1IOZA

Crystal structure of the c-ha-ras protein prepared by the cell-free synthesis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
162
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenomethionine incorporation into a protein by cell-free synthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
total genus 56
structure length 162
sequence length 169
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1iozA00
4OQNA 2XITA 3RSLA 1RYFA 4KITB 4DLRA 4LJ6A 1G5RA 4B75A 4TLAA 5GVSA 4UNPA 3C5CA 5E4FA 3PUYA 3O8RA 3MD0A 1E9SA 3FE2A 3KX2A 4B32A 3RRZA 1MO4A 1MH1A 3V00A 2D4HA 2QBYB 1II0A 3CLVA 2F9MA 3AVQA 3QXSA 1OH7A 2YC2C 1QHSA 2ZYWX 2REXB 2NQ2C 2V9PA 1WDTA 1OE0A 5AJYA 4D4LA 2C98A 2ZE8A 4FMDF 4GOJA 2XOKD 1NLYA 4M9XA 2P3SA 4JVMA 4D81A 4L16A 4AC9A 2GJKA 3DHWC 1S8FA 3LVQE 4B33A 1H8ED 1ZIOA 2J7PD 1OV4A 1U9IC 5EE5B 1W48A 2GHIA 1NN0A 3N70A 4MGIR 2FZ4A 1N6LA 3A4NA 4ZCLA 1NVVR 4PXAA 2KBFA 2EQBA 2W6ID 2O5VA 3X1WA 1Z2CA 1R0XA 1E1QD 3IUYA 4TT3A 1JB1A 5EXPA 1XTSA 3BB3A 3FKQA 4DLVA 4LYFA 4EJSA 1HA3A 3GEEA 1AS2A 2QUZA 4PSVA 3WYFA 4AG5A 3U3RA 2CCKA 4C2UA 3PXGA 1XCGB 2OE2A 2QMOA 3EPHA 1AQUA 1MRNA 4QM7A 1QHNA 4Q7JB 5FR2A 2KB0A 3GLHA 1RKBA 1VG1A 1YRBA 2OT3B 5JECA 5J40A 1GNQA 3TMKA 3DVLA 2ODBA 1C4OA 3QVUA 5KNCA 1T3SA 2ZRAA 4PC3A 4Q9JA 2GVZC 5JJIA 1VMAA 1PVOA 3BOSA 3DOFA 1JPJA 3DMNA 2QMHA 4X8LA 3CM0A 4BLPA 4BLOA 4PZZA 4Q21A 3U3KA 4LK2A 1P7CA 1QHYA 1T8UA 2XZOA 3CNNA 5DYGA 1OFTA 4J0QA 1WMSA 2A5YB 4B74A 4H9GA 2WWXA 3WYAA 5BXQC 4DLYA 4Z51A 4MRNA 2RCNA 1U8YA 2GTPA 4RCYA 4RSGA 3IEVA 4Q19A 3W6OA 2CNWD 1CRPA 3X2SA 2GZHA 1KZ7B 3ICEA 5JEEA 5KSZA 1QZXA 1T5IA 4LV6A 5EQTA 3BB1A 5JMTA 4JMPA 4CVNA 5J4YA 1D2MA 3TQCA 4GNKA 4KAXA 3QNUA 4B2IA 3FYHA 5FBVB 3PVSA 4CGZA 1R10A 4FN5A 1JAIA 3O8DA 2NOAA 4CRWB 3MWLA 5G53C 4LI0A 1IOZA 2WOOA 3GJ6A 3W5IA 2PL3A 4UJ5A 1FUKA 1NVXQ 4BZXA 1G64A 1Z07A 1V5WA 1KDRA 3CR8A 1OXSC 4NU0A 2GDJA 3OE7D 5LD2C 2QSZA 4KYIB 4U02A 2Q3HA 4YLGA 1D8TA 4RVCA 2GJ8A 2QU8A 1GRQA 4QHYA 821PA 4B48A 4JLJA 4L9WA 121PA 2E9SA 2FDCA 3AGPA 2XTNA 4B3XA 1TAGA 2AR7A 4A2WA 4EQ6B 1XPRA 1S0UA 1Z22A 2D3WA 4M1SA 2FMXA 4DCSA 3QF4B 1UBGA 1NKTA 3ECCA 2C03A 3BWDD 3QJYA 2W2XA 3RC3A 1TF5A 4HDQB 4WXPA 3QIAA 3BH0A 4YONB 2I4IA 2J0VA 3ZDQA 2X2EA 1T91A 4DT1A 1CJTC 3LWNA 3CW2A 2JGNA 2IW3A 3SHWA 1RZ3A 4Q4LA 2QRNA 3HP1A 3IQXA 3KKNA 2OO7A 4V03A 1NNEA 2C99A 4LX0A 2AWOA 2C5LA 4ZCIA 1MV5A 3B1XA 1R5NA 3LNCA 4EFNA 2G9NA 2K5UA 2YC4C 1E0KA 4CZ2A 5KSPA 2XNDD 1PLLA 2AXPA 1US8B 3DKPA 3EPLA 4QBIA 4AKIA 2C95A 3E2IA 4BLSA 3NHAA 2O8BA 3U6KA 2DY1A 2R6DA 1EFCA 3FOZA 1QHHA 2WV9A 3GJ7A 1KI3A 3WXMA 5FUWA 4XD7D 1OJLA 2YWGA 2A5JA 4MYHA 5DHAA 4ZCMA 1TTTA 1M8PA 3DDCA 2OEPA 3GLHB 3GLFA 2OV2A 4XTRA 2NO9A 2WJVA 2DFLA 4BLTA 3ZIAD 1W49A 5FOSA 1UDXA 2ZRCA 2C77A 2Q9CA 5AWFC 2WJJA 4QJ5A 2O8EB 1AJEA 3GLIE 3ZQJA 3K09A 4TYWA 1FMJA 2OBNA 4MKGA 2YINC 3I8XA 3CRW1 1E32A 1XEXB 3B9QA 2GBLA 3VTKA 1JQJC 2ZSFA 3FB4A 2XTZA 2VA8A 5LB2A 4DSOA 1N0UA 2XTMA 2H18A 4JSTA 1KI2A 3OIVA 3HPRA 2EW1A 3JZAA 2NPIA 2WBLC 3CX6A 2C96A 3T5GA 3FWYA 1E9EA 4KYUA 1N0VC 2RB4A 3RHFA 4FXPA 1H8HD 1WE2A 1KJYA 4BLRA 3THXB 1N3BA 4OK3A 2BBSA 4KVAA 3VHXA 1Z6YA 1AKYA 1Z6GA 3U60B 2J0SA 3CWZA 3I4LA 2ZIAA 3PENA 3IO5A 5TARA 2HF9A 3FMOB 1NJFA 1IJFA 1E9CA 4Q1BA 5AJWA 2QAGA 1PZNA 3UIEA 1GVNB 2IK8A 3H4MA 1SXJE 1KI4A 5CK5A 3PR1A 1T0JB 5EP1A 3OFNA 3KKOA 4TMWA 3SBDA 4QC2A 4HYYA 2NG1A 3X1YA 1XEXA 5AJXA 1MR3F 4E07A 2DWQA 2VF7A 2YHSA 1X8KA 4Q9IA 2MSEB 5LBIA 3VU9A 1NF3A 4YQFA 4US0R 3TSWA 1N5KA 1GILA 3L8YA 5C2JB 3NH6A 3SYLA 4B3GA 2HXSA 3SFVA 1GL7A 4OK5A 1W0KA 2QROA 1G4AE 4HLCA 4IXNA 4NCIA 3TRFA 2F9LA 1ZU5A 2J45A 3WMGA 5KYKA 1TU4A 2EFEB 2GZDA 5HZHA 1G16A 2X1VA 4POAA 3VKWA 2FG5A 2RGXA 2ZYVX 1MO6A 2WZQA 4QGGA 2H7VA 4KU4A 2GA8A 2R6GA 4JSYA 3ONWA 2KBEA 2FA9A 3QPWA 4JVSB 4US2R 3NBFA 3THYA 4AKGA 2PBRA 1E96A 2QBYA 3KKQA 3QG1A 2JIZA 2Z6VA 3PEUA 1XEFA 2QT0A 4JLDA 2Z4RA 3B6EA 1IBRA 4D80A 2ZTSA 4JKYA 4DRZA 4I1OA 1IAQA 1CR2A 2HJVA 1CF4A 1IQPA 1IN6A 1XEWX 1IY1A 2ZRIA 1RYHA 2VIIA 3SQXA 3AVYA 2VH5R 2O8CA 3KL4A 3K0AA 4WZ6A 4ITRC 4C0AC 1LVGA 4RD0A 4BFTA 4QJ3A 1ETUA 1E2MA 2F1JA 1DE0A 1RVDA 3NVAA 4ZKDA 1XPOA 4EUNA 1ZM3A 1VTKA 4DXAA 4P4UA 2V3CC 5KUTA 4CF7A 1W0JA 4QFMA 4EQ6A 4QBHA 5FFMA 1G8GA 2FFAA 3QUSA 2JLVA 2GJSA 4HSEA 4QBFA 3ASZA 3B1WA 2ZRKA 3VNUA 1VIAA 2C78A 3EWAA 2ODWA 4W7SA 3K8YA 3U6BA 2WMOB 1ZJ6A 2O0JA 2BIFA 1IXSB 4JYBA 1MT0A 2G0TA 3LW8A 2GCOB 4PZYA 1GG2A 3NEJA 3U7EB 5EUQB 1XD2A 4KODA 1KYIA 1LW7A 2QI9C 1XTKA 2O0KA 1ZUHA 3P4XA 1GSIA 4Q48A 2DPXA 4NP6A 1YR6A 1NVVQ 3ZZ0A 1E1RD 1A82A 1B23P 3RABA 1IN7A 2OFXA 4DEYA 3HJNA 3GFPA 2CVHA 2QMEA 1VYVA 2REOA 1VECA 2VO1A 5FTJA 3K9LA 5CIWA 3WMFA 1ZC3A 1R2QA 3SDZA 2VSOA 4LC0A 4C7OA 3OZXA 4FW9A 1G7CA 1L7VC 1WP9A 1DO0A 4N0DA 2NPFA 3PUXA 4ACAA 3A1SA 4DUGD 4KFSA 5B57C 2FN4A 3SYKA 2FSGA 1RW4A 1D2NA 1Z6XA 3A4MA 2ZSAA 4CW7A 1JR3E 1W4CA 4IHQA 1AGRA 1M2OB 2F3TA 4GOKA 5C18A 3B8HA 1P2UA 4LOAA 3T06B 4LHZA 3CUEF 2CK3D 2ZI4A 3QPUA 4DCNA 5JSZB 3W8NA 5EUMA 2ZI6A 3PUWA 1MOZA 1IHUA 2ZU6A 2CDNA 1SVSA 3QKSB 4M9SA 1ZIPA 3OEHA 4A6PA 1FZQA 2EVWX 4X8MA 4A15A 5JI3E 1XTQA 1COWA 5JRZA 5DNYB 2OAQ1 4D4KA 1J8YF 2PZGA 2QAJA 3LQRA 1KI6B 2AD1A 4FCWA 5EP2A 1OFHA 1RJ9A 4ZIRB 1KY3A 2GAOA 1YZKA 2HEIA 3H86A 4AD8A 4PAQA 2CMKA 2P6UA 4BZQA 4RFSA 3A1TA 3X1XA 3Q5DA 3EIQA 5HCIA 4C0BA 5K8LA 1YZQA 4OK6A 5FOXA 2JLXA 1KK3A 1X3SA 1R5OA 5JZVA 5JCPA 4B3CA 1Z0DA 4HAWA 3D8BA 1HE1C 3BE4A 5HZKA 2ZEJA 3I32A 1A1VA 2ZJ5A 4B6FA 1WBBA 2YYZA 4TL9A 1KY2A 4O25A 1TX4B 1OIXA 4JVLA 3IILA 4B3BA 3SHFA 1UKVY 5JWHA 2NO6A 1SHZA 2UKDA 1G41A 2A3RA 1VG0B 3NKVA 4PHHA 1M6NA 3F3YA 4XVQA 4L9SA 3MJHA 3OF5A 3NDPA 5A4JA 1N6OA 2FX3A 3DL0A 1T6NA 4A92A 4TLBA 3RANA 1R6BX 4GP7A 2PLRA 4KFTA 3AVXA 3GLHE 4EPYA 3UMRA 3EZ7A 4PPGA 1RE0A 3A36A 4LPKA 3TBKA 2J0QA 3ETLA 1YHNA 3P4YA 5CM8B 2BDTA 2GCPA 1YZTA 4B2PA 5K8TA 1CIPA 4IDOA 1BIFA 2UZIR 3IHWA 2V8OA 3L0SA 4OKSA 3A58B 4V0MA 1DAHA 1TQ6A 1UKYA 4M22A 3GLFE 2AKAB 2ZVPX 1GKYA 2RGNA 1ELOA 3AH8A 3W90A 3A1UA 1DELA 1M7GA 2QTHA 4XD7A 1E3MA 1CEEA 4B47A 3RWOA 1LFDB 2OCAA 1N6RA 1MRSA 1OYWA 3GD7A 2F7SA 3H1TA 5CJPA 2XXAB 1TU3A 1DAGA 3B1ZA 1Z8FA 4KSBA 2A9KA 5ELXA 3C7KA 3ZD6A 4QOSA 3RAPR 1WF3A 2ECKA 1SVIA 3W6NA 1Q1ZA 4NHOA 2IBMA 2JJ1A 4PPFA 1GUAA 2GRJA 3OEEA 4BASA 2ZPTX 4G5QA 5JHHB 4OI0A 4Q4HA 4NYIR 4GL2A 3TH5A 4BGDA 3BD9A 3H84A 1OXTA 2WWFA 3AKEA 1GP2A 3THOA 1SXJB 3OEHD 4JLMA 3FKSD 1E1QA 4TT3D 1R7RA 1E9FA 1ODFA 1AN0A 3NH9A 2RGAA 4M1OA 1G3IA 5E7MA 2D7CA 3KKMA 4HAVA 4OI4A 1OHHD 3G0HA 1SKYB 3LDAA 4M21A 4NKRA 4TYYA 4BFYA 1IY0A 1FOEB 2ZSBA 3G5UA 4Q7LA 1FMLA 3SEAA 4AYXA 1AM4D 2GVDC 2ODNA 3R8FA 2VL7A 1YRAA 5DI3A 2IYSA 2NZJA 3QVVA 5SZKB 2IS6A 1DPFA 1NN3A 3AF4A 5DN6A 1KK0A 1SQ5A 2I1QA 4FMCB 3K70D 4JKIA 3HDTA 1JR3A 4B6EA 4GSYA 3BAFA 1F48A 3BXZA 4TWZA 3OFND 2GETA 4U7DA 5TVKA 3EA5A 1SVOA 3GCGA 4EIWA 5BYJA 4ILEA 4PHFA 2VSXA 3C5HA 1CS4C 1E9RA 4Q00A 4BFZA 4NPHA 2O8DA 4E03A 5LPNA 1S9DA 1P3JA 4M9QA 4JBXA 3EZ9A 1VG8A 3A1WA 4KBGA 4GRAA 4G5RA 1TQ4A 3KXLA 1JALA 5J47A 2ZR9A 1P9NA 4NMMA 4U5XA 5L3QA 1TNDA 1FNMA 1XEWY 2GESA 3K1JA 3P27A 4LV8B 1E9AA 4A8JC 3AP1A 1OFIA 2GXUA 5EJEA 3CX7A 3SFZA 4DDVA 4Q1AA 2GEVA 2GK6A 5IK2D 4Q9KA 2ZM5A 3F5FA 3NDBB 4BUJA 1CBUA 2PCLA 5CB8A 5L8VA 3PQCA 4I1SA 1FW6A 5ANRB 4EAQA 4HATA 2O8CB 3GMTA 3MMPA 3OHMA 1VCOA 4V0NA 4PAMA 2G0NA 1J70A 1GOTA 2WICA 521PA 1KI9A 1AZSC 1K8RA 3MUFA 4QHSA 2ZXUA 4RD1A 4AG6A 4ZIRA 2VP2A 2VF8A 1KIMA 3AVVA 3MWYW 3U2QA 3KQKA 1YZNA 2IS2A 1HUQA 1ZYUA 4AY2A 3MWKA 3LA6A 2BEJA 2X2FA 4M53A 3KQHA 3K0CC 4ABYA 1YKSA 4ACBA 1EFHA 4QGFA 1NRJB 4RKFA 2YWEA 4B43A 3SNHA 2HT1A 3KB1A 4V02A 2R2AA 3ZZTA 3KTAB 2OCBA 3OIWA 3EPJA 4ESVA 1CKEA 2G77B 3Q7QA 2QP4A 4P31A 1JXOA 5FOVA 1P4SA 2OAP1 2HUPA 2C8VA 4IOMA 2WSSD 2F43B 2J59A 1R0YA 4LBZA 1SHKA 2IA5A 2Q6TA 3K0AB 4FCTA 1S4QA 1ESMA 1MO5A 3SJAA 4TMTA 3RS5A 2X77A 1AS3A 3VU9B 1M34E 3BGWA 3F0TA 1Q21A 1NG9A 3EWSA 1O87A 2JATA 2EU8A 4II7A 4GPTA 1G9XA 5H70A 1NVUQ 1KO1A 3SJCA 3CRMA 5CDFE 3W3AA 4A36A 2BJVA 3UKDA 4DLXA 4MKHA 1E2FA 2B8WA 2QM7A 3PFIA 3L0IB 3V4RA 1JR6A 5BN3A 2Q3FA 4JVNA 4K81B 3ZQ6A 2Q9AA 4MGKR 1KSHA 4V0LA 2PMDA 2QM8A 4AYTA 1E0AA 2BCJQ 4HZUB 1EFRD 2FWRA 1E9DA 1KAGA 3EC1A 4RCZA 1PV4A 3E1SA 3FMIA 3GLIA 2IT1A 621PA 5AUOB 1NBMA 2CLDX 2YZ2A 3RLFA 1IXRC 2FSHA 5KSYA 1P9RA 1CR1A 4BLQA 4G5GA 3SC3A 1U8AA 1ZD9A 1YZUA 2QGZA 5EZ5A 3CRVA 3ZLJA 4C0LA 3K9NA 2QEQA 1QHHB 2G6BA 2ZAMA 1SVMA 2GCOA 1UKZA 4MRVA 1UBCA 4DB2A 4YMWA 1N6IA 2WWHA 3N2EA 4JT4A 4PC7A 4HUQB 3AV0B 3SU8A 3KXKA 4O0MA 4DSTA 2PT5A 5J4HA 4QM6A 1TEXA 4Q4AA 3EASA 1F2UA 4DCTA 2UZ3A 3O8BA 4URVR 2PH1A 4C0JA 4B3DA 2J7PA 5J4KA 3PCRB 2O8EA 5FPYA 4DWJA 3TSZA 4UXHA 2H1LA 5FBQB 2Z0MA 5FTKA 4URZR 1YR9A 3TQFA 2JDID 1W4BA 3O47A 5KOYA 2AFHE 2JJ8A 3W3ZB 1EFTA 1NN1A 2ORIA 1Q1BA 4HLUC 4OHWA 4GMXA 2DBYA 4BPBA 5IRCD 5JJKA 2CJWA 2RGBA 1J7KA 1R8SA 3MRSA 1BMFD 1XCPA 2FH5B 2Y8EA 5BW8A 2OG2A 4NYIQ 2F55A 1EWQA 3GJ4A 2R9VA 3ZVMA 2IUTA 4D4JA 4TTPA 1G19A 2QL6A 2WSMA 5FI1B 721PA 2C2HA 1KI7A 4GZLA 2O52A 1S2MA 3H2YA 1AS0A 4Q66C 1N2CE 3ZYCA 3LO5A 2GEUA 2BOVA 4IDNA 1SKYE 4PC1A 1N6HA 2YWFA 4EPVA 5AJVB 2IYVA 4YC7A 5TMPA 2IS1A 1YR8A 3DM5A 2ZI5A 5D3QA 4A6XA 2OM2A 3EG5A 3MSXA 3CR7A 4M9ZA 4TLDA 4YMTA 1XTJA 1O3YA 2FU5C 2IL1A 2VYFA 2ZRFA 1FTSA 4V0OA 2AK3A 1ZCAA 4IOJA 2QP9X 4AK9A 4F92B 2ONJA 1KGDA 2Z5FA 3BRWD 4A0FA 1IN8A 4ERNA 4OL0A 3WRYC 2ZRLA 1NSFA 1Z83A 2WPDA 2ZITA 4D82A 1Z0JA 4IJMA 1E4YA 3HU1A 5H1YA 4X8OA 2Q3MA 1FP7A 1UBFA 4E5UA 2FOLA 1K6MA 4W9MC 4LDJA 2EWWA 3B60A 3EX7C 3HU2A 2RAPA 3DEFA 2GEDA 2PCJA 1W44A 4I1UA 5G3YA 2OBLA 1T0HB 3FHOA 1Z0IA 4FWIB 4LBWA 3LY5A 5DI9A 1QBKC 1ZNXA 4LPSA 3HR8A 1T3HA 3PIRA 4PX9A 1Z3IX 1F2TB 2P6NA 4A8JB 1OXXK 1Q22A 1QHIA 4TMVA 5EE3A 3UATA 1NL3A 4PO9A 3LV8A 4M8NE 3X1ZA 4ESHA 1N6KA 4Q5IA 3KUCA 3TNFA 5JSZA 3QE0A 1KJWA 1W36C 5M04A 1KDTA 3J81k 3GPLA 3PEYA 421PA 4DVGA 3N5CA 3BBPA 4DDWA 3PEVA 4JLVA 1D5CA 2QP3A 2KE5A 1UDWA 3K09C 1W0JD 1F2UB 2R44A 1IM2A 5G41A 3PJRA 3GEHA 4P33A 3UMSA 1U9IA 4C9BA 3PUVA 1U94A 3AUYA 3I73A 1IY2A 4LZZA 1SKQA 4Q47A 3ZH9B 2KWIA 1Z0KA 2AWNA 3VR4A 5F98A 1XNJA 3LX5A 4DEXA 2W6JA 3LH5A 3T1VA 2OCPA 2VHJA 1KI8A 1OFUX 4V0ME 2WWYA 4NCKA 2A5DA 4MDEA 4JL5A 2CLSA 4OI2A 4HAUA 3KQLA 2CHGA 4TYQA 1MABB 5TB5A 4XWAA 3SS8A 4O3MA 3AKCA 4IFBA 4PSAA 1KHTA 4EPXA 3ADBA 3GLGB 4F38A 5AUPB 1BKDR 5CDFA 5HR5A 1YJ5A 2IYLD 2GF9A 1JI0A 5HE9A 3U3OA 2JJ2A 1CR4A 3QKUA 1P2SA 3UMFA 1FNNA 2ZANA 1DAEA 4GP6A 5UKDA 2PEZA 2BV3A 1WXQA 2RHDA 3AGQA 3UWKA 3K0FB 4CEJB 3AVWA 1W4AA 2IXFA 4WOPA 4Q9LA 4PR0A 5FPTA 4C3ZA 2VHUA 4ZDJA 3DMDA 2ODEA 4MRPA 1Q0UA 3VR6A 3ZVLA 1UJ2A 2R8RA 1G3MA 3IIJA 2HXYA 5JJLA 4XVRA 4PZLA 1L4UA 4LYHA 1FPMA 2H17A 2IXGA 2QN6A 5G3ZA 2JA1A 1XFAA 2ZRHA 3GJ3A 2XOKA 5P21A 5FR1A 3QI2A 5F9FA 2W0SA 4BEJA 2RMKA 2VP4A 1CP2A 1CU1A 1OPXA 5KDOA 3RS3A 2RGGA 4Q1FA 1ZW6A 3T12A 3BJIC 2WM9B 4KLZA 5HKKD 2QT1A 1AQYA 4H1UA 2ZREA 3QF7A 2BCGY 1KNQA 2AK2A 2BMJA 2V7QD 4RD3A 5IF9A 5JI2E 1J8MF 3ZD7A 4AURA 2V54A 5F3WB 1UEIA 1KTVA 3MAAC 2VPPA 2XX3A 3W9YA 5HCNA 4UQOA 1E69A 2DHRA 2IUSA 4BECA 2FFQA 4Q18A 3EPKA 3LX8A 1GNRA 1OB2A 1EX7A 1NN5A 4MQBA 3U44B 2AKYA 1G21E 1LS6A 4HUTA 3PEWA 2IEYA 4URWR 2AN9A 1V43A 3ZZUA 4MITA 3QXCA 5CYPA 2PZFA 3AKDA 2F1RA 5B64A 1KDOA 5JS7A 3TUIC 1W1WA 5KO2A 3HYTA 4G5SA 1G5PA 3ZGXA 1TMKA 1XU4A 2B6HA 3HR7A 5D3MA 3IDQA 2P5SA 1Z47A 4OHZA 4LSGA 3DO6A 4MGYR 3AVOA 4ASUD 1ZMXA 3BERA 1KO5A 5TXGA 2BKEA 3RDPA 4LGMA 3O8CA 2FV8A 5A0FA 4CEIA 1W0KD 3ND8A 1ZNYA 1T3LA 4TL6A 4TLCA 2UVQA 3NHBA 3HPQA 3CNOA 1HQYE 4MUBA 4OQLA 2BVNA 5CJ2A 2JAQA 5DO9A 4EFMA 4NONA 2H5EA 4PFSA 2JIZD 1XB2A 4A1FA 2FGKA 1EK0A 4MYTA 1R0ZA 3OIUA 3I5XA 3GQBA 2VQSA 3NWJA 2XXAA 4ZV4A 1OXUA 2P65A 2YV5A 2EYUA 3U7HB 4Z8XA 4BEBA 3AP3A 3R8CA 1RPZA 1E0JA 2VHCA 2W58A 4KV9A 3R7WB 2O8BB 1CJMA 1ZD8A 3CH5A 3QPVA 2HLDD 4OHXA 4C0HA 4QHTA 1F6BA 1R5BA 3G82C 1D2EA 1XP8A 4LBYA 4DB4A 2ANCA 2RGDA 3FFBA 3NBZC 4K46A 3R9WA 4QXAA 2IEZA 4HB4A 1U0JA 4WVFA 3LQQA 3K53A 4H1VA 3ZS9A 4EJSB 5JCZA 2PX0A 3RNLA 2GBLC 1ANKA 5AUNB 5L3RA 3A4LA 1XD9A 2E1RA 5GJVC 5BWMA 2QG6A 4Q7KA 2W00A 4HLQB 4PANA 3LVRE 3SBEA 1FFHA 3KJEA 2PZEA 2QE7A 1XTIA 3U7FB 2GZAA 2ZRJA 2QGNA 3OIYA 1GKUB 1UKEA 1S1CA 4KSCA 4QRHA 2A7QA 1CRQA 4QNMA 1D9ZA 5D3MB 4YXWA 1G1MA 2OFWA 3QXJA 1P6XA 2BJWA 3CH4B 1G3RA 2ZJ8A 2DFTA 2XJ9A 1YZGA 2W0MA 3VR2A 1C9KA 1S3GA 4JJKA 1GL9B 1Z0AA 1U99A 1B0UA 4URXR 1I4TD 2FFBA 3UPUA 4Q03A 3VFDA 2RGNC 1PJRA 3CZPA 4RFVA 2O8FA 4EDHA 2JLYA 1E2JA 1HTWA 3HYRA 1SVLA 5B30A 2ZQ5A 2CBZA 2CE2X 1Z08A 1J2JA 1G8HA 3FPAA 1G18A 3NBXX 3REFA 1Y3AA 4EKDA 1DG3A 2F43A 2R6CA 4KVGA 1XF9A 4YDSA 4MGZR 3U5ZB 2Z4SA 3PV0A 2JLWA 2VRWA 2IXEA 4URUR 3T15A 2ZRNA 1JBKA 5DISB 3I1FA 4WW0A 2PJZA 3QXHA 4TTRA 4TZ0A 4R2IA 2VP9A 3GLGE 1U90A 4IVPA 4LHYA 3EW9A 5DIFA 3LRPA 4F4IA 1DG1G 2R6AA 3ZIAA 1NLZA 3LXXA 1KAOA 2IHYA 1UADA 3EC2A 2RGEA 1W5SA 1WA5A 4MUAA 1EFUA 4A9AA 1E0SA 1NMXA 1GFIA 2P0EA 1E2PA 3CONA 1ZUNB 3NBYC 4NYJQ 3CPJB 2D74A 2XNDA 4UKDA 4DLZA 2PMKA 3WBJA 2IC5A 3SI7A 4Q9HA 4WAUA 4R71A 2WTUA 1X6VA 3JVVA 4OI1A 3BH6A 3K0EA 4FMBB 2ZJYA 1ZINA 2G83A 1XPUA 1E1RA 4QGAA 3SZRA 2WIBA 3NTUA 4HLUA 3AF0A 4O2LA 4O2RA 3M0EA 1WBDA 4DCUA 1FP6A 4LWZA 2MMGA 4BRUA 1YZLA 2OSBA 4PQFA 4XWOA 5LD2B 3CF2A 4BZPA 5KNDA 3K0FA 4GBMA 4GI7A 4IRUB 1TPZA 2BMDA 4PHTA 2ZAOA 3BIFA 3AP2A 1ZNZA 1G6OA 221PA 3NIBA 5FTMA 3LAWA 3WNBA 4B2LA 1DAIA 1HH4A 3D3QA 3EA0A 4PPNA 3W6PA 2N46A 1G6HA 5DI3B 3QEOA 4U00A 1RRCA 4B73A 2J3EA 1SGWA 2A2ZA 2FFHA 2JLUA 3EZFA 2O0HA 3IEUA 1YR7A 5FOWA 2ZU0C 4XVUA 2O8DB 1SXJD 1T8TA 1UPTA 2I1VB 1KSJA 1LB1B 5JWRA 4DLUA 4LYAA 3IGFA 2E87A 4JLKA 4PO8A 2MMCA 2EFGA 3SR0A 4ZDIA 3LW7A 4Z1MD 4ARZA 4R98A 1FL9A 3LBHA 4FD2A 4I1VA 5GJCA 4AKEA 1CJVC 5EXSA 1FQJA 3U3MA 2QE7D 1I2MA 2WHXA 1Z63A 4E22A 1X86B 4PC2A 1KK2A 4A0RA 2AD5A 2CNWA 2HDNB 2FPKA 2HF8A 5C46F 1A7JA 1T9HA 1OF1A 3NC1C 2ZE7A 4LHVA 1GRNA 2ZUBA 3A37A 4G5OA 3L8ZA 2OCYC 1I4DD 1N5JA 4HAZA 1R4AA 3GFOA 1G8YA 1Q3TA 1UM8A 2VEDA 1FUUA 3Q3JB 2WOJA 3UG6A 2ERXA 2GNOA 1X1SA 4BWYA 4A2PA 4G1UC 1DAFA 2XZPA 3OAAD 3U4QB 3RC8A 2P6RA 3B7GA 4ZPXA 4A4DA 3GFTA 1EG7A 4CEHB 3KFVA 4Q4HB 4DBLC 2CEAA 2BKUA 2QENA 3Q8XB 3QXXA 5FBRB 4D0LB 1DAKA 3Q5EA 3GEIA 1SXJC 3U7GA 3R9IA 4JS0A 5FUVA 5TY0A 2HYDA 3D6TB 2YJTD 4KHZA 2J5XA 4RZXA 1GNPA 4QG7A 1OT3A 4TMKA 4UNSA 1KO7A 3L0OA 3RYTC 1E4VA 3B9PA 4ZO4A 1NMZA 5FUYA 3UANA 2ZE6A 4NDZA 4LJ9A 3ICQB 2W2VA 1BO6A 2V1XA 3AB3A 1HT2E 3A8TA 5DE3A 3T61A 1U0HC 2REBA 3BS4A 2XZLA 2NMVA 4YMSA 1P62B 1OLOA 2P2LA 3ZJYA 2JEOA 1TUEA 2QQEA 2ZI3A 5B2ZA 3R20A 2OZEA 1GAJA 3WHLA 2SHKA 4PO1A 4Q02A 2WAYA 2ZR7A 4M1WA 4KCGA 2ZSEA 5AUQA 4PQRA 2MSCB 3BC1A 4PTLA 4R2HA 5B58C 2JLZA 2C04A 5FPKA 4DDUA 1BH2A 3MFYA 1ZVQA 2GILA 2QZ4A 2FPLA 2QA5A 4UNNA 2WKRA 5KPDA 3CX8A 3VAAA 3VNVA 1NKSA 3PG5A 3K70C 1E2LA 3L43A 3AF2A 1Q1EA 1G7SA 3MG9A 2ZE5A 1KDPA 1KI6A 2BEKA 2BWJA 3GJ8A 3U61B 1HT1E 5DN6D 4S35A 2EYQA 3P32A 4HI0E 2AXNA 4BFSA 1IONA 2CCGA 2CL0X 4DLWA 2IYQA 3FGNA 2AHOA 1G8FA 2R65A 1GTVA 4QL3A 1EX6A 4XTCS 4DT1B 4P32A 5JWOA 2FF7A 3KXIA 4PPQA 1VHTA 3TJZA 1F5NA 4FI3C 3REGA 2QQ0A 4IDHA 4ASUA 4BFWA 1FX0B 1AKEA 1PUJA 1OHHA 2ANBA 1ZNWA 1M74A 1E2EA 2ZUDA 4WBSA 4X8HA 1OKKD 3TSOA 1JXMA 4I4LA 2BBTA 3QF4A 3QY0A 5E95A 1RRPA 1G3QA 2CCJA 4P4SA 1OIWA 1QF9A 2ZRGA 2ORWA 5AK0A 2RH5A 1UF9A 3K9GA 2A5GA 2GK7A 4IDPA 2IWHA 2DB3A 2QPTA 3I72A 1I4LD 5E7JA 5BQ5A 1KOFA 1VDZA 1M7HA 2QAGB 3LLMA 3EZ2A 4TZ6A 3VKGA 2GWHA 4K8OA 4B71A 2DR3A 5DHFA 3FFAA 2QSYA 3CF6R 1P5ZB 1G5TA 5CIQA 1E2IA 2J0UA 4P3YA 4BQSA 1W46A 3LBIA 3DKVA 3QG5A 2EWVA 2KSQA 3N2IA 2F1HA 1RC8A 5H68A 5SZHB 2CE7A 2PX3A 4CIDA 2ZUCA 3QKRA 2MSDB 3PITA 5GJWC 5HE8A 1MO3A 2X8AA 3IO3A 2W83A 3S1AB 5DYIA 1BOFA 1XXHE 5TV2A 3BFKA 3IBYA 3TLXA 1II9A 2WWWA 4TQAA 3EXAA 2CK3A 3BK7A 4URYR 1G291 2B92A 1CULC 4F93B 2WJYA 4OHVA 3T34A 3CWQA 3C8UA 1JJVA 2KJQA 1G7RA 4HDOB 2CL7X 4ZI2A 2X19A 4OQFA 1AA9A 1TQDA 3AF1A 4P0TA 4RY2A 1G17A 2J1LA 2GXAA 3TIFA 3VQTA 5L3SB 2ZYUX 3LXRA 4KI0A 1VPLA 5C1BA 1DBSA 1E2QA 3T1OA 1W47A 4XSGA 4HEJA 2QMUA 2D7DA 1XXHB 3KUDA 1QRAA 4YXWD 1DVRA 2IYXA 4M2LA 4TYPA 3R7WA 3D31A 1HV8A 1EGAA 3NG1A 5BN5A 3IQWA 2WWGA 1OIVA 1RFLA 1OW3B 4XWKA 4NCJA 3TK1A 5L3VA 3ADCA 3B85A 1E2NA 2JJ2D 1DEKA 1NIPA 2OFOA 3BFXA 4RJLA 1CTQA 2XSZD 3CIOA 4Z54A 4MKFA 1NBMD 1NSTA 4TMZA 1PUIA 2ZJZA 2DWPA 2NGRA 4HZIA 1P9WA 2V55B 3OE7A 2EFHB 4JIMA 3CRRA 2ZROA 2D62A 4NYMQ 2LWIA 1US8A 4N0EA 4IXMA 1G8PA 1CJUC 1E79D 1G4UR 5BYKA 5JLJA 3IPXA 3KQUA 4C2TA 1NBME 3SN6A 1OXVA 3AVTA 3L82B 3K9HA 1P72A 1X8LA 5F9HA 2BBWA 1X1RA 5CLLA 2NO0A 3MGCA 3V9PA 4NCNA 5BN4A 1XXHA 1N6PA 1KKMA 2OLKA 5L3QB 2BM1A 1OH8A 1OSNA 5HPYB 4DLTA 3LD9A 1NIJA 1ZAKA 1ZBDA 3HU3A 5FH9A 4GT1A 2BHRA 2D06A 3AEZA 4DCVA 3PUZA 2ONKA 2LKDA 2GJ9A 3CBQA 3L2OB 1EFRA 3D7MA 2CVFA 2J46A 4C0QC 4RD2A 1FTNA 1ZM2A 3WY9A 5HKKA 1SULA 2IX3A 1U2RA 1N5LA 4R9UC 3UK6A 3U44A 2V7QA 4IDQA 4IW3B 3SOPA 5JBQA 2DFKB 4A82A 4MKIA 3KKPA 3X1DA 5J4VA 1ZP6A 1XMVA 2ZJAA 2D2FA 4WA7A 1YQTA 3P20A 4PC6A 3QBTA 4BRWA 4XIGS 1II8A 4L8GA 5C4GB 3S1AA 1GIAA 1UBEA 1A2BA 3K70B 1GKIA 1D9XA 3M4YA 4Y0AA 4B34A 3SQWA 5J5CA 2A30A 1XCMA 3TR0A 3A6PC 3THWA 3KJGA 1JJ7A 4B3FX 5SZJA 3QKSA 5AR1A 2FE4A 1JR3D 1AGPA 3ZVNA 2PLFA 3QBVA 5DGXA 5H8WA 5TDHA 2XJ4A 3FKSA 4F4CA 4QJ4A 3WMEA 5IDVA 5SZIA 2ZVQX 6Q21A 4XJXA 2WIAA 1YU9A 1OH5A 4NYMR 4Q1DA 5C4MA 1TF7A 3MJRA 3LLUA 2EFDB 1XTRA 1GZSA 3I3SR 4LJ8A 1FX0A 2IYTA 2ERYA 2I3BA 2J9RA 2WPDD 2YWHA 4GMDA 4A0HA 2BM0A 1VYUA 3GJ5A 2ZS9A 1JECA 2B7BA 2ZYTX 1GWNA 3VKHA 1Q20A 1HEIA 4G01B 1KO8A 4HAYA 5F2EA 3B1VA 4AYWA 3T1TA 4OQXA 1GL6A 2OESA 3RRMA 2VTKA 3CF0A 5GVRA 4YMUA 1NY5A 2OXRA 2HJGA 5FTNA 1DTSA 3L0PA 1H8HA 1CXZA 2CL6X 2XSZA 4PHGA 4AIIA 4I99A 4D0GA 3B78A 4GDFA 1TEVA 5EE1A 1CLUA 2FEMA 4BE7B 3ADDA 2J0UB 2BMFA 2C9CA 3CPHA 4KLNA 5CK4A 4HB3A 4TSFD 1XRJA 3LFUA 4BFXA 4L15A 2KI5A 4QNRA 3WHKA 1XMSA 2FJUA 1TF2A 1ZD1A 5FPSA 1YE8A 1H8EA 3DZ8A 4JLNA 3WBKA 4TN1A 5LDDC 1NY6A 3ZVRA 4CT5A 1ZM7A 2ZETA 1OB5A 1UFQA 3GLFB 1NG1A 1LF5A 4RKEA 2CLCX 3DZDA 5EZ6B 5KDLA 2W6IA 1N5IA 1P61B 1WQ1R 5JHGB 4XOIA 3AF3A 5IK2A 1F3OA 2Q9BA 2QY9A 1XDBA 3UG7A 1I2DA 3TAHA 1KNXA 2NZ8A 4JJZA 4M4SA 1LS1A 1A2KC 1HYQA 4NL4H 4RZ3A 3VMFA 2C9YA 2ATXA 3RRNA 3AM1A 4MDFA 4FINA 2CHQA 1W7AA 1W36B 3AQ4A 4G3XA 1S9HA 2IYWA 2JCSA 2GF0A 2QPAA 4EPRA 1DADA 3IIMA 2CJWB 3VX3A 4F4JA 4FMCF 2GCNA 3Q7PA 5CYOA 2HCBA 3WNDA 4C0SA 1DO2A 2P67A 3THYB 1VHLA 3ADKA 1VG9B 3P1JA 2LCFA 2XGJA 4NZYA 1XMIA 5FL7D 1OH6A 4TL8A 1KSGA 3SJZA 4C4PA 3QKRB 2ZS7A 4DC9A 4DIDA 2ZS8A 3NXSA 2YOFA 2VLIA 1U8ZA 1G3UA 1E99A 2YOHA 1XWIA 2GXQA 5KPJA 2FSFA 2TMKA 4DJTA 2H8KA 3IHLA 4NYJR 4N3NA 4LCBA 1KMHB 4TTQA 1QHXA 3FVQA 1Q44A 3MCAA 4DIEA 1Q12A 4FWTA 4GZMA 2EFCB 1DS6A 2NTYC 4RD6A 3C16C 1R0WA 4LJYA 4Q7MB 2IF0A 2L0XA 3IBGA 2JJ1D 1TQ2A 3KQNA 1U0LA 4Q4AB 4MRRA 1ZUIA 5FBWB 4UNRA 1LV7A 4HUQA 3ND9A 4N1AA 3NC0C 4RD4A 4R7ZA 4ON9A 3GLGA 4UNQA 3VR1A 2ZRDA 1EXMA 3R9XA 2Z83A 1QG4A 4D4MA 1VCIA 3EARA 4DLSA 2NO1A 3THWB 3ZS8A 1KZGB 1Q3HA 1U81A 1DOAA 1Y63A 2JDIA 1AK2A 1F2TA 2G1KA 4TL7A 3QOFA 3CKLA 2FNAA 3V4FA 4A8JA 2YNMA 4LJAA 3SJBA 2ZRPA 4CEHA 4C7OB 3K0CA 2VHQA 1IN4A 2Q0HA 2QAGC 2Q21A 1Z6AA 1BMFA 5KSOA 2J41A 1YVDA 3KJHA 1II8B 4UXJA 5KTYA 1QVAA 3W34A 3TUZC 3KB2A 4HZUA 2IYYA 4MRSA 4Q01A 4TSFA 2PJRA 2ORVA 2N42A 3RWMB 4JLPA 3WP0A 1GITA 4P4SB 2WWIA 1R8QA 3C15C 2BBOA 3BFVA 3QQ5A 4NTZA 3FMPB 3M6AA 4JLAA 5EE0A 1VYTA 2ZR0A 2WJHA 1KJZA 1JQLB 4B76A 4DKXA 4JLBA 3TVDA 1H65A 2G88A 1CJKC 4LHWA 4Z1MA 4MYUA 3RS4A 2WKPA 5DH9A 4BFVA 3M1IA 2ZSDA 2QNRA 2NO7A 2JLRA 3RRYA 2YVUA 3I8SA 1G7TA 1P73A 2J7KA 4NBSA 3T5DA 2DCUA 1XZQA 2C9OA 4S2EA 4GOXA 4V0KA 2H92A 2ASEA 4XSHA 2AL7A 1E2DA 1E2HA 3CRQA 1KI1A 1G20E 4Z8YA 2IWRA 3I92A 4B44A 2IF2A 4P4TA 3GLIB 3SE0A 1L4YA 2RGCA 3RSOA 2V1UA 4TMXA 1PLKA 1K5GA 4D2IA 2ZJBA 3C14C 4OJQA 3IPYA 2QPOA 3QSYA 2QTFA 4DUGA 4LJ7A 4L5BA 5FPHA 3TW8B 1S3SA 1KO4A 1ZM9A 3K0SA 4CYMA 1X8JA 2W2TA 4I81A 5FL7A 1W4RA 4EFLA 1P75A 2RKOA 4FCVA 5FBLB 4DZZA 3TAUA 3UWOA 1E79A 1HY3A 2GAAA 4HAXA 4LY6A 4M1MA 4WZBE 1L8QA 4Q4JA 3TGPA 5L3SA 2HLDA 1BS1A 1RRFA 4Q1CA 4M0LA 4IEIA 2VSFA 2IS4A 2JLSA 2QORA 4B35A 2VBCA 4KO8A 5IT5A 2GJAA 5KU1A 2WJGA 2FGJA 3GJ0A 2A5FA 4PQYA 5AJZA 5DSZA 2Z43A 4Q4JB 5EXTA 2J87A 4C30A 3T1QA 4AKHA 1SVKA 2DFNA 2DYKA 2ATVA 4IKEA 5EXXA 5A5GA 4Q1EA 1IJEA 3VR3A 1COWD 3HWSA 4KFUA 1E6CA 2R6FA 1LY1A 4TYNA 1E94E 3UXMA 2FZLA 3FHCB 1XZPA 5FL3A 1U98A 1P60A 2BC9A 1GDDA 2R62A 2WVJA 4IFEA 1TL7C 1XD8A 4HB0A 4Y0VA 4QKQA 5LB4A 4IVRA 4MYCA 1GRRA 2P5TB 4BFUA 4JZKA 1KK1A 2YKGA 2ZRMA 1S96A 4JL8A 2GKSA 2XEXA 3BORA 4G0NA 1Q57A 1MABA 3F8TA 3E70C 4GFDA 1AIPA 5CLQA 1N25A 1RJ9B 4W5HA 3LBNA 3ASYA 4EPWA 3VR5A 1JNYA 2WKQA 4D25A 4KXFB 2RHMA 4LUCA 2NIPA 4D26A 2CHVA 4D0NA 4AI6A 1MKYA 4KFRA 3IIKA 4JYCA 3CB4A 1RIFA 4M1YA 5GADl 1E98A 4L4UA 1Z2AA 3C41J 5E7IA 3OESA 1BYUA 4A2QA 2HYIC 5EE9A 2ZJ2A 2AFIE 3BB4A 3KDSE 4PSKA 3TR5A 1K5DA 4CEIB 3AVPA 4W5WA 1JEEA 1TUIA 1XD2B 5G40A 1OKKA 1Z5ZA 4JT2A 2B8TA 3RS2A 4KJZA 1QHGA 1A5TA 2VHTA 1CR0A 2OLJA 3EAQA 4FIDA 3TE6A 4ARZB 3B2EA 4MA4A 1LF0A 3TVTA 1A4RA 1M7BA 1ZU4A 2CXXA 2N1BA 4QBGB 2IYRA 3I5YA 2D2EA 3C4JA 1Z0FA 2OXCA 2VP5A 2HT6A 5HTKA 1E2KA 4US1R 3MWJA 1Z6TA 3B13B 4M1KA 4UXIA 4A0GA 4AWXA 4ZI3A 4JBYA 2OILA 4LV5B 2WMNB 3TUJC 4LC1A 1HE8B 2AX4A 4LJ5A 4TQUS 4F91B 5CB6A 2F6RA 3A1VA 5JEDA 2V4ZA 4RZ2A 3RS7A 2GXSA 3WNCA 4OBEA 4LYJA 1HURA 1N6NA 2WJIA 5FOUA 4LHXA 4RFSB 1BYIA 3OEED 1D6JA 1DARA 2OUKA 1P2VA 3EIEA 1SXJA 3GP8A 4TLEA 3VHLB 2H16A 1KMQA 4DHEA 3QKTA 4ZDKA 3VX4A 4D6PA 4IOLA 1JPNA 2XNSA 1DAMA 4LRWA 3RS0A 1T4GA 1XX6A 2IYUA 4LJ4A 3I61A 4YDHB 2V6JA 1EWRA 1NVWQ 4DSNA 5JS8A 2H57A 3CNLA 2A78A 2QTVB 1LNZA 3B1YA 1ZRHA 5KNBA 3T35A 1P2TA 1ZM4A 1SVWA 1XBTA 3W5JA 5JRJA 3FHTA 2FEOA 4F7WA 2XB4A 4EJSC 4PAOA 2DWOA 3WYGA 3W8RA 2XAUA 3DOEA 8OHMA 3WRXC 1EESA 5JFGA 3TW4A 3U4QA 5DLQC 5K8UA 2O8FB 1NJGA 2F3RA 2ZJOA 2IYZA 2V6IA 4HDCA 2OBMA 1M1YE 3Q9LA 1ESNA 3SYNA 1TADA 1OYYA 3Q85A 4NH0A 4OJKA 2ZRBA 5FTLA 5EP4A 1Z28A 1F60A 3B5JA 3TKLA 2BMEA 3AUXA 3B82A 2XB2A 3JVUA 4W5JA 2IUUA 3P26A 1Q1QA 2HCJB 1QVRA 3QEJA 3EZ6A 1XJCA 1VKJA 1FQKA 4OYHA 3AVUA 1Z06A 2HV8A 4ZDWA 1NLFA 1W36D 1IXZA 5FUXA 4IOKA 4IEEA 2PT7A 1WRBA 5E3HA 2B7CA 2PEYA 4HB2A 3IKJA 4RZUA 5IHPA 1C1YA 3NEYA 4CDGA 3QENA 4IVQA 4E09A 2QRZA 3THXA 3Q72A 5CM9C 1NP6A 1ZCBA 2ZI9A 3BH7A 1NMYA 1UAAA 3AKYA 3MLEA 3CO5A 2VP6A 1KKLA 3FTQA 4M1TA 1WB9A 4HLDA 1T5LA 1Z29A 5GJBA 2YOGA 1NI3A 5J4LA 1JAHA 1W5TA 1HQCA 2W6JD 3DM9B 1QG2A 2WAXA 4DDTA 3JZMA 1ZC4A 2G1JA 4JLOA 3OAAA 4CEJA 4CT4B 3CPEA 3KFXA 1L2TA 1RRGA 4OQMA 2FSIA 1UEJA 4NCHA 3I62A 2LKCA 1IN5A 5KHOC 3CZQA 5FI0B 4EPTA 1VCMA 2B21A 4WXRA 4ZKEA 4OHYA 3KJIA 3RVBA 2WSSA 1J90A 4MH0R 1W2HA 1W2GA 4XH9B 4QGHA 1J99A 4FMDB 3KZ1E 3DPUA 1PLJA 2F1IA 4WIAA 3FMFA 1JEDA 1XJ0A 1GM5A 1WCV1 4DSUA 1ONBA 1XMJA 1E2GA 1E9BA 4WZAE 4JL6A 2VP0A 1SZPA 1LTQA 3E5HA 5CITA 3KTAA 4YMVA 1KSFX 3H0KA 1XJQA 3U3JA 1VCNA 1AZTA 2JASA 3GJXC 4LBVA 5FOTA 5K8IA 4NE2A 4JBWA 1KMHA 3WP1B 4TQ9A 1VIYA 2JLQA 4C0KA 5KDDA 5EP3A 4UJ3A 4KBFA 2OHFA 2IHBA 2FPMA 2ZI7A 3EIHA 1QDEA 2G3YA 1N0WA 3FDIA 1S1MA
chains in the Genus database with same CATH superfamily
2BTOA 4KPFC 2XITA 3DZCA 5BMVF 4FS8A 1RYFA 2PU5A 2V97A 4B75A 3HVJA 4H7EA 4RIFA 4TLAA 5AKIA 2WKSA 5CFNA 2YV4A 5GVSA 3EYAA 3PC7A 2EEZA 3C5CA 5E4FA 2NNLD 3LP5A 4AY6A 3KX2A 1MBZA 4RW0A 4PVCA 1MO4A 4Y6PA 4N9WA 3V00A 2WKWA 3NIWA 1II0A 3ED1A 5JIBA 2F9MA 1Z37A 3AVQA 4WOBA 2ZYWX 3ZHQA 1L1RA 2REXB 1EVLA 4N5NA 1JJIA 1KEEB 1A9XB 4FXOA 2V9PA 1IH8A 4HYQA 4JJAA 5AJYA 1CR6A 3M3PA 4FMDF 4UCWA 2WHQA 2VRCA 1YDHA 4CQLA 4L16A 1SN7A 1BW9A 3DHWC 1ZIOA 2R48A 3RSSA 3G0OA 4IIHA 4OJTA 4LQCA 4F3TA 2OV4A 1I9GA 4QUJA 4MQFB 3VR3D 3N70A 4YT5A 2JFHA 5K01A 2FZ4A 1N6LA 2JFFA 2JFGA 2I3DA 5GV7A 3WBBA 2DXIA 3L0DA 4KDRA 4DC0A 2I66A 2W6ID 4LF9B 4LJRA 2AJBA 2O5VA 2HA4A 2I2DA 2XAAA 2XWQA 3GNTA 4H16A 3TRIA 1PJAA 3M89A 5HSGA 1JB1A 3AFOA 4UD6A 5FWYB 5IAEA 1PV2A 4URHA 1HA3A 1T9AA 3LPNA 1VE9A 3BK1A 2X5OA 1F5SA 1PFYA 2R8XA 2CCKA 4GPIB 3U3RA 5BMVB 3PXGA 1XCGB 4FQ7A 2QMOA 3ZHXA 3JATB 1GYPA 1Q0HA 1YRLA 5KYYA 1DC3A 1NXWA 3WIEA 3KQVA 4LHSA 3CLUD 2C0PA 5DBHX 3U4AA 3L93A 2LR0A 4P35A 2VXCA 4YAWA 1S2DA 2Q07A 3CEAA 5EMLA 5FR2A 2PKQP 2COEA 4DUYB 1VG1A 1YRBA 5GPBA 5JECA 3D4NA 1GNQA 3TMKA 4MVCA 1O6BA 1C4OA 1UC9A 3R3YA 3L6DA 2GVZC 4Q9JA 1KBZA 4NY1A 3ZN2A 1O95A 4EBBA 3IE0A 1YAHA 5A4IS 2WJWA 3CF4G 5KTPA 4CV2A 1B3BA 3D2LA 3TFQA 1WXDA 3J81A 4YGXB 3CFYA 3L6RA 3M5PA 5IMSA 5HF5A 2PO7A 1P7CA 4AMGA 4PYJA 3CNNA 3UNXA 4CCAA 1OFTA 4WBNA 2A5YB 2WE8A 1FXWA 2YQ5A 1V4VA 5CT5A 4YAIA 4OVKA 1L7AA 3C7DB 1N2EA 2GZMA 1QORA 3F6BX 1K06A 1GSAA 4LI3X 4DLYA 1QFMA 1QWOA 2ODQA 3FYUA 1NF9A 4OHMA 3UEOA 5LJIA 1BQ3A 4RSGA 5DZSA 3WFZA 3IEVA 1ISFA 1KYQA 1IZ9A 2ZB2A 1BXZA 4FT2A 1VJGA 1QZXA 1RXEA 2CUZA 2O8NA 4OLBA 4RKQA 3JALB 4LV6A 4Y1GA 4CQMA 1TO1E 2EZUA 4JMPA 1D2MA 1U7UA 4GRIA 4GNKA 1DC4A 2QW1A 1QB8A 3QNUA 1HT0A 1ZXLA 2FSUA 2WW8A 1NQ5A 2BFDA 3FYHA 4CMIB 5ESDA 4EJMA 2X42A 3I9OA 1JAIA 2X7XA 4G0MA 4CRWB 4YH1A 5G53C 4LI0A 1N75A 3IBSA 3JWEA 3X0DA 3SCZA 3TPCA 4NG5A 4JA0A 4JXZA 2Y0PA 3T0GA 4EVQA 4XCXA 1FUKA 4MULA 4ZQGA 1RS0A 3PSAA 4NHEA 1IOWA 4R05A 5EZYB 5A4AA 3CR8A 1PT7A 1XK6A 2AJCA 2VRBA 2WILA 1QDUA 2GBFA 3OE7D 1PR6A 5EZQA 3D0OA 1LDNA 2QSZA 1E3DA 2I7VA 4KYIB 2Q3HA 4YLGA 5LBUA 1BROA 2RBKA 3LTEA 3QLVC 3S6JA 2GJ8A 3KJFA 4RF4A 2QU8A 4QHYA 4R2WA 3OOHA 5DV9A 5TEVA 1T35A 2HHCA 1Y4AE 1EVEA 4B48A 3HJHA 3ILXA 2HGSA 3AGPA 2XTNA 5DTQA 4ND3A 4UC0A 2I6SA 1FSZA 3C8MA 1XPRA 5LMNB 1Z22A 4M1SA 5DTMA 2HW8A 1XZKA 4NEHB 3ZV5A 1FJGB 1YL6A 2LP4Y 3ECCA 2DSTA 1LPBB 3BWDD 3HXPA 4QASA 2W2XA 4YAFA 3OM0A 3G2JA 3F74A 1ZS9A 3P9XA 4H15A 3ZDQA 3QV1A 1ADJA 1TVKA 2X2EA 1ZOSA 3ELDA 4KTVE 1ST3A 1E1NA 4DT1A 5LD2C 1WUHS 4D3FA 5IDYA 2IW3A 2W4IA 3ESBA 3IAAA 2C42A 5CB4A 1ZO8A 2JFYA 1QQBA 3O2NA 4J3JA 1TAQA 4ZQHA 4EYSA 3JTMA 4U7FA 3KKNA 5JC8A 2F48A 1NNEA 4B84A 2PK3A 2AWOA 3FWPA 4LX0A 3ELYA 1GZ3A 2HA7A 3M3HA 3HG7A 2G9NA 1HDRA 5HJ7A 4WOKA 2B3DA 2PLWA 4ZAFA 1F20A 2QUHA 4EKYA 5U9CA 2IPOA 4CMHA 5KSPA 4L2IB 2I22A 4I3GA 2XGGA 5E3JA 3B1KA 3RGGA 5KC8A 1AGXA 1OA1A 3LE8A 5HFAA 3P2IA 2PGNA 4HQKA 3E2IA 3KZVA 2DY1A 5ADWA 2OV6A 3FOZA 3EGDA 1QHHA 4MMZB 2WV9A 3F7TA 4FFVA 3OCXA 3GI1A 4XFKA 4ZVUA 3WOVA 2A0FA 4XD7D 3EBPA 4JR0A 5G4KA 1OJLA 1OVMA 3TMYA 2A5JA 3UK2A 4F3NA 5DHAA 4ZCMA 4LDNA 5EMJA 1JDSA 2IUEA 2RE8A 4UASA 2B34A 3S40A 4ZN6A 3WK6A 1U0BB 2I55A 3WSTA 2Y4NA 5B7NA 4DRXA 5A03A 4TM8A 1VLQA 2G67A 5H3LA 3UT0A 5FOSA 2X0JA 2C77A 2ZRCA 2H0AA 3PK0A 5DXJA 5LNK6 1GNTA 4KN6A 2FPRA 4AXXA 4E2FA 3J7AC 2F3SA 1QYVA 4H1TA 4OM8A 2BFDB 1E32A 5IS2A 4C7BA 1C8LA 1M5TA 4S1TA 1Y3HA 2GAFA 3FB4A 1EVJA 5F2OA 1L5HA 2YIVX 4ND2A 2QDKA 4R51A 5AIBA 4RDXA 2C3MA 2V45A 3BCUA 4X84A 3DQQA 2WV7A 3QMPA 4UUPA 2PWBA 1BXGA 2J6IA 1CLEA 4H4EA 2E4UA 3SWWA 4EG4A 4DQKA 1L5NA 3ED5A 2XQVA 2NPIA 5F7OA 3VZDA 3CX6A 3NANA 1N7HA 3D1VA 4J90A 1E9EA 3RI3A 1ORTA 4FXPA 3GZTB 3PNPA 1KJYA 2DOKA 4YO7A 4Z3KA 4OK3A 2QNIA 3THXB 1EDZA 1SY7A 3T7SA 3VHXA 1KVSA 3K20A 4YQEA 3U60B 1C3EA 3OPYB 1CFJA 1SCUB 2QD5A 3IO5A 3FWKA 1B8UA 3HRKA 4WZAB 3RKSA 3KWFA 3AF6A 1E9CA 4Q1BA 4QPCA 3KQLA 3ZE1B 2DC1A 2BZ1A 2W2LA 1M1UA 2XEDA 4RVSA 1PZNA 3GBPA 5B1YA 3QYJA 1YR2A 5GONF 2A1TR 5CK5A 3FI9A 3QW4B 3RSCA 1XTPA 3DCNA 5CCXA 3NVDA 4S24A 4RTLA 2C9DA 4QC2A 3SBDA 4EI8A 2NG1A 3ELWA 5F35A 4ZU3A 4AP6A 5LN1A 1XRMA 3P8ZA 1L6RA 1PFVA 2QZZA 2I62A 3CLRD 5JAMA 1PK9A 2VF7A 2KQUA 2YHSA 4TTJA 4Q9IA 4C4RA 3UQYS 1N5KA 3JSXA 3BXXA 4RJKA 1I4OA 1KJJA 3NH6A 3SFVA 5TIIA 4OK5A 1DIOB 1BXRA 2Z3VA 1G4AE 2EJVA 2J5RA 3EQ9A 3TRFA 5DMXA 1ZU5A 2J45A 4J07A 2H1OA 1V8BA 2XUJA 4C07A 5KYKA 1C8VB 1D07A 1XZNA 3DF7A 4FYMA 2GZDA 3I5MA 3MQ4A 3OA2A 2AW3A 2O0LA 4PQGA 3X1KA 4CPDA 4KG7A 3UA4A 3ZV3A 3GF4A 4C2UA 1SA0A 1FEZA 2BFCB 4OGGA 1E3IA 1YQGA 2AEEA 2R6GA 2QTMA 4BQIA 4YRBA 2KBEA 2EGHA 2FA9A 3L05A 1OAKA 3LUDA 4JVSB 3HKCB 1ML4A 3JQEA 3TEFA 3E05A 4US2R 3THYA 1X7DA 4UTZA 5K0SA 3L8GA 3QG1A 4IM7A 4I5GA 1O5IA 3TOVA 4ZQEA 1YNSA 3E7WA 3H19A 4JD5A 1KEEA 2WNSA 4WEQA 1TM2A 4FT4A 1KOJA 2ISCA 2Z4RA 3C74A 3FDZA 3PVZA 1M54A 1PE0A 4W8HA 3B52X 4AJHA 3KWJA 2BTEA 1ZL0A 4NFHA 1VYHA 2GZ1A 5KSWB 2G70A 4R3WA 4ZOCA 1RXSA 1O2DA 2HN9A 4NAVA 4Q3AA 1IY1A 2ZRIA 1RYHA 2FK8A 3WRWA 1ZISA 1TJ4A 4HDMB 1CPYA 3INGA 3KL4A 1Y7TA 3DW3X 3AJAA 1M2EA 4H7KA 1C7FA 4RC9A 2MOKA 4QJ3A 1ETUA 2ZJ0A 1FVOA 1M1NA 1RVDA 1DEAA 1R0LA 2NTNA 1IZ8A 3PGKA 4II2A 4IIJA 3ZUGA 3H1GA 2HNAA 3VA7A 2V3CC 5KUTA 1QHEA 4EGAA 3WLIA 3QOWA 2Y0DA 2VNHA 2APJA 2HY7A 2R86A 3D7RA 4FTWA 4CTOA 4P08A 1ECBA 1R3UA 2BEWB 4N3BA 3KC2A 3ZDEA 1OU0A 1G8GA 3QUSA 4CLEA 2QN9A 1PHPA 2R8YA 2FUG6 3R5JA 4QBFA 5ECWA 3SF8B 2VHYA 5GP1A 3WDSA 1L1FA 3WMRA 4BB5A 3F4BA 2HHLA 3L46A 2KLHA 2N0SA 1KS2A 3F4LA 3R9KA 5EKSA 4X7MA 1ESDA 3U6BA 4P3KA 4CM1A 4J1TC 2BIFA 1IXSB 2V3WA 3GFFA 1RRKA 4ZZIA 2XMSA 5DHQA 3LW8A 1GO2A 3VTAA 1ND5A 4D43A 2GF2A 1UKBA 1CQJB 1KA9H 2YS6A 3AW8A 3A9SA 3QE4A 5KWIA 3WLHA 4C14A 3COPA 2ADOA 4OKIA 1RP7A 5H0IA 2E89A 3PRKE 4IWYA 1YR6A 4AUNA 4XEUA 4GLLA 1I3LA 3RABA 3V1KA 1IN7A 4E30A 4UAVA 3GFPA 1DPGA 2CVHA 2QM3A 2FRDA 2YVLA 1P1BA 2ZBUA 2REOA 4E2WA 3WMFA 5CIWA 3ICWA 2L42A 3D3WA 4DS3A 4QYSA 4RM3A 2VSOA 1DJNA 3HUFA 4LC0A 5FNZA 3OZXA 5H3HA 4FW9A 5KNDD 3GDOA 2I4NA 1E3LA 2YWDA 2ONYA 4L0QA 3PUXA 3A1SA 3A6JA 5LYJF 1SCAA 3CEPB 3H9UA 4CLRA 4IUCS 4MHOA 3ZDZB 2FSGA 1KZ4A 1PWYE 3JD4A 2Y1GA 3DZHA 2BRUC 1W4CA 4CW7A 4IHQA 5KTTA 4G4GA 5HKOA 4MPRA 1U0NA 3T9AA 2GM5A 3JYQA 2BGMA 1TGYA 4MV5A 1LCIA 4LHZA 3CUEF 2VJOA 3R6LA 3W8NA 3L8DA 3PUWA 2NXCA 1FS5A 1GXSB 1J2TA 1I14A 1K2VN 2ZU6A 3QKSB 1WXGA 2I29A 4QARA 3OEHA 1FZQA 4A15A 2HMYB 3I2FA 1M76A 4OUKX 4EHLA 3HNRA 3ORRA 4E11A 1XTQA 2I6UA 2WJ6A 1COWA 3WRYA 5EXDA 5JI3E 5DNYB 1DCKA 3DXYA 1K86A 3H1BA 4D4KA 1K8YB 1Y6ZA 3C1OA 3I0ZA 1NRWA 3LOPA 1KI6B 1IEVA 2AD1A 4I8XA 1FB5A 5ICSA 3FTFA 3GCDA 5ENVA 1KY3A 4CQNA 4GOMD 3GN2A 4YEDA 5B1HA 4BMZA 1WKCA 1UQTA 2BP7B 1LLDA 1IK4A 1RP1A 2HEIA 2HCFA 4FEYA 1J09A 2CMKA 2IUYA 2V8BA 4KIJA 4ETWA 4LXHA 3WGQA 5LWHA 4WX2B 3EIQA 1FQWA 5BT8A 4OK6A 5FOXA 2JLXA 2NVWA 1X3SA 4WN9B 1VZ2A 2X9LA 4B3CA 2ZIWB 5DLYA 3W6ZA 1Y8QA 1C7JA 5IX8A 3VDXA 1MW9X 1B2LA 3KJNA 1H2EA 4ZGGA 9LDTA 3I32A 1A1VA 1V1JA 4B6FA 1ADBA 1UT5A 1QXSA 2H65A 3S2ZA 1WBBA 1SBTA 2YYZA 4B46A 4G56A 4O25A 1CEYA 3T5CA 4JKOA 1CQIA 3UB3A 3TZ6A 1N34B 5AQEA 3IILA 4INOA 2IDJA 1YBAA 4GLFA 3V97A 1GAXA 2P2NA 4RH3A 4DA8A 2NO6A 3IBCA 1KY5A 2A3RA 4EHNA 4YRGA 1XZGA 2HX1A 1KORA 1RD4A 3MT7A 4YP7A 1NJ5A 1N6OA 1VCHA 2FX3A 3DL0A 2YW9A 4A92A 1T0UA 4TLBA 1HX7A 1BCSB 1ZOLA 2X9VA 5K3EA 2AI1A 3IKMB 2OO5A 3JQAA 4DLKA 5ISMA 1ZJJA 2R84A 3FOFC 2RC6A 2PMEA 3EZ7A 3QU5A 2B1IA 4RH1A 1VE7A 1ZA1A 3TBKA 2J0QA 3RYHB 3ETLA 4IIUA 5JT1A 2ACVA 1OUMA 1TTQB 5CFOA 3W2GA 3OJFA 3OPVA 4R6XA 2BGKA 1CIPA 1J0BA 1HZZC 1VIVA 2VT2A 1A9PA 2V8OA 3H8SA 4U7JA 5ALNA 3NS7A 4OKSA 1JLLB 1GPYA 1E1DA 2F8MA 2OAEA 2EIHA 1TQ6A 1UKYA 4DYDA 1RZVA 4M22A 2NWQA 2AKAB 4M8IA 1U3FA 1GKYA 1ELOA 2HSZA 4UMVA 3A27A 4GHWA 2QTHA 4BXOB 5BNIA 4RF2A 4F85A 2CLFB 1JDPA 3PR2B 4H0CA 3SF0A 4EVSA 4MLPA 5EMNA 2OCAA 3E22A 5ITWA 2PWYA 1OYWA 1FA9A 1Z35A 1FCJA 1DEXA 4KVFA 4XIJA 3DNMA 3FXAA 2VHXA 4MR7A 5EAIA 1AXGA 3OPYA 4AKTA 3QEAZ 3HXTA 1QR2A 3M6WA 4UAUA 4GZ3A 4KSBA 2X8WA 1GFWA 3GRCA 3UTCA 3BIXA 4AP5A 4YIHA 3IV6A 3U80A 3FMGA 5EYPB 1Q1ZA 2JJ1A 4MS3A 2GUGA 4PGGA 1DJPA 2ZPTX 3H16A 4NENA 2H31A 4WOCA 4GGOA 3E9MA 2OGWA 3Q7RA 4Q4HA 3KHTA 4KZPA 4GL2A 1QLHA 4HADA 3TH5A 4C4XA 2HO5A 3H84A 4MKXA 3PEEA 2CJPA 3PXDA 2Q99A 3THOA 1SXJB 1ZEJA 4KH1A 1P1RA 4LY3A 1T24A 2UV8A 4C2BA 2IY9A 2RGAA 3C3KA 5CVVA 1P1IA 3TTXA 5E7MA 3D3JA 1P74A 2ZWIA 3KKMA 1W2WB 1OHHD 1Q0PA 1YCDA 1UOQA 2B83A 4ND1A 5T8KC 4BFYA 3KKZA 2RG1A 4QUGA 5JS1A 3G5UA 1J5PA 1O96A 4I1IA 1DAOA 1FMLA 1I24A 1ZBQA 4D57A 2O2GA 3HFJA 2FJPA 2GVDC 3FJOA 3MGBA 3UWMA 3TIVA 4BKMA 3S99A 3RARA 4FKMA 2VL7A 4E4TA 4QU8A 3CNEA 1V3TA 2AQHA 1LA2A 3AF4A 3H5IA 4NWIA 5DN6A 2PUVA 1P80A 2H5IA 5EIBD 2I1QA 4IIEA 4WJKB 4JKIA 4AECA 1DMRA 2DHEA 1JR3A 4WVLA 4B6EA 3L4BA 4EHHA 3V48A 4EHFA 1NZJA 3CUWA 3G7NA 3Q41A 4OM7A 4TWZA 3HLTA 1FS6A 2JBAB 2ZTLA 2GETA 1DZ3A 3DUWA 3QK7A 5I9NA 2DECA 1O94A 2FSVC 2QS9A 4G84A 5DK6A 2Y6VA 2P0YA 3PT9A 4C5CA 3GCGA 4ZAVA 1WHTB 1Z26A 2O2EA 2ZBFA 2UUBB 5LU9A 2OZVA 5BYJA 4ILEA 1E7QA 2I2XB 1KRHA 3H9BA 4GG1A 2VSXA 1NFRA 1CS4C 3C5HA 4OP2A 1E9RA 4XGIA 3RGWS 4DBVO 4JB0A 1Q77A 2CVOA 2PX5A 2V58A 4NPHA 2IOFA 5BV7A 2JB9A 3LZ6A 2J3JA 2QTBA 4FFWA 2POCA 1BKYA 2WD8A 3JZDA 1G8KA 3NO4A 3ORHA 3Q11A 4H7HA 4NICA 5H83A 4C3VA 4GBED 4RK6A 4M9QA 2FSPA 1KS9A 5IXSA 1JIVA 4JHLA 1QK3A 1CNMA 3DOIA 4FYPA 4G5RA 1K6JA 1TQ4A 4MA5A 5J47A 2J5QA 2ZR9A 1P9NA 3LUGA 1QC5B 1G8JA 1XDSA 2ZTMA 3OIFA 3PQ8A 4NMMA 4ZOLB 2AT1A 5BYAA 2GESA 3F98A 3P27A 2HJRA 1JSLA 2V5AA 3UJDA 1OFIA 5ITZB 4L08A 4KWHA 3MK31 2NU7B 2RI0A 3E3AA 3R3WA 5J3JA 3DP9A 2VJYA 4PNZA 4Q1AA 4GLBA 3UWDA 3NDBB 4Q9KA 3NETA 2ZM5A 3VSEA 1SD2A 1CBUA 2EWMA 2PCLA 3KU4A 4BUJA 3OQMA 2WG1A 5FWXA 5AOCA 5I5GA 5BPHA 3IMGA 4HATA 2OUIA 4K6HA 2HZ7A 2PZKA 1GNLA 2E82A 1FRQA 3EXG1 2PG3A 3OHMA 1ZMBA 4V0NA 4PAMA 2C4NA 4ZO6A 1XL0A 1RHKA 2G0NA 521PA 4CM3A 1BJTA 4QHSA 4XOUA 1DBVO 1YJQA 1JIJA 4AW9A 4HQRA 2FMUA 1REQB 1R8YA 3TSAA 3U2QA 2IS2A 4F04A 3IT0A 4DLAA 3V8NA 4LRUA 2I7XA 3GDFA 2ZWPA 4TS1A 1YRYE 3DDSA 3K0CC 5DYWA 1JG7A 3ENQA 1EFHA 1SPBS 3A3NA 3FYDA 1R4MA 4BP8A 4QGFA 1NRJB 5K0GA 2HT1A 3GWGA 2Z1MA 5EHGA 4KUHA 5TPWA 1TOAA 2FPXA 4O4JA 4BNLA 1K3FA 1W76A 3N8DA 1U5CA 4L7VA 4IOMA 5J5VA 1M1YB 2ZAYA 5A6SA 1R0YA 4DV4B 3GEDA 2QZSA 4FCTA 1E6EA 1MG5A 3W8FA 3RVQA 4ZAGA 5EC8A 3K5IA 1ESMA 3RS5A 1PJTA 3IP5A 3FZEA 4YS6A 4F7DA 5KTMA 3MVEA 1K27A 3QV2A 1YT5A 5I9IA 3K9QO 1NG9A 4AJJA 1EX1A 1ZK1A 3KP1A 1ZICA 4AJ2A 1K98A 4QOIA 1KO1A 1KEZA 3P9ZA 5B7QA 2AW5A 3CRMA 1QH1A 3MTDA 2BZSA 1AUOA 1FZTA 3LCCA 4K9KA 1BDJA 1JR6A 1M2NA 3R41A 3ZQ6A 2E4XA 1KSHA 2BFOA 1JLKA 4DR7B 1X87A 2J8ZA 3I6MA 3GFGA 4ISBA 1E9VA 5CVEA 5J43A 1MPXA 1TK2A 3GXBA 3WGGA 3AR6A 1A7UA 4RCZA 4S1OA 1PV4A 4GQBA 4M37A 2Q4TA 4MB0A 2FDXA 2E4ZA 4O2AF 3WYCA 5AUOB 621PA 4I9HA 4D7AA 1NBMA 2CLDX 4JNCA 4Y9UA 2JHPA 3NYQA 1B8VA 4N5DA 1IXRC 1P9RA 4JROA 3HDQA 3NOQA 2JVIA 4BLQA 4UTPA 2JJYA 1U8AA 1ZD9A 4HZGA 3TKYA 2LGJA 4EB6A 3CRVA 4YROA 3LMKA 5BSMA 2FXVA 3OJLA 2XD9A 4C4YA 4BY9E 3HCPA 4QPJC 2XUAA 1EXDA 4OREX 2G6BA 2ZYRA 3DE6X 1PS9A 1UAGA 5GY7A 2LZ0A 1GUFA 1N6IA 3PPYA 3SQLA 4AQDA 4PC7A 1AKVA 1Z13A 1T5SA 3AV0B 4Q4DA 5KEIA 1I2BA 1U3DA 3T4EA 4QM6A 2FEXA 5P8WA 3ZLTA 4NBNA 3I9FA 3HFGA 2CMDA 5FNVA 1J8FA 4OAOA 4TXHA 5IH3A 4EM6A 3PCRB 3QVWA 2O8EA 3NYIA 5FPYA 4UFNA 4PEVA 2CLOB 2H1LA 5JCOA 3TSZA 4F71A 1XDUA 3ISJA 4URZR 1UPCA 1W4BA 2WDPA 3HN2A 3MRVA 3O47A 5A05A 5KOYA 2AFHE 1P6QA 4NV0A 1XWFA 2UZ1A 4XA8A 5DGTA 5I5EA 4MUKA 5E6UB 5REQA 3V42A 3EFHA 4HLUC 4OHWA 1EE9A 4DQUA 1R64A 4QDUA 1N9GB 2C2GA 4BPBA 2XWSA 2RGBA 1J7KA 4MR9B 5LMZA 2JGDB 1XCPA 2FH5B 4FE3A 4YTEA 4AWAA 4Z6KA 4AJ9A 3IDFA 3LQKA 2R9VA 3O38A 4O4LF 1E6UA 4UHCA 2HWXA 1V2HE 5EJ8A 1V4BA 721PA 2C2HA 2PFKA 4CE6A 3MC1A 3L8CA 3ZHSA 1EBFA 4Q3KA 2P2ZA 2C1EA 3CMMA 3H2YA 4J75A 4Q66C 4XIIA 3V46A 5MFPA 3LO5A 4R1QA 4YRZA 3DOHA 3LOQA 1RJEA 1AB5A 4L8FA 5AJVB 4U0JA 4PZ9A 2IYVA 2UZ0A 3X43A 4YC7A 5TMPA 4L5CA 5CLIA 1THZA 1U9JA 5E0OA 1XVUA 2GUWA 4C1NA 4TZKA 2A0WA 3C85A 4RY9A 1ST2A 3L92A 1K7SN 2IYNA 3D1JA 1JT2A 3CBGA 3CR7A 3ZK7A 1ILEA 3PE3A 4KR6A 2IL1A 2F00A 3CS3A 2W98A 5NLLA 3IP7A 3BGSA 4UVHA 1ZCAA 3HCRA 1QF7A 1KQNA 5L6MB 1U31A 2QP9X 2RDMA 4QLBA 5THKA 2ONJA 3PI6A 4B6JA 2OGSA 2QUAA 2CXUA 4QBKA 2AZMA 2P4EA 1T3GA 2P1ZA 2XOEA 3LT2A 2C5EA 4OL0A 4NBUA 4TTSA 4ERNA 1Z83A 4D82A 1CP3A 1ZHFA 1DLJA 2WM2A 3NJRA 3GMSA 3JZFA 4NBWA 1E4YA 2AMVA 3HU1A 1U2TA 3R3VA 4X8OA 3VJLA 2Q3MA 4O33A 1XEAA 4PF1A 1FP7A 1UBFA 4E5UA 3N2GA 1K6MA 4W9MC 2C7GA 3ZTTA 4LDJA 1AHPA 2XE4A 5JD6A 3EX7C 1RTTA 3WFIA 3L1KA 3URMA 3T1HB 3HY6A 1IBLB 1DUSA 2RAPA 3DEFA 1HYHA 2ZIVB 3CUSA 4I1UA 2OBLA 1O9HA 3RBAA 3AW9A 2ROQA 1Z74A 5ELMA 1RFGE 4LTDA 1NLMA 4LBWA 1GZ7A 1RLIA 1MHPA 1POXA 1VRVA 1E1YA 3HB1A 5LQNA 3E8MA 1ZPDA 3PCXA 1OXXK 2I76A 3ANMA 5EE3A 2GR9A 3X1ZA 1ZSVA 2GPJA 4M8NE 4PO9A 4XPIA 5KSYA 3TNFA 4Q5IA 1GYQA 1O08A 3HJCA 3WK4A 5CFZA 1PEKE 1QAMA 3DE0X 1BN7A 3J81k 1OFUA 4DVGA 1XMQB 1HQDA 3EB9A 4DDWA 4JLVA 4K9RA 3K09C 3PJRA 3IAUA 1BG6A 2X0KA 3GEHA 4P33A 1MLDA 2OZLA 5AW8A 5K8JB 1Y1LA 5JXJA 4INJA 1IY2A 4LZZA 3VPGA 3BMNA 3IUBA 2PAFA 2X0EA 4EG5A 1NUHA 2JJMA 1E61A 3DBOB 3JQQA 2WFZA 3UW1A 1CNEA 1MF7A 1QPBA 3LX5A 4C7MA 3T1VA 3MIIA 4HGQA 2JI9A 4LOLA 3ZWOA 4E70A 4BVBA 4MVJH 1TFUA 2CMFA 5TQ0A 1KI8A 1OFUX 3ORSA 3GCZA 3QNMA 4V0ME 3WOHA 2C7RA 4EJFA 1C0IA 2A5DA 4JL5A 5JQGB 1SJ9A 3IR5A 2P3OA 4E7OA 2AGVA 5KNDH 4XWAA 4W99A 3FGPA 5B36A 1H5QA 3WLAA 4PSAA 3OX3A 3DA8A 3GLGB 4OF4A 1G20A 3AOGA 1HYEA 5I45A 4KJXA 5CDFA 1MB3A 5HR5A 1W19A 1YJ5A 2B99A 2IYLD 5HE9A 2I2AA 1RQXA 5ALEA 4UU8A 5EIBC 2FPIB 2PX8A 3UMGA 2G8NA 2W6QA 2JAUA 4JXJA 3UMFA 2YV2A 2WSLA 2WDZA 1U02A 2AMYA 2PEZA 3NWBA 2PSJA 3QRWA 1B14A 5AI8A 2FKAA 3NHMA 2WINI 2CFRA 5LZ9A 2GKGA 1JPVA 2XKBA 3AVWA 3IT2A 4DA9A 2VHUA 2YZGA 2HD4A 1IAVA 2Q5LA 3VR6A 3ZVLA 1UJ2A 5H7XA 4G23A 4RL6A 3E53A 1RPNA 4I4IA 4GVXA 3SR4A 5JJLA 2JIMA 4NH4A 2HMSA 1JT9A 1AGYA 4MVJD 1L4UA 1FPMA 3HCAA 2BGWA 4Q12A 5FWYA 3G8YA 5B12A 2QZPA 3L4EA 2JA1A 1JEYA 1XFAA 2ZRHA 2QLBA 3USES 3JSAA 2ZAIA 3PDIA 3BWXA 1F12A 5P21A 5FR1A 1NDHA 2W0SA 3HB5X 1ZSYA 2PKWA 4GEKA 4LA4A 4LECA 1AO0A 2B35A 2Y27A 1Z4PX 1PTKA 4C78A 3QVGA 5KDOA 1HYGA 1UBMS 1D04A 4KUGA 1Z33A 1HFWA 2HLPA 1ZVKA 2KX7A 3DLHA 4KLZA 1U1DA 4WE3A 3A2KA 5I9BA 1M10A 1R0BA 4H1UA 2BCGY 5EUQB 1J8MF 2NPOA 1EA7A 3OMXA 5CVTA 1SQ6A 2LTAA 1JJBA 5HMLA 1T9ZA 5HCNA 2FR1A 3CRZA 1HOTA 1SUBA 2VAVA 3CSSA 2GS9A 4REMA 4OJMX 5IBPA 4TS4A 1QRRA 4YRIA 4R9NA 3OA0A 3EPKA 3AR8A 2J4FA 3QUBA 2AS0A 1OB2A 1EX7A 2XWPA 1NN5A 1VSQA 3MOGA 4IHJF 3U44B 2B4QA 2ECPA 3WLFA 1TVMA 1QVVA 1V1RA 3KVNA 4HD8A 5FCDA 4HUTA 1WDLA 3JQRA 5ALSA 2AN9A 4Z2YA 1V43A 2PGLA 1SZCA 4B31A 2G4LA 3E61A 3AKDA 1JXQA 4L8YA 1N2OA 5B64A 4HX9A 1W1WA 5PNTA 5KO2A 1JKJB 1XP5A 1OGJA 2FAXA 2VC2B 5DIZA 2B6HA 2GN4A 2J9FB 1U2GC 4IGKA 1Z47A 2XTAA 4LSGA 4II3A 1U2EA 3AVOA 3IODA 4RANA 1QDLB 3JQ6A 4OFWA 1Z73A 2QTGA 2B1RA 3BERA 1TUBB 4G07A 2H48A 4P4GA 3OE5A 2QX7A 3RFXA 2W22A 3PDJA 3GNSA 1FRNA 2JW5A 2FV8A 3PRJA 2QI9F 1SZDA 1W0KD 5SICE 4CEIA 3ND8A 4TL6A 1NULA 3NHBA 1TXGA 3HPQA 5I7AA 3RTAA 5KOIA 1CUZA 2HUNA 5DO9A 5HRUA 5FJJA 2B5WA 5CFLA 2JIZD 3LL7A 4C2AA 1OWOA 4H7PA 4M1EA 3AILA 4K7JA 3I5XA 1Q15A 4H35A 1VKOA 1EK1A 4BIMA 3M6IA 4ZV4A 2WAOA 1GVHA 4QXRA 3FRJA 4RJ2A 5LMUB 3U7HB 5A04A 1RPZA 2Q27A 1Z5VA 2CZGA 3KR0A 1CCWA 2DERA 4GPZA 2W58A 1RRMA 4W63A 4EG8A 2OYSA 1F6DA 2BZ0A 1LSOA 1CJMA 2Y68A 3E27A 2C82A 3CH5A 3EHEA 3GUCA 3KB8A 3W3AH 4CM4A 3H87A 3OZEA 2WZBA 4QHTA 3G82C 3R7NA 1TZCA 4LBYA 2DT5A 2R751 2RGDA 3IP3A 5DGCA 5JU6A 1QU3A 4QXAA 3W79A 1ZONA 2IEZA 4NMXB 1U0JA 2J30A 1A5SB 4WVFA 3LQQA 4K05A 4D8YA 5ALZA 3MCTA 4B6QA 4MHSA 3TB6A 3IX7A 4TV9B 2PX0A 1G5IA 1H2WA 1NZDA 2CYBA 4PZAA 5JCZA 3IESA 2NM0A 3F9CA 3ZDFA 2QLMA 1EJBA 1JHVA 2QG6A 1I6KA 4MUNA 2W00A 1F51E 3AIOA 4HLQB 4U4AA 1X1CA 3SXPA 4RK7A 4YV1A 2VWGA 3IIIA 5DULA 3U7FB 4DLPA 3EOAI 4FVTA 2HIAA 4WKPA 4ECAA 3SNKA 2QGNA 2EDAA 3OIYA 4JX9A 1DO8A 5U4QA 1S1CA 4GI3A 1VKNA 1TU0A 1CRQA 2A7QA 4HFNA 4L4XA 1XAJA 4MEBA 4KSCA 5TX7A 4RKWA 1TCVA 1N92A 1R9NA 1JJFA 1P6XA 4P5EA 4FE4A 4GAEA 1G3RA 3FHLA 3I5UA 5CA1B 3DR5A 1FDOA 1S3GA 2PGXA 1GL9B 3EPRA 2NUTB 3Q4GA 2WU0A 4BUCA 2FEKA 1ZGCA 3HEAA 5AVUA 3F90A 3TWOA 2XIQA 2NXJA 2FMIA 5ALDA 2QX8A 3FIUA 1HDCA 4Q03A 4B82A 4X1YA 1WL8A 1N1DA 3RFTA 2HJ9A 5FYDA 4UFPA 4GD3Q 2GH1A 1PJRA 3QVOA 3K71B 1E59A 4RFVA 4DANA 4EDHA 5HTOA 3KUKA 2W2MA 2ZQYA 2XLCA 2ZQ5A 1RI1A 3CT6A 2CBZA 3WSWA 3N2YA 1WU8A 2I3AA 2QSUA 4JR2A 1VJRA 2C4KA 4NEGA 2ZT7A 5A6SB 3REFA 3V1LA 4KVGA 3L8HA 4EKDA 3U5ZB 3MPOA 4H59A 2QRVA 2YXEA 4YDSA 5JR3A 2IXEA 3B1JA 3VNAA 3JRNA 2GLTA 1N2BA 5B6JA 2HQBA 2Y1KA 3QXHA 4TTRA 4R2IA 3GLGE 2JD1A 4D9NA 3AYZB 3ZCTA 2JZNA 3VR6H 3BKWA 3LRPA 4ID9A 1C7QA 3UENA 4F46A 5KYXA 3LXXA 2IHYA 4UHEA 3LKVA 1H05A 4MUAA 4TZTA 4YUWA 5ES4B 1FDVA 1ZWKA 4P83A 1E0SA 5G1NA 4NYJQ 1GFIA 1E2PA 3CONA 3IP6A 2IXBA 5B4VA 2XNDA 2ZUVA 3MW8A 3V4OA 2HIMA 3JVVA 2UVDA 3BH6A 2ZJYA 5CFQA 1ZINA 4QRIA 5E6SA 4XWTA 1TCUA 5C51B 4IWXA 1QP7A 4P0PB 2ZXEA 2D1SA 4MS4B 2I91A 3AF0A 1PGOA 4O2RA 3N2LA 2JC3A 4UTOA 2YWBA 1SKAA 1TAHA 3K2QA 1XF1A 4XWOA 4ENRA 3NJ4A 5LD2B 3PJEA 1K4KA 3CF2A 2PMBA 4BZPA 3DXZA 5KNDA 1EP3B 1JDUA 4GBMA 4GI7A 4PHTA 1L3IA 4ZAYA 3AP2A 1ZNZA 4CV1A 4DDKA 1NW6A 4IHJA 4RSRA 4B2LA 1Z7YA 3ZNQA 1HH4A 3IAFA 5CEFA 2WI8A 1AZLA 3T9BA 3W6PA 1OWLA 1NXOA 1G6HA 1WMAA 2P3LA 4U00A 2ZLBA 2XKAA 2XR1A 2R66A 2J3EA 1SGWA 3EFEA 3OT1A 3SEZA 3WHPA 2FFHA 2XXJA 2AKEA 1CRLA 3EZFA 3FNIA 3HEMA 1YR7A 4RHFA 1EGHA 2JBWA 3IBTA 1C9YA 1PL6A 2D1YA 3AM5A 3IVCA 4DWVA 2O8DB 4IIJF 1LJLA 1MJGM 1K97A 1W29A 1BJRE 4M6WB 1T2AA 4X93A 4KDEA 5JTTA 4AL4A 3UHAA 1RDFA 1LBQA 1WW3A 1WCIA 2QJRA 3E7PA 2Z9DA 3G1WA 3QSGA 2EFGA 4LYAA 4U2DA 3B7PA 4I6JA 5EIEA 3FPHA 4RSMA 1N32B 4ARZA 4R98A 2Z56A 4FD2A 3ZZMA 3AL2A 3QTLA 2L18A 2K87A 5EXSA 5U1PA 1HFKA 3U0BA 3VGJA 3ZBPA 1UP7A 4BX0A 3ZTWA 1NVMB 2QE7D 1HEUA 3I9LA 2XMGA 3QWBA 2WHXA 2WU8A 1X86B 1EH5A 2IZ1A 3KU1A 1YONA 3P2MA 3TI9A 1W4LA 3ZTYA 2FPKA 5BWCA 1R6D