIDA 1S3GA 2NOAA 1US8B 3CR7A 4GRAA 3BB3A 2KSQA 2JDID 2J7PA 2I1QA 5BN4A 1XD2B 3RRYA 1EFTA 3X1DA 3CRVA 4JVLA 1KGDA 1Z5ZA 3EWSA 3LAWA 4OHZA 1V43A 2O8EB 5KPDA 4JYCA 1BH2A 2ODNA 1JR3A 2FG5A 4MUBA 4C0QC 4DRZA 4OL0A 4NYIQ 2REBA 4DBLC 1XU4A 3PUXA 2IWRA 3RYTC 1JEEA 4AI6A 4IVPA 2IWHA 1GOTA 1RPZA 2WVJA 5L3VA 3CNOA 2R6DA 1ZIPA 4EPTA 1GL9B 3NBZC 5F2EA 2QEQA 3KB1A 4RKEA 4TLDA 1GNRA 3ZZ0A 3ZVMA 5IT5A 1XD2A 1E69A 2ZRCA 2ZUBA 3KL4A 2CNWA 3GJ3A 3L43A 2QUZA 4B43A 4XWAA 4L9WA 5IK2A 3SJAA 1E1RD 4MRVA 2RCNA 1DELA 3EXAA 4K8OA 4V0NA 2CHGA 4BFVA 4TLEA 1BYIA 4ASUA 3K1JA 1IBRA 2YOHA 3TSWA 4QBGB 6Q21A 2DCUA 4DLUA 4RFVA 4DSUA 1DO0A 4KLZA 1OW3B 3B1VA 2OAQ1 3B85A 2XJ9A 1W44A 3GEHA 4KU4A 1WRBA 3TUIC 3V00A 1KK3A 1XMJA 2FOLA 4B6FA 1BS1A 5HZHA 5KOYA 1KK1A 4DB4A 2P3SA 1HTWA 3ONWA 4W5JA 2NIPA 3GJ5A 4HSEA 1G21E 1A4RA 3KJGA 1TAGA 4DLWA 5EE1A 2FSHA 4Y0VA 1DEKA 2IYZA 5KNCA 1RZ3A 2CL0X 4Q7JB 1QHNA 4P4SB 1ZYUA 4QJ5A 4OK6A 5FTKA 2H57A 3O8RA 3VR5A 2W2XA 3K8YA 1FMJA 4G3XA 4TL9A 5GVRA 1NNEA 3GMTA 2BEJA 5DI3A 1G3MA 2ZIAA 4MKIA 2R6CA 2NMVA 1AM4D 2D74A 2A5GA 1X3SA 3Q5DA 1FTSA 4G0NA 4OI2A 4YQFA 1XPUA 1ZD9A 2XOKA 2ZAMA 3LY5A 1NY5A 3EAQA 1OV4A 1GRQA 2CEAA 4P3YA 2ATVA 1ZUNB 3EW9A 2O8BB 3REFA 4JYBA 4KJZA 1Z47A 3RAPR 1ZUIA 2D62A 2ZYVX 3D31A 3W90A 3QI2A 1G7RA 1ZMXA 4Q1DA 3THXB 5DH9A 1HE1C 1YE8A 2VSFA 3RABA 1TNDA 1XEXA 2EU8A 4QHSA 3ZGXA 5FL7A 4GSYA 2ZE6A 5CJPA 4MYCA 3K0FB 5J4LA 4BLOA 2P65A 3PV0A 2GAOA 3U7HB 1NVVR 2CLSA 1XD8A 2GXSA 2OCBA 3K0AA 3NBFA 2BJWA 1XDBA 1EX6A 2H16A 4RFSB 3EX7C 1S2MA 3RS0A 1KO8A 5GVSA 1XPOA 4S2EA 3NHAA 1M74A 4XVQA 4DWJA 4IRUB 2PJZA 1AKYA 1G5RA 1XZPA 3AF1A 2YC2C 1UAAA 1QDEA 3HPRA 3T35A 3U6BA 1R5BA 1P3JA 2ZUDA 4KBGA 4DLVA 1SXJD 1KNQA 3VU9A 3LBIA 3CZQA 1I4TD 4FINA 2VEDA 1Z63A 2WWXA 2IXEA 4RZXA 1MOZA 2H17A 4C0AC 2P6RA 4JT2A 3SBDA 2QY9A 1E9AA 1J70A 1G20E 5D3QA 1DAIA 3GD7A 3SBEA 1CR2A 3WHLA 3ZIAA 1N5KA 2DFKB 3IO3A 4Q02A 1P7CA 3QEJA 4KVGA 2I3BA 5KYKA 1XTJA 3X1WA 2EQBA 3BFXA 4ACAA 1IJEA 4UJ5A 2RH5A 2GF9A 4QL3A 2A7QA 1XPRA 1N0WA 3MMPA 4CT4B 4JVNA 1VTKA 4G5QA 4KFSA 2WKPA 1TF2A 4ZI3A 3ZVNA 2CE7A 1E2GA 1E9CA 2H5EA 2GCNA 3VQTA 3BGWA 3CX6A 4NH0A 4PHGA 4TYYA 5KHOC 3IHLA 3B5JA 5CK5A 1FQKA 1G8FA 3WMEA 1VYVA 4TSFD 5EP3A 1ZINA 2IBMA 3OEHD 1Z8FA 2G3YA 1RJ9A 5KSOA 3J81k 1Z3IX 2NO1A 2CCJA 4M22A 1R7RA 2XSZD 2GK7A 2ZVPX 4KFTA 3ZS8A 5JI2E 3L0IB 4B3FX 2BKUA 4Q4JA 3LXXA 4DT1B 2Z43A 5M04A 1ZM2A 3GLGE 2Q6TA 2FFAA 5JS7A 2LWIA 2EW1A 3QG5A 4WIAA 1XEWX 1CJMA 4BFSA 1T5LA 2PCLA 1XEXB 4YMSA 2WMOB 2V4ZA 4JMPA 3R20A 3HPQA 4IKEA 1CS4C 4Z54A 3FHCB 4QHTA 2QT1A 3IBGA 3K9GA 5DNYB 3KQKA 1CJVC 1IQPA 1K8RA 2GXQA 3F0TA 2WOJA 2VHJA 3B8HA 4HUQB 4RVCA 1COWD 3ZDQA 4C0BA 4D4LA 1G18A 3VFDA 2ZSEA 5JBQA 2CJWA 2JIZD 1AZSC 3QXHA 3V4FA 1F2TA 1N5JA 1IAQA 1DAKA 1IN5A 1F2TB 3KFVA 3ZQ6A 5AUOB 1QVRA 4EJSA 1IY2A 2AK2A 1GKYA 5FBWB 1W36C 1TF7A 3LD9A 4JZKA 5FL7D 3NHBA 4OHYA 2GCPA 3A58B 4MRPA 4W7SA 3K09A 1WB9A 1TX4B 1W4CA 3KKOA 4UQOA 4XWOA 3CBQA 1TEXA 4PAOA 2ZRAA 1M6NA 5TMPA 4G5RA 1Z2CA 4LJ8A 1DAGA 3P4YA 4HLUC 3QXXA 2FU5C 4DCTA 2EWWA 5JCPA 1QHHB 3PENA 1KZ7B 1NVWQ 1UKYA 4OQXA 1OSNA 5KSYA 2YNMA 3GEIA 1Q3TA 1X8LA 3VNUA 4US2R 1XCGB 1NKTA 2JEOA 3OEEA 3P26A 3UK6A 4CEHB 1G8PA 3DOEA 4CYMA 2A5JA 4MITA 4MYTA 3FFBA 1Z0KA 2HLDD 1NSFA 3FE2A 4II7A 2W6ID 1YR8A 4F38A 3VMFA 2GDJA 1M1YE 4XJXA 4AIIA 2QMHA 1YHNA 1S96A 2PZGA 3LXRA 1PLJA 1LS6A 3GLFB 4ZV4A 3T1OA 5HZKA 1OH6A 4KV9A 3T1TA 1HH4A 4LCBA 3ETLA 5L3RA 1MABB 3O8DA 1N0VC 5CITA 3JVUA 3I73A 3P27A 1NN3A 4NCKA 2J59A 2ZM5A 1EG7A 3THYA 2IW3A 1ZCBA 4FXPA 3QKRB 4QHYA 2A5DA 2JLWA 1X8JA 3QY0A 1FUUA 2HUPA 2WJGA 5CM8B 2FV8A 4LJ9A 1Y3AA 1KMQA 1CXZA 1XMIA 4LV8B 3U3MA 5F9FA 4OYHA 5GJWC 2P2LA 3RDPA 1ZUHA 1IN4A 1E2NA 3QXCA 1R8SA 2QMOA 4PX9A 2MMGA 1NBME 3A6PC 1VCNA 4OI0A 1OXUA 4LJ5A 2FMXA 2QI9C 3D3QA 4QG7A 4D0NA 1X8KA 1XX6A 1Q44A 2ZRFA 4DHEA 2CK3D 1JPJA 1R8QA 2ZROA 3CX7A 2LKDA 5D3MB 2WAXA 3RNLA 3PEUA 2C78A 4FWTA 3R8CA 4HEJA 4DZZA 2CLDX 4BFXA 3UPUA 5SZIA 5KNBA 3ADDA 3B9PA 3ND8A 1VHLA 4HLCA 3I1FA 5FUYA 3RSOA 4PPFA 2BVNA 3BB1A 4M9SA 1AS3A 5CDFE 2ZI5A 1JJVA 3GLIB 4DCSA 4GFDA 3ZH9B 2EYQA 1ZW6A 1UBCA 1JAHA 4G5GA 4P31A 1XJ0A 4PFSA 4Q9HA 2QL6A 4YXWA 5D3MA 3FPAA 3K70B 3UATA 4NE2A 1UKVY 3X1ZA 4DJTA 1E94E 4RJLA 2W6JA 3KDSE 4ZKDA 4BECA 1HURA 1KI1A 2GNOA 4Q1EA 1OB5A 3VAAA 3KB2A 4BLPA 4BWYA 1NG9A 4JL8A 2BV3A 2GJ8A 4O3MA 3AVWA 2ZJAA 4EFNA 3UIEA 3X1XA 3VNVA 4G1UC 4Z51A 3GLFE 1TPZA 5HKKA 5DGXA 5JJLA 1BMFA 4BQSA 4V0OA 5KDOA 4QBFA 4BFWA 1OIVA 1TADA 1MRSA 2ZRGA 3RS5A 4HAZA 4Q1BA 3KJHA 1NIPA 3LFUA 2ZU0C 3M0EA 1IN6A 2H92A 2V7QD 1NBMD 2XNDA 2VF7A 3NEJA 1NLZA 4B48A 2Z0MA 3HJNA 4DIEA 4ABYA 4EFLA 2XNSA 2FSIA 4FMBB 3NDBB 1E79A 1KYIA 3GPLA 2VP5A 3H86A 1E2IA 1S3SA 3KQUA 3G5UA 4DSTA 4LHWA 1VG9B 3RS4A 4C0SA 2R62A 4TMZA 4US1R 4YLGA 3I5YA 1G8YA 4WBSA 2ZETA 2LKCA 4UXHA 1YRAA 2ZU6A 2HLDA 5L3QB 1ZM4A 2ZJOA 4Q7LA 1RC8A 4RD4A 1OYWA 4NP6A 3GJ0A 3P4XA 2CCKA 4D0GA 1CULC 4LSGA 3NTUA 3I3SR 5TVKA 2I4IA 2CBZA 2ZTSA 4LZZA 4MGZR 3U5ZB 1D6JA 1T4GA 1G5TA 4C2TA 3DM5A 2BIFA 4IDQA 4ERNA 2HCJB 4M0LA 1ZCAA 2F1IA 2BWJA 1AQYA 1J99A 4L9SA 1UKZA 4K46A 3QENA 2O8FA 2VHQA 2JLZA 2DR3A 3BRWD 4KAXA 2XSZA 1E9SA 2JCSA 1U99A 4HLDA 4R9UC 3IUYA 1SVIA 2ZI7A 2O8CA 5AJXA 4JLBA 3WHKA 1O87A 2UVQA 3FHOA 2ZSFA 5KTYA 2H7VA 1P73A 5FOTA 4B71A 2EFGA 4A92A 2ERYA 2OBLA 2V7QA 2XNDD 4MDFA 3GLHE 4XVUA 3C7KA 2ZYTX 4DSNA 4NCJA 2ZPTX 3K9NA 5DN6A 4Q03A 4GDFA 1T5IA 3QXJA 1JAIA 3AQ4A 3CRRA 1YJ5A 1ZAKA 2E9SA 2ZQ5A 2GZAA 3FMPB 1XF9A 3EIEA 5LD2C 3AP3A 5H70A 4JKYA 3L2OB 4XVRA 4JVMA 3LX5A 1G64A 3GFTA 3L82B 1U9IC 1WA5A 3QXSA 3IIKA 2N46A 4ZIRA 4D81A 1XTKA 5KU1A 1ESMA 5LDDC 3MGCA 1AGRA 1A7JA 1KDRA 1M8PA 1YZUA 2C9CA 3K9HA 4MGKR 4RD2A 2Q0HA 2AWOA 2ZE8A 4MKHA 4PC7A 3OEHA 4TYNA 2VO1A 4POAA 5IDVA 3I32A 2IYVA 4PPQA 3T5GA 1KKMA 1G3QA 4JLPA 4R2IA 2GXUA 3DZ8A 3E2IA 1GUAA 5IF9A 1H8ED 3LQQA 4DLRA 1GKIA 3RS7A 2YVUA 3C5HA 4RZ3A 4IHQA 1A82A 2W6JD 5A0FA 1T8UA 4AK9A 1GKUB 1A2BA 3AKDA 4RCYA 1AZTA 1E2QA 1S9DA 2FF7A 2QQ0A 2ZJBA 4Q00A 1EX7A 4TT3A 1L2TA 1WDTA 3BH7A 5FL3A 4KYUA 2XGJA 1E0JA 1A1VA 5EXSA 1P4SA 5FI1B 4N1AA 1KI6B 1D9XA 1OPXA 4UJ3A 4B34A 4EPVA 2NZJA 1OKKD 1XTSA 3C15C 4A8JC 3A4NA 4FN5A 4DCNA 4LYFA 4NU0A 5JJKA 1KKLA 1WF3A 5JEDA 2VL7A 1X1SA 5ANRB 3CPEA 1YZLA 3ASYA 2A9KA 3SQWA 1BMFD 4TTRA 2YV5A 5J4KA 4YMWA 3SJBA 3BFVA 4EFMA 4A0GA 4QFMA 1G291 1AGPA 3ZLJA 4TMXA 5E7JA 1F48A 4GOJA 4H1UA 4O0MA 4NYMQ 2ZE7A 1IXZA 4URZR 2ZAOA 2P6NA 1J8YF 1Z06A 4IFBA 4PHHA 2J1LA 2DB3A 4CEJB 2NPFA 2GETA 4I4LA 3I92A 1NP6A 2N42A 4PPNA 3A1UA 3X1YA 2MSDB 1MH1A 3W6OA 4LBVA 2WWYA 3MLEA 4DLTA 5EUQB 5G3ZA 2ZS7A 5LB2A 2ZSDA 4B3XA 1PV4A 2QORA 3WRYC 3LVQE 2X2FA 3SN6A 2F55A 2C5LA 2XXAB 4PO9A 2Y8EA 4KSBA 3N2EA 4M1YA 4OQLA 3ICEA 3DMDA 3CLVA 5EZ5A 5P21A 3U2QA 2GEUA 4A2WA 1P75A 1EFHA 5EQTA 1HEIA 4WXPA 1SXJB 4XSGA 4DVGA 4QRHA 5BQ5A 4QNMA 5FBVB 5KUTA 2PMDA 1P72A 1P60A 5GJVC 1ZP6A 5CM9C 1Q20A 3IPYA 4Q9KA 1JQLB 3I4LA 5DI3B 2PEYA 4KVAA 3QF4B 1FMLA 5F3WB 4I1SA 1BYUA 4MRRA 3QEOA 5DYGA 5E95A 1Q1ZA 5A4JA 1CKEA 1OFIA 4R7ZA 1R10A 3TR0A 1E2HA 1F3OA 1NLYA 3IBYA 2FSGA 1Q3HA 1S9HA 2C04A 4KSCA 3U44A 4YDSA 2QE7A 4E22A 1MV5A 4MDEA 2OBMA 4FW9A 2IF0A 2WJVA 4IDOA 3FMIA 4IEEA 4WZAE 5UKDA 2OO7A 4NCIA 4BLRA 1OH7A 3SYKA 2ZRPA 4U5XA 2ANBA 3LW8A 2L0XA 1N5IA 1JXMA 1RRGA 1T6NA 1Y63A 4V0LA 4JS0A 2HF9A 4M1KA 1R0ZA 2ODBA 1Z0FA 1P5ZB 4Z1MD 1GAJA 2P6UA 4LUCA 4OJQA 1G3UA 5FH9A 4HYYA 3WYFA 5J4HA 1LY1A 2QE7D 2ERXA 5FOWA 4ON9A 3TJZA 3AVVA 3ZYCA 2AD1A 4BRWA 4A0HA 4IVQA 2JDIA 1QRAA 4HZIA 1NN1A 5EJEA 1R0YA 3K0SA 4P4UA 4JLOA 1ZD1A 3UMSA 1AIPA 1U98A 1OFUX 2YC4C 3H84A 1OB2A 4HAXA 3Q5EA 3CX8A 2KBEA 5B2ZA 2FGJA 2PBRA 4GOXA 1E6CA 3FTQA 3CH5A 3HR7A 4IXMA 4JT4A 4A82A 4B44A 4HB3A 4C0JA 4Q66C 4ARZB 1PUJA 5FTNA 3L0SA 1J8MF 4EQ6A 3AVTA 5JLJA 4EQ6B 4AYXA 5K8TA 1E2FA 1Z0IA 3IO5A 2QM8A 1RRCA 1P62B 1ZM3A 2VBCA 2GCOA 2NO7A 2H8KA 2ZI9A 3Q9LA 4Q01A 4WZ6A 4A2QA 4BRUA 5AR1A 2YOFA 5EXXA 4CIDA 2ZRBA 4PAQA 4Z8YA 5JI3E 4LBYA 1X6VA 2FEMA 1XFAA 2J0QA 2CL7X 2WJJA 4ARZA 1M7BA 4DUGA 5G3YA 2EVWX 3K0FA 3GEEA 4Z8XA 3TKLA 3QUSA 1G41A 2GZHA 3MUFA 1DVRA 3DEFA 2F43B 2WJHA 5JZVA 2REXB 4B74A 3IHWA 4JLNA 3QBVA 5SZJA 1Z6GA 3OE7D 4NYJQ 2DPXA 4OK3A 4PC3A 4B32A 1LTQA 3SJZA 1II8A 2OXRA 2A2ZA 2A30A 2AKYA 4BEBA 1ZBDA 3GLFA 1S4QA 3Q7PA 1G8HA 2MSCB 5AUNB 3GLIA 4A2PA 2BBTA 1VHTA 2NTYC 2VA8A 3ADKA 1E1QD 2JJ1D 4TL8A 1NLFA 4TMWA 2HYIC 3CNLA 3L0OA 3U4QB 2OM2A 1R0XA 3SU8A 1E1QA 3IEUA 2ZRIA 1QHXA 2SHKA 4W5HA 4GOKA 3UG6A 5DE3A 1E2DA 4X8OA 2ZR0A 3LW7A 1R6BX 1IN7A 1XXHA 4LJAA 1HT2E 3AUXA 5BN5A 5DHAA 1R4AA 1NJFA 4PZLA 3PXGA 2WICA 2GBLA 2WHXA 2EWVA 2IYUA 1E0KA 2OSBA 1Q12A 3RSLA 3U60B 3TVTA 1SZPA 2GILA 4YONB 2Q9BA 5AUPB 1Z6YA 2BBOA 1S8FA 3T15A 1R0WA 2ZRLA 5AJZA 1UFQA 2CDNA 5FFMA 4EPWA 2BOVA 4V0ME 2QU8A 3DM9B 1ZC4A 2VIIA 3VR2A 1M2OB 3IQXA 1Z28A 2FFBA 2BEKA 1UEJA 2IEZA 4B3CA 4GZMA 2ZSAA 4LX0A 821PA 1TU3A 1K6MA 2JGNA 3SFVA 4CDGA 3MCAA 3JZAA 4G01B 3ZVRA 3FKQA 5DLQC 3AVQA 3FGNA 4B3DA 1XNJA 2WPDD 4C4PA 4PZYA 2IYQA 1MR3F 5SZKB 4GBMA 4TT3D 4RD1A 1WQ1R 2OCPA 2DBYA 3K0CA 1K5DA 2WOOA 1WBDA 1CJTC 1GNPA 1U0HC 2W2VA 4BLTA 3RC8A 1T3HA 3AP1A 4PZZA 2J7KA 1HYQA 2C9YA 3CH4B 4V0KA 1OYYA 3GJXC 3TGPA 4GNKA 3BC1A 5TY0A 4L4UA 5FI0B 2QAGA 1SKYE 2FDCA 1WXQA 2OG2A 2F9MA 2OV2A 1E0SA 2ZSBA 1RRPA 4M1WA 5L3SB 1T9HA 2OFOA 2IHBA 2KB0A 5FTMA 3VTKA 1YZNA 4B3BA 3WXMA 1FL9A 1YQTA 1N25A 4BFTA 4FCWA 5J40A 521PA 1DADA 4Q4JB 4DT1A 1VIAA 3R7WB 2O0JA 1R2QA 1U8YA 4JLKA 2J41A 3TSZA 1DAFA 2WWHA 1RYFA 4P33A 2FEOA 1LS1A 3R8FA 2R6AA 3AKCA 1Z22A 5DO9A 1YKSA 3PCRB 1IXSB 2E1RA 3LV8A 2JLSA 2KBFA 1N3BA 1SXJC 2O0KA 3TUZC 1FP7A 4KCGA 2GJAA 4AY2A 1QG4A 3ECCA 4ZIRB 1VCOA 1QHHA 4JBWA 1DO2A 2QQEA 2KI5A 5AWFC 2V1UA 4AYTA 1ZM7A 2JLRA 3BBPA 3QKRA 3K09C 1Z0DA 3O8CA 3LDAA 5E4FA 2BM1A 1EFRD 1GRRA 2REOA 1KY3A 5CDFA 4BUJA 4DDVA 4CEIB 4TLAA 4IOKA 3S1AA 1Z08A 4BLQA 1N6OA 2HV8A 1G8GA 2OEPA 4AD8A 4G5SA 3T1QA 3K0EA 4OHVA 2WSSD 1Z83A 4F7WA 1JR3E 4IW3B 2J0VA 4ACBA 1CP2A 5AUQA 4F91B 2YINC 1G5PA 5BW8A 3NVAA 2QBYA 2NG1A 1LFDB 2F3RA 2XTZA 2JASA 1II9A 4TLBA 2NO0A 1UPTA 2CCGA 1UKEA 4I81A 1U0JA 3UMRA 4F4CA 2F1JA 4JBXA 1C9KA 4DLSA 2F9LA 1GNQA 3EIHA 3AH8A 4Q47A 3OAAA 4FMDB 1DAMA 1FP6A 3LRPA 2YKGA 4B35A 3PUWA 2A3RA 2ZJZA 3PR1A 3QOFA 2ZI4A 1GILA 3SYNA 1AQUA 2OLKA 1W1WA 3NG1A 5G40A 3Q7QA 1CR4A 1N6NA 2OFXA 3RRZA 1T3SA 3LX8A 2V3CC 5E3HA 1D5CA 4BASA 3W5JA 1I2MA 3Q3JB 5C46F 3GP8A 4GPTA 1KZGB 2OHFA 5DYIA 3TRFA 4HZUB 2Q9CA 4A4DA 1CRPA 1AKEA 1Z0AA 1KSJA 2F7SA 3QF4A 4V02A 3OESA 2D06A 4OQFA 4ZO4A 2C98A 3AF3A 1B0UA 1KOFA 1FOEB 2ZRNA 2VLIA 1ONBA 4NKRA 2QM7A 3CM0A 1I2DA 3B1WA 3JZMA 2IS2A 1JB1A 4ITRC 3HYTA 2J46A 4C30A 4TTPA 1Q1QA 3LNCA 5FTJA 1FZQA 4JLJA 4S35A 4XWKA 1II8B 1EWRA 3KFXA 5E7MA 3U3JA 4IJMA 1NVUQ 2GJSA 1PJRA 4MQBA 2CHQA 3WYAA 1MO5A 5JWRA 1S1CA 5K8LA 4YMVA 2Q3MA 2QNRA 2WSSA 4TL6A 3WP1B 1G6HA 5EXPA 2O0HA 1OH8A 3SHWA 3V4RA 2PL3A 3BK7A 4HAWA 1QF9A 2ZJ2A 1E1RA 4IDNA 4DKXA 4US0R 2FN4A 4LI0A 5CIWA 2TMKA 2A78A 2CE2X 3E70C 2AK3A 3SEAA 2GF0A 3BE4A 4MYUA 2ZS8A 5L3SA 4DDTA 3P1JA 2VHCA 1P9NA 3WMGA 2CNWD 3SDZA 4QXAA 4LJ4A 2KJQA 1I4LD 2OZEA 3OAAD 4UXIA 5CIQA 2V9PA 1N6KA 2P0EA 2NO6A 1E2KA 1CEEA 4TWZA 4TZ6A 1TUIA 1RVDA 2HEIA 4HDOB 5FR2A 3U7GA 4UNQA 2IHYA 3M1IA 4NTZA 1Q57A 4GP7A 4LYAA 1XD9A 1UBFA 3LLUA 4HZUA 5HR5A 5JCZA 2BJVA 3N70A 5IHPA 1UBGA 4UNRA 2XX3A 1YZQA 3RS2A 1BIFA 1E4YA 1NY6A 4U02A 3ND9A 4A15A 5ELXA 3SJCA 5LBIA 1H8HA 2CVFA 3C41J 4M53A 1KI6A 2QG6A 1AS0A 3KJIA 3EZ6A 1YZGA 1KJWA 3OFND 5DI9A 4MH0R 3ADBA 1LV7A 3U3OA 2OCAA 5B58C 3THWA 2PH1A 1TL7C 4LHVA 3RRNA 3AGQA 1HQCA 3TIFA 2GJKA 4PXAA 3FOZA 4WW0A 3UANA 1KK0A 3EPJA 2A5YB 3LH5A 2JLVA 4A0FA 4LGMA 2WJIA 4OHXA 4MYHA 2XOKD 1XJCA 3C5CA 4CF7A 1NN0A 2F1RA 5JSZA 2Z4SA 3H2YA 2AX4A 4TSFA 2QP4A 5TXGA 3LVRE 2IS6A 3EC2A 4DLXA 4V0MA 721PA 4IEIA 1FPMA 2Q9AA 3TQCA 5KNDA 1DAEA 3KJEA 4QGAA 2PT7A 4B75A 4HDQB 3EA0A 2V6JA 1XWIA 4PC2A 3ADCA 1NMYA 3PITA 2R2AA 2R8RA 5GADl 3V9PA 2VPPA 2FFHA 4TLCA 3UG7A 3B78A 1P61B 1CLUA 4AKIA 2V55B 1OXTA 2FA9A 2WKQA 3JVVA 2OCYC 1VYUA 3AF4A 4D6PA 3CIOA 2ZJ8A 1D2MA 1IOZA 1JR6A 2J87A 3KKPA 5B57C 3EG5A 2RGBA 5B64A 4KFUA 4FIDA 3TVDA 3D6TB 1XBTA 3DKPA 1G3IA 1KIMA 1W2HA 2GA8A 3VHLB 1SVMA 4I1OA 1COWA 5KSZA 2WTUA 3KXLA 2QRNA 3DZDA 1W4RA 3RVBA 2XTMA 4V03A 3QSYA 1YR9A 5J4YA 2XITA 3RWOA 2FPLA 1FUKA 4CZ2A 1JI0A 1SVOA 3K70C 4WA7A 3WBKA 1ZRHA 2ZRMA 1W0KD 2O8FB 2ZEJA 3I72A 3U7FB 4QGGA 3WNCA 2V6IA 1QBKC 2G0NA 2HF8A 1KI8A 4OKSA 1N5LA 3W6PA 3I61A 2C99A 5JWOA 4TMTA 3VKGA 3CRQA 4QJ4A 1KI4A 1SKYB 4U00A 3FVQA 1US8A 4Q9IA 1L4UA 1GTVA 3CW2A 3QE0A 2ASEA 5H8WA 4C3ZA 2FPMA 4NL4H 1FW6A 2BHRA 4LHZA 3TAHA 3IILA 4KBFA 3VR6A 4URUR 4NYMR 4PPGA 2Q21A 1RRFA 2X8AA 4IDPA 5F9HA 1U9IA 1GL6A 5B30A 3VX4A 2C77A 4Q7MB 3U3KA 1G4AE 5GJBA 3OE7A 3AF2A 4XTCS 1E9BA 1XTQA 1J90A 1PLKA 3UWOA 3CF2A 3Q8XB 4ILEA 1BKDR 2FH5B 2JLXA 1W0JA 1NVXQ 1SVLA 2QMUA 3MWYW 5FBRB 4D0LB 3Q85A 5FBQB 1OH5A 3O8BA 4BZPA 2VF8A 4YMUA 2XAUA 4QKQA 1D2NA 2BMJA 3D7MA 4O2LA 2GVZC 5J4VA 4JLAA 3ZZTA 4XD7A 1NJGA 4PC6A 2X77A 4NDZA 4HAYA 2RHDA 2ZRKA 3CO5A 2PLRA 4C0LA 4RD0A 2GZDA 5GJCA 3IQWA 2D2EA 3GLGA 3NBYC 1MRNA 1YU9A 4D4MA 4PQYA 1DG3A 2P5SA 1N6RA 4PR0A 1G19A 3PUZA 2B21A 1O3YA 4F4IA 3FYHA 1G16A 1KJZA 1E99A 5JFGA 1KI7A 2CLCX 2J5XA 1KSHA 3FFAA 5L3QA 4A0RA 1GG2A 3CPJB 2HT1A 1RIFA 2WMNB 2AHOA 4L8GA 1RW4A 4HUQA 3NEYA 3W8RA 5JJIA 4YXWD 1CJUC 4QM7A 4EJSC 2ZREA 2RGXA 2X19A 3GJ6A 1UJ2A 2W83A 4QBIA 1JECA 4TL7A 1ZNXA 4YDHB 4I1UA 2OILA 5EP2A 4M21A 3ZS9A 4B76A 1SKQA 3T12A 3BIFA 3U61B 3LBHA 4G5OA 2QN6A 1W2GA 1ZVQA 3FKSA 4N3NA 1HA3A
chains in the Genus database with same CATH superfamily
3LHFA 5EWMB 3EIWA 3GJ4A 3UTDA 3NT2A 5CHYA 3FMOB 5D3ZA 4FT4A 3FWHA 3ND7A 3L4BA 2AR7A 3G1TA 4H1HA 1MC8A 2ZIFA 4M8SA 5E9WA 3DUFB 4JQZA 4AKSA 5DHTA 2ONKA 4QUBA 2WSMA 4K3VA 4M87A 4Z0NA 3TR5A 1ZZGA 4CKZA 2VDPB 4D8XA 2HDNB 4YMLA 4ZVUA 1DPFA 3EXFB 4HWPA 1RYNA 4MYRA 3QKSA 4WCDA 5FWXB 3NWPA 1NF3A 2IS1A 2C5EA 2IEDA 1EWYA 3QSGA 4BNMA 5JC8A 1ZI6A 4QFDA 4E03A 1U0FA 1OVMA 1LDGA 1PV1A 1DS6A 1OFHA 2QJFA 1EM8A 3CURA 3JTMA 4PLVA 4AMZA 4PO8A 2XXAA 3R9KA 4FYKA 1GQOA 3IP7A 2QZJA 2IPLA 4K6HA 2YWFA 2PUCA 3NM5A 2NTNA 3CB4A 1I8TA 3N3BC 5ES4B 1WXGA 1CQJB 1X39A 1Y8RB 3AJAA 5EEHA 3OCCA 2BELA 1U5AA 2KWIA 3FOCA 4MWCA 5CT4A 3U9TA 1KJJA 4N5IX 1P2TA 4MK4A 3BAZA 1SHKA 1CFJA 3BOSA 4KHPB 4WZBB 4YWJA 3EIQA 3IIJA 5LN1A 5KOJB 2DBZA 4LN1A 2JGEA 1BGXT 3FLAA 1O96B 5C1PA 4RORA 4DW8A 5FBLB 3D3EA 1GTL1 3ROPA 5F52A 2X1VA 1IZ9A 1KHHA 1CQIA 1HT3A 4XLLA 3GBPA 5FF9A 1F2DA 3G82C 4TLMB 2Q7DA 1PBNA 1RQPA 4V3BA 2BM9A 4LVUA 1O4VA 3KQOA 3GFFA 2HMSA 3R6DA 2ACVA 1C0EA 1PK7A 5LZ5A 4RIEA 4RH1A 5JATA 3RRFA 1GUBA 1T6ZA 3LWDA 3Q9SA 3EGXA 3M83A 1MXHA 3SZUA 4BO0A 1CRQA 3EVTA 3PXEA 2M6LA 1OREA 3SMQA 1FCJA 3C6BA 2LV8A 4B2IA 1VBFA 1Z34A 4FMCB 3RANA 4GL2A 4FDTA 5C8YF 1HNNA 3GCWA 4V1CA 1S2NA 4L2IA 2IZZA 3EZLA 2V9ZA 3KZOA 1R8JA 4DNOA 4HPJB 3RHZA 1QOQB 3N0RA 3HWSA 3NKFA 5AOCA 1JVBA 3IVGA 1C0PA 3OE4A 3K94A 4L0MA 4KXFB 5HE8A 1BE6A 4RDHA 3WNBA 3MCUA 2JFNA 1V7QA 4LKRA 5COBA 3OIFA 5IM5A 5I01A 1G20B 3BRQA 5I7HA 1FU7A 1KQPA 2IL1A 3R44A 4ZWNA 4Z4QA 3ABIA 1ST3A 3PHLA 3C8UA 3IE2A 4I55A 4DIMA 3VJRA 3VJLA 6LDHA 2I6SA 2QGNA 3DS8A 4K6OA 4OGGA 2DBVO 3HXKA 1XKQA 4AMYA 2ENWA 4R3WA 3G0HA 3LX4A 4AF8A 4ZDKA 4UZSA 3V5NA 3AUSA 4RIIA 2BGWA 4S3MA 2AZDA 3EZXA 4KRYA 4RPJA 4BC0A 2J9ZB 3L04A 1K2VN 4G09A 1Y6FA 1JDNA 2FPIA 1R15A 3KEMA 4LQ4A 1XCMA 3HCEA 2XB9A 5I48A 2O8EA 2O5VA 3WQRA 1X7ZA 4NG5A 1EIZA 4LBWA 4Q1FA 5ADHA 3TFWA 1NQAO 4DR7B 3K7EA 2C03A 4LJSA 4TV9A 4FE3A 4GH5A 2RBKA 2NZVG 3D6NB 3A4MA 3OPVA 5K3DA 1XQ9A 4BV9A 3G5AA 4NYIR 3LDHA 4LDJA 2IYFA 1N9ZA 4XYLA 2Y4OA 3CF0A 2B9EA 4KUHA 4OXXA 4F96A 2RAUA 3OZXA 1PFWA 1BWRA 2LP4Y 3R23A 2PMEA 1DBRA 2G4VA 2R9VA 5LP6A 1DWUA 4I50A 1QP8A 4G89A 4LTMA 3KTAB 3A3PA 3LWBA 3P5SA 4RV5A 4UEQA 3DZIA 3M6VA 3KLPX 4CL0A 3HS3A 5B4TA 2RGEA 1BE8A 1KDTA 4TQGA 1IK6A 3K6JA 5ALEA 1X1EA 4ICIA 1IEWA 3A9UA 1HV8A 1JQEA 1XQYA 4NAUA 4QTTB 1E5DA 3SR3A 2C2KA 3V4OA 1RADA 3QKUA 4RZQA 1X19A 2JHGA 3U4CA 2NGRA 2IZ7A 1IQ0A 1XP8A 4J4BA 3WB1A 4MWBA 2I4TA 5FWXA 4E2WA 1YZFA 3OZEA 1ISFA 3BE5A 2PJRA 4KQ1A 1IAVA 1RXYA 5JXGA 4XD7D 1W36D 1USUA 2V6MA 3NLLA 1GKKA 3HL4A 4KYTA 3HCWA 1E9FA 4C14A 3SZ3A 4B45A 1BS2A 3F49S 2PX0A 3AWIA 2C3YA 1Z56C 1RTTA 4MVJH 1ID8A 5JNUA 1JEOA 1XZIA 4ENTA 4RZ2A 4R71A 4ZEMA 2UZIR 1DOZA 2XTNA 1ZGGA 3B53X 2OORC 4U5QA 4WXRA 4D82A 4EF6A 2AV6A 4KXXA 1Z0SA 5HQJA 1UC4B 3A2NA 1N1GA 4N82A 5C0OE 2OE2A 3T5TA 3PR3A 4KI0A 2ZYHA 3HSSA 3OX3A 4ZVLA 1Q77A 2XDQA 2XMDA 3I4CA 4JD5A 3WK8A 4ILKA 3I8SA 4AY3A 5J2TF 3A3KA 3FHLA 3MOIA 3H0KA 2CNLA 5AKHA 4CQJA 4KWHA 2PL1A 4S1OA 4UM9D 2WTXA 3F8TA 5K1ZA 3QOWA 1SCUA 2P9HA 2V7WA 2JAQA 3C4JA 2YJGA 1DKNA 4Q6WA 2UYYA 1LLUA 3PFIA 1M8GA 1TYBE 1V6AA 2W6CX 1KOJA 3NANA 5AM4A 5K3FB 4DJ5X 2YZMA 3EXIB 5IBQA 4M9CA 2EZTA 2H59A 3JD4A 1S8AA 4K5QA 3WRWA 1ZD8A 4D79A 4MDYA 5HZMA 5L95A 1J23A 1L4NA 2HPHA 4BQOA 2W0MA 4OEHA 1N4AA 4RVGA 1H2BA 2UZ3A 3DHVA 5B3JA 1SRQA 3A4VA 2V5VA 1M5TA 3CZPA 4QEKA 5LNK6 1AKNA 2Y67A 2XUJA 3FI9A 4D26A 1X14A 2I7CA 3RIEA 4AKHA 4BFCA 3B6JA 2BMFA 2LNDA 1OE0A 4WK2B 5GAJA 3CT4A 4LKOA 3EZ7A 1QBGA 2ZTHA 4DLZA 3AZOA 2Q46A 2ZJ5A 5TF0A 2XUHA 3D4IA 4C76A 1CJKC 3UJ7A 2GXAA 1ZN9A 1U02A 1UEXC 5KNCD 4MGIR 3HXPA 3KVVA 2G1KA 4HGRA 2OXIA 2X0FA 1ATIA 5AJWA 3EA5A 1C7EA 2R8ZA 3ABOB 4Q4HA 4BLSA 3NJ4A 1NHWA 3DBLB 2NZWA 3CLUC 1ZS9A 2WTBA 5DM60 1EFUA 2YHSA 3OZSA 1TZ2A 2VTKA 4AKGA 1DAHA 4LF5B 2R7MA 3DSRA 3BZWA 1E32A 5KS2A 1Y6QA 4DJFC 1MOQA 3NBXX 4Q48A 5FNZA 4EDFA 1IY9A 3HO6A 3KM0A 4O1HA 2O06A 1B8VA 4DIFA 3G23A 1AKVA 1X7YA 4FT2A 2RHJA 3UKOA 5FPSA 2D4AA 1X7YB 4IX9A 2HBRA 2A59A 2MMCA 1NVVQ 3MJSA 5EKXA 3TLAA 4ARAA 4ZZ0A 2QBYB 3KUKA 3MWJA 3GG2A 1K0UA 1N3YA 1Z7GA 1M7GA 2AN4A 3CJRA 3G85A 3KPWA 3P0HA 4A9AA 4JEMA 4QREA 3BDAA 3UAVA 4Q1CA 4X7PA 1P4AA 4JEUA 5CT5A 2COUA 1XNRB 1GG5A 4K7JA 4URHA 4ZRMA 2GN6A 3KB6A 4AYWA 5EKDA 5IT9A 1QQAA 3V46A 1I1HA 1S5PA 2OXTA 3BIXA 1RI4A 4UOEA 1S0UA 1TVKB 4BZXA 1N77A 1FVXA 2HK6A 3X1KA 1Y6RA 1LVGA 1M33A 4KAAA 5TEVA 1RE0A 1JFVA 4EA9A 1QVAA 1NXSA 4KODA 4RBNA 3AFGA 1WBBA 2M32A 4YHBA 3V34A 1ZD2P 3ONFA 5TPZA 2HQOA 2XCQA 4CKXA 1SEVA 4LECA 4ZO9A 1GQQA 2BHLA 2ECKA 1B8OA 1GRVA 4X41A 3BCHA 1U4OA 2PH5A 4DSOA 1U1IA 1TFUA 5AVXA 4AJEA 1TVEA 2PLWA 4GMXA 1MO6A 4CM4A 4HDAA 2AMLA 1ECBA 3MTAA 3PHCA 1WEHA 3RVJA 3MILA 5EZ6B 3A28A 3AR9A 2WPNA 1GGNA 2OV3A 3ASZA 3HM2A 1M0SA 1G5QA 3KZMA 3O74A 3OOSA 4C21A 2I22A 2C4KA 3HI6A 4G0OA 4DC9A 1JLKA 3TTVA 3KX2A 2JZCA 3QBTA 3TE6A 1PFVA 1NXTA 5MN6A 4O6VA 1KMHB 1XMXA 4YCNA 1UC9A 3E3LA 3C16C 4ESOA 4ZT2A 4AP5A 3GDWA 3QWAA 4L0DA 4ESVA 3RD5A 2D7DA 3L77A 3PZBA 3E84A 4C03A 3H75A 3W4IA 2C5SA 4ZVOA 3NH6A 3GW8A 5TB5A 4PLCA 2YZ7A 4ZOQI 1KH3A 1W46A 1ZNZA 5LMUB 5C7IO 1CS0A 2AA3A 1KSGA 2ID4A 4FFVA 1C29B 1EK0A 3W5IA 2IOHA 2Z8YA 2W6IA 4L5BA 3W0LB 3GLKA 1QR6A 4BJ5A 1ANKA 4QLAA 4E3ZA 1KO7A 4V2IA 3I09A 4C7VA 3GZJA 4HX9A 4H1VA 2ZPAA 3EZ9A 5EIAA 3DPUA 1DWPA 3UT0A 3HACA 3MWGA 1EE2A 2VKTA 4BGVA 1D1QA 2PY6A 2X40A 1EBFA 1V6SA 2HA3A 3IHKA 2H2DA 2H3EA 4JWTA 2G88A 4U4AA 5AJTA 3COVA 3P71T 1TVCA 2GO7A 4HXYA 1OVGA 4JUIA 4NICA 5HIKA 1WOYA 1DFGA 1PT8A 3MWLA 1E6EA 4BNDA 5A0VA 1PW5A 2CY0A 4A0QA 1D6SA 2I5PO 1II0A 3KOYA 3OBBA 4PC1A 1MXFA 2QTVB 2VP4A 3FPLA 4XIJA 1VPTA 4UZEA 4QUEA 2J5RA 2UYCA 3A6GA 4GOLD 4W5WA 1EIWA 2LBPA 5A7GA 2WTAA 3L5KA 1NMEA 5EJ9A 3FRJA 2DY1A 3SIPA 1D4OA 4NJOA 1HZJA 4KQJA 3RUIA 4WZZA 4C87A 4GX5A 5LB4A 2G5TA 5EJ4A 3ZCRA 5C7LO 5CT8A 5DSZA 4PQRA 4EY4A 4N5DA 2OO5A 5H83A 1PQYA 3SR0A 4OAPA 2YY5A 4EFKA 3BXEA 3TI7A 5HMMA 1J07A 4EW3A 1ZLXA 4R3NA 4ESHA 1J0BA 4JI7B 2JFOA 3HUUA 2IP2A 3LA6A 5EJMA 3GLHA 3OIYA 4FCVA 4RZIA 3HKEA 4HH4A 5GGYA 4PS1A 5HRUA 4ES6A 4IILA 1A69A 1T3LA 2BGTA 1NFQA 3CZAA 1USIA 4JJGA 1KK2A 1T2AA 3RRBA 3DFZA 1TM1E 2QZPA 1U8XX 2GBCA 4D3XA 1Z4QA 3PJFA 2PKEA 1QG2A 3QVUA 1DTSA 4LYGA 1CIPA 5F7OA 1GARA 2OBFA 2W90A 3KT0A 1J8DA 4YX9A 1UXGA 1EXWA 3PQ5A 4HGNA 5H4GA 4QARA 2RHBA 3BFKA 4RM2A 2BDEA 2JPDA 4JROA 1P7YA 4BGIA 5CA0F 1XB2A 3TCNA 3CKLA 2EAUA 5BYJA 3QX3A 2IUFA 2AFIB 5CLLA 3OQHA 5FUWA 1IDN1 2OFWA 4PG4A 1RJWA 4PR3A 4N7BA 2XGGA 1GQFA 2A9FA 3TAUA 3WLMA 1WVGA 1OT3A 2JGRA 5BWMA 3ZZUA 2AVDA 4Q7KA 2G5CA 5TGZA 3GFPA 1YVRA 2QVCA 1OZ0A 3B6MA 3PFKA 1DV1A 2GK6A 3GB9A 3QJYA 5JAZA 1SRRA 1Z0JA 1BKYA 4YJ3A 5HHTA 1FVOA 1O7JA 1WV1A 3E81A 1CZKA 3PL1A 5HTKA 1LQUA 2R1VB 2ZVQX 1REQA 3C5VA 5TV2A 2B92A 1B00A 4L16A 5EJAA 4CDRA 4EPXA 5AIBA 2XZOA 4C1NA 1ODFA 1UM9B 3JWHA 1ZH6A 3WLRA 1Q1BA 1SHUX 4UCQA 5TE9A 3IBSA 5C8DA 3PEYA 1UJCA 3FTDA 3L18A 4F84A 5MDHA 1AB5A 1E4VA 4PX5A 4MI3A 5E4YA 4ND7A 3S55A 5ADWA 1ZJ4A 2QX6A 3MAGA 4JLVA 4OHFA 4UASA 3WWPA 3OC0A 1M83A 2FPXA 4JJ4A 5H3HA 5SZHB 4O2RA 4I3GA 3Q8KA 4MR8A 3D6AA 2G9VA 1C1XA 3R24A 4FD2A 4OF4A 4XX0A 4WJLA 4NMHA 1OLOA 5TSDA 2GI4A 2XUGA 1PJLA 2OFPA 4Q5IA 1D03A 4PLZA 4IDFA 3L0PA 2QJOA 4R81A 3WQSB 4A36A 2NU8B 2XTJA 3HBJA 4BKQA 1VKJA 2Z2IA 4HATA 3B60A 1W75A 2ZYUX 4FZJA 3P0EA 4IQFA 4O8CA 4CL2A 3O4RA 2W2PA 4G9BA 3WNZA 4KXVA 5ER6A 1J9ZA 1X0XA 1UFRA 4KXYA 3JZDA 3VNRA 3RLFA 5AM2A 2N9UA 4CKBA 1TO6A 1GJRA 1NI4A 5CLJA 3T9AA 4MB2A 1ORRA 1Y3HA 4HQLA 3TZBA 3F4BA 1EFCA 2V59A 3PSAA 3MIZA 4UUNA 3RFFA 2VQEB 4DV3B 1GM5A 1N8NA 2QUJA 3DYVA 3K5PA 4MGYR 1ZNQO 5B6JA 1X7GA 2DHQA 4CM5A 1M0EA 2VYFA 1L7NA 1GWNA 4CKWB 2PQ2A 4C2UA 1EI9A 4DXHA 1GU0A 4UMVA 5DEIA 3QPUA 1C7FA 2IA5A 4M1TA 4TWAA 1KPIA 1EE9A 4EY8A 4OIMA 5JW6A 1RIIA 4JYPA 2PKXA 3T4PA 3P9SA 1WF6A 3UUGA 3IAS1 2GZMA 5IDQA 4P3KA 2WHPA 1DGQA 1G55A 2DZDA 2QM3A 4OTZA 2ON6A 4X6LA 5J59A 1B2RA 4HQOA 4E14A 2ZJYA 2J4DA 2RMKA 2YYZA 1I7LA 3C14C 3HCBA 1G3RA 3OKCA 3T99A 5D51S 5ALXA 3U17A 1FS4A 4MO2A 3DE2X 3RUCA 1Q84A 2AI2A 2WPDA 3GGGA 3AKYA 3WXBA 2JJMA 1GV1A 1U6JA 2V54A 2VP6A 3AF0A 3OJLA 3HU3A 4GQBA 5HCUA 1KMMA 4HUTA 5YASA 4XIYA 2H1FA 3CRNA 2BRUA 2BZSA 4W6QA 4PGAA 1YIAA 3GD5A 1P31A 5EJ7A 5CVVA 10MHA 1T3GA 4QU5A 5F4ZA 4D9HA 4B6OA 2O5RA 2QROA 3N2GB 3CQ9A 2VHWA 3SX4A 1Z6AA 4HXGA 3LU1A 2BMDA 2HJHA 2JKZA 4OLJA 3DPSA 4KGZA 2Z2XA 3ESYA 1ZBQA 1XQ1A 3A1CA 4KGDA 4TSKA 1U0TA 1D1PA 3DUWA 3MYRA 5AKZA 3F1KA 4FWIB 1SUCA 4MW0A 1EHCA 3EZYA 3PNBA 4AN4A 3F7NA 4MHSA 3QA9A 2FFQA 4R9RA 3OIVA 3T61A 1YGPA 2PX3A 1JR2A 5GOTA 1U3GA 1YR2A 3UWPA 4AJPA 2PX5A 3EVAA 1GCUA 1ZD4A 1LW6E 3IXLA 4Z4EA 3LHIA 1GZSA 2ODEA 3PVZA 3LY7A 3DLBA 2O2EA 1WCXA 1JYSA 3HI4A 1V4VA 4HH1A 1KVUA 3DW3X 1SHZA 1OXXK 2EGHA 3DC2A 1OFTA 2EL7A 1UK7A 3ILSA 1ZRMA 3K92A 5E6RB 4NXNB 3KPUA 1MFPA 1LRLA 4YI3A 1JUDA 3HYCA 2Q1YA 4FBLA 4FCTA 2WZBA 4LQDA 3VR3A 2ZJ3A 4MVJD 2FK8A 3QE3A 3TGWA 4O4HB 2WD7B 1KJ9A 3T7CA 1TKBA 1JR4A 2I67A 2ORIA 3OLVA 1U1CA 2QPAA 1I7QB 3IDOA 5G2OA 6REQB 3DMYA 2YWHA 4MQMA 1LZLA 1C3OA 1BRMA 1TA9A 2BMEA 1U65A 2VSQA 2PYIA 4OY3A 3ZQKA 1RLTA 5CXXA 5A5VA 2CJXA 3DBHB 4AJNA 2VQ3A 1KARA 1UK9A 5AOBA 5AVSA 5K0GA 3GN1A 4QPPA 2X42A 3AJDA 1GLGA 4ALMA 2RAPA 4BBZA 1K4KA 4KXWA 1FFYA 3E61A 2ZANA 2I7VA 5CVEA 3VR3D 5IANA 1Y81A 2D6FA 4D80A 1JJ7A 4G6ZA 4QOJA 2QX8A 3U26A 4B9EA 1VRWA 4L50A 2QAJA 4LPKA 4UU1A 2GAAA 3FSEA 3DDUA 3LQFA 5CX1A 2W22A 4CU2A 1UEIA 1VSVA 3E18A 3MJDA 1RQXA 1G8KA 3E9MA 3GPCA 4OQEA 4E32A 1L5MA 3QW4B 2XPCA 3TLEA 4JXKA 4FYVA 3VH4A 4TYMA 1ETUA 2H6EA 4Q3LA 4LF4B 4H7PA 4DQVA 1T26A 2IELA 2PSDA 4MVYA 5BR8B 5EI5A 2Z3WA 3WGLA 3G2KA 3EXG1 3UO8B 4DCPA 4FNAA 3QLVA 3T34A 4F6RA 3RC3A 1EGMB 2ADFA 3STHA 1UBEA 4G26A 2BEVA 3VR4A 4GI3A 4PNEA 1FTNA 4F71A 3WO0A 2B34A 1P1BA 2PRKA 1G7TA 4OUDA 3TLKA 4FYXA 1DOHA 3K70D 4HK4A 3ZIDA 3CRMA 2M1XA 3I6YA 4NHOA 2PGDA 2PUGA 5I6DA 4ZEVA 5KWSA 2WM9B 5K8IA 4LDQA 4UMEA 1FNMA 3E1SA 1AJEA 1FC0A 3DC7A 3HDQA 1MB0A 1TQ6A 2Q7XA 5IFLA 3TR6A 2PT5A 1JDPA 1SUEA 2Q99A 4R40A 4D4JA 1FP4B 3N7AA 4KFRA 3R9XB 2H0RA 1U7DA 4RZUA 3WKDA 3IKMB 5H81A 1E96A 4DG9A 4URXR 1U3UA 2WB2A 1GQ2A 1QH1A 1DOAA 1IPFA 1R5OA 1YJAA 2C7BA 2F43A 1G6OA 2B7BA 2Q3HA 1GNTA 2AMFA 1M1YA 1LNSA 1M6VA 1VI2A 3AY3A 1Y1KE 1ZH4A 4HNAB 2GTPA 5JMTA 4E5KA 2EHDA 4RXTA 1K06A 2O05A 2CSUA 3CWZA 4KYIB 1TLFA 4ALJA 2QUKA 1I10A 2Q4TA 5AHOA 3W05A 1WMEA 1CW2B 3VKFA 3KFLA 2XZLA 4QQNA 4GZLA 2HT6A 3AOEA 2C7QA 3C6ZA 2EZUA 3ON5A 4L75A 2FSFA 3UQZA 4CQNA 5HG0A 3E6AA 3OJ0A 3VVBA 2D1QA 4I9NA 2P9ZA 1Q1EA 3AVPA 4M0DA 3QTLA 1VPLA 3SOPA 3CS3A 5CW1A 3FN4A 1YE5A 5KIAA 4JXZA 1OC2A 4FONA 3D3WB 4QVIA 3AVWA 3A4IA 1FK8A 2QTCA 2UAGA 3UJ6A 3I04A 3F47A 3K0AB 5E2BA 1QO0D 3W4JA 1QGUA 2ZDHA 3NAGA 1FW8A 2ETVA 3ZW7A 4QGFA 3SSMA 1YFJA 1FSPA 1ONPA 3V2IA 1IOLA 4QO8A 3TDKA 1ICIA 221PA 1TLTA 3V97A 2IH5A 1FXSA 1F4LA 2CFCA 3U9SA 1EP2B 2LZ0A 4UTNA 2F1OA 5CCEA 4CCWA 2XJ4A 1P1RA 4J4TA 4BN5A 4LJ7A 1HQYE 5C8ZA 2VDWB 5JD3A 1MKYA 2IF2A 5FPYA 4EVRA 1EFDN 1QTRA 2DP4E 5BN3A 5HRAA 3IVXA 4B2PA 1BHJA 2CXPA 1Y9DA 4PAMA 4UU8A 2D5LA 2Z2JA 1UXJA 4YP0A 2JAUA 1QONA 1K1EA 2L18A 5J3JA 3WYGA 4X45A 2HFKA 4U7TB 2R97A 3GVHA 1C30B 1VA4A 4JI5B 5KYWB 4XYEA 1MLDA 3OICA 3A04A 1U9ZA 3THRA 1EWQA 1AUXA 1JEDA 1MP0A 3V2GA 1WE2A 8ATCA 3OM9A 2V6FA 3AR6A 4UKDA 1H8HD 1RPAA 4Q4DA 1DHRA 3CSSA 3ITEA 2FSVA 5K20A 1NUPA 3BXXA 4U7DA 2DFTA 3TRDA 1X8XA 1PG5A 4MLPA 4KV7A 4RK7A 5A3QA 3P7MA 2JA2A 3Q8LA 2R1ZA 2P9JA 5ALIA 2Y1GA 1B1AA 4C7OA 1TUBA 3EFHA 2GUGA 2WWWA 1M8FA 3CLHA 4WPGA 4GI1A 2I2WA 3P2IA 4PLGA 4E94A 4EYQA 3QZUA 3FPBA 1XDZA 5JXHA 4X1IB 5CB6A 5A4AA 2P67A 2W8BB 3GLSA 1CUHA 5H9VA 3O8RA 5AHKA 4NE9A 2HMWA 3WNDA 1Y1LA 1V8BA 1YV9A 2YXPX 2ZB8A 3A1SA 3LMKA 3NPAA 4WAUA 4DCMA 1T8SA 4TSFD 4BOYA 1BEUB 4V3CA 1C3VA 3UWMA 3D0RA 2WUVA 3OQ1A 1JALA 3AM1A 1T91A 2W00A 2ZGVA 3EZNA 2O8DB 4S1WA 4YAWA 1DSSG 2DPHA 4KPYA 2EERA 4QJ3A 1SGWA 3ENWA 3PRJA 3Q1LA 4K9NA 4M1SA 1DX6A 3F74A 2QZ4A 3I05A 1FQJA 4URVR 3B1XA 2NPOA 2Q2WA 2C5HA 1OLUA 3KQLA 2BAGA 3SFZA 2X2EA 5FOQA 1VM6A 2W58A 2E6UX 4HS9A 4OQYA 3VX3A 1IDOA 3A26A 3LKBA 4LRWA 2DUUA 3TLZA 1OTHA 1QGOA 2O4CA 4GBJA 1MW9X 5LJIA 1TM4E 5A5GA 4KO8A 3CISA 3NETA 5BQ3A 1PJZA 5AW0A 2VPZA 4HN4B 1U7PA 3I2YX 4RENA 3MA0A 4TKLA 2CK3A 1W8DA 3K96A 3BXOA 1DC5A 2QHXA 2E89A 2HU2A 2CXQA 1GRNA 2YV4A 2NV0A 1FFBA 3OQOA 4UVGA 1LLDA 1NX9A 4LRTB 4E51A 4IWNA 1TJ5A 2YXEA 5ARDA 3BB4A 5CPFA 2B2CA 3N8IA 1O94C 4BX8A 4Z0TA 2C2MA 1OHHA 1M73E 2EFDB 3I8OA 1E2MA 3IRVA 4OUDB 4PTLA 5L4NA 5HVNA 2FPWA 3BE6A 3MRTA 2QMQA 5JDIA 1NQXA 2BKEA 1IBCA 4O29A 3SMVA 5TQ2A 3LZDA 4F1KA 2HM7A 3T5DA 2NZ2A 2J07A 5MHTA 1E6LA 3W8NA 2ES4A 4FUQA 1OXBB 2OHIA 2K7FA 4YJGB 4ECEA 4YAUA 3R6TA 5IAAA 2HF2A 3O1JC 2O7SA 1PWHA 3DCIA 4GRAA 4Y7CA 1JHRA 1ZK2A 1KVSA 3KYJB 4DYVA 2I1QA 4IICA 1USKA 5HBGA 4RA9B 3IQZA 4TSRA 1A9SA 4NS4A 1Q1NA 1UBOS 2XYQA 2W11A 4GVPA 3CRVA 4OLFA 2XD9A 1KGDA 2EDCA 3EWSA 3V7NA 2I2XB 3RYFB 4ZJUA 4K1XA 1E61A 1FYDA 2ARKA 2PNFA 4JYCA 2ODNA 1OU4A 1PR4A 2QXUA 4QT0A 3T94A 7GPBA 1R4MB 5B1YA 4NBRA 4HDSB 1JTEA 1ECLA 1TAUA 3MT0A 5JCJA 3WBFA 4W63A 2IWRA 3RYTC 2PAFA 2XUOA 3ZLBA 3WI7A 4B6JA 4CCAA 2XWPA 6PFKA 4G1BA 5I9NA 1X74A 4PX3A 4FQ8A 3ZBPA 4BKUA 3HJUA 2R6DA 2VK4A 1ZMRA 2O1WA 3ZNPA 4EPTA 3EDCA 1RR6A 4UBOA 3TB6A 4EFDA 4ZK6A 5LP6B 2GGSA 1I5RA 3DUFA 1GNRA 2EKQA 3HJRA 3ZVMA 2OD7A 1EVZA 5FQOA 1UP7A 5ALQA 3ZDEA 4ZI5A 3EVCA 2YMQA 2GSDA 5DGCA 5I9MA 3GJ3A 2B4YA 3PT5A 5LC1A 2X8WA 4BB0A 1ZN8A 1MB2A 4XWAA 2G71A 2PVCA 1JFLA 4G5HA 5JT1A 3ZJ5A 4QTYA 1X7XB 5DHPA 2GPBA 3SZOA 3ZY5A 3W2TA 4LS3A 2VF4X 2JHAA 2OWEA 4GDMA 1LI5A 5DNUA 3NI2A 4BP9A 4K8OA 2P4UA 2VNHA 2A57A 2GHRA 4V0NA 3SSAA 3ZWYA 5C81A 5A5FA 1MH9A 1RT9A 4ASUA 1LLQA 2CD7A 4BNXA 4RLHA 2VI5A 3MLBA 3V4PB 6Q21A 1T4MA 1Z68A 3WK4A 1ZQ1A 1B43A 2DCUA 4RFVA 2VYVA 3HN6A 2QUAA 4FYMA 1R6AA 4MI1A 1LSUA 4GGOA 4KU4A 5HK8A 1GCAA 3TPCA 1WRBA 3PTZA 3ER9A 1KK3A 5CD1A 1M2GA 1QUEA 1IM8A 2FOLA 5LXTA 4EARA 3PGLA 3PDWA 4JBHA 3ST7A 3TS1A 3L0DA 4M7PA 3NAZA 2YXLA 2P3SA 3L4SO 4JJIA 2NIPA 4HSEA 2O4UX 2VXCA 4QWMA 1GZ5A 2KM1A 2HWWA 1TAGA 3VV2A 5T6MA 3RVQA 3ZV6A 4WXYB 3OPYI 3I9JA 1T13A 3CSDA 3E1GA 1G4HA 1PIWA 5KNCA 1RZ3A 1MC5A 2CL0X 3PDIA 1W73A 4BO8A 4CQLB 1JMVA 4ND5A 5KKNB 4P4SB 3ZI7A 1ZYUA 1SUPA 1QNLA 3AUKA 1R8XA 2F3SA 4LXXA 1AUPA 1IHOA 3CKKA 1Q3KA 3OUTA 4G41A 4PEVA 2J3JA 4MYDA 1ESCA 2VDUE 3GMTA 4Y9RA 2AR9A 2BEJA 3I9MA 4J29A 2ZXFA 4YJFB 4LWPA 2HHAA 4F0JA 5K6RA 1AM4D 2JC3A 3C6YA 3MVEA 4G0NA 2UZ1A 3B9BA 3CO0S 4L5YA 2ZAMA 3RASA 1WP4A 1NY5A 3M33A 1OV4A 2CEAA 4HAIA 4WI1A 3K2IA 4PZUA 4AICA 3L8HA 3IAM1 3V1YA 4DDUA 4KNYA 1Z47A 3WE7A 4XFJA 2O8BB 1KYYA 4PSCA 4Y9TA 3UA3A 2QTGA 4WCFC 5ARBA 1HDOA 4QOEA 2OAEA 4BMCA 1TW3A 2ZM6B 2PX4A 4HDMA 4JGGA 2R3SA 1HE1C 4H77A 3STWA 1VHJA 1LGYA 1SCIA 5LIRA 1V5IA 1WTCA 1RS0A 1CUGA 1OBOA 3NTQA 2WA1A 4X3OA 3FM9A 1Y8RA 4Z3KA 1W87A 2NO5A 4ZHSA 3VPHA 3ZD9A 2P65A 3DLPX 3FFTA 3U7HB 2OCBA 3SC4A 2D00A 1XDBA 1EX6A 1J21A 4ER5A 2HLPA 4PG8A 2XA1A 1LV8A 3GFGA 3PLNA 4PYMA 1G8JA 3OZGA 2MYNA 5TPWA 3S3TA 3UMBA 1ECJA 3B48A 4M0EA 1PSZA 5I5EA 2YC2C 1XMPA 3HPRA 3VTAA 3RJTA 2C7OA 4LF9B 3N0VA 3P9RA 2GFIA 1Y34E 3LBIA 2PV0A 1I4TD 4L8WB 4OQZA 4HVCA 4WN3A 2WWXA 2IXEA 4RZXA 1GPH1 1CQZA 1UBJS 4C0AC 3ABSB 5AJUA 4G1CA 2Q7OE 1I4EB 4LXUA 5D3QA 1DAIA 1C1DB 4REOA 1CR2A 4KI7A 3WHLA 3WL6A 1THMA 5KYYA 1VIMA 4CL8A 2DFKB 4MCAA 3QX9A 4Q02A 1P7CA 1RJFA 1RKQA 1UBNA 2FN7A 3CZ4A 3RKSA 4MMYB 1C8VB 3HXMA 1YZ3A 4GVXA 5AW5A 3JVEA 3L84A 3X1WA 3BFXA 4ACAA 4P5EA 5JQWA 1AN9A 2GBGA 1UPCA 4ED9A 3OLWA 2PS1A 1SELA 3MN1A 4QL3A 2HAEA 3QU2A 4EHLA 1TPYA 4Y6RA 1XPRA 5EVCA 4JVNA 4Y6LA 4ZOLF 2Z5LA 2XE8A 5D87A 3VQTA 4FX2A 5KYWA 3H65A 4UAVA 3RNOA 5KHOC 3IHLA 4EF5A 2QD2A 3B5JA 5CK5A 2E1PA 1QFMA 3G0DA 4Q39A 3CVXA 2Q4DA 1VPWA 1VYVA 1XIVA 1ZINA 3JVIA 4RGBA 4B5KA 3A70A 3LQYA 3VUFA 2V5AA 4I4NA 1IB6A 1RJ9A 2X8JA 3OQPA 5DXFA 4HV4A 4M22A 2CCJA 1R7RA 2XSZD 1PGQA 4KFTA 4LRUA 5T6BA 4IHAA 4QPCA 2HGZA 2VK2A 3L0IB 4B3FX 2O3SA 3PUHA 2XQKA 3QEMB 2Z43A 4GW3A 3H99A 5M04A 3GLGE 2CL5A 1G8MA 1ISJA 1M1ZA 3R5HA 2Q6TA 3BXGA 3QTBA 1JKJB 4WIAA 1XEWX 4FJ0A 1OR8A 1T0PA 2DERA 2PCLA 3T9FA 1XEXB 2V4ZA 1GUDA 2XMGA 2IW1A 3IAS6 3LI2A 1NJ2A 4DGSA 1XU9A 2J09A 3Q2OA 4GICA 2OV8A 1K8RA 1I51A 4I14A 1PTKA 3ZDQA 5ALKA 2ODPA 3MGGA 3CVWA 4YS6A 5JFOA 5KCZA 2Q45A 1EU1A 1U0NA 6ADHA 2PUDA 3QVJA 5JBQA 2CJWA 3QXHA 1AZSC 1WZNA 4M89A 2FEXA 1KZ6A 1P1IA 1N5JA 1DAKA 1LDNA 2XNKA 1CR6A 1GKLA 1RQLA 1AXEA 1F2TB 2XOEA 3PC2A 3VJKA 1WHTA 3JQGA 4BQEA 1QVRA 2OOKA 2B2NA 1IY2A 4EJSA 2OLEA 3LD9A 1H3EA 5AESA 2DHEA 1UT6A 4CTKA 2AFIA 2C84A 2J3DA 4ZRNA 1N1EA 1D2AA 3W8FA 2X22A 3H5AA 4IO1A 1TEXA 1K9VF 3S8YA 2E55A 2ZRAA 4RIFA 1M6NA 2KS6A 1EWTA 5TMPA 3WDKA 5K9ZA 4G5RA 4OB6A 3AXSA 1GA4A 1A7KA 1FFGA 2HF7A 1FUYB 2EWWA 4DCTA 1FSFA 3PENA 4PRKA 3H2KA 4OQXA 4XQEA 4AS1A 5A9RA 1Q3TA 4FHZA 4OQQA 5CGQB 4US2R 2YIDA 3OEEA 3UGQA 3KIPA 2EG9A 1AKRA 1G8PA 4MITA 1PJ4A 5EIEA 3FFBA 1Z0KA 3H3XA 2YY7A 3D8TA 3IESA 1NSFA 2ZOSA 3EDQA 2CDCA 2W6ID 3I9OA 3TBFA 3ORHA 4HOYA 3VMFA 4UHEA 2GDJA 1M1YE 1UMDB 2VSYA 2YRWA 3KLOA 2EJBA 1YHNA 1EM8B 5FBKA 3H97A 3P0RA 5B3JC 5CIYA 2ZBDA 2ZP1A 4L4YA 5AI8A 4RKWA 2A94A 3IKVA 1PLJA 3D1JA 3NP9A 4JBNA 3GLFB 3CSUA 5ECGC 2NTJA 5ICFA 4ZV4A 5HZKA 4H18A 1OH6A 1V1RA 4PYQA 1OROA 5L3RA 1TE2A 1VE5A 3LUHA 4DBVO 4DY6A 1P4GA 5CITA 5EHQA 3P27A 4LXGA 2X14A 2J59A 2ZT5A 1MJHA 3BFJA 3WGYA 1NURA 1EG7A 2FX5A 2IW3A 1KC3A 2ONCA 3Q7SA 4FXPA 3S0JA 1KE2A 4LYDA 4FQ5A 2JLWA 1FUUA 1RRKA 3HEAA 5CM8B 4LJ9A 2XA9A 3RF6A 4NXMB 4JHLA 3IQHX 1UH5A 4ML3A 4EW2A 2D7JA 5IT4A 2CZQA 2BUBA 2FEKA 4LV8B 5JCOA 5F9FA 3D3NA 4OYHA 2IP1A 5GJWC 5BW6B 5CEFA 2GZ3A 4WSOA 4DNQA 4B2YA 1R8SA 3L7JA 1H66A 4Y3UA 4PX9A 3ENQA 1QV6A 1QLJA 1JHZA 3H18A 5D84A 4V1CI 1VCNA 4AJ4A 4PFJA 4WLVA 2Y0EA 4HWTA 3PK0A 2YJ5A 3GRUA 4ZVNA 5PNTA 1MU0A 1XX6A 5ICMA 2NUPA 4HYQA 2CK3D 4GPIB 1UFKA 3CX7A 3DMTA 3NALA 4HP8A 1C7RA 3OOYA 1MJFA 3FSGA 1IBMB 3TG8A 4KP7A 3TDMA 1I9GA 1ADYA 1WUYA 3FGOA 2LD4A 4GM0A 3K6SA 4FWTA 3KEQA 4HEJA 4WN9A 4BFXA 5DTRA 5KTSA 1I80A 5SZIA 3B9PA 4C4RA 2VHEA