1IOZA

Crystal structure of the c-ha-ras protein prepared by the cell-free synthesis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
162
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Selenomethionine incorporation into a protein by cell-free synthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 56
structure length 162
sequence length 169
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1iozA00
5A4JA 4JLOA 1T6NA 2QBYA 1P9RA 2F7SA 1AQYA 3X1YA 4MYUA 4HB2A 1E94E 2NTYC 3IEVA 2RHDA 5FL7A 4DSUA 5DHAA 3I72A 4HAVA 3B9QA 4RSGA 4URXR 4NZYA 5IT5A 1T91A 2AN9A 1CR2A 3B2EA 1G20E 4H9GA 1N0UA 4OHXA 3PCRB 1HH4A 3P4XA 3ZZUA 1KKLA 1KO4A 1NMYA 1S8FA 2AFHE 2FV8A 4B47A 3GLFB 5LD2B 2EVWX 5J4HA 5DN6D 4OJQA 4P32A 1NIJA 3U44B 3L0IB 2JLYA 3FHTA 3SJZA 3WP1B 1KO5A 4BPBA 2B7CA 3WMFA 5KNBA 4ZIRA 4P4SA 1BOFA 3OESA 5EUMA 3BB4A 4FMCF 4KI0A 1CRQA 1GRRA 4TSFA 1QHHA 3THWB 1P73A 2O8EA 5TB5A 5FOVA 1NIPA 3F3YA 2GHIA 2FZLA 3TR5A 2ZXUA 1WDTA 4QBIA 1RYHA 4GNKA 2WKQA 3FMFA 1OXSC 1E0AA 3KJIA 4UNNA 1ZAKA 2C03A 2A2ZA 2R6FA 3TGPA 1LF0A 1GDDA 3H1TA 4TMTA 4U00A 1Q3TA 1GRNA 2JLUA 4JL6A 3I4LA 3MFYA 3QPUA 2VTKA 1IJFA 2VH5R 2ZRFA 1E69A 1UEIA 3CF2A 1EFHA 3EWSA 3MSXA 2A7QA 1E2IA 5JCZA 3OE7D 3P27A 2V7QA 3B1VA 1WRBA 1KI9A 2BJVA 1AM4D 3EA0A 5DI9A 5J5CA 1R0ZA 4LDJA 2QQEA 4DVGA 2P0EA 5DI3B 3AUXA 1IY2A 3L2OB 4HZUA 5HKKA 1M74A 3QBVA 1NJFA 4X8HA 1XEXB 3MWLA 4IDQA 1DAEA 4MRNA 3T06B 4C2TA 2ZJZA 4UXJA 1E0JA 2OXRA 1OYYA 4DCVA 1Q12A 3FTQA 3B1YA 4ASUA 1N6IA 1M8PA 1TF5A 2QTVB 2F6RA 2RKOA 2ZUDA 1NBMD 3I92A 1R7RA 4V02A 5F2EA 5L3RA 3RRYA 4TTRA 1PZNA 3BD9A 4Q1EA 3D8BA 2H16A 5JHGB 4PC1A 1XMJA 4V0LA 3UMRA 5KDLA 1F3OA 1OH5A 1AK2A 1R2QA 2QE7A 4K81B 2GKSA 3BH0A 4TYQA 4QL3A 2ZRMA 3CKLA 5D3MA 1II8A 4WVFA 1DARA 4ZDJA 1VIAA 2FZ4A 1ZC3A 3CZPA 4WOPA 1QG2A 3U3MA 1U0JA 3CR8A 2FPLA 2A30A 3UG7A 3ADCA 1KJYA 4V0NA 1FX0A 2D4HA 2PZEA 3NIBA 5AK0A 3E1SA 5AWFC 2N1BA 4CW7A 1EFUA 3HU2A 5JI3E 1ESNA 1G7CA 5HKKD 3OEEA 1QF9A 1O87A 4PAMA 4GDFA 1KSHA 4B3CA 4W9MC 2G83A 1OPXA 3R7WB 5EZ6B 3UMFA 1JALA 1ANKA 3RRNA 1KOFA 1ZIPA 2NO9A 4Q4AB 1UKEA 2BBTA 2YINC 4ASUD 4AYTA 4NYMQ 1G3UA 4Q00A 4IJMA 1WBDA 1ZU5A 2CL6X 4IDPA 4Q9LA 1I2DA 1SVOA 2OE2A 1D2EA 1AS0A 1P9NA 5JRZA 2OBMA 4JJKA 3V4RA 3PEUA 2J0QA 1P6XA 1N5IA 1E2NA 1W2HA 3FYHA 2WSMA 1E9RA 5AUOB 1A2KC 2R44A 2X8AA 1YVDA 3Q9LA 4CT5A 1Z22A 2VQSA 3SYNA 4G5RA 1ZCBA 3SU8A 2FMXA 5CDFE 1JQLB 1XCPA 2BBOA 3OEED 4QNRA 1OFIA 4WZ6A 4NPHA 2WKPA 4NONA 2JCSA 3IKJA 3KKMA 4JLAA 4C0BA 421PA 1Z6YA 3TSZA 1DAKA 4RZ3A 2HYDA 2H17A 2FX3A 4LCBA 4PO8A 1YZGA 4PAQA 1U0LA 1LS1A 1VCOA 4TYNA 1W0JD 1AGPA 1WP9A 1ZM2A 4I1VA 2JGNA 4ZKDA 2WBLC 2XTNA 1NLZA 5JJLA 5ANRB 1NG1A 2FGKA 3FMPB 5GVRA 4HLDA 4AYXA 4Q02A 4RD1A 2CJWA 2CK3D 1K6MA 5FOXA 3GFOA 1II0A 1G6HA 3L43A 2WWFA 2WMOB 3OIVA 4E07A 1EWQA 4NCHA 4ZDWA 3VHXA 5E7JA 4QOSA 2R6CA 4M1OA 5LBIA 4G5QA 4GP6A 2YWGA 3AP1A 2CMKA 2OO7A 1N2CE 5JWHA 2ZSFA 1G17A 4XIGS 2IC5A 3VAAA 1J7KA 2Z83A 2BOVA 3NEYA 1NVXQ 1U9IC 2G0TA 4EPYA 2F1JA 2J41A 3QKSB 4A8JA 2BJWA 3GJ8A 4UQOA 3TNFA 1MABA 4FMDB 4TT3D 5G53C 3H86A 1Z5ZA 3WNDA 3VQTA 5J47A 1G7SA 4BFWA 2HT1A 3GLIE 3L8ZA 2OLKA 4A2QA 4CDGA 3A1WA 4A1FA 2ATVA 3A8TA 3V9PA 2FJUA 3A1SA 3KXKA 4PC7A 2J1LA 4H1UA 5HZHA 4L8GA 2DB3A 1S2MA 1XPUA 3AVUA 1JAHA 4PSVA 4LHWA 3QJYA 2DWPA 3ECCA 4JVMA 1XU4A 2WJJA 3K9NA 4WW0A 2QGZA 3T1OA 1GG2A 4DRZA 4URYR 5IK2A 4LBZA 1W2GA 1CJMA 4LWZA 1T3SA 4Q66C 1SQ5A 1T0JB 4EQ6A 1Q1QA 4TLEA 2HV8A 3AF1A 2DHRA 5B2ZA 1W46A 3RC3A 5BYKA 5E7IA 1IONA 1BYUA 3FE2A 2H8KA 3PUZA 2QRNA 2LWIA 3HU1A 1YKSA 2AKYA 1GILA 2L0XA 4BZXA 2FFHA 5KUTA 2NO1A 1OXVA 1TUEA 3SOPA 1CJVC 2B21A 3BAFA 3NXSA 1A5TA 3PFIA 1EXMA 2I4IA 5FTJA 4KJZA 3PXGA 2ZYTX 4XD7D 3ND8A 1ODFA 1FUUA 1DO2A 2XOKD 4RD6A 3U7GA 3U3OA 1IXZA 4JSYA 5FUVA 3EZ2A 1TQDA 4EPXA 1E32A 5KSYA 3QQ5A 4EIWA 5IK2D 4F92B 3WHKA 3X1DA 4GP7A 1XB2A 4BFUA 1TQ4A 2X2EA 4LJ6A 5G3ZA 5C4MA 3U4QB 3B9PA 3THXA 4Z54A 1L8QA 4R2HA 3FKQA 4Q1FA 3CUEF 2F1IA 2QG6A 4KFSA 1RKBA 1UDWA 2QMUA 3WNBA 1L2TA 1W48A 2UKDA 5LDDC 2P65A 3DKVA 4AYWA 1IY1A 1CULC 1DTSA 4HUQB 4F91B 3UKDA 2G6BA 3AP2A 4QHTA 2ATXA 1U90A 1ZD1A 3W5IA 3TUZC 4A6PA 4CYMA 5FOSA 3L0OA 2GJ9A 4Q7JB 1E99A 1I4TD 2IYVA 3LY5A 4XWKA 4FD2A 1Z63A 4LJ7A 1VDZA 1IN4A 1OYWA 2ZYUX 4I1SA 2ZI3A 1JJVA 3I1FA 4LZZA 1Z0FA 4G01B 3DL0A 1KNQA 1NN1A 3EG5A 2Q9AA 4G1UC 3SN6A 5K8TA 3EX7C 5JLJA 5TXGA 4XWAA 1ZCAA 3K0AA 3GJ6A 4PANA 3NTUA 1I2MA 1OW3B 4LJ8A 4XSGA 4F7WA 5J4YA 4D6PA 1KMHB 4KXFB 2F1HA 2JLRA 3OIUA 3QKUA 2EFCB 3B1XA 1OIXA 4GL2A 4OJKA 1H8ED 4CIDA 1NN0A 4E03A 2FSIA 2R6GA 1R10A 2FA9A 2YVUA 2IUSA 3R9XA 2DCUA 2AX4A 1G8GA 3GCGA 2PZFA 3SC3A 2WJIA 3L0PA 1T3HA 2FFQA 4DCUA 4ESVA 1BKDR 4B2PA 3IPXA 4N0EA 2R8RA 4DEXA 1XD9A 3GLFA 2A5DA 1ETUA 1TUIA 1B23P 1P7CA 4JLMA 3FVQA 4Z1MA 1G1MA 1KAGA 5FBQB 3V4FA 2DY1A 1T5LA 1TTTA 2HF9A 2WPDD 3A36A 4CEHB 4PZZA 4PSKA 4O3MA 3VR2A 5F98A 3Q8XB 4Z8YA 1F2UA 1AQUA 2C2HA 2F43B 4KLZA 3IPYA 1F60A 4EFMA 3R8FA 5TVKA 4N1AA 3R9IA 4NHOA 3RRMA 3M1IA 1U0HC 2BCGY 4HB4A 5L3SA 1U94A 1S1CA 2YHSA 1HE8B 1OXUA 2KBEA 2XSZA 5EP4A 3VKHA 4PXAA 4NTZA 3GLHE 4HYYA 2ZUCA 3GJXC 5HE8A 1KO7A 4BFSA 4PO9A 1G5TA 2P67A 4MITA 4TZ0A 2IHYA 1Z29A 1N6OA 3DPUA 2CLSA 1RRGA 2IXFA 1JECA 4KLNA 3PENA 3SJBA 3WBKA 3X1WA 2AHOA 3LO5A 2QSZA 1E2MA 1DAHA 1Q57A 1UKZA 1AN0A 1QHXA 3L82B 4Z1MD 3EXAA 2Q9BA 4LBWA 5EE9A 1VMAA 3QPVA 2BMFA 1Z6TA 2AFIE 2X77A 1TEVA 4N3NA 3ZZTA 3B6EA 4PO1A 3KQNA 5JCPA 2BHRA 4F38A 1E1RD 3LBNA 1P5ZB 4OI4A 2OLJA 4C0AC 1U99A 3Q7PA 3WRXC 4KFUA 1XZQA 4M1WA 3K9LA 4TMVA 2WIAA 3SEAA 3ETLA 2IXGA 5LB2A 1XJCA 2QP4A 2YOFA 1U98A 1LS6A 1L4UA 2GNOA 3MWYW 1FNMA 1EG7A 5B30A 3LAWA 1OH7A 4BWYA 1DADA 2ZR0A 2IYLD 1E2LA 2QAGC 2LKCA 4YLGA 1Q22A 4E09A 5TV2A 3O8BA 1CU1A 3CNOA 3GJ0A 3MRSA 2Z5FA 1JPJA 2YC4C 3BIFA 1HTWA 2WHXA 5G3YA 4IOJA 2ZRGA 2CLCX 1E2FA 1IHUA 4FWIB 4L5BA 3UANA 4D26A 3X2SA 1G7RA 1W47A 2ZE6A 4QGHA 3KKNA 2R2AA 2ZJYA 3NKVA 4CGZA 2YJTD 1JR3D 3K0EA 3W3AA 2UVQA 4V0ME 1NRJB 4BZQA 2REBA 2KWIA 5E7MA 2ZANA 4QGGA 4F4JA 2FF7A 1VCIA 4A2PA 3WP0A 4JKYA 2QM8A 3TW8B 1BMFA 4BFYA 3FFAA 2QP9X 2GJKA 3IUYA 4NYIR 3GJ5A 3OIYA 5GJBA 1MKYA 2RGEA 4MGKR 4YQFA 2RH5A 1ZJ6A 4DCSA 1QRAA 3JVVA 3WRYC 3IILA 3T12A 1KHTA 2Q3HA 2IYWA 4EJSB 3KL4A 4P0TA 3EZFA 1OB2A 1OFTA 4F93B 2EYQA 3L8YA 1QDEA 2G77B 3GPLA 1MO3A 4Y0VA 4PQRA 4GMXA 2VYFA 2RB4A 1YE8A 1H8HD 1VHTA 4Q9KA 5CLLA 2ZJ8A 3DO6A 4HDQB 1CP2A 2ANBA 2Z4RA 4A9AA 1ONBA 4BFZA 1D6JA 5EZ5A 1CIPA 2BBWA 1AJEA 2J45A 1T0HB 1N25A 3OEHA 2XXAB 2ZJ5A 1RC8A 2IW3A 2REXB 2WSSA 1D9XA 2NO7A 5JZVA 4CEIB 4DIDA 4JLBA 1ZNXA 1G3RA 2FE4A 4HAXA 3EWAA 3U6KA 3W8RA 4US1R 5FPHA 1KIMA 3ZVMA 1SXJE 2GXQA 1XZPA 2PEZA 2ZUBA 4D4MA 2BCJQ 2SHKA 3VFDA 4BZPA 3BB1A 2G0NA 1Z2CA 2DPXA 1QVRA 3CF0A 3QY0A 1SKYE 4GI7A 4JL5A 5EXSA 4BFVA 3PJRA 4ZCMA 1XCGB 3RS5A 1E9BA 3QKTA 4XVQA 1E1QD 4AY2A 2FFAA 2PZGA 1WF3A 4U5XA 4Q4LA 3QF7A 3I62A 4LJAA 3ZVNA 2X2FA 2GZHA 5CDFA 4DWJA 3E2IA 5FOTA 4QXAA 1G9XA 1SXJC 2BVNA 1C9KA 3VR3A 1OH6A 2VP5A 4ZI2A 5DHFA 3SFZA 2ORWA 2WSSD 4FXPA 2ZITA 2RGNA 1B0UA 3DM5A 1J99A 3MLEA 3K0FA 2D74A 3P4YA 3WMEA 4Q4HB 2BMEA 3B85A 4WIAA 4G5OA 3S1AA 3RNLA 4C7OB 1KI3A 2C9OA 1Z8FA 2QT1A 3KX2A 4DXAA 1FMLA 3B82A 4W5HA 1W36C 3A1UA 4YMVA 3TMKA 1U9IA 2K5UA 3HJNA 4LJ5A 4ILEA 2HYIC 3TE6A 1XXHE 4DT1B 5EP2A 2GAAA 2YWHA 3RLFA 3IQWA 3T35A 2A9KA 1P2TA 4DB4A 1G8HA 4EKDA 3WHLA 4OYHA 1W36B 3EW9A 1P2SA 3A58B 4OK6A 1GZSA 1D5CA 5BN4A 4US0R 3PVSA 1Z47A 1G21E 1F48A 5C4GB 2Q3MA 1RW4A 1OT3A 4O25A 2ZJ2A 3LXXA 2J7PD 3EC1A 4BLSA 2F55A 3T15A 2XB4A 2C96A 2EQBA 2REOA 3TQCA 4JLDA 2Q3FA 4ZO4A 3VHLB 3MCAA 2NPFA 5FR2A 1TX4B 3GEHA 1N0VC 3SJAA 3QEJA 3CNNA 3ICEA 4OQLA 1ZVQA 2HDNB 2NPIA 2VP0A 2QSYA 4S2EA 4DDTA 1OXTA 1NKTA 3QNUA 3LBHA 4L4UA 4NBSA 4ERNA 3KDSE 4GRAA 3SZRA 1HYQA 2YNMA 4B3XA 1S3GA 4LC0A 4QBFA 4MUAA 1ESMA 1XDBA 5CM9C 5GJVC 1E79A 3K70D 3NG1A 1G8YA 3GLIA 3CONA 1K5GA 2GA8A 5CB6A 5GADl 2FWRA 4GOJA 2D7CA 2XJ4A 2XNDA 4S35A 3SHWA 5J4VA 3REGA 3PIRA 4Q7KA 3IO5A 3VX3A 3ZDQA 3AUYA 3N70A 2O8FB 2QPAA 2Z4SA 4MA4A 1RYFA 1A7JA 2OZEA 1HUQA 2EWWA 3B7GA 3U3RA 5LD2C 3B5JA 2Z0MA 2V8OA 1FTSA 3QEOA 2RAPA 1RE0A 1U8AA 4K8OA 4KO8A 5KU1A 1XEFA 3ADBA 2ZM5A 1VKJA 4M1SA 5J40A 4AKGA 1ZD8A 1F5NA 2CXXA 4KITB 2BIFA 3B60A 1NP6A 4OK5A 4PPQA 5EJEA 121PA 1OB5A 2ANCA 1GL7A 3TVDA 1UM8A 3THYB 5DLQC 2AL7A 5JWOA 1ZNYA 1XPRA 4B6EA 2WM9B 1Z07A 3GJ3A 1P2VA 4GBMA 4D4LA 5JWRA 3QE0A 3W6PA 4UKDA 3KTAB 2GCOB 1UF9A 1NLYA 1XNJA 5HR5A 1KZ7B 2R6DA 1HQCA 4C3ZA 4KU4A 1IOZA 2CL0X 2C8VA 3QBTA 2XNDD 3KJGA 2ZYVX 4M8NE 1RRFA 3K9GA 4GZMA 3ONWA 2XZOA 1E2KA 4W5JA 2W6IA 1XPOA 1N5JA 4LPSA 1CJKC 4OI2A 4LYJA 5FL7D 2GWHA 1LF5A 2ZQ5A 4Q1BA 2GEUA 1KTVA 4LC1A 4QC2A 4RCZA 4B2IA 2P2LA 2FPMA 2IYYA 1ZUIA 2AR7A 5FH9A 4L9SA 5P21A 2FPKA 3CLVA 1GKIA 5FUXA 2C5LA 3F5FA 3RS7A 4RFVA 3LLMA 5DYGA 3UXMA 4PC6A 4ZDKA 3R8CA 1JPNA 1N3BA 3T1TA 1XMSA 2AD1A 1I4LD 3F8TA 1DG1G 4HI0E 2ZU6A 4TYPA 1E6CA 4UXHA 4FI3C 1UFQA 1KDRA 2Q6TA 4JVLA 4L16A 5FBRB 2PCJA 2FOLA 2EFGA 4TSFD 2ZRDA 4DDVA 3I61A 4OI0A 4EPRA 3WNCA 1ZIOA 4BLQA 4FINA 4TL6A 2HXYA 1BIFA 3LFUA 2W6ID 1Q1BA 2P6UA 1KMQA 3QI2A 3ZH9B 1OHHA 1W44A 2AKAB 3KKPA 4TL8A 1EX7A 1KO8A 1T8TA 3R9WA 3K53A 1G8FA 5FR1A 3CWQA 4LV6A 4WAUA 2F43A 2P5TB 4ARZA 5BW8A 2RGCA 1ZC4A 1DPFA 1YHNA 1EWRA 1NY6A 2ODBA 3NWJA 4IVQA 2VIIA 4JLPA 3NC1C 3VR4A 2Z43A 1YQTA 2AXPA 1SGWA 3OAAA 4JSTA 2Q21A 2V7QD 1P2UA 2O0HA 2QP3A 1KGDA 1MRNA 3ZYCA 4WBSA 4C0QC 2I1VB 1RRCA 4IEIA 4NKRA 4B3GA 1FL9A 3BB3A 2VP2A 3KFVA 2W6JA 1G5RA 3I73A 3GLGB 5JJIA 4AKIA 3OFNA 1P9WA 3R20A 1VCNA 1RJ9B 3ADDA 1K8RA 4NYJQ 4ZCLA 4PQYA 3W90A 1V43A 2GETA 3G0HA 4L9WA 2P5SA 4X8MA 4DLRA 3I32A 5AUQA 3W3ZB 1DELA 3IIKA 3TAHA 3SQXA 1L4YA 2XGJA 4TTQA 2QE7D 2OM2A 2PX3A 5IHPA 1Z6AA 1DS6A 2OFOA 1TU4A 3QUSA 4NCIA 1KSFX 5HPYB 2P6RA 2PCLA 3D7MA 4YMWA 2Q9CA 1UBCA 3OAAD 1LFDB 3GLHA 8OHMA 3AM1A 1VYTA 2GXSA 5JHHB 4P33A 1ZM7A 3B1WA 2W2VA 1NG9A 1P4SA 2XAUA 1FQKA 1Q3HA 2NMVA 4B75A 4YDHB 4EUNA 1ZRHA 1A82A 2FSFA 2ZRLA 4HAWA 4RZUA 4HB3A 1IAQA 2LKDA 1OSNA 4P4UA 1R8QA 3UG6A 4LV8B 2PBRA 2QM7A 2WOJA 3OFND 1ZINA 2FN4A 2IYZA 2VP6A 3G5UA 3VR6A 3NDPA 3TKLA 1SVIA 3AF2A 2I3BA 5H1YA 5KNDA 5KPDA 2GF0A 1E98A 1US8B 3CW2A 1DAIA 4B35A 2ZPTX 2IBMA 2F3RA 2QAGA 4MRRA 2ZU0C 5IDVA 4URVR 3CX7A 2O8DA 1N6HA 5KSOA 1LW7A 1Z08A 4M1YA 2ODNA 2ASEA 1NY5A 1QHIA 3WBJA 4PHGA 1M7BA 4Q47A 3SNHA 4YMUA 2JEOA 2QA5A 2DBYA 1NVVQ 2WZQA 2O8BA 1SZPA 3CB4A 4LI0A 1E2PA 1ZW6A 4RFSA 3ZIAA 5HZKA 1XEWX 2VSFA 2IUTA 4TLCA 2C98A 3EZ7A 4DCNA 4M1KA 5B58C 5AJXA 5JJKA 2W2TA 5JI2E 4HSEA 1IJEA 2JLWA 1MV5A 1Z06A 1VIYA 1MRSA 1KI6A 1RZ3A 2J5XA 4BRWA 5AJYA 2GJ8A 5L3QB 2IYUA 4R71A 3ZD6A 2KBFA 5KDOA 1ZNZA 1FFHA 1KY2A 2OEPA 4JBYA 4JLNA 2J59A 5FPSA 4DJTA 4F4CA 1XMVA 1E9CA 1TADA 1YZQA 3LW8A 2A78A 3D31A 4V0MA 3BORA 4QBGB 5M04A 2IS2A 2GESA 1TF7A 1UKVY 4A92A 1VYVA 4TMWA 2YOHA 1ZUHA 3TQFA 1G7TA 4FCTA 1GIAA 3SHFA 4PTLA 3GFPA 1OXXK 4M0LA 2WV9A 1JEEA 4CZ2A 4BFXA 4TYWA 2ZR7A 1E4YA 3OIWA 3U7HB 1HT2E 3FMIA 2QN6A 1XD2A 1LTQA 2R9VA 4HDCA 1VG0B 4Q1AA 4RZ2A 4GSYA 1K5DA 5EQTA 4QHYA 3ZIAD 5JSZA 4CEJB 5DGXA 2A5GA 2GBLC 2J0UB 4V03A 2ZRHA 4O0MA 4MDFA 4IXMA 2QORA 1W4AA 4TL9A 4AKHA 2CCKA 1E2HA 1D8TA 4Z51A 2OESA 3SBDA 4UNQA 3CF6R 1Z28A 2CE2X 3EPLA 3EPJA 4FCWA 3IGFA 3RDPA 5E95A 1WA5A 3CPEA 2WWXA 3U6BA 1W4CA 4POAA 1NL3A 1CLUA 2WJHA 5BXQC 2ZROA 1XRJA 3G82C 5FBLB 2GF9A 3FDIA 4JZKA 1GFIA 4AD8A 2V6JA 4IVPA 6Q21A 1NNEA 1SXJA 2EU8A 5DNYB 2GCNA 2YWEA 2EFHB 2PX0A 4O2RA 2JLSA 2O8CA 2VPPA 3BFVA 1H65A 3U2QA 1CR4A 2V1UA 3SS8A 5AJVB 3QPWA 3T1QA 1GITA 4V0KA 3VU9B 3GEEA 3ASYA 1SHKA 5JEDA 5KOYA 4TTPA 3A1VA 2QBYB 1OF1A 3CH4B 1NMXA 2ZI9A 1M7GA 4RD0A 3LW7A 1NVUQ 1Z0KA 2YZ2A 1Q1ZA 5CM8B 4HATA 4TQ9A 2IYSA 2OG2A 4IFEA 4OQFA 4BFTA 1KO1A 4IHQA 4Q4JA 1NBME 2IS6A 1N6RA 1IXRC 1A4RA 2V55B 2WJYA 1GTVA 3QF4B 4MYCA 1VG1A 1AS2A 1XMIA 2IHBA 4DZZA 4GFDA 1T3LA 2GEDA 2PLFA 4M53A 1E2QA 4JT2A 3FMOB 2B6HA 3TR0A 1YZTA 4WXPA 4YXWA 2F9MA 4DDUA 3AH8A 3IBYA 4ACAA 1LVGA 4ZIRB 1G8PA 2A5FA 3PR1A 2PMDA 4QGFA 1XXHA 4BLRA 3K0SA 1IN8A 2CCJA 4RKEA 5FL3A 2ODWA 1QHHB 2QU8A 5DISB 2O8EB 1N5LA 2ZRBA 3AVTA 4KBGA 5EP3A 1EFCA 4EFLA 4A2WA 1E96A 2BKUA 2IYTA 2VBCA 4B3FX 1Z0AA 3LH5A 2RHMA 4NE2A 5E3HA 5HCNA 4TZ6A 4WXRA 5FOWA 1OKKA 1BH2A 5KO2A 3MJHA 2CHVA 4HZIA 2B92A 4I1OA 1P75A 4A36A 4MRVA 4OHZA 4IOLA 1J8YF 2GILA 2WAYA 4IEEA 3AGPA 3E70C 5JRJA 1LNZA 4QKQA 1IM2A 2ZJAA 3EARA 1TMKA 4AG6A 4DLXA 2NZ8A 4AIIA 2ZIAA 5FPYA 4JJZA 2NZJA 2JA1A 2QENA 3U44A 1N6KA 3NBFA 1EGAA 4KSCA 3RANA 2HCBA 4IKEA 4YXWD 3VNUA 1XD8A 2CBZA 4HZUB 2ZSAA 2XZPA 3GJ7A 2CEAA 3KTAA 3BBPA 4GT1A 1QZXA 2FH5B 3JZAA 2CVHA 3LX5A 1JEDA 1R0YA 3THWA 3CZQA 4G3XA 1M6NA 4EDHA 4IOMA 4XWOA 2X1VA 3CWZA 1Y3AA 3AEZA 2RGAA 4EFNA 2OT3B 3VNVA 4FIDA 1GAJA 1EFRA 1G291 2OCYC 1O3YA 3JZMA 1UPTA 1HT1E 4BE7B 2IYQA 2ZETA 3DZDA 2WWIA 4RY2A 3DDCA 1Z0IA 3N5CA 5EXXA 4ZKEA 1QBKC 2E87A 2QPTA 2WVJA 1X6VA 2XTZA 3EIQA 2C95A 3U5ZB 1QHGA 3QXJA 5DH9A 1IQPA 5DIFA 4FMCB 1E2JA 2CCGA 5D3MB 4HLCA 1II8B 1W4BA 3P1JA 3J81k 1EFTA 4QBHA 1W1WA 3EZ6A 2WWGA 2MMCA 3QVUA 3QENA 1FX0B 2QY9A 1GM5A 2O52A 5DI3A 1ZM3A 2J3EA 1AGRA 4M22A 4JMPA 4PHTA 4OQNA 1XEXA 3U60B 1X8LA 1KI2A 2BV3A 4MKHA 2G9NA 1KDOA 1YU9A 5FUYA 2GJSA 1FMJA 2RGBA 4DDWA 3BH6A 2ZRPA 4YONB 2XSZD 5JECA 1KJWA 2ZJOA 5AR1A 4JLVA 4LRWA 3AKCA 4Q5IA 5DE3A 4CRWB 3QG5A 5F9HA 4LJ9A 4D2IA 3QXSA 2BMDA 4QNMA 3VX4A 2IEYA 3QKRB 1Z0JA 2WOOA 4HLUC 4LX0A 1OFUX 1AIPA 4MRPA 1X1SA 2IL1A 2FU5C 1MR3F 2IA5A 3BFKA 4R7ZA 3ND9A 3C16C 3U7FB 2AD5A 4R9UC 3SE0A 1AZSC 3M4YA 3I5XA 1E3MA 2OCPA 4BASA 4NU0A 4GOXA 1XJQA 4LV5B 3WY9A 3PEWA 2YWFA 4KAXA 5B64A 1PUIA 4C0LA 1JXMA 3CRQA 3R7WA 4OHVA 4EPWA 3TIFA 1HV8A 1Q44A 3TUJC 4EJSC 4Q4AA 3AP3A 2CHQA 721PA 1GWNA 3KKOA 4ACBA 1KK2A 5K8IA 1G4UR 2WMNB 3RSOA 1MO4A 3AKDA 4B33A 5BWMA 2ZYWX 4LHYA 4CF7A 4LYFA 3X1XA 3CRW1 3PITA 4I99A 4QJ4A 4XJXA 4KYUA 2QL6A 4PPNA 2G88A 4QGAA 2NO6A 3MUFA 4XTRA 4CVNA 1XWIA 1IN7A 3KFXA 2CJWB 4H1VA 2R65A 4ZCIA 3IO3A 4IOKA 2PLRA 1OE0A 3IDQA 2EYUA 4FMDF 1IN6A 5SZKB 3KXLA 4AURA 4E22A 1XTIA 4AC9A 1F2TB 2QEQA 1GNQA 3Q3JB 1R0XA 2PH1A 2QROA 4BEBA 4PFSA 221PA 1JB1A 4ESHA 4A8JC 1S3SA 1KDPA 2FG5A 4BLTA 5BQ5A 2RGXA 4JVNA 1VPLA 4PQFA 3ZVRA 4LSGA 1HY3A 1S1MA 2BEJA 4I4LA 2WWYA 1BMFD 4Q03A 3L0SA 4Q19A 4A8JB 1UDXA 2IXEA 1BYIA 2ZRJA 3AVPA 1GKUB 1JXOA 1MABB 1V5WA 2OSBA 3NBZC 2XZLA 2JIZA 1SKQA 4P4TA 1G4AE 2W83A 2PT5A 3CNLA 4DLZA 1PUJA 4RZXA 4HB0A 3ZLJA 4NYMR 3SYLA 1Q20A 2QTFA 5EE0A 3C7KA 4OK3A 3GP8A 3CRVA 1WBBA 1XF9A 3NC0C 5FUWA 3B13B 3IHLA 3DOEA 3QXCA 2BM1A 4RD4A 3A4NA 5KSZA 2HT6A 3V00A 5C1BA 5FTKA 1R5NA 4MUBA 1SVKA 5EE3A 1UADA 3VR5A 2ZVQX 4HLQB 3OEHD 3THOA 4BLOA 1DE0A 2GAOA 3RS0A 3TH5A 1D9ZA 3C14C 4PC2A 3T34A 4MGYR 1N6NA 4LJYA 3KJHA 1KZGB 2FNAA 1XTSA 1W5TA 1ZNWA 5L3QA 1G6OA 1S9DA 1Y63A 3AF0A 1YZLA 4G5GA 3FFBA 3QKSA 1T8UA 4LYAA 1LV7A 4B3DA 3LQQA 1MO5A 2IS4A 5KNCA 3SJCA 1GVNB 3SYKA 2JIZD 3LXRA 4E5UA 1R6BX 2JDIA 621PA 4QM6A 2QGNA 4URUR 2WICA 1QHSA 3AKYA 3AF3A 5EXPA 2OBLA 5L8VA 4ZI3A 2ZI4A 1FW6A 1YRBA 4C30A 1XTQA 1FOEB 2CLDX 4DLVA 4LHVA 5DYIA 4GPTA 1KYIA 2IWHA 3K0CC 4JLKA 1CS4C 1X1RA 1MO6A 1XEWY 2IS1A 3QXHA 3MJRA 3QG1A 2QT0A 1MOZA 3EZ9A 1IN5A 3THXB 2NOAA 2C78A 1FUKA 5C46F 1T4GA 4D82A 1UBEA 2GK6A 3CR7A 3UMSA 2RMKA 3TAUA 2LCFA 3KB1A 1KK0A 1G19A 3BK7A 3H2YA 1TU3A 4JYBA 1P72A 4LOAA 3H84A 2G1KA 2PJRA 2V1XA 5DO9A 1DG3A 1PJRA 4R2IA 3KQUA 3HR7A 4Q18A 4XSHA 4KCGA 2PEYA 3IBGA 4II7A 1OV4A 4OHWA 5TMPA 2XB2A 4B43A 2MSCB 4B76A 4QFMA 1KI4A 2VHQA 2KB0A 1KJZA 3CX6A 3K0AB 4D80A 3N2EA 3CM0A 1YRAA 4P31A 4KV9A 5HTKA 3W5JA 2HEIA 3KKQA 1RIFA 3SDZA 5A0FA 5SZJA 1F6BA 4NCNA 3T1VA 3U4QA 1GNRA 4M9ZA 3FGNA 3SR0A 2GZDA 1DO0A 2V54A 4Q48A 2C04A 3B1ZA 4MYTA 1E79D 2CHGA 1UEJA 4LJ4A 1GOTA 3MWJA 3MGCA 1TEXA 2ZS8A 1CEEA 4MKFA 5CK5A 3QF4A 3IHWA 4XH9B 1X8KA 4HUQA 5LB4A 2ZE5A 1E9DA 3C15C 1CF4A 3B8HA 2YYZA 2VEDA 3FB4A 3AGQA 5KSPA 2D2FA 4DLTA 3EAQA 1W4RA 1WXQA 3IQXA 3OE7A 4QRHA 1KY3A 3LVRE 2ZVPX 2DWOA 2ZRAA 3C41J 3ZVLA 2FGJA 2GCPA 2YOGA 4IW3B 3HP1A 4EPTA 3KQLA 3EPKA 3D6TB 2OFWA 5CLQA 1F2UB 4IVRA 4Q7MB 1PVOA 4B48A 4NCJA 2NQ2C 1JR3E 1YR9A 2N46A 4W7SA 4P3YA 1ZUNB 3EIHA 3LDAA 4B74A 1KMHA 5L3SB 2O0KA 3QSYA 3RVBA 1AS3A 4Q1CA 1NBMA 1W5SA 2XX3A 2DR3A 2AWOA 1VTKA 3EA5A 4MYHA 4DSOA 3I5YA 3K9HA 2ERYA 4UNSA 4PSAA 4UJ5A 2OUKA 4PZYA 1DBSA 2H57A 3KQHA 3U3KA 4FWTA 4OL0A 3SFVA 1AKYA 1E9AA 2ERXA 3EASA 3GLGE 4DIEA 1G16A 1U8ZA 2ZJBA 2HF8A 3TBKA 4BGDA 4B73A 1A1VA 4LK2A 4WA7A 3OF5A 2QAJA 4CEHA 3GD7A 1E9SA 2E9SA 3EC2A 2JJ2A 4LHZA 3ZJYA 1JI0A 3NH9A 4QG7A 4B34A 2IF0A 4KHZA 5AUPB 5IF9A 3NHBA 1CJTC 4NYIQ 4BQSA 3AVWA 3VR1A 4R98A 1FQJA 2OFXA 3Q5EA 2V6IA 1D2NA 3RHFA 2D62A 3M6AA 1E2EA 1S96A 1S4QA 1WQ1R 1N6PA 2IK8A 5H8WA 3AVQA 4OI1A 4WZBE 3N2IA 1R5OA 3BWDD 4K46A 4TL7A 2W00A 4FMBB 1IBRA 5FPKA 2ZRKA 4OKSA 1SHZA 1W0KA 2AK2A 2KSQA 3U3JA 4DLYA 4KODA 3KUCA 1D2MA 4G5SA 5UKDA 2IF2A 4B3BA 2ZEJA 1P3JA 4B44A 2VRWA 2Q0HA 4JS0A 1X3SA 4RCYA 4DUGA 4YDSA 4QJ3A 2W0SA 1CKEA 2G1JA 2KE5A 3CRRA 1ZBDA 4NMMA 2H1LA 4A0FA 4YMTA 3BERA 1YR7A 2EFEB 2QTHA 5EE1A 4A15A 1OHHD 3UATA 1T9HA 3T61A 2V4ZA 4D0NA 2VF8A 2JJ2D 5FOUA 4BUJA 2QMOA 2ZI6A 2DYKA 1HA3A 5EUQB 4C0KA 5CK4A 3E5HA 4BLPA 5K8UA 3FWYA 1EX6A 2BC9A 5EP1A 1BO6A 1G3QA 1QHYA 5JS7A 1WCV1 1R8SA 1GL9B 4KVGA 4TQAA 2WJVA 1J8MF 1OLOA 2BWJA 1W0JA 1FP7A 1QVAA 2PL3A 2AK3A 4YMSA 3NBYC 4UNPA 4A4DA 1W0KD 4HUTA 4A82A 2W6JD 4URWR 1ZP6A 3QKRA 2JJ1A 2C9CA 5CJ2A 1TL7C 2WWWA 1UBFA 2CK3A 4DUGD 1G18A 2R62A 4FW9A 4KSBA 1GUAA 5KPJA 2PMKA 1CR1A 2DFKB 3H0KA 2GDJA 2HXSA 4BECA 4HLUA 1N5KA 3GEIA 2ORIA 4AI6A 2OCBA 2ZREA 1Q1EA 4MDEA 2O0JA 2NO0A 1JJ7A 1KI8A 4DCTA 5CJPA 3OZXA 2VP9A 4DLUA 1FNNA 2MSDB 3PUVA 4QJ5A 1Z3IX 4M9SA 1XTJA 2EWVA 2KI5A 4JVSB 3RS4A 2FSHA 1JR6A 1M7HA 3PQCA 3MAAC 3LA6A 1KAOA 3TSOA 4GOKA 2VLIA 3ZS8A 2BMJA 4TT3A 5FTNA 4D0LB 3MMPA 1MH1A 5FI1B 4EJSA 2JLZA 3CO5A 4PX9A 2QQ0A 4B71A 1DAFA 2JJ1D 1YZNA 3AV0B 4KYIB 1SVSA 3PUXA 2I1QA 4J0QA 4Q1DA 3X1ZA 1X86B 4O2LA 1OH8A 3A4LA 4A6XA 2A3RA 1NJGA 2F3TA 2QRZA 4MGIR 4OQXA 2QI9C 4M21A 1EK0A 2RGNC 2ZE8A 5G40A 1YJ5A 1QG4A 3K09C 3CH5A 1CJUC 2FDCA 1T5IA 3AF4A 1F2TA 1NLFA 2XXAA 2QUZA 3WYAA 1UAAA 3PV0A 3DHWC 2W2XA 1JNYA 2ZSDA 1JAIA 5AJZA 1IXSB 5BYJA 3T5GA 3K70C 2AXNA 4X8OA 4CEIA 3DEFA 3K0FB 1NSTA 2IUUA 2CDNA 4NCKA 3S1AB 1TQ6A 3RRZA 3NEJA 821PA 3TW4A 1E0KA 4IDNA 2BEKA 1JBKA 2XEXA 4X8LA 5TY0A 3K70B 5JS8A 2JLVA 3EIEA 4MGZR 1R0WA 4MH0R 5HE9A 1P60A 3FHCB 2W0MA 2XTMA 5C18A 2H92A 1J2JA 2CVFA 1ZM4A 4QHSA 4B2LA 2MMGA 3O8DA 1KDTA 5GJWC 4MQBA 2J0VA 4ZV4A 3BRWD 5H70A 4DKXA 2YKGA 4XD7A 2XNSA 3IIJA 3K8YA 1OFHA 5A5GA 2GTPA 3BFXA 2XOKA 2BDTA 2VF7A 4JT4A 1DAMA 1DAGA 3W34A 4D25A 5JEEA 1W49A 3W6OA 1XBTA 1G64A 2ZI7A 3DOFA 4LPKA 4N0DA 4RKFA 3RS2A 2IT1A 1U8YA 1LB1B 1ZU4A 1PLJA 1EESA 2V3CC 3TSWA 3MD0A 1VECA 2OCAA 4HAYA 4Q4HA 5B57C 3HU3A 2IEZA 4C7OA 3HDTA 3W8NA 2Y8EA 3EPHA 2TMKA 3O8RA 3Q85A 2HLDA 2OAP1 1N0WA 1GL6A 1OIWA 3GQBA 4XVUA 3ZZ0A 2FSGA 4XVRA 4UNRA 3GLIB 4WZAE 4EPVA 2OHFA 4D4JA 3NH6A 4DT1A 2UZ3A 3Q5DA 3NHAA 3RABA 3TLXA 1KK3A 4HAZA 2EFDB 1SVLA 3T5DA 3FKSA 4MRSA 2A5JA 2D06A 1M2OB 1JQJC 2BM0A 5TARA 1M34E 3LVQE 4DHEA 2JASA 2ZS7A 1NKSA 3NVAA 3A37A 1ZD9A 1KKMA 4JIMA 3W6NA 2YV5A 4W5WA 3ZD7A 1OIVA 3RAPR 1TQ2A 5GVSA 2C77A 4MKGA 4TLDA 5J4LA 1L7VC 1TAGA 2RCNA 3RWMB 2IWRA 1H8EA 2J87A 2MSEB 1SXJD 3FHOA 3K0CA 2NG1A 1FPMA 3CRMA 3DM9B 3RSLA 5LPNA 3PEVA 4P4SB 3W9YA 4BRUA 2ORVA 4OQMA 4XTCS 5HCIA 2HLDD 1ZMXA 1CTQA 1KNXA 2ZR9A 1HEIA 3ZQJA 3Q7QA 2WTUA 3QOFA 3KUDA 3KJEA 5CYOA 4B32A 4U02A 1E2GA 1S0UA 2JAQA 4PC3A 3B78A 3QVVA 1X8JA 1KK1A 3IIMA 2O8FA 3ADKA 3ZS9A 1W36D 3RS3A 1Z83A 2DFLA 2WPDA 4G0NA 3FKSD 5CB8A 1G41A 1C4OA 2Z6VA 4U7DA 2D3WA 3MWKA 3BH7A 2ZE7A 2DFTA 4D4KA 5SZHB 3CPJB 4ITRC 3BC1A 1R4AA 1TNDA 4V0OA 3M0EA 2F9LA 4PPFA 3TJZA 2CE7A 3BE4A 1VG9B 2P6NA 1VYUA 3H4MA 4FN5A 2RGGA 2ZI5A 1KSGA 2OAQ1 4JBXA 3THYA 1RFLA 3AVOA 2O5VA 2A5YB 2XITA 3GFTA 4Y0AA 4A0RA 3UWOA 2CL7X 3MG9A 4C0JA 2GCOA 4NL4H 2NGRA 2QPOA 1YR6A 2JLXA 4Q7LA 2R6AA 1XX6A 2JLQA 4OBEA 3TK1A 3BGWA 3PUYA 4Q9JA 1G5PA 4TMXA 5BN3A 5FI0B 4A0HA 2DWQA 1YZUA 4TQUS 4YC7A 4OHYA 1GKYA 2D2EA 5EXTA 3DZ8A 1HQYE 1NF3A 1PLKA 2C99A 4US2R 5F9FA 3WXMA 2PJZA 1NMZA 3RWOA 1W7AA 1OKKD 4JYCA 3AVYA 1E1RA 1NSFA 2VHUA 4MKIA 4I81A 4ARZB 5JMTA 2ONJA 2V9PA 2OILA 2DFNA 2VP4A 2KJQA 2OBNA 4RJLA 1VG8A 4NH0A 2YC2C 2VA8A 3DVLA 4M2LA 4JBWA 2XJ9A 3ZGXA 5L3VA 3AVXA 4TLBA 4QM7A 2ZRIA 1FTNA 2EW1A 2HJGA 2ONKA 3LLUA 4LGMA 3OHMA 2W58A 3QXXA 2GZAA 5TDHA 1RRPA 1DEKA 2OXCA 4KFTA 2ZSBA 1DOAA 3C5HA 4HEJA 4M1TA 2ODEA 1LY1A 2WJGA 3BS4A 4JKIA 2GEVA 3ZQ6A 3DMNA 4RD3A 4M9QA 3A1TA 2ZRNA 4IXNA 1DVRA 1EFRD 3LQRA 1XTRA 2GRJA 2J7KA 5C2JB 1A2BA 4TYYA 1XJ0A 4AG5A 3PEYA 1N6LA 1JR3A 3DMDA 1R5BA 3O8CA 5AJWA 4AKEA 3GMTA 4TN1A 1KSJA 2FFBA 5F3WB 3RC8A 1Q0UA 3D3QA 2ZTSA 3P26A 1BS1A 4M1MA 3HYRA 3FPAA 1S9HA 5EE5B 3GLHB 1NN3A 4C0SA 1PV4A 1RPZA 3GJ4A 1RVDA 2ZRCA 4CT4B 4TMKA 1E0SA 5FTMA 4C0HA 3P20A 4D0GA 1E2DA 5FTLA 5DSZA 4XOIA 2P3SA 5FBWB 4GZLA 5G41A 2JATA 4IDHA 3UWKA 5E4FA 3U7EB 3GLGA 2D7DA 1WE2A 1MT0A 1COWA 3NDBB 4Q9HA 5AUNB 2F1RA 1CR0A 1RJ9A 3P32A 2HCJB 3HWSA 1U81A 3DKPA 3F0TA 4D81A 3AVVA 3VKGA 1H8HA 5GJCA 3VKWA 4M9XA 521PA 1Q21A 1SVWA 4B6FA 2QAGB 3BOSA 3LBIA 1VHLA 2QMEA 1II9A 3BXZA 2O8DB 1FZQA 2H5EA 1P62B 2ZSEA 3LD9A 1U2RA 1SVMA 3LNCA 3ASZA 5ELXA 2GXAA 2WAXA 1ZYUA 2HJVA 4PAOA 2VSOA 4FCVA 2J0SA 3K1JA 4I1UA 3C4JA 4UJ3A 4JLJA 1CXZA 3UPUA 4LY6A 3IEUA 4HDOB 2O8BB 2HUPA 4RFSB 2VHCA 4BEJA 1XFAA 3ICQB 4F4IA 4DEYA 5CIWA 3PUWA 4IRUB 1WMSA 1COWD 1KI6B 3PG5A 3UK6A 1E1QA 2WWHA 5CIQA 5H68A 2FEOA 4L15A 5BN5A 3AQ4A 2FEMA 2VL7A 3KZ1E 1AA9A 2PT7A 1UJ2A 4KVAA 3SBEA 1US8A 5JBQA 4DBLC 2B8WA 4TLAA 2X19A 1Z0DA 4ZPXA 2B8TA 3CIOA 1NI3A 3TRFA 4NYJR 3A6PC 2GVZC 1ZM9A 4DC9A 1KI7A 3AKEA 2VO1A 1YR8A 1SULA 2J46A 3HPRA 3C5CA 1XP8A 2ECKA 3UIEA 2ZAOA 4DLSA 3I8XA 4RD2A 4C4PA 1ELOA 3LWNA 3TUIC 3HYTA 2GVDC 4PR0A 2C9YA 3HR8A 1QHNA 5FPTA 1FP6A 1Z2AA 4KBFA 4UXIA 4DSNA 1XD2B 4ZDIA 2OV2A 4PPGA 4LHXA 5KDDA 1UKYA 2B7BA 4PHFA 5JSZB 2VSXA 2VHTA 3WYFA 4PZLA 3CX8A 4IDOA 1PLLA 2CNWA 3I8SA 4Q9IA 3Q72A 4EQ6B 1Z6GA 2WKRA 3HPQA 2BKEA 2GXUA 4RVCA 3VTKA 3RYTC 5K8LA 1HURA 4AWXA 2E1RA 2N42A 1XTKA 4HAUA 4LBYA 4DSTA 4EAQA 2J7PA 2ZAMA 3U61B 3SQWA 1VCMA 1GP2A 2G3YA 3WMGA 1TPZA 2NIPA 3REFA 3CPHA 4TWZA 5CITA 4LYHA 1C1YA 1E4VA 4DB2A 1KI1A 2GJAA 1P61B 2IYXA 4TMZA 2IYRA 2JJ8A 1E9FA 5FFMA 3K09A 1SXJB 1UBGA 5D3QA 3QIAA 2O8CB 1HE1C 4IFBA 4KFRA 4C9BA 2IX3A 1XCMA 3C8UA 2H7VA 1AKEA 2H18A 1AZTA 4Q21A 3LRPA 1SKYB 5FBVB 1J70A 4AK9A 1NN5A 2RGDA 4CEJA 4DLWA 5KYKA 5KHOC 1NVVR 2J0UA 5IRCD 1CBUA 1E9EA 4ABYA 1M1YE 3KQKA 1IY0A 2BBSA 1YZKA 2CNWD 1J90A 3WYGA 4Z8XA 2GK7A 3LV8A 1G3IA 1Z6XA 3CBQA 2ZS9A 2GBLA 4Q4JB 1GSIA 3BJIC 4LUCA 2VHJA 1I4DD 5CYPA 1OJLA 1TF2A 2QNRA 1G3MA 1GNPA 2QZ4A 3A4MA 2J9RA 3KXIA 3O47A 4GMDA 3TVTA 2AWNA 2JDID 4M4SA 4ON9A 3SI7A 5DN6A 3LX8A 3VMFA 5KTYA 4URZR 5SZIA 3FOZA 4PHHA 3KB2A 3GLFE 4NDZA 2WIBA 3NBXX 4NP6A 3AB3A 3JVUA 4A0GA 1WB9A 2QMHA 1GRQA 4JL8A 4LBVA 4C2UA 5J4KA 1XXHB 1NVWQ 3I3SR 2UZIR 5JFGA 4Q01A 3VU9A 1CRPA
chains in the Genus database with same CATH superfamily
2FJPA 3IQGX 4JLOA 4KQ1A 3ITNA 1AQYA 1TJ4A 5ADUS 4N65A 2I8AA 5EJ8A 4H1HA 3O84A 2IUFA 2V6FA 1JJIA 4Y2GA 3L4SO 2RHDA 3QVOA 1BNCA 2R7AA 4WUVA 5DHAA 3GCWA 3I72A 1XRPA 3B9QA 3Q88A 3RSZA 3ZGOA 5IT5A 4OQ4A 4DZRA 3L7OA 1QS0A 2CBXA 1EFPB 3FNRA 2Y1CA 1G20E 4PYMA 1N0UA 4TWJA 1XVUA 2Z2XA 1C30A 1GAXA 1KKLA 3M6IA 4E12A 2J9ZB 4P9NA 2EKQA 2R8OA 3ZHZA 5LWQA 1L4LA 4PG5A 5DN6D 3BE5A 4OJQA 2PM8A 1ODLA 4P32A 3VV3A 4NFYA 1ZEMA 2ZR8A 3IP6A 3P9RA 3LY7A 3IVCA 5I45A 1KO5A 1XN4A 2B7CA 5K0GA 5KNBA 4DR5B 5E9JA 3IMKA 2W8BA 2B0JA 1ECCA 1Z7WA 3DGFC 1BOFA 1TW3A 3GGGA 1E0DA 4JQZA 4LKOA 1NOIA 4DLLA 3UJBA 3BB4A 2VAMA 3A1NA 4KPUA 1V8PA 1GRRA 1GZ4A 1SELA 2E7ZA 3JARB 4EKNB 1QYCA 2DBZA 3ECSA 3THWB 1NXOA 1XJWA 4B6OA 1JU3A 3ETEA 2YICA 5TB5A 4YAGA 3G2OA 3H11B 4YAOA 1ZJYA 3G68A 2EFJA 4KK3A 4XUGB 3EXEA 4O2AB 3KVRA 4QBIA 2JH9A 3DO8A 4FONA 5CB4B 2WKQA 1V2HE 3T7TA 1PUXA 3CKYA 1I6LA 3PDJA 1E0AA 4ZOAA 4UNNA 1L1EA 3NIFB 4YYZA 5AQ1A 1QLHA 3KJXA 4Z49A 4D9EA 4EG7A 3GUZA 4ANFA 1DC7A 4JL6A 2Z09A 1W25A 2VTKA 3YASA 5F2NA 4C14A 4YV1A 5CX4A 1VJRA 5BV1A 3BXXA 3EMBA 2G5TA 3MSXA 3ULKA 2X5KO 2A7QA 4N0MA 4KO4S 3L7YA 5JAPA 3OE7D 1L7PA 2I2WA 3P27A 1E1CA 3VHRA 4AN0A 1Z2NX 1KI9A 2FWPA 5JD6A 2B30A 4AX8A 4LDJA 2QQEA 2P0EA 4B4VA 3T5PA 2ODAA 2XKJE 4HZUA 4P3KA 4A03A 3P0HA 1M74A 3JTEA 5I9SA 4JI8B 4X8HA 1XEXB 3C48A 3EN0A 2MYPA 2VRCD 3B3GA 3HS3A 2YYSA 3OQMA 1G60A 2C9MA 4J90A 1L8XA 1W5FA 4OD0A 4YFVA 1PGPA 2ZJZA 3N8IA 2YV3A 4I4IA 5A71A 1OYYA 2H2IA 2G76A 2BISA 1A4UA 5IPFA 1M73E 4NH4A 4NATA 3RU7A 4Q82A 3UKJA 9LDTA 4JBLA 5TSDA 1N6IA 4F3CA 1M8PA 3HUTA 2XXBA 4V02A 5JAOA 5L3RA 1JHUA 2VPZA 2AMVA 4FEGA 2C2KA 3RRYA 3RRJA 3NNDA 2XGMA 1JF8A 4TTRA 1MB0A 3A9RA 1SH7A 2OMEA 5JHGB 1P44A 4V0LA 2DC1A 1ZD3A 4TXHA 1OH5A 1AK2A 1R2QA 4LE0A 4EJ2A 1PFGA 2OCXA 1XQYA 3OD1A 4DV5B 3BH0A 1X74A 3PNPA 4TYQA 5C5DA 3CKLA 2NUPB 3EFHA 4WVFA 2Y27A 1VIAA 2Q4BA 2HV9A 4BBPA 1QG2A 2VF5X 5KX5F 1X1TA 5LMZA 4MJXA 2PLNA 5AK6A 3SLKA 2APJA 4V0NA 3I09A 2D4HA 1MG5A 4DMGA 2PZEA 2V9CA 3NIBA 2FSVC 5C1OA 2D54A 3ZC3A 4JJAA 5JRDS 2QD5A 1NV8A 1G7CA 2WSBA 3EDMA 3PC7A 4FXOA 3HZRA 2VUSA 1NUAA 5ICEA 1K9VF 4V39A 5ALOA 1FBTA 1N2SA 1QCYA 3GUVA 3N2NA 1HDYA 1RMYA 3H3JA 1JALA 5TMBA 3H04A 1PJCA 1DIHA 1RWKA 2AFRA 3M2PA 3PZRA 3UQZA 1JPVA 3AIKA 2FEAA 3IBFA 1JWAB 3G2NA 1G8MA 4I7EA 3N0TA 3KJFA 1FP4A 3ACDA 5DNVA 4ZARA 3WJ7A 4U8HA 1G3UA 3UAZA 4HRXA 1F12A 3VNQA 1I3NA 2Y0DA 1UR5A 1BU5A 3Q0EA 4LDRA 1LA2A 3LPCA 4MCIA 1SVOA 4EGSA 3UB3A 4YASA 2R1VB 1OAOC 2YZGA 2B3DA 4ZV7A 1AS0A 1V1RB 1WB5A 5JAHA 4FB4A 3GELA 2OBMA 3LC0A 3EF3A 3OKAA 4YRMA 1NPYA 1V9CA 4HWGA 4EA6A 1VPWA 1L1RA 1ULAA 1NQXA 5HP4A 1YFKA 1E9RA 3CR3C 4LX8A 3QVSA 2JGDA 4ZT7A 2QR3A 2R44A 4GXRA 2X8AA 2GEKA 1YVDA 4F4FA 3BWXA 1GSAA 3SYNA 5HZMA 1X92A 4PICA 1AUOA 1B1CA 2BBOA 4GZ5A 2XYGA 3KR2A 1FRFS 4RTLA 3PNVA 1NBEA 2GD2A 1TVEA 1ULUA 1LW6E 1WDWB 4BNUA 3KAJA 3RLIA 2O4CA 2BGWA 3OJOA 4C0BA 2ZXEA 2RE8A 1J0DA 1RS0A 1ES9A 1OTYA 2ECPA 1BE6A 2WAOA 1QMGA 2L17A 5HX7A 5KYXB 2EHDA 4W5TA 3VR6H 1LS1A 3VO2A 1OWPA 2BKXA 2WNHA 4ENSA 5JOQA 4TYNA 3L77A 4FOPA 1WP9A 1ZM2A 1HMYA 1H0SA 1J6UA 1N1DA 1T2EA 1WV0A 2JFHA 2VDPB 3IPCA 4RKYA 3R7BA 1WXHA 3WWZA 1FSFA 4WK0B 3ELYA 4ZKDA 1YDGA 3AW9A 5A0TA 1UM9A 2GNPA 3T9EA 2O57A 1JTVA 1PEYA 2FGKA 3VBEA 5E9WA 2IZ5A 4Q02A 5FOXA 3HTXA 2JK0A 2MINB 4PG6A 3CJRA 3T7SA 4YJ3B 3OIVA 3T6KA 1BG6A 3WIOA 2NVWA 4HDKB 1YL6A 4YMLA 2WWRA 4NCHA 5HMLA 3G6WA 3UPDA 3VHXA 1TYDE 1VL0A 3LVBA 4M1OA 2YXNA 1UC9A 4G5QA 1PP4A 1CUGA 1VE1A 3HA3A 1ILWA 2CMKA 3LCCA 3LPDA 5J2UB 5IBCA 3ANSA 2ZSFA 4YH1A 1TUBB 4NENB 5C8ZA 1GLGA 4NNOA 3NEYA 5EWMA 3ZJTA 1M2WA 1NVXQ 4LXUA 3U37A 3W2IA 3AFGA 3IE2A 3MCZA 3PCTA 5DM70 4BNWA 3GMDA 3IRVA 5E6SA 1PT8A 4L22A 2CXHA 2J41A 3B2NA 1YA6A 5LQRA 4QWWA 4JHLA 2BJWA 4UMFA 4MA0A 4UQOA 4L2IA 4XIIA 3RT7A 4A8JA 4D9HA 2PWPA 3V7UA 4C06A 1E3DA 3AR7A 4O4LA 4TT3D 2R8BA 4YO7A 3WLTA 3U48A 3VQTA 2CNLA 3JWIA 3IEMA 1V7PC 1ZI8A 3L8ZA 4Y6RA 3A4TA 1H2HA 3OURA 4M49A 3RWBA 4YR7A 3L6UA 3T5AA 3Q7TA 4MAMA 2Y6UA 4C7VA 3O1IC 2ATVA 3V9PA 1LK0A 2FJUA 3KXKA 2XRZA 2GLXA 1ZK2A 2HH9A 4RPHA 4L95C 4KRFA 1CQJB 4DN6A 2OHVA 4HJXA 4PSVA 1MX5A 4LHWA 4CI9A 1IB6A 2GN0A 2Q6VA 1KZ9A 1QIJA 2W6MA 3DZFA 3HFSA 3RFFA 2WJJA 3KD3A 2QGZA 3T1OA 3IUQA 4FDTA 3TI9A 2P91A 1POWA 2R11A 3WLEA 4DRZA 2NV6A 3NBKA 2PMEA 3KQQA 3W7BA 3JWPA 4LWZA 4Q66C 5C35A 1Q1QA 4TLEA 2FPPB 3AF1A 2DHRA 3DV0B 3HB5X 3MTIA 5COQA 5IC5A 5B6PA 1QIKA 3NHUA 3U9LA 1J9GA 1QOPB 3LDUA 4RKWA 4YAEA 1S02A 3AL2A 3H16A 5CA0A 1IONA 4C5AA 1EBUA 1WU7A 4BV8A 3NBQA 2YN2A 4LOHA 2H8KA 3OETA 3ED5A 4N54A 1TQHA 1VSVA 2D2XA 2ZDGA 1SCNE 2YX1A 1U2TA 4KXYA 3HKEB 4OFZA 1U7XA 4BZXA 4MQ5A 4WD3A 4ZQCB 3D4IA 4NBTA 1IUOA 1HXHA 4OXNA 3SC2A 1B6SA 2WD9A 5IMBA 1DEAA 2B21A 1R3UA 3NXSA 4U7JA 4X24A 5T41A 3RI3A 4CQMB 5JFOA 3R0VA 5K0CA 4P6VF 4MVYA 4X93A 3G3EA 4AS1A 1G2IA 4JR0A 1FUUA 4HN2A 1DO2A 2XOKD 1A98A 4G0WA 3QXGA 4PLZA 4CL3A 3U7GA 4YQYA 3U3OA 4JSYA 1SZDA 4V0SA 1M72A 1E32A 4OUKX 3ANLA 4KQFA 4I08A 5ITWA 2C8JA 5IFKA 4D9JA 2JFOA 3B7WA 1WNFA 3L8DA 1S2LA 3QQ5A 4EIWA 1LJ8A 3LDGA 3UWDA 5HUQA 1RU3A 1HNNA 2ZBEA 4XB6B 1R15A 5G3ZA 1FFEA 3U4QB 1Z2PX 1SBHA 3MILA 2PQMA 4YDQA 3CUEF 3FWPA 4M9UA 5B3JA 2FVYA 5ELMA 3WNQA 1GT6A 4P0QB 3RT9A 3IMGA 1RKBA 2HWXA 3HJTA 2PGNA 3BMOA 1W48A 2HRZA 2QTAA 2UKDA 1E3TA 4NCXA 2P65A 4MPPA 5LDDC 1Z2OX 3FETA 2MSKA 1IY1A 1CULC 4GKVA 4HUQB 3AOEA 1N2EA 5LYJA 1YCDA 5FWYB 2Q3CA 1YQQA 1PV2A 3FAKA 4J4BA 4MDHA 4LF9B 3JQPA 1R64A 3OZBA 1V7ZA 3I01A 7REQA 3L0OA 4BKPA 4Y98A 1D4AA 1V4BA 4XWKA 4FD2A 2BR5A 1U1FA 1IN4A 3HV2A 1BD3A 2ZYUX 2ZI3A 3I1FA 3H5AA 3OICA 1Z0FA 1FFXB 2GGSA 7MHTA 2QIOA 4LJLA 1N1EA 4G1UC 2C92A 3ESZA 3SN6A 4O0LA 4LQDA 4BDTA 5JLJA 4E94A 1PD1A 1ZCAA 3K0AA 3PGKA 4RX1A 4PANA 2VNKA 2Y71A 1OW3B 1ISHA 1UIRA 4LJ8A 4QECA 1ZMTA 1IZ7A 2O7SA 1EAYA 5E38A 4KXFB 2JLRA 3OIUA 4ZVOA 4D0SA 1SXQA 3RVOA 3HGMA 3R3JA 5JH7F 1AKUA 5EIBC 1H8ED 1NN0A 3IQIX 1E6UA 3SG0A 4MIKA 2NSLA 2YVUA 4JBNA 3LT4A 3VPDA 5JPDA 3R9XA 2QJWA 5BV2P 3T41A 2A7XA 3AR8A 2PZFA 3KVYA 4G0QA 4NJOA 3V8QA 3DTVD 3L0PA 4AM8A 1JLHA 3D7KA 5DNCA 3KC2A 2R8RA 2GPTA 1MB9A 5CFRA 4FZ5A 1XD9A 3OUTA 2RGYA 1ETUA 5EZYA 3SGLA 1P7CA 3TQIA 4F3KA 1B23P 4NNJA 1ZOIA 4I5IA 4EITA 2QRPA 5KBYA 3OY2A 5ALRA 4FX2A 3OQNA 3FSGA 5BWNA 2HF9A 1AK1A 1C1DA 2WUWE 1JEOA 1QKIA 3TZQA 5M29A 1FMCA 2HK8A 3G2IA 3ZHSA 4ZQGA 3DE2X 5C1IA 3SIRA 2QGFA 3W0LB 4O3MA 4WBNA 4IIGA 1Y8AA 3ZK9A 2I76A 3CMMA 2PD6A 1F2UA 4EFMA 5A3QA 1CJSA 1OC4A 3R8FA 2HC9A 1JAZA 3DFMA 1SWVA 5TVKA 4B7CA 2EV9A 3C6BA 3IHKA 2NACA 1U0HC 1P17A 3DH0A 2YHSA 3HKCB 1HE8B 4WCFC 1KJQA 4ZRMA 3NCTA 4M8IA 1ULSA 2DBVO 3GJXC 3GLHE 3OP4A 4RDCA 1KO7A 1LPBB 3GZTB 4NS1A 4MITA 3K0HA 4ROSA 4L8WB 4WCVA 5AKGA 2QUJA 1KH3A 1Z29A 3PHGA 2MYTA 2ZWVA 3HA7A 1RRGA 3E61A 2ZYHA 3EAFA 4WCFB 4DNPA 4L5JA 5FUMA 5CLGA 2BD0A 4KLNA 2LE0A 3PQ2A 1VLZA 4YT2A 4PLWA 3LO5A 1GAEO 2I78A 3AFIA 3EFEA 5EMHA 5EIXA 1DAHA 1AN0A 2DPLA 2Q9BA 4CQJA 1X9IA 1Y82A 3CLKA 3KR9A 3A27A 3QPVA 1Q17A 1J2RA 3KOOA 1Z6TA 1I33A 2CXQA 3MEQA 4X1KA 5GOTA 3HVJA 4AX4A 4BQPA 3RU2A 3ZU6A 3KQNA 3GRVA 1OZ0A 2NTJA 2O2DA 5EQDA 2P0YA 1OZHA 1P5ZB 3LBNA 2YWJA 1O97D 1RC1A 3MGBA 4JX9A 2FUKA 1H3EA 4GH5A 3ZBUA 1U99A 3IUNA 5JTUA 3Q7PA 5D6OA 1JIUA 3KS9A 2HFKA 1XZQA 1KJJA 3K9LA 1QO0D 3EJWA 1ISJA 3H19A 5CCEA 3G2LA 2J5QA 4EG4A 4X6XA 3RKUA 2G5CA 5LQUA 1E7WA 1UMDA 3BWBA 4K3VA 3OLYA 2B82A 3ZLVA 1U8XX 3L49A 4L9RA 3DAHA 3RBZA 2GNOA 3G79A 3WIBA 3T3IA 3LCJA 4OXIA 16PKA 3MT7A 3KZMA 4P8RA 1EG7A 1UOOA 3LAWA 4GX0A 3WC4A 4BWYA 2QAGC 1ODCA 5JBNA 5F1OA 5G0WA 1NRIA 3ETDA 1O6CA 3MRSA 2Z5FA 3C6XA 4UOEA 4IIJB 1PG0A 2H7XA 2HCTA 2WHXA 3F7TA 3X3HA 2CLCX 2R87A 4NOLA 5AXDA 4WJLA 2B36A 2ORYA 1G7RA 3NWOA 1H2YA 2EP8A 2IU0A 3X2SA 4OP3A 1GPKA 2H65A 4LJKA 2JJQA 3ZDDA 2JFBA 1VDMA 3UN1A 4IJ5A 1F4VA 5CDSA 1SFRA 2WFMA 1C3OB 3AM4A 3GRPA 3BA1A 4DYDA 1NTOA 4XUEA 2WYIA 3V1UA 1OBOA 2ZANA 4UVHA 1VMIA 1Y9JA 3FUVA 4RU1A 5LP6C 4JKYA 2Q2QA 3WP0A 4A2PA 2QM8A 4X64B 3URMA 4KFCA 2JGJA 2F64A 2QP9X 3QHAA 1BU8A 2EJBA 2I2FA 4NY1A 4ZVKA 4C2AA 2C9ZA 2H4JA 1MKYA 1PHRA 2C2WA 2YMLA 4Y7CA 5GJBA 4DCSA 1ZJ6A 2AMYA 1VE7A 1MJFA 4Q16A 5LP6B 4JHXA 1CUEA 3GPIA 4XYGA 4P5DA 3KL4A 1XQXA 1ZSNA 3WL5A 4DIMA 2NSYA 1Q0TA 2R7NA 5I8PA 4MVXA 1OFTA 2HJHA 4F93B 1YOBA 2ZKLA 4LQCA 5AKYA 3TMYA 4CHTA 1MVLA 1M8GA 4Y0VA 4NZ9A 4YRKA 3C4VA 3EDQA 1H8HD 2I6GA 2X0NA 3AZOA 1J1IA 2X5XA 3LT2A 4I5FA 1N2HA 3DO6A 4BMXA 1CP2A 2Z4RA 5CFZA 2BFEA 1HKHA 2JAHA 2RK4A 1YBVA 2BBWA 1EFKA 2G7MC 3IAS1 3IP1A 1NNLA 4IZOA 1N25A 2RHJA 2VDVE 3OEHA 4MYRA 4QAJA 4UFOA 4TTAA 3W3AD 4YT4A 2IW3A 4JC5A 3DLCA 2FFJA 2YWCA 3W78A 4F96A 1R4NA 1E3EA 1D9XA 3FTNA 4Y2RA 4B46A 1H6BA 13PKA 3GFFA 4C4OA 5CCBA 4TTJA 2FE4A 3PD1A 4CM8B 2QV0A 4L50A 2C7OA 3N0VA 2X5OA 3ZD9A 5DGCA 4EO9A 3ZVMA 1JEYB 5BWOA 2GXQA 4QO7A 2R751 4HJRA 5EJ2A 1C9DB 2OYSA 2LRHA 3AL3A 4EVIA 3P9NA 3I30X 2VH1A 5LIRA 2BCJQ 1SIUA 1IH8A 1QIHA 5FPQA 5IHXA 2PZLA 4MW2A 3VFDA 3A6LA 1KYTA 3AI2A 4J0KA 3AINA 1JBEA 1QVRA 3K35A 1WV1A 3QY0A 1VE5A 4G5FA 5EXSA 3NBUA 1KE2A 4ZCMA 1XCGB 3PTLA 3AXSA 4PSUA 3NPAA 1BE1A 4AZ0B 2Q6OA 4H60A 2FFAA 2X0DA 2YY7A 3R5KA 2DHCA 2Z3WA 2XLCA 4LJAA 3DBLA 1R50A 2X2FA 3U5TA 4DWJA 4QXAA 1SXJC 3EMDA 4M87A 4JWKA 1WLSA 5FWNA 5MN4A 2EKZA 4ZI2A 5A3SA 6LDHA 1GCGA 3TWOA 1TD9A 1X9HA 4RM3A 4JGIA 4E3WA 1Y8QB 1F20A 1NW6A 5DHFA 4B6RA 1KXZA 4DR6B 5J58A 3F6SA 1B0UA 1XC7A 1UQTA 1Q0PA 4Y1EA 3K0FA 1KRXA 3ILSA 4FFBA 1U7ZA 4G1MB 4Q4HB 4RHYA 2FPXA 2YUTA 4RVFA 2BMEA 3B85A 4ZD6A 4C7OB 3RNLA 2Q5QA 3I45A 3GEBA 4K2HA 2QT1A 4MKRA 5I7HA 4BO9A 2BGJA 3D7NA 1S7CA 4W5HA 1QC5B 4ZT6A 2PGIA 1NULA 1CNFA 4LZPA 4O4JB 1P1BA 3A3KA 1NXSA 2HYIC 3TE6A 4DT1B 2R5FA 3OU6A 1F8FA 2YWHA 3MJ4A 1RAIA 1RC0A 2XKBA 1N2XA 3PDHA 1CB7A 1G8HA 3PE6A 4P7JA 4XCQA 2H0AA 2V9ZA 1GZSA 3TRKA 1D5CA 4TS1A 1QQ6A 2CJYA 2JL1A 3PVSA 1I7LA 3LXXA 2J7PD 3K5HA 3CV3A 3DGEC 3GUUA 1CQWA 2C96A 5AOVA 1QGAA 2E4VA 2HIHA 4JLDA 4LF8B 3VR3D 4FEAA 5SYAA 5DHPA 2IEIA 3DQQA 3GLUA 4IJ6A 4ZOBA 3RKSA 1TM3E 5G1PA 4WGGA 3PE3A 2FF5A 3GCZA 3ZN2A 3ICEA 1THMA 2A1TS 3HKDB 4KACA 4S2EA 1YE5A 2R1ZA 4IKOA 3QNUA 3A3YA 4L4UA 4NBSA 5ARCA 2WWTA 3KDSE 1C2YA 3N39C 1HYQA 1TZBA 1Y6ZA 2Z2ZA 3U4DA 4WBXC 2ZIWB 1GNLA 1MMFB 1XDBA 2PYZA 2B8NA 3JALA 5CM9C 1E64A 4ZQFA 1E79A 1HFJA 5AI5A 3RSGA 5FX2A 3O3NB 2R2GA 2QNIA 1K5GA 4KOEC 5DNEA 1WQ3A 2FWRA 3KSAC 1N75A 2BF4A 2XJ4A 7AT1A 4S35A 3SHWA 1U0SY 3REGA 3USCS 4X61A 4Q7KA 4AAYA 3IO5A 3H6HA 4DR7B 3AUYA 1VBMA 3KR0A 4L57A 5IG2A 2AJ8A 4MA4A 2OOKA 2DH5A 2OZEA 3CEPB 4OQDA 4RJ2A 5EVCA 1HUQA 1V3UA 3PDIA 1TIBA 3KEGA 3IKTA 1ZMBA 1QVZA 1E9VA 3KOYA 1R8XA 3RCBA 1PIWA 2V8OA 1FTSA 3UJ6A 4F2DA 3QEOA 3HL0A 5F5XA 5TC4A 5BMVF 3CJTA 4PXSA 1RE0A 4BQEA 1U8AA 5K3CA 3OZVA 4A5SA 1X94A 3KHSA 4M1SA 2V7XA 1Y7LA 1ZD8A 1F5NA 2J4FA 2CXXA 1Y1TA 2OUIA 4H3HB 2AE1A 1PO7A 3M5WA 1NP6A 4EA9A 5EJEA 121PA 1KRWA 1ISMA 2HQBA 2IHVA 3E84A 5DLQC 1Y34E 2P2YA 2WM9B 3M9WA 4B6EA 3A9UA 2AN4A 5E1MA 4RQTA 5MHTA 5JWRA 3SMVA 1IK6A 3RADC 1M5RA 4BXOA 2A4MA 3PNSA 1XNJA 4JJ7A 4LZLA 2GVNA 3SIWA 2NU9A 2R6DA 5A2GA 3GT3A 3H2GA 4KU4A 1DBWA 4IO0A 5B58T 3QBTA 3M82A 3UGKA 2HZBA 2W2OA 2XNDD 3KJGA 1X13A 2AIRA 1J2TA 3HBMA 4NOMA 2W6IA 4W5JA 3RHSA 1N5JA 3SKVA 3VU3A 1XPOA 4LPSA 1KYWA 3RRBA 1FYFA 1QFZA 4EF6A 1YDEA 4H7EA 4INZA 1QHEA 1PGQA 2ZCUA 1DMSA 4Q1BA 1YNSA 3C0KA 5BWCA 4XLTA 3LDHA 3PE4A 4V0QA 4O8CA 2FPMA 1ZUIA 1U7UA 2XV1A 3KWJA 3KZCA 4K9QA 5FNVF 1M2KA 1V96A 5FH9A 3OZAA 3BE8A 2BMVA 3RS7A 1MAHA 2J9GA 1VKHA 1NWHA 1MUUA 2EHJA 1Q95A 3EXG2 3FJOA 1U3FA 3K5WA 3BTVA 3QPAA 4IJWA 1I4EB 5HGJA 5K8CA 3S28A 3T1TA 3GBVA 2BE9A 4K6MA 2P69A 1I4LD 3F8TA 3M6XA 3MINA 3S2GA 1TYEB 3GGDA 3KLNA 2CD9A 4FSDA 4L16A 4GLFA 4PYRA 5JO0A 1OLSA 4G8BA 1XPJA 4TSFD 1BVUA 2OHHA 4TX1A 3I61A 3QLJA 2MWMA 4BNMA 3TPCA 1CZLA 3UK1A 3WGVA 2Q6IA 3TCNA 2D1SA 2E6UX 4QICA 4EMBA 3ZH9B 1W44A 1NW7A 2AKAB 2GUGA 1T8TA 3R9WA 2BEUB 1EUCA 1QFJA 1BGWA 4UQPA 4YJFA 3LHDA 2F43A 5BW8A 1GA1A 4YCBA 2NUTA 3GRZA 1DPFA 1RMTA 1EWRA 1YHNA 2VIIA 1AXGA 2GCGA 1YQTA 4RVHA 1A96A 2Q27A 4EI2A 1TAUA 5T64A 3ITKA 1WUYA 4UHHA 3W9BA 4ZI7A 2PXCA 4CLDA 5IDQA 2YW9A 4EABA 1OT5A 3B6JA 4C0QC 4J0GA 4Z3KA 2I4RA 3BKWA 4JB8A 1FL9A 1PRYA 4Y3UA 5A02A 3BB3A 1IUNA 2VP2A 2YQZA 4YDRA 1YASA 2C20A 1ID1A 3BHIA 3GAZA 4JI5B 4RTSA 2MYNA 5JJIA 3GVIA 1DC4A 3N7UA 2QN3A 4UPVA 2HA3A 4DRXB 5HF9A 3R20A 1P9WA 4U0KA 3OZSA 5I7EA 2I34A 5KQGA 1RJ9B 2HO5A 4Q3NA 5JISA 4DMCA 1X7ZB 4X20A 3WAJA 4PQYA 2Q1WA 2V5VA 3ZDYB 4II2A 3G0HA 1YMVA 3Q3VA 3UV7A 2VYCA 4DLRA 3I32A 4EY3A 1TZCA 4LVCA 3IIKA 4DG8A 3ZX4A 2J3HA 4A23A 3L7MA 1X1DA 3W5SA 3FBGA 3UPTA 1H69A 3PHHA 2QE7D 1LTKA 5IHPA 1Z6AA 1EA7A 5JMWA 3QUSA 3VM6A 4FS3A 1AH2A 1SA0B 1K4YA 3NMUF 4WESA 2PCLA 4YMWA 1UBCA 3OAAD 1LFDB 1Y8RB 5DEIA 4AG3A 4C21A 3BZUA 1VYTA 2XVZA 5A4KA 3AEQB 1XV5A 1RFGE 1ZM7A 3JR3A 4P33A 4P2BA 3H1PA 5A4IS 5IP5A 3KXDA 1P4SA 1IM8A 3LPMA 1GGEA 4D4GA 1LBIA 4HQ0A 3WRXA 3H1FA 2CFRA 3DB2A 3FPFA 4KH0A 4R1NA 4RZUA 1EQUA 1IAQA 2SBTA 4MR9B 1YI8A 3E48A 4A8PA 5BUSA 1W6UA 2NXCA 1OSNA 2O3RA 2Z04A 2VLBA 3NHRA 1R8QA 4CM9A 1O0SA 3FNFA 1R0BA 4JYZA 2CC2A 2PBRA 3TAXA 3NHYA 3RJZA 2GLUA 1CSEE 1HLFA 3SZLA 4WASA 4OLFA 2AFIA 4Y9TA 2H63A 1MOSA 2Q6KA 3DOIA 5IVIA 2GF0A 3CW2A 1US8B 4F5YA 3TDNA 3M3PA 4KI7A 4B35A 2ZPTX 2FK8A 2F3RA 3NYIA 3I5UA 3PC8C 5IDVA 3PQ4A 5T8KC 1EIZA 3CX7A 4HZGA 5CGQB 3PQFA 3WOHA 1N6HA 4QTTB 2OO3A 1GCIA 4RELA 2ASEA 3ROKA 1QHIA 4I1YA 2A58A 5AKEA 5DEOA 4GGPA 2FCRA 3HVRA 4YMUA 4K9DA 4LVNA 2JEOA 5JIBA 2CZQA 1B0PA 2HGZA 2QA5A 2Y4OA 3LBYA 1NVVQ 4KNVA 3FI9A 4HS4A 3WO1A 5IKXA 3H2IA 3FM9A 2AUTA 1SZPA 1G66A 4YCDA 1RWWA 3DDSA 5LCXA 4EF4A 1QTIA 1H1LA 2C98A 2GTHA 1SG9A 3D6UA 4M1KA 5JJKA 3LY8A 4KWEA 3VVBA 1RZ3A 2J5XA 1X8XA 3B5IA 5AJYA 3WGYA 2JHAA 2GJ8A 1LSOA 4R71A 3BRWA 2IVFA 2R7KA 4OMCA 3V7WA 3T7DA 3JU3A 3DVRX 1ZNZA 1KY2A 3IT3A 2CDRA 1FYVA 2FSSA 2BGRA 2J59A 1XMVA 3WGUA 3CF4G 1EP2B 1TADA 1IK4A 1A5BB 4MAFA 5KQMA 2CXNA 4EKEA 1OI3A 5FF9A 2GESA 2EZUA 2GEBA 2J3LA 2QN1A 2WD7B 3M7IA 5EIFA 1T43A 1VYVA 1ZIDA 3DPSA 3HJCA 4RF5A 1QP4A 1GFWA 4RTMA 1G7TA 5M5BA 5GPBA 1GIAA 2PKCA 2YHIA 2IEDA 3U31A 5HJ7A 1FS6A 1Y4UA 4GGOA 3GFPA 4H0CA 3WO0A 1A88A 4M0LA 3OSZA 4R9RA 4BFXA 4QTUB 3FMVA 1E4YA 4NI5A 3CLTC 4EKGA 1YDMA 3E35A 3OIWA 2D0DA 2YZ7A 1Z18A 3QWAA 4DRYA 2OKGA 5JDIA 3U7HB 1SQSA 1XLVA 1JH9A 4OHCA 2QLFA 1LLDA 1BX1A 1XD2A 4WFIA 4GICA 1H2XA 4RZ2A 1K5DA 2V7VA 3OQBA 3F8WA 4HEA6 4EG0A 1NVBA 3HSYA 5E2IA 4U9HS 1LC3A 1TGVA 2XMZA 5ES3A 1DX9A 5EIOA 3WJAA 2A94A 5GONA 4YY3B 5I9NA 5LMUB 1W4AA 1ZZEA 1YVEI 3BMNB 4HYTA 1ZH6A 3QLEA 4HP8A 4D9FA 1CVLA 1FX1A 2W7TA 3TD9A 4PX3A 4K87A 1Z28A 1TK2A 2M2IA 2QRMA 1WA5A 3U0BA 1DIBA 5IUNC 2Z30A 5ER9A 4AVYA 1SBNE 3V7YA 3M8KA 3X2EA 5K09A 3IAAA 2WJHA 1CLUA 1YUMA 3E3MA 2ZROA 3E9YA 4DV0B 3EGIA 2BI4A 3QLVA 2GF9A 5HBRA 1UPXA 1GFIA 2P41A 2OV3A 3L9XA 3MS2A 3K1AB 1V35A 3LBFA 1RZRD 3F96A 4AROA 3QOWA 4LW8A 2GCNA 1NUHA 2EFHB 1ZX1A 2J3JA 2PT6A 3C1OA 1VFNA 4O2RA 2FUCA 1PSZA 1H65A 4YRAA 3G5TA 3M4ZA 4FHEA 3L5OA 4L1KA 3RC2A 1B0ZA 2OHJA 3SS8A 1FDVA 1ZGJA 1YGYA 5EWJB 1VHJA 4PYOA 1GITA 1ZICA 1RXUA 1Q7BA 3VU9B 4HAIA 4O8ZA 1WHSB 3VNRA 4DTIA 4UTZA 1QV6A 1YL5A 1NMXA 1MV8A 2OGSA 1KHHA 1DBIA 1M7GA 2WU1A 3E7PA 4RD0A 2OAGA 1NV9A 4ZAGA 5AVWA 3OJEA 4QPPA 2Z2YA 3RB8A 3X1JA 2WUFA 1T6YA 4ETNA 5DBIA 2J6BA 5JY6A 4OQFA 1EFDN 3A06A 4IHQA 2Y92A 1N6RA 2REQA 4EGJA 3KZOA 1A4RA 1IOVA 1ICIA 2BFCB 3Q1LA 3HVUA 4YT8A 2IYFA 2V55B 2WJYA 3QF4B 2FMIA 2HBRA 1EJ0A 1ECJA 2WAAA 2B2CA 1PTJA 3GYGA 1VC2A 1U1DA 5D7BA 3UMGA 3FOEC 1A9OA 3AIMA 4MW5A 4Z5XA 4GFDA 1JMVA 2PLFA 3UOGA 4JT2A 3WBFA 2BN4A 2X13A 2FW1A 4OX9Y 1J5XA 3BFPA 5TQ0A 2X58A 1YJBA 5HG0A 1SUIA 3QPBA 1ZSYA 3ENQA 3NB0A 1YT5A 1JR4A 3VH4A 4ACAA 1XG5A 4WZAB 4D6YA 2PMDA 4QGFA 3S99A 2O14A 5H59A 3I23A 4DR2B 1Z37A 4OUDA 2RKWA 3DF7A 5FL3A 2FZEA 1KYYA 5K3SA 2ZAIA 3SHOA 5C8YB 2QU8A 5C1DA 3T1YB 4FN4A 2O8EB 3SZMA 1R5JA 2PH7A 2ZRBA 1XTBA 3AVTA 4N3AA 5ALYA 5EP3A 2ZJ6A 5LYYA 1M34B 4C05A 1UWLA 1E96A 5HSGA 1A04A 2IYTA 5I3CA 1JEQB 2EX1A 1QQ7A 1DB3A 3LH5A 4LF4B 5E3HA 2ZJ7A 5HCNA 3ZDZB 2G71A 1YWGO 3MMXA 3B3QA 1OKKA 2EXXA 1BH2A 2DU8A 3UB4A 1V7CA 1EFPA 1I3MA 2V0NA 4OHZA 3LKVA 1JHRA 2XZTA 3LWBA 3GA0A 1J2EA 2C8KA 4NG5A 4QKQA 1Z5OA 1TMKA 1IUPA 4P3NA 1QGUB 1T25A 5FPYA 2JA1A 4O2BB 4YALA 1P18A 3HXPA 1UBMS 1UDRA 1UBUS 2BAGA 3NBFA 5L53A 1E89A 4GECA 3RANA 3VNUA 3NW9A 1SUFA 5C7YA 2YYAA 1XD8A 3FOBA 1VIDA 2Q28A 2XZPA 2ODPA 2C7GA 2CEAA 3V6LA 5CVDA 4NBUA 5AW2A 3ZV5A 4IWXA 4DTCA 1H85A 2HPVA 3I4FA 2CVHA 2P68A 3JZAA 3LX5A 4QWMA 3THWA 1KPGA 1N34B 5IVHA 4GYWA 2J9YB 2XWJI 3H11A 4XWOA 2ERCA 2X1VA 4X00A 1BFKA 1Y3AA 3AEZA 4O2AA 1Q0HA 3EMKA 4E6PA 2VQFB 2OCYC 4KN5A 5CB4A 1HOXA 3WDMA 4L7VA 4C5BA 1XZ8A 4RY2A 1S5PA 2BGKA 4H77A 4UM9B 4NICA 3AB7A 4X54A 3F7NA 2B5VA 4K3UA 1QBKC 2WVJA 2I87A 5EXXA 3WWEA 1VE3A 4EZEA 1P0CA 4FYXA 4OXYA 4YR9A 1N9ZA 1K7YA 2D1QA 3QXJA 4QDXA 4CETA 4ZHQB 3GRAA 5DH9A 5MN5A 1GLNA 1E2JA 1Y81A 2VNJA 4L4RA 4HLCA 1W4BA 1JDNA 4O1HA 2VAXA 2PGDA 2YL2A 4YUZA 5BR8B 4QBHA 4JJIA 1ZJZA 4IZ6A 4QRDA 2MMCA 2G7ZA 1ENZA 3QVUA 1NHGA 1HBJA 3QENA 3I9KA 3WSVA 2LW7A 4MUHA 1OFGA 1ZM3A 4ZOLF 2J3EA 3D8HA 2AG8A 2ZIGA 4M22A 2ATEA 2TSYB 2XMPA 3QX7A 1NATA 4OQNA 1XEXA 3U60B 5LWHA 4W99A 1X8LA 4UE6A 1U2DA 4JH0A 4CKEB 4TVKA 2B4AA 4RLHA 5HIJA 5EJ9A 3R7DA 4MKHA 1KZ1A 4BVLA 1KDOA 4DABA 4D96A 1UEXC 3VZBA 4DLKA 2GJSA 5LA6B 2DLCX 3PHBE 5H81A 5K3BA 5JECA 4W1RA 2ZRPA 2MTBA 2XSZD 5T6MA 2EKPA 4K40A 4MQMA 4LOLA 1BW9B 1H2WA 4R6XA 4LRWA 4C20A 1DGQA 4UDNA 2Q4RA 4Q5IA 4CRWB 2J32A 3QWBA 2NO4A 4D2IA 3L0BA 5ENDA 3V33A 1W5AA 3NAQA 3UWPA 3E7DA 3QKRB 3ZCQA 4K9MA 4LX0A 1AIPA 4MRPA 3ER9A 1QZ3A 1X1SA 2HJSA 5CFMA 1KZYC 1MR3F 2ZUEA 3ABOB 5CVTA 2A4KA 4L6IA 3T3DA 4DNXA 2VJCA 3KXPA 4DQXA 1JQEA 5KU7A 3DJYA 2AOUA 1CNEA 1N8SA 2AD5A 3CGWA 1TJ3A 3M4YA 4OFXA 3BXOA 1BVHA 1Q16A 1SNYA 5H80A 1T2AA 1Q6ZA 1X9GA 1XJQA 3TJMA 1JG4A 2IELA 1SMKA 3II6X 3PF9A 4F8YA 3AEYA 4DE5A 4WECA 2JGLA 3CRQA 1EWYA 2YYYA 3LUJA 2FSVA 4O3FA 1WXEA 3EOAI 4EJSC 3C3MA 3AP3A 5I8ZA 2NUAB 5J3JA 1M2FA 2JIRA 3KKOA 3JQQA 5H5JA 4CTOA 1G4UR 1KA9H 2WMNB 3M6LA 5HUHA 4JP8A 3RJTA 3GG9A 3A6DA