1IOZA

Crystal structure of the c-ha-ras protein prepared by the cell-free synthesis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
162
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Selenomethionine incorporation into a protein by cell-free synthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 56
structure length 162
sequence length 169
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1iozA00
2HXSA 2QMUA 1UM8A 4FWIB 1KI3A 1IM2A 2P3SA 3VR4A 1X1RA 5KYKA 4AG6A 5BWMA 1M8PA 5LB2A 3FKQA 4QM7A 4AKIA 5EE3A 4DUGA 2UKDA 5FPHA 5BYKA 1E0KA 3BB3A 1TUIA 5G41A 3TGPA 1UBGA 2KE5A 2RB4A 1IN6A 4WAUA 3DMDA 2L0XA 2EFCB 5EZ5A 2HDNB 5L3RA 1D9XA 1HH4A 1HV8A 3AKYA 4JJZA 5H1YA 3O8DA 1AJEA 3CZQA 1LV7A 3KQKA 3QPWA 3W34A 1GAJA 3I61A 2XSZD 5M04A 3BXZA 1KK2A 3AUYA 4NDZA 1N6HA 3CBQA 1PUJA 4IOKA 2BMFA 4DCSA 2D62A 2BBWA 4V0NA 4IRUB 1G7CA 3N5CA 4CDGA 5JSZB 2GXAA 1LB1B 3K70D 2ZREA 3BORA 1OV4A 5FL7A 3ZZTA 2H16A 1KK3A 1G21E 1UKVY 2OXRA 2WM9B 4HUQB 1AN0A 2GEVA 1EG7A 1BIFA 5JEEA 2FU5C 1ZINA 1ZM2A 1G8HA 2R6DA 2KSQA 4JKIA 2PT5A 3MMPA 5D3MB 1EFRA 4PZZA 5CYPA 2CNWD 1A2KC 2ZTSA 2VRWA 3AP3A 4M9SA 2D2EA 3W9YA 4BLSA 1N3BA 3ZZ0A 2NTYC 2ZUBA 4PQYA 4BZPA 3SC3A 2OLJA 3PJRA 3LFUA 4A2PA 4R9UC 1QHYA 1ZVQA 2B8TA 1AKYA 5CM9C 2CHVA 4Q9HA 3AP2A 2BCGY 1E2JA 4M8NE 4B2IA 1VPLA 1CXZA 5HCNA 5JI3E 4V0KA 1JR3D 2J41A 1WA5A 2MMCA 4MH0R 5AUOB 3HU1A 2AFIE 5KU1A 3UATA 1VYUA 1EFCA 4YMUA 2CXXA 2IYVA 3QKSA 3T06B 5EE5B 4CT4B 1MR3F 2QG6A 4BFVA 5CB6A 4B75A 3P32A 1ZCAA 1N5IA 5FBVB 5JWRA 1DAFA 1J90A 4CEHA 3SQXA 3WP0A 2ODNA 5FBQB 5KPJA 4GT1A 3L0IB 1OFUX 4TWZA 4JLNA 4R2HA 3TMKA 4M1SA 4AKEA 1PV4A 1NKTA 4JLMA 2GAOA 3WMFA 5LD2C 1Z2CA 221PA 1IN8A 3TSZA 4Q18A 1J99A 4RFSA 2ZROA 2W6IA 1NVVQ 4PPQA 4FIDA 1X86B 3MAAC 1U0HC 4K81B 3PVSA 4QBFA 1O87A 1Z8FA 5AJXA 1P2TA 1GRQA 1XXHE 5IF9A 1AIPA 4C0BA 4LX0A 1Z5ZA 4EJSC 2Q0HA 3GEHA 4M9ZA 4P31A 1U8YA 4P3YA 1N5LA 2X1VA 3UMRA 1EWRA 2A9KA 2AD5A 5AJYA 4URZR 2ZJAA 4URWR 3VHLB 2Q9AA 1OYWA 3OHMA 3TH5A 4DDUA 2HLDD 4WA7A 5FBLB 5BN5A 3AH8A 2GAAA 5J4VA 2ZRAA 2QP4A 1CRQA 4JKYA 4LBYA 4TQAA 1LFDB 3DZDA 4NCNA 5F98A 3PG5A 3EZFA 4ZKDA 4JS0A 4IVPA 5JWHA 4XD7A 5F3WB 4LC0A 4M53A 4Q5IA 2FSFA 3U3MA 4A0RA 2W6JA 3T1TA 4PPGA 1S1MA 2NOAA 2C78A 1XU4A 1ZM4A 1DAIA 4NCJA 4RZ2A 4OQFA 2CCGA 1ZNYA 1TU3A 1ZC4A 4QBIA 4M1WA 2O8BB 3I8XA 3AF2A 3MFYA 4LJYA 1YKSA 4DT1B 1H8HD 3TUIC 4HLCA 4A9AA 3DPUA 4Q4HA 5J5CA 4JT2A 2O0JA 3LX5A 4JL8A 3PQCA 5CLQA 1A2BA 3OAAA 3QBTA 2JLRA 4NL4H 2WJGA 4JVSB 4AD8A 3RS7A 2ZSDA 1JJ7A 1ODFA 4O2LA 1D2EA 1KKMA 4B2LA 2IYLD 3QKRA 2OO7A 4KFUA 3T61A 5GJBA 4B33A 2BM1A 3IO3A 4LJ5A 2IYWA 3HPRA 1W44A 3AKDA 5J4KA 5HE8A 4GSYA 4XJXA 4AI6A 1UEJA 4I1VA 2ZE8A 1U98A 1U9IC 1ZBDA 1BKDR 4KJZA 1NVVR 1SXJA 2QAGB 3C5HA 2WJIA 4UNPA 3NTUA 2IEZA 1F2UB 1QZXA 1E1RD 4PAQA 3AVPA 1KOFA 2KB0A 2QMEA 3PXGA 4NCIA 2W0MA 1S2MA 2F1JA 1JJVA 4UKDA 5LBIA 4MKIA 1E99A 1SVSA 4TTPA 3QG1A 1KDTA 1N0UA 4DRZA 2C8VA 1CJTC 2EU8A 1CLUA 1D9ZA 3CRQA 3LBHA 1PLLA 1OLOA 1XD2B 4NYJQ 4D2IA 1XF9A 4UNSA 2OBNA 1NN1A 1XD9A 3FWYA 3P27A 3PEUA 1S3GA 1W49A 2PJZA 2BIFA 4IOJA 3VX4A 5C18A 2NO6A 1NF3A 4JLJA 2V54A 4Q9LA 1FNNA 3B9PA 1M7GA 4NP6A 4L15A 4OQNA 5HPYB 4ZKEA 1G16A 4RFVA 4PX9A 4JBYA 4LPSA 3MWYW 1N5KA 4LJ4A 2O8EA 4JVNA 2C9CA 2W2VA 4URYR 2W2XA 4OK6A 1P6XA 1MRNA 4YDHB 5FBRB 2CL7X 3A4MA 1NMZA 1LTQA 1RJ9A 3UKDA 1W47A 2ZRNA 3RWOA 2JJ1A 1NSTA 4TMXA 1R0WA 4B47A 2GZAA 1RE0A 1RIFA 5LDDC 2W83A 3AM1A 3KKMA 4YONB 3B2EA 3CR8A 3OFND 1VECA 1VCOA 2DWOA 2QQ0A 3GLHA 1OB5A 5HE9A 2GESA 3GPLA 2WICA 5FI1B 2HEIA 1CS4C 1KDRA 3R7WB 2HXYA 2V6IA 2G1JA 4IDHA 1K8RA 4WIAA 1J8MF 4QHTA 3NVAA 2QGNA 1WDTA 4B6EA 2RGNA 1Y63A 4Q1BA 1Y3AA 5DO9A 5KNCA 1OH7A 5IK2A 3QEOA 4BGDA 2PMKA 3EZ6A 1DS6A 3VR2A 2Z83A 1HE8B 2BC9A 2QEQA 2O8FB 2PX0A 5BXQC 2G83A 1JPJA 2ZJ5A 1GL7A 3QEJA 1HYQA 3I62A 3RS0A 1TX4B 4YMVA 2IT1A 2IBMA 4V02A 2FN4A 1RRCA 5EE9A 4PHHA 1GL9B 3MWKA 4PC1A 4DLSA 2QM8A 3NDPA 2ZJ2A 2WWFA 3TAHA 4KLZA 4Q4JA 3IGFA 3L0PA 1OSNA 4TYQA 2WKRA 2P0EA 2VEDA 1C9KA 2O8DA 3GJXC 2XB2A 2RGEA 4M1TA 2BEJA 4NYJR 4D0NA 2IX3A 1GFIA 5J47A 1Q21A 5SZIA 2PJRA 1GG2A 1ZIOA 1ZYUA 1KDOA 5CK4A 4C7OA 3CF6R 4EPVA 2IYYA 4ZCIA 4IDNA 2ZR9A 1FTSA 2J3EA 4WZBE 5JRJA 1OT3A 2JLZA 4L5BA 4QJ4A 3T1OA 2GRJA 1EX6A 2OESA 4QHYA 3AF3A 3OE7A 3R9XA 2REOA 1KGDA 2FX3A 1NMYA 4RD1A 2IUTA 3CWQA 3QENA 2CBZA 4RD4A 3ZLJA 1GNQA 2H92A 1OXVA 3A1TA 3CRMA 5AJZA 3HJNA 3FMIA 4OI1A 2GXQA 1E2LA 2HT6A 1N6IA 1RC8A 1IXSB 3DL0A 3U6BA 4UJ5A 3GLFA 4F93B 4R71A 2GVZC 4WVFA 1P2VA 3F3YA 4G01B 4KSCA 2XXAA 1Z2AA 1OIXA 1RYFA 1T0HB 4KFRA 4C0AC 1XB2A 2JJ8A 5CJPA 4HLQB 3M4YA 1I4TD 4U00A 4XSHA 1SXJC 2XOKA 1I4LD 2B7CA 3UG6A 5DI3A 1U94A 3R9WA 1X3SA 3L0OA 4O2RA 4A4DA 3O8CA 3OEHA 1VG8A 3IQXA 1G8FA 1W48A 2GXUA 4DBLC 1W2GA 2HCJB 4N3NA 2J87A 2WMNB 3RRYA 1NBMD 3BRWD 4I1SA 3W8NA 3B1XA 3O47A 1E2KA 1EESA 3TR0A 1MV5A 4Q7KA 2FA9A 1SVIA 1KMHA 4KODA 2Z4RA 2AXPA 2OCYC 3SBDA 1E2DA 5FUVA 1W7AA 2WKQA 4KXFB 2FFHA 4C2UA 1GITA 1KO7A 2DHRA 4LYFA 2F3RA 4QNRA 1NNEA 1LF5A 3LBIA 1U81A 1ETUA 3EA0A 3RVBA 2XEXA 3LH5A 3AEZA 1ZUHA 3LX8A 2EVWX 4UXJA 1RW4A 1UBCA 2KBEA 4LWZA 1W4CA 2CE7A 2VP9A 1YR8A 1G18A 4NYMQ 1T6NA 3RRMA 5SZJA 4B34A 1XEFA 3QJYA 1IBRA 1K5DA 1UBFA 2GF9A 1LW7A 3WP1B 4Q19A 4JYBA 2WPDA 3HYRA 4Q66C 1X8KA 5DI9A 3T5GA 1BMFA 4DXAA 3HU3A 2JATA 4JL5A 3VR3A 3CM0A 3CX8A 3F0TA 3GLIB 1T5IA 4TLCA 1G3MA 2V9PA 2ZI9A 5E95A 1XEXB 3ZH9B 2WAYA 2D4HA 4Z54A 4HZUB 3AQ4A 5BN4A 1SXJE 2DYKA 1QG2A 3P26A 2OCPA 1KI1A 4LHWA 4IOLA 3U44A 4N0DA 1KJZA 2NPFA 2RGNC 1CTQA 3THXB 3AVXA 2QSZA 3RRNA 4UXHA 1SVWA 3MCAA 4PFSA 4Q47A 5FTKA 1CRPA 1G3RA 4IKEA 2AFHE 1MO4A 4JZKA 1SZPA 3HR8A 5FFMA 3X1XA 1J7KA 2ONKA 3KQNA 4UXIA 2OBMA 2ZSBA 4BFXA 5GVSA 1XDBA 1KSGA 4LCBA 4JLDA 2IXFA 2F55A 3I1FA 5BW8A 5KUTA 2GKSA 4YQFA 4KLNA 1JEDA 4NTZA 1WRBA 4PANA 2ZI4A 1RFLA 3B1VA 2P5TB 1XX6A 2VHCA 4GI7A 3KJGA 4BFSA 5KDDA 4DIEA 4NCKA 4DIDA 4RJLA 3RS3A 2VA8A 1ESNA 2AKAB 4R7ZA 2QI9C 2WJHA 4TQUS 3F5FA 4NH0A 1P4SA 1IY2A 5CK5A 4PAMA 5BYJA 2YKGA 3RLFA 4QHSA 1BO6A 1T5LA 5LB4A 3PUWA 1CU1A 4QJ5A 2F3TA 2P65A 3F8TA 4RZ3A 1W36B 1SKYE 4KVAA 4XH9B 4Q1CA 4P33A 3GLHE 2OFWA 2GCOA 3WRXC 4L8GA 4G5QA 4ZDJA 2ZI3A 4NYMR 4D80A 3K0CC 4YMSA 1KZGB 3QKUA 1KY3A 1ZU5A 2V7QA 1XTQA 2QGZA 1FFHA 2A5DA 4DB2A 2B6HA 3L8ZA 5H70A 3KXLA 4NU0A 4XOIA 1E2FA 4X8OA 3D3QA 4BLTA 3I5XA 1FQKA 5FTJA 1OIVA 2WBLC 2P6RA 1TEVA 3B8HA 3UWKA 4Q03A 5JHHB 2NQ2C 3TRFA 3V4RA 2F9MA 1WXQA 1F3OA 4DCUA 3KB1A 5JWOA 5HCIA 5JMTA 3VTKA 2R6AA 5K8TA 5L3QA 4D4LA 5C4MA 4TSFD 1T3LA 2ODEA 4B3FX 2ATXA 1ZW6A 4B3BA 1IN5A 1WMSA 4XSGA 1QBKC 3AF0A 1Q12A 1I2MA 1CIPA 1PJRA 1XXHA 5FPTA 4C0JA 1GKUB 4TL9A 4Z8XA 4HAXA 3QF4A 1UADA 1ZM3A 2REXB 4A0HA 1HQYE 2F9LA 4TLEA 1ZRHA 4LC1A 1G3UA 4FXPA 3DDCA 4BECA 5G3YA 1R7RA 1VTKA 4AYWA 2RH5A 4BEBA 1YZGA 1E1QD 3X1WA 2ZU6A 2WV9A 4WZ6A 2ZJBA 1SKQA 3IHLA 3ZQ6A 4D4KA 3QVUA 4KSBA 4H9GA 2HYDA 4BFZA 3GLGA 5CB8A 4MKGA 2J7KA 3MLEA 4JLPA 4I81A 4X8HA 4TL7A 2QMHA 2XTMA 4B43A 2O8EB 2VO1A 2CHQA 3NIBA 2XZOA 5KNBA 2A5GA 1IJEA 4HLUC 1RJ9B 4QRHA 2IYSA 3GLFE 1ZJ6A 1FMLA 1X8LA 1T9HA 4EFNA 3W6PA 3A1WA 4GOKA 1T4GA 1GNRA 2BVNA 3VR1A 4DLWA 4B76A 4DJTA 3AVVA 3IEUA 1N0WA 4US0R 5CIWA 5AR1A 3TSOA 3FMPB 3TE6A 4EAQA 5JZVA 2QE7A 3I8SA 4S2EA 2AN9A 2OZEA 2UVQA 3EWAA 3R20A 4EJSA 1NN0A 2CCKA 1NJGA 1P9NA 4ASUA 5DE3A 2FH5B 2QT1A 1Z08A 1A4RA 4CEJA 2J9RA 1JB1A 3CKLA 4L9SA 4EPWA 3ETLA 3PUZA 3LO5A 1A7JA 3EXAA 2QPTA 4HAWA 2B8WA 3I72A 3QPVA 3W3AA 1G5PA 2DBYA 3H0KA 5CM8B 4NZYA 2QN6A 3THYB 4ZIRA 4KYUA 1SVKA 2GJ9A 5TV2A 2OV2A 1IY0A 4BFUA 3EPLA 3WBKA 1DAEA 3RSLA 2RGAA 3VNVA 5C2JB 4TMVA 4LV6A 4P4TA 3SYKA 5J4LA 2VSXA 4YDSA 1J2JA 4FMDB 2JCSA 3GQBA 2G9NA 1ESMA 4H1UA 2ZUCA 3U7EB 4DCTA 1AQUA 1OKKA 1W0JD 1UBEA 3V4FA 1R5NA 3B6EA 2C99A 2Z4SA 1YR7A 4C7OB 1W5TA 2CMKA 3C16C 3REGA 4JIMA 5E3HA 4M1MA 2QBYA 5IRCD 4TYYA 3KKPA 1Q1ZA 2GJSA 3BAFA 5FL7D 2R6GA 4BFYA 2O0HA 3K09A 4IOMA 4QNMA 2O8CB 2WWHA 2ZRDA 4LJ7A 2E1RA 3CH4B 1E79A 4LK2A 1LY1A 4B6FA 3MG9A 4HSEA 4KHZA 3K8YA 1U0JA 1L2TA 4ZI2A 5GJVC 1WP9A 4BFWA 2F43B 3NH9A 4HDQB 2J0UB 5G3ZA 3ZIAA 1J70A 4RY2A 1YZLA 3IHWA 1YZKA 4JLOA 4LJ9A 3PUXA 2ZYVX 1CJUC 1UEIA 4LBZA 4U7DA 1Q22A 1CR2A 5AJWA 4JLAA 2RGCA 3GLFB 1KNQA 1KI2A 4G5OA 1VHTA 1YR9A 2OCBA 3KXKA 4W5HA 1MH1A 3CR7A 3QXHA 1DO2A 2SHKA 1F2TB 4PQRA 1FPMA 5FPKA 3U3OA 1XMJA 2ZRKA 2XAUA 4OKSA 4Z1MD 1QF9A 2G0NA 2D3WA 2QP9X 4UNQA 3GMTA 1KSJA 3LW8A 3QXCA 1YZQA 1AS0A 1U9IA 2IUUA 4Z51A 1DG3A 2XNSA 1HT2E 4HYYA 3TVTA 2HCBA 2XJ9A 1G20E 1NI3A 4A2WA 2IWHA 4Q21A 3T1QA 1XJQA 2DPXA 2IEYA 4BLQA 1OH8A 4EKDA 2YC4C 1COWD 2ZE6A 5CYOA 1E9FA 2ZANA 1F60A 3SYLA 2RGGA 5G53C 2JLUA 121PA 4PAOA 3EPKA 2WSMA 2TMKA 2XNDD 4NCHA 5SZKB 2WMOB 1KMHB 4AURA 1G7SA 3BD9A 2WWWA 3NEJA 1PUIA 3Q5EA 1MOZA 1E9SA 4X8LA 2UZ3A 4KU4A 1Q44A 2ODWA 1DAMA 3KL4A 3GJ4A 2VPPA 4DLZA 2RGBA 1NG9A 4P4SA 2FOLA 3KTAB 2V6JA 2FEMA 4US1R 1WE2A 5FUYA 2X8AA 1GWNA 3U3RA 4ARZA 1LVGA 1Z47A 2F7SA 4F92B 4RD6A 2IF2A 3AVWA 4F4IA 2C9OA 1Z6GA 4BZQA 2OLKA 1W0KD 2EWWA 3CPJB 1EGAA 1KI8A 2NZJA 3DOFA 3IQWA 3DHWC 4R2IA 4WBSA 2A5JA 2GCPA 3SI7A 5JBQA 4AKHA 3L2OB 1U0LA 1NLYA 1ZMXA 3CB4A 4CZ2A 1KIMA 2AL7A 4Q9JA 5IHPA 5EP1A 2OAP1 2XSZA 1IQPA 5DYIA 4LV8B 3VU9B 2ODBA 5FUWA 4D81A 5DSZA 2VF7A 4L4UA 1UAAA 1E3MA 3EWSA 1S96A 2P67A 3IIJA 4PZLA 1T91A 4GZMA 4EPRA 4FWTA 3TIFA 4XD7D 3SHFA 4B35A 3U44B 1W5SA 2BDTA 1IOZA 4EDHA 2HF8A 3EAQA 1DBSA 2FGKA 3QSYA 2CL6X 1TUEA 2FJUA 3ND8A 2CNWA 3T35A 3VHXA 5JJIA 4M4SA 4O0MA 1W36D 2FDCA 1OFTA 1I2DA 1JEEA 1MRSA 1SHKA 4B71A 2JLXA 3L43A 3VX3A 3JVVA 5FPSA 2WWXA 2VP0A 2EFDB 3WNCA 1ELOA 3UXMA 1M7HA 4TLDA 1YZUA 3OAAD 2ZSAA 3BC1A 1KZ7B 5KNDA 3W6NA 3GLGE 1JR3A 3RAPR 1TQ2A 3A58B 1K5GA 1DAKA 3V00A 1NIPA 3I73A 4CIDA 2ZSEA 2IK8A 1GM5A 3ICQB 1GVNB 5DHFA 1M1YE 1OF1A 2RAPA 821PA 3SJZA 1DAGA 2OFXA 3LQRA 2F1HA 1GTVA 3VR5A 1CJVC 2BKUA 4Q1AA 1Z6YA 1QVAA 3DOEA 1JAHA 3IBGA 1IXRC 3WNDA 3KKNA 3UWOA 1FUKA 4DDWA 1E0JA 4JLKA 1U99A 2BCJQ 3D7MA 1E9EA 1VCMA 3K09C 2ZAOA 2OG2A 1KI6B 3ASZA 5TVKA 4A1FA 1E98A 4OJKA 4KBFA 2IYTA 3TR5A 3FPAA 5J4HA 1YZNA 4PR0A 5BQ5A 3IPXA 3NEYA 2LWIA 2ZM5A 1P5ZB 2F6RA 3R8CA 1G7RA 2BHRA 2HJVA 4ACAA 2FV8A 2WJVA 1N5JA 2ZETA 3D6TB 3A8TA 3LXXA 2VLIA 4LJ6A 5EXTA 5F2EA 5ELXA 3E70C 2OILA 3CW2A 1G41A 2V1UA 1Z83A 1OPXA 1R2QA 3RWMB 5DIFA 1G4AE 1HT1E 2HLDA 3BB1A 5CJ2A 3AKEA 1EX7A 4AYTA 4DB4A 2R2AA 3LY5A 3EARA 4YC7A 2BM0A 3DM5A 3H84A 2IYRA 1Z6TA 5J40A 3VKWA 3NH6A 4D26A 1GZSA 4FW9A 4MYHA 3K0EA 1XXHB 3QKTA 4ON9A 4IW3B 4CEIA 2ZPTX 1ZAKA 2ZYTX 1RPZA 3OIUA 1ZNZA 1TF2A 3SJCA 4C0QC 4O3MA 2C04A 1DTSA 2MMGA 3EASA 2P5SA 1G17A 4ACBA 4WOPA 3KQUA 4JT4A 1QHHA 1R0YA 4JVMA 3KKQA 1Q3TA 2DCUA 4V03A 1A1VA 1XZQA 4DC9A 4BUJA 5AUNB 1H8HA 3A36A 4DEXA 4E22A 1Z0DA 2CK3D 4QBHA 2V8OA 2FFBA 2CVHA 4BZXA 1Z3IX 4A6XA 2WTUA 3SNHA 2DFTA 2IHBA 4Q4AA 2EYQA 3WYAA 4MYTA 1KO5A 1W4AA 4M0LA 2ZSFA 2A5FA 1G3IA 1XRJA 2ZI6A 3CZPA 2VL7A 3K0FB 4F4CA 2BBSA 3B1ZA 2GA8A 1WBBA 1Z0JA 2P2LA 4BLRA 1MABA 1ZD1A 2JJ2D 4TL8A 1AGPA 4NMMA 3AF1A 4DLVA 3ZQJA 5L3SB 2VYFA 1T3SA 5LD2B 1VYVA 2CLDX 1Z6XA 4LJAA 1I4DD 3Q72A 3ADDA 3K70C 2AR7A 2H18A 1RRPA 3DO6A 4G1UC 4W9MC 2GCNA 2FZ4A 3LLMA 4DDTA 5HR5A 1T8TA 3EZ7A 2IS6A 1NY5A 3ND9A 2PLRA 5ANRB 2FE4A 1G291 3VMFA 2OT3B 1AKEA 1B0UA 2NO0A 2QORA 4EJSB 3IILA 1D2MA 1XBTA 4AK9A 4Q7LA 3ZVNA 3DVLA 4XVQA 2R6FA 1FTNA 2KJQA 1IONA 2N42A 1IN7A 4PC6A 4D6PA 3PEWA 2WZQA 4CEJB 1NG1A 3C7KA 3MWLA 1G8YA 1ZUIA 4U02A 4GNKA 5FI0B 1P72A 1XTRA 2QU8A 4WW0A 2J59A 3Q3JB 1HY3A 2IA5A 1UJ2A 4GP7A 1R8SA 1KMQA 1VG1A 1XMSA 3N2EA 4JSTA 4IFEA 4BRWA 3BH0A 1GRRA 2ERXA 2ZJYA 2IC5A 2Q6TA 4KBGA 1CR0A 3GJ8A 1W46A 3G5UA 3P4XA 1DE0A 3U3JA 4DDVA 3CNOA 4Q9KA 4M2LA 2WHXA 4LI0A 2XGJA 2HUPA 4DSOA 3SDZA 3K0AA 1KY2A 1XEWY 5CDFA 3BGWA 2VH5R 1UPTA 5JFGA 3FMFA 1W2HA 1OJLA 1TL7C 5FH9A 3THWA 3VR6A 1JNYA 2IYXA 3OFNA 3TQFA 4QJ3A 3PUVA 3WBJA 4FN5A 3Q7QA 5L8VA 3OEED 4ZDKA 4KI0A 4B3CA 1E9RA 2ZE7A 1M2OB 4DSTA 2J0QA 1VKJA 2QRZA 4BFTA 4C0KA 3K0CA 3M0EA 4P32A 5EUMA 4C3ZA 4D4MA 2O52A 2FWRA 1VIYA 1G5TA 3LVRE 4MRRA 3T5DA 2OE2A 2E87A 4HUTA 1CF4A 4ILEA 2G88A 5J4YA 3GEIA 1GILA 2IW3A 4M9XA 1J8YF 3Q7PA 4CYMA 4N0EA 1E4YA 3ZS9A 1JI0A 1T0JB 2AX4A 3THOA 3TLXA 3TUZC 3B85A 3OIYA 2VSFA 3KQLA 2FFAA 1XWIA 4FMCB 4XTRA 3LD9A 2JIZD 5FTNA 3TSWA 2AHOA 2C03A 2QMOA 3QUSA 4GL2A 3IUYA 3W5JA 1NN5A 4C9BA 3AB3A 4IHQA 1LS1A 4NONA 4C0LA 3CH5A 4EUNA 2FG5A 1IXZA 4TZ0A 4DLYA 1JR3E 1BOFA 4ZDIA 5KDLA 2XJ4A 5AJVB 1NRJB 1N6KA 4TLBA 1FUUA 3I4LA 3C4JA 4PSAA 1QHXA 1TTTA 4EPXA 4ZI3A 3FFAA 5JHGB 3HU2A 2P6NA 4Q48A 3RABA 2GNOA 2IYUA 1LNZA 4B2PA 3K1JA 3B78A 3SEAA 3AGQA 4E07A 5H8WA 5FOUA 4OHYA 5JSZA 3E2IA 3X1DA 3C15C 3QI2A 4B74A 2VBCA 2VTKA 1KSFX 3AVYA 3GFOA 1AGRA 5G40A 1YHNA 1P2SA 2VP2A 1BS1A 3EC1A 3RHFA 3PITA 3IPYA 1FZQA 4CT5A 1EXMA 4N1AA 4ARZB 3MRSA 1FNMA 5H68A 1ZD9A 4KYIB 3UMSA 3HR7A 3ZS8A 1FP7A 2QNRA 5KSZA 4MKFA 1XPOA 3R8FA 1AK2A 3QKSB 2ZIAA 4EIWA 2YWHA 2R9VA 1HE1C 2QRNA 2V55B 2ZRIA 5C4GB 3UMFA 5FOSA 4TMZA 4HLUA 3EZ9A 4CEHB 4GFDA 4ZPXA 1KAOA 4MDFA 4IVRA 2C5LA 2QROA 2JLVA 5F9HA 5E7MA 5TMPA 4PQFA 4DVGA 2H8KA 4MA4A 1E2QA 2VSOA 3KQHA 4OQLA 3QY0A 3EG5A 3NBXX 4RD3A 4RFSB 4TN1A 2H17A 1E96A 5AWFC 1BYIA 1D2NA 4A2QA 2X19A 4OI0A 3SJAA 1FQJA 3U4QA 2Q21A 2WOOA 1NBMA 2AK2A 3L0SA 3RS5A 1AZTA 3TW4A 4JJKA 4MRSA 4S35A 4TLAA 2OAQ1 3J81k 1OIWA 3CF2A 3L82B 4B48A 4QL3A 2J1LA 2VP4A 3I32A 1WBDA 3T1VA 1DVRA 4IXMA 8OHMA 1NJFA 2ZRGA 1QHNA 1E2MA 4Q1EA 2H57A 2QP3A 3KUCA 1VG0B 2AKYA 4RSGA 2J7PD 3TW8B 1DG1G 5DN6D 2B92A 1NP6A 2W58A 4A8JC 4BASA 3LAWA 4V0OA 4CRWB 6Q21A 2YNMA 1SGWA 1S4QA 3H86A 3I3SR 3DKVA 2GJKA 1E6CA 3QQ5A 3BE4A 3OIVA 3W8RA 2GDJA 2JDIA 3MWJA 3SYNA 4TT3D 1IN4A 2JGNA 5EQTA 2VHUA 4QGHA 3BWDD 5IT5A 4TYWA 1G19A 1Q1EA 2ZYWX 3A6PC 5L3VA 2QTVB 2GZHA 2RHDA 1OE0A 1P61B 4QKQA 1QRAA 3LNCA 4EPTA 3X1YA 4Q4HB 4L16A 4MDEA 3FE2A 2P6UA 1JQLB 2ZJZA 3CRVA 5KO2A 3U5ZB 1L4UA 3T12A 1TNDA 1KI9A 5CIQA 3ADKA 4JBWA 1XTSA 4YXWD 4UNRA 4PXAA 3R9IA 2ZI5A 5B30A 4LOAA 3QKRB 3TKLA 3WHKA 4PO1A 2EW1A 2PZFA 1E2IA 3SN6A 4C4PA 4MGYR 1NL3A 1JAIA 5BN3A 1SHZA 5HKKD 3BBPA 1OH5A 3MUFA 4ZV4A 2KI5A 1V5WA 3AVUA 1OHHD 3OESA 1WQ1R 4P0TA 4BE7B 5JEDA 4NBSA 4FMDF 5E7JA 1RYHA 2PCJA 2FSIA 3VQTA 1ZP6A 1KHTA 4PPNA 1SXJB 3H4MA 5JS7A 2YC2C 4ESVA 1JR6A 3QOFA 3VKGA 4C2TA 2WWGA 4PTLA 3LXRA 1GDDA 4ITRC 2NG1A 4JBXA 4LV5B 2R44A 2IWRA 3UIEA 4KITB 2EWVA 3KZ1E 1HUQA 1X6VA 1GNPA 5CDFE 1XZPA 1H65A 2D2FA 1H8ED 3GJ0A 1NVXQ 1GP2A 2PBRA 3QG5A 5DLQC 3I5YA 3ZD6A 3JVUA 2C98A 1KI7A 4LY6A 1R5OA 1ZNWA 1VIAA 4JLBA 4DEYA 1R6BX 4I1OA 2OSBA 4OK3A 4HB3A 4ZDWA 1P2UA 5JRZA 1T3HA 4Q4AB 2XZLA 2R62A 1QDEA 3IEVA 1VCNA 4ASUD 4XVRA 3U6KA 1P62B 5A5GA 1XD2A 2N46A 3QE0A 2QY9A 2F1RA 3QBVA 2Z0MA 2ZS7A 4QM6A 2O5VA 4WXRA 1G8GA 1G9XA 1SKYB 3GCGA 2Z43A 3QXXA 1GKIA 3AKCA 2E9SA 2V1XA 3N2IA 1K6MA 2HJGA 2ZQ5A 2XTZA 3BJIC 3GLHB 3U7GA 3I92A 1JBKA 3B13B 4LYAA 4LRWA 5FOTA 1QHSA 4TSFA 2QA5A 5JLJA 4DWJA 5B58C 1XCGB 1CJKC 2YWEA 5EXSA 2QT0A 4PO9A 2CEAA 3LRPA 3CIOA 2Z5FA 1E9CA 1IAQA 4HZIA 3T34A 4BLPA 2WIBA 4QFMA 1Z29A 1AQYA 1HA3A 1KI4A 2ZRHA 5DYGA 3Q5DA 5DISB 1OKKD 4GMDA 3SE0A 1IY1A 4O25A 1S1CA 2V4ZA 2NPIA 1M6NA 1P7CA 2GTPA 4GOXA 2CLSA 1M7BA 2NIPA 5C46F 4Q4LA 2GHIA 3K9HA 3U61B 3MJRA 2IS1A 4KCGA 2VHTA 3QPUA 3BK7A 3NBFA 1CR1A 5P21A 3QVVA 3BERA 4GOJA 2WVJA 4G5GA 1E1QA 2YOGA 1KSHA 3QIAA 4DUGD 4XVUA 1IJFA 5EXXA 1L8QA 3W5IA 5GVRA 4LHZA 4M1KA 1OW3B 1XCMA 2BBTA 1F48A 3EIEA 2CL0X 4M1YA 2QPAA 4D0LB 1S0UA 3JZMA 3Q8XB 4OHZA 5GADl 1VG9B 2FSHA 4Q4JB 3A1VA 1P75A 621PA 1YVDA 2O8DB 4TQ9A 3D31A 2RGDA 1QVRA 2BKEA 2GILA 2QTHA 3RSOA 4A92A 2CCJA 1E32A 1E2HA 3A4NA 2GEUA 4IXNA 4M1OA 2ZRBA 3P20A 3CO5A 3G0HA 3W6OA 3B7GA 1R4AA 1EFRD 2PH1A 2G0TA 2VP6A 4HI0E 1G8PA 1N6LA 3U3KA 4DLUA 4K46A 2WAXA 1Z22A 4QBGB 3KX2A 2WOJA 3WHLA 2ONJA 1SVOA 5KSOA 1NBME 3FKSA 3X2SA 3CNLA 4GP6A 5B2ZA 4A36A 2NGRA 3WXMA 4MKHA 4KAXA 1WF3A 4YLGA 4D0GA 2XXAB 1R5BA 1E9DA 4PO8A 4Y0AA 2OM2A 2ERYA 4LJ8A 2Y8EA 4QGGA 2FSGA 4KV9A 2BMEA 3CPEA 2V3CC 3E1SA 4GDFA 3IKJA 3O8BA 3RYTC 4DLXA 3ZD7A 4IDPA 1NSFA 1FOEB 4OHWA 3RS4A 4HB0A 2ZJ8A 5DI3B 3KJHA 4IVQA 1TF7A 4UNNA 1VHLA 4I1UA 1CBUA 1XFAA 2IS2A 2X2EA 4LHYA 3REFA 2IXEA 1Q0UA 1Z0FA 4II7A 2WSSA 3CPHA 1SVMA 1PLJA 5FL3A 4XWOA 2ZUDA 4LPKA 1TF5A 2I4IA 1W0JA 1XTJA 2A78A 4LDJA 4J0QA 4W5WA 3FFBA 4C30A 2PEYA 3A4LA 3ZGXA 2JLWA 4PHTA 3AUXA 1JPNA 1W1WA 2PX3A 4U5XA 2BJWA 2QAGC 2CE2X 3HP1A 3TJZA 2EFHB 3UANA 4R98A 1MO6A 3AVTA 2GXSA 2W6ID 4FMBB 3BOSA 3E5HA 1S9DA 4C0HA 4QGFA 3SHWA 5GJWC 4I99A 2F1IA 2CLCX 1G5RA 3PR1A 2NMVA 3A1SA 4QOSA 5EP2A 3WY9A 2WIAA 1Q1BA 5AUPB 4Y0VA 4A15A 2ANBA 4NYIQ 1GKYA 1YU9A 4AC9A 4POAA 1U90A 1XCPA 4FCVA 1II8A 1TAGA 4LHVA 3CF0A 4DSUA 1G64A 3NDBB 3A1UA 1DOAA 4MRVA 4Z1MA 1L4YA 1R0XA 1E9AA 3D8BA 2BV3A 3SJBA 1NMXA 3SBEA 1PLKA 3TNFA 3NXSA 5KTYA 3GJ5A 5FR2A 3LQQA 2BOVA 5E4FA 2GK6A 2W6JD 3U4QB 1N25A 4OQMA 1COWA 5C1BA 4FCWA 2RGXA 4A0GA 4OBEA 2G1KA 3K9GA 4TMWA 2XNDA 1YQTA 2FPMA 1TMKA 1XJCA 4MYUA 3GLIA 4IDOA 1XEXA 2DFLA 2Q9BA 3HWSA 5K8LA 4NPHA 5A4JA 2REBA 4LHXA 3RRZA 5JS8A 4HZUA 2GZDA 1NN3A 3KKOA 2EYUA 3LWNA 1AS2A 2H1LA 3O8RA 3M1IA 5CITA 3THXA 3B82A 1XMVA 2ZRCA 4Q1DA 3ZZUA 1G4UR 2CDNA 1KK0A 2QENA 1TPZA 4JLVA 1U8AA 4B73A 1DARA 1LS6A 3ONWA 3NBYC 1W0KA 2ORWA 4DZZA 3ZVMA 1Q20A 4JVLA 3CUEF 3C5CA 2JEOA 421PA 1T8UA 1YRAA 4KFTA 2GVDC 5AK0A 721PA 4ZO4A 2A2ZA 2MSEB 3ZYCA 2PT7A 2XX3A 3MD0A 3UPUA 1XTKA 1SXJD 1UKEA 2QAJA 3MGCA 2GJ8A 3KDSE 5KHOC 2FF7A 4WXPA 4LYJA 3NHAA 5FPYA 4AWXA 2GCOB 2QL6A 1S8FA 1KAGA 2RMKA 2RHMA 3AV0B 4A6PA 4ERNA 1DPFA 2W0SA 2GK7A 4Q9IA 1US8A 1HQCA 2FZLA 4MITA 5EXPA 1Q57A 2ZYUX 1E2PA 3SFZA 4NYIR 3EZ2A 2QUZA 2FMXA 3NKVA 4UQOA 3PEYA 1VDZA 2QM7A 4HAVA 1XD8A 3S1AA 2DB3A 1GOTA 3PCRB 3Q9LA 1Q1QA 3BFXA 1MO5A 4DLTA 4CF7A 2CVFA 1GSIA 3OIWA 4IEEA 3HYTA 1DEKA 1UFQA 2ECKA 1Z06A 3IO5A 5KSPA 5L3QB 1QHIA 1P60A 4GPTA 4RCZA 1TQ6A 2G77B 2VP5A 2BEKA 1CJMA 3V9PA 2A3RA 2C2HA 2LCFA 4KO8A 1X1SA 1D6JA 1RVDA 4H1VA 1VCIA 1E9BA 3X1ZA 5FBWB 3BB4A 3BH7A 3QF4B 3ZVLA 2Q9CA 2Q3HA 2GBLA 2Q3MA 2JJ1D 2JLYA 2BWJA 2IF0A 3ZVRA 2J45A 2VHQA 3RC3A 1N2CE 1M34E 3OF5A 4Q7MB 4RVCA 3ICEA 3U7FB 2FNAA 2HV8A 1II0A 4LZZA 2ZRLA 4L9WA 3KB2A 1KJYA 5B64A 4OQXA 3LVQE 3GLGB 2ZR7A 3LV8A 3DM9B 4MUBA 3WYFA 1OH6A 1EFHA 1XTIA 4RCYA 3B1YA 4EPYA 2AXNA 3AF4A 4FMCF 1XMIA 5IK2D 3RANA 5EE1A 2I1VB 3FOZA 3CX7A 1NIJA 1KTVA 1YE8A 4NE2A 2VHJA 5FOXA 3U7HB 3BIFA 4DLRA 5KDOA 3FB4A 4IEIA 2DR3A 2PL3A 4BWYA 1KJWA 2QTFA 4TTRA 1N0VC 2Z6VA 3K9NA 4I4LA 3NWJA 5F9FA 1AZSC 2FPKA 4MGZR 4JYCA 4B3XA 3ADCA 2DY1A 3GJ3A 1YZTA 2GJAA 3MSXA 1NKSA 5KOYA 1ZU4A 1YJ5A 2DFNA 1Z6AA 2JA1A 1E1RA 1ZC3A 3RDPA 4EFMA 4URVR 1EFUA 2ORIA 4QGAA 1TQ4A 1G1MA 1G7TA 3EA5A 4M9QA 2YINC 4TYPA 4IDQA 2BMDA 1JALA 4EQ6A 1G6OA 3LDAA 1A82A 1C1YA 5FTMA 2ZVPX 2YV5A 1E2GA 2WJJA 1JECA 1ZNXA 2GETA 5HTKA 1P9RA 5JECA 1U8ZA 3OE7D 3G82C 4ZCMA 1DO0A 2CK3A 2WWIA 3P4YA 3UK6A 1YRBA 2CJWA 2O0KA 4A8JA 4ZIRB 1FP6A 2ZAMA 1ZIPA 1CR4A 3ASYA 1FX0A 2A5YB 3MJHA 3H1TA 4FCTA 5EP3A 2IL1A 1F5NA 5EP4A 2LKCA 4DSNA 4GMXA 2C96A 5FOVA 1TQDA 5DH9A 3C14C 2YVUA 1ZCBA 2GF0A 4X8MA 2XITA 4OHVA 2C95A 1MT0A 1N6OA 1OXSC 4LGMA 2OUKA 1LF0A 1G3QA 2JJ2A 4F91B 1OXUA 3HDTA 3SOPA 2QBYB 2XOKD 1IHUA 1SVLA 4MGIR 5D3QA 5EJEA 3THYA 1WCV1 5K8UA 3BFVA 3OEHD 3PENA 3CWZA 2I3BA 4LBVA 3VKHA 1D8TA 1UF9A 2N1BA 4LSGA 1Z28A 3GP8A 5FUXA 2EFEB 1NVWQ 3M6AA 2B21A 3H2YA 3BH6A 2IYQA 2ZITA 1AA9A 4MRNA 4DHEA 2GWHA 1L7VC 1R10A 1R8QA 4ESHA 1JQJC 1Z63A 3SFVA 1W36C 2D7CA 2ZEJA 1DAHA 2ZVQX 3OZXA 4AKGA 2DFKB 4V0MA 2ZS8A 4MQBA 5KPDA 5SZHB 3LBNA 4MRPA 4PSKA 4V0LA 3GLIE 2O8CA 4DCNA 4HEJA 3PUYA 4Q7JB 4Z8YA 1XEWX 2GEDA 4LUCA 1XPUA 4UJ3A 4E03A 2H7VA 4GRAA 2F43A 3SQWA 2J0UA 4RD0A 3FTQA 3N70A 3TAUA 2NO1A 4Q00A 3HPQA 4RZUA 3ZDQA 4G5RA 5TXGA 1OXTA 3NC0C 3FMOB 2WPDD 4G0NA 2YJTD 1NLZA 1P73A 2CHGA 2GBLC 1BMFD 1F2TA 2WKPA 3KJIA 4HAUA 2A30A 1UKYA 2OHFA 4QC2A 4XWAA 2YOHA 4PHFA 2B7BA 5TDHA 3PV0A 2KBFA 1EFTA 3FHTA 1VYTA 3PIRA 4PHGA 4A82A 1P9WA 1KK1A 4RD2A 1E94E 4P4SB 3VNUA 3NC1C 1ZM7A 3IIMA 5E7IA 2HF9A 2ZRPA 1KO8A 1X8JA 4HUQA 3OEEA 1DELA 2XZPA 2BMJA 1GRNA 3WNBA 4C0SA 3EPJA 5A0FA 3GFTA 4Q02A 5D3MA 3ZJYA 3TQCA 3A37A 2BBOA 4MYCA 4Q01A 2G6BA 4TZ6A 1XJ0A 5EUQB 2ZS9A 4TYNA 1HTWA 3FVQA 1E2EA 3LW7A 4GBMA 1II8B 3DKPA 3CONA 4E09A 3NHBA 2IHYA 1GL6A 3KTAA 2LKDA 3T15A 4W5JA 4CVNA 1JXMA 3DZ8A 3EIQA 2YOFA 1S3SA 2JIZA 3WMGA 1V43A 3Q85A 4PC3A 2X2FA 1TADA 3CRRA 2D7DA 3K70B 2QSYA 4FINA 5K8IA 4URUR 2ATVA 2J0VA 4TMTA 1AM4D 3TUJC 1KYIA 4AG5A 5HZHA 3VU9A 4BEJA 3EIHA 1CP2A 1VMAA 1RKBA 2J46A 1C4OA 2J5XA 2JASA 2JDID 2Q3FA 1ZD8A 4B44A 3EC2A 3CRW1 1OXXK 4BLOA 4D25A 2RKOA 3TK1A 4EFLA 1BH2A 1OFHA 5JCZA 1W4BA 4RKFA 4XWKA 1GUAA 1FMJA 4B3GA 3W90A 2FPLA 2NO7A 3C8UA 3IDQA 2DWPA 4HATA 2V7QD 3K53A 1AS3A 3ADBA 5DGXA 2AWOA 3QNUA 1CEEA 3IIKA 5FR1A 5JJKA 521PA 3CNNA 2FEOA 1QG4A 4GZLA 4OI2A 1Z0IA 3KFXA 2JLSA 4CW7A 3AVQA 3SR0A 1Z07A 2OCAA 4TTQA 1G6HA 1F6BA 2HT1A 5JCPA 4JL6A 1RRGA 3B60A 5AUQA 1GIAA 5EZ6B 3KJEA 2XTNA 3PFIA 1CULC 4IFBA 3EX7C 2PEZA 5HZKA 2FGJA 2YHSA 4WZAE 1UDWA 3U2QA 4AIIA 1MKYA 2X77A 2XB4A 4OL0A 2ZRJA 2NZ8A 3JZAA 4HAYA 4JSYA 4D82A 2C77A 2QZ4A 3WRYC 2OFOA 3DMNA 4ZCLA 1US8B 1PZNA 2JLQA 2AWNA 2JAQA 1P3JA 1D5CA 2PCLA 2YZ2A 5FTLA 3EPHA 3KFVA 1Z0AA 4RZXA 4W7SA 3GJ6A 3LA6A 3S1AB 1QHGA 3FHCB 4BRUA 3GEEA 1NY6A 4NKRA 2VQSA 1ANKA 2O8BA 4PC2A 1Z0KA 4DT1A 2EQBA 3TVDA 2QQEA 1KDPA 3FYHA 3VAAA 1WB9A 1KI6A 4MUAA 1NVUQ 4OI4A 3GFPA 3WYGA 2J7PA 1XNJA 4B3DA 4KVGA 4NHOA 5DN6A 3CLVA 4IJMA 2IUSA 2MSDB 4OYHA 2OBLA 4PC7A 3L8YA 1A5TA 2ZI7A 4CEIB 2ZRMA 1OFIA 2WWYA 1FW6A 1ZUNB 2ZJOA 4QG7A 1FL9A 4US2R 3K0SA 2AK3A 3AVOA 4TT3A 1O3YA 1KNXA 2AD1A 2ANCA 4CGZA 1QHHB 2UZIR 4M21A 5JI2E 4BPBA 1XP8A 2K5UA 2ZU0C 4F7WA 4ABYA 3AGPA 2QAGA 1B23P 1EK0A 3QXJA 4P4UA 3PEVA 4QXAA 1E0AA 3FGNA 3B1WA 4HLDA 1F2UA 2W2TA 3SZRA 1UDXA 1KKLA 2QE7D 2EFGA 3NBZC 4LBWA 2PZGA 1NLFA 2D74A 2G3YA 4FD2A 3P1JA 2OEPA 4YXWA 3W3ZB 1SQ5A 3CX6A 4JMPA 1R0ZA 1JXOA 3IBYA 2ZRFA 1N6NA 4K8OA 5CLLA 1RZ3A 2D06A 1MO3A 5TY0A 3GJ7A 3WMEA 5HKKA 3RS2A 1MABB 2VF8A 2YYZA 3B5JA 2ZE5A 4BQSA 1CKEA 3QF7A 4HB4A 3QXSA 1OHHA 3FDIA 4MGKR 2YWGA 4V0ME 2J0SA 1N6PA 2PLFA 5EE0A 2PMDA 4KFSA 2ASEA 3NG1A 2I1QA 3RC8A 1HURA 4OJQA 1W4RA 3SU8A 3U60B 2OXCA 3ECCA 3KUDA 2W00A 3AP1A 4HB2A 4E5UA 2MSCB 1RRFA 3K0FA 2BJVA 3UG7A 1EWQA 1YR6A 3TBKA 2ZR0A 4B32A 4PZYA 3LLUA 2YWFA 1TU4A 1SULA 3C41J 3DEFA 4HDOB 3FHOA 4PSVA 4EQ6B 3VFDA 5L3SA 1BYUA 2HYIC 4M22A 1H8EA 5TB5A 1E69A 4AYXA 3RNLA 1E79D 4RKEA 2WJYA 3R7WA 3KXIA 4D4JA 1KO1A 4YMTA 3B9QA 5JJLA 1KO4A 1U2RA 3BS4A 3SS8A 2CJWB 2DWQA 3ZIAD 2VIIA 4A8JB 1DADA 4F4JA 4OHXA 4F38A 5KSYA 2IS4A 4XIGS 1FX0B 1UKZA 1OB2A 1II9A 3FKSD 1M74A 1XPRA 4G5SA 1Q3HA 3K0AB 5DHAA 4DCVA 5LPNA 2O8FA 2PZEA 1N6RA 4PPFA 2R8RA 5B57C 2ZXUA 2IXGA 4XTCS 4AY2A 4A0FA 5TARA 1HEIA 2KWIA 4G3XA 3THWB 5GJCA 4YMWA 1ZM9A 5UKDA 2C9YA 2NO9A 2ORVA 5FOWA 1OYYA 4HAZA 1S9HA 3GD7A 2A7QA 2R6CA 2R65A 1ONBA 2H5EA 4DKXA 2FFQA 3K9LA 2QPOA 2WSSD 4OK5A 4HDCA 1TEXA 4FI3C 1E4VA 3BFKA 3EW9A 4Q1FA 1E0SA 4URXR 5DNYB 5IDVA 4LYHA 4TMKA 1E2NA 4TL6A 2IYZA 2RCNA 1PVOA
chains in the Genus database with same CATH superfamily
5CDUA 2QMUA 1CY0A 1EDDA 1SO8A 2A3NA 1ILEA 3V80A 4FWIB 4DCJA 5GIPE 1IM2A 3OSZA 1X1RA 5LBTA 5IM5A 4AG6A 5AJUA 4G1VA 4KYVA 2QJFA 4BGIA 3LT0A 4P7FA 4WT7A 1X13A 3OKAA 4BNMA 1MJNA 5LB2A 1RMTA 2BGTA 1QH8B 4WJKB 1H5UA 4RZSA 5BYKA 4AKIA 3DEIA 1RP1A 2IOYA 1E0KA 2P1ZA 5EG5A 2FPIB 5G41A 4NY1A 1PG5A 2GKOA 1WXGA 2MOKA 2VZ8A 1IN6A 1QO0D 3QHPA 5TRTA 3IUMA 3SLRA 2WHPA 4FOTA 4E33A 1I9CA 3K1AA 3OF2A 4DGSA 3RIEA 1HH4A 1MB0A 1HV8A 1XZGA 1ZJYA 1GV0A 2HA2A 3AKYA 3O4GA 3M5CA 3RRMA 4X9XA 1RI5A 2IU4A 4J7XA 4IUBS 1LV7A 3ZG6A 4ZT5A 4QUJA 1KK2A 2V7GA 1GDHA 4EW1A 1H2FA 4OYLA 4RXUA 3ZLTA 4V0NA 1I24A 3DSRA 4YUXA 5DCLA 5ESXA 1O89A 4CDGA 1H2YA 4DNQA 1LB1B 4X7RA 2FW6A 2ZREA 2FWIA 1NVKA 2OHJA 1OV4A 2GN6A 3BORA 4MCJA 2AJCA 5FL7A 4N65A 1SEPA 2QL5A 1UKVY 3ILXA 4HS4A 4HUQB 4Z5XA 3SDSA 1WW3A 4CQLB 4CQMA 3ESAA 2FU5C 1U8UA 2XKKA 1QVVA 3AFNA 3BRQA 4K2HA 4UUNA 5AK4A 4PZZA 1LSUA 2CNWD 3HL4A 1TKAA 1SXQA 5D1NA 4LC9A 2ZTSA 4M9SA 4U6NA 1XZKA 5GM1A 5I4KA 3PHJA 1PT9A 1ISIA 1N8SA 1N3BA 2C4MA 2FZ5A 1E3LA 5BRJA 2VPZA 4PGAA 2YWBA 2OLJA 4P5PA 5IBRA 3WK9A 1MU0A 4RZHA 1C81A 1SPXA 3KAJA 5HSGA 4RVGA 2AKEA 1AKYA 2YZNA 4D8YA 2GEFA 7REQB 4X92A 4M8NE 2UXDB 1KETA 5LBUA 4LZAA 2P11A 4QTZA 3KEFA 4P3KA 4BNDA 3FIUA 3ORRA 2QL9A 3MMNA 1R64A 1UXJA 2EKBA 2OZPA 4V0KA 1JR3D 2J41A 3EFOA 4FJ0A 4D9MA 4QVIA 2LW7A 4CL0A 4UCWA 2A0UA 2XUGA 3H5WA 3B36A 3K31A 3ZKWB 4B7AA 2JBWA 1GG9A 1RQ7A 2FWNA 5IHXA 2CXXA 4UTXA 5EJIA 1L5HA 2GM4A 5EE5B 3AX6A 4JC0A 4BFVA 5CB6A 1YB5A 3P32A 3UYKA 3ORHA 4YYZA 1N5IA 5FBVB 1DAFA 1J90A 3SQXA 1E0DA 2IY9A 4Q82A 1M5TA 1XVVA 1OFUX 1XT6A 3OUTA 4YJ3F 5K7SA 4G89A 3HTXA 1KVUA 4B8ZA 4WZBA 2QZJA 4BBAA 4E2YA 4ED9A 3C6MA 1U0SY 1A0OA 3WMFA 3BMQB 3BG5A 1LWNA 2VATA 3U4AA 4AZTA 2XEDA 3BK2A 1IN8A 4HJXA 2IH2A 2ZROA 3AU9A 2ORED 2ZRQA 3DXXA 1W0CA 2B4AA 3PFHA 3OE5A 4Y2SA 4F96A 4HNVA 5ALYA 2BF4A 5LP6A 5LZ7A 3PVSA 3T7AA 5AJHA 3ESRA 3SBXA 2OB1A 1XXHE 1HOTA 2QN3A 3LHSA 4C76A 2D0IA 1WD7A 3GEHA 4M8SA 1ORDA 4P31A 2IXTA 3UMRA 2X1VA 2IFTA 3JQ8B 3DZGA 1Z74A 4Y1RB 1VPTA 2WU0A 3HKCA 3HZRA 5AW0A 4HDMA 1A8IA 4BNUA 3JQDA 3TXXA 2HLDD 4WA7A 1KE1A 4QELA 1H4SA 2WUFA 5AMXA 1R4ZA 3WDMA 2ZRAA 4YLYA 1LFAA 4KO1S 2QP4A 1CRQA 1K06A 2D5BA 4LBYA 1LFDB 3AW9A 3DZDA 3KLMX 4CCYB 3EZFA 4ZKDA 3IAS6 1CS0B 2RHGB 4JS0A 4UHFA 3IOEA 2XCOA 2YS6A 3PRYA 3R5TA 1OXMA 1UJ6A 1PCXA 4LDRA 5JWHA 3VRHA 3ZCXA 5F3WB 1RPAA 4YAKA 1T26A 3U3MA 3UN1A 2ZPUA 1R00A 4CIYA 2W6JA 1T1GA 5LQAA 4PPGA 2XCUA 1S1MA 4MAMA 3DLHA 1DAIA 4NCJA 4J0CA 1ZSVA 3KSUA 3PNKA 3AWDA 3WLHA 4M7RA 2HBQA 3IT3A 4X95A 2RG1A 2Q3LA 2XOXA 4BYGA 3WLJA 1DP4A 5K09A 1E7MA 2OO5C 2QD3A 4M1WA 1P0MA 1FSSA 1ZGGA 4IDDA 4AJHA 1NONA 2ACVA 1YKSA 1SD1A 5ES3A 4DT1B 5BN3B 1RYNA 4D3XA 1ZL2A 3MIIA 3DBOB 3DPUA 3E0QA 4RCVA 2H6EA 3DG9A 5J5CA 2VF5X 4MWGA 4QREA 3MBKA 4CMHA 4FS3A 1I2CA 4DA9A 4FYKA 3PQCA 3FPGA 4CIBA 4W9NA 1C30B 1E18A 3V55A 4UU8A 4AD8A 3EVGA 3RS7A 1DC5A 2ZSDA 1ODFA 1MD9A 4NECA 3TAXA 1F8YA 1H6BA 1KKMA 2FZCA 1IIRA 5HKAA 4XZ3A 2O19A 2OHOA 3T61A 3IUNA 3GEDA 4AXBA 1S2LA 1I1HA 3JWJA 4QGBA 2J9YB 3TFOA 2C97A 4MZXA 1ICIA 3IQFA 3U9TA 3RUCA 5D00A 3MUEA 5J4KA 4H6WA 1U2TA 3PE4A 2I6QA 3AJEA 2ZE8A 5CNKA 5JXIA 2Q4DA 3O3CA 4H6VA 5CD1A 1U9IC 1Z4OA 1Y7HA 4NOLA 3BFJA 1IUPA 3DBHB 1C3EA 5KNLA 2WJIA 4P2BA 1DBWA 1HDOA 1XE3A 3D1JA 4EGCB 2PY6A 1K7YA 1QZXA 1L4NA 5JZMA 3PX2A 5DX1A 2BGMA 1SPBS 3T3EA 1JJVA 1PE0A 4EVSA 2AC4A 1E99A 1XIVA 2PA3A 1IQRA 2I2AA 3R6LA 4W4TA 1CJTC 3C2QA 4ZREA 1QWSA 4DEVA 3GR6A 3M81A 3N1UA 3ONFA 1APBA 4RTOA 3BDIA 4BNLA 4RXTA 4UNSA 3OOYA 4Z9FA 1L7DA 2E5FA 3GT4A 4J7AA 2BHLA 1SH7A 3FWYA 2FWMX 3JAWA 4H6XA 2PJZA 3MT7A 1XAHA 5DWQA 4C6TB 5H02A 1TRHA 2ILTA 1TUBA 4Q9LA 5FLKA 4RTPA 1FNNA 3BCRA 5IYZB 2QUAA 3JYNA 2RC5A 3O92A 4HNSA 3UB2A 4B3RB 1G16A 3OCVA 1T1RA 4HFRA 3K0KA 1QB8A 3ELDA 5IJZA 4LZPA 3OT5A 5AVVA 4L0DA 2VPTA 1EB9A 3FYCA 4LDPA 5BR4A 5IJ9A 4JDPA 3UF0A 4JVNA 2C9CA 4FDAA 4JXJA 1R0BA 1BD4A 3RC8A 1MRNA 2QW8A 1XCBA 4WY2A 1U5CA 1LDGA 2CL7X 4M0EA 1LTQA 1WXDA 2HWKA 1W47A 2Q3EA 3DZKA 3WB0A 3RWOA 5H59A 4GQIA 4RS4A 3ZWXA 2DLDA 1RIFA 2W83A 3WHPA 2NTVA 5JAPA 5IXJA 1VJRA 1P1CA 1KU0A 1MF7A 3COPA 1VECA 1D4ZA 3A6FA 2QQ0A 1T6BY 3OQVA 4NBNA 4K88A 2JCVA 1H93A 2GESA 2JG3A 3ZXUB 4C7XA 2RSLA 1KDRA 2HXYA 2G1JA 2C5AA 2I66A 2Q2WA 4IDHA 4PFQA 4N47A 1SMKA 3T5BA 4QLBA 1J8MF 1QGED 4S1WA 5DNDA 2ZATA 3ZGLA 3LUKA 4B6EA 2J3MA 2RGNA 4QD3A 1Y6RA 5K3CA 3Q7TA 3OCCA 1NVAA 4ARBA 1V6CA 3M6LA 1OH7A 5AVZA 5HF6A 4W5RA 2VTBB 5CFOA 2A7XA 3T41A 4DNFA 3EZ6A 4BX3A 4E30A 5JH7F 1HZZC 2H52A 3HFGA 3PGXA 4RF4A 5A06A 2QEQA 2YN4A 4AMYA 3HP4A 5BV1A 4E15A 3EEOA 1YJAA 1X92A 3RSZA 1B15A 4ZGGA 2PUDA 3VGPA 1ODCA 1RKQA 1DIOB 2KLHA 3MGAA 4TTJA 1HYQA 3SGLA 1FRQA 4RHCA 3RS0A 3SF8A 4EFKA 2IT1A 4IGIA 2FN4A 2HH9A 5EE9A 5FP0A 2CDCA 2QM3A 4E21A 4I19A 4RIEA 1QE3A 4RKWA 3DVRX 4DLSA 3L1JA 1ORVA 1YZVA 2AIRA 1R6XA 3WRYA 3IEIA 1H6AA 4KLZA 4Q4JA 2PRIA 4X45A 2FN7A 2EF0A 3P71T 3TLBA 3ZNNA 1I9GA 1XQ6A 4FDLA 3KOWA 1C9KA 3GJXC 3H9BA 2RGEA 3UXEA 2C5HA 4D9GA 3A2MA 2IX3A 1Q21A 1C4KA 5SZIA 5CA1B 1J0DA 1ZIOA 1YCDA 1SWWA 2WF5A 1ZYUA 3WK7A 1KDOA 3CR3C 4C7OA 3CF6R 1T2VA 1JQ5A 2BSQA 4EPVA 2IYYA 3H17A 3KSZO 1HXHA 2DUJA 1YQDA 1D4OA 1JIIA 1PK7A 4WZBE 1P4RA 3UGKA 1OT3A 2HUNA 4L5BA 4QJ4A 3QEBZ 5KKAA 3T1OA 4AQDA 1EX6A 4AO6A 1Z68A 2NT4A 4QHYA 4E11A 5IN4A 4CMKA 1P1JA 1V3UA 1W25A 2GEBA 3RT9A 5JDCA 3OQBA 1LDBA 2EJCA 4YJGB 2CBZA 2FMUA 5AT1A 5KYUB 4PTZA 1GPLA 2Z04A 4A1OA 4FB4A 1KOLA 1OXVA 1P31A 2B0CA 2G17A 3H11A 3HI6A 4MUFA 4XDGA 2GCEA 1K8YB 3HJNA 4C6SA 4L4SA 2Z5VA 2Q2NA 3A05A 3UW3A 2BFDA 5GTDA 2AOTA 1JKMA 1Y1PA 2DJIA 3DL0A 3MF4A 3OLXA 2HREA 3TZEA 3ZWOA 4R71A 4RF5A 2GVZC 4WVFA 1VA4A 4YN3A 1SM4A 3UT5B 3ZE9A 1H3FA 2FEWB 1Z2AA 1OIXA 2O2DA 1KEPA 4N8DA 1T0HB 4G4GA 4UOQA 2Y2UA 4L07A 2Z6QA 4BBZA 5HBRA 3HUTA 3PFGA 5F7OA 4TMFA 1SXJC 3ZY4A 5CFPA 1H2WA 5LSAA 2C5GA 3EXHC 5DI3A 1SFRA 4YAIA 1X3SA 4RK7A 4TWRA 3O8CA 2BGNA 5E7QA 5LCXA 2ONCA 3IQXA 1NOJA 3VU0A 4YRGA 1TM4E 4LF8B 4I9HA 3S8MA 2WMNB 1NBMD 3M4JA 5ILOA 4XQCA 1XHLA 3B1XA 1LPNA 4RY8A 1E2KA 2B69A 3K5IA 3QVTA 2OFFA 1EESA 1DBRA 1O96B 3MOIA 2FA9A 3AZOA 1SVIA 1F0NA 4Y2RA 5EFOA 1HFWA 5EJMA 3RYCB 3C1TA 5CPFA 3HBLA 4KXFB 5I4IA 1AMUA 3H9QA 1PN3A 4Q24A 2H3HA 1GITA 1KO7A 2XLBA 2I2CA 3ND7A 5T5QA 2QRVA 3LBIA 1U81A 5IM4A 3H1AA 1NUHA 2GUWA 4I5GA 1Q7GA 4EA8A 4MS3A 4HGZA 3RVBA 2Q5CA 4C05A 3KSAC 3LH5A 4XQEA 1B8PA 2ZDQA 4H4CA 3S99A 3RFVA 4LXQA 3TLZA 3LX8A 2V6FA 2G08A 1UBCA 2KBEA 3CMCO 5DVZA 1U1IA 5EQJB 4ZEVA 2PKQO 2NZ2A 2VDKB 3ET5A 4X6XA 1XEFA 1ADYA 1K5DA 4K3UA 1UBFA 3WP1B 1LW7A 1WMEA 1H0SA 2XNCA 3A9WA 2OK7A 1FTGA 2IIPA 4PLCA 4CIXA 2QJRA 5ARDA 1JH8A 5DI9A 3MPOA 2IP1A 1COZA 2X8LA 1TZBA 3GZTB 4HEA6 4RETA 3VR3A 3AO0B 2ZBPA 4JL5A 4O08A 4W5TA 3K30A 3RAGA 4MVJA 4CKBB 3GLIB 3ZU4A 4NAHA 5E95A 3ZH9B 4MA0A 3I9LA 1KFCB 3WLOA 2XNKA 4UU0A 4ENSA 3AQ4A 1O7JA 2XMPA 5IJAA 3ER9A 3Q8KA 2FUKA 1V45E 5T8KC 2VDQB 2OCPA 1GY8A 3QHAA 4J2TA 4ZXPA 2NPFA 2CUTA 3Q87B 2ZZKA 3BILA 3EOBI 4IJUA 5MF6A 3WV5A 3ROQA 4B3MB 2J9FB 1SVWA 3AR3A 1EKXA 4EY3A 3OVMA 4Q47A 1ZFNA 3ACCA 3GT0A 1ZWLA 2PX5A 1SZPA 4Y9SA 3CN9A 1HQKA 2OBMA 1JEYA 3JATA 3NIGB 3ZZ1A 1C5KA 2VHYA 3CEAA 3E03A 2YMQA 1KSGA 5I9MA 5KJ1A 1JQKA 1MDFA 3ZX4A 5BP7A 5KUTA 2C8KA 3GT7A 1VC2A 4KLNA 2BKVA 1BVRA 4TWJA 4NTZA 2VHZA 2H7YA 1YOBA 4PANA 2ZI4A 2PH5A 2NZUG 2UZ1B 3B1VA 4RKRA 1XX6A 2VHCA 4ND6A 1SC6A 1ZH0A 3UUEA 4GICA 1I3KA 3ROGA 4CMJA 1Q6ZA 3HYCA 3KJGA 4BFSA 2IIQA 1KJJA 4NCKA 3WO1A 1RC0A 1FDUA 5ELMA 3RVJA 1XF1A 4P38A 1ESNA 2AKAB 3WK4A 2Y27A 3HDJA 4IZOA 1H0RA 1OXBB 2AR9A 3F5FA 4L7VA 5JPIA 3ZIDA 4BNFA 1IY2A 1I7NA 3RLFA 1BO6A 2G9QA 4MUGA 4Q34A 2RI0A 3B7WA 4QJ5A 4Y6SA 2F3TA 2QIOA 2G5CA 2P65A 4QUKA 1RLOA 2QKYA 2RG7A 3FAKA 3JW8A 2VOEA 4RK1A 3VAYA 5ICCA 1W36B 1BXGB 4OGGA 3C6ZA 3IE0A 1BKSB 4KDCA 4Z3OA 3D6JA 1T5HX 4Q1CA 1TECE 3X2EA 1T5SA 2GCOA 4OHRA 1EJBA 4YTEA 4Q3EA 4ZDJA 2RHBA 1DRJA 2JVJA 3QTTA 1WLYA 3K0CC 5A1TA 1KZGB 1QS0B 2X2PA 2HRBA 4LRTB 1ZH4A 3G0DA 1ZR4A 4C0XA 1OX5A 1U3TA 4Y2HA 3S1SA 2B6HA 1X7YA 1VMEA 2XODA 2VBGA 2H48A 4CUZA 5AVQA 2R8OA 2X5OA 4NU0A 1YQEA 4PV7A 4XOIA 4IIYA 3ZTYA 4YT4A 5AW2A 3HXOA 3I5XA 1OIVA 4DPKA 2NUTA 4MUXA 4Q03A 3VO8A 3F74A 3LY9A 3C70A 1E3WB 4YT2A 3HSYA 4FT2A 3BF7A 1SIOA 4Y2TA 1C1DB 2DE0X 1F3OA 1YQWA 1CUJA 1S2IA 5JMTA 3F2VA 1OBVA 2R6AA 4RZQA 4TSFD 4XGNA 2G28A 2DPLA 5A71A 1KXJA 1BN7A 1R5JA 1R6UA 2ODEA 4EHBA 3L6RA 1EEXB 4AY6A 1QBKC 3AF0A 4YR9A 3QHQA 1M2HA 5NULA 1RJEA 5KYTA 2XUJA 1PJRA 3GLVA 4KO2S 4P82A 5B1EA 2ZK7A 4H7HA 1GKUB 2TMDA 1V37A 5T4HA 1U80A 3K72B 4Z8XA 3QF4A 2JIQA 3ED5A 1UADA 2E48A 4FHEA 3HB9A 1HQYE 3KYIB 3WK5A 1BHSA 2PBZA 1PF7E 3KPWA 1A5AB 3L9XA 3O1IC 4LC1A 2LE0A 3ITKA 2BELA 4JROA 5EHIA 3ENVA 3NIWA 2XCSB 4O4IA 1YZGA 1E1QD 1PZEA 2HLPA 2WV9A 2ZU6A 4HGNA 4QYMA 3TLEA 3TOCA 5ECGC 3SS7X 1WTAA 4H9GA 1IHDA 3GLGA 4F72A 2HX1A 3P2JA 1PJCA 5HJ7A 5EIBC 2KX7A 1N33B 3OICA 1NUSA 4KAJA 3SJUA 3L7MA 1UMDB 4I81A 2J5QA 2I2BA 5CDSA 4ZMSA 2XTMA 1C41A 1SUWA 9GPBA 1NSYA 5ICMA 1A5BB 5JXWA 3ZJVA 4CTMA 2J4DA 1MV8A 2XE7A 4I0WB 4P4NA 2O8EB 3FPEA 1QNFA 4XLLA 4EB0A 1DO8A 3EUFA 5I01A 5IVIA 1IJEA 4HLUC 4RW0A 4PF1A 4JWTA 4FYJA 3VYSB 5HJ5A 3HDGA 2J0QA 1ECLA 5HIAA 3W1VA 1FMLA 1PIWA 2EZUA 3FX2A 4AKTA 4I6GA 3O75A 1RCFA 4MUNA 3SY8A 3A1WA 3UK7A 5AD1A 3UKOA 2AUMA 1TLFA 1GNRA 2BVNA 3LS2A 4GMGA 1L4LA 2OO3A 4HH4A 4QSHA 1SC3A 3VR1A 4B76A 4DJTA 3ZV7A 1TUGA 2CLIB 2K4MA 3AW8A 3QMVA 4M7PA 4QAJA 5CIWA 2DGDA 4J4BA 3ZWVA 3PS9A 4RNDB 1C9YA 4BKUA 4E5KA 1U7WA 3I8SA 4S2EA 1ULUA 2FUG6 1RZUA 5L3VA 5K1ZA 4N41A 3EEIA 2GR9A 3OZAA 5DOZA 4JOSA 3AB7A 3ZWNA 1N2OA 1O4WA 1KWGA 3AESA 3CHYA 5EIWA 1D8AA 4J9VA 4X1IA 5CCEA 2FUNB 1PFVA 2O5RA 2JHGA 1GUBA 1K6IA 2ODAA 4EPWA 4U6QA 4FHCA 2C4WA 3UJHA 1YULA 2XDAA 2YV4A 1ZXLA 5IAJA 3I72A 2P75A 4ARAA 3ETEA 3W3AA 2DBYA 3K9QO 2WYUA 3IURA 2QN6A 1XV5A 2ZYDA 5IH3A 4OLFA 2QTAA 2OV2A 1X0XA 3H1PA 2DVMA 4UZFA 1VI5A 4NICA 3ZE8A 1LJUA 1DAEA 3J7TA 4B40A 3NFRA 3N2KA 3TLAA 4HPWA 2YHAA 2Y6VA 1EG2A 3TO5A 4LSMA 2CLEB 2D5CA 2I1LA 3PFBA 1EI9A 3DE3X 3QLVC 4C4RA 3O7MA 3U0BA 4FMDB 5DHUA 5JAOA 3B52X 4PCUA 3RT7A 1TB4A 3MAGA 2OVFA 1AQUA 1OKKA 3U7EB 2PX8A 3S6JA 4DIKA 4E1AA 2C99A 2Z4SA 2BAGA 5CT6A 4MWBA 1W5TA 2CMKA 5JCOC 3JQCA 4L0CA 4BMPB 3T52A 1M0SA 3BAFA 1R74A 2V45A 3HBJA 1O1YA 1STOA 2AJ8A 3CEJA 2R6GA 3RG2A 2HKIA 5I5GA 4MVJE 2O0HA 3E61A 5DHTA 3TTUA 1I6MA 3GIDA 5BRAA 5HGXA 1VJGA 2O8CB 3FOEC 2EZTA 4ALJA 2H1VA 5ALJA 3R9XB 1HNZB 4FNOA 1Z7WA 4KHZA 4BGVA 3IEKA 3VO2A 4ZI2A 3H8JA 1WP9A 3C8DA 5CT8A 3B3JA 5JNVA 1TYCA 3NH9A 5DLYA 3IFSA 5G3ZA 3ZIAA 1J70A 1LUAA 1Q17A 3EG9A 2GHRA 3GRFA 2ZYVX 5LKRA 1T34A 3E15A 4EYQA 3TD2A 1LQ2A 3GLFB 1KI2A 1VHTA 1YR9A 2OCBA 2P4EA 3WJ1A 3CR7A 5H5JA 1DO2A 4PQRA 4R1TA 5FPKA 2K2WA 3VYRB 3U3OA 5K45A 2A9PA 3NHZA 2XAUA 4Z1MD 3BT7A 2BZGA 2G0NA 5ALDA 3GMTA 1KSJA 3QXCA 4DUPA 2J67A 3GPIA 4BCCA 4YRIA 5I3ZA 9MHTA 3CNEA 2XJ9A 4G4JA 5FPPA 2IXBA 3ETNA 4A2WA 4Q21A 4MRMB 3CC8A 5FWYA 2DPXA 4HTAA 3QX3A 2QLBA 4I55F 4RELA 1GPMA 3PWTA 4EY7A 3DTNA 3F2IA 4BQEA 1FRFS 4OQEA 2YC4C 5CYOA 3NAQA 4AUEA 5HTOA 5IBQA 2FLVA 3VPSA 3X43A 5G53C 1Q11A 1TD9A 1PT6A 5B5SA 4ZALA 1V7PC 1M8FA 3BL6A 4QYXA 5LZ9A 3IMCA 4L50A 1CY7A 4RA9A 1KMHB 3FOWA 3BD9A 4OF4A 5D6NA 3ZW9A 5F78A 3PNMA 3MQFA 1MOZA 5I5EA 4C3OB 2F1KA 4J91A 4NBKA 4AW9A 2P68A 3OZWA 3SX4A 3HV2A 1U3DA 1VSBA 4C4AA 1JPVA 1EVZA 4PYQA 2FEMA 4US1R 1WE2A 2PSFA 3VZSA 3R40A 1L8OA 1KS2A 2WMYA 2CT8A 2FHSA 2UU9B 1TU0A 3H87A 4AG3A 3PFKA 4B7CA 2IF2A 4U0JA 5E6SA 3AVWA 4F4IA 3IXMA 4ZT6A 2C9OA 4OUKX 2YXDA 4BO9A 1X1AA 3EWNA 4H7DA 1W0KD 2HCRA 3VU9B 5JLJA 1EGAA 1YRQA 1CR6A 2NZJA 4Y7DA 2VWHA 2W93A 3IA2A 3O8LA 4WBSA 4GWKA 4I1PA 2FEAA 4MW4A 5FKJA 1NLYA 2MU1A 4KQXA 2XMSA 4CZ2A 2AL7A 4Q9JA 5BQPA 1IBKB 1W73A 4QT4A 3PQ8A 1L7EA 1RKUA 3EXG2 5CYFA 1T4MA 4D81A 1YJCA 4M86A 3VSCA 4MW9A 2PGAA 4X6YA 3LO8A 4RACA 3IIJA 3WO0A 1TMOA 1T91A 4PZLA 4RPKA 2ISCA 3ZHOA 1Z88A 2FRDC 3P97A 2RGWA 1UM9B 4EHJA 1BSVA 1JDTA 4XD7D 2E55A 5FA8A 1A9OA 4B35A 5ARBA 1PL7A 1CHDA 1W5SA 2BDTA 3CLSD 5JSYA 1DBSA 2HIAA 2QD4A 2QUBA 2CL6X 5B37A 5LM3A 1Y4SA 3W9BA 3ND8A 4G5YA 3VPXA 1J7JA 1M1NA 2NPOA 4IH9A 3STWA 3T35A 5JJIA 5B3LA 2ERCA 4INAA 3ROFA 2FDCA 2HWUA 4EK9A 4DWVA 1LDEA 1O08A 2OKGA 4B71A 2IUFA 4RIFA 4QDKA 2WWXA 2JLXA 3O26A 4L7QA 5DWVA 2PAAA 1BD3A 3A11A 2I4LA 5SYAA 4LG1A 3UXMA 2OVBA 1SUIA 1M7HA 1G20B 1E4OA 4L85A 1JR4A 1XKLA 3DBIA 3JVDA 4WK4B 1G21B 4FE3A 4ZV7A 2QLLA 4YRNA 3AUJB 4LGCA 2NU7B 3GLGE 4N5IX 3ETGA 4L27A 3FY4A 3A58B 2JAOA 4CR8A 3O4IA 4NDNE 1JU3A 3ABIA 1FUYB 1NIPA 1WUJS 2BGLA 2IK8A 3NNSA 4CIDA 1MW8X 3ICQB 1T15A 3JQAB 3K7EA 2VYQA 4OBWA 4RSRA 3E9NA 2OFXA 3CZCA 2X5KO 4XIJA 3P9IA 1SQ0A 1ZOIA 2F1HA 2XXBA 1QCZA 4XQ0A 3VR5A 2BKUA 1D4AA 4E1BA 1YQUA 4LSZA 3TG8A 4DLLA 2F8TA 3EAFA 2W4IA 1QVAA 4UZSA 5C7LO 3DOEA 2HY7A 3D3WB 3IBGA 4GL4A 4G5HA 3N8HA 3N9IA 1FUKA 2QTVA 3NGLA 3UWOA 3BHNA 1E0JA 2BUBA 4EVQA 2BCJQ 2XT6A 3DL7A 1U5BB 2AG1A 4EB3A 4YY3B 4RE5A 1T5DX 2HMAA 3CS3A 3L1IA 1UIMA 4KK3A 4OBBA 3PLRA 4RADA 1ODKA 4XM2A 1ZIDA 2XUIA 1XDWA 4A73A 2ZUEA 3O4FA 1AQIA 3H5NA 4I8XA 2ZAIA 2C7PA 1UINA 4NQRA 3PSAA 1EDEA 2MR5A 4PSCA 2BHRA 1DQRA 2HJVA 4BAUA 4ACAA 3VKUA 1P9OA 1P7ZA 2GZMA 2ZETA 3ZLVA 3DBVO 4MIOA 1WOMA 3E5NA 1L6IA 3NONA 1M6VA 2OILA 3CW2A 3FZNA 1IEQA 1PD1A 1Q0RA 1YACA 1OPXA 3AERA 1UDRA 1ZBQA 2UZAA 4IJ6A 2FVYA 5G4LA 2IVZA 4B46A 5IASA 1B0ZA 4AYTA 2HR1A 4DB4A 4OXKA 3ICOA 4DILA 3QX8A 4YECA 5AVUA 3M5PA 5HXAA 3IAXA 4P9NA 4QFDA 5BQFA 4X62B 4J6FA 1Z6TA 2O07A 5D87A 4RFLA 5GONB 2M2IA 4BN4A 3CLTD 4YI3A 4D26A 4FW9A 4MYHA 4XSVA 4DDKA 2AJTA 5CH5A 3K1ZA 1LA2A 5AKIA 3K6SB 4MEBA 2GPWA 1UP7A 1JEQB 2ZPTX 2Q3JA 3OIUA 1Y6ZA 3HN6A 3KYDA 2WNIA 3HZZA 5HWSA 3MTQA 3SXJA 5KOHA 3I45A 4HWPA 2MMGA 3AJDA 3LIIA 1WXEA 2WTBA 2WVGA 5EY5B 4WOPA 4ANFA 1ZL0A 3OEYA 1QHHA 4K9NA 2FRVA 3GZNB 5JFTA 1A1VA 3USZA 1XZQA 2E3JA 4BUJA 2HAEA 1IOWA 5DRYA 4EY4A 2Y0DA 4LVOA 2APJA 4UVDA 1ZGHA 3ZWWA 2CVHA 2CJFA 2HPAA 2W2QA 2WTUA 3PHCA 2VJAA 4AJKA 5FTWA 3SKYA 2PU7A 2QZPA 1WU7A 4LYDA 2DFTA 1RXIA 1V5EA 1MBZA 2JKZA 2H59A 3WYAA 1YDMA 1I5OA 5EMMA 4I1RA 1W4AA 2Y1XA 5BORA 2A5FA 1CW2B 1MMFB 2HQSA 2VT2A 3QU4A 5DT2A 2ZI6A 1YB1A 1CJBA 2VL7A 4E6PA 5KU7A 5HF5A 3B1ZA 2GA8A 2O05A 4L2IA 3RUDA 1DKUA 2Z5LA 1YBMA 1U2DC 3HGMA 1OI7A 5HM8A 3C6KA 3VVBA 4DR2B 1YUMA 4TL8A 1UQRA 4XB2A 3I76A 1VE1A 1AGPA 4NXNB 1DXOA 1OLSA 1TFUA 3KJZA 4MVJG 1AXRA 1YBHA 3ESCA 3BPSA 3GHYA 3ZQJA 4CF3A 3EBLA 5LQJA 1QGOA 2C57A 2YWJA 1Z38A 2CLDX 2PSEA 2V96A 3E9CA 5JU6A 1KTIA 3K70C 2D59A 3KV3O 4TKUB 5E9JA 1RRPA 3DO6A 2IPXA 2Y0PA 2UDPA 3Q12A 3UHJA 4DZRA 4E46A 3KJQA 2GCNA 3FPBA 2R4UA 3K6KA 3LLMA 4O2AF 3Q0TA 4OQPA 1NY5A 5ADUS 1TCUA 4JC8A 5LXTF 4BIMA 2VSNA 2ZPAA 3BMOB 4GGPA 3DLAA 4FLMA 2PRSA 5BPHA 3I09A 4ZOLB 2QORA 1WY5A 4EJSB 2O4CA 3ILVA 1G2PA 3AL3A 2O8VA 4YVFA 2XUQA 5E6RA 1YA4A 4AK9A 4FHZA 4RF3A 1FTNA 1QRDA 2XF8A 2N42A 3MMZA 4KVZA 1IYZA 1GAEO 3CXRA 1K66A 4XQGA 5TSDA 2OAGA 1ZZGA 4E4YA 3SMVA 2CXNA 2JGDA 3C7KA 3MWLA 4IJKA 3F6PA 1ZUIA 3IAHA 4IV5A 4N8EA 3TIVA 3WL5A 5FI0B 1P72A 4CMCA 3W5CA 4MAFA 4WW0A 1JFRA 3Q3JB 2E37A 2VJKA 1ZY2A 2O0MA 1PQPA 1PEDA 3F67A 4KX5A 1VG1A 1HE4A 1XMSA 3LPDA 4JQZA 3N2EA 4E2ZA 4AX8A 3BH0A 3AEUA 1GAWA 2PWBA 2IC5A 2JJYA 5DNUA 4KBGA 3GJ8A 1NMQA 3JQ9A 3SJZA 3EPPA 1NPYA 1DE0A 2VRCA 3DYVA 4Z86A 3Q0EA 3T9BA 1Y8QA 3PEEA 1Z39A 5ALXA 3DL4A 4EVRA 4DSOA 3O83A 1Y1LA 2B20A 4EMSA 2XCQA 4RTQA 1ZOPA 2IEAA 3JR3A 3AR4A 1UPTA 2REQB 1QDLB 1RWBA 3KLBA 1RYZA 4TTVA 3FFWA 1OJLA 3VC3A 1N3IA 3CFYA 2QZ9A 3RYHB 4I9GA 1IWPB 2HO5A 3TD6A 3ZBTA 3ZI0A 1YT5A 4PICA 5FH9A 3OFNA 1QYIA 1SU6A 3PUVA 3WBJA 4FN5A 1NF9A 3I9NA 4QOJA 1NQUA 4ND1A 3PXAA 2NSLA 3TZBA 1K0UA 4BMVA 4B3CA 2DPHA 1E9RA 1PGOA 1RPNA 4Z49A 1VKJA 1K9VF 2BGKA 4X20A 4C0KA 4YCLA 3Q5GA 5F76A 2HRDA 2A0YA 5CLJA 4NWIA 5EUMA 1WVMA 4U7PB 1XSEA 2Y4OA 1CY2A 2O52A 4L73A 2CHUA 1O6GA 1JP7A 4RDIA 1KVSA 2NXEA 2ZB8A 4NAVA 1G5TA 3LVRE 4R1PA 3RVMA 2OE2A 4IGKA 3U0VA 1NFFA 1FRNA 4I4IA 4IDCA 4TLMB 3ZUGA 4WOJA 2HA3A 1E7WA 3GEIA 3NV7A 4M9XA 4NBTA 4O4HF 2J30A 5D6OA 3ZS9A 2GJ4A 5K0BA 1T0JB 2RB5A 1QIEA 3THOA 3B85A 2A58A 2ZCUA 3KQLA 5IPFA 5D3ZA 1XWIA 3MTEA 2JIZD 5FTNA 4RTRA 1ZJ4A 2ZJ6A 4XAQA 1A8HA 2FPIA 2C3UA 4OBXA 4AN0A 1JIXA 1NN5A 2X7XA 1JEAA 3AB3A 4V3CA 4IHQA 4P3PA 5F35A 1YIDA 1A50B 1XQXA 4GDMA 4J1TC 3DMGA 4BC1A 2DSTA 3DAYA 4TZ0A 5KDLA 4M0MA 3RUIA 3DKKA 5EZQA 2QV7A 2YMLA 4ZAYA 3P9NA 3D7KA 3L0CA 4NFSA 4EPXA 1Q92A 3LNTA 3HU2A 1NUAA 3H0EA 3TR6A 2Q3CA 3O21A 1EVQA 1CUFA 2J48A 1T9ZA 3R3JA 1GXSB 2J3QA 4Q15A 1P1BA 4E07A 3CEHA 5A0TA 4FJ2A 4BJ1A 2VK2A 3JWIA 3TL6A 3UJ6A 5I9SA 3UA4A 3CKMA 3UJ3X 2BSXA 1QCDA 2B5OA 4N0MA 3ELUA 2OHXA 5G40A 1YHNA 5TMDA 5TVGA 4N5NA 2CJPA 4YB8A 3PKIA 3RHFA 3DDZX 2QN9A 1UJMA 2G8NA 2QLMA 4CT5A 4RZIA 1X1BA 2GEJA 4P3NA 5IMBA 5EHQA 4N1AA 3UGQA 3O74A 1QV6A 4JOQA 4ARZB 1AUXA 1A76A 4F4FA 4WDRA 1ZD9A 2J6CA 3EGVA 5EPOA 3TCXB 3M4NA 4E2XA 5C8DA 2XRMA 3ZS8A 2QNRA 3LUDA 3WGOA 4MKFA 1XPOA 3ZLBA 3PNSA 2D7JA 2BM8A 1AK2A 4U7FA 3QKSB 2ZIAA 3IRVA 4EIWA 2IPAB 5JO0A 2GWRA 2R9VA 2J3IA 5JISA 3UMFA 3RVRA 5KAMA 4IZHA 1PDWA 3OT1A 4WESA 3E82A 3D54D 2GNAA 3RM3A 2O20A 1NW3A 2VNKA 7REQA 1KAOA 3ADPA 4IVRA 1NXSA 2C5LA 4K6OA 1H2RS 4V0SA 1J42A 3AY0A 4PQFA 1QIGA 3FNHA 5B1IA 3G2IA 3IEMA 1QU2A 1E6EA 1E2QA 4OQLA 3AR5A 1VSUA 1O8CA 1RADA 2ONZA 2TRSB 3LX4A 3NBXX 4RFSB 4BKOA 1WSAA 4W82A 3GG2A 2X19A 2KM1A 3KM0A 4RDHA 1GU0A 4O59O 4DQDA 3BRWA 4C08A 4MI1A 3AIMA 1ISRA 1UAYA 2VRBA 3NTRA 3NXKA 3RS5A 4JJKA 4MRSA 4PLVA 3LPAA 1ODTC 4S35A 1UP4A 1G8AA 2FB9A 2OAQ1 1OIWA 3DBLB 2A84A 4K9LA 4KUGA 3FSGD 5IU6A 2RBKA 1W93A 2J1LA 1WBDA 3I32A 4OOFA 3K8ZA 4P8RA 1EM8B 5TGTA 3LCVB 3T1VA 3AXTA 3BSSA 3DC2A 4UQPA 5EIFA 8OHMA 1XZIA 2ZRGA 1KYZA 4RKQA 1QMGA 4KZPA 2AKYA 1QGAA 2WJ6A 3O84A 1XGKA 3ZZMA 3D2BA 4F5ZA 2H2IA 2ZZNA 3TEMA 1KL7A 3N39C 1OBOA 2B92A 4CN8A 2QF7A 2EERA 3VM6A 2A35A 4BASA 4BNTA 3T5AA 4V0OA 1EE2A 2CHEA 6Q21A 3DMTA 5KQLA 2B30A 3S70A 1XVAA 2WJ4A 3I3SR 3D3JA 4EG8A 1YA6A 3RSCA 2RFLA 3W8RA 3JQ8A 2I4NA 1I30A 3NWOA 3L6OO 2P6PA 3IEXA 1BROA 4M9RA 4Y1RA 3IT1A 3OHSX 3MWJA 3SYNA 5FHRA 2ZIFA 1TIBA 3EF1A 3NALA 3Q40A