1DBSA

Mechanistic implications and family relationships from the structure of dethiobiotin synthetase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biotin biosynthesis
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Mechanistic implications and family relationships from the structure of dethiobiotin synthetase.
pubmed doi rcsb
source organism Escherichia coli
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1994-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dbsA00
2QY9A 4LHVA 2ZRJA 2NGRA 1GDDA 4MGYR 1RRCA 4DSOA 3E70C 1NMZA 2AWNA 3Q3JB 1FFHA 2NO6A 1R0ZA 1IY0A 4ITRC 2ZRAA 1LY1A 2CXXA 3E5HA 3QXXA 4BFZA 4NBSA 3UG6A 4DLWA 1X8JA 2R9VA 4DCNA 2JA1A 4ZI2A 1P4SA 5FBVB 5FPSA 4BFSA 2BJWA 2C04A 3MAAC 3SN6A 2CJWB 6Q21A 4BFVA 2ZRIA 4ZDJA 1IN7A 1DPFA 2W83A 4D81A 2LCFA 3T1VA 3KUDA 2IYSA 5BW8A 1F5NA 4NP6A 1J90A 2ZRKA 2PX0A 1WCV1 3L2OB 1Q21A 1XRJA 2VSFA 5J4VA 1UBGA 1SXJD 2RHMA 3CR8A 3H4MA 4HLUA 5CLQA 2O5VA 4FMCF 4G3XA 4W5HA 4M1SA 2XZPA 1QG4A 1P61B 1TQ6A 1DBSA 3CRRA 2O8DB 4AKHA 4PX9A 3R9IA 3ZDQA 3SFVA 2FFQA 3CONA 4QBIA 4PAOA 5LB4A 2FG5A 1G6HA 4AURA 5C18A 5TMPA 521PA 4R71A 3QY0A 3FHCB 3GLFB 2ZAMA 2F3TA 4EQ6B 1G8GA 2FV8A 2JASA 4EIWA 1DAFA 1YKSA 3ZD7A 3W3ZB 3CBQA 5JZVA 2ZJOA 1Z08A 4DLUA 1S8FA 2IYYA 4PZLA 4IEEA 5B2ZA 2OXRA 3RRYA 4AIIA 4TSFA 4TMWA 4Y0AA 2REBA 2VPPA 1R0WA 1HT1E 3QIAA 3DOFA 2ZJAA 3DEFA 3GEHA 5JRZA 2ZQ5A 1MR3F 1P2UA 1TMKA 4FI3C 3L8YA 4B3FX 1N0VC 2CEAA 3P4XA 4O2LA 3BGWA 4BEJA 5EXXA 1OF1A 3ICQB 1EXMA 4QL3A 4DT1A 2SHKA 5K8LA 2WV9A 4GT1A 4JYCA 1D2NA 4RJLA 5E7IA 3SR0A 2JIZA 2MMGA 3GLHA 2W0MA 3HYRA 3ICEA 2HUPA 3WBJA 3E2IA 3FYHA 3RRNA 2F9LA 4C2TA 2HJGA 2WOJA 5JHGB 1F60A 3X1ZA 3LWNA 2VSOA 2OLKA 3BERA 2ZETA 1WA5A 3LQRA 2ZE6A 3TSOA 2OLJA 4XVQA 2VQSA 4B75A 4QKQA 1AJEA 1XJCA 5JRJA 3IQXA 4OJKA 1VIAA 4HYYA 1U0HC 4HZUA 1GRNA 4YMSA 1OH5A 2H17A 3GLFA 3ETLA 3AVWA 1OHHD 2GVZC 5M04A 4Z8XA 3P1JA 2HV8A 1AGRA 3OFNA 3ZVNA 1WP9A 2WWGA 4A8JA 1T0HB 4Q02A 1FX0B 1N0WA 3KJIA 1OXTA 1Q57A 5A0FA 1C9KA 4DXAA 2A5FA 2QAJA 2XTNA 421PA 2Q3HA 3SBEA 4F7WA 3FWYA 4JL5A 4DCTA 2K5UA 3L0OA 2BJVA 1IXSB 1ZNXA 4JYBA 4S35A 4KODA 4I1OA 2OCYC 2ZRHA 5JI3E 1J2JA 1GNRA 1S4QA 1HTWA 2VHJA 4K81B 4TYPA 3RYTC 4Q4HB 2OESA 2ZYVX 1CRPA 1MT0A 2W0SA 2IYRA 4PPNA 4U5XA 5LDDC 4BUJA 1KSFX 1AS2A 2G77B 4IOLA 4XSGA 5BN3A 2G1JA 3QXJA 5HKKA 5KHOC 4RZXA 4PSAA 3AM1A 2RH5A 1TUIA 2GWHA 1XXHA 2C96A 2GAAA 2KI5A 2NZ8A 3LDAA 4HAZA 1P73A 1HE8B 1G7RA 3T35A 4A0RA 5KTYA 1MABA 3NWJA 4GZMA 1W0KA 5AUPB 4PC7A 5JWRA 3TR5A 1Q1QA 3CRVA 1MH1A 3TJZA 3TR0A 5FOXA 2BBOA 2QAGA 1A82A 2QRZA 1S1CA 5AJWA 3NDPA 2V3CC 3K0SA 3PV0A 2B6HA 3DPUA 4OK5A 4NYJR 3AUYA 3L82B 4G5QA 2ZROA 3AQ4A 3BIFA 4JJKA 4NCHA 3FKSA 4UNSA 4WXPA 1CF4A 1KMHB 4TMVA 2NZJA 4JSYA 1W5SA 2ZR0A 1Z0FA 2FSFA 4TYNA 3U6BA 4YMTA 3RS4A 4Q9IA 2VHCA 1XD2A 2GCNA 1FP7A 2QM7A 2ERXA 5LBIA 3T1QA 2WKRA 3T15A 3SU8A 4US0R 1W0JA 1JR3E 4FIDA 2IBMA 4JVSB 1VYTA 3GJ7A 4JBYA 4V0ME 2QP9X 4UXJA 1XMSA 1WRBA 4V03A 2FX3A 1FUKA 1RJ9A 1WF3A 1VYVA 2C78A 2UZIR 2QMUA 1AM4D 4HLQB 2GEDA 3KB1A 2DHRA 3U7HB 5FL3A 1NIPA 3MJHA 1CJVC 3QXSA 4RD2A 1YHNA 3EZ2A 3RS0A 3TSWA 4B3GA 1NN0A 1VYUA 4A1FA 1CR1A 5EJEA 3NVAA 4JZKA 4OHVA 5FUVA 4AYXA 4EPWA 4NCIA 1YZLA 4QBHA 1JR3D 1UDXA 2YYZA 5JS7A 5KSZA 1Z0JA 4HDQB 2IS1A 3AP1A 3U6KA 4BZQA 4AG6A 3U7GA 1EFTA 1U0JA 4QHTA 2QTHA 2NPFA 4O3MA 3MMPA 3QKUA 3WXMA 2MMCA 4LJYA 5TDHA 5TVKA 3HWSA 1GKYA 3NBZC 2UVQA 2A5GA 5HTKA 3AVYA 1S3SA 1E6CA 4AKGA 4B44A 5CIQA 4CEHB 1U90A 2G1KA 4XSHA 1TF7A 4ZKEA 1UKZA 4RCYA 4DZZA 1KMHA 4IXNA 3VTKA 3A1UA 3CIOA 3WYGA 1R5BA 3B2EA 2PMKA 3RC8A 2CL0X 1SKYB 3MWLA 4HLCA 2BHRA 5JHHB 2JLWA 1E2HA 3I92A 3KB2A 1G17A 5CJ2A 1KSGA 2F3RA 4QGFA 721PA 4OQMA 5IK2D 5HZHA 1VCNA 1SHKA 4DC9A 1E99A 2FPKA 3KKPA 4U7DA 4MH0R 4ACAA 1PZNA 2A5YB 5BXQC 1Z28A 2WWFA 5KNBA 4UNNA 1JPJA 2GJKA 1VG9B 2D2EA 1T5IA 4G5RA 5DI3A 3GJ6A 4B2IA 2ZJ2A 1DO0A 3U44B 2ZRGA 2CVHA 2IWRA 4DHEA 3C7KA 4DUGD 3TW8B 2D3WA 1XZPA 2QTVB 3PEUA 3UG7A 2O8FB 1G8PA 2J7PD 3TGPA 4Q1CA 1GIAA 4PTLA 2IA5A 5DI9A 5BYKA 1VDZA 3DZDA 1KJYA 4B6FA 1ZUHA 3OE7D 1QVAA 1OPXA 3ZJYA 1R5OA 3OIYA 1XTSA 3KKQA 1N3BA 1W5TA 2P6UA 2EFHB 2CVFA 3MD0A 4I81A 5FR2A 2NO1A 2NPIA 3RANA 4LJ7A 4E09A 4TL9A 1VHTA 3WMGA 1KAOA 3CF6R 4OQNA 3ONWA 4L8GA 4R2IA 3T34A 1GVNB 2IX3A 3Q85A 2J0UB 4A0FA 2YOFA 3SOPA 1UDWA 4BFYA 1IM2A 1XX6A 1G1MA 2IEZA 4JKIA 5GJWC 5JLJA 5EXSA 3RSOA 1LW7A 3AUXA 3CH5A 4CW7A 3B7GA 3WYFA 5FTLA 4OHYA 1DVRA 4B71A 2HYDA 3DL0A 4WXRA 3IBGA 4RFVA 3KJGA 2ZRDA 5SZJA 2GTPA 1P9NA 2I1QA 5DO9A 1OKKA 1AQYA 1XD9A 2VL7A 3NBFA 1XD8A 3EIHA 1B0UA 3BB4A 2ODBA 1PV4A 3PR1A 3W6NA 2CNWA 1KI1A 2DWOA 2EWVA 4JLAA 4LRWA 4KLNA 1GM5A 1CJTC 1ZAKA 1CEEA 1IN8A 2V1XA 1JNYA 1HH4A 1S3GA 4P3YA 4OHZA 1OFHA 3S1AA 2VP6A 5E7JA 5FOSA 1II9A 2QE7D 2IT1A 2NMVA 4CEJB 4MKGA 4NONA 5HE8A 2Z0MA 4ERNA 1CJKC 2ZSEA 4G5GA 1ZCAA 1KO1A 2ZITA 3CPHA 4KO8A 3VFDA 4FINA 4EPYA 2AL7A 4W9MC 1N25A 5EP4A 3L0SA 3KKNA 3AEZA 4DWJA 5G40A 3T1OA 3R8CA 1XPOA 2GCPA 2ZE5A 4DSTA 2R8RA 4RKEA 4YQFA 1XWIA 2VHUA 4LK2A 3Q5EA 4XWOA 1HUQA 3X1WA 1II8A 2G0TA 2JGNA 2ZS8A 3IGFA 3W8NA 4R9UC 1CXZA 3F3YA 3UWOA 1P2TA 3X2SA 5KU1A 2JDIA 4MRPA 3ASYA 1XTKA 2P65A 2GXSA 1ZUNB 3H86A 1XF9A 3K0AA 4DLVA 2BBWA 2ZSAA 4YC7A 1HT2E 1NL3A 3SJBA 2QP3A 2BV3A 2EW1A 5ELXA 1T8UA 1TU4A 1Z3IX 4GOKA 1CLUA 1TNDA 4IKEA 1XNJA 1E1QD 3DKVA 2ATXA 2EWWA 3KKMA 5FPKA 2KBFA 2IYZA 4DLXA 5C1BA 4MDEA 2AD1A 1H8ED 1IN4A 1R4AA 1AKYA 3QENA 2QM8A 2OBMA 4MDFA 1N2CE 1YE8A 3EWAA 3K70D 3DOEA 4M9XA 1KNXA 3QPUA 4ESVA 4US2R 2ZM5A 5E7MA 4B43A 5DISB 1VMAA 3HPQA 4I1SA 3THYA 1RPZA 2O8CB 2IK8A 3X1YA 2W6IA 1KHTA 3KJHA 4CEJA 1H8HD 4TMKA 4TN1A 2W2VA 2WJJA 2W2TA 4LBVA 2YC2C 2DY1A 1E0JA 3LW7A 1GTVA 3RWOA 1OFUX 3VR1A 1KO7A 3ZH9B 1Z06A 1X8KA 3B1ZA 3LX8A 2AD5A 2NO0A 4KLZA 1COWA 4ZCMA 3ND9A 4KU4A 3KL4A 2R2AA 3Q7QA 1U9IC 3PENA 4LJ6A 4XTRA 5D3MA 3GLIE 1RC8A 1D2MA 3O8BA 4A2QA 1KSHA 2CL7X 2AKYA 3T5DA 4QJ5A 4Q9KA 4GI7A 1N6HA 3RC3A 3TKLA 1SVIA 3I5YA 4GOJA 4NU0A 4RY2A 4LC1A 5JMTA 1DO2A 4NMMA 1BMFD 4MUBA 1GNPA 2QZ4A 4UNRA 1EFRD 3MJRA 4LJAA 2BMJA 1T3HA 3AKEA 3L0PA 4PQFA 1CJUC 8OHMA 3ZLJA 2JLYA 1G291 5FTNA 3A6PC 3LVQE 1LB1B 1NN1A 4Q19A 4PC1A 2GNOA 3W9YA 3P32A 4PPGA 5CITA 4DEXA 1RYHA 2QTFA 2FMXA 4RD0A 4TTQA 3CWZA 3UMFA 1R10A 1YR7A 2JJ1D 4EUNA 3U5ZB 1KI6B 5EE1A 1XMIA 2WJGA 2FF7A 1T5LA 4KAXA 2F9MA 4OK6A 1W4CA 2EFGA 1XPUA 4YDHB 4GZLA 3BH6A 5LPNA 5AUQA 1ESNA 1NNEA 1KO5A 1E2DA 4JKYA 5AJZA 2FE4A 3L0IB 3LX5A 1FL9A 4JJZA 1BO6A 4L5BA 3D3QA 4DSNA 2GZAA 2ZI5A 2VHQA 3GEIA 4ZCIA 3LBNA 4NYIQ 5BYJA 2WAXA 2IUTA 2W6JD 4AWXA 2HJVA 1J70A 2J0SA 1G3QA 3PEYA 2XITA 4ARZA 1BOFA 2VP4A 4RZ2A 3PUVA 2DPXA 4QBGB 3DVLA 1NRJB 3N5CA 1CKEA 2ZUCA 4KHZA 1E79A 2KE5A 4LV6A 1ZD9A 1LTQA 2ORIA 1FPMA 5KSOA 4HAYA 2RGNC 3LXXA 1G7CA 3AGQA 5GJCA 1IN5A 5DYIA 3B85A 1UM8A 5EE5B 1N5IA 4HUTA 4HDOB 2J45A 4B6EA 3WRYC 2ZUDA 1SXJB 2CHQA 1KAGA 1S1MA 2RAPA 2ZS7A 2WJIA 3SS8A 4HAWA 2NO7A 3JVVA 5TARA 5CDFE 2IHYA 2OUKA 2XTMA 2OBNA 1R8SA 4DDWA 3CR7A 2MSEB 1BYUA 4FD2A 4BPBA 1Z6TA 4CEIB 2CK3A 4JBWA 3NH6A 1VCMA 5EE3A 2DFTA 4GNKA 4JLNA 1Z63A 3QXCA 3LLUA 2UZ3A 3Q8XB 2QP4A 1NN5A 1NG9A 4BLQA 1DAMA 3I61A 3BFXA 5JCZA 3KQNA 4HB2A 3ZIAA 5CB8A 4A92A 1HY3A 1Z2AA 2HF9A 5KOYA 2CCGA 221PA 4RCZA 3ZYCA 2OXCA 4IDPA 2OAQ1 2EYQA 1A5TA 2XSZA 1XCMA 1E9FA 2CBZA 4GP6A 3R9XA 3Q5DA 3EW9A 3GJXC 1AIPA 2RHDA 4EAQA 2RMKA 4TQAA 1ZC4A 3RS5A 2YVUA 4R98A 5FUXA 1ZIPA 2QMEA 3ADKA 1QDEA 3CNNA 1E98A 4PC3A 3WBKA 2OFOA 1GKIA 3GJ3A 1E2LA 3DZ8A 4HEJA 3AP3A 3IO5A 4JL6A 4HSEA 5BN5A 4LHZA 1U99A 3SE0A 1XFAA 3SQXA 1ZC3A 3KTAB 2CE2X 1E3MA 4HAXA 1FZQA 3KFVA 2ONJA 1NVUQ 3R7WB 4ON9A 2LKDA 1MRSA 4FMCB 2V7QD 3UPUA 5FI0B 2XAUA 4IHQA 5K8IA 3V4FA 3R20A 2GEVA 1CP2A 1ZCBA 4UXIA 4CEIA 1M1YE 1ZD8A 4C7OB 1S9HA 3MSXA 5CIWA 3B8HA 5DIFA 2BKEA 1I2MA 2QUZA 1Z5ZA 3TVDA 2GZHA 2HLDA 2YNMA 3OAAD 4BZPA 4RVCA 2WWWA 1KGDA 4D4MA 3RLFA 4D4KA 1L4YA 1X86B 2Z4RA 4AD8A 3J81k 3Q9LA 1SXJE 3D6TB 1DAIA 4E07A 1J8YF 3HR8A 3VR3A 1KK1A 3UWKA 1G19A 5JJKA 1G7TA 1FOEB 1HV8A 2IS4A 3WNDA 4BE7B 3BC1A 3EPKA 4QJ4A 4MKFA 2AWOA 2RGBA 1JR6A 2QENA 2GCOA 4OKSA 1YU9A 2NOAA 3EWSA 4A36A 1U2RA 4L15A 4G01B 1N0UA 3I72A 3VHXA 3BFVA 2YOGA 4TMZA 2WSMA 4C4PA 1F6BA 2ZI9A 1G9XA 1KK0A 2EFDB 4L9SA 3EIQA 3QI2A 4LV8B 1KMQA 1G64A 4KSBA 4PSVA 1KI9A 2ODWA 5G3YA 4UJ5A 4XWAA 1XU4A 4BGDA 3OEEA 1VG0B 1IQPA 1E4VA 2ZRBA 4Q66C 1A1VA 3KTAA 5GJVC 5KPJA 2TMKA 3CPEA 4KBGA 4W5WA 1MO6A 1U8ZA 1GFIA 1UKYA 3KUCA 2REOA 2O8BA 1Q44A 1X8LA 2O8EB 5G53C 1U9IA 1KDRA 1D9XA 2WWXA 4Q03A 5E4FA 1QZXA 3HP1A 5FUYA 1U94A 4YXWA 1QBKC 1I4TD 2ZIAA 4GDFA 4MYTA 4MUAA 2ZSFA 1RW4A 3EG5A 4GOXA 1EX7A 2ZXUA 3QQ5A 4QM7A 4C2UA 2HF8A 3KXIA 4PHGA 3HJNA 2Q6TA 2GETA 4A2PA 5J5CA 1NJGA 2C9YA 4M22A 1BKDR 3OHMA 4DCUA 4XVRA 4Q4AB 2ZRFA 3SZRA 2J3EA 3EA5A 1XCPA 3K8YA 3G5UA 1M34E 2BCGY 4TYYA 3KJEA 5KDDA 3A1WA 2GXAA 3TUJC 3CUEF 1NF3A 4LV5B 4ZIRB 4EKDA 4B32A 3AGPA 2CJWA 4Z1MA 1Z22A 1NBMA 5FBQB 1KJWA 5KSPA 2WMNB 4GMDA 2OAP1 1SVKA 3QOFA 4XH9B 4KFSA 2P67A 4WBSA 4B3DA 4BZXA 3UMRA 1E4YA 1RYFA 3O8DA 2XNDA 2ZJYA 3OEHA 3SJCA 4DLTA 1M7GA 5BN4A 4HATA 2XOKA 1HQCA 4M53A 5EP1A 2O8DA 2IYWA 5AJVB 2J0VA 4M9ZA 3QEJA 2PZFA 5G3ZA 1YR6A 3FE2A 1M74A 4LGMA 5JS8A 3P20A 5HZKA 5FTMA 3CZQA 3K70C 1UAAA 4FMDF 2QSYA 2QT1A 4EQ6A 2ZRNA 1JB1A 3ZZTA 1P2SA 3T1TA 4IOMA 1S0UA 2C9CA 4DVGA 4JLBA 1XCGB 4GP7A 5J4HA 3SHFA 4TTPA 1G41A 1QG2A 4CRWB 1G7SA 4LZZA 2XB2A 1E2QA 2RGNA 3K9LA 1ZD1A 2PL3A 1E9EA 2X2EA 2GA8A 3B13B 1YZTA 1RFLA 3IIMA 2CCKA 4IVPA 3GLHE 4IDHA 4DLYA 5KUTA 3SFZA 2EVWX 2PZGA 2VIIA 2OBLA 4TSFD 4ZIRA 3ADBA 1G5PA 1UBFA 4NCJA 2I3BA 4C0KA 3F0TA 4KFRA 2ANBA 3LV8A 1G8HA 4KFTA 4M1YA 4LI0A 4B2PA 1MV5A 1NKSA 5KPDA 3AH8A 5KNDA 4I99A 1SVOA 1E9AA 3KXLA 3ZZUA 3C4JA 3GFPA 5KSYA 3EPHA 1FNMA 1E32A 1TF2A 5JEEA 5KDLA 2IYQA 2YWEA 3WYAA 4URVR 3MCAA 2Q3FA 1SQ5A 3MRSA 1JQLB 1XEWX 1EG7A 1CBUA 2P5SA 2JIZD 1W36D 4N1AA 4FCVA 5DN6A 3VU9B 2G0NA 3QNUA 4TT3A 2ZRCA 4P4UA 3KQUA 4JLDA 4POAA 4Q00A 1NY6A 2V54A 2WWIA 2D62A 3IEUA 3LD9A 2ZU0C 5FPHA 3TNFA 2G83A 4CF7A 4AI6A 3GMTA 2FWRA 3KX2A 5JEDA 1PLJA 2V4ZA 1QHNA 1CR0A 2IF2A 1FQJA 4I4LA 2IXFA 5EZ5A 3VNUA 2F55A 3HDTA 2ZI3A 4EFLA 5EUQB 3VKGA 1E2MA 1FX0A 1T8TA 5F2EA 4NHOA 5JWHA 3DMNA 3B9PA 3C5HA 4V0OA 1YZKA 2A7QA 3BK7A 5G41A 4KI0A 3T06B 5J47A 1IN6A 4M1OA 4EPXA 3OFND 1AZTA 4DBLC 1G3MA 2HDNB 4NYMR 3WNBA 3BBPA 3VX3A 4Q4HA 3K0EA 2WSSA 4LJ9A 4CZ2A 4PO9A 3ZQ6A 2Z43A 4RD1A 2ORWA 4HB4A 1TX4B 2D74A 4MGIR 2EFCB 1OFTA 2WPDA 1JI0A 3DDCA 4P31A 4B3CA 2R6CA 4DB4A 3BFKA 5H70A 1ZMXA 4GPTA 3AB3A 4URWR 1YQTA 1QRAA 1T4GA 2H1LA 3MG9A 4UNPA 5KDOA 3K9NA 2D4HA 3GQBA 1KDTA 2RB4A 2H5EA 1AGPA 3ZS8A 4MKIA 2W2XA 3R8FA 1LFDB 2ERYA 5HKKD 1S9DA 3U4QB 1QHXA 4MITA 4L9WA 2HT6A 1KO8A 2V1UA 2RGAA 5EP3A 2R62A 2JJ2A 1ETUA 3I3SR 4ZO4A 4MQBA 4DDVA 3CW2A 4B3XA 3GFOA 3D7MA 3U7FB 1W0KD 2CLSA 1UKEA 2ZYWX 2BCJQ 5CM8B 4P0TA 3NC1C 4YMWA 1E0AA 1SVLA 4IOJA 3A58B 1OJLA 2PX3A 4BQSA 2J87A 3RWMB 2PEZA 1GG2A 2X19A 3K0FB 1YR9A 2VLIA 1ZU5A 1E2EA 4XOIA 1XTJA 4LWZA 3PQCA 5C2JB 3FKSD 1IJEA 3M6AA 2FH5B 2HT1A 2GJAA 2LWIA 4F91B 2VBCA 1DAEA 1NMYA 1LV7A 2RCNA 1M8PA 4X8LA 2FZLA 1GNQA 1QHIA 3OIUA 4LPKA 1Z8FA 5H1YA 3ADDA 1W0JD 1Z6XA 2OCAA 2Y8EA 2H92A 3U3KA 2B7BA 1R0XA 1SHZA 2V6IA 4PPFA 4UNQA 1W1WA 1CU1A 2QBYB 3K70B 1W4RA 4EPRA 1P9RA 3HU2A 2C5LA 1TEXA 1I4LD 1KSJA 3GJ8A 4UJ3A 4F4JA 3NH9A 1FMLA 2GXQA 2WM9B 2XJ4A 3FMOB 3FMFA 3HU3A 2FFHA 1F48A 1JBKA 4QC2A 1ONBA 2FNAA 2FSHA 4M1MA 3VHLB 3U4QA 4TZ6A 2IW3A 4LHXA 3SI7A 1S2MA 2BM1A 2C9OA 3NEJA 1V43A 4A9AA 2CE7A 1MO3A 4DCVA 2YZ2A 3THXB 4DLSA 3AVXA 1E1RA 2XTZA 2OO7A 1WBDA 5DGXA 4CEHA 4RFSB 1ANKA 4JLKA 4V02A 3HU1A 3TQCA 2OT3B 1KIMA 5UKDA 4ASUA 2WHXA 4ZDKA 3Q72A 3UANA 4Q48A 4OQLA 5TB5A 3W90A 2ZRMA 5FBWB 2RGDA 2BMFA 3ZVRA 2QQ0A 2QGZA 1OXSC 1YJ5A 4Q1FA 1KOFA 1HEIA 3RS2A 5P21A 1N5LA 1L4UA 4HI0E 5C4MA 4BWYA 4C0HA 1NSTA 3CNOA 4IJMA 2P6RA 5KYKA 1YRAA 4JIMA 1T6NA 4LBYA 4DCSA 1EGAA 1GRQA 1DOAA 1PLKA 4BRUA 2IUUA 1TTTA 3A1SA 1JALA 1WBBA 4WOPA 3WP1B 2ATVA 2VEDA 1K8RA 3PUXA 5FTKA 2KWIA 3C14C 5J40A 3IIJA 3NXSA 2WTUA 1YZQA 3VR4A 2VH5R 3KDSE 2YWGA 3U44A 1P62B 1EFCA 2QN6A 3L43A 4URYR 1ZRHA 1E94E 1FUUA 3M4YA 1VIYA 3LNCA 4Q1BA 2QBYA 2O8FA 3GLIB 2ZUBA 5KO2A 3M0EA 3LY5A 4WAUA 2G9NA 2YJTD 4EFMA 5F9FA 1Q1EA 1JXOA 1QHHB 4KBFA 1ZM7A 2BBTA 2BMDA 2WJHA 4LOAA 2XXAB 2IL1A 4JVNA 4TYQA 1W47A 4BFTA 4D6PA 2DFLA 5FFMA 1CTQA 3CH4B 1SXJC 4PO1A 4TMTA 1RRGA 2HXSA 2WMOB 4Q7KA 2RGXA 1G6OA 2H57A 2Z6VA 1RKBA 3AF4A 4B47A 5KNCA 3SHWA 4AC9A 2IYTA 1XB2A 2J0UA 3FPAA 4D4LA 4C3ZA 2P3SA 2ZEJA 3BORA 2C03A 4H1UA 4JL8A 2ODEA 1H65A 1SGWA 3IIKA 1LF5A 3IQWA 4C9BA 2WZQA 4O25A 1Q3TA 2ANCA 2KB0A 4OJQA 4CT5A 4EFNA 2FGKA 2HCJB 4NE2A 2GILA 2GDJA 1XEXB 2JATA 3KQLA 2OFWA 2OSBA 3TK1A 4BLPA 5JJIA 1G3UA 1TEVA 2HXYA 2WJYA 4TYWA 4O0MA 3K9GA 2VYFA 2AHOA 3ZZ0A 2ZSDA 4PO8A 5GVSA 1Z0IA 4D2IA 1SKQA 4Q1AA 4P33A 4R7ZA 5C46F 5K8UA 4HAUA 4M9SA 3RS7A 5IF9A 5JI2E 3KQKA 1UEJA 2IYUA 4BFUA 4ZV4A 1BYIA 1E69A 1OKKD 2PT5A 3EXAA 3VR2A 2WWHA 1F2TB 5FPYA 2DWQA 4E5UA 5EZ6B 2CNWD 3PITA 1JQJC 1KO4A 3SYLA 1PUJA 2PCLA 5B58C 4AYWA 4Q47A 5HPYB 3X1DA 1EX6A 1IJFA 2AXNA 2PJZA 1FW6A 2PJRA 1A7JA 1ELOA 3EX7C 1P60A 1LNZA 2MSDB 2CHVA 1K6MA 5AJYA 4QBFA 3TIFA 4QJ3A 2L0XA 4OI0A 4LSGA 2RGCA 1Z47A 1JJVA 4HDCA 3VAAA 2V9PA 2W58A 5EUMA 3GLGB 2JLUA 3B1YA 3AVPA 4U00A 1OT3A 2KBEA 5J4LA 4B48A 1D2EA 2IEYA 3GFTA 2AX4A 2PH1A 2ZRLA 3WY9A 3IILA 2VHTA 1JAHA 2ZSBA 4GFDA 2GF9A 1V5WA 3ZGXA 2JLZA 4M1KA 1TADA 2OG2A 4GMXA 1M7BA 2D2FA 5DHAA 2F43B 2JDID 5FL7A 3QBVA 4PC6A 3NKVA 4M2LA 1KI2A 4CGZA 1XEXA 1Z0KA 2Q9AA 4QOSA 3RDPA 4KVGA 4IDOA 2BOVA 3A4LA 4TL8A 4A0GA 2WWYA 3JVUA 4P4SB 2NQ2C 1NVVQ 1RRFA 2OHFA 4D0LB 1XMVA 2DYKA 3WHLA 3GP8A 4TQUS 4Q01A 1VG8A 2FPLA 3PFIA 2AK3A 2O8CA 1UF9A 5H68A 3AKYA 1DAGA 1UADA 4MYCA 3B6EA 2J0QA 1C1YA 2P2LA 1Q20A 2P5TB 4G0NA 3PG5A 5EXPA 1G5RA 1OV4A 3SQWA 1AK2A 5F3WB 2W6ID 1KDPA 3OZXA 3Q7PA 3B5JA 1GL6A 4XVUA 1RE0A 3UXMA 4LYFA 1KYIA 1SULA 3THOA 1FP6A 1R8QA 4B33A 1TQDA 3DO6A 3I8XA 4GSYA 3W5IA 5IRCD 5L8VA 4Q5IA 1X1RA 3B1WA 5FPTA 5SZKB 4B73A 2ZPTX 2DWPA 4P32A 3V9PA 2GK7A 4W5JA 3PEWA 2GAOA 5JWOA 2FFBA 1AN0A 3BWDD 3EC1A 1COWD 1M2OB 3OESA 3T5GA 4KITB 5FBRB 1GITA 4LJ5A 1JJ7A 1LS6A 2JLRA 1XTRA 3U61B 1KY3A 1F3OA 4UXHA 1DARA 3A4NA 1J8MF 3D31A 3TUZC 1DAHA 4B74A 1DTSA 1QVRA 1WXQA 2F43A 3VR5A 5DHFA 1QF9A 4PZYA 2WVJA 5CLLA 1IY2A 5F9HA 3EIEA 1NLYA 4TTRA 2O52A 2OFXA 1E2IA 2NTYC 3GLGE 4RSGA 3FGNA 1NMXA 5H8WA 2IYXA 1KI4A 4A8JC 4IDNA 5L3SB 1W44A 4XIGS 2Q21A 2ZJ8A 4Q7MB 1KI6A 1HA3A 3K09C 1LF0A 1AZSC 2YOHA 5L3VA 2EQBA 3TH5A 3LQQA 4XWKA 3RABA 4Q4JB 5JSZB 3IPYA 4QXAA 2VO1A 3BOSA 3CX7A 3ZS9A 4ZCLA 2XZOA 2IYLD 3KZ1E 3LO5A 4B35A 4PAQA 2FDCA 4JBXA 2ZYTX 3EC2A 3SYNA 4ESHA 3MFYA 3C41J 2JEOA 1NVWQ 4BFWA 1JEEA 1EWQA 4PXAA 5J4KA 4CT4B 2WIBA 3EA0A 1FTNA 1HURA 1KI3A 2VSXA 1GKUB 4Q1DA 2PLFA 5CYOA 3H0KA 1PUIA 3GJ4A 3PUZA 4Q7JB 5FOVA 4OK3A 4RZUA 4LC0A 4NYIR 1G5TA 4OI1A 3RS3A 3K9HA 3QG1A 2VF8A 3PUWA 5B64A 4AK9A 2EYUA 3O47A 3I5XA 3H84A 3LW8A 3NHAA 1E79D 2FSGA 3BH7A 4A6PA 2G3YA 1SXJA 3U60B 1L2TA 3DMDA 4DDTA 1DE0A 5L3SA 3JZAA 1W2HA 1OH6A 2ZI4A 1NVXQ 4BEBA 4Q7LA 4JVLA 4GBMA 4IRUB 1TAGA 3MWKA 2XGJA 2B92A 3RRZA 3LVRE 821PA 1CR4A 3A4MA 4Q4JA 3SJAA 1E0SA 1LS1A 3C8UA 1AKEA 3VX4A 2F1RA 4CYMA 1XPRA 1GP2A 2ORVA 3CF0A 3MWYW 4LCBA 2H7VA 4TZ0A 1D5CA 2CK3D 4NL4H 5GVRA 2OEPA 4MRRA 3QVUA 4DDUA 4Z54A 3RAPR 1ZM2A 4QNMA 2XJ9A 4IOKA 2UKDA 3REFA 3NDBB 1KKLA 2BVNA 1AS0A 1CJMA 2GK6A 3FFAA 3V00A 2NIPA 1A2BA 2PLRA 2VTKA 4MGZR 3NIBA 4QNRA 3SNHA 2FA9A 3LA6A 2A5DA 3SYKA 1Z0AA 1E2FA 4QG7A 1DELA 3ZIAD 3HYTA 1XTIA 1RRPA 1TPZA 3N2IA 3DM9B 2KSQA 4FW9A 4TMXA 1E9SA 3NBYC 4BASA 1U98A 3KQHA 5BWMA 5DLQC 5JJLA 3TAHA 1YVDA 2X8AA 2G88A 3EZFA 4TLDA 1SVSA 4Q9LA 5FR1A 3MGCA 4O2RA 4XD7A 2D06A 1UPTA 2IYVA 2PZEA 1OXXK 2XSZD 1NIJA 1T0JB 4DRZA 3W6PA 4N0DA 2GF0A 4II7A 1ODFA 2BEKA 1TQ2A 4QGHA 1R6BX 2YV5A 2NO9A 4DT1B 3R7WA 4US1R 3JZMA 5CM9C 4PHFA 3C15C 4NPHA 4P4TA 1GL7A 2GJSA 3FTQA 4NTZA 1Q12A 1EFUA 3GLHB 1W36B 4HLDA 4YMVA 5DSZA 5B30A 4DSUA 4C7OA 3CZPA 2ZR7A 3CX6A 1HYQA 4M21A 2GVDC 1G8FA 5FOWA 3TAUA 1ZU4A 1KNQA 3B60A 3HPRA 3NEYA 1OHHA 3QPVA 4FMDB 4QHSA 4OQFA 2F1JA 1SVMA 2REXB 4QFMA 4CDGA 2YHSA 4Y0VA 1IHUA 4EPVA 4HZUB 3GPLA 5K8TA 3WP0A 2HLDD 1MRNA 1T3SA 1FMJA 2IS6A 3QXHA 1Z2CA 1JECA 2YKGA 1P5ZB 1N6PA 2WBLC 4MRVA 1RIFA 2H18A 2Q9CA 1NLFA 2IHBA 4A8JB 4AKIA 4AKEA 1OXVA 2ODNA 2ZS9A 3WMEA 2V8OA 3ZVMA 1KI7A 1OB5A 2JLVA 2BMEA 3OIWA 5JECA 2J9RA 3LAWA 2J5XA 4UQOA 4KXFB 1ZVQA 4BRWA 1T9HA 3PUYA 1IXZA 3TSZA 5HCIA 1IOZA 3EARA 2J41A 2GHIA 2GRJA 1NN3A 2ZJZA 3QKTA 4MA4A 1XMJA 4K46A 1U8YA 2Z4SA 1Q1BA 1JPNA 2PEYA 3L8ZA 4XD7D 4FWTA 5GADl 2NG1A 4EJSC 3T61A 1EK0A 2O8EA 1UKVY 4F92B 3OEED 3EASA 1HQYE 1XXHB 1N5KA 5FH9A 4NYJQ 4PR0A 4XJXA 4H9GA 3NG1A 3H1TA 5J4YA 1MABB 4A82A 1G4AE 1PJRA 3P4YA 2GZDA 3AVOA 3BB1A 1G21E 2CLCX 1E9BA 1GWNA 1W2GA 2QAGB 1Z29A 1WB9A 2QSZA 4NCKA 4JMPA 4JSTA 4YXWD 2B8TA 2QI9C 4Q4AA 1NBME 2YC4C 1IAQA 2N1BA 3I73A 1E2GA 1GZSA 1GOTA 1UFQA 2VP5A 1L7VC 4YDSA 3F5FA 2FEOA 1Z6AA 1YR8A 1IXRC 5TY0A 3THWB 3FOZA 4NYMQ 2V55B 3TQFA 1WDTA 1XJ0A 4UKDA 1XD2B 1DADA 4D4JA 2XNSA 4LYAA 2DB3A 4ZPXA 1MKYA 2OV2A 4K8OA 1P2VA 4B2LA 1ZYUA 4FMBB 4ABYA 3K09A 3EPLA 4BLTA 3AVVA 1VG1A 3SDZA 1AQUA 3RSLA 2QU8A 2A5JA 2XX3A 1GRRA 1VPLA 2Z5FA 4C0AC 4C0JA 3ZVLA 2IXGA 3CRQA 5D3QA 3BRWD 4Z1MD 1RJ9B 2Q0HA 1G8YA 3A37A 1NBMD 4ILEA 1N6IA 4I1VA 4IFEA 3GLFE 1O3YA 4PAMA 3QPWA 1QHSA 2N42A 2Z83A 1ZINA 3LBHA 3QF4B 1JR3A 4D0NA 4A15A 5HE9A 3ZQJA 3OEHD 4V0MA 2XNDD 1YZGA 2ZI7A 4QGAA 2VP0A 1ZNWA 2N46A 2O0JA 2R44A 3VNVA 2XOKD 2BKUA 1RVDA 1T91A 3AV0B 4LBWA 2C95A 3ZD6A 1AS3A 2ZI6A 2ONKA 4X8HA 5BQ5A 3DHWC 2I1VB 4LX0A 4MGKR 2EFEB 4B34A 1YZNA 1MO5A 1M6NA 1IONA 2G6BA 2GBLC 2YINC 3C5CA 3UKDA 2E9SA 3LFUA 1NG1A 4KVAA 2R6FA 2AXPA 4OL0A 4WA7A 4D82A 3B1XA 1FQKA 4M4SA 4LPSA 3OF5A 5B57C 5IK2A 3BJIC 2HCBA 4A6XA 1ZJ6A 1E9DA 1XXHE 2BDTA 4F38A 3IHLA 3THWA 3B9QA 1LVGA 4JLMA 1KKMA 4LHYA 4M8NE 4DIDA 1F2UB 5FOUA 1FNNA 1OIXA 3FMPB 4ZKDA 1RZ3A 3MWJA 3K0CC 3VQTA 4Q18A 3V4RA 3LLMA 1OIWA 5AJXA 4ZDWA 4DUGA 3W34A 4LHWA 4DEYA 4D25A 4PC2A 2J7PA 5AUNB 3RNLA 2QEQA 2MSCB 3U7EB 1TQ4A 4IXMA 3QF4A 1EFHA 3OE7A 4OYHA 5DI3B 3VU9A 4JVMA 4J0QA 1US8B 1P72A 3QG5A 4JLOA 4MRSA 1P75A 3NHBA 1N6LA 4RD4A 1OH8A 1JEDA 2W00A 1HE1C 1G18A 4IDQA 1NSFA 3CM0A 3GEEA 4EPTA 4KFUA 5TXGA 1OE0A 2GEUA 1CULC 4G5OA 5DN6D 2F1IA 4URZR 4TT3D 1D6JA 1KZGB 3LRPA 4JLPA 1OYWA 1E2NA 4G5SA 1G3IA 4MYUA 2H8KA 1MO4A 1A2KC 1O87A 3U3JA 2WKQA 1UBCA 3FDIA 4BFXA 4CIDA 1QHYA 1GILA 3LBIA 3CLVA 1MOZA 1ZBDA 1KI8A 2BEJA 4LJ8A 2OE2A 5DH9A 3QEOA 4LYJA 1E2PA 1TU3A 3FFBA 2HYIC 1F2UA 2CDNA 1XZQA 4YLGA 3KFXA 1Y63A 1CS4C 4EJSB 4E03A 1UJ2A 4WW0A 3IPXA 2GJ9A 1VCOA 3EZ9A 1OB2A 4AY2A 4WZBE 2X1VA 2WSSD 3AKDA 5DYGA 1W48A 1UBEA 3GJ0A 2QE7A 4TLEA 3CPJB 2ZJ5A 3BD9A 1Q3HA 4GL2A 3A1TA 2FSIA 3CB4A 2C2HA 1DS6A 4NZYA 2RGGA 2WPDD 3ECCA 4QHYA 3I62A 1ZM3A 4TLBA 1OYYA 5CK4A 2B8WA 1M7HA 1ZM4A 2AFIE 2EU8A 4WZAE 4DKXA 2C99A 5AWFC 4OI4A 1Q22A 1US8A 1OSNA 2CHGA 4NDZA 3S1AB 4JT2A 3B78A 2ZYUX 2BM0A 2CL6X 1VCIA 3H2YA 1XJQA 4FCTA 3QE0A 4DIEA 3DM5A 2R6DA 2QROA 1DG3A 2X77A 1EESA 5HR5A 2ZAOA 4FXPA 1Y3AA 4PFSA 4V0LA 1N6RA 1Z6YA 2JJ2D 1DG1G 3QJYA 1T3LA 2FEMA 2XEXA 3K0FA 2JLXA 1NKTA 2ZJBA 4C0BA 4EDHA 3CRW1 2H16A 2OZEA 1G20E 3SEAA 1TL7C 3FHOA 2Q9BA 1II8B 3TMKA 1GUAA 3PVSA 1XEWY 3MLEA 1ZUIA 5TV2A 4AYTA 2OCPA 1G16A 1E1QA 1Z0DA 1XBTA 2IC5A 4PHHA 1J99A 4Z51A 3K0AB 3MUFA 2RKOA 1CR2A 4DB2A 3K53A 2B7CA 1H8EA 4V0KA 3QVVA 2Q3MA 4NH0A 1N6KA 4HB3A 3ND8A 3ASZA 4OBEA 1UEIA 4PHTA 4EJSA 5IT5A 3UIEA 1NJFA 3CKLA 2ZTSA 1XTQA 3AF3A 2LKCA 1KK2A 1N6NA 4LUCA 3N2EA 4N3NA 3B82A 3IUYA 2DBYA 3W8RA 2D7DA 5AK0A 5DNYB 1ESMA 1N5JA 3PCRB 2I4IA 5FTJA 1H8HA 2VF7A 1R7RA 2B21A 2P0EA 2VP9A 4HZIA 4KYUA 4WIAA 4LJ4A 4C0QC 1ZNYA 4BLOA 3KXKA 4M0LA 3TE6A 2RGEA 4RD6A 3CRMA 3SBDA 1NY5A 2OCBA 3F8TA 4C0SA 1U81A 3VKHA 3UMSA 1SKYE 3UATA 3THXA 3THYB 3I4LA 1WMSA 3QKSB 4RFSA 5SZHB 3TW4A 2J46A 4FCWA 4F4IA 4QM6A 2O0KA 4X8OA 4N0EA 1ZIOA 3N70A 5DE3A 3AVQA 1I4DD 3WRXC 2PBRA 3SC3A 3VKWA 1OIVA 1E1RD 1OW3B 3W3AA 4OQXA 2WOOA 3PXGA 2BWJA 2QPOA 3LXRA 2JAQA 3OIVA 1P6XA 4ASUD 4KCGA 3IHWA 2OM2A 2A2ZA 5JCPA 3AKCA 3I8SA 5SZIA 3W5JA 1BMFA 4I1UA 3GJ5A 5D3MB 5EP2A 1EFRA 3O8RA 1ZW6A 1PLLA 5GJBA 3CX8A 3A8TA 2R6AA 3VR6A 1CIPA 3ADCA 4OHWA 3BB3A 3I32A 121PA 2GESA 4A0HA 2QPAA 1EWRA 2YWHA 4Q21A 1IY1A 1C4OA 3NTUA 2P6NA 4ZI3A 1KY2A 3BH0A 3GLIA 1E9RA 2IF0A 2VP2A 2DFNA 4A2WA 1II0A 5FOTA 3NC0C 2JJ1A 3QSYA 4M1TA 1QHHA 2FJUA 2XXAA 2AR7A 2GBLA 4QRHA 4DLRA 5CK5A 1K5DA 2VRWA 2PT7A 1D9ZA 1E0KA 1XEFA 4C0LA 3EZ6A 4LDJA 2AKAB 4Q1EA 3KKOA 5A4JA 1W4BA 1N6OA 3FB4A 2A3RA 4IVQA 2ZREA 5JFGA 3QKSA 3C16C 4DLZA 4PZZA 4CVNA 2CCJA 5EQTA 2ECKA 2DCUA 2AK2A 4QGGA 4TL6A 2W6JA 4HLUC 3SJZA 4OHXA 1R2QA 3O8CA 2JLSA 2R65A 4URUR 2BBSA 3K0CA 5LD2C 3AF1A 1B23P 4RKFA 3PJRA 4TL7A 2IXEA 4F4CA 2D7CA 4LY6A 2C8VA 1WQ1R 2KJQA 2YWFA 1GAJA 2ZE8A 4BLRA 4IW3B 5E3HA 4H1VA 1X1SA 4ARZB 3IBYA 3FHTA 2IS2A 1W4AA 4Q4LA 1E96A 1NLZA 1KZ7B 2FPMA 2WICA 2ZVQX 3PEVA 2PMDA 4GRAA 621PA 1CRQA 2CLDX 1VTKA 2JCSA 5CB6A 3BAFA 1D8TA 4A4DA 4JS0A 1F2TA 4WVFA 1W7AA 1A4RA 2FU5C 3GD7A 1PVOA 2AFHE 4AG5A 4BLSA 2XZLA 3U3OA 2E87A 1KJZA 1ZP6A 1XDBA 5FBLB 2QQEA 2ZU6A 4XTCS 4TQ9A 5A5GA 2R6GA 1FTSA 2ZRPA 3M1IA 1R0YA 1U8AA 3A1VA 1OH7A 3D8BA 1OFIA 2C77A 1WE2A 4MRNA 2VA8A 3WNCA 4RD3A 2WJVA 3U3RA 2V6JA 3QBTA 4B3BA 5L3QB 3RVBA 4IEIA 1W36C 3U2QA 1VHLA 3AF0A 4X8MA 3RRMA 2QL6A 3I1FA 3LH5A 3GLGA 2QMOA 1BIFA 1QHGA 3CNLA 3G82C 3P26A 2JLQA 3CWQA 5IHPA 1GSIA 5E95A 1P9WA 4HAVA 5CDFA 4YONB 1E9CA 4TLAA 5CYPA 3E1SA 4L16A 1XP8A 4KV9A 4S2EA 4Q9HA 5FI1B 3WHKA 2A78A 2QG6A 4LYHA 2GJ8A 4NKRA 3WMFA 3TRFA 3AVUA 1P3JA 4M1WA 5JBQA 2BIFA 1G3RA 3TBKA 1NP6A 2FN4A 4P4SA 4PQRA 3UK6A 2QA5A 2A9KA 1K5GA 1OLOA 3K1JA 4KYIB 4PSKA 5FL7D 3RHFA 4JLVA 3T12A 4HUQB 4KJZA 3IO3A 2FOLA 5FUWA 1L8QA 2QRNA 3QKRB 3W6OA 5AUOB 1DAKA 2V7QA 5EE9A 2J1LA 4IVRA 1YZUA 2PCJA 3HR7A 4PQYA 2AN9A 2FGJA 3X1XA 2ZVPX 1NVVR 4M9QA 2BC9A 1J7KA 1KDOA 4MYHA 3EAQA 2DR3A 4OI2A 3GCGA 3OAAA 2GXUA 1OXUA 4KSCA 2C98A 1Q0UA 1ZM9A 2CMKA 2WKPA 1P7CA 3DKPA 4NCNA 4D26A 1X6VA 1NI3A 2QMHA 4PANA 5L3QA 2E1RA 4V0NA 1BS1A 2OILA 3QF7A 3U3MA 3BS4A 1G4UR 3IKJA 4ACBA 3PIRA 1Z07A 2GKSA 3TUIC 2J59A 1Z6GA 5L3RA 1IBRA 1W49A 4MKHA 2J7KA 3IDQA 3A36A 4FWIB 2QORA 2ZR9A 3QUSA 1KTVA 1DEKA 1I2DA 1Q1ZA 3AP2A 5CJPA 4RZ3A 1YRBA 5HCNA 3IEVA 1BH2A 2XB4A 2ZE7A 4L4UA 4E22A 2QAGC 4W7SA 4FN5A 3B1VA 2WIAA 3NBXX 4Z8YA 4DJTA 1GL9B 1JXMA 1AA9A 4LBZA 2GCOB 5AR1A 3AVTA 4C30A 2WAYA 1VKJA 2ZANA 1Z83A 4U02A 2QGNA 2DFKB 4JLJA 4BECA 2F1HA 3VMFA 4PPQA 4Q9JA 2X2FA 4TLCA 1JAIA 1W46A 3FVQA 3R9WA 4HUQA 1X3SA 3FKQA 4R2HA 1E2KA 3TLXA 3P27A 3QKRA 5EE0A 2FFAA 3CO5A 1S96A 4B76A 3REGA 2F6RA 5JSZA 3TVTA 3BXZA 3CF2A 2ASEA 1SVWA 4TWZA 5LD2B 1R5NA 1ZNZA 2FZ4A 2JJ8A 1SZPA 5C4GB 4YMUA 1KK3A 5ANRB 4D0GA 4ZDIA 3BE4A 3FMIA 2O0HA 3EPJA 3EZ7A 5EXTA 4F93B 4WZ6A 4URXR 1VECA 3AF2A 2O8BB 5F98A 2QT0A 5IDVA 2QPTA 2HEIA 2IWHA 1E2JA 1U0LA 3G0HA 4G1UC 4JT4A 4HB0A 1TF5A 5LB2A 2A30A 2IUSA 2QNRA 2F7SA 1TUEA 4IFBA 4D80A
chains in the Genus database with same CATH superfamily
3P9NA 2ZRJA 4LHVA 1GDDA 1P2BA 3IP1A 4MGYR 4PR3A 5C7YA 4FXOA 1DWQA 3LQ2A 1LJ8A 5KYWB 1WIWA 4QAQA 4MVJD 1EUZA 5B1YA 1JQAA 3PXAA 2CXXA 3WK9A 3QXXA 1CQZA 1U2DA 2H1WA 4DCNA 2OQRA 2PKYX 1V11A 2WD7B 1VI5A 2H5JA 2BJWA 3I2HA 4U2EA 3RS8A 5KOJA 4KHPB 2ZRIA 4F5YA 3BTOA 3UW3A 1YIAA 4WWHA 1GLNA 2W83A 4UULA 4D81A 2LCFA 2W43A 3SIPA 4KRYA 1MVLA 3IKLA 5BW8A 1Z4IA 1MJFA 2UVPB 3COZA 2XXBA 3KYDB 4G07A 1KE1A 3RHTA 1U7DA 3AX6A 1WCV1 1V41E 5J4VA 3O82A 4TYMA 4AY5A 3HDVA 1X2BA 5DYWA 2O5VA 5BN4B 5BSMA 1B6TA 1QRRA 3E18A 4K2AA 4F45A 5JXJA 1ZOPA 2O8DB 4V3BA 1ZH0A 1IVYA 5I9IA 1A3CA 1IPHA 2OHOA 4XQCA 3SFVA 5TLSA 1KU0A 3C3WA 5ALPA 4MUKA 5LB4A 4MWGA 3DV0B 2QYTA 1DTWA 1ZGGA 4N5HX 1FUEA 4XR4A 5TMPA 2AF4C 4R71A 3GLFB 2JFXA 3MGAA 4OMCA 3TIGA 3V46A 4YYEA 1Z39A 2YWCA 3A2MA 4K7JA 1G8GA 2FV8A 4EQ6B 4GUAA 1Q92A 1YK1A 4AJ2A 1YKSA 3S8YA 2PNFA 1PS9A 3TQSA 1DTEA 1Z8HA 1L7AA 3EMKA 3Q3EA 4ECEA 4IEEA 5B2ZA 2PL9A 4UU7A 1SCJA 4TMWA 4Y0AA 1X9GA 3NJ8A 3H04A 1R0WA 2PS0A 4XQGA 3LRTA 4J6EA 4N5LA 3ZK7A 1N0HA 1XHLA 3ZHXA 2QVGA 4YUXA 1SK8A 2OB1A 1P2UA 2PWPA 3F7NA 3L5OA 4NEQA 3U13A 2VZ9A 3SHVA 3OURA 3HRKA 1OVMA 2HLHA 2W7TA 1GPYA 2CEAA 1Q19A 2G76A 2YRXA 3P4XA 2I3AA 4GLJA 4J3JA 4ZT6A 4BEJA 5B7QA 1OF1A 5KQSA 2IU6A 2DFDA 3AI3A 1VA5A 1OLXB 5K8LA 2L82A 3DB2A 1ZGHA 2I22A 5E7IA 1AMOA 3AEUA 1LEHA 3H2KA 2XMDA 4KLAA 2CZQA 2H2IA 2YRWA 4RA6B 2X86A 1IY8A 4I5IA 1Q7GA 3M34A 1BXZA 1ZWKA 2K7FA 5BT8A 3WNQA 2RBEA 3PFWO 4QDZA 1Z16A 5EIWA 2AOTB 3X1ZA 2Y92A 5H4GA 2YW2A 3BERA 3GRVA 5DX0A 1JBQA 5EJ8A 2ZJ7A 3LQRA 1ZOOA 3O4FA 1L5ZA 2OLJA 2FVXA 3TSOA 4QKQA 1V7CA 2GA9A 4JV5B 1P18A 1SCUB 1IAVA 4QGSA 3FTPA 1XJCA 2Q3JA 5FV7A 3ZHCA 3MOGA 2M2IA 1SU6A 2FUG1 1ZH4A 2WJWA 2HRZA 1GZ5A 2VJLA 3L01A 4HZUA 1NI5A 1XKLA 1QQAA 4JCCA 3H9EO 3O8OA 3AJDA 4KGXA 3MT0A 1OH5A 3GK3A 1QIEA 2RK3A 4Z8XA 3P1JA 4E33A 4AZWA 4RZQA 1K06A 3NWOA 2Q2NA 1BE1A 3Q6IA 4EA6A 1GFSA 4UTNA 1KF0A 1QGZA 3B38A 4GM4A 4ERXA 3ZHQA 1IXKA 1RLMA 3R4VA 1A9PA 2OHGA 3LOUA 2AR9A 2Q3HA 1T0UA 4U8GA 3FWYA 4F7WA 1GAXA 1U8TA 2HGSA 2K5UA 3L0OA 1QB7A 5JV5A 1RM5A 2VJYA 3DZFA 4S35A 5TQ2B 2HHHB 1XQ1A 5JI3E 4IY1A 5INTA 1OBHA 2BZ0A 2OESA 4EGAA 5AW7A 1CRPA 3CUKA 1CUBA 1E5DA 1QS0A 3I9KA 2JI9A 3DE7X 5KWSA 3OUTA 1A4XA 1AS2A 2G77B 4JJEA 5HKKA 2G1JA 2X76A 4U9HS 5KHOC 3K32A 3NAMA 2AZDA 1ZK1A 3OJWA 4RADA 2JW5A 1TUIA 2J4DA 2IQ5A 2W6NA 4DIUA 2C31A 2PGIA 4EVSA 2H0QA 4KXVA 3F5DA 1J5EB 1AUOA 1QORA 3ZZMA 4HAZA 4HH3C 3LUFA 1G7RA 4DJAA 5D00A 5KTYA 1MABA 2QVZX 4Y1RB 5IN5A 3SHTA 4PPYA 4PSUA 1SRRA 1W0KA 1ZN8A 5AUPB 2VWHA 5ALLA 1CY0A 4M88A 1V2GA 3QOWA 2QAGA 5CPFA 5DASA 5KNLA 1A82A 1BRTA 1OYOA 3VVMA 1Q7TA 1S1CA 5AJWA 4X00A 5EHNA 2Y6VA 1M1NB 1V8PA 2I7TA 3K0SA 1TGVA 2B6HA 3VKUA 3EVBA 5IWAB 3D02A 1RAAA 2IPMA 4Z9XA 1GEGA 1LUAA 4W1QA 5DNEA 5IEBA 4ENPA 1R8XA 2AMVA 1U7UA 1WZCA 2NZJA 1W5SA 1U7PA 1OQAA 1Z0FA 3L1HA 2AFIB 3KWJA 4WZAB 4BCCA 3CSUA 4D5EA 4YMTA 4ZJZA 2ZJ1A 4TYNA 2ZDQA 1KYYA 2V3VA 1ZSYA 2C4KA 1PGNA 3BFJA 1FFGA 3UPDA 4H27A 2QM7A 3UK7A 2AE1A 2ERXA 3W9BA 4YR9A 1O1YA 3T15A 4KEAA 3NTOA 2UXBB 1RXSA 2XGSA 1JR3E 4G26A 3KSDO 1U0NA 2VSNA 4CM7A 1XMSA 5TS3A 4G0WA 3D9QX 4FGZA 4V03A 4ZOCA 3HZZA 1FUKA 3LLCA 4KQFA 2WSIA 3X1JA 4RVDA 2UZIR 3S3TA 2QMUA 1NOJA 4B6GA 1TYAE 7REQB 3IBCA 1ORIA 2DHRA 2ETVA 4GI2A 4IIDA 3IOYA 3Q12A 4C6SA 4CKYA 1E1KA 3NIDB 5HS6A 1Y82A 2EOAA 4OBWA 1VYUA 5DWDA 1Y1RA 5J1SB 1F2VA 3H2HA 4RW0A 5DNDA 4QYIB 4QECA 3NYIA 1EFVB 4JSRA 4QARA 2IVFA 2O1EA 2DQZA 2FQYA 2QNIA 4JN6B 5LYJA 4JU9A 3LXUX 1YZLA 1ULZA 2B4KA 4JYZA 1RRKA 1DXQA 1JR3D 1NV8A 1UDXA 4RH0A 5FFNA 3L07A 1ZH2A 3TOZA 4BOYA 3K5HA 3NAGA 5JCOC 3I4FA 4LE1A 3D6MA 3CMCO 1OMOA 4CFSA 2WQ6A 2WHPB 2NPFA 4EI9A 4QEKA 1RVV1 3KT6A 3MMPA 2MMCA 3Q3GE 4BO9A 5TDHA 3HWSA 1GKYA 1W73A 1VA4A 5HTKA 3E9NA 1E6CA 2O3JA 4YTEA 4B44A 5CHYA 5AM4A 1W4LA 3KEQA 2BFOA 5I7EA 1KMHA 2R48A 4IXNA 3A1UA 4M54A 2Y27A 5AQEA 1B1CA 4BVLA 3KCQA 1R5BA 4BO8A 3KYJB 2PMKA 1WABA 1Y3BE 5KZMB 1SKYB 5CA1A 1XVAA 3O4IA 5GAJA 3AZPA 3I92A 1YVPA 4AIRA 1IYZA 2F3RA 2AFVA 3OWOA 4QGFA 721PA 3LHFA 1YOVA 1SHKA 4JDUA 3HZRA 1ISHA 4WBXC 4RJ2A 1F3LA 1P8JA 4HD8A 3UXYA 1T43A 3KKPA 3MWEB 5KYYB 4F46A 1I7QB 4U7DA 2RFLA 4GGOA 5BXQC 4BZZA 5KNBA 5T8KC 5I45A 2YN0A 2GTIA 5IBRA 1XAJA 1XRLA 1QX3A 1G20A 3GEBA 1T5IA 4MS1B 5DI3A 2M1ZA 3GJ6A 2X4LA 2G5TA 4EARA 1YIOA 4G8BA 4ZV7A 2IWRA 3BDIA 2PKCA 4DUGD 3TW8B 2J4CA 2D3WA 2QTVB 5IAEA 3UJ8A 1R12A 5GM1A 2O8FB 1G8PA 3RJTA 5JASA 3RUEA 2P5YA 2H5LA 6REQA 4MQUA 2NZXA 5BYKA 1GEEA 1KJYA 5EC8A 3OE7D 3TKYA 1WHTA 2VNJA 2ZBFA 2ZZKA 1I5RA 1XTSA 2O1SA 1SURA 1N3BA 3KKQA 4PM4A 4PY2A 2P6UA 4IZHA 4WTOA 5EIHA 4FDTA 5F76A 5KVSA 1QQTA 3MD0A 5FR2A 1QIFA 4IXTA 2NO1A 3NOOA 3LBAA 3NWPA 4X20B 1ZK3A 2OCXA 4EVRA 3AW8A 3R3SA 1SZDA 2DTXA 4OQNA 4GKVA 2YJ6A 3UH0A 1XTTA 4XQ9A 3ZBPA 1LLFA 4E1BA 5BSRA 2IX3A 3P5BA 3IL2A 2GAIA 1V37A 1YF3A 2GI4A 2W2LD 3CT6A 4Y6PA 2DMRA 1TA4A 1IM2A 3VYUB 1G1MA 1GPDG 1JWAB 1X1EA 3ICOA 3PDHA 1XTPA 5EXSA 1M8FA 2XLCA 2RH9B 3GA5A 3KZNA 4GXQA 3LYLA 4Z2YA 2Q28A 2OKGA 3NALA 4CTKA 3WYFA 5FTLA 2W6MA 3RU2A 3OZUA 4ZT4A 1YIDA 3AERB 4B71A 2HYDA 1IZ9A 1DPGA 1RS0A 2P9CA 3I3OA 4OB8A 3TNJA 1YR1A 2ECPA 4I50F 4N03A 4RFVA 3EIWA 5EGNA 1XLUA 4OTZA 2E55A 5JAMA 2JIDA 1YL5A 4PYLA 4I19A 4QA9A 3PDCA 2O0MA 2BGLA 3E61A 1PQWA 3AHFA 3GY0A 7ABPA 2QTZA 4U9UA 4IUYA 5KJEA 3F6EX 3SR3A 1AQYA 1UAYA 1XD9A 2NU6B 3NBFA 4JK3A 2PLAA 3BB4A 4JI5B 1KR5A 4NMXB 1PV4A 5JS1A 2ACEA 4R54A 3WDLA 3LWZA 4KLNA 1NW3A 1CJTC 1ZAKA 2IHVA 1IN8A 2V96A 4AJOA 1CEEA 1L4FA 2NUTB 1X14A 2RH8A 3QMWA 2PL5A 2Z09A 3D0OA 2CUNA 3DFUA 4FUQA 2VP6A 4OHZA 1II9A 5JZBA 2QE7D 2IT1A 1C9EA 3N87A 2GFQA 2PO7A 2C5AA 3F1LA 1JKXA 4NONA 1ISJA 5HE8A 2Z0MA 4IDFA 2O05A 2ZSEA 3AOGA 3H1AA 1H2BA 3ABSB 1CNEA 1OPRA 4HS9A 4EPYA 3DBHA 1SIBE 2Y68A 3AI7A 1XP5A 3SEQA 4EGSA 3GUUA 2EKZA 4YN3A 4KXQA 4MUYA 3ILHA 2VYQA 4L51A 4TUYA 4DQUA 2ZE5A 3JATB 1WSAA 2R8RA 4LN1A 2B0JA 1QZZA 4F3RA 4BX2A 2AI2A 3PXXA 2Y1LA 4Q3BA 1H2FA 4FPXA 3JW8A 1F7UA 1VGRA 1II8A 1C2TA 3R6WA 3JSXA 5ESXA 3INNA 4C4XA 4COOA 5KWJA 2WZBA 3AF6A 2FETA 1SOVA 4NPAA 2Z9DA 1Y7LA 3F3YA 3QA3E 1XDUA 5TGTA 1XROA 2JDIA 4MRPA 4BO0A 4BTVA 3FCSB 2DHEA 2GXSA 3VKVA 2XB9A 3VPDA 1R00A 3I5AA 3OQMA 5T3YA 4GEKA 1W30A 2SKEA 4M9RA 3SJBA 3PKZA 2BV3A 1MX1A 4G0PA 2IEIA 2XV1A 5ED0A 2YQZA 3CXRA 4GOKA 3HSSA 1WXFA 4PCUA 2PMBA 1Y5RA 4X92A 2EWWA 4JOQA 3M83A 3S2YA 3IDAA 1KFJB 2IYZA 3KOWA 1ECFA 3I9LA 4HN9A 4JLSA 4PAGA 2XWQA 4ITUA 1KYWA 1KR2A 4WK6A 3DLHA 5ECDA 2JCVA 4D99A 5A03A 3RUPA 4RESA 2Z5VA 3PJGA 2BFCA 3K70D 2QB5A 3E4CA 2UUOA 1KNXA 1SQ6A 4WNYA 2WT8A 3DMFA 3EOZA 1GPH1 1BXGB 5CT6A 1G2PA 5A5FA 4ESVA 3HPQA 4MAAA 2Q2VA 1GCAA 1DX6A 1RPZA 4RH1A 1SUCA 1HT0A 3AESB 3DCIA 3X1YA 2W6IA 4HWKA 4ANFA 3DHEA 3KJHA 4N54A 4PRKA 4BLUA 1H8HD 2LUOA 3W4KA 2P9HA 3ED5A 4BNVA 3VO2A 2NXNA 2WJJA 4TN1A 4O8ZA 2W2TA 4LBVA 4IV5A 2DY1A 1E0JA 3LW7A 1GTVA 5IM4A 2PZ8A 1OFUX 3VR1A 4DR2B 1VLZA 4COKA 1CUZA 3O4GA 1G63A 1ZJ5A 4ZT2A 4F4FA 3RKRA 1X8KA 5CFOA 2HADA 1ZQ1A 2Z9CA 1NPDA 3H9UA 4XB6B 3GVPA 1BW9A 3A1EA 2JIOA 5F73A 4GYYA 1P1KA 1C1XA 4GG1A 1E18A 1K4KA 2PJDA 4FNMA 4OUDA 2FW7A 3MOIA 2O7RA 1VSTA 3BSYA 4BMOB 5KC9A 3RVKA 3D4NA 1M5UA 4RVSA 3UFXB 1LVUA 2CJPA 3A25A 4RGYA 3KR9A 5D3MA 3GLIE 1TAUA 1D1SA 2HA4A 1RC8A 2DKNA 3O8BA 1ZOLA 2VQDA 3JU3A 4JP5A 3SICE 3W3AD 3TSAA 4QPJC 2ZJ3A 1POXA 2VDWA 3D3WA 3T5DA 4F2GA 1RACA 3KPYA 3RC3A 2WU1A 3LPCA 4GOJA 4K9LA 4OXKA 4LC1A 1VGQA 4NMMA 2ZT5A 4CXMA 4N48A 1GNPA 2QZ4A 4BX8A 2H2GA 3IKVA 4LJAA 3WTCA 3STHA 1JXAA 1EP9A 3WK5A 3VR6D 3N7TA 4IJQA 4PQFA 8OHMA 1MNQA 3SX4A 3C3PA 2JLYA 1G291 4BS9A 5FTNA 1VZ2A 2DLDA 3LVQE 4ZD6A 3RADC 4Q19A 4FS3A 3K71B 4H7IA 2BHTA 2FMHA 3DE2X 1ZH8A 3ZI4A 3IKTA 3L6RA 4OM7A 8GPBA 2FMXA 4RD0A 4TTQA 4WL0A 1GHTA 2R00C 1YR7A 5CVEA 3TOXA 5FO0A 3DOIA 1WNTA 1KI6B 4TN5A 2FW9A 1T5LA 3JAMA 1N4AA 5LPNA 5E6SB 1A4UA 2H63A 3PPVA 4BB0A 5T4HA 4PN7A 3ORSA 5B12A 2VUTA 3GVXA 5E1MA 4G5YA 4LKRA 3N7AA 5SYNA 3AUTA 1ODCA 1OLUB 3G6WA 3TM5A 5KJ1A 1FNBA 1XDGA 5DNAA 3AY3A 4L5BA 4XVCA 3B5EA 4ZYYA 1ECLA 1P0PA 4H77A 3GLKA 4RA9A 3R0VA 1JTEA 4LZWA 3JYHA 5KMGA 2VHQA 1VP9A 2XUIA 3IAS1 4NYIQ 4S1TA 3VZSA 2CKMA 5AM5A 2IV2X 2ZCVA 4R8VA 2IUTA 4LXHA 1RTTA 4ZO6A 3WGLA 1FF9A 5CDGA 2HQBA 2HJVA 3DQPA 5EGSA 5FUMA 3RC7A 1VM6A 1KFKB 2CMGA 5C4IA 4AJIA 1L9XA 4ROTA 1I3OA 1NQUA 3EXG2 3CE6A 1APBA 1RXCA 2NT4A 3FYCA 1PZXA 5DHQA 2OPBA 4LV6A 1LTQA 2ORIA 1CUEA 1V45E 3D4OA 4K8RB 5F52A 4BL5A 1WHSA 2PY6A 1NW9B 3CUSA 3LXXA 1P45A 2HQRA 1LNSA 4ZQGA 3K16A 4CMIB 2P3OA 1DIAA 2VATA 1Q1GA 1R6TA 3CB2A 4MR7B 3CZ4A 5J58A 3A6EA 1N5IA 4UCXA 4HDOB 5TQ0B 4YJ3F 4B6EA 3B8EA 4K6OA 3WRYC 1SXJB 1VJGA 2CHQA 4YB8A 3HXQA 2WJIA 4HAWA 5KTSA 4NEHB 1MFPA 1PJ8A 3REQA 1WL8A 2CMDA 2B1JA 1WXIA 2OBNA 2Z9BA 3GBPA 3NT5A 3TSYA 3W6ZA 4DWVA 4EHHA 5BSEA 3CR7A 1PFKA 1DIOB 1M0SA 4G8CA 4FYMA 1NVTA 1UXHA 1Z6TA 4PO3X 4EHKA 1T2FA 4CEIB 3F90A 4G0MA 1VCMA 1UMCA 2QRHA 2DFTA 2QTTA 2VKTA 2GZSA 2VZEA 1LPPA 2WTXA 4MTLA 4QUJA 4U3JA 4WXYB 3SS7X 4GX5A 1Z63A 4KR3A 4M9CA 5KOHA 1NN5A 1XZNA 1DAMA 1USIA 2RARA 2V7GA 4AB1A 4OJNA 3G9ZA 4HB2A 1VXRA 1FP2A 3ZIAA 1ADBA 5CB8A 4IZOA 3WHIA 1B6GA 3KT3A 2HO5A 5FHRA 2NAPA 1C1HA 2VS1A 2A9JA 1QOQB 3H0EA 4OIFA 2RKBA 4BNXA 7YASA 5KOYA 1V71A 4D3ZA 2EX4A 2OXCA 3RGWS 1GLGA 1A8UA 2R25B 2OAQ1 4JJGA 1QC5A 1A5TA 4CDNA 3JWHA 2HC9A 3BGSA 4O4LB 1E9FA 1ID8A 1OGIA 4TVBA 2VJQA 1AIPA 3QYJA 4DV1B 3EISA 3OUUA 4TQAA 3RAEC 1Y8CA 4WGFA 3RS5A 4R98A 5K0NA 1ZIPA 4HAIA 1E98A 4IIGA 2G40A 3WBKA 1UQRA 2C42A 2HK8A 2I6GA 5BP7A 3O7WA 3IO5A 3VSEA 5K6RA 3KS9A 3AINA 4JL6A 1U99A 3N1UA 4MQ5A 2Y1KA 3HHEA 4AN4A 5E0OA 4F5WA 3GUYA 4AY4A 4N76A 4GVLA 1I13A 1FZQA 3TDKA 2LNDA 5B3JA 5CFNA 3IBSA 4LDNA 2FFJA 1VIVA 5AHKA 2AMJA 4M1QA 3UPUA 3UGKA 9GPBA 2XRZA 3E2MA 4ZVPA 3U4DA 3V4FA 1J97A 1I14A 3V1TC 3NJ4A 4CFYA 4QTUB 4KRXA 4TMFA 4C7OB 1N9KA 1ZKDA 4XEUA 2QUZA 4MWDA 5CT8A 5BUSA 4N9WA 1Y8QA 1PU2A 2O2SA 2PYZA 4IUBS 4OA8A 2WWWA 1KGDA 5IASA 1HOTA 4YBZA 3PR3A 3DTVA 3GUCA 4D4KA 4AZ3B 1T2UA 4MV5A 5REQB 2WZDA 2DE0X 3Q9LA 3D6TB 3J81k 1XAHA 1C30B 1DAIA 2HK9A 2YFKA 4E07A 3OQPA 1J8YF 3ABIA 1EFDN 4QD3A 2AJLI 4KO4S 1G7TA 2IS4A 3DDNA 2PKEA 4MW9A 4BJ3A 3R2JA 4NESA 3RQSA 4MKFA 2AWOA 4I2NA 2RGBA 1ZOSA 2PX6A 3B12A 4X6LA 2SKDA 4OKSA 2PRIA 3ND6A 1XDWA 4D8VA 4C3UA 2NOAA 4DQLA 4NE9A 4D4HA 4DLKA 4Q3OA 1PDOA 2ADFA 4G01B 1LV8A 2I0FA 5DF1A 1PDWA 2YOGA 1J5XA 1K4YA 4WLOA 4O1HA 4BE9A 4RANA 3VYRB 4EYSA 3PNVA 1K3FA 4AJ9A 4J2TA 2PUBA 4BNHA 5AK4A 2WYWA 3DUFB 2QT9A 3DUWA 4UVHA 2L19A 3DTYA 1VE5A 4JJ6A 5K6TA 1MFZA 2C82A 4WT7A 1TZ2A 4FYKA 4XIFA 5TEWA 5KEIA 2H4ZA 1IXYA 1RQLA 4C22A 4EAAA 1TRHA 2C1XA 3RTAA 1WM1A 4D79A 3KTAA 3VZPA 1QMPA 2I54A 3DR3A 4KBGA 3MJEA 3LMKA 5CW2A 1MC4A 3EYAA 2PUCA 2F3PA 3KUCA 4FFDA 3SSOA 2REOA 3L06A 4AZ0B 1X8LA 3HGMA 1ZUWA 2I7VA 2SECE 2WWXA 2X4DA 3Q2KA 1U0OC 1F0YA 4GKBA 5EKSA 3P0JA 3T7EA 1L5VA 4YXWA 1QBKC 1I4TD 1XRSB 3OMXA 1GSOA 2PGOA 2ZSFA 2BM8A 1CQIA 2QJRA 3A6HA 4GOXA 3ABZA 3CJRA 3PYMA 4FOOA 3CEJA 4OMFG 1L4HA 2HF8A 4Q3NA 4X1OA 4LYDA 4MDYA 2ZDGA 1DRKA 1MG0A 3CKMA 4EBFA 2HHLA 2XRFA 1U0GA 2IOYA 4A2PA 4PG6A 5J5CA 2H1FA 2PLNA 4M22A 2YS6A 1BKDR 3OEWA 5IFKA 2P68A 4XVRA 5JTUA 3W1VA 3ZD8A 2J3EA 3EA5A 1ITZA 5DBIA 1EBUA 3U1BA 3ZJTA 3H9BA 1KP9A 3NZEA 4MQMA 3TXYA 4F5ZA 1SBTA 1E3IA 5KDDA 3HEAA 2GEKA 2YMPA 3FHJA 4C06A 2CLFB 2WD7A 3F6YA 1PS0A 3F5MA 3HMKA 5DMHA 4D97A 4ICIA 4B32A 3SQNA 1Z22A 1NBMA 4Y6OA 4GMDA 2H3HA 4WRRA 1P0MA 2OAP1 5EHGA 5KHLB 3OTOB 3ME5A 4XH9B 5LDGA 1P3Y1 4AG3A 1CY7A 4PG8A 4RTMA 1N8SA 2UVPA 2XA9A 3H75A 2G7ZA 3OEHA 3VJMA 3O8DA 3D8NA 4UTOA 5MFZA 3FG9A 1Y1LA 3M9LA 4OJYA 5BN4A 1KEKA 4YP6A 5HX7A 4X3CA 4URFA 4S1OA 1GPMA 1RM4A 4M53A 3HUTA 5EP1A 4KVFA 2O8DA 1MAUA 3L4KA 2AEEA 1UBTS 2RG7A 5C1PA 5KREA 1YI0A 4LGMA 5JS8A 5EMNA 1MHTA 4L7VA 2VAVA 1O94A 2ZFUA 3P20A 2C58A 2Z2KA 3SF0A 1BFUA 1AMUA 3KKZA 2GZ1A 3OKCA 3MRTA 3L6DA 3K70C 2C2GA 5I7RA 2JVJA 2F4VB 2QSYA 1XAIA 2QT1A 3FETA 5DLDA 1JB1A 1VLMA 4EQ6A 2OGSA 1E8NA 1H2EA 2Z5LA 5AVTA 2MSKA 3ELWA 4IOMA 1FTQA 1S0UA 2C9CA 2VK8A 2YJ3A 3W5UA 1FYWA 4RPCA 3PC3A 2WF9A 5CFMA 2H54A 2IYAA 2VJKA 3PHLA 5ICEA 1MA3A 5EAIA 5EERA 1VJCA 3LGSA 2ZIZA 3GUHA 3PNKA 5M5BA 3D1JA 3VPFA 5A0VA 2P7HA 3KTDA 5GZ6A 2XB2A 1RU3A 4PIVA 1B6RA 1E9EA 3E9CA 3F6SA 1ZH6A 1YZTA 4I4IA 4QX6A 1C8VB 2QR5A 4F04A 3ESDA 5K03A 3R1IA 1VP3A 1JSXA 2EX0A 2CDCA 2OZPA 3IXQA 4D8TA 2PZGA 1SIWA 2IZ5A 3CGGA 4JWKA 1G5PA 4L8YA 5KYGA 2Z6UA 2VDRB 3JQDA 4A03A 3LV8A 4D46A 1OLXA 2HBYA 4W8HA 4KFTA 3ZWBA 2DQ4A 1MV5A 2Y93A 3AH8A 4HJXA 4I99A 3TBFA 3O3MB 3OJCA 5JDIA 1X87A 3ZZUA 1L7XA 3FDFA 1FNMA 1E32A 2FJ0A 3EQZA 1O4WA 5KDLA 2VPXA 2IYQA 1YASA 4CL2A 5DM0A 4URVR 1MB3A 2WYHA 1M2EA 3ZJ4A 1RMYA 1UJBA 3ELYA 4P4GA 1NVFA 4A7PA 3FJOA 4MHSA 3AHJA 4PTYA 1AKWA 2XYRA 2DLCX 3RK1A 5DEIA 3HYSA 4FC6A 1W36D 3AEQA 3H97A 1P7WA 2HF2A 4IKPA 5HSGA 1U63A 3KNZA 3MB8A 2Z04A 4Z0HO 5MHTA 2RJ3A 2D62A 3TNFA 1N8TA 2H4YA 3PI7A 3PPIA 2XDQB 4YRMA 3UXEA 3B7PA 3E03A 1M1XB 3ENNA 2JAOA 1Z8DA 3LHIA 3TGLA 1QHNA 2IF2A 1U7OA 1WEHA 3QVWA 4QFBA 1BCRB 5A4MS 5G0VA 3ABQB 4GD3Q 2F55A 3OMWA 1DL5A 4EFLA 4QSHA 1FFXB 2LR0A 3QM1A 3OT1B 3B9PA 4V0OA 4K9KA 4M9UA 3WGHA 2YVKA 2LCQA 3NIGB 5HRAA 3L49A 3HZOA 3GI1A 3T06B 1PNVA 4XPZA 2OL4A 4MGEA 3ZCPA 2H48A 1VLHA 4EPXA 1T4CA 3OFND 5BSWA 4CM9A 4WCVA 2HDNB 4GR9A 3RV4A 4FNOA 1MXHA 4Y2UA 2C5HA 4ZOLA 1U8CB 2A1TS 5EA2A 4EITA 4CZ2A 4R8KA 3QPBA 6GPBA 4RD1A 3HCBA 4PNEA 4JI3B 4MB0A 3V97A 3F4LA 3BD7A 3HHPA 4MGIR 1PHPA 2EFCB 3MRXA 1Z5GA 2B9VA 5FB3A 3VZQA 4B3CA 2EP7A 2OBBA 4QREA 3AB3A 4G2NA 4IG4A 3MG9A 3D54D 4EG8A 2VDUE 3HBFA 1LX7A 3ANLA 3K9NA 2O20A 4MW0A 4XPIB 2D7JA 2RB4A 2VDOB 2H5EA 1ZS9A 3QXGA 3TLYA 4BMSA 2FE1A 1O0SA 2AOUB 3IOMA 1QPBA 2ERYA 2JHPA 3FYDA 4PNPA 1VSUA 2I66A 4Y1RA 1H85A 2XI4A 1FFEA 3ECSA 2G72A 1KKUA 1Z2OX 2JEZA 2JS7A 4L0DA 3D5EA 4BNDA 4TXMA 4E94A 3VJKA 4L9WA 3PCXA 3GDWA 2V1UA 5ECGC 2JJ2A 1M1NA 4UHKA 4C05A 1N2GA 1V48A 4NLLA 4OSOA 4MLDA 4ZI5A 4BATA 5A1JA 2WIGA 4OP2A 3OQVA 3T1NA 3PJFA 4R83A 2I7CA 4CQLB 2VF5X 3GT3A 4JUFA 5CM8B 4YMWA 4DUPA 4WZAA 4ZK6A 4UZEA 1N77A 5BWLA 2JGKA 1U8XX 3L4BC 1G59A 2JFZA 2WF8A 2ZBGA 3U37A 4F2WA 2RK6A 3K0FB 2QQ5A 4JQYA 1ZITA 4YX9A 1DJMA 5GV7A 3PQCA 2BMWA 1ORVA 4ML3A 2QTGA 4O59O 2GJAA 4QU8A 4CCYB 4YALA 2JGEA 3RFXA 1DAEA 1NMYA 3LRXA 1LV7A 4FBGA 5H83A 1UC9A 3SP1A 3LSYA 1VHWA 4RVOA 2V7UA 3U7QA 3HXLA 1P8AA 2H92A 4R0NA 4I4CA 4J9VA 1G98A 4ZEMA 5AVSA 5M7EA 3PDWA 5DBHX 4D9CA 4QYIA 5I6DA 2J5QA 1QH8B 1DC6A 4EUKA 1XF1A 3H87A 1GGVA 1LH0A 2D8MA 2HMVA 3M3PA 2C5LA 3T5AA 4RTOA 1A71A 1GT6A 4LISA 4WOKA 3B1KA 4EJ6A 1I4LD 4FYXA 4O4JF 3W77A 3NH9A 4E08A 1OXBB 4ARSA 1G5IA 3W9SA 2JFYA 1RQ2A 5JDCC 3QFFA 3HUEA 3FMOB 3FMFA 1W2WB 1QGED 3U7JA 4AJEA 2FNAA 2FSHA 1Y5MA 1TT5B 1QP7A 3NHKA 1S2MA 2WHPA 1L7BA 2AZTA 3E9QA 2CE7A 3H2SA 1MO3A 1E1CB 2FHSA 1G8AA 2Q5IA 2DECA 5JXGA 5I4KA 5T7BA 2BM9A 3THXB 3A2KA 3AVXA 2OD7A 3T0FA 4FD3A 4RFSB 5C0OE 1HRDA 2V6BA 4CKWA 3HU1A 2GK3A 8MHTA 1N2CB 2X5KO 3DDZX 1ICIA 4ZDKA 1TZMA 1GPUA 2EP8A 2ZP1A 3IT3A 2RGDA 2Z8YA 4NMWA 1ZPDA 1UJ4A 1C7EA 2ENWA 1FXWF 4RS4A 1UKCA 2OYCA 1VB3A 2PTGA 2YY6A 3NETA 4GPIB 1HEIA 4Q1FA 5P21A 1N5LA 1BOOA 1L4UA 1L4BA 2Q6IA 2RI1A 3O1LA 4MV0A 4BWYA 4C0HA 1DKOA 3KG2A 2PHZA 5CNMA 3RAGA 1IHOA 4WMLA 4CF3A 3IH5A 3OZGA 1SEVA 1H5UA 4LBYA 1JFSA 4E70A 1KWGA 4N0MA 2FZCA 5LFAA 1DOAA 1TLFA 3GC6A 4BRUA 2E3JA 3MWEA 1H4SA 2IXBA 1RYNA 3FHLA 3EDRA 4ZOQI 3WP1B 3HCPA 2ATVA 4K03A 3PUXA 2KWIA 3C14C 4I14A 2B5VA 2OGTA 3HL0A 4IGIA 4JP3A 4LYEA 3RPEA 4ZXFA 1XLTC 3VR4A 2W4QA 4MS1A 2FEKA 3SNKA 4TOIA 4QQKA 1PR9A 2L69A 2O3TA 2XQGA 4UARA 5HGXA 1E94E 2IELA 1S8AA 2O8FA 4J16C 5TR9A 4ZAVA 3LY5A 3V1YA 4TROA 2YJTD 3OFJA 3DDUA 4FOTA 2QI9F 3SDSA 4KBFA 4EKEA 5FWXB 2BMDA 2XXAB 2V0GA 1YMVA 4R69A 3WRWA 2JVKA 4TYQA 3FNIA 4KXMA 4MVXA 4JI6B 5FFMA 5L7TA 2Q8NA 5HVNA 4X20A 2NLOA 2QUAA 3PXEA 4J7XA 2HMTA 1ODTC 4BGVA 4ZHQA 1O95D 3RVPA 1ZRNA 1GNLA 2WWTA 4KVZA 4B47A 2WNSA 3FPAA 1AKVA 5LQKA 4KO2S 5AO9A 2O7NA 2PGXA 2VDVE 3RIXA 2BHLA 3WQHA 4BKQA 2ODEA 5F3RA 1WSWA 3GDOA 1SGWA 1ID1A 1LF5A 1EIZA 1GU0A 5IW8A 3AERA 3LT1A 5GOTA 3IRVA 2ANCA 3FLAA 2KB0A 4OJQA 5GPBA 3CMMA 2DQKA 4CT5A 5HXAA 3OPYI 2I03A 4RMJA 3TM4A 2H2FA 2FGKA 3G2OA 3UUFA 1ISGA 4QUBA 5EZYA 1SC9A 1LJUA 2V7BA 3JTEA 1H5NA 2NU6A 2WJYA 4Q82A 4TYWA 4OHUA 3RF7A 2AHOA 5EMHA 1I9GA 4ZC1A 4PO8A 1QIGA 3RKUA 3M5CA 2JJMA 4Q9DA 1SKQA 2WD8A 4Q1AA 4P33A 4R7ZA 2NUTA 2FW6A 1OZ0A 5K20A 1GZUA 3P2IA 1GGFA 4HAUA 4M9SA 4PGFA 4L73A 4B17A 3EIXA 5IF9A 1QYRA 4L5IA 1YR2A 4BFUA 4YECA 4G5XA 2YVAA 3VBEA 3VR2A 1F2TB 3LC2O 3QZUA 4IGEA 3RKSA 5LJLA 4J75A 3SM9A 3KWLA 5COQA 1RP7A 1M83A 3LQKA 4YCBA 4K9PA 4X95A 4ZPJA 3PITA 4DPKA 1JQJC 1M3SA 2H59A 2C2BA 2QZJA 1XQVA 3ZE1B 4CG3A 5JR3A 5A6SB 1UR5A 3OE4A 3CN9A 4AYWA 2IH5A 3AR8A 3I6YA 3IUSA 4BNLA 1KL7A 3GDHA 4MX8A 4P92A 1EX6A 3OE5A 4W5OA 4QOIA 2JCGA 3ECAA 1TECE 2FN9A 1ELOA 5ALQA 2XNCA 1LNZA 3HMQA 4AZTA 5AJYA 4QBFA 4QJ3A 1JA0A 4E7OA 5F7ZA 3LKZA 1AKTA 2JH3A 1YC2A 1P77A 5DXFA 3G8YA 3I2KA 4MPPA 3VAAA 3EIOA 3I45A 5EUMA 3GLGB 2QK4A 3B1YA 3EEYA 2JLUA 3AVPA 4OFWA 4DGQA 2OY0A 5J4LA 3S8MA 2IYFA 1D2EA 3GB9A 1ZN2A 5K3AA 4BMNA 3GFTA 2PH1A 2ZRLA 3NWBA 2JIPA 2KS6A 3O9VA 2VHTA 3IV7A 3X43A 3PKIA 3OPYB 4FE3A 4N5IX 2XF2A 4IH1A 1DQRA 2GF9A 3ZOKA 3IV9A 1V5WA 5AVZA 2M32A 1U0BB 1WPGA 2M98A 1LPBB 3ZGXA 3RTCA 4UEQA 1TADA 3C3EA 2ZUTA 4DMFA 4GXRA 1M7BA 2VK4A 3IEKA 2IRWA 3V1LA 2I4OA 3HY3A 4OBBA 4M2LA 3V7YA 1KI2A 3M33A 3AKZA 3VVBA 1XEXA 5E4TA 2GCGA 2DHCA 4M1ZA 2YUIA 2I6UA 4KVGA 5F7XA 4IDOA 4P3KA 4TL8A 3T1HB 3JVUA 2D1YA 1HQDA 3E7DA 4F5DA 1X9IA 1GPNA 2VZLA 2DYKA 4K05A 3WHLA 4OQYA 4RIEA 1BXGA 1GA1A 3NUGA 1OX4B 1KE2A 2ON6A 3PQ6A 1Z34A 3MF4A 3EQ8A 1NF2A 2AK3A 4D7AA 3TEMA 3K5WA 1YONA 2FMIA 2JIBA 3AESA 3SVTA 5LMNB 5H68A 1AN9A 3AKYA 1UADA 2A57A 4BB6A 3IT1A 4BMCA 2RBKA 3B6EA 3FH0A 2H7XA 3FSRA 3ZR4B 4AY6A 2E4YA 1EVQA 1NYTA 2QUKA 3ETEA 3FCUB 4X5OA 4EG1A 3JALB 1Z0SA 3SQWA 5FAKA 3DQZA 1KEEB 2IYNA 1KDPA 3M3DA 4PZUA 2BMVA 1KTIA 1DFHA 3B5JA 4RHXA 2Z1NA 4YEDA 1FDVA 2MYPA 1VKRA 3THOA 2OGWA 4WK4B 4UHEA 4B33A 1PG5A 2FPUA 3W5IA 3I8XA 4F8JA 5GINE 1JMYA 2QNBA