3FRJA

Crystal structure of 11b-hydroxysteroid dehydrogenase-1 (11b-hsd1) in complex with piperidyl benzamide inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
262
Chain Sequence
b'QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-Dehydrogenase, Isozyme 1
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Discovery and optimization of piperidyl benzamide derivatives as a novel class of 11beta-HSD1 inhibitors.
pubmed doi rcsb
total genus 96
structure length 262
sequence length 264
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3frjA00
1WVGA 1H9BA 3RUEA 4J1SA 2ET6A 3IJPA 4PGFA 1KVUA 3KSDO 4R1NA 1I8TA 4BL5A 3ONDA 5DN9A 5DNAA 4DXHA 4GWGA 4ZGWA 1C1DB 4JNKA 3JD1A 2CDBA 4YJGA 3WYEA 3PIIA 4DQUA 1U4OA 4RF2A 4HWKA 1QYVA 3EYWA 1MA0A 2FSSA 3DHNA 5JY1A 1BW9B 1GTMA 1SOWA 5L51A 5L4NA 2CZCA 3DMYA 1F12A 1I2ZA 2VTEA 3MOIA 3NRCA 2AXQA 4IMRA 4CQLB 3TNLA 3AW9A 1C14A 5JMPA 4GGOA 2X5KO 4QO7A 3OJFA 4TROA 3ASUA 1L1FA 1DRWA 2JFFA 3HJAA 4XGIA 1FDVA 2VNSA 5LC1A 1HSZA 2G82A 4JK3A 1Y9AA 1XIVA 3NTQA 2NU7A 4FN4A 2NTNA 2VNAA 3BMOA 4DPLA 4B7UA 2A92A 5IF3A 3BHJA 1UDBA 1ARZA 2CD9A 3RBXA 1V6AA 3DOJA 3TSCA 3GNTA 3TOZA 1G0NA 4BGEA 3AU9A 3RAJA 3NV9A 4E2YA 1N2SA 5DCUA 5CEJA 2JAPA 3GA0A 3STHA 5KJEA 4J9VA 4N18A 5T64A 3TZHA 3B20A 1ZSNA 4IDCA 2ZCVA 1BDMA 1YL7A 4E5PA 4XCVA 3NT4A 2H5LA 2UYYA 3EAGA 2JKVA 4L75A 1DHTA 2GD1O 2X9VA 2FY8A 4ILKA 1FMCA 2UUOA 4WCDA 4B8WA 4BGUA 3HDYA 4MVJM 4KQWA 4J4HA 3NT5A 5JC1A 2WTBA 4I9NA 1E7QA 1R4MA 3PXXA 1GEGA 3EGOA 4DYVA 5JW6A 3ZU5A 3A28A 4I5FA 3DBRA 3DAPA 1DXYA 4E13A 2BRUA 1Q7CA 1SCUA 1IB6A 5F1PA 2VWHA 2I76A 4GQAA 2EW2A 1F17A 4A73A 3RCBA 4RVGA 4DPKA 4R4JA 4GLOA 2IZ0A 3GN1A 1X7DA 1H2HA 2XXBA 3HFSA 3NDIA 3WYBA 4B4VA 1SNYA 4QEDA 5AXBA 4YB8A 2I66A 3BMOB 3DXFA 4A0SA 4YRAA 1T1RA 3W8EA 4OSOA 4RF5A 3WLEA 4IDGA 3ENKA 3WGYA 2A35A 2C7VA 4BNHA 1BTOA 4YEDA 4J91A 4I1IA 4F6LA 4JN6B 2ZJ1A 4NK4A 2YV2A 2O7QA 1DO8A 1PZGA 2C0CA 1I2BA 4HNGA 4IUYA 2OFPA 1PWZA 5A02A 5JO0A 1I10A 1KVRA 3L4BC 4Q39A 2Q2VA 2X5OA 3HE3A 4CQLA 3FWNA 3R3SA 4BNGA 2V65A 2RIRA 3LT1A 3UFXA 4NU6A 4QECA 1SMKA 2A4KA 3TJRA 4NBTA 4Y6SA 2SCUA 3N7UA 3WOHA 2PNFA 3VC7A 4BNYA 1H6BA 1Z82A 3FN4A 2J3KA 3ONEA 3O38A 3PWZA 3RBVA 3WJAA 1RM5A 8ADHA 1VJTA 4B7CA 2X7HA 4DC0A 1OAAA 2VZ0A 4B7XA 4QSMA 3GAFA 1N5DA 2GERA 1D1SA 5JY6A 2AEFA 3GT0A 4PLPA 2EGGA 4QQRA 2VYVD 3C7CB 4UEJA 2YHIA 1BXZA 1VRWA 4NNJA 4JBHA 3RSHA 2WD7A 5HRUA 3UAGA 4IMPA 3R3JA 2BFAA 4PVCA 1NPYA 4GKVA 4ND2A 5LDGA 4WGGA 2W2LA 3H2ZA 1P1JA 3GGOA 2QG4A 4FC6A 4JP2A 2E6UX 1ENOA 1VLLA 1WZIA 2NU8A 3U4CA 4B4WA 2EG9A 1JVSA 1GU7A 2E48A 1I3KA 3FNFA 4D7AA 1EVIA 1DRVA 3GEDA 1HLPA 3E03A 4BKUA 1HYGA 5HS4A 5JDCA 1OC4A 1X0VA 4DUPA 2HMSA 2GR9A 4BQRA 4R5MA 2QRLA 2VCYA 1LSJA 2HK9A 1RYDA 1B16A 5L7WA 3KYCB 3MTGA 1LA2A 1FDSA 3IKVA 1DLJA 2PTGA 4NI5A 2BGMA 1ISGA 1J49A 3ZU4A 3E9QA 3PFFA 4PN3A 4YYZA 4XYEA 3PQEA 4RPGA 4ZQBA 1LLUA 1J4AA 1I30A 4KUEA 2IEBA 2Q3EA 2FR0A 4FFMA 3LK7A 3MTJA 5EJ2A 4CLEA 2W98A 2DFVA 4DMLA 3EVTA 3O03A 1NWHA 2P2SA 4NDNE 1NQAO 3PJGA 1A5ZA 3T7EA 1U3VA 3LDHA 3T4XA 1BDBA 2X0JA 4R5HA 5L45A 1E7WA 1R4NA 1IL0A 4P4NA 3ZWNA 4E3ZA 2GSDA 4J1NA 4I8XA 3QWIA 4XR4A 5JDCC 4HFJA 4Z0TA 1H0KA 2ZTLA 4YWJA 1DLIA 1L7EA 5CDSA 2FP4A 3ZZNA 4N5LA 1WLYA 5JE8A 4YPOA 4ZQEA 4C7JA 4WE3A 4CLRA 1R15A 3OJ0A 5L4LA 1QYWA 5JAMA 5BNIA 4CUJA 2RHRA 1BSVA 3AWDA 1DFIA 1NR1A 1GZ6A 1YGYA 3NDJA 3BAZA 3H5RA 3DBVO 3KVOA 4PG4A 4XWYA 4D3DA 1NP3A 4U6QA 1CQJA 1NYTA 2YUTA 3ZWOA 5BSEA 1MG0A 5THQA 5BQFA 2HMUA 2RH4A 2C20A 3GMDA 1I33A 4GL4A 5I7FA 1KIFA 3GVCA 4CMIB 4YAJA 1PWXA 3LYLA 4A27A 4QO8A 4RLHA 1U8XX 5HA5A 4J4TA 1H93A 1UP6A 1DC5A 1EFLA 4GX2A 4WOJA 1CIVA 5A9TA 1NHGA 5DP2A 4A03A 2IZ1A 1R0KA 3PIDA 1J5PA 1N9GB 4BKOA 2DFDA 1EQUA 1T2AA 1ORRA 1UZMA 3SLKA 4I5EA 2E4AA 4R9RA 3V2UA 1HZJA 3ITDA 1CWUA 3AFMA 2O3UA 4D43A 1K89A 1ZBQA 4CV2A 3KO8A 2J3IA 1E92A 3K96A 1F06A 1JVBA 1BGVA 1BW9A 1DIGA 3M6IA 4YJHA 4EGFA 5KJ1A 3DO5A 1SOVA 1OC2A 5AYVA 3FNHA 1XYGA 4FFNA 2VWGA 2FPGA 2YQ4A 5G4LA 3D5TA 1LSSA 4ITUA 5CDGA 2IE0A 1B7GO 1F0YA 1P3DA 4FFOA 4KMSA 4DIOA 1ULUA 4J0EA 2CF6A 2GLXA 4CV0A 4FSHA 2H63A 2C54A 3H9JA 4IPTA 4O0LA 3ADOA 4FFPA 5CDTA 1YB1A 4LN1A 4YQZA 3L77A 2B5WA 4ZQHA 3OICA 2EKLA 3HB5X 3JYPA 4M1QA 4WLUA 4OJNA 1WP4A 4FFRA 4GWKA 4BNZA 1LXCA 2A9FA 2WWRA 1T4DA 4ZVVA 5CEEA 3F4LA 4CM5A 3OJEA 3E5RA 1E6EA 3N58A 2VYVA 2J5RA 3MJTA 2DBZA 3WYCA 1GV0A 1DC4A 1V3UA 3DBRB 3IAHA 3IUSA 5DDIP 2JAHA 3O8QB 1VPDA 4IZHA 3RWBA 1PL8A 4MDHA 3RC9A 1T1SA 2D1YA 4AJLA 1I24A 1A27A 3JQGB 3TOXA 3RC1A 2ZB8A 3E48A 4A5OA 4BO1A 5KKAA 2PZMA 2QRJA 3HDQA 4WNIA 1AUPA 1N7GA 2JJYA 4EUHA 1PR3A 4ZU3A 1MLDA 5A05A 5JCJA 3JTMA 4IGEA 5EQDA 2CMDA 3V1UA 3IMFA 1DIRA 4RZIA 4AJ2A 4XGNA 3NJ4A 3IKTA 4IS2A 3PVZA 3QLJA 1ULSA 3TZ6A 3W8DA 2HK7A 2AE2A 1VSUA 4N7RA 3BYZA 4DVJA 3GZNB 1JWAB 1DJNA 2C5AA 3ZWCA 4WLNA 2IZZA 3KZVA 3H6KA 3K8ZA 4R3WA 3TQHA 4OQZA 3LZ6A 3W4IA 1GL3A 1Z7BA 1HE4A 3KBOA 4TWRA 2NSDA 5JDIA 3KYBA 4R1SA 3ROMA 2OMEA 3K30A 4XEHA 2W2KA 4CLHA 4OKIA 4F3YA 4DRYA 1CEQA 3OIFA 1NR7A 2P9GA 3I9MA 5IDQA 1K6XA 2F00A 1E1KA 1YDEA 2V7PA 4CQMB 2V6MA 1IOLA 2QYTA 3R0IA 3KOUA 1Q2XA 4GAEA 2HRZA 1ZJZA 3NJ8A 1N92A 4Y98A 1AE1A 3OSUA 4I9HA 1YKFA 5TT0A 4E2XA 5ILOA 2OL4A 4XX0A 3IJRA 3HHPA 3QWFA 5KTKA 5KKCA 1CERA 3U5TA 5JCXA 1E77A 2EV9A 2PGJA 3H9UA 2AEJA 3BHMA 3WGIA 4ALJA 2WD7B 2DQ4A 3GRKA 2Y1EA 2QZZA 1GYPA 1QMGA 1V35A 4XGKA 1GCOA 3KSZO 1NHWA 2GPTA 1Y81A 2OHXA 3A14A 5TT1A 2FR8A 1W6UA 4NU5A 1I3MA 3PGJA 4P22A 4B8ZA 3AOEC 1UXJA 3N74A 1C1DA 3D3WA 2WYWA 4BO0A 1AHIA 5JDIC 4BNMA 2GNAA 1ISFA 1NBOA 3QVOA 1GY8A 3D4OA 2Y68A 4DYDA 4YJDA 3I9JA 2BI8A 2JL1A 4IDBA 1U8FO 1M67A 1U3UA 4BKPA 2AHRA 3TF5A 1HYHA 3UF0A 3Q0EA 4Q9NA 3WMWA 1JKIA 1MC5A 4XYGA 1PJ4A 3QE3A 3VTFA 3ZWBA 2JFGA 2PKQP 4AJJA 5I7SA 1HDZA 5G0SA 1GYRA 2DPHA 1HE5A 1NQOA 1QKIA 1Q0QA 2JCXA 3QRWA 3WDSA 5L4SA 4AJ4A 4FPXA 2BI7A 4QXMA 2DLDA 2G76A 4FOSA 4AJEA 2O23A 1E3WB 3VPXA 1LLQA 2GZ1A 3PQFA 4WLEA 4YJGB 5ENDA 1PL7A 3KLPX 1ID1A 4OM8A 4BNFA 3DZJA 5I8ZA 4CM9D 3UHAA 3MZ0A 1RWBA 2XAAA 3FBGA 1DAPA 2AEMA 2PKQO 1P1IA 3GVIA 5FI5A 1ENYA 1YOVB 4WLVA 4DLBA 2RBEA 4BO5A 1A9ZA 2OP0A 4ZQGA 5KNLA 4Y6RA 1G6KA 1NXQA 3B70A 3MJEA 4IM7A 4XYBA 3GZNA 3O26A 1NX6A 5A1TA 5B4VA 4CMBA 3SJ7A 3P5SA 2C5EA 3W1VA 1IZ9A 1E1MA 1F8FA 3JQ7B 1XCBA 2EIHA 2J6IA 4A2CA 2X9GA 4MVJG 3TWOA 1DAOA 4XJSA 1QRRA 1WAMA 3WWYA 4CMAA 3TPCA 2X4GA 3ADPA 4GLLA 2Q1TA 1VKOA 5KOIA 5DF1A 4CLDA 1XQ6A 1YH3A 2HLPA 4H3VA 3GGGA 5JAIA 5COAA 1YB4A 7ADHA 2EERA 3V5NA 5HWSA 1YXMA 4O1MA 4EUFA 1HZZA 3SEFA 4DQVA 2Y1CA 5G0TA 4CMKA 3ZV4A 4YTEA 3PWKA 1ONNA 3ETDA 2OO5A 5I7VA 4BGVA 1RM4A 3WIEA 4Z3KA 1HRDA 3ANLA 3C8MA 4JLWA 1WDLA 2PK3A 2X8LA 4OXYA 4BB6A 1LNQA 3FCOA 3QA9A 1HDXA 2B4QA 3AOGA 1AN9A 5JAZA 1QLJA 1KC1A 4K28A 2JD2A 1E6UA 4YT8A 1WMAA 1KETA 4ZD6A 1ZJYA 4EJ0A 5T8KA 4GSKA 4BGIA 4BOYA 2ZYDA 3QWAA 4IQGA 1Z45A 3WGQA 4NJMB 4TVOA 5FEUA 2Y1DA 3QW2A 2GRAA 4LISA 3LT2A 4M54A 4YAKA 1PGJA 4AJNA 4EYEA 1PQPA 1LDBA 4DGSA 1QP8A 1VM6A 2IRWA 4OOFA 1OZAA 4IJVA 3RKUA 2EHDA 3W4KA 5BSGA 1LX6A 2AMFA 2EJVA 5TSDA 4D3FA 3MWDB 1ZXLA 1I2CA 3AJRA 3PZBA 1XG5A 2B83A 1DIAA 4J2HA 4TVBA 3HN7A 1EUCA 4P4GA 4RF4A 1OBFO 3PWSA 2BFMA 3PRJA 4D79A 1TT7A 5T67A 3ZHYA 3HUDA 1H5QA 1JAXA 4IS3A 3PHJA 5C7OO 1NASA 2GN6A 5T8KC 4GVXA 4OIMA 1R0SA 3F4BA 1B2LA 2G5CA 3ORFA 3GR6A 1Z73A 5A03A 2GZ3A 3HADA 3FPCA 5GMOA 3RU9A 1RYEA 4AJKA 4PLTA 3U4DA 1A72A 2AQKA 4LCJA 3ZHZA 3DZHA 2P4HX 4RCVA 1FF9A 5JSFA 5KWEA 3VTZA 4M87A 1VE9A 3RBZA 1HL3A 4FB5A 3BMNB 1SZJG 1KERA 3H3JA 3MOGA 1HTBA 4CODB 2UV8A 4M8SA 1PR9A 1LDGA 4LCEA 4PLHA 4RV9A 3VZRA 2FMUA 4PG5A 5A3JA 2O4CA 4L4XA 4CLOA 3H4VA 3JQFC 3ST7A 3L6DA 3FR7A 2CSUA 3IQDB 1IY8A 1ADCA 1YRLA 1GPJA 3BMQA 1IHYA 3LLSA 1HDOA 2QHXA 2EWMA 4D45A 2VT2A 5ER9A 2DTXA 2B69A 2ZATA 3GEMA 1AGNA 4BO8A 1ZSVA 1E5QA 4PRKA 5LCXA 2VQ3A 1LTHR 4O6VA 1P0FA 1MG5A 4IQ8A 4JBGA 5THKA 2IYPA 3WGZA 2QZ9A 5GZ6A 4NBUA 5TLSA 4CQMD 1R16A 4EBFA 3DBHB 1LSOA 5DCYA 4QFCA 1E7MA 3UKOA 3SC6A 4KOAA 3G79A 3UGKA 4LMPA 4MIYA 2G17A 1EVYA 2W90A 3UW3A 4B4OA 4E5NA 4DIBA 3WBBA 1PS8A 3AUTA 3ZV5A 2BLLA 1C1XB 1NQTA 1GV1A 4RDHA 3I83A 3ZI0A 3QQPA 3OETA 1WZEA 4XQEA 3K9QO 2YFQA 3V2GA 3UOGA 2NVUA 4XDZA 2VUUA 1NPTO 1PZEA 1VL8A 4E32A 3S2IA 2VOEA 4CMEA 4CM6A 1DFHA 2Q49A 3KYCA 3D64A 4MPDA 3WNVA 5FYDA 3LF2A 4GX5A 3I6IA 1CDOA 3GOHA 3VOSA 4XYMA 5IDWA 3AK4A 3HB4X 2VHWA 4A10A 3K92A 1ADBA 2IYOA 5T5QA 2PH3A 2X9NA 3EHEA 5HM8A 2Q1UA 1NPDA 3TZKA 3V2HA 2PD6A 3ZDFA 2E82A 2P91A 4II2A 1V3VA 2C29D 3K31A 2H9IA 3ETEA 3KXDA 4D0SA 2EKPA 3CZRA 4QUKA 3T4EA 4BMNA 3WTBA 3ZWXA 4GGPA 2EJWA 4NFYA 1ZSYA 3WX0A 2WSBA 1Z7EA 1X14A 1C3VA 4EZBA 4PLWA 8LDHA 3U4IA 2FZWA 2NQTA 3EK2A 2Y0CA 1DEHA 4W6ZA 3VZPA 1KY4A 3BMCB 2HKIA 2Q99A 4J0FA 1DIHA 2DBVO 3WJ7A 3B1JA 2LDXA 5TJ9A 3KLMX 2X0IA 1LBEA 3BTOA 4HUJA 3VPHA 2FRDA 5HBRA 5JS6A 5F5NA 1TLTA 4LSMA 1WXDA 2BHLA 4YJHB 5F5LA 3RI3A 3UUWA 4F45A 3Q6IA 4BQPA 3DAGA 4EI2A 5A9SB 1B8VA 1YONA 2WYVA 1IE3A 3CTMA 3PGXA 4MKZA 4XDYA 1E3EA 5J23A 4UVHA 4BB5A 1B3BA 3C7AA 2Y93A 1LI4A 1UAGA 4XB2A 5L3ZA 3VVCA 4Y6PA 1TA4A 1M2WA 3ZV6A 5TRTA 4CM4B 4G65A 4DL9A 1DPGA 1FDWA 4EEXA 1VJ0A 2OUIA 1XLTA 3F47A 1HDYA 3OM9A 4U0KA 5C3MA 5JXWA 5L53A 4FD3A 3FTNA 5G4KA 1VL6A 1YBVA 5ITVA 1GADO 3COSA 1W0CA 3DMTC 2E49A 4CM9A 4D0RA 4S3MA 4CM3A 1V8BA 4OSPA 4E2ZA 5JAQA 3OQBA 5CPBA 1YDWA 1R4MB 3WGHA 3HG7A 1EUDA 2PGLA 4DA9A 2BH9A 4R1TA 5TNXA 1XR3A 1N1EA 4BNKA 2GGSA 3RUHA 3W8FA 4UUPA 4KWIA 1P33A 2Y67A 5COQA 1U3WA 4J1TA 5CEFA 1P9LA 3ITKA 3LLVA 3G49A 4TRJA 4KDEA 1ML3A 1JN0A 2D5CA 4BO2A 1D3AA 1MFZA 2FR1A 1FK8A 1KEWA 1HDCA 1Y5MA 3ENNA 3PHHA 3H9QA 4WNCA 5JPIA 4FOOA 4YCAA 1H2BA 3ZNNA 2WE8A 3GH3A 3WSWA 1W73A 5IAAA 1FJHA 3PFWO 4MP6A 4GMFA 4NBWA 5ENVA 4RPHA 3HSKA 2VN8A 4H15A 3D7LA 3VH3A 4DBZA 4YT4A 3INRA 4N5MA 5C7LO 1JKJA 5EL0A 2EF1A 1UXIA 3H9GA 4E5MA 3EVNA 1IULA 4W99A 4YAGA 1NFRA 4PLFA 5KJFA 2WEKA 2HQ1A 2XOXA 4NFHA 4RPLA 3DL2A 1PJTA 4IIUA 2RCYA 4Q3CA 1YWGO 1T25A 3JQGA 4RVDA 2DT5A 3VH2A 3VKUA 1ZK3A 4RLSA 4PG8A 3WXBA 3I4CA 1KS9A 4AL4A 4WKGA 1F14A 4E30A 3RC2A 4Y67A 2NVBA 1MC4A 4CM4A 4MVJD 1HWYA 1EBUA 1VI2A 4CMHA 1HT0A 2DUUA 5EESA 3JSAA 5KIAA 4MVJF 3PHLA 4B3JA 3A9WA 3RUCA 1P31A 3ZU3A 1NFFA 3RFVA 5ADHA 4LVCA 4DIFA 3FNGA 3QVWA 4GX0A 3KV3O 5IJZA 4QTZA 4CM8A 2W4QA 3JD4A 1WW8A 4IGFA 4O5OA 4GH5A 5A9RA 3PDUA 1P1RA 3D0OA 3VKVA 4IDAA 2PGDA 5LDHA 4L74A 1Y8QB 5JYEA 3JQ8A 3GHHA 4E33A 4J49A 3IP1A 1D1TA 3KM0A 5AXAA 3JYLA 2JHGA 4DMMA 2NADA 3MJ4A 4ZICA 1IYZA 4KP7A 3UICA 4H16A 3K2EA 5CPFA 1HYEA 2OBNA 4Z9YA 4UVGA 1IPFA 1QLHA 3D3WB 3GC6A 3I5MA 4IY1A 4OGWA 4OO3A 2NVWA 5GZ3A 5ER6A 2ZIZA 2GN8A 3F3SA 1X15A 4BMSA 1R6DA 4EEZA 1PIWA 1X7HA 2HUNA 4ALIA 1KC3A 1OMOA 1Y6JA 1K0UA 4U6SA 1I3NA 4NG5A 1RM0A 4KTTE 3AUSA 2DUWA 3D4NA 3GN2A 1DHRA 1B15A 2GUGA 2AE1A 4NK5A 5EERA 1KEPA 4K6FA 5F3RA 3GDFA 4IQ0A 4YXFA 4HNHA 2ZQZA 3ABIA 2VHYA 4RL6A 1LDNA 1NAHA 3PPIA 3IC5A 1M6WA 2O50A 1I36A 1ADFA 1H6AA 3PK0A 4FGSA 4RORA 1T2CA 3VAZA 3DBLB 1L7DA 2GCGA 4BNXA 4TRRA 3W4JA 3GQVA 3RQSA 3RUAA 2DKNA 3V8BA 3C85A 4PLCA 4HV4A 5DCWA 4FS3A 2J8ZA 4Z0PA 1EBFA 1E7SA 2IXAA 1T2DA 4R9SA 4S1VA 1HE2A 4YAIA 3IL2A 2B37A 3GRPA 1YBAA 3JQ8B 1VJ1A 2BKAA 3MCVA 3IIEA 4YR9A 5TC4A 4XIJA 1E1LA 5DOZA 1ZMOA 4CMIA 3QVTA 4LMRA 5H82A 3B6ZA 1EEHA 3QJ5A 2QIOA 1EMDA 1WPQA 4Y9DA 4NHEA 4J6FA 3S2EA 2XXJA 3WSVA 3INTA 1GUYA 4BNNA 4CL8A 2X58A 2BFOA 1EE2A 4LGVA 2DBQA 2QQ5A 4RDIA 1ZK2A 2HU2A 2HCTA 4TRNA 5KJ6A 1H94A 5TF4A 5L7TA 3PDJA 1PGPA 2I5PO 5COBA 3AUUA 4YRDA 3ANNA 2C2YA 1LQUA 3LVFO 2AQHA 2J5QA 2WJPA 2DM6A 3S2GA 2Z1NA 5C37A 2BGKA 4DLAA 5L9AA 4KWHA 3AI2A 2Y99A 1LRLA 4J90A 3ZV3A 1B8UA 2OORA 3O8QA 5IN4A 3IP3A 2YY7A 2CF5A 1UR5A 2PA3A 3FBTA 3JQ6A 4HFMA 5FF9A 5G0VA 1Q0HA 4BO6A 3FTPA 1EK5A 2D0IA 5B37A 4INAA 1A7KA 2Y1GA 3AM3A 3R1IA 3JCZA 5BSFA 4E31A 3C1OA 3ICPA 4YQYA 1PQWA 3GHYA 4XRGA 3RUIA 3DZIA 1YL5A 3I6QA 3WMXA 2I99A 3X2FA 4JQCA 3K73O 1X1EA 5ES3A 3VH4A 1XEAA 3K5PA 3GG2A 4BNLA 1A71A 1G1AA 1U7TA 4CM7A 5MGBA 2RH8A 3HDJA 3OEWA 1LDEA 2PV7A 4RVFA 2I3GA 3HN2A 1U2DA 5AXCA 4WK6A 2P4QA 1K3TA 2J3HA 2YFHA 3WNQA 3L4SO 4BMVA 5CG2A 5ICSA 2UDPA 4D44A 3G1TA 4JBIA 5T57A 5TJHA 3ANMA 3EDMA 3I4FA 3PP8A 4XQCA 3TZQA 1KEVA 1P0CA 4ALNA 4WASA 4LVUA 3GPDG 3TRIA 1Q0LA 3BMCA 4MINA 2NACA 2EEZA 1KEUA 5CAEA 1JU9A 1PZHA 3B1KA 2YYYA 1JTVA 1LSUA 5H83A 4AJPA 1IZ0A 3ICCA 4PFJA 1UXKA 4B3IA 4RVHA 2JFHA 2CDAA 2X86A 1C0IA 1UAYA 3I9LA 2Z95A 4LSWA 4MJLA 5F21A 4DTIA 5KVSA 2QYSA 4OKNA 1ISJA 4NBVA 5A9SA 4NJOA 1UJMA 2BFPA 4L0QA 3Q1LA 2AW5A 4EITA 2VYNA 2VYND 4YDRA 3RU7A 2E37A 2Z1MA 1UH5A 3RJ9A 3S2FA 3QVSA 4WCFB 1K6JA 4FJ0A 4AICA 3DTYA 2CVOA 2ZYAA 1XQ1A 1SO8A 3L0DA 4BO9A 4ZJUA 4CUKA 4FGWA 3ZH2A 1YJ8A 3WTCA 3CINA 5DBGA 1IPEA 1MUUA 2PZKA 3VDRA 2YQ5A 1RJWA 4JXKA 2ZB3A 1GFSA 1LEHA 1LRKA 5F1OA 3WS7A 4B4UA 4XA8A 4RPKA 4XR9A 3MJVA 1W4ZA 4D46A 1N1GA 2YV1A 1UZLA 4PCVA 1SBYA 3AUAA 5A5EA 2PR2A 2O3SA 4U8GA 3H5NA 1ZH8A 3E6AA 1PGOA 1MXFA 3OQ6A 4PLYA 5DZSA 2RHCA 3Q11A 5DP1A 1WMBA 4PZCA 2HJRA 3DZBA 4RJTA 2X1HA 2EKQA 3CMMA 5BR7A 2F1KA 3GMSA 2W2LD 4BVAA 3U49A 5CDYA 2WMDA 3GVHA 1LRJA 3H3FA 4ALLA 3MJCA 4MO2A 4Z3DA 4ND3A 3JQEA 4RGBA 1UDAA 3VPFA 3DR3A 1ZKMA 3KYDA 2VRCA 3PYLA 3Q3CA 1GPDG 1Y9EA 3TFQA 2JCYA 3QY9A 3BIOA 4K9DA 2GYYA 5AXDA 1M6HA 3KRTA 3BMQB 2Q1WA 3QVXA 5K6AC 1TI7A 1YVEI 2WD8A 1XA0A 5JYDA 4IZIA 3NTRA 5BNTA 3QV1A 3BMNA 1QV7A 3WQRA 1EE9A 3QSGA 1Y8RB 3IUPA 5I7EA 1ZEMA 2DU8A 4CJXA 1QR6A 4UEKA 3AM5A 3LF1A 3PHIA 4JROA 4HY3A 2PD3A 3EZYA 2PWZA 2X0NA 1J0XO 4AJOA 5EMHA 3NDRA 2CUKA 5JFOA 3DEYX 3KB6A 1LJ8A 4BNTA 3RD5A 2G1UA 1H6DA 1DIBA 3QWBA 3WICA 1SAYA 4ALKA 1PJCA 1U7HA 5DBIA 2VWPA 2NU9A 2Y1FA 3RVDA 5L40A 4ND1A 1KOLA 1AXEA 1K6IA 2OP1A 4XJTA 5AQ1A 1KVTA 5CFZA 4FIZA 3O9ZA 5IXYA 2Q45A 5K6AA 3DB2A 3S1LA 4YJFA 1WNTA 1K5HA 4KUGA 3ZU2A 3UXYA 1Z75A 4J2OA 2OXIA 4CR8A 4XKJA 1F8GA 3GGPA 2A94A 3JYOA 4MVJI 3AI1A 2PD4A 4Z0HO 4IDEA 4MVJH 4WOKA 3ZHXA 2B4RO 4UREA 2EP7A 3Q9NA 1ZK0A 5IXSA 3M1AA 4RVUA 3CSDA 4FC7A 3C3XA 3PHGA 3C1TA 3KEOA 3VPSA 1JW9B 1BRMA 2JCVA 1ZFNA 2NV6A 1LU9A 5EN4A 3ZWMA 4L4RA 4FCCA 5C5IA 5JCJD 1E5LA 1O5IA 3E82A 1NVMB 2ZB7A 3F9IA 1GUFA 3KUXA 3GUCA 3HDHA 3JD0A 3NX4A 4NJMA 3SX2A 1ZCJA 9LDTA 2D5AA 3V1YA 4PG6A 3P19A 2I3AA 5U9CA 1GAEO 1IHXA 4HKTA 4O63O 4E5YA 3NUGA 3OP4A 3FI9A 3WBFA 5IDXA 4YVFA 2O3TA 3OBBA 4HFRA 3JQCA 2WYUA 4J16A 3U0BA 4DREA 5TS3A 2Y05A 5JC8A 1M75A 4UULA 3RASA 3G1UA 2PY6A 3DFUA 4NIMA 1MB4A 1XU7A 1U5AA 4DQXA 3ULKA 1FDTA 3E5MA 2R6JA 4HX5A 3E9MA 4AJIA 2G0TA 1S7CA 1Y8RA 3KEQA 4PG7A 4I5GA 1BXKA 2JHFA 2X22A 3PTZA 1XKQA 2YW9A 1QYDA 3ZWWA 5JNLA 2HDHA 1U3TA 4RQTA 1P77A 3EY4A 3ZNQA 4U5QA 4JJIA 1NVGA 1XWFA 4L8VA 1QYCA 4J7UA 1VKNA 1ZVMA 1X7GA 3NGXA 4MIEA 4FW8A 2WDZA 3ROKA 1O6ZA 1H9AA 2VHZA 3OJOA 4RZHA 1JKFA 3CH6A 1CRWG 1ISMA 2VOJA 5DULA 3TFOA 1UDCA 5K9ZA 1A9YA 4Z6KA 2CVZA 3KTDA 3DTTA 3LSYA 5EQFA 2V6BA 3WWZA 1PQUA 2QRKA 1T24A 3VDQA 2CNBA 1T2EA 3L4BA 1I3LA 5I9LA 5EINA 1UP7A 1P1FA 4ESOA 3DOCA 3E1KA 3LT4A 4BV8A 3H65A 4K6CA 1VL0A 2OBYA 4YAEA 4NFSA 4CLOB 4LK3A 3JD3A 1VSVA 4BNVA 4Y8VA 3LT0A 4KQXA 1CETA 4OQYA 1NVTA 4B3HA 3ROPA 3SC4A 4M49A 2YV3A 4PLGA 1UP4A 1EFKA 1K2WA 3D5QA 3D1LA 3JV7A 1H6CA 3EZLA 3OQ1A 3SXPA 1BXGB 1V9LA 2EGHA 1PJSA 3LQFA 2RAFA 1GQQA 2VWQA 4I08A 3AY3A 3IS3A 3RROA 2D4AA 4DWVA 4CMGA 5BSHA 3A1NA 3NAQA 1GCUA 4O59O 3FNEA 2P9EA 3DONA 1YE3A 1BMDA 1HF3A 5AVOA 4NBRA 5U4QA 1OFGA 4DC1A 3ZWPA 2NU6A 2BF7A 3GK3A 5IFLA 3Q2IA 1V0JA 3BTUA 3AY6A 1QORA 4CV3A 1ONOA 4MP3A 3I1JA 3GAZA 1UXHA 3H2SA 1EZ4A 3U3XA 4U0JA 1Y8QA 4GKBA 1TT5A 1VC2A 2HO5A 4AG3A 1P74A 4CM8B 1WDMA 4QT0A 1NWCA 2H1SA 2IDZA 2J3JA 3F1KA 1UZNA 3WQSB 5MDHA 4OMUA 2AG8A 2R2GA 4W82A 3DZGA 2CY0A 2V6FA 3OH8A 2DAPA 3FRJA 1OI7A 3GPIA 2Y0EA 1GD1O 2IEDA 2Z5LA 1I5RA 3M2TA 1NNUA 3QP9A 4L73A 4YACA 4BS9A 1MXHA 1Y5RA 1ZUD1 3OJLA 4XD2A 1N9GA 4ZN6A 3NT2A 4NPCA 4C7KA 1WWKA 3G0OA 4RO0A 3WG9A 3OIDA 5I9NA 1R66A 2IODA 3U9LA 3TL3A 1J6UA 2FWMX 4TZKA 4NMHA 1P1KA 3FSRA 2GN4A 1ISIA 3WLFA 1U9JA 1YB5A 5CG1A 3EC7A 1XU9A 2YDXA 4FQ8A 1ENZA 4G81A 4CR7A 3NEPX 3E8XA 3HWRA 3KHUA 5G0WA 5BT9A 4RF3A 1PJLA 1C0PA 4G5HA 3CMCO 4M55A 4FDAA 3GNQA 3L6EA 3ZWVA 3JQFA 4HADA 2ZTVA 3G17A 4F46A 4ZQFA 2H6EA 3PLRA 3QHAA 3PJEA 3C7DB 3WB9A 3JQAA 2ZJ0A 3GUYA 1S6YA 1X0XA 3U62A 1UXGA 1QYXA 3F1LA 2WM3A 2TMDA 1PGQA 4N5NA 4P4LA 1KY5A 3M1LA 2O3JA 3GZ4A 3NGLA 4XZ3A 3PI7A 5FFFA 5TX7A 1E3JA 3D3EA 4U7WA 2C59A 3ZN2A 4MKRA 2OZPA 3JQDA 4GPD1 1GZ3A 2VZ8A 2CDCA 2YJZA 1O89A 5BNFA 1O94A 2O3QA 3GDOA 1T2FA 2BELA 3MWEB 4GX1A 1CQIA 5B12A 2I67A 5KVQA 2VRBA 2P5UA 1CJCA 5IN5A 3S55A 2HMTA 1P44A 2X0RA 1SB8A 3DBLA 1U5CA 1YO6A 3UH1A 1N7HA 3VZQA 3TDKA 3FF4A 2XPCA 1ONPA 1W8DA 4BKQA 4YRBA 1PU2A 5L95A 1O9BA 1YS4A 5JMWA 1DB3A 4QFDA 2Y1OA 4FR5A 2ZKLA 4TRMA 4D41A 2DBRA 5KVCA 2UVDA 3GLQA 4L4SA 1MP0A 3E9NA 1D8AA 4CMEC 1PTJA 3ZHBA 4YT2A 1EQ2A 3B1FA 4I9UA 4LW8A 5I8WA 2GF2A 5CHEA 3X2EA 4OAQA 3AI3A 4J7XA 3U09A 5A3VA 2WE7A 2HRBA 2ZCUA 3PQDA 1SEPA 3PYXA 1LQTA 3I23A 1D4FA 4AJ1A 3ROQA 5G4KB 3SVTA 4UUOA 5F1KA 5EIOA 4X54A 1TXGA 1NAIA 1XELA 2DVMA 3HZZA 3ONFA 5GY7A 2NWQA 1B8PA 3ETGA 3K2BA 3JQBC 4YA6A 1I01A 2P68A 4R3NA 5CP8A 3RUDA 3MEQA 1QXSA 4CPDA 2TMGA 3UN1A 4Q3BA 1P45A 4Z9XA 3DAFA 1PX0A 3WGGA 1I0ZA 1HDRA 2BGLA 2POQX 4FJ1A 3CE6A 2GO1A 4D42A 1EUZA 1RKXA 2HAEA 1R12A 2ZTUA 4JGBA 3SJUA 3TN7A 2B0JA 4BNWA 1Y1PA 4NQZA 1GYQA 2Y0DA 3Q9UA 1Z6ZA 4JJFA 1DJQA 1YJQA 2YHUA 3K6JA 3UCXA 1A4IA 5GZ1A 4W7IA 4PZEA 3JYQA 3PLNA 2B5VA 3RKRA 1ZNQO 2OGUA 1PEDA 4BNUA 3NKLA 5T6BA 2GDZA 3QIVA 4CV1A 3P2YA 3JQAB 4NR0A 3CUKA 4RQUA 2GASA 4GVLA 5G0UA 1YQDA 3GVPA 2PZJA 1XHLA 3M2PA 3V1TC 3JQBA 1BVUA 4XIYA 1R37A 1MFPA 3BZUA 4KDFA 3WR5A 1NQ5A 2HSDA 1OOEA 4WEOA 4BHTA 4BIIA 4Q3EA 4PRLA 4QX6A 3DMTA 1DRUA 3TZCA 4MVJP 1G0OA 2EXXA 4P8RA 3E18A 4J1QA 2JD0A 2BD0A 3CEAA 3JQ7A 3UCFA 3GDGA 2ZTMA 3GY0A 1WDKA 1U28A 3P7MA 1ZEJA 5B4TA 2NVUB 1E1NA 2YDYA 1DDOA 2ILTA 4IDFA 1Q7BA 1C1XA 5FI3A 1E6WA 1HKUA 1YQGA 3OF2A 4MVJE 3ZGYA 1UUFA 2NUAA 4R01A 1EK6A 5K0ZA 1ENPA 4J3FA 4CR6A 4DBVO 1B14A 3GFBA 4MVJA 1T4BA 3I9OA 4CL3A 2X5JO 2EW8A 4OXNA 4BKRA 4IJWA 3L9WA 5KCZA 3C24A 2PH5A 3I52A 3DQPA 1B3RA 3AOEA 1HEUA 4MIOA 1KBZA 4ROSA 3CIFA 4TQGA 3U4HA 2V6GA 3AY7A 2YHIB 1MX3A 5IG2A 1GZ4A 4E12A 3DHEA 5JLAA 1B26A 2Q1SA 4MOWA 1AXGA 3C1AA 3UVEA 2DC1A 2B35A 2B4TO 3EW7A 3NYWA 3RUFA 4R69A 1Z74A 1GDHA 3FD8A 3H5AA 4H7PA 4NZ9A 4R54A 1DC3A 2FOIA 4ALMA 1EDOA 2VHVA 4Q3NA 2D2IA 4PIVA 3VHRA 1AHHA 4M89A 1KVSA 3DC2A 4XQ9A 4YJFB 1QV6A 3UCEA 1RPNA 3F46A 3IDSA 2NQ8A 4DLLA 1ZK1A 4RPJA 1HXHA 1QG6A 2CVQA 3ZW8A 3GFGA 3BTSA 4HXYA 5IZCA 2P5YA 3L6OO 3TL2A 2HMWA 5A5FA 4RVSA 1U1IA 4I5DA 4E6PA 4TKMA 4WLFA 3BA1A 3GVXA 3RFXA 2VHXA 1YBMA 2PKRA 4L76A 3ZCXA 2BMAA 3JYNA 2AA3A 4P38A 4XYLA 3GG9A 2Y66A 4TKLA 1GR0A 4IDDA 1BXGA 4WEQA 3WGOA 2I6TA 3LC2O 1ZMTA 3R6DA 2Q46A 3F5QA 3DZKA 1JLLA 1XGKA 4ND5A 3WFIA 5KJCA 3T7CA 4Z9FA 3OMLA 4E21A 4JJGA 4WJZA 1M76A 1HDGO 4UUNA 4C4OA 4E5KA 4ZRMA 1MV8A 4XQGA 1TB4A 4ND4A 2UAGA 4OOEA 4BO7A 3GNSA 1C0KA 4LRTB 1I32A 4W7HA 4EDFA 1C0LA 3I3OA 5L7YA 3FR8A 3CXRA 1PGNA 4UEOA 2FPIA 1YL6A 1PS0A 2NTVA 5IZCC 2FSVA 2GN9A 5TGDA 4CLRB 1N8KA 4J43A 2ZQYA 4YBZA 3DWFA 2C82A 5G2OA 2AG5A 2X6TA 4GSLA 1ZZEA 1LDMA 3DBHA 3OA2A 1FDUA 5ILGA 5AOVA 2I9PA 4JX8A 5DT9A 1E7YA 3F5SA 4IJUA 1JDJA 1PJ2A 2W2KB 2Q2WA 4AVYA 1KVQA 2FN7A 1E3IA 2OOSA 4KUHA 3HQ4O 2W8ZA 3AU8A 1JWBB 4R41A 3PJDA 3WIDA 4J7CA 1HSOA 2VRCD 3OFSA 4WCFC 2O4UX 4IIVA 3KETA 1ISHA 2O2SA 4CM1A 1LC0A 1R0LA 1V3TA 1O0SA 1ZK4A 4OYRA 2VUTA 4CMCA 2UUPA 1DBVO 1ZIDA 4GI2A 4A7PA 3HFGA 5TQVA 4UAGA 2NLOA 3JD2A 1LLCA 1BVRA 4EUEA 2DPGA 1E3LA 6LDHA 2XF8A 3GF4A 2J5KA 2ZB4A 5EPOA 1LDYA 4LRSB 3LU1A 2R00C 4IXWA 2FPPA 1DC6A 1PSDA 1FXSA 4HFNA 4KTVE 4FFLA 4EJMA 1KYQA 5ICMA 2AQIA 3KYDB 2QX7A 4F6CA 1P1HA 3EMKA 2ZK7A 3KSUA 9LDBA 3IOYA 5H81A 1T26A 4ZA2A 4TMFA 1ZW1A 4FBGA 4BNJA 1Q1NA 1A7AA 3P2OA 4A26A 1BHSA 2X23A 3DDNA 2C7GA 4WECA 1XDWA 2C2XA 4GMGA 1EVZA 2HJSA 1YOVA 3SBOA 3OHSX 4HBGA 4CUZA 1B0AA 1PJQA 1EDZA 4AJHA 2CFCA 3D4PA 4WCFA 4WPGA 1IUKA 1Y7TA 2PZLA 4DPMA 3MJSA 3PZRA 5FWNA 2FZEA 3OIGA 2DTEA 4E0BA 2Q4BA 3AFNA 5B1YA 2VTDA 4R1UA 1HE3A 1CYDA 1DOHA 3JQAD 1E3WA 4N54A 4OL9A 2R00A 4R51A 5DBFA 5KVVA 1X13A 1YQXA 4B79A 3VZSA 3ZWYA 1PS9A 5U1PA 4HP8A 2NTJA 3OA0A 4E4YA 1TT5B 3ASVA 3JQ9A 3LC7O 4JIGA 1BG6A 1SEVA 4IXTA 4PVDA 5C7IO 1U4SA 3I9KA 4BUCA 1NFQA 1M66A 2VUSA 1PL6A 3OECA 4D3SA 3L07A 3ZNPA 3WQQA 2HK8A 5HTOA 5HS6A 1HETA 3RIHA 2Q4EA 3QWHA 3DOOA 2DTDA 1Q7GA 4IBOA 2D3TA 2LDBA 1JAYA 2Q2QA 3Q2KA 4UVDA 5I9MA 3W6UA 1E0DA 2PFGA 5JO9A 3HNPA 1GQ2A 2I65A 4FJ2A 3ZNOA 3FWZA 1GEEA 3BTVA 4W9NA 4Q3DA 3VVBA 2IXBA 4II3A 1BWSA 4OH1A 1XSEA 3DFZA 1QSGA 4ZRNA 2NNLD 4CMJA 4BNIA 4KZPA 3VH1A 6ADHA 3BXXA 4JCOA 1D7OA 2VZ9A 4TSKA 2C07A 4NH4A 1SPXA 4IINA 4BO4A 4G2NA 1SB9A 4K26A 4M86A 1LC3A 4WUVA 3RFTA 3SLGA 4ID9A 1HLDA 4CLXA 3JQ9C 1EVJA 2Q50A 1TEHA 4URFA 2NM0A 3ZWAA 3A4VA 1TVEA 3I9NA 3CKYA 4MP8A 1CF2O 1DFGA 1NTOA 7MDHA 4Q3AA 4MKXA 5DOVA 4PZDA 4UVIA 3RJ5A 5IZ4A 1ADGA 3DHYA 4CQMA 3WGTA 4W4TA 1LLDA 3G3EA 3A06A 4AFNA 1A4UA 3ZW9A 4UUMA 3CZMA 1E7RA 1PZFA 2B36A 3PEFA 4L9RA 4R16A 4OHUA 3BHIA 4W9NC 1R4NB 4PLVA 3L9XA 5IDYA 1JQBA 3RC7A 3EUWA 1RM3A 3ON5A 2D59A 5ITWA 2GZ2A 3PJFA 4EJ6A 1NM5A 1X1TA 1ZO8A 3W6ZA 3O4RA 2EP5A 2HMVA 3WFJA 2PLAA 1PJ3A 2D8AA 3H7AA 2ZYGA 1GUZA 2AQ8A 2YZ7A 4K1LA 3AM4A 4PLZA 3PYMA 3S8MA 4EW6A 5A06A 2FHSA 3GEGA 1JA9A 3H8VA 4OXKA 3INGA 4UVEA 4J9UE 1U2GA 5JBIA 3OEYA 1DSSG 1MGOA 4E2WA 4XRRA 1LUAA 4ONEA 5A04A 4YT5A 3VPGA 2O2YA 1E3SA 1O95A 3F6YA 1ZXBA 3CPSA 4IJKA 3H9EO 3DZFA 4BV9A 2O48X 5CDUA 4JP3A 4WLOA 3NTOA 2VT3A 3FHLA 4BO3A 4J4BA 1GQYA 3LC1O 1PJBA 1SC6A 2QW8A 4R68A 4GBJA 5A4DA 1O8CA 2JD1A 4TZTA 2O3RA 3FPLA 4ZHSA 4XB1A 5TIIA 2P9CA 5B4UA 2O7SA
chains in the Genus database with same CATH superfamily
3P0RA 2ET6A 1U02A 2KPOA 3IJPA 1KVUA 3KSDO 4R1NA 1I8TA 4URXR 2XYPA 3D59A 5DN9A 5ED0A 5T4EA 1C1DB 5G3ZA 2CDBA 3MMSA 3KHTA 4BNDB 1YVUA 4DQUA 2FPWA 4PYJA 2F1HA 2BZSA 4HWKA 2ZR0A 4RCZA 4W1QA 1E6KA 2W71A 1B6RA 2FSSA 3EQ6A 1XQYA 3HU2A 4LOHA 2O8BA 5AI5A 4FLEA 3EOZA 3TB6A 4HTFB 3B5IA 5JQWA 3KEMA 1I1NA 5LQUA 1X1QA 5GIPE 2JFUA 1BX0A 2ZU6A 1X77A 4BVKA 1H4VB 3B3GA 4X66B 4LFAB 3H8SA 3NRCA 1NVWQ 3QV2A 4WVFA 4CQLB 2PEYA 1E9FA 1K2VN 1OZFA 1QANA 1G3MA 3KT3A 2QNBA 4GWLA 1AGXA 1IC6A 3KLNA 1E2QA 1X7WB 1WSDA 1IY1A 3OMWA 1DRWA 4KE9A 3KR9A 1MTZA 3ANSA 1FDVA 3QELA 1N5KA 1ZD4A 3LHIA 4HDCA 3FUWA 3MQFA 2VNSA 3TLKA 5LC1A 3AG5A 1JHVA 3PGLA 4F9FA 4TZ0A 2IS6A 3A4IA 2AXPA 1YZUA 3VKGA 1Y9AA 1XIVA 4BWVA 3ECAA 3R0XA 3KX2A 2NU7A 1Q21A 2NTNA 2YZNA 3E27A 4OHKA 3B78A 2A9PA 1N2CB 3BHJA 2XUGA 1ARZA 3RPEA 1QH1B 5JNVA 2JARA 1ECPA 1E9EA 3EE6A 3DOJA 3GNTA 3QU5A 1MHPA 2VP4A 4N40A 2ZIFA 2A0YA 5BQPA 2YMMA 2WU8A 4WJKB 4E2YA 1Z4KA 1N2SA 4MKHA 4L9AA 1FYVA 2HF2A 5DCUA 2AJTA 5KTTA 3EFHA 4HT3B 1M3SA 1Q1GA 3OQPA 4HVAA 3WKCA 5IFKA 1MAHA 3ZGVA 3L7YA 1HK7A 2H5LA 2LVBA 1RKBA 2UYYA 4TS1A 2JKVA 3MB8A 4ZOAA 4O4HF 5KOJB 1DHTA 2GD1O 2X9VA 1T35A 1R4ZA 1M8KA 5LPNA 1FMCA 3GLFE 1RABA 3EQZA 4P2BA 1IK6A 4BGUA 2BP7A 2GO7A 1SULA 1H3EA 1DUVG 2QLTA 3J81k 4J4HA 1THZA 1Z22A 2QYOA 1RWKA 1E7QA 2CXQA 2BY4A 2WDPA 1DADA 2O07A 2WTBA 4QBKA 3RTCA 1QF9A 1RMTA 2AOWA 3PXXA 5HFAA 3TBFA 4A8JB 2ZIXB 1JX6A 1G5IA 3G2MA 1Z62A 1H2FA 4RESA 1JXAA 1N2XA 1WB4A 2YINC 4HHEA 1U81A 3DBRA 4OK3A 3UAWA 5AKXA 1Q7CA 3GELA 1SCUA 1UBOS 2QTGA 4X8LA 4IIBA 2WLTA 1QIKA 5KX5F 1JJAA 1XEXB 4RY8A 3W9SA 3NHSA 8ABPA 1I7PA 5E4JA 5EVJA 5HJEA 4GUAA 4NZNA 4F5WA 4WSOA 3G6WA 3JQPA 4UTRA 4ZGGA 1YZNA 5FP0A 1ODSA 1H2HA 1V4BA 2XXBA 3L0CA 4O1IA 4YNBA 4EH1A 2Y77A 1AKRA 1H8HD 4B4VA 4AQDA 1W36C 4QEDA 3TLXA 5HF8A 4EJSC 3IAM6 4ZQCB 1UZAA 3BBPA 4A0SA 4YRAA 1VA4A 2NXEA 3WLEA 1FTYA 5HBGA 3WGYA 5E9WA 1EUDB 2P9ZA 2C7VA 3I8XA 3P4UA 5CT4A 2CSXA 2JF0A 4FFWA 2CYBA 4X7MA 3HY4A 4JN6B 1P2DA 1NBAA 3VDMA 3IJ5A 4RNCA 3OY7A 2O1XA 3P9PA 5A6SA 2OFPA 2YZKA 3KELA 3HJFA 1I10A 4BQNA 1VLJA 3GXBA 1YMUA 1DMSA 1L3IA 2KE5A 5GONB 2X5OA 5EJAA 3R3SA 4PTZA 2G06A 3S8EA 5AVJA 2DCUA 4QNNA 1DKNA 1VMDA 5B7QA 3UXEA 3W5JA 5BV7A 3EPHA 5AKLA 4JAVC 3AHCA 4FMDF 3N7UA 3O2SB 2FSFA 2JLVA 4OI4A 2H92A 3V7UA 3ONEA 4A6DA 1GL6A 1F8YA 2W8BB 3PWZA 3RBVA 3HNOA 4F2DA 2J4DA 5F33A 4B7CA 1FVOA 4EY6A 4RK0A 4FDMA 2VZ0A 3WLAA 2R60A 2D1RA 4NY1A 1O4WA 1WSAA 3TR0A 4LVOA 2QRPA 4B7XA 3GAFA 3FDFA 4MR7A 1N5DA 3GLIE 2GTHA 1JU4A 2H7VA 3LRPA 4TTVA 3Q10A 1POXA 4MXDA 2Y0BA 4QQRA 1WCIB 4UEJA 1C3LA 1GA6A 1BXZA 1EHIA 2GAFA 2PG3A 1ONBA 1MPXA 2B4YA 2CK3D 3RSHA 4JBHA 3RRYA 4C9BA 3EXG1 4IMPA 4PICA 5IAOA 3H8JA 2CB0A 3IBCA 1NPYA 5IK2A 3A0UA 2FJ0A 4Q4LA 3U3MA 3FFBA 2CLLB 4HZUB 1TCCA 2WQ7A 2JVIA 3IMEA 4FC6A 4NPHA 5HQJA 4EUSA 3R5KA 4P1ZA 3SFZA 3OAAA 3KQUA 3VNUA 1MW8X 3DPSA 1ENOA 1NUTA 1VLLA 1T2NA 1LK5A 3ML1A 2EG9A 3K70D 4O29A 1SD1A 1JVSA 4C7OB 4HQFA 3AV0B 2E48A 4D6YA 3PKJA 4HVLA 1OLUA 1WCWA 2IXFA 1QHYA 2I3ZA 2JEOA 1NQVA 2VNJA 3C5VA 4DR1B 1THGA 2WYHA 3H6HA 3SHVA 3CVWA 2XTNA 5BYBA 1YDHA 5JDCA 1YRYE 3ER6A 3IEUA 4BQRA 1V16B 2ZUDA 5BN5B 1Z8HA 3DYIA 2QRLA 3SZUA 4UU8A 5DH9A 3QUCA 1IIBA 2BTOA 5AK4A 2VJPA 5JZSA 4BZPA 1JEQB 2WIBA 2YTZA 4KPGA 1L5NA 3MWFA 4ZEWA 1C80A 4TSFA 3I4LA 3MTDA 1AM4D 3UFXB 2BTQA 4P54A 4PN3A 3E9QA 2QMOA 2HTFA 4QLBA 1C9YA 2ZANA 5KTRA 5BYJA 1EP3B 5DO9A 4EA6A 1JAIA 1I30A 3CZCA 4B3DA 2DG2A 1Z38A 3IFSA 4K0RA 4DMLA 2TYSB 5J3JA 1NURA 4PYMA 1ORVA 3EVTA 1M5TA 1Y3AA 3ABOB 4P3NA 3PJGA 1T6XA 3LBYA 4HRXA 4Y2HA 1NIJA 3ZXUB 4OQLA 2QAGB 2YJNA 1Z83A 4HPJB 1BDBA 1INLA 2P27A 2X0JA 3BWEA 4R5HA 4RULA 4NEQA 3WI7A 1PR1A 2YHBA 3FCYA 1LCIA 2HSWA 1W59A 1M6VB 3ZTWA 3A1CA 2P9QA 4HNQA 1JG2A 2R48A 1C29B 3BWDD 4YJ3F 5FRDA 3TTVA 2G25A 4HWTA 4AULA 4WXYB 4YWJA 1B93A 1XP8A 1VPWA 3WRXC 4AIIA 5JE8A 4YPOA 4ZQEA 5A4JA 1JFFB 4WE3A 4QULA 4XSHA 3MMNA 1R15A 4EHNA 4CLRA 4DANA 5I4BA 1XAGA 1NP6A 1U0RA 1GT91 3PBKA 4AY5A 5L4LA 2XB2A 4G07A 4WJLA 1OT3A 2Z6UA 1G2PA 3SP1A 5TGZA 4EVQA 2RHRA 1DX6A 3AWDA 3VR3A 3D8SA 1DFIA 1FYEA 1NR1A 1GZ6A 4P2GA 3BAZA 3H5RA 2X1LA 1TK9A 5SICE 3FM9A 2OB1A 5LKRA 1EXNA 4OJYA 5DLPA 2WT8A 1DRJA 1CQJA 5CDFE 4ARCA 4JBYA 1MG0A 3C6ZA 1UKYA 4FEEA 4QOGA 5THQA 5BQFA 2HMUA 1E4EA 1F48A 5FIUA 1ZINA 5E9JA 3KD3A 3NBZC 5E6RA 2J0EA 4A27A 4HXGA 1KDVA 1E9CA 1LVHA 1ZIXA 2C9BA 2DJIA 3HB7A 1H93A 4G4GA 3LP6A 4J4TA 4PTYA 2Z98A 4B4KA 4GIBA 4RABA 1EFLA 4YMTA 4KHZA 2IUEA 4WFQA 2ZIGA 4WOJA 1BFDA 1GG2A 1ZESA 5JSYA 1MO3A 3K35A 2FW8A 1ZH6A 2C92A 3NVDA 5DP2A 3OCVA 3BB1A 2IZ1A 1GAWA 1R0KA 4F85A 3QYAA 5EKTA 1J5PA 2V7UA 3WRXA 2J7PD 4XLLA 1W88A 3E3NA 3FDZB 3BM5A 5HZKA 1T2AA 1ORRA 2IDKA 1SH7A 1ZRMA 2ZIEA 2AZ4A 3HA5A 1PG0A 2Z6AA 2WVGA 1PCXA 3V2UA 1QHEA 3WZ2A 1HZJA 1CWUA 1N4AA 3PGKA 1CTQA 2SKCA 1K89A 1CCWA 1TE2A 2NU6B 3A6DA 2EZTA 2BF4A 1LS1A 4JYCA 3UJNA 4DMUB 3K96A 1F06A 1JVBA 1I6KA 1X86B 4UAVA 1REQB 3J80A 3A6GA 2QVXX 1BA2A 3EWIA 1AVTA 2YJ3A 3KZNA 3FNHA 1TKRA 2ZVPX 2VWGA 1QK4A 1EINA 3PXCX 2YQ4A 1XMPA 4K9RA 3GEHA 4UEWA 1FU4A 2OZLA 1VFNA 1DZIA 4B40A 2BFCB 2IE0A 1QVRA 1B7GO 2A59A 3AF2A 4OHFA 1FTQA 1PEKE 4J0EA 3K0FB 4C4TA 5KQGA 4BZQA 4FSHA 1XVIA 1TO6A 5LLTA 1N6IA 4G23A 2QZ4A 2Q7XA 4LN1A 4YQZA 3NXSA 5EXSA 4D9FA 4F9TA 5LZ8A 2B5WA 3OICA 5DISB 2EKLA 3HB5X 4M1QA 4MW5A 2HCBA 4N7MA 4WLUA 1WP4A 3RABA 1JE1A 1ORWA 4EF4A 2HRDA 2F17A 4FFRA 5C81A 2FPXA 4ZVVA 1K7EB 2ZSHA 3QFHA 2AHOA 5CB8A 3ILSA 4JT4A 5EEGA 1CY1A 2DZDA 4JI7B 3EZ9A 3PXEA 1OLSB 3K4PA 3QFTA 3IEMA 3EBOA 1R4AA 3MJTA 3PEVA 1NF8A 1V3UA 4NOKA 4KAJA 3WYCA 2OCAA 3IAHA 3IUSA 4HPWA 5DDIP 5K3EA 1VPDA 1WUHS 4IZHA 1NF2A 3OD1A 3RWBA 1FP4B 4MDHA 2D1YA 4QGAA 2QZPA 2EBWA 3TOXA 4KV7A 2B1RA 4NBNA 3E48A 2IE8A 3OZCA 2IUFA 2JH3A 4OBEA 3SIRA 1SK9A 3HDQA 5KX5B 2AUMA 3HO8A 1N7GA 3NC4A 3QENA 3ZJVA 1PDVA 1QS0B 5CD1A 4W8HA 4ZU3A 2IHJA 3HSYA 1TJYA 5A05A 1NW9B 3CQ9A 4IGEA 2C96A 2IWHA 5EQDA 1GTJ1 1N8TA 1T8WA 2F7SA 2CMFA 2E55A 5C3UA 3EG9A 1E2BA 1DIRA 1XTUA 4RMGA 4AZ0A 3LTEA 3PC7A 3KP1A 4I81A 3IKTA 3PVZA 4OHPA 4NBLA 3X2SA 3QLJA 1WSWA 4MUEA 2ECKA 3WADA 3GW8A 2OTCA 1XDGA 3W8DA 4ZARA 4N7RA 3QFFA 4KIUA 2QUAA 3OD5A 1JWAB 5BSUA 4Y1EA 1AK2A 1XDBA 3TQHA 1H22A 3QG1A 1K8ZB 2JIDA 2V3WA 4R1QA 3TD9A 2D2EA 4FDLA 1HNZB 1Z7BA 2DHCA 3KBOA 4RZQA 4TWRA 2OZLB 2XUJA 4R8KA 2OMEA 4K46A 3K30A 3IAAA 4JP8A 2FX3A 1LVGA 2DQSA 2XUOA 1KO7A 4DRYA 4DSOA 4DR2B 1FFYA 1NR7A 4DLKA 4OX9B 3K1ZA 1S2NA 2GEJA 3V6LA 3HL4A 5IDQA 2DLNA 3CNNA 2RKWA 3MFQA 1K6XA 3ZX5A 1O4VA 4OQNA 5A1JA 2V6MA 4HRYA 1I7DA 2QYTA 5FWYA 4CCAA 4EMTA 2HRZA 2IY9A 5D3ZA 4C6TB 1MX9A 3NJ8A 4D8UA 4F4UA 2JZCA 4MLDA 4Y1FA 3SI7A 1AE1A 3OSUA 1JPVA 3QLVA 4NMXB 4ENPA 3AL0C 4I9HA 4E2XA 5ILOA 1SA0A 3PLAE 4TWIA 3HHPA 3QWFA 4RZ2A 1HTTA 1NMXA 2BBWA 4FNMA 4MUIA 2X13A 3W2IA 3U5TA 1IOVA 4LMAA 4ZI7A 4Z7NB 3HH8A 3BHMA 3BGOS 1Z47A 5AKZA 3IQWA 4XZ3A 5I7RA 4QTYA 4GICA 2H51A 2DOKA 1V35A 2Z09A 4XGKA 1B8OA 3ZE8A 4ZZ3A 5E6UA 1CUIA 1NHWA 2JPDA 2EJCA 3A14A 4ARSA 3W2EA 5AESA 1GQSA 2ZRGA 1I3MA 3O90A 2P6MA 1VBKA 2PH7A 3PGJA 2FXIA 3W79A 4P32A 1UXJA 2OCGA 4YRNA 2E4ZA 2BGRA 2F3RA 3D3WA 3FHJA 3NHAA 4RPIA 3BL8A 4HSEA 1PT8A 1KZGB 1JALA 3KKEA 3QVOA 5BSVA 2HGZA 2CMHA 1NGSA 3FYDA 4EP1A 1ZCAA 2BI8A 1GCGA 3AV3A 3Q2OA 4FZ5A 4CEHB 1T5LA 1T9BA 3AVTA 5CW1A 1J8DA 3ZG6A 2C9OA 4BKPA 3JWHA 5EMJA 1NUUA 3ZWQA 4RS4A 3WMWA 1GLGA 2FKNA 4KLNA 1PJ4A 1Y1RA 2OCYC 2Z04A 3DVAA 4HDRB 4TOIA 4XAQA 3VTFA 1UDRA 5FLKA 3HCBA 4MUFA 4EYKA 3EHDA 3TGLA 2IS2A 5I7SA 1HDZA 1VCHA 4I4LA 1V6SA 3DFKA 5AK0A 3OKPA 2JCXA 4DMGA 4F4DA 4JJEA 4AJ4A 3LXUX 4QXMA 2P2LA 4DKXA 1XALA 4BAZA 4PYNA 2RHGB 5B3AA 3IQFA 4JB3A 3QX3A 1FSPA 1O08A 1FLNA 4YJGB 4M88A 2P6NA 4BC0A 4QPPA 3E53A 3CNLA 1SBIA 4OM8A 4BNFA 1QIMA 1QGAA 2CNOA 2GHIA 3QKTA 3ZTYA 4K40A 3OG9A 4K3VA 2CLKB 3MZ0A 3SS8A 2XAAA 3R8FA 4RACA 1W2GA 1ZWKA 1NVFA 2BDUA 5FTMA 2ZBGA 1L5GB 1PVOA 2AEMA 1XZKA 3PC2A 2A9OA 3C70A 2JI4A 3R8CA 4OQXA 1ENYA 1YOVB 4WLVA 2E4XA 2RBEA 5EE3A 4OI0A 5ALQA 3TE6A 4LF5B 2CLOB 2W0SA 1DKPA 3SIWA 2GRJA 3AINA 1NXQA 1CDDA 4DIMA 4IM7A 3HBFA 5A1TA 4BMXA 5CA1F 4OUDB 3SJ7A 4OREX 1DMRA 2C5EA 1YA6A 1Y37A 4TTIA 1Z5VA 3W1VA 2IHYA 3OE7A 3IHTA 4A2CA 1HY3A 2J6IA 4LC9A 2FXVA 2X9GA 4NCNA 3TWOA 1KJWA 1ZBDA 2MSDB 1DEXA 3CNHA 2VL7A 4XJSA 1FS4A 3S29A 3NNSA 3ZCVA 4CMAA 4YN3A 5LNK1 1NQXA 5JZMA 3HUEA 3IE1A 4Q9IA 1VKOA 2ZAOA 2FQ1A 1O97D 4KWCA 5DLYA 2Q7DA 1ATZA 4N8EA 3W05A 1AMNA 4EZEA 4FZRA 4DG9A 2E5FA 4XJXA 5COAA 4MRNA 1YB4A 7ADHA 1T3HA 3PT5A 4KI0A 2GESA 3NC1C 5FBQB 3LAWA 3SEFA 3UMCA 1FQWA 4BFCA 4E88A 4L4YA 5EJ4A 3AILA 1QQ7A 1W4CA 4OH7A 3M9LA 3ETDA 3F6RA 2MYUA 2E7ZA 1RM4A 3G5MA 3WIEA 4OB8A 4Z3KA 2A78A 3AEKB 5C46F 5E0OA 3C8MA 2E87A 4POAA 2XB6A 3FCOA 1T8TA 3MTEA 1BQEA 1AN9A 5JAZA 3AF6A 4R2MA 2XIJA 1GSOA 1SXIA 3C6QA 3OPYI 4M9RA 5EE9A 4EJ0A 4GEGA 1ZI6A 2AUTA 1KO1A 4NDAA 1X74A 1JDPA 3TW0A 1Z29A 2DWQA 3DTNA 2Q4DA 4EECA 1TAQA 2OXEA 2P9YA 3CYFA 4TVOA 3QW2A 4I4TB 1PFUA 2GRAA 4LISA 3P32A 4M54A 2F59A 1EX7A 4WOPA 1NG1A 4MAAA 5DHFA 5HKKA 2X14A 3ESDA 3ND7A 4BLPA 5HJ5A 1A97A 5IWAB 5HUHA 2EFHB 2HGSA 2R87A 1J8QA 1TJNA 3K6KA 4FONA 2JJ2A 4S35A 4G0QA 2EHDA 5TS2A 4EVRA 1QVZA 3K09C 3W4KA 2F9LA 1JAHA 3K9HA 5TSDA 2H2WA 1HZZC 2O0KA 3BXHA 2CMKA 1KL7A 1I2CA 3A8TA 2J67A 2G08A 4O3FA 3PZBA 2KI5A 1P4GA 1DIAA 2H29A 4J2HA 3N0WA 4AMZA 1P5JA 3G7SA 4TVBA 3N28A 5IKMA 4PQYA 3HMKA 2Q5IA 1G8AA 3O1JC 3AUYA 1NQWA 2BFMA 2WPNA 3OM1A 3PRJA 2Q9UA 4EFMA 2GD6A 2GUWA 3IKMB 3ZE9A 3JZAA 4CU2A 3HUDA 1F6DA 4CEJB 1PZXA 2HYIC 5JROA 1JAXA 2ZLBA 3JAWB 1QG2A 3K7EA 3M6AA 3AC0A 5F4BA 4IS3A 5IEBA 3AKEA 4AZ3A 3GLGB 3RFUA 5CTAA 3F4BA 1DQZA 3MWLA 1B2LA 3ZC3A 1QBGA 3G2LA 3ORFA 4AG5A 4X7BA 1KYWA 1Z73A 3ZWDA 1CQWA 1RMYA 2HPAA 3KQTA 3PUYA 2GZ3A 3HADA 3O8OB 3C6YA 3FPCA 4D8VA 3A6PC 3RU9A 1GTZA 1V37A 1JRLA 4EYQA 1LFAA 2WHPA 3DZHA 3WFZA 4RKWA 4FCVA 1X39A 5BW6B 4EI7A 4YXWD 5KWEA 2FU5C 4Y9RA 2PUWA 4G0PA 4XUGB 5DRTA 4AO8A 1XMJA 4ERNA 4RJJA 4FHCA 3S2SA 4IYJA 3H3JA 4JC0A 3MOGA 1HTBA 4MQMA 4B82A 5J63A 2DFLA 4PO3X 3R4CA 2WNIA 5LQRA 2JLBA 5EI5A 4Z4HA 4LCEA 3TL6A 5LP6F 4EQ6B 4IDQA 3H42B 3PR3A 1GNRA 3FB4A 2O4CA 1ZGJA 1VJRA 3PFNA 5DNEA 1RYFA 4FHDA 3S5UA 3H4VA 3JY6A 4FYJA 4PN7A 4ZZ1A 4ZCPA 5LUAA 3L6DA 5IJ0A 2CNWD 5EJFA 4DAEA 3IQDB 3AXSA 1VIYA 1IY8A 1ADCA 3OCZA 3O3CA 4X93A 3GJZA 4BVFA 4HC4A 3AJ9A 3LLSA 1HDOA 1MTOA 1R9NA 2QHXA 4Q4AA 4WESA 1YK0A 3FOZA 3I76A 2RHWA 1RXSA 1X3LA 2RJNA 4QU8A 2DTXA 3P2MA 2C1XA 3IV9A 4YXWA 4UBLA 1AGNA 3I3SR 1PR0A 1Q17A 2X6QA 4PRKA 5KI6A 4BO8A 2BV3A 2XTAA 4O6VA 3DOIA 1XZGA 3EXEB 5KX5A 3BK1A 1MG5A 3FYUA 3H1PA 4JBGA 3RHSA 3ELBA 2SICE 1J21A 2VHCA 3AIOA 5GZ6A 2X4DA 3U7HB 1C5KA 1Z39A 4NBUA 2PEZA 1T9GR 3SZRA 3DBHB 2GZAA 1LSOA 3GGJA 4EBFA 5DCYA 3RC3A 4YQFA 1NRJB 1PFWA 2NZ8A 4QFCA 3I72A 4PC2A 5ALVA 5KYUA 5AVXA 3UKOA 3JWIA 1CB0A 3C5CA 1YI1A 2W90A 4MUAA 5HIMA 4LHYA 5G1NA 4P82A 2ORVA 2ZJ3A 1PS8A 4F0JA 1KH2A 1TQ4A 2WSLA 4F3RA 3QLUC 4PPGA 3T1VA 1NQTA 3TZEA 3ZCSA 3DH0A 3ZI0A 3QQPA 4XQEA 3Q88A 3V2GA 4YP0A 4EHDA 3RAEC 3RG8A 4QOJA 1U04A 3VU8A 3WGLA 4E32A 5B3JC 4HS9A 3S2IA 5KVAA 4D9KA 4P0QB 4RW0A 3KIPA 1IHUA 2OZEA 1T2UA 3A9RA 3OX3A 3ZW7A 3W06A 2NYUA 4FZJA 1DFHA 4OFZA 3FUCA 3KYCA 3MRVA 3AKCA 1MIHA 3NH9A 2O2EA 4PC7A 3LF2A 5FYDA 5K4AA 3I6IA 1BC5A 3IRUA 1DQYA 4HGYA 1GDTA 3THWB 3OLXA 3VOSA 5K0EA 3KR1A 3FYUC 4L4ZA 5IAGA 3HB4X 4MGEA 2A9RA 4A10A 2GEBA 4QNMA 4LJ8A 4D80A 5T5QA 4QHTA 4XIGS 5DM60 2X9NA 3G59A 5HM8A 3CF4G 3V4RA 3PCXA 4R31A 1NPDA 3UMSA 3GEEA 3MS7A 3M6WA 2OLEA 4ZC8A 3GT3A 3PDCA 4II2A 5FQNA 2IYUA 3ETEA 2BKVA 4JLKA 5AO9A 4XTCS 1C7ZA 1XZNA 3A11A 5DCLA 3CZRA 3QKRB 4F97A 3ZD8A 3WTBA 1XMXA 5D6OA 4GGPA 3ZWXA 2L42A 2WSBA 1X14A 3KKZA 3H4TA 1L4NA 1XQWA 2NV2B 3FNIA 3SJZA 4IF4A 1JB1A 2DR3A 3EK2A 4NZOA 4UOZA 2HZ7A 1DEHA 3VO1A 4KVGA 2QUBA 2O6HA 1RU3A 1IG0A 1P39A 4QOFA 1KY4A 1K88A 2HKIA 2NPIA 2VLIA 1J9ZA 1DIHA 2DBVO 1N5OX 2FH5B 2W6QA 3JZFA 4BCBA 4ZTZB 2VH1A 3B1JA 2VHJA 3VPHA 2DCMA 2FRDA 1UBNA 2HFKA 1QHHB 4HBZA 2R7MA 4PC6A 3L4EA 2BHLA 1KEKA 5F5LA 1DEKA 2P79A 1JNXX 1E2HA 3RI3A 5HF5A 2FMHA 4WD3A 2GAAA 4ASUD 2QE7A 3OHMA 2NPFA 5AUOB 4MKZA 3SX0A 3PGXA 2BL4A 1ZGAA 2EARA 4OF4A 2GPSA 1OWPA 1UOOA 4UVHA 5E8JA 3L6RA 4Q3OA 2VDPB 1CVLA 1JHOA 1NUSA 2IF2A 3H1EA 2VXCA 3HV2A 1Y63A 1RI3A 2G80A 4IH4A 5DN6A 5L3ZA 3TCXB 4Z51A 4GBED 3TI7A 1VPVA 2CYCA 2WU0A 1MPTA 4KQJA 1ACMA 1VJ0A 1VL5A 2L69A 3L0SA 1C4WA 4G3XA 4G8BA 1UJ5A 3JARB 4U0KA 3RG2A 3V8VA 5JXWA 3DDCA 1SGWA 3JRWA 3FTNA 4O2BB 2IVZA 5G4KA 5ITVA 3DMTC 4UNRA 1W87A 2I1WA 2IYXA 3TKLA 4CM9A 1QDUA 3JS5A 5LA6A 3RT9A 2ZYHA 1E61A 4M1TA 1CY4A 2MT9A 4KNWA 4OSPA 5JAQA 4CM3A 5DBHX 4E2ZA 3CX8A 4NCAA 5BOVA 4JFRA 1XZFA 5DYIA 3X1WA 2M1ZA 4BX9A 2RG7A 1JQ5A 1MOQA 2BH9A 1T5HX 2VA9A 3A9SA 1N1EA 3HJRA 5DX0A 1U28C 2GGSA 2FRDC 4JA2A 2H48A 2WWIA 1P33A 3B38A 4KWIA 5K8TA 1VXRA 5I7OA 3D4LA 1IQ0A 4JUBA 1P9LA 3ITKA 3LLVA 4CT4B 5CA0B 5KTOA 3BWMA 3KHSA 2C2KA 4KDEA 3WSTA 4BO2A 2I1QA 4NJEA 1VKRA 1X80A 2FR1A 4L5BA 1FK8A 3V4VB 2X8JA 4FEAA 1Z2AA 4PU0A 4Q12A 4YGXB 1UWVA 4B2LA 1B0PA 3ZNNA 4UM7A 4UU7A 4JD5A 1JIVA 3EXIA 2VPXA 4MP6A 3NP9A 1NBWB 5K0LA 4E08A 5ENVA 4ZHQB 3QX8A 2J9FB 3AH8A 3HSKA 3HWX1 3L0IB 3KL4A 3B3FA 2OECA 2YCBA 4EUKA 4YT4A 1OSNA 4NZYA 4OLJA 3ZD9A 3LW8A 3GIWA 4RH0A 4C4XA 1H5NA 3KPWA 4V24A 4EMUA 4WBNA 3LGAA 4UJ5A 2LPMA 4N5DA 4V0MA 3D4IA 1L7AA 4M8IA 2JB9A 5EWLB 1ESMA 1DKRA 3EVNA 4G0ZA 5EIWA 1NFRA 4OK5A 5FOXA 4YAGA 1VG1A 2WEKA 4B87A 4N5HX 2XOXA 4JSRA 4NFHA 4ZALA 3W7AA 1XZQA 2PZEA 1R3DA 1YWGO 1T25A 4IXMA 4UXJA 1YD7A 2DT5A 3VKUA 1ZK3A 3FVWA 3B3JA 1J90A 3N70A 4D02A 2QSZA 3I4CA 4MITA 4DJ5X 3P8ZA 1UDWA 4X44A 4WKGA 1F14A 2VP3A 1EIWA 4TUYB 1MC4A 2QI9C 3DEFA 3TJMA 2F62A 2J87A 1HWYA 1EBUA 1VI2A 2DUUA 5EESA 2J59A 4E1AA 4MVJF 4B3JA 2RGGA 5IH7A 3D3KA 1T5BA 1O95D 2PTHA 2YFKA 3WHIA 5H7XA 3AR4A 4LVCA 4DIFA 3FNGA 1AMUA 4MHTA 1RQLA 1KRXA 1WPRA 3WA7A 2HLDD 3FCEA 3IPLA 4UBKA 1O6BA 3KE9A 5EYPB 4H18A 2VAPA 3BILA 2CHVA 1WW8A 4F6RA 5KU7A 1RT9A 3D0OA 1AQNA 4C7BA 2PGDA 5IW8A 3HZOA 4EG1A 1Y8QB 1J8MF 2I8LA 4XEUA 4DARA 1T6YA 3OWXA 3IP1A 2PUAA 4YONB 3PXGA 2RGAA 3KM0A 5AHKA 4E2FA 1XJWA 3F8WA 4H77A 4ZVTA 3T35A 3AJAA 1HM5A 2BJHA 1TCBA 1V7ZA 4O2AB 1L7PA 2ZAGA 2YJ6A 2R7NA 4YQEA 4D5EA 3EULA 5AVKA 4JJ7A 1P9WA 2GN2A 2BFNA 5CPFA 3QW4B 3EX7C 3W5AA 3L04A 4C6SA 2OBNA 2XA9A 5JR3A 3GLHA 3I5MA 1JSZA 5BW4A 2H2FA 3PI6A 1KTIA 2AIRA 3N2NA 4HI0E 3BD9A 4H1VA 4BMSA 1CW2B 1U7OA 4F12A 5I3CA 1DQNA 1TRKA 5AWFC 3KKMA 2Y3IA 2HUNA 5SZKB 3EGWA 4B73A 4DZZA 4HTFA 1N5JA 1K0UA 5LU9A 2W2TA 4E07A 2GCNA 1IZZA 2VK2A 3D4NA 3GQBB 1Z3CA 3VR5H 4YRRA 2I6QA 1KEPA 3GDFA 4YXFA 1N3LA 2P6PA 1COWA 4JR1A 4O0MA 8ATCA 4MHSA 2QXTA 2ZTHA 3PPIA 1IDOA 5FBRB 1I4OA 1ADFA 1DXHA 4U5XA 4CCWA 2CUNA 4NFLA 3LIIA 3LUCA 3PDIB 4RMHA 3E58A 1T2CA 5HMMA 3VAZA 5IUJC 3QPWA 5E95A 2GCGA 2WPDD 7REQB 3W90A 1DE0A 2I2XB 4Q7EA 4BIMA 3RQSA 4ZI3A 1C1YA 4MW9A 5K05A 1RXCA 1ZIPA 2HF9A 3DYVA 1U31A 4P7GA 5C8YF 5KYKA 2A0XA 10MHA 2NX2A 2LKDA 1PNVA 4KBFA 1DDGA 1TYDE 1SKUA 3UAXA 3PCRB 1DI0A 3MBIA 4Q05A 4ND8A 1XA3A 1G9SA 1E7SA 3BPSA 2E89A 2J6BA 4S1VA 4CG2A 3N1UA 3FZNA 2NG1A 2R5FA 3IL2A 1KO8A 2FRVA 2B37A 3GLTA 4DB4A 2WSSA 3JQ8B 3AJ8A 1YCHA 4PYQA 1VJ1A 2X0EA 2GXAA 1G9XA 1T10A 2MWMA 2YL2A 4XIJA 2GNPA 1ZMOA 2GK7A 3NBAA 4YMSA 3B6ZA 3ME5A 3IXQA 2QIOA 5HIKA 4Y9DA 3FG9A 5CHYA 3AHFA 3KOZA 1ZNYA 4NHEA 2AD1A 3URKA 1SBTA 2LE0A 3WSVA 4GYYA 4BNNA 2X5NA 4CL8A 1E2NA 4Z5XA 4FT2A 4LGVA 1HL7A 2DBQA 5LMZA 1XNGA 2DUNA 1KOFA 4ZYYA 4JI0B 2NZJA 2O7RA 5COBA 4U2DA 4GM1A 5ADWA 1G38A 3AMVA 2C2YA 1DJLA 4KN8A 2WJPA 1ZHHA 2WJAA 4ZVSA 4ENWA 2KLHA 2BGKA 4NCXA 4BASA 1KEEA 3LKBA 3PUHA 2BCJQ 1OX6A 3M4YA 4DLAA 4A8JA 5BV1A 2FPUA 2QX4A 3UMBA 4KWHA 1J2EA 3EXFA 1LRLA 5CX1B 3UJ3X 1MABA 1B6TA 2FW0A 3QE4A 3GDWA 1P4HA 4R81A 2PA3A 5G0VA 3FBTA 4BO6A 2M6SA 2O2IA 3SBEA 3SZ3A 3VSCA 2ZZNA 4OTZA 5E8RA 2FPKA 2PS0A 1HE1C 5B37A 4FHZA 4INAA 4F56A 4XQ0A 5PGMA 1YB2A 4HWOA 3SD7A 3R2JA 3OM8A 3I2KA 3R1IA 2OGTA 1KDPA 3JCZA 1RJ9B 4UTNA 3K0FA 3V7FA 1CZKA 2ZRAA 1PQWA 4ZVMA 1CK4A 3DZIA 4QLAA 1AGPA 5LYJA 3V3KA 1HA3A 2IYFA 3K73O 1U8AA 2GOYA 3R20A 2D3WA 1L5VA 3GFSA 4YRGA 1FDRA 4XWTA 3DBOB 4BNLA 1Q44A 1IQRA 1G1AA 1U7TA 1WUYA 3O94A 4NVRA 3K9NA 3EF0A 2PRIA 2GHRA 4MMYB 4RVFA 2CLMB 3KQLA 4XIFA 4DKJA 1N6LA 1JIIA 1X1AA 1Q0ZA 2R8ZA 1E60A 1DELA 1G20E 5ICSA 4MQBA 2ZJOA 2NTEA 4JBIA 5TJHA 4HUQA 3ANMA 2YMPA 3PP8A 3U7FB 1AQIA 1XI2A 3P9XA 2G4VA 1N0IA 2REQA 4R83A 4WASA 3HU5A 2AI3A 4PBSA 3GPDG 4I7EA 5C8ZA 5K6TA 4ZOLB 3TSAA 1DQRA 1Q0LA 3N8NA 1U0LA 4MINA 2EEZA 4BNDA 5CAEA 1VI5A 1JU9A 2WPDA 3CZAA 7REQA 4RTPA 1JTVA 5A0VA 3B5EA 3I45A 1VCIA 1GXSA 2PLRA 4EMSA 5BV8A 2EFJA 4PFJA 3USZA 1UXKA 4AZ3B 1QP7A 2HJ9A 2HSGA 3N6RA 2RGUA 3RF7A 3JZDA 1VLZA 4MJLA 1D2EA 3EARA 3I28A 4R40A 2VS1A 2ILVA 4INJA 4NBVA 3PEYA 2VPYA 5F64A 3UT5B 1UJMA 3O8OA 2LCIA 2BFPA 2EFEB 3H4IA 2AW5A 4HDKA 2XDQA 2VIIA 4L0QA 4BN5A 4E1VA 2XCIA 4R7TA 4UNQA 1PR2A 2AG6A 2AX4A 4HQKA 4UFOA 2G6TA 3RU7A 1RJEA 5C4GB 4X64B 2H1OA 3VNVA 2C00A 3U1VA 3VR0A 3RJ9A 3QVSA 1O1YA 5D87A 1Z35A 2D5BA 2IYVA 2ZRNA 5EJIA 5JVDB 4AICA 3JXEA 2CVOA 5ARBA 1YK1A 2BSQA 1M1YE 1J70A 1BYUA 2IUUA 3KSMA 3KQHA 1X7XB 3D7MA 1PEAA 3MJRA 4CKCA 3C5WP 4MYUA 1XZCA 4NCIA 1NUQA 1ECFA 2G04A 1V45E 2X77A 2YN0A 1JILA 3AEYA 3VDRA 4MW6A 1M2OA 2GFHA 1KZ7B 4BAUA 1CUEA 4XA8A 4GDMA 4D9IA 4KCGA 4MWBA 1EXMA 2CJPA 4ND7A 1LPNA 5FWYB 4V1CA 2GD0A 3UMRA 1UZLA 1S02A 4PCVA 2GM3A 3SSNA 3TLMA 3AJEA 2VRWA 3AUAA 3K9GA 4J94A 3LUBA 4X45A 2O3SA 4U8GA 3H5NA 3N3BC 3WIVA 3NHYA 4F8EA 1JHUA 4HDMA 5AJHA 4FVTA 2J3LA 3OQ6A 4PLYA 5DZSA 5JCOC 2IXGA 2NUTB 2RHCA 3Q11A 4I66A 2HCJB 5AIBA 1GP2A 1CD5A 2PJZA 3SYMA 2Z56A 3K0BA 2EKQA 2WJ4A 4KH1A 4OM7A 3PQ4A 5BR7A 2F1KA 3GMSA 1OU0A 1SM4A 1W5TA 4UZEA 3U49A 4AF7A 1LTQA 2EZ4A 2ZP1A 4REOA 3H3FA 5MFPA 4C7VA 3LW7A 4Z3DA 5ED4A 2HIMA 1YI0A 2VF7A 2R3SA 4ND3A 1P4JA 2P35A 2A14A 3NTUA 2QR2A 3I92A 4RGBA 1EJ2A 1OLOA 2WT4A 5FV7A 4LSGA 1GPDG 1RAIA 1RHJA 1VE6A 3W5CA 2WG1A 3DA8A 4RTQA 3THOA 2K2WA 1JSRA 1DTWB 1RPJA 1U2GC 3AR6A 3EXHB 1MA3A 4DNPA 1VKHA 1UKZA 2GEDA 1J39A 1M2GA 1QH1A 1SJ9A 1ZY2A 2F1RA 2PJUA 2PX8A 4Q5IA 5CFLA 2HREA 1O95C 1TIBA 3TSWA 1KWGA 3OEED 1G6HA 4L9WA 3QVXA 4JCCA 3QK7A 1TI7A 2UZ4A 3OFVA 2GTPA 3A70A 1YVEI 3R7LA 3AVWA 1T8RA 4HB3A 3UJCA 2VDRB 4Z8XA 3BIWA 1JYEA 5ALIA 5LYYA 2FPOA 5LXTA 4FHGA 5EJMA 2WJHA 4MQEA 2BEVA 3QSGA 2PMFA 1Z26A 2QQGA 1SUSA 4TV8F 1TJ3A 1JECA 2XNCA 1WB6A 4BATA 4CJXA 3PQ3A 2JZNA 3AVPA 4CKCB 3LF1A 3DD5A 4AZVA 4HY3A 2ODAA 2PD3A 3P2EA 2PWZA 2C5HA 2GZSA 2X0NA 4KIJA 1XAIA 3R8XA 1LBTA 3NDRA 3FROA 3B6MA 3ELYA 4MDYA 5JFOA 1OGIA 5F77A 3K05A 4BNTA 1DX9A 2G1UA 2XUKA 2YS6A 2H0AA 3QWBA 5FHQA 5HXAA 3ROEA 2I4MA 1CU1A 2ZI5A 2H8GA 1NKTA 5CFQA 3THYB 4F93B 3BGSA 2GKGA 2QLFA 2W7TA 4HDNB 4ALKA 1U7HA 2GAJA 5DBIA 1YS6A 1Q2UA 1VYHA 4ND1A 4A26A 3W04A 1AXEA 2G5TA 3DOEA 4INPA 2XOKA 1DO2A 1K6IA 5MHTA 3C3AA 4XJTA 3ZVRA 5AQ1A 4WACA 1NE2A 1G8MA 2Q45A 5CITA 2XEDA 4UARA 3LBNA 4IUDS 2KX7A 4DCOA 1JDNA 1U6JA 4GMXA 4KUGA 2P8JA 4NG4A 3UXYA 3NEAA 1Z75A 5ITZB 3IHKA 3S8YA 4J2OA 1CJKC 1W4BA 1SPBS 2ASVA 1NLUA 4XKJA 2OXIA 1F8GA 3T06B 4EJSB 1G6OA 3DEKA 1EAYA 4FSDA 3JYOA 3SC3A 1T8SA 3OLCX 3IPXA 1J8VA 1PG5A 3AI1A 2PD4A 3IULA 3P2IA 1NT2A 4UHBA 4CKBA 5C5EA 1RWNA 3VYUB 4MI6A 1PHRA 3ZU6A 4LDRA 4UREA 1KK0A 2EP7A 2X19A 3SXJA 2CE7A 3N8HA 4RVUA 5FKJA 3C3XA 2IHTA 3PUJA 3C1TA 3RJTA 5DYTA 3H87A 1JW9B 4FIDA 3TLJA 4TTAA 4L57A 5DX8A 1J0CA 1K8RA 1NOJA 1RWOA 2QK4A 3EDYA 2P78A 9ABPA 3AP2A 1QO7A 3ADBA 3QVGA 2I55A 3G7NA 3NASA 5EUMA 1V5IA 4EF6A 1SU6A 2XOKD 4L4RA 1SIOA 2YYAA