3FRJA

Crystal structure of 11b-hydroxysteroid dehydrogenase-1 (11b-hsd1) in complex with piperidyl benzamide inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
262
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-Dehydrogenase, Isozyme 1
publication title Discovery and optimization of piperidyl benzamide derivatives as a novel class of 11beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 96
structure length 262
sequence length 264
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3frjA00
3FWZA 4I08A 3DTTA 8LDHA 4D7AA 1GV0A 2Q4BA 3G3EA 3X2FA 4E2YA 4BNMA 5KNLA 2Q4EA 4ZD6A 1XIVA 4H16A 3PJEA 4QEDA 3GRKA 1R12A 5CDGA 4LCEA 4AICA 1EZ4A 5ILGA 1R0LA 4IM7A 4B4UA 4O1MA 2IEBA 3INGA 3PZBA 4YRAA 2FMUA 2YYYA 5H82A 4Z3DA 3U9LA 2PWZA 2V7PA 1ISJA 3GUCA 1G0OA 1PS9A 4ZQBA 1ENYA 2B69A 1U8XX 3CXRA 4S1VA 4ZQFA 5GZ6A 2DLDA 4LCJA 2NTNA 3WGYA 3GQVA 3RKUA 3OJOA 5AYVA 2ET6A 1LSUA 4PFJA 3HDYA 2CZCA 5H83A 4L4SA 1R0KA 3LSYA 1ISGA 3E6AA 3RUFA 2CDBA 3JQAB 1A9ZA 3AOEC 3DOCA 4MKZA 4P4NA 4J7XA 1HDXA 2CF5A 1NAIA 2PR2A 3G0OA 2NU7A 3RBZA 3RUHA 3E1KA 1UXHA 1C0PA 1CEQA 4QX6A 2JD2A 2VRBA 4BO2A 4CQLA 1KYQA 3KETA 3KUXA 1JA9A 3ZDFA 4KDFA 4OL9A 1DFGA 3AM3A 4CMEC 1MGOA 1NXQA 1LDGA 4DVJA 1ARZA 1FDWA 2C29D 1P1KA 5H81A 4ND5A 1ZK2A 3JQ8B 4IMRA 2J8ZA 2B4RO 4YAJA 1JU9A 3KOUA 4ALKA 4R69A 3K2EA 1FK8A 4FB5A 1RPNA 4U0KA 2GNAA 2OO5A 4OQYA 4YQZA 2EG9A 1Z73A 4CPDA 4QSMA 1TB4A 4A2CA 5ICSA 2FR0A 3Q2IA 2VUTA 1D1TA 4JQCA 3UCXA 3E03A 1E92A 2VWQA 5IAAA 1Z7BA 3DC2A 2PGDA 1IHXA 1YXMA 3NDRA 3EDMA 4IUYA 3R3JA 1WDLA 3RC2A 3STHA 2NQ8A 3WGGA 4J7CA 1OC2A 4XR9A 1R15A 2GCGA 2YFHA 3PXXA 1PJ2A 3Q9UA 3RQSA 3MTGA 3VHRA 2ZIZA 4N7RA 2DUUA 2EGGA 4W99A 3DONA 4JBHA 4R5MA 2G5CA 4WLVA 3S55A 3T7EA 3ZWCA 1KERA 3WG9A 4JJFA 5T67A 5L7TA 3ZWBA 3K92A 3QVTA 2ZJ1A 3I9LA 5JY1A 1F8GA 2X9NA 3H9GA 4I8XA 3TQHA 4E5NA 4YR9A 1GZ6A 4B4WA 1L1FA 2AE2A 3RI3A 3ZWNA 1DLIA 1XELA 1D1SA 5T8KA 4Z6KA 1QYDA 4IQGA 4MVJH 3RJ9A 3VTZA 3WQQA 4R1UA 1GQ2A 2JAPA 3L6OO 3DOJA 1ZW1A 4BB5A 3ZHYA 4UVDA 1JKFA 1W6UA 1NQAO 1EQ2A 1PJTA 2PZKA 4IINA 3N7UA 2EP7A 1NPYA 1ZJYA 1WZEA 5IDYA 3AJRA 2NSDA 1B7GO 1GY8A 3WYEA 5DBGA 3VPHA 4O0LA 2LDXA 2O3JA 5K6AA 1HETA 3HDJA 1ONNA 1I2CA 2FZEA 1DPGA 3GVIA 4J4HA 2WE8A 3ZWAA 1N7GA 2VT3A 1EFKA 1S7CA 1GZ3A 1YJQA 2HMWA 3BA1A 3H9EO 3WDSA 3WGOA 3FN4A 1T2DA 2ZATA 4WLOA 4MKXA 4Q3EA 1PGOA 1MG0A 1VC2A 2DKNA 1SO8A 4J4BA 4XQGA 3SBOA 5JCXA 1ZFNA 2C0CA 4B7CA 2W8ZA 3GVHA 3WGIA 1PQPA 3KO8A 3W1VA 1EBFA 1YL6A 2FSSA 1H2HA 2ZCUA 3WNQA 3DAPA 1TEHA 1DHRA 1ZKMA 3KBOA 2VTEA 1HDZA 2DTXA 3OQBA 3DMTA 3NX4A 4OOEA 3OJLA 1P1JA 3IQDB 2O2SA 5A03A 3VPSA 1N9GA 2UVDA 4M55A 4DQVA 4MO2A 3OM9A 3ZI0A 2Q45A 2HKIA 1A72A 1NPDA 1V8BA 1Z6ZA 1XKQA 1I8TA 4WOKA 2B5VA 1N1EA 2EHDA 2P4QA 1G6KA 3I9OA 3FBTA 1MLDA 5A9RA 3B1KA 4W82A 2HJSA 3HZZA 4PLCA 4AVYA 3C3XA 3JQEA 4YEDA 3GVXA 1LDYA 1A9YA 3C7CB 3K31A 3RVDA 3B1JA 2O3RA 1BVUA 2SCUA 1FF9A 4R68A 3CPSA 4J43A 1P3DA 4MOWA 4FFOA 2I65A 4XQCA 4DBVO 1SC6A 4C7JA 6LDHA 2RCYA 2H1SA 2PKQP 4XYGA 4EGFA 5C37A 3HQ4O 3O4RA 3PRJA 1UR5A 2WYUA 1H6AA 3P2OA 1P1FA 5EMHA 3K73O 5EESA 1BXKA 4IQ0A 2C54A 3I9JA 3OIDA 7ADHA 5IJZA 1GUZA 3JD2A 4RF2A 2X22A 4E2ZA 5KKCA 3DOOA 5CP8A 4ZJUA 4IJVA 4J90A 1EK6A 2B36A 3S8MA 3KTDA 1RM0A 3N74A 4TRNA 4E31A 5G0VA 3QRWA 3BMOA 3OEWA 4RQUA 4J16A 4C7KA 4ILKA 4DC1A 4TROA 1M75A 4Q3CA 3WWZA 1HYHA 1NP3A 2Q49A 3MJ4A 1I3NA 2LDBA 3D4NA 4GVXA 1X7GA 3ZV3A 2P91A 1PL8A 2IXAA 2YQ4A 4I5EA 4ND1A 4YJFB 5THQA 5A5EA 2XXJA 2Q1UA 4OSOA 4F45A 1XWFA 4BKQA 5EIOA 4CL8A 3ZNQA 4OHUA 5K9ZA 2XXBA 5BSHA 3TOZA 4WGGA 1UH5A 3D0OA 3CE6A 1TI7A 4JN6B 4CR6A 3GN2A 3FBGA 2RIRA 5KIAA 2V6FA 2Y1FA 3NEPX 2HSDA 4NFSA 2X1HA 2AEMA 3D3WA 3GGGA 4BNVA 4B3HA 4YB8A 1B16A 4Z9YA 1X7DA 3A9WA 1DC6A 3JD3A 3O9ZA 4YXFA 4NK5A 1LDNA 1MB4A 3A1NA 1IL0A 3TZCA 5TRTA 3UICA 4EJ6A 1GYPA 3R3SA 1JWBB 1DIBA 3ZWXA 2PZMA 3R0IA 1WPQA 2ZB8A 4BGIA 4YCAA 2J6IA 3OSUA 1DXYA 1IUKA 2ZTUA 3EAGA 4JP2A 3UUWA 1PQUA 2FPPA 3DFUA 3H5AA 2X0RA 1IPEA 5I7EA 3OHSX 1QR6A 4S3MA 1DIHA 3TN7A 4OXYA 4GQAA 4JLWA 2QYSA 4PG5A 3QWHA 5DT9A 2RAFA 4XYEA 3WYCA 1YOVA 2E6UX 4LMPA 1H2BA 1D7OA 1UDAA 2JD0A 2P5UA 3P19A 4WKGA 1I3KA 1LSOA 3EZYA 1U5CA 3I9KA 4XGIA 5T8KC 1ISMA 2P4HX 5B4UA 1BMDA 1KETA 4FFMA 4E5KA 4QO7A 2BF7A 2HLPA 3WOHA 1Q2XA 5L4LA 4RDHA 1PTJA 1T2AA 3WBFA 1HXHA 1B3RA 1X1EA 2D3TA 4NJMA 3EVTA 3GDGA 1XU7A 4RVFA 5F1OA 2A94A 3H8VA 1P0CA 1XDWA 2B5WA 4Y8VA 4RQTA 3D5QA 4AJ2A 5JDCA 1LC3A 1QV6A 1SZJG 5I8ZA 3JQ9A 3KVOA 2F1KA 4W7IA 1I33A 2FZWA 1KEUA 4QECA 1B0AA 1X15A 2GN6A 3G79A 2X0NA 4EITA 5K6AC 1V35A 1OZAA 3WQRA 4CV2A 3WTCA 3LC1O 1YB1A 3DZBA 1UZNA 9LDBA 4CM8B 4WUVA 2G0TA 2BD0A 1Q0QA 3CKYA 1JW9B 2P9CA 4BO7A 1KY4A 3PQDA 5FF9A 4MVJP 1PS0A 3NKLA 3LC2O 5ER9A 1LDMA 1T4DA 3GOHA 4N5LA 1BG6A 1HDCA 1UZMA 3GDFA 3H5RA 4D3SA 3UCFA 1X1TA 3LF1A 5I9MA 1NQ5A 4BB6A 4RO0A 4DREA 3VTFA 4MP8A 3WTBA 4ZHSA 2IZZA 4E21A 5ER6A 2J5KA 4R5HA 5CAEA 4CM9A 5B4TA 2HO5A 4WEOA 3A28A 3IUSA 5K0ZA 4E30A 3DL2A 1OI7A 1YRLA 3HADA 4DL9A 2VHZA 3FR8A 4HFMA 4EUEA 4KP7A 1I10A 3AM4A 1BW9B 4NBWA 1ISIA 3DMTC 5I7VA 5KVCA 1N8KA 2VWHA 3IL2A 4PLGA 4CM7A 4FC6A 4Y6RA 3W8DA 3LT0A 4IDEA 1EVJA 4RF5A 3GZNB 2WTBA 4CMBA 5I7FA 2I3AA 3ANLA 4XD2A 5FI5A 3ULKA 5CDSA 1BXZA 4A5OA 1KVSA 1UXIA 5L4NA 4RZIA 1RM5A 4AJNA 2QG4A 1PZEA 1D4FA 4LRTB 1U7HA 1Y8RB 5BSGA 4CQMA 1M67A 2JCYA 2IEDA 2B0JA 2P5YA 4R3WA 3U4IA 1UXJA 1B15A 1LLDA 5CDUA 3I9NA 2O50A 4PIVA 3DHEA 3OETA 5JMWA 1PJSA 3DHYA 4E6PA 4X54A 4TKMA 2EKLA 2OUIA 1KVUA 1WZIA 3DZIA 3QJ5A 2YHUA 1JAXA 3EUWA 4Q3NA 3F46A 3AUTA 2GN8A 3GEMA 1GPJA 2GDZA 3U4CA 3ZV6A 4D3FA 4D42A 4B3IA 3DQPA 4BKPA 1LRLA 2BFPA 3GH3A 3UKOA 1JKIA 5KCZA 3D4PA 1XA0A 3TZHA 4XKJA 4TWRA 5G2OA 3MJVA 2BRUA 2D0IA 3BTUA 3KSDO 2Q1SA 3H3JA 3A4VA 4CMJA 3PGXA 2P2SA 3KRTA 4J49A 1BXGA 3PFFA 2AW5A 2AG8A 5F5NA 3NTRA 1YB5A 3ANNA 2GYYA 4M89A 3TWOA 4CLRB 3BXXA 4DIFA 4KUGA 1X0VA 3TF5A 1HZJA 3H3FA 4MKRA 4C4OA 5C7OO 2PKRA 2JHGA 1WWKA 3F47A 2PTGA 4I5FA 4YJGB 1GEGA 3K8ZA 2CVZA 1EVYA 2D5CA 2Y05A 4IDFA 3BMNB 2D8AA 4L74A 1I01A 3GNTA 3TRIA 5CG1A 5EQDA 4CR7A 3I3OA 1FDTA 3MJEA 5KVQA 4FW8A 3A14A 1MX3A 1UJMA 1S6YA 5JS6A 1DOHA 3EGOA 4UEOA 3DWFA 2O4CA 4HFRA 1FXSA 4B3JA 4FPXA 4IZHA 2YZ7A 3DDNA 4E2XA 3VC7A 2QW8A 1UP6A 2XF8A 3F3SA 3QVXA 3ZWVA 1ZJZA 4CMIB 1TVEA 2DBVO 3GAZA 2UDPA 3JQCA 1NFFA 2UUPA 3OMLA 4A73A 2QYTA 2Y68A 3ICPA 2J3JA 1I2ZA 4Q3AA 3GG2A 1ENZA 3QHAA 3QA9A 3L6EA 4XA8A 1F12A 3NDJA 1HKUA 1GU7A 4J1QA 2QIOA 4IS2A 3IS3A 3PWZA 3JQDA 1E0DA 2HAEA 1QG6A 3LYLA 2AXQA 2AQKA 4IIVA 3DXFA 5B37A 2E48A 2W2KA 4J1NA 1H9BA 2OP1A 3FCOA 1BSVA 5A5FA 4ZN6A 3ADOA 4J2HA 4RVGA 4TRJA 4EDFA 2E4AA 4BO1A 1SAYA 3K9QO 2R00A 5EN4A 3JQ8A 4UULA 5JCJA 1XQ6A 3D64A 3TPCA 2CD9A 5EPOA 2DQ4A 3PJDA 1C1DB 1QP8A 1QYVA 1XYGA 1OC4A 2YUTA 2O23A 3INTA 3OJFA 3HFGA 3PDJA 4PLYA 5I7SA 2V65A 3HN2A 3GG9A 2PH3A 3NDIA 3ETDA 4RLHA 5DF1A 2ZB3A 2POQX 4LW8A 3FNFA 4IBOA 2OHXA 2CUKA 3O03A 4GSLA 3RKRA 4AJ1A 2W4QA 4BQPA 1CQJA 4KTTE 4FR5A 2B4TO 4MP6A 2B83A 1ZEJA 3HG7A 1ZSYA 5CG2A 4PRKA 1LQUA 4M49A 4F6CA 2OFPA 3AY7A 3RWBA 3AI1A 4WNIA 2WE7A 1O89A 1LLQA 5G4KB 1J6UA 5U1PA 4DQXA 1P44A 1Y7TA 3PK0A 5JDCC 1HE2A 3JQ9C 1K0UA 2JCVA 4DRYA 1D8AA 3EMKA 2C59A 2V6MA 5JAQA 4KQXA 4CMAA 1DAPA 2EW8A 3VH2A 3ZWOA 4OQZA 4K26A 4JNKA 4HX5A 4DIBA 2Q1WA 4XJTA 4A27A 2C2XA 1BVRA 2OBNA 2ZYAA 3AI3A 1DHTA 4MIOA 2NM0A 2GN9A 3PQEA 4D46A 1ONPA 4YTEA 1YS4A 2HMTA 1XR3A 1GD1O 4FN4A 3INRA 3W6ZA 4QO8A 5JNLA 4PLVA 4D79A 3RIHA 4IDGA 1JN0A 2B35A 5TC4A 1DRUA 2WYWA 1L7DA 4MVJI 2YDYA 1OFGA 2VYNA 1DIGA 2EJWA 1V6AA 3L77A 3O8QB 4IDBA 4JP3A 1J0XO 4N54A 4NR0A 4UUMA 5JMPA 3ZWWA 4DLBA 3FR7A 5TIIA 2R2GA 2UYYA 2AQ8A 3ZH2A 2AHRA 5MGBA 4NBRA 1YJ8A 5AXAA 1AHHA 2EEZA 3G17A 3V2UA 1B14A 5A9TA 1KEWA 4EI2A 2P9GA 3P2YA 4R1NA 5L53A 1E3JA 2VRCD 3LQFA 4J3FA 4TSKA 4EW6A 3X2EA 5B4VA 1E3LA 1GZ4A 3QLJA 4DYVA 4RVUA 4NBUA 3DAGA 4CMGA 2PLAA 5EJ2A 4DPKA 4OH1A 5KWEA 2YW9A 3VDRA 3JQFA 4JK3A 1F06A 1F14A 3COSA 2GZ1A 4IS3A 4BNFA 1GUFA 3JQBA 1KEVA 1BDBA 1ENPA 1I32A 2DBQA 2FSVA 3NTOA 4L4RA 1DJNA 3D1LA 1VSUA 4II2A 3RBXA 4XEHA 3WSWA 2H6EA 2X86A 4DTIA 4LK3A 1PGQA 4QXMA 2JKVA 4GX2A 2IXBA 3WNVA 5JBIA 3OP4A 1GFSA 4GX5A 1OAAA 2I9PA 1P31A 4NK4A 3NJ8A 1NWHA 1MC5A 2GF2A 1FMCA 3BMCB 1CWUA 3C24A 2VZ9A 1IB6A 3MEQA 3Q0EA 5IF3A 2CNBA 4OJNA 5GZ3A 2OOSA 3M6IA 1ULSA 1NTOA 4K1LA 1K89A 4CLDA 4I1IA 3B1FA 1VKOA 3JYOA 3H9QA 5ICMA 2C82A 3QIVA 3FHLA 1WVGA 5IZCA 5IZ4A 1UAGA 2E49A 1HSOA 1NFRA 3DBLB 1PJBA 4Z0HO 1I2BA 4CV0A 1V3UA 4UVHA 1ISFA 2BI8A 2GERA 2O3UA 2VYND 3ENKA 5AXCA 3WS7A 3Q2KA 4ALJA 3WBBA 1AXGA 4MVJA 5MDHA 2G76A 2O7SA 3E82A 1TT5B 4MIEA 1XCBA 1ZUD1 3CEAA 5ADHA 1A71A 4MDHA 1K5HA 1RJWA 3I1JA 1FDUA 2X4GA 3SEFA 1WW8A 1P1HA 4J7UA 5KJFA 2PGLA 4CLXA 2VNSA 1YGYA 4Y67A 2GZ2A 4DYDA 2JD1A 4XDZA 3K5PA 1YH3A 1H94A 1LX6A 1M76A 1QXSA 1YVEI 2PY6A 1DIAA 3BZUA 2RHRA 2WYVA 1I3LA 3M1LA 5COBA 4YBZA 4MINA 5B12A 2R6JA 3C7AA 1JWAB 3BTVA 2RH8A 2GPTA 4WCFB 4XIJA 2PH5A 3AUUA 1ZK4A 4OM8A 3CIFA 3E5MA 1LDEA 2HMUA 2I6TA 4GH5A 1E6EA 1LEHA 4CMCA 2O3TA 3RAJA 3KSUA 3L9XA 2C5AA 4CUJA 3LC7O 4J6FA 3DZGA 5HS4A 1E6WA 1J4AA 4P22A 1KVTA 2G17A 5HBRA 4Z9FA 4XQEA 2PZLA 7MDHA 4CV1A 4PGFA 1DJQA 3OJEA 4YJHA 2R00C 4N18A 3RFXA 5JO9A 4W9NA 4QT0A 4OKNA 1EVZA 1HDGO 4NPCA 1E77A 5DCYA 1C1XB 4OIMA 3PLNA 4P4GA 4DBZA 1NAHA 3EHEA 1TLTA 4KOAA 4DA9A 4L4XA 1P45A 2JCXA 1PR9A 1AXEA 3F6YA 2VYVA 3MZ0A 3KHUA 1Y9AA 3GC6A 3WXBA 3U4HA 3BYZA 4ONEA 3W8EA 1E7RA 1VRWA 1BRMA 4M87A 3QWIA 4XRRA 3PHIA 3G49A 5U4QA 1NBOA 5JDIA 4XB1A 1PL6A 3BHMA 2DAPA 3IOYA 4MVJD 3CMCO 2IE0A 2J3HA 1K3TA 5JO0A 3UXYA 1ML3A 1YWGO 1A7KA 4IXWA 1DRWA 5JYDA 3PJFA 1PR3A 2BH9A 2DUWA 1QKIA 4BMNA 1DC5A 4ZQGA 2W90A 3H65A 1IHYA 4PLZA 1H6DA 1W4ZA 1M6HA 3DBHA 4FOSA 4FQ8A 2FP4A 2QRLA 1GL3A 1T24A 2NU8A 2HDHA 4IDDA 1R4NA 3AUSA 4FBGA 5AVOA 5I9LA 4NU6A 1K6JA 2WD7A 1SOVA 4D44A 3VPFA 2PFGA 2B37A 2X9VA 5B1YA 3KYDB 3FPCA 4U6SA 4Z0TA 3WIEA 3JV7A 1VLLA 4F6LA 2X9GA 4DLLA 3ZV5A 3F4LA 4CMKA 4WOJA 3V1YA 2VWGA 3GRPA 2EGHA 3OH8A 5JFOA 1HZZA 2H63A 3AI2A 4ID9A 4OSPA 1DIRA 2ZQZA 2JFGA 2Y1GA 3MWDB 3GNSA 4ALMA 2RH4A 4FJ2A 3TOXA 4H15A 3MTJA 4WJZA 3VKUA 3WMXA 2ZTLA 3QY9A 2I3GA 1V3TA 1A4UA 4ALNA 3U0BA 4BKRA 4EEZA 5A3VA 4XRGA 3V1TC 5BNTA 1OMOA 1I30A 3OICA 3DZFA 4HBGA 3SXPA 1GAEO 3D3EA 1ZO8A 4IJUA 4BNNA 1Y5MA 4P8RA 4MVJG 5L51A 2WDZA 2AEFA 3HN7A 2GO1A 3MCVA 1PJ3A 1O94A 1P33A 2AE1A 4XIYA 2EKQA 2VTDA 3TZQA 3GK3A 3RFTA 3GF4A 3JQFC 1O5IA 2I67A 4NI5A 5BT9A 3U09A 1B3BA 4HNGA 3JQBC 4XR4A 5JPIA 4B7UA 4YRBA 3MJTA 5I9NA 1HT0A 4XGKA 2Q2QA 3H2SA 3GHYA 1NR7A 4A26A 5L4SA 3LT4A 1BW9A 1GR0A 3TL3A 4BO6A 4E3ZA 3PHLA 1SMKA 3WX0A 1VL0A 4JIGA 5LC1A 3ZHBA 5FWNA 2X8LA 5JAIA 3C1AA 3DZJA 3NUGA 2GGSA 1RM3A 4E12A 1SEPA 3IUPA 4HADA 1GTMA 3DAFA 3HHPA 1YL7A 3B70A 3QE3A 1N92A 1R66A 4AJLA 3DHNA 4LGVA 1NASA 2HMVA 4BMSA 2NVUA 5JYEA 2PD4A 2EWMA 4J2OA 3F5QA 3AWDA 3PIIA 4WE3A 2Y1CA 1Y8RA 3FRJA 3L0DA 2XAAA 1RWBA 5BQFA 2FHSA 2HK9A 3D4OA 3GMSA 3TL2A 4CR8A 3RUCA 4OKIA 2Y0CA 4HFNA 4I5GA 3AU8A 5ENVA 4J1TA 5IZCC 3DR3A 1EDZA 2FR8A 2PV7A 3AW9A 2GN4A 2VZ8A 3F4BA 1HRDA 4GSKA 1H5QA 1RYEA 2DU8A 3BAZA 3R6DA 3RUIA 2VCYA 3DBVO 3DB2A 3UN1A 3QVOA 1GUYA 3OFSA 3PHJA 1ZSVA 3KEQA 1AN9A 3DBRA 3JSAA 4GKVA 3RU7A 4UAGA 2VQ3A 1HL3A 1GEEA 1CRWG 1HYEA 5DOVA 2NU9A 2GRAA 4ZGWA 1R6DA 4KUHA 1A4IA 2GLXA 5KTKA 2EV9A 4A10A 4E5YA 3HSKA 4L73A 1LSSA 2AQHA 4CLRA 2IODA 4IZIA 1B8VA 1UUFA 1A5ZA 5JAMA 2AG5A 4W4TA 2NTJA 4BIIA 4YJGA 4BL5A 4EJ0A 5DNAA 3OIFA 1EK5A 3PEFA 3M2PA 3ZU5A 4G2NA 3VZQA 3W6UA 2D1YA 1Y8QB 4U8GA 1T2CA 3BIOA 3W4JA 2A9FA 1UP4A 4RF3A 3I4CA 1N7HA 4GVLA 1PX0A 5FEUA 1ZXLA 3ASUA 2ZJ0A 3AM5A 1GADO 2VZ0A 2DTEA 3WGTA 1RKXA 1JLLA 1JVBA 4OOFA 4ROSA 2O4UX 3VZSA 3ONDA 3KYBA 5GZ1A 5JC1A 3JQ7B 2J5QA 2X7HA 3BTSA 1KIFA 1T1RA 4B79A 1B8UA 3FSRA 4IXTA 3RSHA 4BO3A 5L7YA 1VL6A 4W9NC 3LVFO 3EVNA 5A05A 5LCXA 3ZCXA 4Q3BA 2O3QA 2EJVA 3ZW8A 1IYZA 5KOIA 4PVCA 3PQFA 4U0JA 4YAEA 4YT8A 3QV1A 1T4BA 3ENNA 5L9AA 3JQGA 4RVDA 1UP7A 2CFCA 1EEHA 5DULA 1H6BA 1L7EA 2HUNA 1Z82A 1ZSNA 3JYPA 5JDIC 2IDZA 5AXDA 1SEVA 4BNLA 4IDCA 2C2YA 4YQYA 3JYNA 4BO5A 1CYDA 4DWVA 3GN1A 1ENOA 1E7SA 1E3WA 1EUDA 5GY7A 5A3JA 1Q1NA 4PG4A 4TKLA 1K6IA 3PWKA 3U62A 4WLEA 3G1TA 2AQIA 1GCOA 5A9SB 4XDYA 5HTOA 2EP5A 2V6BA 3AK4A 4BOYA 1ISHA 1IULA 4FOOA 4EUHA 2NNLD 1QLJA 1YBVA 3B6ZA 3KYCB 3AOGA 3VOSA 2BGKA 1ZBQA 4R9SA 1X0XA 3CTMA 2BI7A 2YY7A 2Z1NA 4IY1A 4CUKA 3E8XA 3KXDA 1UDCA 1C14A 4J1SA 5G4KA 3PYMA 3JQ6A 4MPDA 3GR6A 1Z7EA 4GGPA 3VPXA 1ULUA 3RC9A 1KS9A 4E2WA 1ZMTA 4CMHA 1ADCA 4TRRA 3HNPA 4ZRNA 2QRJA 4KDEA 4GWGA 2EKPA 1PS8A 3DEYX 3OIGA 4R9RA 2JFFA 1CETA 3UF0A 4R54A 4FCCA 3VZRA 1CQIA 4IQ8A 1YE3A 4J9UE 1KY5A 3S2EA 1KVQA 3I5MA 3HE3A 3ST7A 5IN4A 4XQ9A 3JYLA 3RUDA 5T6BA 4J91A 2QQ5A 4P38A 3T7CA 2VOEA 3ZZNA 4XB2A 1WLYA 3Q9NA 4RZHA 4IJKA 1YB4A 2CVOA 4G81A 4HKTA 5IG2A 4B4OA 1DC3A 4BGVA 3CSDA 3O8QA 2W98A 1FDVA 2QRKA 2ZYDA 4RPJA 5DOZA 1DBVO 1F8FA 1VL8A 2OZPA 4CM1A 4PZCA 4NIMA 4CM9D 1E1MA 1ZIDA 4E4YA 3ROKA 5DCUA 4NQZA 2I76A 3CZRA 1H93A 1U7TA 3AFNA 3I4FA 1E7QA 2C07A 3JD4A 4CLHA 4Y9DA 2NADA 2W2LA 1OBFO 2PD3A 3E9MA 2X5OA 1LJ8A 1DAOA 4TRMA 1YOVB 4WECA 1EBUA 4KZPA 1K6XA 4RPLA 4BNYA 1MXFA 5IDXA 3WMWA 3L4BA 1H0KA 4F3YA 2YV2A 3BTOA 3D5TA 3NT4A 1MV8A 4NG5A 5ILOA 1HLDA 4LVCA 1BWSA 3M2TA 5DP1A 4UEJA 5CHEA 3TNLA 3VVBA 4YT5A 1PQWA 1P1IA 3GPDG 3H7AA 2X0IA 3QVSA 4J0EA 3PZRA 4CQMD 3JQAA 1ZXBA 3WB9A 1W0CA 1YDWA 2D4AA 5FYDA 4FFNA 2B4QA 3CH6A 3Q3CA 4H7PA 3BMQB 3EYWA 3BMCA 3QWBA 3UW3A 2ZTVA 1YQGA 1VJ1A 1LBEA 2OGUA 1AGNA 1LRKA 3A06A 4GAEA 1NQTA 2JJYA 5JE8A 1XEAA 1JDJA 1T25A 5JLAA 4RJTA 2O3SA 4W6ZA 2BMAA 1CF2O 5EQFA 4L8VA 3RBVA 3ZWPA 4BHTA 4F46A 4K28A 2DBRA 4Y6SA 1C0KA 2D59A 5A04A 5L7WA 3OF2A 1Y9EA 2AA3A 3H4VA 4YT2A 3U5TA 3DBLA 1HDOA 1NNUA 2HRBA 4HY3A 1LXCA 2X5JO 1I5RA 2YV3A 4E13A 2O7QA 5DN9A 5G4LA 1Z74A 1HE4A 5TT0A 5HM8A 1VJTA 1TT5A 4JBGA 3P5SA 2GZ3A 3TDKA 4UUOA 2YHIB 4NBVA 1IZ9A 1QYWA 4Z9XA 3PVZA 4DIOA 3Q6IA 1BTOA 1DFHA 3V5NA 1PWXA 3PI7A 1ZK1A 1YBMA 4E5MA 1YL5A 2QZ9A 5U9CA 2FY8A 3C85A 5KVSA 1Q7CA 2I99A 2OL4A 3PHHA 3PPIA 4LRSB 4R16A 4Z3KA 1Z45A 2VHVA 3IIEA 3CZMA 3KEOA 4NFHA 4BNGA 1ZZEA 2C7VA 3CUKA 2GUGA 3V2HA 4Q39A 4ESOA 3VVCA 1YQDA 1GYRA 4WCFA 1AHIA 3RASA 4TVBA 4FGWA 1G1AA 1YQXA 4D0SA 3GVCA 4DQUA 3OBBA 4IPTA 3ZU2A 2D5AA 2Y0DA 2YDXA 3GZ4A 3JQAD 5JW6A 1U1IA 4AFNA 4CLOB 4AL4A 3Q1LA 3RD5A 1RM4A 4FC7A 3FPLA 4RGBA 1T2FA 2EIHA 3IJPA 3ZNOA 3B20A 5AOVA 3W4KA 4QFCA 2FPGA 4HV4A 4D43A 1QLHA 1DO8A 4L75A 1WDMA 1NVMB 4KUEA 5F5LA 3WFIA 5BSEA 3HDQA 3KB6A 3C7DB 4UUNA 3TSCA 5CDTA 2A35A 4XGNA 5L95A 1SB9A 3ADPA 1HYGA 1SOWA 1C1XA 1WXDA 4BNTA 5JAZA 5JCJD 1HTBA 4EJMA 2ZTMA 4UVIA 5EL0A 4HP8A 2GSDA 1GQYA 4UUPA 5FI3A 5IFLA 3GGPA 4ND2A 1CDOA 1PZHA 4OO3A 1EMDA 1IY8A 4Y6PA 4GX0A 1V0JA 4PCVA 4BUCA 2Z1MA 4AJIA 4BO0A 4CODB 5IN5A 2WEKA 1R4MB 4CM6A 3MOGA 1QYXA 4BNUA 3P7MA 2Q1TA 3ITKA 1U4OA 1DDOA 2OBYA 1GCUA 4BNXA 4FFLA 5GMOA 2QHXA 1UAYA 1NHWA 2Z95A 1F17A 1B2LA 5IXSA 4N5NA 1LUAA 3OA0A 3U49A 3SC6A 1MP0A 4IGEA 3WJAA 4D0RA 3GA0A 4YPOA 2O2YA 4UVGA 3KYDA 3LU1A 5COQA 3WIDA 4EUFA 5BNIA 4WEQA 1WNTA 4JJIA 1U3UA 5DZSA 2BLLA 3JCZA 3TZKA 4B4VA 4XZ3A 2VHYA 3S2IA 2C20A 4E33A 1MC4A 3K30A 3MWEB 4ZVVA 4DMLA 2HRZA 3U4DA 4RV9A 4BVAA 1ADGA 1HLPA 4JXKA 3ON5A 5F3RA 3ITDA 3V8BA 3JTMA 3JYQA 2XPCA 4ZQHA 5J23A 4II3A 2IRWA 1W8DA 4YWJA 2P68A 5IXYA 1M2WA 3ZHZA 5JC8A 4H3VA 4BGEA 1E3SA 2W2KB 4PG6A 4R41A 4D41A 1MFZA 3SX2A 3EZLA 2BFAA 4GGOA 1NQOA 4O6VA 1C0LA 3WWYA 2ZB4A 3KZVA 4UEKA 3AUAA 4I9NA 5AXBA 3WFJA 3VAZA 2VUSA 1E1KA 4IJWA 4NNJA 1ONOA 4GPD1 4CM3A 3LF2A 3I52A 2X58A 5TJ9A 3UFXA 1PJQA 1R37A 4I9HA 3O38A 2Q99A 4NMHA 4XYBA 3OECA 3L4BC 3E48A 3QQPA 4CM4B 1T2EA 1E3EA 2YV1A 5CPFA 5L3ZA 1HE5A 4QFDA 1WAMA 4NFYA 3DZKA 4J0FA 5EERA 2DFVA 1U5AA 2WWRA 2X0JA 5C3MA 3NJ4A 4FIZA 4GMGA 2JHFA 3C1OA 4PG7A 3RROA 3K96A 1PGJA 3NAQA 4YJFA 1FJHA 2BFOA 1B26A 1HSZA 1ZCJA 2DVMA 5HA5A 3WICA 3L6DA 4ND3A 2DPGA 4OGWA 4IGFA 5L45A 4FJ1A 1NPTO 4FS3A 2ILTA 2J3KA 2Q2VA 2WM3A 1MUUA 2Y99A 1PZGA 3OQ6A 4GKBA 4B8ZA 2Q2WA 4TZKA 1R16A 2A4KA 2Z5LA 3IDSA 4M86A 4AJJA 3MJCA 3IKTA 3TZ6A 4WCDA 1H9AA 3UVEA 1PSDA 4OXNA 5ITVA 1YBAA 1Q7GA 1J5PA 1UZLA 1XU9A 4XX0A 2I5PO 3RJ5A 4KWHA 3OJ0A 3FI9A 3SJ7A 4ZU3A 1VKNA 2VWPA 4TZTA 4XJSA 4D45A 5TX7A 5G0TA 4A0SA 3UAGA 4B7XA 3FTPA 4RLSA 2DTDA 1CIVA 2QZZA 2C5EA 2PNFA 4G65A 4UREA 2PZJA 4LN1A 4CM5A 2OXIA 2ZKLA 1SB8A 3I23A 2ZQYA 1EUZA 3NRCA 1AE1A 4A7PA 2Y1EA 1TT7A 1Z75A 3RCBA 3IMFA 1U3WA 5L40A 3ANMA 3HFSA 1ZEMA 1P74A 2DM6A 4B8WA 3W8FA 3LZ6A 4Q3DA 2BELA 4HNHA 1Q0HA 3IJRA 2G1UA 4WCFC 3WJ7A 5KJCA 4DMMA 1QORA 3GT0A 3ZU3A 2DT5A 1IPFA 3KLPX 3JD0A 1LQTA 4K6CA 2F00A 1PWZA 3EK2A 1Y8QA 3UCEA 5BSFA 2VUUA 1IOLA 1P0FA 3FWNA 3ZWMA 4NZ9A 2YQ5A 1N1GA 4JJGA 3GVPA 3H9UA 2NV6A 5KJEA 3S2FA 4M1QA 3JQ7A 3ONFA 4YACA 4PLPA 3GY0A 3D7LA 4EYEA 3EW7A 3FNGA 3VH3A 4IMPA 2CY0A 2J3IA 5TSDA 4CQLB 5ES3A 1ZK3A 3GNQA 1R0SA 4RDIA 5BR7A 4K9DA 3TFQA 2HK8A 2J5RA 3DZHA 3KSZO 1E3IA 3R1IA 4LVUA 2X5KO 4CM8A 5I8WA 3PLRA 1U3TA 1F0YA 4BS9A 3ZHXA 1LTHR 4PZDA 1GPDG 2UV8A 1NVGA 4HUJA 5T64A 2VYVD 4LMRA 3RFVA 2X6TA 1V9LA 1U28A 3I6IA 3JD1A 1A7AA 2YJZA 4I9UA 4CUZA 4LSWA 4FFRA 4ZA2A 4Z0PA 2WD8A 1LC0A 1YONA 4K6FA 1PZFA 1WDKA 1U2GA 3GFBA 8ADHA 1K2WA 5A9SA 3NYWA 3S1LA 2AEJA 1JVSA 4FDAA 1GDHA 1U9JA 3C8MA 2NLOA 4KWIA 4LISA 3ONEA 3KLMX 3UOGA 3ZU4A 1VE9A 1E7MA 2I66A 3H2ZA 2CDCA 3WGHA 4PVDA 4UVEA 3U3XA 1O9BA 1EQUA 1PJLA 3KYCA 4G5HA 4TVOA 2EF1A 5JY6A 4AJHA 4R1TA 3GZNA 4MVJF 1P77A 2HK7A 4AG3A 2FWMX 1E5QA 5ENDA 2WMDA 5ITWA 5AQ1A 4GX1A 3FNHA 1XLTA 5DP2A 5BNFA 3VKVA 5A06A 5A4DA 1JAYA 3S2GA 3RU9A 1I0ZA 3WR5A 4NDNE 1AUPA 2DBZA 1E7YA 4ZRMA 5TS3A 3QVWA 3NT5A 5TNXA 3RC1A 4BO8A 4E0BA 1KEPA 1T26A 2GD1O 3DFZA 1ID1A 3G1UA 4HWKA 2NVBA 1UXKA 5COAA 3DTYA 4ITUA 4JBIA 1M66A 4FFPA 2CMDA 2FOIA 1T1SA 3ORFA 3ICCA 4GBJA 5TJHA 4L76A 1KOLA 3ABIA 4BV9A 3HJAA 3PDUA 1DRVA 2G82A 3L07A 1EDOA 4MJLA 4YJHB 5TLSA 3F5SA 3SVTA 4YJDA 1LA2A 1U3VA 2DC1A 2GASA 3HWRA 1EFLA 1FDSA 1NFQA 3RUAA 2EXXA 2CSUA 1D3AA 3PYLA 3FNEA 4RL6A 1LSJA 9LDTA 5TQVA 1CERA 4CV3A 4YRDA 1N2SA 5G0SA 1ADFA 1X14A 4PLWA 3C1TA 5KJ6A 4RF4A 1Q0LA 1H6CA 1N5DA 1XHLA 4RPGA 4DUPA 1P9LA 4OMUA 2P9EA 1U8FO 3BMNA 3GPIA 1ZH8A 1PJ4A 2HCTA 5JSFA 5KJ1A 3KV3O 4PRLA 2H9IA 4GLOA 4BV8A 1ZK0A 1QV7A 3ZWYA 3FF4A 3WQSB 3PIDA 3E9NA 3MJSA 4DLAA 3O26A 3DBHB 1PU2A 4TQGA 1IZ0A 2E82A 1PGPA 1R4NB 3T4EA 3PWSA 1NVTA 4RPHA 3ROQA 3ZNNA 4XYMA 4CMIA 1B8PA 2WD7B 1SCUA 3UHAA 1N9GB 1ZNQO 1BHSA 4E5PA 1EE2A 4BNWA 4PLTA 1EUCA 3AFMA 1NR1A 4RORA 2C7GA 1LNQA 1ZVMA 4CJXA 1A27A 3DMYA 3N58A 2FN7A 4BNJA 4EBFA 1EE9A 3OEYA 3WLEA 2XOXA 4U6QA 4RCVA 3GAFA 3LK7A 1LLUA 4EEXA 2PKQO 1PIWA 3PJGA 3TJRA 1PEDA 2DFDA 3ZNPA 4AJKA 3UH1A 4BNKA 3ROPA 3BMQA 2YFQA 3NTQA 1ADBA 1HE3A 3PFWO 3QP9A 2H5LA 5JXWA 5T5QA 1HEUA 4HXYA 3IKVA 3K6JA 1QRRA 4MVJE 3HB5X 5TT1A 2Q46A 1DB3A 5T57A 4PG8A 3WSVA 4KMSA 1C1DA 1MXHA 4GMFA 4HFJA 2IZ1A 3F9IA 3I9MA 3I83A 4YYZA 2JL1A 1Y6JA 1KVRA 3WGQA 3SJUA 4ALLA 4QQRA 1W73A 5F1KA 1DSSG 1KC1A 1VJ0A 4IIUA 1CJCA 1WMBA 4R3NA 4BNHA 2WSBA 3GFGA 1ZMOA 3BMOB 2NTVA 3ROMA 1E1LA 2PK3A 2RBEA 4J9VA 4MVJM 4Q9NA 2YHIA 4NH4A 2HQ1A 5F21A 3WGZA 4CL3A 4RPKA 2BKAA 5CFZA 4PZEA 2CDAA 1DFIA 2GR9A 4A03A 3PP8A 3LDHA 4BO4A 5F1PA 5EINA 3NT2A 3VH1A 4FJ0A 2OMEA 1I3MA 3HUDA 2UUOA 5HWSA 3TFOA 4YAIA 4OAQA 1NYTA 5DDIP 2ZK7A 4TMFA 6ADHA 2RHCA 4JGBA 1YKFA 1XGKA 1NHGA 2IYPA 4JCOA 3V2GA 4YDRA 1JQBA 2NQTA 2EERA 2BHLA 4AJOA 4DPLA 5CEEA 4WPGA 2NVUB 4ND4A 3EC7A 1LI4A 3KM0A 4BNIA 1ORRA 3E5RA 5CEJA 4WNCA 2NUAA 4J4TA 3EY4A 4Y98A 4CLOA 1DC4A 2O48X 3IAHA 3IP3A 3ZW9A 3D3WB 3GHHA 1V3VA 1Y1PA 4MP3A 3Q11A 3I6QA 1BGVA 3AOEA 4KQWA 3ASVA 3ETEA 4R4JA 5FFFA 4WASA 3SLGA 4R1SA 5KKAA 4DXHA 4ZICA 2PA3A 1SPXA 2Y1DA 2Y1OA 1VI2A 4GLLA 3LT2A 3DBRB 4NHEA 4PLHA 4PLFA 2FR1A 2Q50A 4INAA 4CLEA 4CMEA 4ZQEA 2E37A 1GQQA 1O8CA 4FD3A 5DBIA 2FPIA 1I36A 2CVQA 4AJ4A 4NU5A 2CF6A 1EVIA 3L4SO 4GWKA 2HJRA 3F1LA 2NWQA 1I24A 3LT1A 1KC3A 1NM5A 4KTVE 4WLFA 2V6GA 4BGUA 1R4MA 1YO6A 4E32A 3GEDA 5LDHA 1E7WA 1E6UA 1YDEA 1Y81A 4O5OA 1UXGA 4DPMA 1GV1A 2PD6A 1TXGA 2BGMA 1OOEA 2A92A 4JX8A 5TGDA 4EZBA 3GDOA 4YAKA 4QTZA 1GYQA 5A02A 2VT2A 1UDBA 3HB4X 3WLFA 3AU9A 2HMSA 1XQ1A 4GL4A 1MG5A 2VHXA 1E1NA 1U4SA 4BKOA 1LRJA 4YVFA 3WYBA 4M54A 5DCWA 5CDYA 4NJMB 1O95A 3VPGA 2VOJA 4RVHA 1NWCA 4XYLA 4O59O 3GMDA 1VPDA 4LSMA 2EW2A 2DPHA 1M6WA 5HRUA 1Q7BA 2IZ0A 4I5DA 2UAGA 1QMGA 3PHGA 3GEGA 3LLSA 3NV9A 2NACA 2Y0EA 3LLVA 4BMVA 4BO9A 3HDHA 3QW2A 3RUEA 1VM6A 2VN8A 3H5NA 4ALIA 1PGNA 3FD8A 3FTNA 1DLJA 4WLUA 4O63O 2ZYGA 3H9JA 3JQGB 3PTZA 4U5QA 4NBTA 2FRDA 3RC7A 3GLQA 1C3VA 1DEHA 5THKA 4DGSA 5IDQA 1RYDA 3GUYA 5C7IO 1WP4A 1HDYA 5CPBA 4BNZA 4XWYA 4L9RA 3VDQA 2HU2A 3VH4A 2JAHA 2QX7A 2TMDA 1HF3A 3PYXA 4MIYA 3L9WA 3BHJA 4M8SA 1E3WB 4AJEA 3CINA 3M1AA 1X13A 3ZN2A 4N5MA 1MA0A 1JKJA 1Y5RA 3IP1A 1O6ZA 3SLKA 2AMFA 3BHIA 4QUKA 2JFHA 3QSGA 4IDAA 4P4LA 4R01A 2VRCA 1PJCA 5DBFA 2W2LD 2VNAA 4CM4A 2D2IA 5IDWA 4OYRA 3AY3A 3GGOA 3VZPA 3SC4A 4NJOA 5HS6A 4R51A 4W7HA 1QYCA 3QWAA 1QSGA 3E9QA 1X7HA 4YT4A 2OP0A 1U2DA 2PGJA 1LLCA 3V1UA 1C0IA 2Q3EA 4OXKA 1XSEA 2Y66A 1XG5A 3MOIA 2NU6A 1VSVA 4BQRA 1WMAA 5LDGA 2Y67A 4RVSA 2BFMA 4YAGA 4CQMB 1LDBA 2IYOA 2Y93A 4FGSA 1JTVA 1MFPA 3NGLA 3E18A 3T4XA 3OA2A 3NGXA 3OQ1A 4WLNA 3QWFA 1E5LA 5KVVA 4JROA 4BKUA 1KBZA 4AJPA 5A1TA 2NVWA 4PN3A 4GI2A 2VHWA 4D3DA 1G0NA 2TMGA 1TA4A 1BDMA 1IE3A 3DO5A 3F1KA 3K2BA 4U7WA 1NX6A 3CMMA 1HDRA 3H6KA 1J49A 4XCVA 5G0WA 5G0UA 4WK6A 4URFA 3UGKA 3IC5A 1O0SA 2BGLA 3PGJA 1PL7A 2ZCVA 2OORA 3W4IA 3ETGA 4YA6A 4FSHA 5C7LO 2WJPA 1SBYA 1BXGB 1LU9A 2ZB7A 1HWYA 1P1RA 4DC0A 5C5IA 3ZV4A 5TF4A 4L0QA 1SNYA 5CEFA 2X23A 3AY6A 3ZGYA
chains in the Genus database with same CATH superfamily
5DNWA 4LNHA 5BWLA 2WUFA 4FILA 4HWPA 3AFOA 2VHQA 3A3PA 3U60B 4QYMA 3KHSA 1CIPA 3H19A 2J4DA 2XCRB 2Q4EA 1UBGA 4ZD6A 1AMNA 4RETA 4PC1A 3KYJB 1YE8A 4ZO4A 1J24A 3UUEA 5CDGA 4LCEA 1XTKA 1SXJE 1ML4A 1TNDA 1OIXA 2LZ0A 2DWPA 1EZ4A 2WIFA 3W5DA 5E4YA 5FBLB 2TMYA 2FZ4A 1Q95A 2IEBA 4O1IA 5F9MA 2J9FB 5G3YA 5K3FA 3TRKA 4BUJA 1BWRA 1FFXA 4Z3DA 2G0NA 5EPUA 4G67A 3B36A 3X1YA 4FFVA 2AFHB 2RGWA 2WC1A 3GUCA 4YCNA 2AOVA 3R7FA 1ENYA 2XMGA 3H9BA 1MIHA 1GSOA 2D1SA 3PENA 2GEJA 5AK0A 3G7UA 4LCJA 1E79D 2BISA 4ZU6X 1B41A 3DULA 3HBMA 4MLDA 1T8WA 3OJOA 2FQWA 1VL2A 2ACEA 3MTQA 4QOIA 4KXQA 3WP0A 5CBPA 3KQNA 3UKDA 4EVIA 4L4SA 3DV2A 1R0KA 4W7SA 3BREA 4G1FA 4W5HA 1CF9A 2B2XA 3BBLA 3RUFA 2CDBA 4BEWA 2WSSD 3JQAB 2FP3A 2GPYA 4MKZA 4P4NA 4CYMA 2ZRPA 2CF5A 1ECCA 3MWDA 3QV2A 3RUHA 1KL7A 5AK4A 3RRJA 1G8SA 1CEQA 1GIAA 4LY9A 1F6DA 2ODBA 1AGYA 2YC2C 1QK3A 2ZRFA 5U4XA 4CQLA 4EB6A 4EQ6B 5CCBA 3EQ2A 3KETA 1JSZA 2OK8A 2IXTA 2VF2A 1EXDA 4UM8B 5FOTA 4F7WA 5FO1A 2AN3A 5J43A 4KDFA 1ZRMA 1X7WA 4LFAB 1BGWA 7REQA 4GYWA 1NXQA 1LDGA 1ZUNA 2PRJA 1U9CA 2C29D 2GILA 1MO4A 2WFLA 1HEIA 1A8PA 3MT9A 3OTWA 2QUIA 4TLCA 4ND5A 3MN1A 2VXOA 1DKOA 2B4RO 2F17A 2J8ZA 1A4RA 4YAJA 4BMOB 3O2QB 4UE3S 5F23A 4R69A 4G8DA 4R2JA 1O96A 3CLSD 2VJNA 2LIVA 1IEQA 1A04A 4MV5A 1G5FA 2B4AA 3CX4A 1M72A 3QVUA 4A8TA 1KWKA 3N8NA 4RHCA 1YFKA 1J0BA 4W9MC 1ZH4A 3B3GA 4QSMA 4A2CA 5EXSA 5JNTA 2ECOA 4UZEA 3OLQA 3GFTA 1U0NA 5HR5A 3T7SA 4YXWA 1KI1A 3Q2IA 5G1NA 2VZEA 4LDZA 3THRA 3PQ8A 1E92A 1OUMA 2VDWB 2K87A 2VWQA 4LVOA 4QPDA 5K3CA 5IAAA 4AI6A 4D5GA 5ESDA 1IHXA 3E2IA 3TMYA 3DYVA 2OSVA 3JAKB 4R40A 3F73A 2R1VB 4NZYA 2EQAA 5AOBA 1E1CB 1SUEA 1VFNA 2ZRJA 1WDLA 1GGJA 3ASZA 4IUYA 1TUBB 1ST3A 1TM2A 3STHA 2CV0A 3WGGA 2KI5A 2R7MA 3DPIA 1TW3A 3FYUA 3AH8A 4XR9A 4GD3Q 1XJ0A 1VXRA 1T5LA 3RQSA 1ADYA 3VHRA 2VAMA 3RS8A 4D92A 3FX2A 4N7RA 2DUUA 4W99A 1UANA 2QVCA 3RSCA 3KPWA 4ZYWA 1HOTA 1JSXA 2HHCA 4FHFA 2J3MA 4FLEA 4JBHA 4WLVA 4C2AA 4M2LA 1VJDA 3VSCA 4URVR 1JBQA 4MGIR 1W2WB 3ZWCA 1KERA 4MICA 5L7TA 2HNBA 4M9RA 1T5HX 2ZIVB 3KJHA 4OD0A 2PMBA 4Q3OA 10MHA 1OIVA 2UXCB 3TQHA 2VHCA 4AF6A 1M83A 3PUXA 4MRMB 4B4WA 3RI3A 3SOZA 3ESXA 4Y6QA 2EARA 3C3JA 1XELA 2FQYA 3MHPA 1RYFA 4HZUB 4LXGA 1QHEA 5T8KA 3EWNA 4Z6KA 4UDYX 1IN5A 5M04A 2CNOA 4B9EA 2FRDC 3E1GA 3HNOA 1UBTS 2OC9A 3RJ9A 4DUYB 2QW1A 3NTXA 1GQ2A 3L6OO 2VJCA 1M1XB 4R1UA 2JGRA 1NLFA 5L3SA 1E9AA 3ZHYA 2QTTA 3IDZA 4UVDA 2ZJAA 1FU7A 1P7PA 1NQAO 1HNNA 1RJ9B 2EL9A 2F62A 3VX4A 3L1HA 3S68A 1E2EA 5BR8B 3NTLA 1ZJYA 4OUDA 3AGQA 3QBJA 3FGPA 4R1PA 5B1SA 2BBOA 4F97A 3D8NA 1N7IA 4I99A 4C2UA 4ZC1A 1B7GO 5IM5A 1L4YA 2HWXA 3VPHA 3DZCA 1OFUA 4WFQA 2ZITA 4RZXA 5K0FA 1HETA 1UQRA 4XASA 1H8HA 4D4JA 1VHJA 3PCTA 4X62B 3AF6A 4E09A 2VQSA 1M8JA 1ONNA 1I2CA 3I8XA 1ZL2A 3LM8A 3QG1A 4H7DA 1DPGA 4P3KA 3ZKWA 1UBRS 3NJRA 4AAYA 1QQAA 1N7GA 2VT3A 1EFKA 3PDIA 1SXHA 1H2EA 2AFHE 3F9CA 3LT5A 1MVOA 4WWHA 2HMWA 2HYDA 2E9SA 3BA1A 5F7JA 1QRSA 5F33A 3WGOA 1VTKA 3EY9A 3CF0A 3FN4A 4FONA 2O8DA 4WLOA 2EBUA 3EQZA 1PRYA 4ER3A 3W5CA 5H7XA 4ZEWA 1NVUQ 3M34A 1KXJA 2YMQA 1K66A 2V9PA 3E27A 3LUHA 2AOWA 1SO8A 4ER0A 2RHOA 1ZH0A 4HDMB 2QM7A 3EZGA 4CFSA 5JCXA 2C0CA 3RSSA 2W8ZA 5AKYA 5BUCA 3GVHA 4FU0A 1M0SA 2ZJ3A 3W1VA 1T5DX 3KO8A 1EBFA 1TOAA 4HK4A 4KREA 1TKRA 4EMSA 3L79A 5DXJA 1JIKA 1T6ZA 1YZLA 3THXB 1SKUA 3KBOA 4X20A 3TH5A 4J0QA 5CFOA 4P4SB 3NX4A 1EM8A 4JJ6A 3O0DA 2H7XA 2UVDA 1S8FA 1CHDA 1QCCA 3L06A 4IHAA 2GCOA 4MO2A 1KKMA 3CBQA 2OO3A 4QDUA 2AR0A 2JLZA 3WZMA 2Q45A 4NARA 4LF7B 3DVAB 4ZXPA 2XRZA 2QI9C 5JJCA 3ZDBA 4TMKA 1I7PA 3EXEB 1Z5VA 1N1EA 2QR2A 2HM7A 2EF0A 2YNMA 1DBPA 2P4QA 3FKJA 3IQZA 1P9OA 1G6KA 2G28A 3I9OA 4HAVA 5K5EA 1MLDA 3CLSC 1NUTA 4W82A 5KYKA 4RTKA 3ND8A 3AUYA 1TX4B 5DWQA 5DYYA 5SYMA 4F7DA 4Z4FA 4DS3A 5JS1A 2AL7A 3SCZA 4PLCA 1AMUA 2XGJA 3JQEA 3LJKA 1JYEA 3GVXA 3K31A 1XDBA 1OLUB 1G5HA 4BDTA 2WF9A 2R48A 1QH8A 1FNBA 1JDNA 1FF9A 1HFWA 2PJZA 2SCUA 4O02B 3T5GA 5J2UA 2BTOA 2VPZA 3PKZA 2QJRA 2OXCA 4FFOA 3S27A 4G5QA 1SC6A 4C7JA 4XUGB 1EB8A 2A0XA 2I4IA 4AYXA 2H1SA 2PKQP 4XYGA 1YB2A 2NW6A 3VOAA 5LP1A 4RD2A 3LL7A 4HUTA 5KX5F 2OTCA 1UR5A 2OM6A 2QNRA 2FWBA 3MUEA 3TB4A 4D8YA 5I3CA 1GKIA 3P2OA 4RWZA 5EMHA 4L15A 1Z07A 3BWCA 3CVOA 4TYQA 1O7JA 2QVXX 3WL5A 4I1VA 4KK3A 5AKGA 4IQ0A 2C54A 3IPLA 3I9JA 2LTAA 4GQIA 2X22A 4A8PA 4WJKB 2ONJA 4E2ZA 4ZJUA 4MQUA 3DMDA 4IJVA 2B36A 2XQIA 4Y0AA 2DQYA 4G1UC 3ZHUA 3OZBA 3IXLA 3KLBA 3P4UA 1NY6A 1RWWA 2A1UA 2J3LA 2VPWA 4I50B 4ILKA 4CG2A 5JZVA 4TROA 2R7KA 2B8TA 2EFJA 3N39C 4X65B 1NP3A 4TTJA 2Q49A 3MJ4A 4RXUA 2LDBA 1GNVA 5BMOA 4DN6A 2C4HA 3AXSA 1OF1A 1XEXA 3KQQA 2CLOB 1PL8A 4AF7A 4CDMA 1XXHA 4I5EA 3RKSA 4ZGGA 3L7LA 3K0FA 3D54D 1Z6XA 3HXLA 3NXKA 4JEUA 2QXUA 3E1SA 3NBQA 3IHLA 4L16A 5EIOA 3M89A 4I50F 3ZNQA 4RSGA 3HCDA 4YP0A 4EATA 1U6JA 5HJEA 1QQ7A 3MS4A 3VKFA 3VNAA 4D9FA 4Q1EA 4QARA 3G2NA 4LY3A 5CHYA 1UH5A 2RJNA 2EP8A 5CA1A 3ORQA 1RQRA 2C57A 2ZDHA 2JHAA 1HEYA 2Q8NA 5KINB 3BXPA 1Y1LA 4JN6B 2QV0A 4IX9A 3FBGA 1YRHA 5DX0A 5EYPA 1AX9A 1QX4A 2E4UA 4Z4GA 1MF7A 4IL5A 3EPHA 1B16A 1S4QA 1IIBA 3FPGA 1X7DA 3JD3A 1DC6A 5AI9A 5CCEA 2MSKA 5H3CA 4KDRA 2IC5A 3FOFC 2G0AA 1IZ7A 5AT1A 4DLYA 4ISBA 4YXFA 2ZBRA 4NK5A 4DNFA 4FDTA 2QK4A 2QROA 3SOPA 5HVNA 4JC0A 5FWXB 3BJMA 3KOMA 1XRRA 4PWYA 1Z83A 5CH8A 5BQ5A 4Q4AA 2PZMA 2X0DA 3R0IA 4AXXA 5BUQA 2D7DA 5DHQA 3UQYS 4YN3A 3OSUA 3NAZA 1XTRA 2RGUA 1TCAA 3UUWA 1PQUA 2ZIXA 1OHHA 4B4DA 3LOUA 1Y9JA 4CFYA 4DMCA 2FPPA 4Q4JB 1RJDA 2X0RA 1MABB 5I7EA 1Z3CA 1I2DA 3R74A 4L57A 3TN7A 4GQAA 1MEEA 4JLWA 1E2UA 4PG5A 4D80A 1VHDA 4KVAA 3QUTA 3UWOA 4A2QA 4GXRA 3D6UA 5KBYA 3G8BA 3IHWA 2OHJA 3EA0A 3GCZA 4X6YA 2QENA 1ATIA 1RR6A 3RG2A 5IXJA 2JD0A 5HKLA 3ZDDA 2RHDA 3OO0A 4KPGA 5JASA 2DLNA 1T1JA 3O84A 3TMAA 1W5TA 3I9KA 2J1LA 2W93A 2FSUA 2X2FA 3BJEA 5KQMA 3I32A 2P4HX 1C4KA 2FX3A 3MAJA 3HDVA 3Q40A 4O2BB 4QO7A 5HFNA 4A8JC 5B4UA 5IKMA 3OZVA 1T2NA 1PTJA 2X42A 4D9HA 3H5IA 3QH4A 3BULA 3WBFA 4LJ7A 4V0ME 3NHBA 4ZGBA 1F1BA 5DM60 2I4OA 1AZWA 2I1VB 1XU7A 3DJYA 1GL6A 3VR5D 4BP3A 2A94A 2B4KA 2ZI7A 1P0CA 3JZAA 4HAZA 3D5QA 3S28A 5J4YA 1Z68A 4H0CA 1LC3A 1QV6A 1M2NA 2PBZA 5I8ZA 1CEYA 1T3TA 5E6SB 2F1KA 4B85A 3DMHA 1H1TA 1UADA 4O2BF 3AEUB 3O1HB 4R6WA 3C2QA 4WOPA 2GN6A 2GXUA 3K2QA 4Y7CA 5I3ZA 5K6AC 3WQRA 2PX0A 1QFZA 4Z7JA 1YB1A 3V8VA 2ZQ5A 3DZBA 4BNDA 1UZNA 1CUJA 1N2EA 3AIIA 1PJ8A 1BQ3A 3GZTB 2OGTA 4CM8B 1DUSA 5LL6P 1Q0QA 4U9HS 2P4EA 2VJOA 2R47A 1PT5A 1YR8A 4IFBA 3PQDA 1XTVA 2YQZA 5EWJA 4KE6A 4MVJP 2PUAA 1PS0A 2ZJ4A 3NKLA 5JS7A 5FUYA 3S8YA 3BIXA 1T4DA 3T3NA 1HDCA 3IX7A 4D3SA 3H4IA 4BFXA 4PM4A 3UCFA 2VBCA 4KVZA 5AD1A 4ZANA 1KYTA 3VV2A 2DBYA 2PX3A 4DREA 4OK3A 2WAOA 4ZJZA 3I05A 4E4TA 4ZVSA 4KJXA 1EFVA 1T0UA 1T9KA 3GRUA 4GSYA 4LC9A 3ROFA 2CXUA 1YZUA 1COZA 1G59A 4TX1A 2F1JA 5CAEA 4XSGA 3A28A 4QHYA 3G0CA 4BP1A 4RTMA 1RRVA 1OI7A 3CF4A 3P9XA 3NANA 4H7EA 2ERXA 4HBZA 3EZNA 4UNIA 1KDVA 2WWVD 4KP7A 3AM4A 3JTEA 4ZPJA 3DYBA 5KTYA 3NHWA 1FQKA 4XFDA 3JVUA 4DDMA 3OI7A 3R5FA 2IIBA 1U2RA 3IL2A 1A8HA 3G5UA 3RRMA 4Y6RA 3V4LA 1O6BA 3ONNA 4ENSA 5AVQA 1Z5WA 2Q5FA 2ZT6A 3A3OA 1JAHA 3I04M 4JB2A 5H9WA 1XDUA 1Y42X 1WF6A 3L7JA 4N3GA 1NBMA 1W9MA 4RZIA 1RM5A 3WL7A 3GA7A 1EJ6A 3L7NA 2ZYVX 4K88A 1K75A 4MXDA 4D9GA 2VH5R 4H1VA 4FGJA 1U7HA 2VPXA 5MFPA 1JJFA 3JPYA 4YRFA 4IIYA 1T36B 5EHIA 1DELA 1JG7A 1L1RA 1Y89A 2LD4A 2JCYA 1FEZA 1WO8A 2IEDA 1I13A 4NE2A 4OQNA 3IJEB 3LMKA 5FLXA 5CDUA 3K6SB 1KAGA 3KAJA 4RY2A 2Y6UA 2BZ0A 2O2GA 2WNHA 1PJSA 3CC8A 4BX9A 4DNOA 4E6PA 4TKMA 3X1WA 1DV1A 3LIPA 3A32A 3BUSA 2YHUA 3PICA 3EUWA 3QJ5A 3F46A 3AUTA 4QU8A 3GEMA 4D3FA 3X2SA 1GILA 4BKPA 5KQGA 3WLLA 4O2AA 1H4VB 2LIPA 3TZHA 2WAYA 3MJVA 1X8LA 2ECPA 3GCXA 2Z5GA 2YZGA 4JLAA 5LBTA 2NO6A 3BTUA 2Q1SA 3C87A 3IIJA 3CLTD 3PGXA 3MLEA 3AR7A 1P60A 2IYFA 1KR2A 2P2SA 1BXGA 2NUPA 3GD5A 2O2DA 3C3YA 3KPVA 3U3RA 1KF0A 2I8LA 3ANNA 3DDOA 3KT3A 4RC9A 3TWOA 3BXXA 4DIFA 5AW4A 3AP2A 3K32A 1W1WA 3HL0A 1RCFA 3TQFA 5ADWA 4E22A 4MKRA 5BRJA 4TQAA 1PYDA 2PKRA 2JHGA 3U7JA 3VOBA 4OAOA 2PN1A 4QTUB 5IJ9B 3NEJA 3KQKA 1SCAA 1XKTA 1N5LA 1TYZA 2D5CA 1JALA 2D54A 2HA3A 3BMNB 3DVLA 2D8AA 4REQB 5D3KA 2BEWA 1VE1A 1BJRE 3RT9A 2PEZA 2AG1A 2AFRA 2I22A 3BGVA 4ZMSA 3B1YA 1TQ6A 5KVQA 1FDTA 3HVKA 3MJEA 2J33A 4ABYA 3B2EA 4LJ4A 1ECGA 3ZZMA 1I7DA 3CV3A 4RSHA 4UEOA 4HFRA 2AI2A 1M5TA 1MU0A 1FXSA 3L7MA 3QYFA 1KI8A 1RT9A 4IIFA 4IZHA 1U02A 1JLLB 5K0CA 3AL0C 1N7JA 4MRNA 1T1GA 5KPDA 2XGMA 3F3SA 3GWZA 1RRFA 1F38A 3QVXA 1E2JA 1TVEA 2DBVO 1FIUA 4YMIA 5IMBA 3QIAA 3GAAA 3OMLA 1NMZA 2RBKA 3SYTA 3U80A 3OZWA 1GU1A 4RD6A 4BEVA 5EJ7A 2OKGA 3ICPA 1KQPA 1SN7A 1Z88A 1JILA 4NOMA 5TEVA 3GG2A 1ENZA 4H1WA 3L6EA 3TNYA 3UAZA 1F12A 4MEBA 3T7DA 1HKUA 1UC9A 2DUJA 2ZWIA 4POOA 5LU8A 3SVLA 4M88A 3QUSA 5FPHA 5BVHB 3P0HA 2COUA 1PVDA 3LCMA 5JZOA 1Z35A 1TC1A 1ZC4A 4RAOA 3VUEA 4IIVA 3DHVA 2JLBA 2Z3VA 5B37A 3HJCA 2E48A 2ZXEA 4ISCA 4J1NA 3SF8B 4PC3A 4KFTA 3WNDA 1EFPB 1GZVA 5BWMA 2F3SA 5LXTA 3EA4A 4M1TA 3FUWA 2XZTA 4J2HA 4C30A 3EJ6A 2GCNA 3E7WA 4EDFA 4BU0A 2WJ3A 2HQBA 5ICFA 3ZDXB 4IVPA 4MQLA 4ADSG 1SAYA 5AW3A 3S1AB 4EVSA 3RBAA 4UULA 3ZCTA 1EWRA 2GXSA 3D64A 3TPCA 3ZV7A 2O8NA 3RAEC 2DQ4A 2O20A 1ZOOA 4RMGA 4UNRA 3K1YA 1QYVA 5AJZA 1XYGA 1ZH6A 2ORIA 1XTQA 2JJ1A 2LGJA 1R64A 5CK5A 3CF4G 3HYCA 4RLHA 2P1DA 4JL6A 1EIWA 3ZQJA 4LW8A 2XRMA 1Z0DA 2XBLA 3RKRA 2X1MA 1Y1RA 2FX2A 4FR5A 4KTTE 3D7NA 2QTVB 4FFBA 2FLWA 5EIXA 1CULC 1T3SA 5CG2A 1LQUA 2UZ1A 4M49A 4F6CA 3ZG6A 4LY6A 4CNBA 3WLAA 3AY7A 1AD2A 2JFZA 3RWBA 4OUKX 1P5FA 2ZBFA 4WNIA 4C6TB 1ZNYA 2X8WA 2YH2A 1OXSC 1J6UA 4G6ZA 4MW1A 4BRZA 3AEKA 1OB2A 1EESA 3GRYA 4UCWA 2EYUA 2GVDC 2IYXA 3DEHA 1JR2A 1HE2A 1HYQA 3KXPA 1K0UA 5JDCC 5NLLA 4OYHA 2WHXA 4ZVQA 3KSBC 3IE1A 3PUYA 2YWBA 4ZMRA 1QH9A 1O95D 2C4KA 4MQ5A 5FOWA 1IHDA 4L08A 3L0IB 2OBMA 2BM1A 3G23A 1C7FA 2HMYB 1IHPA 1NV9A 3CPEA 3QKUA 1FYEA 1X7XA 5JYCA 1F20A 3CJRA 2DHCA 1Z5PA 4OQZA 5F64A 1G9TA 3V4FA 4RKEA 1JF8A 3TSZA 2KBEA 3BBPA 4JLNA 3G0HA 4LOLA 3PC6A 3IIIA 1ZI8A 2V7WA 5CLQA 3T6KA 4Z0NA 2ZYAA 1WDWB 3FPJA 3TLGB 3CLTC 2OHVA 2Z09A 3AX6A 4YTEA 1YS4A 5SZJA 3THOA 1YFLA 1G7RA 4AKTA 4FN4A 2BGGA 3A3NA 3HM2A 1M2GA 3INRA 3OEHA 3A6GA 3H5VA 4PLVA 4QO8A 5CLLA 5EWMB 3W6ZA 5FWYA 4P84A 2YL2A 1JN0A 1M2OA 2H4HA 4QUEA 4OHZA 5I7RA 2B35A 3QFCA 1DRUA 1L7DA 5CT4A 5IAKA 2V7XA 2IJGX 3AR3A 2EJWA 1V6AA 3AKDA 5SYNA 4NR0A 3RHTA 2QWXA 3BXZA 1W5FA 2QPAA 3R0VA 3TEMA 1UJ4A 1YZKA 3FR7A 4UM5A 4DFDA 5INTA 4M4SA 1HG1A 4JI4B 3N53A 1LK0A 2AQ8A 2UYYA 3ZH2A 3N8HA 4ZYZA 4ERNA 1G20B 2XZDA 3WLTA 4MR8A 1WMSA 2CZQA 1AHHA 2GO7A 2C00A 3MWYW 1ORDA 1DBSA 1H1DA 1W49A 2ZI5A 1V7CA 2G9UA 1C0EA 2YOHA 3ZCSA 3IO3A 5GINE 4V39A 4R1NA 3HA3A 1KMHA 1OPRA 4CDGA 1RIIA 4J3FA 5LMCA 4PRYA 3P0FA 3KB8A 1AKTA 4BCCA 5B4VA 4D9EA 1QQBA 4PPNA 1JIUA 1T8PA 2Z8YM 4RVUA 3N0RA 4H17A 4NBUA 4ZVTA 3D9QX 4GW3A 1H2RS 5DNDA 2XVZA 5EJ2A 1XLWA 5FBRB 4Z4HA 1A69A 1AO3A 3LCJA 3C3EA 1GPYA 4JK3A 2CMFA 3NAGA 2PRZA 2DQSA 1W93A 3DD5A 4FLMA 1BDBA 4JAVC 2PMWB 1ENPA 5GONB 3SSNA 3JZDA 3O2SB 1C3OB 4L4RA 2YJNA 3SPXA 4YRZA 3J81A 2ID7A 1VSUA 1RCTE 2Q6LA 1WLSA 3Q9SA 4RTOA 3WSWA 2H6EA 5JNVA 4B3TB 5EJ9A 2X86A 3BDAA 3CTPA 2HBYA 3I8OA 3NCHA 1EX7A 5KYUB 2XA9A 3CRNA 4GC9A 4ZHQA 1X2BA 1I14A 4GX5A 2V96A 3OQIA 3NJ8A 1NWHA 2JPDA 3IOCA 5DB4A 1FMCA 5GONF 1CWUA 1RKVA 2DCMA 3AM1A 5JJLA 3GJYA 1MRZA 1E1RD 1Y7IA 2TECE 5F76A 1G16A 3D0RA 4LQLA 4R9NA 3Q0EA 5HHTA 4GMXA 4WBNA 2CNBA 2EZ8A 2VJKA 3K9BA 4HAXA 3E35A 4WN3A 4YDQA 1P75A 1Q21A 4ARSA 1ULSA 3GJ5A 1KJIA 2YC4C 3IR7A 2P2CA 1T1IA 2OYRA 2FSPA 3W3AD 3ZEAA 4AMYA 4P53A 4CT0A 4LXYA 2GPJA 1PBTA 2WTUA 4UOEA 2GBLC 3OIYA 5E3JA 3FDJA 4BO4A 3NWBA 1SCQA 2CXTA 1Z4PX 1IQ0A 1WVGA 4PSUA 4MDFA 1HSOA 3WYGA 4FMPA 5AVRA 3PNOA 1KJQA 1TJYA 4WFJA 2NTEA 1XK7A 3DBLB 1AUOA 4Z0HO 1I2BA 3KWMA 1W0KA 4ZO6A 4LYHA 4UVHA 2GERA 3A1DA 1ZOIA 2VYND 4X61A 3IB6A 1PWYE 2NVOA 1C1YA 2CUTA 2UVQA 3Q2KA 2L0XA 2WFAA 4YASA 3QPCA 4LQCA 3UWMA 1P4AA 4F0JA 1J8FA 1C30A 1OKKD 1A71A 5REQA 4QODA 3REFA 1K8ZB 4MDHA 3MBKA 4JENA 1PYOA 1K5HA 4Q0MA 5JXJA 3UV3A 2BFEA 3QELA 3STWA 1YVDA 3BRSA 1L7NA 3E3NA 2V5AA 1J2EA 3BGSA 1FTGA 4CLXA 3WAGA 5CVCA 2W83A 3MTDA 4JYPA 5KSYA 4FT4A 2JD1A 2IKSA 1F6BA 2JZCA 3O3CA 1M76A 1QMPA 3I12A 3HXTA 3MWFA 1VCIA 4ML3A 2JGDB 1I3LA 1BJKA 2WYVA 2V7EA 3VC3A 5A4MS 1KE2A 1LVHA 2G63A 4H08A 1OCEA 1EGQA 1JWAB 2YZMA 4WCFB 1AA6A 4XIJA 1J70A 3AUUA 4DC9A 1E96A 5KYXA 1UEIA 2PUCA 2YOFA 4G2TA 3O8RA 4L27A 5ALEA 2NU6B 2I6TA 4HL6A 3H42B 1E6EA 1LEHA 4ENTA 1L4NA 2PLFA 1IJEA 4L07A 5AKIA 2O3TA 5K3BA 4NYMR 2H3EA 3KSUA 3EZ2A 2C5AA 2IOHA 3JX9A 2JBWA 3SZUA 4J6FA 3DZGA 3WZLA 1XTUA 1OFTA 2CKMA 2G17A 5HBRA 2HWWA 1DQZA 1P29A 2BM0A 2OBXA 3HO8A 4I4IA 5CVVA 1XPRA 1AHNA 1QGZA 4JBLA 3STXA 3WSTA 1G8YA 1E2BA 3LUFA 3BD6A 3KU4A 3J81k 3DO6A 3QEMA 2R00C 2HLDD 4PC2A 4DR2B 4LPKA 3E2PA 5JO9A 4BP8A 1G20E 2XUIA 5DSZA 4ZYLA 2V3CC 1JNXX 4OJQA 1HDGO 2VDVE 4P54A 4UCFA 3ILYA 4B44A 3D4IA 1NAHA 1KH2A 2D5BA 2P2DA 4KOAA 3EVGA 1P45A 1PR9A 3ELYA 2WWWA 1AXEA 3F6CA 3AR2A 4IWYA 4J0DA 3Q9LA 4KQCA 2NQ2C 5JSUA 1SQ0A 3MZ0A 3OT1A 7GPBA 3EEYA 2N46A 1IDN1 2ZRIA 1TUIA 1Y9AA 3BIWA 4G9BA 4S12A 1O0CA 3R3ZA 3HNRA 1QIGA 4PPFA 5FULA 1REQA 1BKDR 2IGBA 3OU7A 4NDZA 2IWRA 1H3NA 1X1CA 4JLMA 4F4UA 4OX9B 1USVA 1UOQA 2HNKA 2ONKA 2XUZA 3PQCA 4XB1A 4NCBA 3BHMA 1KJZA 3LC0A 1CIJA 2VCEA 5CXSA 1OD6A 1JU4A 2J3HA 1ABEA 2ACKA 5K6TA 1YWGO 1DRWA 1ZUHA 2A9OA 4KVGA 4PYIA 5HXAA 4MQBA 2KYRA 1UK6A 1JHXA 3A7DA 1XP8A 1FFDA 4JJEA 4R3UC 3K70C 4UM9D 3H65A 1G63A 3L6CA 3TGWA 2Q3MA 2NUBA 2ZE5A 3NWEA 4AWXA 3U7FB 5K3FB 3CLVA 2QRLA 4PX5A 1GL3A 1FVHA 1T4CB 4IDDA 3AUSA 2QTMA 2PX2A 1XMXA 3FPHA 1B6GA 1K6JA 3L4JA 3RVRA 1IWOA 4BU1A 4RVOA 2W6IA 1DTWB 1RBYA 3VPFA 5B1YA 3HVHA 2AOXA 3KL2A 3STYA 4U6SA 3WIEA 3BJRA 1VLLA 5T41A 4ZIRB 4F6LA 4PZLA 2X9GA 4GBMA 5JVDB 3ZV5A 5G1OA 9ABPA 3F4LA 5KWJA 1D5CA 2VWGA 1CY0A 3LGAA 4F4IA 2JI4A 1RWXA 2RBGA 3E61A 1UBMS 3M4JA 3KT6A 4EKNB 2H63A 4X92A 1H2YA 4H0FA 1R1DA 1KSFX 4ID9A 1PZMA 4KIJA 2A59A 1GPNA 2GAOA 2JFGA 2ZQZA 2GM9A 2QMHA 3CRZA 3MWDB 3GNSA 4ALMA 2C3MA 2RH4A 5AI6A 5IC4A 5KNCA 4H15A 4QOFA 3FF1A 3W2EA 3LL4A 3UTDA 1E2PA 3WMXA 4J6EA 2PXXA 3U3KA 5LBUA 4EB6B 1V3TA 3KE9A 2GEKA 1PDWA 3H2YA 3Q7IA 2ZRAA 4K9NA 5HCIA 2A9JA 1MQSA 3T0GA 1FLNA 3FTQA 4BKRA 3ETHA 5KDLA 5A3VA 1UZUA 1X7WB 2Q3LA 4PRZA 3ZD9A 2WTEA 4O0MA 1XZJA 5BNTA 3IRVA 3CG0A 1X38A 4HBGA 3SJAA 1BEZA 4URXR 2QQFA 2VHUA 1JKXA 1PKXA 2FWJA 2HWKA 3LBFA 4MMZB 4Q03A 4E7OA 1PJ3A 1GKLA 4E5VA 2ZBEA 4GI3A 2W6NA 3TIVA 4I1OA 3M7IA 3TLEA 1FE8A 2DMRA 3Q7TA 1QYRA 3ETNA 1B3BA 3JQBC 1R9JA 1EXMA 1TJ4A 5JPIA 4B84A 3I5UA 4F3KA 2PSHA 4YRBA 4L9WA 4UHEA 4QDJA 5I9NA 5LM3A 3H2SA 4Z7QB 1NR7A 5KO2A 5TPWA 2CW5A 5D5PA 3DCYA 2J7PA 2N9UA 4OCZA 5HUQA 1GR0A 4RCZA 1F0NA 4OAPA 3FLEA 1ZIXA 5CD9A 4PIMA 2A33A 2ARKA 3PHLA 4L95C 3UPUA 5CIYA 3MG9A 4NKRA 4OHKA 1DOAA 2Q6TA 2ZROA 2H1CA 3WX0A 4GOMD 4MDYA 4Z4QA 2H0QA 1E2FA 3KKEA 2AN4A 2QE7D 3CXUA 1UKAA 3G89A 4Y2PA 1FTYA 3KLOA 1Z2CA 1GTMA 3RDPA 1UC5B 1YL7A 3IAEA 5EMJA 5LB4A 3QE3A 2MR5A 4ZDIA 3NBFA 1OH6A 4YRGA 3NIDB 2PFSA 3UB4A 3DHNA 3GP5A 4LGVA 1ORIA 4CETA 2XYQA 1BE8A 5JYEA 2EWMA 3Q5EA 1SG6A 2VLBA 2VJPA 1YKGA 2XAAA 4TPKA 1RHUA 1FBTA 3D4OA 3LHKA 3K5WA 4TS9A 3TL2A 3AXTA 3RUCA 4BLRA 1SVUA 4HFNA 4I5GA 3AU8A 5ENVA 1B23P 2DECA 1RI2A 4J1TA 1CW2B 4D98A 1EDZA 2VAWA 1HNWB 3JQRA 2VZ8A 4JUCA 5SICE 4TT3A 5C35A 5JSQA 1HRDA 2W2QA 3ZJTA 2DU8A 2HIHA 3R6DA 1YZQA 2ZI6A 3OZGA 4GM0A 2BPOA 3F8TA 1WMEA 3EA5A 1W7AA 2CV1A 1R7RA 2QS9A 1J25A 4P3YA 3PHJA 2PUTA 5B2FA 3QTTA 5FCDA 3KEQA 4OUDB 3JSAA 4GKVA 1YVRA 2DH6A 2XDQA 1Z4NA 5ALTA 1EP9A 3ESCA 3C1UA 3RU7A 1T6NA 4OB6A 2XCQA 4IH9A 1L5WA 2VQ3A 4IICA 5A7HA 1W85B 2J3DA 4I1SA 2W43A 1GEEA 1DNPA 3JRWA 4DA6A 2YXBA 1D2CA 1KZ1A 4JOQA 3VMFA 5IKPA 521PA 1ABBA 1UWLA 2BT4A 1I1NA 1WXFA 4KUHA 3ZKWB 2UYGA 3OX4A 5D8DA 5BW8A 3EIHA 3PDIB 1C7RA 3RM3A 4W5QA 4EYKA 1O94D 2AQHA 4JVMA 2IODA 1VCHA 4KFCA 1B8VA 1A5ZA 2JJ2A 2G4CA 2OXEA 2XCUA 2O8DB 4RMJA 1PFQA 1ZWLA 4FUTA 1I6WA 5CCDA 2YY5A 1DEAA 4HS9A 2NTJA 4V0RA 1RRMA 4YJGA 3N07A 4JGGA 2WVGA 1JR6A 4EJ0A 3MW8A 3FPBA 1CR2A 2EG5A 3PEFA 3THWB 3ZU5A 2D2FA 4RY9A 1O97D 4P5PA 5BV8A 1VYTA 4G2NA 4QYSA 3W6UA 2Q41A 3OPYI 1XX6A 4GZ3A 4I1PA 1OX6A 4QDOA 2YIMA 1Y8QB 5HQJA 1G4AE 1Z6PA 3PEEA 4LHSA 4U8GA 3LGXA 1Y3HA 3BT7A 4RF3A 3S3TA 5FOSA 4FYXA 3H1TA 2J0EA 3N59A 5CT9A 3AM5A 1I0LA 4D9MA 4DSAA 2F3QA 4JR1A 1NZDA 3T0IA 3VGJA 5B3LA 1RKXA 3E84A 4P0TA 4MAAA 3LO8A 4OOFA 5AFSA 2O4UX 2O6LA 1W4BA 3FDXA 5GZ1A 2NGRA 3IQIX 2X7HA 3NHKA 3BTSA 1KIFA 1UT6A 2PIAA 2K7FA 1B8UA 5TMPA 4K1XA 3OY7A 3RSHA 5L7YA 4W9NC 3C3CA 3WIBA 4BO3A 2GCOB 5HF9A 1SOUA 1YMUA 3PQ3A 1H23A 2DETA 4O3FA 3BCSA 4JX9A 3WNZA 2I91A 2P8SA 4WD3A 1BDIA 3SQXA 1PEAA 2O3QA 3RF6A 2EJVA 2F8SA 3M6UA 4Q6BA 2Q2OA 1N2BA 5EXTA 5KOIA 4DIUA 3UNXA 4U0JA 4YAEA 3FSGD 4ZT6A 1XLUA 3QV1A 3RV4A 5KWIA 4CL0A 3WGKA 1NLUA 3ZH9B 1CY2A 5LUAA 3A1SA 5IDVA 2P9JA 4MITA 1AZLA 1M2VA 2VJMB 3EYAA 2I7VA 3FLBA 1WUYA 3OWOA 1FYWA 4NZZA 1ZSNA 2JGAA 4IFEA 2OGZA 2IDZA 2ZSBA 3N0WA 1GQOA 3NC1C 2EDCA 4LJ9A 1UEJA 4R83A 3CG4A 2OLEA 5UKDA 3A04A 3K9NA 4YONB 4FB4A 1OLXB 2C2YA 5L3VA 1MJGA 1CYDA 3O47A 3GI1A 3LCRA 3Q6NA 1E7SA 3MGAA 1E3WA 2XHEA 5K0LA 1EUDA 1V2GA 3G8CA 1SVOA 3OCUA 3PFBA 5JI2E 4TKLA 3U62A 3BL5A 3NETA 4DEYA 2AQIA 5A9SB 5J5VA 4XDYA 3E23A 1EI9A 3N7TA 4Q01A 1TLFA 2EP5A 3OE1A 2PSJA 5DHUA 4PQRA 2VXBA 1N6NA 2OENG 4HRXA 5FFMA 1UIMA 3IEKA 4GPTA 4JVLA 1U7OA 1LJLA 5DE3A 3FTEA 3SBDA 5EZ5A 1C80A 1UK8A 2RK6A 4NBLA 1E89A 1JH8A 2WZQA 1II9A 1MT0A 2AXEA 2PX6A 2R2AA 3AOGA 3VOSA 4PYRA 3WOVA 5B1HA 4U7DA 4AULA 3ZI4A 1MOZA 1N6LA 4OA8A 5F1YA 2HPAA 4DA8A 2C97A 2Z30A 4FDMA 1X0XA 5J2TB 1QPZA 2RG1A 1H22A 4K6GA 3WHPA 4QIHA 1IXZA 2A1UB 2KBFA 1O1YA 2BI7A 3D59A 2YY7A 3LDUA 3L8GA 5DNEA 3UJ6A 5A7FA 5MN6A 3E8XA 1YS9A 2AWNA 1HY3A 1XZCA 1NMXA 3DC7A 3EGXB 3FZYA 3W7AA 4KGDA 3DF7A 3V3KA 3AKEA 4TLMB 4RZUA 3ABZA 3GR6A 2JEYA 1SXJD 3OPYA 2QTCA 1ZIYA 1XXHB 1ULUA 4EFMA 3DEKA 3K0FB 1MBZA 1KS9A 1DL5A 1JIJA 1VG0B 4KLAA 5EIWA 3C6YA 2ZT7A 1ADCA 3BCUA 5J2TF 1KP9A 3HNPA 4KDEA 1JHOA 3WGJA 1PVOA 4R9RA 3OIGA 3DPUA 3IMCA 3B6EA 2JGEA 1Z8NA 1CETA 2O0LA 2VDOB 1HBJA 3FWYA 4UMDA 3UF0A 5IF9A 3S1SA 2PO5A 2CZGA 1CQIA 1X42A 1M0EA 4IQ8A 5EZYA 3VJKA 4BVEA 1DJPA 1O4WA 1KY5A 2C5FA 3E53A 3K9GA 4J9UE 3V1MA 5IN4A 3P9YA 2A67A 3HACA 2HJWA 4URYR 5DN6D 4DLWA 1QRTA 1QIEA 2QQ5A 3Q3EA 3R3XA 4HQFA 4HQ6A 4ZCMA 1O94C 1KI4A 2GKSA 4JB0A 4JUIA 3U81A 1W2HA 3Q4GA 1DX4A 3BICA 3H1BA 5JSHA 2CVOA 4G81A 4POAA 3UJNA 2A5FA 2REBA 3E5HA 3CSDA 2QV7A 3F2VA 3AI7A 3FYCA 3QE4A 3B52X 3I2GA 4FTWA 3B3FA 4RPJA 5DOZA 1DBVO 3KJIA 1O97C 4B43A 5CLGA 3FUXA 3HUTA 4QOEA 4ZP1A 3PQ6A 1ESDA 1ZICA 3HMQA 4PZCA 1QUEA 2ZAMA 3GH1A 3TR0A 4NIMA 3CW9A 1U7WA 1ZIDA 3KUKA 4IJ6A 4XWOA 1XFAA 2XUGA 1XN1A 3QVGB 4QTXA 4LYFA 4X1IA 2C8JA 2FPPB 4Z8YA 4IP0A 1QQ5A 2D00A 2I76A 1H05A 1D2AA 3Q8MA 1TYCA 4Y9DA 1H0SA 1IBCA 2QQGA 2W2LA 2YVUA 2UZ3A 1IM8A 3IXMA 4G26A 4M76B 3E9MA 4XFJA 5AHKA 5FBVB 1Q91A 3EIWA 1FRFS 4TRMA 3EVZA 4BNYA 4EG0A 1MXFA 2PLNA 4KPUB 2OYSA 5DHFA 3Q15C 3KQVA 1ZD9A 3AUJB 4UBKA 1SZDA 2BWJA 2VSOA 4WT7A 4P5EA 4UMFA 3EGIA 4LFCB 3ORRA 1T4GA 4M53A 1AB5A 4M9CA 3SQNA 3VVBA 2O57A 2P5SA 4HJRA 5EE1A 3H7AA 3IPAA 3QVSA 1RADA 3N2KA 3ZHVA 4AKGA 4DHEA 4Q9IA 4ER5A 4KXNA 4GPIB 4UZSA 3DWEX 4GC5A 1TTHA 1YDWA 3UV6A 4CF7A 1GDTA 3MCZA 2WM2A 3WWCA 2D7JA 4FFNA 2X4LA 4MGYR 1TVKA 4MRVA 3CURA 2BHNA 4IIJA 4X1OA 5DGDA 1VL1A 5BVGA 3EXFA 3GJXC 5CM2Z 3RIYA 3THYA 4H7PA 2G1PA 3BMCA 3QWBA 3SXUB 4X7RA 3W1EA 4MWGA 2JJQA 4FKMA 1YQGA 3LHSA 2OGUA 1KI7A 1SBIA 4DCUA 3W2FA