3FRJA

Crystal structure of 11b-hydroxysteroid dehydrogenase-1 (11b-hsd1) in complex with piperidyl benzamide inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
262
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-Dehydrogenase, Isozyme 1
publication title Discovery and optimization of piperidyl benzamide derivatives as a novel class of 11beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 262
sequence length 264
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3frjA00
2VN8A 4J90A 3BHJA 3BAZA 1O0SA 1LLDA 1QSGA 4XB2A 4U6QA 1PJBA 4A73A 4YJFB 3PQFA 2VHZA 3PLNA 1MG0A 1SEVA 3C1AA 5ES3A 3I5MA 3VH1A 4CMGA 1BTOA 5B37A 5T67A 3TL3A 3JQFC 3IP1A 1YB1A 4PLHA 5JAMA 4FD3A 3T4EA 3LF2A 1K0UA 4DQUA 3AY7A 1JKFA 1EK5A 4FJ2A 4RPJA 4WASA 1UUFA 3LT1A 3PFWO 3VKUA 3EUWA 2Q2QA 1ZMOA 3CEAA 1H2HA 4AJ1A 2D1YA 2GZ2A 4DMMA 5A9SA 4YWJA 5I9LA 3C3XA 3F4BA 4BV8A 2DBVO 5EIOA 1GYQA 1VL6A 5GY7A 1GL3A 3JQ8B 4PZDA 2EV9A 1H6AA 3ZH2A 3WTCA 5MGBA 3KLMX 5HS6A 4OKNA 1VJ1A 1E1KA 3PIIA 3F6YA 3ANNA 3AM5A 3NTOA 2UVDA 4P38A 1V6AA 5KVQA 1A7AA 4FCCA 3BIOA 3KYBA 2WD8A 2O3RA 4DWVA 1ARZA 3F3SA 1ENOA 3CZMA 1YONA 3DTYA 1MP0A 3A06A 4XRGA 4B8ZA 1JWAB 2XXJA 4D79A 3TN7A 4GQAA 3V2UA 3OH8A 4OSOA 1E3IA 4UVIA 1MA0A 4YQZA 4KUGA 4AJKA 5TQVA 1C0IA 3MWEB 1KC3A 3H2ZA 4BB6A 4KUEA 3RUAA 4CLRB 1HZJA 2VZ0A 3IUPA 2FPIA 4R4JA 1FF9A 1GQQA 4CMEA 1W4ZA 3WGQA 3I1JA 2FZEA 4AJPA 2BGLA 2PTGA 4UREA 4IXTA 3NUGA 1UXKA 1DIGA 2BELA 1FJHA 2VOEA 2VTEA 5L7YA 5GZ1A 1YL5A 1VI2A 4ND4A 4DLLA 2C54A 1Y9AA 5ITVA 3ANMA 3I4CA 3K73O 1UZLA 1W73A 2Y93A 3PVZA 3U4IA 4EW6A 1PS9A 3GN1A 3WJ7A 2I65A 4WLVA 1ISIA 3LQFA 3IC5A 2FR1A 2D3TA 4QEDA 1Y6JA 4RLHA 4G2NA 5L51A 2GO1A 4MIOA 1IPEA 3LYLA 4WLFA 3JQFA 3CE6A 4W7IA 1YDWA 1HDXA 1TT7A 3F1LA 1JAXA 4KUHA 3WJAA 3TJRA 3DAPA 1CF2O 1NPDA 4BNZA 2HRZA 1YQGA 5HM8A 1JDJA 3KBOA 1G1AA 2CMDA 5I9MA 4E33A 1GYPA 2NU6A 4AJJA 4MVJF 1D7OA 1F8FA 1Z75A 2O3UA 3H8VA 4ND2A 3PZBA 1KY5A 2JCVA 1FDWA 3P2OA 8ADHA 5IXSA 1GDHA 5JAIA 3D4NA 4OXKA 4RPHA 4YCAA 3FNGA 3DR3A 2DTEA 4ALLA 4BL5A 3SC6A 1GY8A 1AE1A 2Y66A 2OP1A 4QTZA 5G0VA 4UUNA 4MOWA 1E1MA 1Y81A 3ITKA 1YE3A 4CMBA 2GD1O 3IUSA 5A9SB 4U8GA 3NRCA 4A7PA 2W2KA 4AJ2A 2YUTA 3EAGA 3W8EA 2QW8A 5BSGA 5CDSA 4XD2A 4PFJA 1F14A 3D3EA 3ZWPA 2NVBA 2LDXA 1UDCA 1ENZA 1WP4A 4CUJA 4HNGA 3F47A 3H9EO 3KEQA 3G3EA 3V5NA 1PJSA 3ZGYA 4F45A 3GEMA 3QVXA 3KYDA 2WD7A 4AJIA 1CWUA 2YJZA 4E5KA 1HSOA 2PH3A 2YDXA 4E2WA 1JU9A 4EZBA 4B4OA 1EDOA 4JNKA 4QT0A 5KKAA 1H0KA 3HZZA 4BIIA 5ICMA 5B4VA 3NDJA 2AXQA 3IQDB 4AL4A 3DMTC 3RVDA 4Q39A 5U4QA 3VPFA 1R37A 4G65A 4YAIA 4HADA 4IS2A 4YEDA 4LRSB 3EGOA 4XWYA 4CMJA 2NACA 1XWFA 2GNAA 3WBFA 2C20A 4E2ZA 3B1KA 3HB4X 1E3SA 4XGNA 3D0OA 3AUUA 3E5RA 2C07A 2V6GA 2EGHA 1NFQA 4BO9A 1EBUA 3AK4A 2VZ9A 3GR6A 2YW9A 4DGSA 4NBTA 1T2AA 2VRBA 4IY1A 3KETA 5I9NA 2PZJA 1PWXA 3FTPA 1R16A 1TLTA 4II3A 3PHJA 4PLWA 4XCVA 4OH1A 2PD4A 2W90A 3I52A 2IZ1A 2C5EA 1GEEA 1M76A 2TMDA 5EJ2A 3VH4A 4B3JA 4NH4A 3NT4A 1UZNA 2VYVD 1RM4A 3JYQA 1QG6A 2DBQA 2EW8A 1HDZA 4FW8A 4XA8A 3PJGA 3U49A 2BH9A 2EG9A 3PQEA 3PDUA 2YHIA 4OOFA 4CQLA 1QV7A 4IPTA 2JFHA 3FHLA 1J49A 4IQGA 3WR5A 3O38A 4M8SA 3OM9A 2IXBA 1I2CA 3AOGA 2OO5A 5THQA 2QRLA 3EC7A 5DF1A 1XSEA 2EKLA 2J5RA 3ZZNA 1DBVO 2WE8A 4Y67A 4NFYA 5F5NA 2D5AA 2V6MA 4RZHA 2J3KA 4BGVA 1R4NA 4HWKA 1ZUD1 1M66A 5TGDA 2BGKA 5A1TA 1LQUA 1XA0A 4HKTA 2FR0A 1BXZA 1HTBA 1LRJA 2BHLA 5I8ZA 4TRMA 3PTZA 3DWFA 3T7EA 3F1KA 4CV3A 4XQGA 3JQAA 4CV1A 1U5CA 3U4HA 4WECA 2ZCUA 2CVOA 2W2KB 4LN1A 4IGEA 4IZIA 1LLCA 2PFGA 1PL7A 2PD3A 2Q2VA 5IDQA 1V3UA 4TZKA 5DBFA 1R0LA 4BO5A 3QSGA 3DMTA 1XR3A 2HJSA 1IULA 5AXBA 2BFAA 4CM5A 4J2HA 1XKQA 1U4OA 4YAJA 4ROSA 4UUPA 4KP7A 1YVEI 1IUKA 3PWSA 3C7CB 2SCUA 2WD7B 3RUCA 3KSUA 3GHYA 2YHUA 4CMAA 2B4TO 1C0LA 4DYDA 4N5LA 4F6CA 4RPGA 3OEWA 1U2DA 3JQ7B 3GDGA 3JD0A 3WG9A 4BO7A 1C1DA 4WCDA 5CEFA 1GYRA 1R66A 4FR5A 4YAEA 1I3LA 4WCFC 4ZGWA 4W4TA 4BNFA 3TPCA 4LW8A 2EEZA 5C7OO 3RWBA 1QMGA 1HF3A 3EVTA 2Q46A 2C29D 1I3MA 2H1SA 3JYOA 1PZHA 1UR5A 3BHIA 1T25A 4QECA 1M75A 3ASVA 3ZNPA 3RASA 4DQVA 4PLVA 3R0IA 4WNCA 4J2OA 3ZWYA 4E13A 1PSDA 1KVRA 3IIEA 5KJEA 5C37A 5KJ1A 2NU7A 2JAPA 2W98A 4HBGA 3NJ4A 1PJTA 4Q3NA 3E03A 3F5QA 1KS9A 1HYEA 2PGJA 1ISGA 1WMBA 2VHYA 4CQLB 2YHIB 4L76A 3AI2A 1C0KA 2RAFA 3DAGA 4Z9XA 4L4XA 1LC3A 4I9NA 1HDCA 2B5VA 2Z1MA 4KOAA 4P22A 2CDAA 3WGHA 4CLEA 2AQ8A 1OAAA 2RH8A 4GLOA 5BNTA 1M2WA 5JE8A 4RQTA 1L1FA 3SLGA 1QR6A 1DJQA 2OUIA 2CDCA 1JN0A 1GCOA 2ZB3A 1BXGB 2AG5A 1EE9A 1P77A 4LGVA 2EJVA 3VZPA 2ZJ0A 1N9GA 1LDNA 2Q45A 2RIRA 4U0JA 3OJEA 3K8ZA 3D3WB 4N7RA 3UN1A 3UVEA 2OHXA 3DHNA 3JQAB 3DBHA 5AXCA 4AVYA 4I9UA 5JNLA 1B0AA 1PJQA 3JYPA 1P44A 3E82A 1U28A 1X0XA 2Y05A 3WMWA 3OIFA 2ZB7A 4UUOA 5JYDA 1X1EA 4C4OA 4CQMA 1SEPA 3BTOA 1UP6A 3EY4A 4BO0A 1B14A 4A10A 1BHSA 4CLDA 4YRAA 4D3SA 2QHXA 3QVSA 2X5JO 1WZIA 3RJ9A 4CM4A 2BI7A 5AXAA 4NNJA 4M89A 2Y67A 1W6UA 3A4VA 2ZB4A 4WCFA 3W8DA 3R3JA 3GZNB 4B7CA 1U3VA 2OZPA 3EW7A 3ETDA 2I9PA 2W4QA 2B4RO 3KV3O 5IXYA 3G17A 3X2EA 3PPIA 2RCYA 1HYHA 1Z82A 4NG5A 1D3AA 4L0QA 5C5IA 2ZQZA 4ZRNA 1Y7TA 2EKQA 4BKPA 2O2YA 3N74A 3L9XA 1M67A 2NM0A 1C1DB 1HWYA 2P4QA 2E82A 1DIHA 5I7VA 4WNIA 1UH5A 1YWGO 5CDGA 2G17A 1N1GA 4MVJG 1O94A 1DO8A 2B69A 4UEOA 5KTKA 1Y8RA 2DKNA 3P2YA 1E92A 4NFHA 4B3IA 3F9IA 1KEPA 2O4UX 2QX7A 1KVTA 4UVDA 1FDTA 1MGOA 2ZYAA 3UUWA 1Y1PA 4KZPA 4OXNA 1QXSA 5IN4A 4AJEA 1Q0LA 2JFFA 3GT0A 3NT5A 5LC1A 3S2EA 1E3JA 3FI9A 4BNHA 5IZ4A 1DIRA 1UJMA 1P33A 4I08A 4R69A 4XRRA 1E3WA 4YB8A 4DLAA 1NQAO 5FF9A 1WWKA 2X0JA 3PFFA 4MIYA 3HN2A 9LDBA 1AXGA 2PD6A 4D43A 4LSWA 1B26A 2DQ4A 1HE4A 4Y6PA 1I3KA 5BNFA 3Q2KA 2BRUA 1ML3A 3UKOA 4PVCA 2BKAA 4DYVA 4GX1A 4DIBA 3JQEA 2VTDA 1I2BA 3FNEA 3N7UA 4MPDA 4QSMA 4IQ0A 3E9NA 1EVZA 4CMIA 1VE9A 2V65A 3PYXA 5FFFA 3WLFA 3AY3A 3PHGA 4YT2A 2BFOA 5DP2A 3GDOA 2FR8A 1YXMA 3GEDA 2WDZA 4RV9A 4BKRA 1YJ8A 3M1AA 3RUIA 1AXEA 2JKVA 2FSVA 1F8GA 3K2EA 1VLLA 5T5QA 1PWZA 1N1EA 2UUPA 2X9GA 5F1KA 1BDBA 5JC8A 2QZ9A 1I30A 4LRTB 5DBIA 3WSVA 1J0XO 1PZEA 5JBIA 3V1TC 2FPGA 3MWDB 2W2LA 4R41A 3ZWXA 4NR0A 5JMWA 4XGIA 2FWMX 1RWBA 2Y0EA 4HFNA 1MC4A 2JD2A 1O95A 4B7UA 4CUKA 3H7AA 4II2A 3TFOA 5TIIA 3TZCA 4GSLA 2C7VA 2HRBA 4UEKA 4CQMB 1H2BA 2OBNA 2NLOA 7ADHA 2BLLA 2QYSA 3LT0A 1D8AA 4Q3AA 3QWBA 5F5LA 1ZIDA 2I66A 2HKIA 1ULUA 4WOJA 1EVJA 1YBAA 3E5MA 3OQ6A 3PLRA 3ZU2A 4LISA 4TKLA 3I9LA 4CM4B 5DNAA 4WCFB 2IRWA 1XCBA 3KRTA 1CERA 3RC1A 5THKA 3H5NA 3DZGA 2DFVA 2Y1FA 4BOYA 3ADOA 2VQ3A 4BNTA 1X15A 1IY8A 1KVSA 1EDZA 4JX8A 5CDUA 2IEDA 2JHGA 2EERA 1ISJA 4JBIA 4BO1A 3CXRA 1CJCA 2GR9A 2VYNA 3LC1O 2EP5A 3VAZA 1NX6A 4DIOA 5IDXA 3ZWWA 1T2EA 3GAZA 1U8FO 5A9RA 3L6OO 2JCYA 3AOEC 6ADHA 4R3NA 4ALJA 1PU2A 4PLYA 1WXDA 3KB6A 4ZQHA 4EITA 4YPOA 4ZICA 5B4UA 4E5MA 4IMRA 4G81A 1R6DA 1Q1NA 5CPFA 3KHUA 3D64A 2NU9A 3RROA 1V3TA 2NSDA 3VPHA 2FOIA 4BVAA 1E3WB 1GZ6A 1Z6ZA 4JBGA 4LMRA 2Y1EA 5JCJA 1CQJA 3B70A 3AFNA 3GMDA 1YKFA 1L7EA 3H5AA 1LDYA 1ONOA 3L77A 1MG5A 1YRLA 3OQBA 4BKQA 5A06A 2YZ7A 1DRVA 4I5DA 2NQ8A 5FYDA 1PQWA 1P45A 1KETA 3W1VA 1VPDA 1LTHR 1HDRA 5EQDA 1C1XA 5K0ZA 3MJTA 2O7QA 3WGIA 1U2GA 1DFHA 4TQGA 4J1NA 1DXYA 3E9MA 2YV3A 4NMHA 5EESA 1NVGA 3RBZA 3WFIA 4IJUA 2R00C 1S7CA 1NP3A 2GDZA 2QYTA 2NTNA 4W6ZA 4WUVA 1KIFA 1PGOA 1SPXA 2C2XA 2D8AA 4QFCA 2GSDA 3ZWBA 1F12A 1RM0A 1NAIA 2HMVA 1VM6A 1PGNA 3FBTA 5ER9A 2I76A 1LU9A 3I23A 1O89A 2P4HX 5COQA 1P1HA 4S3MA 1SO8A 4XX0A 3KOUA 1CIVA 2HO5A 1T24A 4XIJA 3DXFA 3COSA 3S2IA 1GQYA 1UXGA 5ILOA 3AU8A 3FCOA 3DFZA 1ZCJA 4MDHA 3WFJA 3ZV5A 3AI1A 3I9OA 4KWIA 4WPGA 1TVEA 1DPGA 4FPXA 4IJWA 2AW5A 4WLEA 2ZYDA 1ADCA 3TWOA 3IL2A 4R1SA 2FSSA 2NQTA 4B4UA 3LDHA 3LLSA 3TZ6A 4YT4A 1XYGA 4ZHSA 1R4MA 3DC2A 3U3XA 1XU9A 1H6BA 5G0SA 4QX6A 3AOEA 1F17A 3DONA 4KQWA 4RF5A 2GF2A 4IXWA 3GVHA 5G4KA 2LDBA 3BA1A 1Q7GA 1MB4A 4J7CA 2WTBA 4QO8A 4GWKA 1PZGA 3DOJA 4J7UA 1FXSA 3GGPA 2GN8A 4MINA 2JFGA 2IODA 3AUSA 1EVYA 2JAHA 4FFNA 3ETEA 4WE3A 3ZW8A 4R1TA 4A5OA 2X5KO 2AHRA 1ONNA 3QP9A 1LDEA 3F5SA 3PZRA 4E30A 5JW6A 4I8XA 3UCEA 1P31A 5A3JA 5L45A 4B8WA 4PG4A 1JKIA 1H9AA 4Z9FA 2WEKA 4D7AA 3CMCO 3ASUA 3DOOA 1SB8A 2PGDA 4KWHA 3HB5X 3U9LA 5EQFA 1FMCA 3ZHZA 3P19A 4BO2A 4IMPA 2F00A 1HEUA 2VHXA 3UH1A 1KEWA 3DHEA 5KVSA 2O3TA 3IKVA 1I2ZA 4EJ6A 1I10A 4GL4A 1A7KA 5CPBA 1ZEMA 3QHAA 4I5FA 1U1IA 4MJLA 1MFPA 5T64A 2PKQP 1C1XB 4K28A 4UVEA 5T8KC 3RC7A 3WNQA 2IDZA 2G0TA 3QWIA 3CUKA 3AWDA 5AVOA 3ZHBA 2QG4A 4NDNE 1LDGA 4OL9A 1N5DA 3MTJA 4WKGA 1K6JA 2GYYA 4KDEA 1GUFA 4OGWA 4XR9A 1P1IA 5EL0A 3WWYA 2IEBA 1E1LA 2JCXA 4CM9D 4ZQEA 1WNTA 1N2SA 4F46A 5C7IO 2HU2A 1PL8A 4AFNA 3WYBA 1NQTA 2ZJ1A 5DDIP 2EIHA 2I3GA 2I6TA 4D46A 4Q3CA 1CYDA 2VHVA 3GVCA 4PCVA 2CVQA 4XYBA 1HYGA 1TEHA 2PWZA 4R9RA 3KO8A 4NJMA 1DLIA 2JJYA 1D1SA 5CEEA 2FRDA 4A03A 4FBGA 3RUEA 4E12A 3PYLA 2DPGA 4OXYA 3U09A 4KTVE 2PA3A 1ULSA 2B4QA 3GUCA 3UHAA 2PR2A 1QYWA 3W6UA 4JK3A 2DUWA 3OEYA 3M2PA 3FSRA 1ZSYA 3JQ6A 4GX0A 2PLAA 4J7XA 5T57A 1XQ1A 5KJ6A 4X54A 4U6SA 3I9NA 1ZFNA 4K1LA 4FFRA 3V8BA 3ZU5A 1WLYA 3HUDA 3AUAA 2QQ5A 3W6ZA 1TT5A 2BI8A 5DT9A 3PI7A 1E7SA 1Z45A 3NKLA 4M55A 5G4LA 3V2HA 2NVUA 1YDEA 3HDHA 3RQSA 3VH2A 1U3UA 5G4KB 1A72A 1A9ZA 4OJNA 2UYYA 4CLHA 3BMNA 2YV2A 4GKVA 3T4XA 4Z6KA 4MVJM 5CG1A 4INAA 3GZ4A 3BTSA 1T1SA 2G82A 5DN9A 5IG2A 4RZIA 3EYWA 1MC5A 1P0FA 5HA5A 4BMNA 1RM5A 4GMGA 5DCUA 5HS4A 3E8XA 4LCJA 3SEFA 4C7JA 4ALMA 3KYCA 4K6FA 1LI4A 2Y1GA 1GEGA 1XEAA 1A4UA 4O1MA 3TZHA 1SZJG 1NM5A 3I9KA 3DZHA 1IB6A 3GA0A 4N54A 3BTVA 3ZWAA 3RCBA 3CINA 3K5PA 1KERA 2UUOA 3OETA 3WX0A 1UAYA 5B12A 1G0NA 2Q1WA 1B8UA 2V6BA 5C7LO 5BSHA 1A71A 3L4BC 3RUHA 3S2GA 3MJSA 1ZZEA 1PZFA 3GVPA 3FNHA 1MV8A 3ONEA 4FFOA 2AE2A 4YT8A 4W9NC 3CSDA 3WGYA 1P1KA 3ROMA 3WQQA 2X7HA 1ZK1A 4XQ9A 4M1QA 2YV1A 3I6QA 3L0DA 1IHXA 2CSUA 4BO3A 1N7HA 2B83A 3ONDA 4CLOA 4BNLA 1DFIA 1IL0A 1JVBA 1GR0A 1PQUA 4R5MA 1ZXBA 4KTTE 4OAQA 4CR8A 5JY1A 1B8PA 3RU9A 1U7HA 4BNKA 4QXMA 1DC5A 1HE5A 4XYGA 1UP7A 1IE3A 3M1LA 3BMCA 2H6EA 1PJ3A 3WQSB 1SOVA 3GFGA 4WJZA 5FI5A 4YXFA 3QRWA 2BFMA 4E32A 4EUHA 2O50A 4FGSA 1SCUA 4R9SA 4B7XA 4PZCA 4AG3A 2EWMA 3FPCA 3UCFA 3GPIA 1O8CA 2CUKA 4PRKA 3KVOA 1DFGA 3VDRA 2BF7A 4DC0A 3RKRA 5CAEA 4F3YA 1MFZA 1VJTA 3QWFA 4FB5A 1ZH8A 4PLFA 4CR6A 5L4SA 3GGOA 2QRKA 1EFLA 1FDUA 4J4TA 1JA9A 4PG6A 4CM6A 5DCYA 4B79A 3WQRA 1DEHA 2PH5A 2VRCD 1I36A 4JGBA 4M87A 4JN6B 4UVGA 1EMDA 2Q1SA 2Z1NA 5KVVA 3D4OA 2NVUB 4A0SA 1IZ9A 5TS3A 3C1TA 4FQ8A 3UCXA 4YJHA 2VYVA 4D41A 3AW9A 1SMKA 2VNSA 5ITWA 2O4CA 4WLOA 3G1TA 3GVXA 3NGLA 4LK3A 4IBOA 5BQFA 3SVTA 3E6AA 2H9IA 3FRJA 3LF1A 4RGBA 1YJQA 5H82A 4J43A 4L73A 3LSYA 5EINA 4CL3A 1EFKA 3KYCB 3GRPA 5JSFA 2D4AA 3FR7A 4WK6A 3GH3A 5DOVA 4XB1A 4ZD6A 1WAMA 2D2IA 4BNXA 4W9NA 4BS9A 3PP8A 1JKJA 3BMOA 3KYDB 3HADA 5L95A 1X7HA 1ZKMA 2FPPA 3HWRA 3DEYX 4BGEA 2VWQA 1NFRA 3HDYA 2P5YA 2WM3A 4YA6A 1SAYA 2RH4A 3ZWCA 5IDYA 3AI3A 5L9AA 3OSUA 4G5HA 4Y6RA 1CDOA 2WE7A 4H3VA 4DXHA 3FWZA 5AYVA 3ITDA 3NJ8A 1E7RA 2FMUA 1T4BA 1DHRA 1YBVA 3U4DA 2A94A 1GUZA 1DOHA 3TFQA 2NTJA 2HQ1A 1SB9A 3H9GA 2X0IA 1ZK2A 1JTVA 4CLOB 5BSEA 1HDGO 1N92A 1UZMA 5I7FA 4RL6A 1HXHA 3TRIA 1SBYA 3IOYA 2IYOA 1ZEJA 4B4WA 5JC1A 4IDEA 5CFZA 1NWCA 1QRRA 2RHRA 1IZ0A 1U3WA 1VC2A 3BMCB 3WYCA 1BW9A 4ZQBA 4FDAA 2X0RA 5COAA 1E7QA 1M6WA 4IDBA 4YDRA 3QVWA 4CR7A 4AJ4A 5JDIC 3SJ7A 3RAJA 4E5YA 3OECA 5TF4A 1AN9A 1KC1A 4K9DA 4BNMA 4DBZA 1UXIA 1LDMA 3E1KA 1VSVA 5JY6A 1NTOA 3R6DA 4P4GA 3SBOA 3OHSX 4R1NA 4MVJE 3UW3A 3RI3A 1KVUA 4J9UE 3OJ0A 2PY6A 1SOWA 3GNSA 4CMKA 4QUKA 3ST7A 3KZVA 3JQBC 3VPGA 1B16A 4IUYA 4BQPA 5KWEA 2CNBA 2J3JA 3OA2A 3TZQA 3RIHA 4CV0A 4RO0A 2NVWA 2ZTUA 3JQGA 3CH6A 1R4NB 3K96A 5CHEA 1H6CA 3S55A 1X7GA 2O3QA 5ILGA 3HN7A 2P91A 4XKJA 2NUAA 2RHCA 3PGXA 4FOOA 4TZTA 2AEMA 3MJCA 3NAQA 2J5KA 3V2GA 3B6ZA 4OMUA 2ZQYA 4RDIA 3ZU3A 3ZNNA 2WWRA 4NBVA 1ZNQO 4MKRA 5L3ZA 2C5AA 2ZATA 1UXJA 3WGZA 3AM3A 1CETA 3PWKA 4Z0HO 4EBFA 3JYNA 4RF4A 2ET6A 3RUDA 1GQ2A 2WYUA 5J23A 2Y1CA 4OIMA 3I9JA 3VPXA 1QYDA 3R1IA 3PK0A 5BT9A 5JPIA 2B0JA 4FOSA 2H5LA 3U5TA 3ONFA 4O63O 4FSHA 1E77A 2OL4A 5CDYA 3NEPX 1M6HA 3ZNOA 3VVBA 3BMOB 4DREA 3PJEA 1XLTA 4GVXA 4J91A 4Z0TA 1TA4A 2X22A 2O3JA 2OOSA 4PLZA 3DDNA 2W8ZA 4BQRA 4DPMA 4XYMA 2DPHA 3DZKA 4BKUA 3TOXA 4R3WA 1RM3A 1P3DA 4TRJA 4IJKA 4L74A 3ROPA 2NNLD 5JO9A 1G6KA 1QYXA 2AEJA 3C85A 4TMFA 2JHFA 4EEXA 4BMSA 1YOVA 1Q0HA 4J6FA 3V1YA 1V8BA 2JD0A 4EEZA 1HLDA 1NHWA 1NVMB 4IZHA 3ICPA 3VC7A 2B35A 5DZSA 3D5QA 5TT1A 3LC7O 5JDIA 5DOZA 3FTNA 3LC2O 3P5SA 4CMCA 1HRDA 3FBGA 3HE3A 2C0CA 4RLSA 4XEHA 4FJ1A 5CP8A 1ZO8A 5MDHA 5TRTA 3GG9A 2ZTLA 1QLJA 2Y0CA 4XZ3A 3GUYA 2J3IA 3JQBA 1BW9B 5JS6A 3KSZO 3NT2A 8LDHA 4PRLA 3H4VA 3TF5A 3JD3A 4ZVVA 2D59A 3VH3A 1KBZA 1EUZA 2I99A 4MP8A 4DBVO 4WLNA 2Y1OA 5TX7A 4M54A 4Y8VA 4KQXA 2CDBA 4AJOA 1DC4A 4KMSA 2X23A 1KVQA 1GPJA 2OMEA 3GNTA 4R5HA 2ZIZA 2Q3EA 2NU8A 4DVJA 5KJCA 1ZMTA 1NNUA 3LU1A 2AE1A 2X4GA 5IN5A 1P1FA 4GX2A 1WW8A 4JQCA 3L6EA 4MKXA 1KOLA 4OQZA 4IIVA 2CF6A 1E3LA 2G76A 1A27A 1MXHA 1R12A 2JL1A 1K6XA 1RYDA 2X6TA 4NI5A 3NDIA 1HDYA 4FFLA 2Y68A 3WIEA 3A28A 4JJIA 2GLXA 1K6IA 3FD8A 3JQGB 4Q9NA 5JMPA 4OM8A 3EZYA 3CMMA 1H6DA 1VL8A 3FF4A 1N9GB 2F1KA 4OQYA 3WICA 1H9BA 1EEHA 5JLAA 5BNIA 3FN4A 1DSSG 2FP4A 4HP8A 1E6WA 1BDMA 2C59A 3DBVO 3DBHB 3WWZA 1PR9A 4MVJP 5TJ9A 2ZCVA 4YAGA 4YAKA 2AQKA 1YH3A 4ZJUA 4IDFA 4CODB 1E6EA 1ORRA 3WXBA 3I9MA 1QKIA 1HKUA 3D4PA 1LSUA 4OKIA 3SXPA 3AM4A 4ND5A 1QLHA 3IKTA 1BSVA 2FZWA 3HSKA 4JCOA 2P68A 3QY9A 3M2TA 1JWBB 1ADGA 1YB5A 4MVJD 3QW2A 1I33A 4YRDA 3H3JA 3MJ4A 3RC9A 4RPLA 2VYND 5JDCC 4E5NA 3JQ9C 1DLJA 5A3VA 1PIWA 4NU6A 3W4IA 5I7EA 1Z73A 1JQBA 3VTZA 2HMUA 2Y1DA 5TT0A 4YJFA 1GFSA 3Q2IA 1LX6A 2VWHA 4I5EA 4YVFA 3BYZA 3MEQA 1LLUA 4B3HA 1GZ4A 4I1IA 2OXIA 1OFGA 3VZRA 3UICA 5TJHA 4EGFA 4K26A 3K92A 1Y8RB 4LSMA 1GV0A 4W82A 2HAEA 1NFFA 5LDHA 1BVRA 1TB4A 2XF8A 3TZKA 1Z7EA 3RUFA 5AQ1A 3HG7A 1DB3A 3HFSA 2WYVA 3WBBA 2J6IA 1MUUA 1PS0A 1NQ5A 2DM6A 4CM7A 1EQ2A 3DZFA 2YDYA 3JQ8A 2DU8A 1GTMA 1VSUA 4NBRA 1MX3A 5A03A 5ENVA 3JQCA 3TDKA 4ALIA 3K6JA 1XU7A 1JLLA 2IZ0A 1NR1A 2FN7A 3ETGA 3ANLA 3DO5A 4ITUA 4DMLA 1WDLA 1ENPA 1HDOA 4IM7A 4J4HA 4J16A 4Z3DA 4CMIB 4OHUA 3B20A 3X2FA 4WEQA 3KTDA 5COBA 4L4SA 3GNQA 1J5PA 1E5LA 3ICCA 2A9FA 1H5QA 5ADHA 5KVCA 3WTBA 1OBFO 4W7HA 3W4JA 5L7WA 2YY7A 3LVFO 4CLRA 1F06A 4LVUA 1NAHA 1GD1O 4WOKA 1OC4A 3CTMA 1EE2A 3I83A 3OIGA 5KOIA 5F21A 3PJFA 1CQIA 1NASA 3FPLA 4GMFA 4HNHA 3R3SA 1A4IA 3U4CA 4RVSA 5JDCA 3HFGA 4R16A 2AQIA 3JQ9A 1U4SA 1VRWA 1PGPA 1SC6A 1U7TA 2AEFA 3OP4A 1BRMA 4P8RA 2EP7A 3IAHA 3Q6IA 1T2CA 3DMYA 2P9CA 3O26A 3GGGA 3JQDA 4FC6A 4J3FA 4AJNA 5IFLA 2GN6A 1E5QA 2OFPA 2RBEA 4FFMA 1WVGA 1LSJA 3NYWA 2FY8A 5JFOA 5CG2A 4ZA2A 3RFVA 2O48X 3JD4A 4NPCA 3PEFA 4NJOA 4MVJH 2V6FA 2GGSA 4CPDA 4JP2A 5AOVA 4L75A 2NADA 1T2FA 3CKYA 4Y6SA 3OFSA 1LLQA 1ID1A 2DT5A 2VNAA 5TC4A 4D3FA 4EJ0A 5F1OA 4H16A 4IIUA 3OQ1A 4ID9A 4YJGA 1DAPA 4BUCA 3Q11A 2A35A 5GZ3A 2GN4A 3DZIA 3C1OA 2YFQA 3H3FA 4MO2A 1JW9B 1P9LA 4EJMA 4YJDA 5JCXA 2NV6A 2E6UX 1EUDA 4Y98A 2GERA 5HTOA 3INTA 4PZEA 4IINA 1XIVA 1Z7BA 1HL3A 3SX2A 3ZDFA 1GAEO 2PZMA 2XPCA 2R00A 4JBHA 3ZN2A 3GC6A 3IJPA 4M86A 5EPOA 1NXQA 2GPTA 2J3HA 1KEUA 1NYTA 1Z74A 1DIBA 3L6DA 4ZQFA 3UAGA 5H83A 1KYQA 1DDOA 2HK9A 1WDMA 4IDGA 5DCWA 1YL7A 3WB9A 1GV1A 4DPLA 3C8MA 1PEDA 3D5TA 4O0LA 5DULA 5HBRA 4A27A 3AY6A 3C24A 4OOEA 1T2DA 3ABIA 5F3RA 4ND3A 4DPKA 1T4DA 3H2SA 4BNUA 1PX0A 1WPQA 2WYWA 5EMHA 3B1FA 4YQYA 4L9RA 2QIOA 3GVIA 1DRWA 1I3NA 1J6UA 2AQHA 2V7PA 3HQ4O 4EUEA 1HE3A 1NPTO 1NHGA 1O5IA 3AU9A 3ZV3A 3A1NA 3WS7A 1PGJA 5TSDA 4Q3BA 5HWSA 3AFMA 3DZBA 3MOGA 4UUMA 4HXYA 3O8QA 2CF5A 4XJSA 2XXBA 2I67A 6LDHA 1J4AA 3GF4A 5K9ZA 1KEVA 3G49A 3STHA 1ISMA 1LSSA 2POQX 5KKCA 1X1TA 4PG5A 1EUCA 4XIYA 2EW2A 4KDFA 5JAQA 4Q3DA 3VHRA 1NVTA 3W4KA 1YS4A 3PRJA 1V0JA 1VJ0A 4CM9A 3QJ5A 1P1RA 4TRRA 1N8KA 1JVSA 3EMKA 4J4BA 3U62A 4DUPA 1R4MB 5FI3A 2IE0A 4ALKA 4D0SA 2R6JA 3A14A 3ZWOA 1YBMA 2QZZA 2A92A 1OMOA 2Q2WA 3RJ5A 1P74A 1I32A 4YACA 4AICA 4GPD1 3VTFA 4ONEA 2G5CA 4RJTA 4PLTA 3FR8A 4GLLA 3WGOA 3LT4A 4E6PA 1HSZA 1U8XX 2DBRA 2B37A 1G0OA 1NPYA 1E7WA 5GZ6A 4BGUA 2BGMA 3OJFA 4YJGB 4IJVA 4N5MA 1ZVMA 1LEHA 2DC1A 2TMGA 3OMLA 3VVCA 4MKZA 1VKOA 3KLPX 4GGOA 3QLJA 5A05A 4R01A 1P0CA 4MVJI 4TSKA 5FWNA 4HV4A 4UAGA 3G1UA 4BNWA 2UDPA 4DTIA 1XQ6A 1DHTA 1PR3A 3QIVA 5T8KA 3I6IA 2NWQA 1NR7A 2C82A 2GUGA 1DC3A 1GADO 3JSAA 3WSWA 4R54A 4S1VA 3GDFA 4D3DA 4Q3EA 2HSDA 3OICA 2BMAA 4GBJA 1AHHA 5G0WA 1GZ3A 3ZHYA 5JO0A 4CL8A 2EKPA 4ZRMA 1C3VA 3JD2A 3UXYA 1CEQA 1A9YA 1IOLA 4GKBA 4RCVA 4BKOA 4YRBA 3V1UA 5IZCC 4IDAA 2GZ3A 3ADPA 4GAEA 1F0YA 3MTGA 4XR4A 4IDCA 3S1LA 3LK7A 2EJWA 3G0OA 3HDQA 3ZNQA 3ZWNA 4BV9A 1E3EA 1LBEA 2DTDA 2HLPA 4DC1A 5TNXA 4BNGA 1L7DA 5C3MA 3QVTA 2ZTMA 3DFUA 2X9VA 2EXXA 3JQ7A 4HUJA 4TRNA 2Z95A 4UULA 2DBZA 4P4LA 4B4VA 2DAPA 5A04A 2D5CA 2QRJA 3H9JA 4D0RA 1YB4A 3KSDO 4YR9A 3LZ6A 3K2BA 4TROA 1R0SA 3PJDA 1YL6A 5KCZA 1RPNA 5CDTA 4I5GA 2X8LA 3L9WA 3W8FA 5CEJA 4NJMB 4JXKA 2UAGA 2AG8A 4XQEA 3ZCXA 3O8QB 4RQUA 3I3OA 1BWSA 2XOXA 2ZYGA 4CV2A 4EYEA 3EZLA 3PHLA 1Y9EA 2YFHA 3GRKA 4M49A 1XHLA 4NK5A 1GPDG 2X9NA 3F4LA 2E49A 5IAAA 3PGJA 1QP8A 4DLBA 2Q50A 4E4YA 4NU5A 3ZV6A 1AGNA 4UEJA 5L40A 4N18A 3BXXA 5BR7A 1U5AA 1ZXLA 3T7CA 4DA9A 4D44A 4LVCA 2VT2A 3IJRA 1XGKA 2ILTA 1OI7A 3QWAA 3GK3A 2OGUA 4A2CA 2DTXA 1TT5B 5U9CA 3RC2A 3JQAD 2WJPA 1ZK0A 3FNFA 2J8ZA 5ICSA 1HT0A 1D1TA 1NQOA 3BMQA 4E5PA 2I3AA 3E9QA 2VZ8A 4J0FA 2Q99A 2EHDA 3BMNB 2I5PO 3C7DB 1IYZA 2P9EA 3WIDA 1PL6A 1YQDA 4NQZA 4BNJA 2OORA 4XJTA 5T6BA 4PN3A 4DIFA 2HK7A 3HDJA 1B3RA 1HLPA 3ENKA 3WGTA 4PVDA 3RBXA 3IS3A 3O03A 2PKRA 4D45A 1BXGA 3SLKA 4QFDA 2O23A 4WEOA 2JD1A 5DBGA 4RORA 3L4BA 4Z0PA 3GQVA 3PHIA 3GAFA 4BNVA 4ESOA 3GEGA 3H5RA 4O5OA 4PG8A 1FK8A 3OIDA 3D3WA 1E7YA 3ROKA 4Y9DA 4E2XA 3BTUA 2VRCA 3N58A 3IP3A 3H9QA 5IZCA 4NZ9A 2ZB8A 1LJ8A 5A02A 5IDWA 1RYEA 4JP3A 3NDRA 5ENDA 2AMFA 5KNLA 3NTQA 4RVUA 4YTEA 3UFXA 4BO6A 3Q1LA 1LA2A 4DRYA 4UVHA 1PTJA 1VL0A 2HMWA 4R1UA 4N5NA 2HCTA 3K30A 5I8WA 2DUUA 3DQPA 2DLDA 4ZN6A 1RJWA 1K89A 5U1PA 4DQXA 3M6IA 3GY0A 2Q49A 4W99A 4XDZA 4CM3A 2PNFA 1EZ4A 1ADBA 1V3VA 2IXAA 3GZNA 4HFRA 4E0BA 4XYLA 1C0PA 3VZSA 1V35A 3CPSA 4LMPA 1ZW1A 2VHWA 2P5UA 4HFJA 4O6VA 5H81A 4OSPA 2UV8A 3VDQA 1W8DA 4D42A 1E1NA 1AHIA 2J5QA 1B3BA 1WDKA 2OP0A 4ZQGA 2FHSA 2PGLA 3MOIA 5JYEA 3CZRA 2ZKLA 1DJNA 1X0VA 3UGKA 4GGPA 4QO7A 1NWHA 2DVMA 4BO8A 4PG7A 1ISHA 1LDBA 2CY0A 4J1SA 1Y5RA 3RFXA 1C14A 3Q0EA 2O3SA 3GHHA 3GPDG 5GMOA 3SJUA 2NTVA 4CMHA 3KXDA 2GRAA 1O6ZA 1X14A 4PIVA 4NIMA 3GG2A 3IMFA 1ZJYA 4Z9YA 1I5RA 4GVLA 4BGIA 1K2WA 4K6CA 3JTMA 1D4FA 2X1HA 1B15A 3JV7A 1ONPA 1N7GA 3OBBA 1YO6A 1ZSNA 4NK4A 4P4NA 1B8VA 1OOEA 4FGWA 4L4RA 1WMAA 1R0KA 4IS3A 3G79A 5JAZA 4OO3A 1LNQA 3GN2A 3BMQB 5A5FA 1UAGA 4RPKA 3VZQA 1IPFA 3ZU4A 4BNNA 3OJLA 4YJHB 4CQMD 1OC2A 3F46A 1AUPA 4FIZA 4GWGA 1YGYA 4CUZA 1BMDA 1W0CA 1CRWG 2GZ1A 3D1LA 1Q7BA 3NX4A 4AJHA 4EI2A 4F6LA 1GU7A 3INGA 3LT2A 5L53A 2VT3A 3GLQA 1BGVA 5LCXA 5L4LA 1HE2A 2BFPA 4EDFA 4R68A 1UDBA 4TWRA 4CLXA 3ENNA 3CIFA 3E48A 3IDSA 4RF2A 5EERA 5ER6A 4RF3A 1DC6A 1XG5A 4FN4A 2IYPA 3TSCA 2GASA 4XYEA 3ZW9A 5KJFA 4URFA 1B2LA 3NV9A 3QVOA 5F1PA 4R51A 5IF3A 4A26A 4NHEA 1U9JA 2AA3A 2Y99A 3LLVA 3QQPA 4JROA 3NTRA 1JAYA 1T1RA 2BD0A 4XQCA 1LSOA 1FDSA 2P2SA 3K9QO 4BB5A 3KUXA 1DRUA 1EBFA 2DFDA 3RFTA 3PYMA 2X86A 2GN9A 4XGKA 1IHYA 2HJRA 1BXKA 1ZJZA 2YQ5A 3DOCA 2HMSA 1WZEA 5G0TA 4MIEA 2PZLA 2D0IA 3L07A 3RBVA 3DBLA 4ALNA 4J9VA 4BNYA 2EGGA 2VOJA 3DAFA 2E37A 2VWPA 5HRUA 2VWGA 4JIGA 4CM8A 4FFPA 4DL9A 3TQHA 1OZAA 2B5WA 2B36A 1E7MA 1LRLA 2PK3A 3MZ0A 5A9TA 4E21A 3VOSA 2O2SA 1PJ4A 3JCZA 4H15A 4WGGA 4QQRA 4ND1A 1XDWA 4E3ZA 2HUNA 2Q4BA 3E18A 3TNLA 2A4KA 3WMXA 4BO4A 1PGQA 4RVFA 4YT5A 4NBUA 2VCYA 3DBRA 1ZBQA 3HHPA 3WYEA 3WDSA 2EF1A 1DAOA 1LC0A 5A4DA 1QYVA 4I9HA 1KY4A 5TLSA 3ZHXA 1UP4A 3JYLA 1Y5MA 1GUYA 4ZU3A 2IZZA 3JD1A 1MXFA 4LCEA 1P1JA 2X58A 4IDDA 3H9UA 1LXCA 2W2LD 2XAAA 3OJOA 4HX5A 1ZSVA 5K6AC 1Q0QA 1EVIA 1ISFA 3KEOA 1I8TA 3PHHA 4RVGA 5EN4A 1ENYA 4PGFA 3DTTA 4NFSA 4NBWA 1V9LA 4GI2A 1EQUA 1LRKA 3MJEA 1E6UA 3BZUA 4OYRA 3B1JA 1Q2XA 1QYCA 1ADFA 2PZKA 1PJLA 1YQXA 3SC4A 2Z5LA 2WSBA 1Y8QA 2CVZA 2YQ4A 3PDJA 3S8MA 2Q1UA 2Q4EA 4L8VA 5G0UA 4PLCA 1NBOA 3ULKA 7MDHA 3Q3CA 3GOHA 3GMSA 1K5HA 2E48A 5LDGA 4CJXA 3NGXA 1FDVA 1E0DA 4RVDA 3RU7A 2VUSA 3PXXA 5I7SA 4Z3KA 5DP1A 1UDAA 4E31A 3MJVA 3H6KA 3BHMA 4JJFA 1X13A 5IJZA 3Q9UA 4H7PA 4EUFA 1HZZA 2PKQO 1SNYA 3O4RA 2P9GA 4MP3A 4RVHA 2C7GA 4GX5A 4YBZA 1T26A 1QORA 3TOZA 1YOVB 3PQDA 2WMDA 3A9WA 3C7AA 3Q9NA 4U5QA 1DIAA 1I01A 1ZK4A 2VUUA 2Y0DA 3QA9A 3ZWMA 5A5EA 1TI7A 3DBLB 4XDYA 4J0EA 3WOHA 3D7LA 3QE3A 1XELA 5JCJD 4MVJA 3VPSA 1B7GO 2Q1TA 3K31A 4BHTA 3WNVA 4MP6A 3AUTA 3L4SO 4CM8B 3HJAA 3WGGA 1PQPA 3GFBA 5AXDA 2O7SA 4CM1A 4TVOA 1H94A 4J49A 4FC7A 5FEUA 3FWNA 1O9BA 3KM0A 3DHYA 2ZK7A 5JXWA 1H93A 5KIAA 1BG6A 4PLPA 5BSFA 1LQTA 3MCVA 1PJCA 1PS8A 4WLUA 4IGFA 4FS3A 5K6AA 1QV6A 3ZI0A 1LUAA 4J1TA 4TKMA 1HETA 1TXGA 3DBRB 3RKUA 1VKNA 3OF2A 3DB2A 1R15A 1UXHA 4TVBA 3RSHA 1A5ZA 4U7WA 3EK2A 3PWZA 3HNPA 3O9ZA 2ZTVA 3U0BA 4E2YA 3ZV4A 1K3TA 1I24A 1BVUA 3EDMA 3WLEA 5B1YA 4FJ0A 4IQ8A 4O59O 2CD9A 2H63A 2G1UA 2YYYA 5L4NA 4BNIA 2VUTA 3VKVA 3QV1A 2E4AA 3EVNA 4HY3A 2CZCA 4J1QA 3EHEA 2OBYA 5L7TA 3S2FA 3OA0A 2GCGA 1ZK3A 3RD5A 3I4FA 1GCUA 1U3TA 3H65A 3ROQA 3TL2A 4U0KA 3P7MA 2HDHA 5B4TA 4YYZA 4ILKA 3AJRA 2X0NA 1Y8QB 3ZWVA 4CMEC 1RKXA 3DL2A 4HFMA 3ON5A 2HK8A 1PJ2A 3UOGA 1MLDA 3DZJA 3ORFA 4JLWA 3UF0A 2X5OA 2PV7A 3QWHA 3PIDA 4C7KA 4PLGA 3INRA 1X7DA 2CFCA 1S6YA 1EK6A 2HMTA 4GSKA 4AJLA 2C2YA 4BMVA 1Q7CA 5G2OA 2R2GA 9LDTA 4JJGA 4GH5A 4RDHA 1I0ZA
chains in the Genus database with same CATH superfamily
2VN8A 3RAEC 3BHJA 3LCRA 2W2OA 1XWIA 1LLDA 1PJBA 4ZV4A 2FMFA 3IR6A 4YJFB 2QV0A 1SEVA 3RIGA 4UTXA 1SVNA 5JAHA 2J0SA 1E4OA 3CF6R 5B37A 4U2EA 3ZE9A 5IBRA 3T52A 5HP4A 1YB1A 4PLHA 4ZO8A 2XITA 1JLSA 3T4EA 4L3WA 4E4RA 3OX1A 4X85A 1RSZA 1K0UA 1O6CA 3AY7A 1X7WB 4K9OA 4WASA 1SHZA 3DE6X 3PPXA 2VP0A 4G5YA 5E3IA 3VKUA 4CWAA 4FINA 4CF7A 4KI0A 1VI6A 2ZRCA 1NRJB 5CIWA 3IE1A 3U3RA 1L7RA 2ONCA 3UG6A 4PIPA 3VNVA 4DMMA 4ARBA 4KLCA 2HF2A 2V5UA 3FCUB 3B1VA 4GI1A 3S44A 5C8VA 4GDFA 1P7PA 2C58A 2DBVO 2V4ZA 4WX2B 5EIOA 3RM3A 1KU0A 4FU0A 4PZDA 1SG6A 1J24A 5IZ4A 4OKNA 2QGZA 3CRRA 4B80A 3PIIA 2HEIA 4BTLA 3ANNA 3AM5A 1PV4A 1GTL1 2MYUA 3HCBA 4LBZA 1JNXX 1RYBA 3HABA 3HCFA 3R3XA 1NMYA 2H4XA 4FOLA 5AI0A 1T1JA 2QU7A 2DR3A 1CFZA 3FPHA 4DWVA 4F06A 1ARZA 2VPIA 1FUYB 2WHYA 5HQTA 4GBMA 4D99A 3AF2A 1QHGA 1YNOA 4EF5A 3PBKA 1OAOC 2OBLA 2V03A 3L01A 1O57A 4NZNA 1DBIA 1P4AA 4B8ZA 4XRGA 4HH0A 1UK6A 1G8MA 4AULA 2JLYA 2PKYX 4EL5A 4GQAA 1DEAA 4O5AA 3EUFA 2BDUA 3OH8A 2P2GA 2PAFA 5LQNA 4UVIA 1MA0A 2HSEA 4KUGA 3BGIA 1I5OA 2FUCA 4N0MA 5TQVA 1XPJA 1G9SA 1HT3A 2JS7A 2Z9CA 4KUEA 4V3BA 4WXRA 4B2IA 4CLRB 2QTVA 2ZJOA 3NTUA 4GRAA 4R4JA 3WNBA 1GQQA 2PZAA 4Y0NA 1ESDA 4XAQA 2JANA 3EXFA 2AJDA 3VSAA 5I4CA 2VP5A 2VT6A 5CB6A 5EMNA 1FRQA 4HDNB 2BGLA 2F8MA 1I1OA 1IEWA 5D6NA 2Q0QA 1Y34E 3NUGA 2Z58A 2TECE 2A30A 1CQIB 3IRVA 3E9YA 1Y7PA 1YL5A 2ZUSA 4ZOLA 5EHGA 1BVHA 2XB9A 3KD3A 1XEWY 4DLLA 1SQ0A 1WQ1R 3FTCA 2C54A 2O59A 2FKNA 4RK6A 4O8CA 3K73O 4HTAA 4F56A 3OLXA 4QE3A 4ZC8A 1PS9A 1O4WA 1U2SA 2I65A 2Z3WA 3WJ7A 1YVPA 4EA8A 3PXGA 1QWSA 2BKEA 2QZJA 4FKZA 4S1WA 1ISIA 3LQFA 2AC4A 3IC5A 2D3TA 4EAAA 4RLHA 2W83A 5L51A 2Q27A 3CX3A 4PCLA 3X3HA 1F8UA 1IPEA 4HDOB 3BWXA 4FYXA 4PTYA 3SPXA 1ZGCA 4X91A 3RT9A 2ZRFA 2JC3A 2VK1A 4I7EA 4D02A 3HLYA 1TZKA 4ENVA 3K5IA 1DE0A 2QQEA 3F1LA 4JI6B 3U0VA 4BMPB 2CHVA 1AS2A 3WJAA 3S7TA 3MLAA 4KNYA 3MELA 2O14A 1FFDA 4K86A 5KYVA 5F2KA 3TJRA 1TADA 4X1KB 1ZICA 1O87A 4TT3A 1GU1A 4LYYA 4X62B 3ZH9B 3QPVA 2GFIA 3QVMA 3QX8A 2N42A 1H2WA 4CEJA 1G1AA 2CMDA 4WNYA 5I9MA 4E33A 2NU6A 5KYTA 1OU0A 4NSNA 1H5NA 4HWRA 1EM8B 4R0VA 3RF6A 2GXQA 4WERA 3PZBA 3EVBA 5HGXA 3ELDA 3HXQA 4M9RA 1RWPA 4MRMA 2HN9A 4O4HA 1J99A 5IXSA 2R44A 5EYPA 1TTPB 4I1RA 1ZGJA 2DTEA 3ROEA 3SC6A 2OO5C 2Q3DA 2ZBVA 1GL6A 2VHQA 1LW6E 3N6RA 4QGSA 3KQOA 4W5QA 2WRZA 2BMJA 3IUSA 2CBXA 1W48A 2IV2X 1N9KA 5A9SB 4P1ZA 2R87A 2IP1A 1FLAA 1GCGA 2VDRB 1XZPA 3AW8A 4JL5A 4NATA 4Q7MB 3MB5A 2ECOA 2QVGA 4ZAZA 1OAOA 4IIGA 4DEXA 3W8EA 2WQZA 4ND7A 1IN7A 4DANA 1D1QA 2BT4A 3N7TA 1ZJ6A 3NHKA 1K4MA 5AW5A 3SX0A 5CDSA 3EQZA 2R2AA 3DF9A 3FDZA 2WIBA 3CZQA 4XPIB 3ZWPA 2NVBA 2GZAA 1OJ7A 5K45A 1UDCA 3I1IA 4FUTA 5HIIA 1WP4A 3G68A 5LD2B 3FWKA 4HNGA 2C7QA 3KEQA 4N0EA 1J8MF 3G3EA 4G9EA 1XJ5A 4B9AA 3QVXA 2I22A 3KYDA 5B2ZA 2M1ZA 1CWUA 2YJZA 3KKQA 1IZYA 4B4OA 4FZJA 2R1ZA 4JNKA 1N2GA 3N28A 3MQFA 4ZZ3A 2PT5A 3TPFA 3TLEA 3IGFA 1E1RD 1A5AB 2BKLA 1Y5LA 3RVDA 3VPFA 3EGXB 3R9WA 4G65A 1ABEA 4IMIB 4HADA 1L4KA 5EE3A 1GRQA 3K09C 2NX2A 5DGTA 3EGOA 2NACA 1C2YA 4B3CA 1XWFA 2GNAA 3VM6A 2V59A 4KMMA 1G98A 1E3SA 3H83A 3L4JA 4UFPA 4EHDA 1XMSA 3E5RA 3AUUA 3HJHA 2ZFUA 5FNVF 1VIVA 4BE4A 1NFQA 4WA7A 1SKYB 4BO9A 5DYGA 3AK4A 4P3XA 3JZFA 5I45A 3KUUA 1U2DC 1RXWA 4NBTA 1G5FA 1X9GA 2CMHA 2XUIA 5I9NA 3K6SB 4X95A 1R16A 4II3A 4EY5A 5BWBA 4ZARA 3Q8LA 1P39A 3QFHA 4DA7A 1Z28A 5TVGA 5BORA 1IUPA 1FQJA 1T0IA 2FN9A 2IZ1A 3L8MA 4NOKA 1IH8A 3QPBA 2C5EA 3VU1A 2PH1A 3AV3A 2O2JA 2C2WA 4HGQA 4N7JA 4OJKA 3K53A 1TDJA 1NL3A 4BLPA 5EJ2A 2VHJA 4ZT6A 3ESYA 3JYQA 4H08A 4NAHA 3AP2A 1G3UA 5CT4A 2OCBA 4M9XA 2BH9A 3F71A 3PQEA 4MUFA 2YHIA 4RA6B 3NIBA 1QV7A 1X1CA 2JFHA 2XYRA 2YRWA 3AIMA 3FHLA 4OGKA 5EXEA 3WR5A 4M8SA 3QXJA 3M3PA 1DX4A 3OM9A 1EFUA 4LKRA 2OO5A 4UQPA 1Z2DA 2RI1A 3ORHA 3UMBA 1OR8A 1XSEA 1MOZA 3CW8X 3WLQA 2WE8A 4Y67A 4NFYA 5F5NA 2IBTA 5DHUA 4F4HA 1Q74A 4OBEA 5LM3A 2DHCA 4RZHA 1WCWA 4ASUD 4N41A 2J3KA 2VLIA 5TMDA 1KDRA 1R4NA 2KMLA 2W48A 1L6RA 1LW7A 1M8PA 4XH9B 3RGWS 1LQUA 2CJXA 4HKTA 5FPKA 4D92A 3MVEA 4P58A 3TLXA 1U1CA 5I8ZA 3CVXA 3TSWA 2WV9A 4TRMA 3B3FA 4GBGA 3FOEC 2V7WA 4Z49A 5IKOA 2QF7A 3JQAA 2QMZA 1Q5PA 2FKAA 3V7UA 3U4HA 4IF6A 2QIPA 3RVKA 3ABZA 3ER6A 3B9RA 2W2KB 1DXOA 3MMZA 4IGEA 4NCIA 4EF6A 4TX1A 1PL7A 1WHTB 4PM4A 1BH6A 2C2ZA 1RAFA 4IH9A 4PS0A 3V42A 4JVNA 2J0QA 3QSGA 4WK0B 3OQVA 2HJSA 3RV4A 2XUFA 4W5HA 1RXVA 3M4JA 2RE8A 4R7GA 2JGEA 5KYXA 1XKQA 3JR7A 3H8JA 3NBZC 4QYTA 3K09A 3V46A 4X65B 4ROSA 4UUPA 1G42A 4NCXA 4M8LA 4MW4A 5KWIA 1IUKA 2XRMA 3R9XB 1IQPA 1GPUA 1NF9A 3E2PA 3HO8A 4YP1A 4C2AA 5KMGB 4OQPA 3RUCA 3RW9A 3B1YA 3FVTA 3VTAA 4XWKA 4Z4GA 4CG1A 2EFJA 1W25A 4I4TA 3R09A 4RC9A 1TCBA 2XDWA 3U1VA 1C0LA 4A8TA 1N6OA 4DYDA 4D0LB 3MHTA 4ER3A 1I0IA 1U2DA 4EO9A 3GDGA 3WG9A 4CZ2A 4DA6A 1QQAA 1RRGA 4KR0A 1SULA 2J6HA 3ZZUA 3L1VA 4BV2A 3QTTA 1E2BA 3DGFC 1XDSA 3TVYA 1CUGA 4AZVA 1R66A 3VJLA 4FR5A 4V03A 5BV8A 1HG1A 5DE3A 1PL0A 3K5HA 4H0CA 4JOBA 4ZGWA 1WB9A 4BNFA 2Q5LA 3AP3A 3AEUB 3L8GA 4R81A 4MV3A 3PQ7A 4Z99A 5HJ2A 3EIFA 3EPLA 3RWBA 2CFRA 1HF3A 1TQ4A 4URYR 3U17A 2Q46A 4COKA 4EGCB 1O97C 1O77A 4PE5B 3BWMA 4GC9A 1Z56C 4YO8A 3I4LA 4N6GA 2ETVA 2FJPA 3B1WA 3DUFA 3BZBA 1M75A 3DZCA 3G0IA 4HNAB 2OB1A 3MF4A 2FG7C 4H7JA 5H16A 3R0IA 2IWHA 4AKGA 3NHUA 1PSDA 1KVRA 4JLSA 4YUXA 1EKXA 4JJ4A 4PO3X 1A88A 2NU7A 4BWVA 2W98A 3E3OA 5JXGA 1KHTA 3SZGA 3NJ4A 1PJTA 1L7BA 1QRDA 4FZ5A 5CA1F 1ISPA 16PKA 5JD6A 4XVHA 1GPAA 4JI8B 1VLJA 3F5QA 4F0JA 1I4TD 4DM4A 2WHPB 4CNBA 2XCRB 2ZWAA 2WYOA 3KT8A 1Y6FA 3OZAA 5J4YA 3U7RA 4L76A 1C0KA 2CUZA 4L4XA 1ECJA 2CEKA 4I9NA 2IYAA 4NYJQ 2Q5EA 5M29A 1RQPA 3ORRA 3FGZA 3K4QA 2RK6A 4GLOA 1OAAA 1Z15A 2RH8A 4YMVA 1M2WA 2QI9F 2C5HA 4I99A 4MR9B 4RQTA 3AHHA 3MK31 2ZXUA 3H42B 1TKRA 3EASA 2A4MA 2QM7A 3NJRA 4MQ6A 5TGZA 4AW9A 1TJ4A 2YVQA 3NTXA 2ZB3A 1TIBA 3L7IA 1AB6A 1RWOA 3OQPA 4ENPA 2AG5A 2FW0A 4RMGA 2VJNA 3C3MA 4LGVA 1FQKA 1EFRD 1KQFA 1THMA 4RUKA 3TXYA 4PSUA 2FPXA 4U7PB 2ZIVB 2BHTA 3MXTA 4W1QA 2G04A 5FFNA 5LNK6 1TVKA 1ODSA 4Z1MA 4PNZA 5B7QA 3EXIA 3UXEA 2HTEA 4NARA 5A7HA 4H18A 1G21A 1KDOA 2QAJA 2WK1A 5E38A 1W1IA 3THSA 2XVAA 5K09A 1DCMA 2Q41A 2ZB7A 4CDNA 2HA5A 3MGBA 3PB3A 3JAMA 4CQMA 1SEPA 2NN3C 2W2VA 2VK4A 3EY4A 3VR3D 5CLFA 1PCXA 2XMZA 5DCLA 5EIAA 3MB8A 3DWEX 3I1YA 4BO0A 2TMYA 3MWLA 1KI1A 1KOJA 1BKSB 1T9KA 4A10A 4CEHB 4LV8B 5DHRA 3REQA 4D3SA 1PE0A 3QVSA 5LYJA 3K9NA 4CM4A 3C3WA 3LQYA 3X1WA 3A4VA 1N6NA 4JKYA 3U3DA 5EJ4A 3R3JA 4B7CA 1O95C 1Z5NA 4C03A 1FYFA 1YZYA 1UMCA 2W4QA 2XB4A 2BBSA 4IHKA 2IXDA 3RAPR 4OUDB 3R9KA 3X2EA 3PL5A 5DWDA 1A2BA 1HTTA 1A0OA 1SVKA 2RCYA 1FXWF 1MJHA 4NG5A 1SHTX 2JFZA 1D3AA 3EZFA 4NF2A 4OGFA 4D2IA 3EH1A 2D0PB 2IKSA 1GPNA 4ZRNA 1XP8A 2VF8A 5JQGF 1XD8A 3O5AA 3LSTA 3SF0A 3L9XA 4BX3A 1M67A 3JYHA 2NM0A 2P4QA 2YHSA 4G1VA 2B8EA 3LIIA 3UGJA 5I7VA 4YCLA 2E4ZA 3OU2A 4DCUA 4KXXA 2BR5A 2FEAA 1MX1A 3OE1A 3K94A 1IVSA 1QIJA 1QH1A 4NFHA 1FSZA 4DJDC 1ST2A 5AJYA 4KR3A 1LPAB 4MWOA 4BPRA 4F21A 1NBMA 2H07A 2WG0A 2ZYAA 3B9PA 3MMNA 4OB7A 5IFKA 1KMHB 4GYYA 3S0JA 2R7NA 3D4LA 3N5KA 3DYBA 1EJ2A 4HN2A 4I36A 4JB2A 4KR6A 1TTHA 2FB9A 5KWVA 1U7XA 1UJMA 1Z2CA 2XNCA 3IUQA 2GM3A 4YB8A 5L6LB 2DLCX 1SXJD 5REQB 4MGHA 4BLSA 1AJEA 1G8SA 1WWKA 5D3MB 3DMNA 1LPSA 1WMDA 5D84A 4CKCB 2A2ZA 2YWXA 4KJXA 1JEYA 3QPDA 3WWDA 4D43A 4LSWA 3GLUA 2DQ4A 4ZCIA 1HE4A 1Z4QA 2FDRA 2HC9A 1PT6A 2O0JA 1I3KA 3AUFA 3FPSA 3K9BA 5BNFA 3VDXA 1CNMA 2WU4A 4NRDA 5CVUA 1ABBA 2PUEA 10MHA 4DYVA 1K8ZB 2ZBQA 4GX1A 3A4MA 5AK6A 3JQEA 3QOWA 5CA0A 3OE7A 1P81A 1JF8A 2JVIA 5FOSA 1DI0A 4CMIA 4H6PA 1OFUA 5ES4B 2HXGA 2XE8A 3B3GA 2PUVA 4HDMA 5FIUA 5AM2A 2ZSFA 5JVDB 3WLFA 3AY3A 1NLFA 3QNWA 4DV2B 4YT2A 4CCAA 3L0OA 2X6RA 3GEDA 4RV9A 3X2SA 4Q6WA 3H11B 3BM5A 4BFUA 1P17A 3RUIA 1ILEA 3OLYA 1T4GA 2F62A 3K2EA 1PWZA 2D2FA 4MWTA 4DMRA 2X1VA 4LOHA 1C80A 5F1KA 4ZCPA 1DNPA 4IICA 3SZRA 4EJFA 5EHXA 3RARA 1QVVA 1GT6A 5KUTA 2VDNB 4J16C 2G08A 4YQEA 1I30A 3WSVA 4L8FA 2XZTA 2VXOA 4ILEA 3UWDA 1D4AA 2MMCA 5MF6A 2PS1A 4NR0A 3CB4A 5B2FA 2FWMX 1ZIYA 2V5AA 2Y0EA 3LHIA 4HFNA 3VO9A 1DO0A 1O95A 4M7PA 5JMOA 4LF7B 4MPTA 2A9PA 4L8LA 3I32A 4CUKA 4D4IA 5LNK1 3LBHA 3T6KA 5H1YA 1ZISA 3ZXYA 5TIIA 3TFOA 3GD5A 3AR6A 5TV2A 4F85A 5K8LA 4QNMA 2Z3VA 4UEKA 2AB0A 1AM4D 4IDNA 1C9JA 5DI9A 2NLOA 3IEIA 2HWUA 2JNWA 3NC4A 3LT0A 4V0MA 3WNCA 1GAXA 4WFKA 1PQYA 1T9CA 2QVLA 3WAKA 1O2DA 3I62A 3AZPA 1ULUA 4WOJA 3JZDA 3K1AA 1ZMBA 2ID8A 4OVKA 2FF7A 1KIMA 3I9LA 3RK1A 3ZU2A 2CKMA 8GPBA 3AUKA 1XCBA 2HBZA 3QEJA 1TIKA 3BWCA 2YR0A 4RSHA 4WK2B 5FBKA 4C78A 3BDIA 3PQ5A 4ZOEA 1XMIA 3V3TA 3X1MA 2KSQA 2OHFA 2DUMA 2VA8A 1XRSB 3Q72A 2Z2IA 1YRQA 4BNTA 1X15A 4L5BA 2EERA 1ISJA 1COWA 4JBIA 2XKAA 4PGGA 4HAZA 4BO1A 1FFYA 1CJCA 2VYNA 1ZWLA 4B5LA 3VAZA 2EP5A 4QDTA 1T4MA 1W49A 4ZOBA 2KB0A 3UMJA 3NVKI 5GWXA 4YREA 4DVGA 1C41A 2BIFA 3DPSA 3GAZA 4FQ5A 1RQ2A 1Y4SA 2WU0A 1G6OA 4AY6A 4W9RA 1C3OA 4HEQA 1WU8A 4R3NA 2Z8YM 1AIPA 1E2IA 2EQ5A 5JD5A 3D0RA 2JAXA 3MM4A 1WXDA 1XTZA 3KB6A 3PF9A 4ZQHA 4YPOA 1CUJA 3UT5B 5TXGA 1JIJA 2HA3A 2XVXA 4BWYA 5FOTA 4G81A 1KE1A 4I19A 3COJA 3SI7A 3HPQA 1CEYA 4HDCA 1NBWB 5KWSA 1V3TA 1FU8A 2HPHA 4OXQA 4Q4DA 1RWXA 3BJEA 4TKVA 3DCNA 4PINA 1GZ6A 4IL5A 3FKJA 4QPNA 3RS4A 4QAQA 3T06B 5HJ5A 5JCJA 3WLNA 1JDZA 4FX2A 2IEYA 2WFZA 3L0PA 3L77A 1YRLA 3OQBA 2A5DA 1SUFA 1YHZA 2P90A 2YC2C 3ENVA 3OM1A 1QDEA 2IQ5A 3R0VA 4UTZA 3H2JA 5AM4A 2J6CA 3CX6A 2XCOA 5FYDA 3RYCA 1PQWA 5JADA 5LZ9A 1P45A 4ARIA 2YVKA 1HDRA 2RBGA 1OLOA 2RKWA 3MJTA 2O7QA 5HIMA 3WGIA 1DFHA 3S1AA 5JZ9A 2GYWA 3THRA 2V6IA 3OZXA 1L1EA 3E9MA 5EESA 5BN5B 1NVGA 2BP7B 2C7BA 3RBZA 5FA6A 1S7CA 2YBEA 3IMCA 3KXPA 3K70C 2E5LB 4W6ZA 1IY1A 1KIFA 1JFVA 4DLNA 4AYTA 5JISA 1SPXA 3P2IA 3SHQA 4D9KA 3R3UA 2EIXA 1FUKA 4QFCA 3ICQB 3WMEA 1WPXA 4IKPA 1NAIA 1BMTA 4OQEA 2BFDB 5DKFA 2I76A 3WWPA 1RTTA 1J1IA 2JJ2A 5COQA 4W9MC 2QUHA 2ZUVA 3E5HA 2NYAA 3I72A 5DI3A 1SO8A 2X5NA 3AG5A 3I1FA 4Z1OA 5MN6A 1OVMA 1XTSA 2I4NA 4H1VA 2FEPA 5KYYB 5DYTA 2O8EB 5K51A 2AWNA 5SY9A 4XIJA 3DXFA 1RZRA 4HQOA 2RGCA 2WHXA 1NMSA 1GQYA 1KZ1A 2ZTSA 3HKCB 4ZHQB 3BL5A 3LD9A 4TN5A 3AU8A 4PCUA 3IVAA 2R4UA 4PZUA 2QTBA 1SQFA 1ZCJA 4WESB 1XB2A 5ECWA 4A0GA 2C96A 1F60A 3AI1A 2AMLA 3I9OA 3CHYA 3P0FA 1N2EA 1DPGA 1TPYA 2Z98A 3CUUA 1TKCA 4WLEA 4TLEA 4YAUA 3OAAD 1KNQA 5LQRA 4RETA 2FSSA 1K27A 3LOUA 2QUJA 2ZS9A 4G41A 3TNFA 5EMLA 3LKVA 1P5RA 1Q50A 1WMSA 2XWPA 4NX2A 4A8HA 2GETA 1H6BA 1N0VC 2YZGA 2R7MA 1F17A 5AVXA 1K8YB 4KQWA 4WZAA 2PVCA 4IXWA 2C8JA 3GVHA 4YMTA 2H4JA 1SCBA 1CFJA 5FBVB 3ZE0B 3NVDA 2AK2A 2LDBA 2OFOA 3TYXA 4OXRA 5AK5A 2C5LA 1E0SA 3EDQA 4IFIA 3LBYA 3HVKA 4KXYA 5J40A 1WX1A 2RB5A 3DOJA 1N4AA 5KYKA 3BWDD 3G2KA 2HU8A 1RYNA 2NXJA 2WR8A 1A4RA 1A9PA 1F48A 2JFGA 4RMNA 4JKIA 2JFUA 2QA5A 3NC0C 4L7VA 2VP6A 4FFNA 4E22A 1RBQA 4MRNA 1MC1A 3ZW8A 1USWA 4D6XA 4YJ2A 2AHRA 3ND9A 1ONNA 5CURA 4EG8A 5ITSA 3E35A 1WEKA 2YYSA 3AI7A 4PAGA 5FCDA 2I3DA 2MIIA 1K06A 3OWXA 3SOPA 1GZUA 3F5SA 1W2HA 1WXWA 2IPNA 1TIPA 1ZOPA 3FFWA 4UTOA 4N4AA 2P9ZA 3SZ3A 3B5EA 1CJKC 4B8WA 1J2EA 1WABA 2XUGA 4F11A 1H9AA 4Z9FA 3W3AD 3UOWA 4Q7JB 3DOOA 3QBEA 2H1FA 1VJCA 3U9LA 2AFHE 3H5TA 2OV2A 1Q19A 5IASA 4GMXA 4IMPA 2F00A 3DDUA 3U44B 1HEUA 5FPQA 2E89A 1FFWA 4Z7NB 1QTRA 2QP3A 3TCXB 2O3TA 3IKVA 2OQVA 2OLEA 4MQUA 1ZBDA 2N47A 2P1ZA 2ZIXB 3OWHA 4GL4A 1KBOA 3TJZA 4DHWA 2I91A 3PDCA 1M2NA 1OGJA 1WXQA 5FTKA 3N9IA 3QJGA 5PGMA 2GJ9A 1M1NB 1MFPA 3E58A 3SN6A 5B36A 4Z3OA 4KG7A 4EFKA 2IDZA 1E79A 4DNQA 4G4SP 3NNDA 4YHBA 3B1XA 4OL9A 5CUQA 5AR1A 1UMBA 3ELUA 1S5PA 3V00A 2NMVA 2GYYA 3KNZA 1GUFA 4XVRA 1S8AA 1P1IA 3RGGA 3WWYA 4L5IA 2VSNA 3GLHB 3K9GA 3M81A 1Q7TA 2BBOA 5FWXA 1HDIA 3N6XA 4V1CI 5CXSA 3L1KA 1OWNA 5BMVF 1N3YA 1XN1A 3GUUA 1NQTA 4KL8S 5LZ8A 5DDIP 2XR1A 2N9UA 1BCRB 1OXUA 1ZN7A 2EIHA 1H2FA 2I6TA 3L02A 4D46A 4ZHQF 1D2NA 1IC6A 1WXXA 3SC2B 3LRTA 4Q4AB 2JATA 4P4SB 2C77A 2YWRA 3GZTB 1HYGA 3ILXA 3PTLA 3IIJA 3WZ2A 4S1NA 4XX0B 4NJMA 3H6HA 3GLKA 4AMBA 1DLIA 4KZKA 1YKSA 1H2YA 1K4KA 1XVVA 4URUR 4BV3A 2HCBA 2X13A 4A03A 2IX9A 2JVJA 2ZYHA 4Q24A 3WE7A 4ZI2A 1KQGA 1T8UA 4BATA 4TTVA 3B2EA 4OXYA 2QRPA 2PA3A 1ULSA 3GUCA 2DUWA 2EYUA 4HAWA 3FSRA 2O0LA 1ZSYA 4GX0A 5BV2P 3EZNA 1QGZA 3OFKA 4J7XA 4X54A 4KK4A 3IULA 3KIPA 2G1KA 2HQRA 2X77A 4UOEA 4E7OA 3ILHA 1LNSA 1Q22A 2OV1A 3FPJA 3W6ZA 1HH4A 2AMYA 1MPTA 2HJHA 4ZREA 5I9BA 4YRMA 1XROA 1Z45A 2VFAA 3HYNA 3NKLA 4HBZA 3R7SA 1QHIA 3VUFA 1ETUA 4ESVA 3V2HA 1NX9A 1N7IA 4P5EA 4RK5A 1JR3E 2N0SA 2C83A 1A72A 2VK8A 3D02A 4HRXA 1DAKA 1ZL2A 1FW8A 1QIGA 2W00A 4UMVA 4CLHA 4LFAB 4MVJM 3DDOA 5CG1A 5ADVA 4INAA 2IYQA 4J0IA 4WKPA 3BSFA 3WYFA 6AT1A 2G82A 5DN9A 2GO7A 1NQXA 3VR5D 3R24A 2Q07A 3BDAA 3EYWA 2RARA 3HYCA 4YMUA 1P0FA 3KHKA 5AVQA 4HWGA 3SGLA 5HS4A 2DQKA 2M1XA 4LY6A 2QAIA 2PV0A 3UJHA 1EK2A 3LUBA 3LUPA 4OM7A 3SS9X 4ITRC 2B94A 3PFCA 4W1SA 3BJMA 4QYIB 1ZHHA 4K6FA 1ZJWA 1C50A 2QDKA 4H31A 1XEAA 5JYBA 5G1NA 4HZUB 1A4UA 4O1MA 4QRHA 2XCTB 3NB0A 3TZHA 4RTNA 4IIJF 5FO1A 4FB4A 2QE6A 4FE7A 1XHFA 3TS1A 3ETCA 3I9KA 3CLSC 3DAHA 1DJMA 1TKAA 5D87A 3PQ6A 5BXYA 3RCBA 3CINA 4FK8A 1N2ZA 4HEJA 3OETA 1MO2A 3T3GA 1X80B 4DRXA 2XOKD 4RADA 2V6BA 2P2YA 3PNYA 2ZAGA 3TZBA 5C7LO 1A71A 4KH1A 3UOAB 2PGOA 3L4BC 1UKCA 3MJSA 3S2GA 4R2MA 4CHTA 3PEWA 4BEJA 4PBRA 3GVPA 3BRQA 3WMGA 1U0JA 3JXEA 1P4SA 4FFOA 3EPRA 4W9NC 4QUIA 2FPIB 3C7KA 2W37A 2AS0A 2H59A 2VJBA 3TAXA 1FFAA 5EJ8A 3RR2A 4JT9A 2V97A 2XUQA 4FNOA 4M1QA 3IPYA 5JLJA 1MJGM 1ZD8A 5FHQA 1FB5A 2OK7A 2N1MA 1DFIA 2G6TA 4GDMA 4MEJA 1GR0A 4D3YA 4DMHA 1W5FA 1D7AA 5KHLB 1C9NA 1NV9A 3H0KA 1RI3A 1QFYA 3TLGB 1ZVKA 4UQLA 4QGAA 4N9QA 2AV6A 1D09A 1QVAA 2HTFA 4ZYXA 5CB0A 1R9NA 3EQ8A 4JFAA 1KTIA 2WU1A 1UP7A 4NZYA 4CVNA 1QO7A 2QPLA 4Y3UA 4B3RB 1G2IA 2PMWB 3GP8A 1RW4A 2P6PA 1SOVA 3GJ4A 4ED9A 1YRAA 3TD9A 1TYZA 4QUBA 4WJZA 4HPWA 3OT1B 4JR0A 1Q92A 5EWMA 3DR5A 1O6FA 3EXEB 3QRWA 4FDMA 1JAHA 2X7XA 4E32A 1QTQA 1MAWA 1C81A 2H4FA 2WKWA 3NPMA 3LA6A 1RJFA 3GPIA 1O8CA 2CUKA 3KVOA 2EZ4A 2Z3ZA 1KKMA 1UMKA 4CCSA 3RKRA 5CAEA 2C97A 5SZIA 1H05A 2IYVA 1ZM9A 2HWWA 4IJMA 4CR6A 5L4SA 2ASVA 3FOCA 4EQ6A 3WRWA 3VBEA 3GGOA 3LDAA 2ZUUA 3V32A 4CFZA 1OI3A 5DTEA 2LPMA 3K2IA 4CM6A 1DADA 2JH9A 2C7RA 3QVGA 2FE4A 2C9OA 4HN9A 4N3CA 1G18A 4PGMA 4EHKA 3AF3A 5J4LA 3D6TB 3H84A 1ONSA 2JIMA 3AESB 1N2CB 5KVVA 1ZN9A 2FMTA 1MRSA 2DOKA 1TNDA 3C1UA 1RCTE 2P79A 5BRNA 4F71A 2QT9A 2QORA 1JPJA 2WV7A 4QULA 4A0SA 3TD6A 5TS3A 2G8LA 1N34B 3TTYA 4J75A 5IVPA 4ND8B 1QZTA 3CKKA 4OUKX 1XYYA 2VNSA 2XNHA 3AW9A 1JJVA 3HCPA 4QU9A 1R27A 5ITWA 2AFHA 1X19A 4JEIA 3GVXA 4XWWA 2OAQ1 2FZKA 5FUQA 4UUQA 2PWPA 4IBOA 5BQFA 4CIVA 4D9BA 1QZZA 1NN1A 3E6AA 1SUPA 3FZYA 4TXMA 2DSTA 3EC2A 3FMPB 3ROXA 3LPMA 3EXG1 3RS5A 4DJ5X 3DXZA 2IPMA 5JXHA 5K6RA 1K75A 4ZT3A 4D97A 1I94B 4CL3A 2NVOA 4C4TA 3KYCB 3GRPA 1F3LA 3GWGA 5JSFA 5KBYA 1QS0B 1SK9A 1GRCA 2ALJA 5DOVA 3RVOA 1WUIS 2ZXEA 1T3HA 1T9ZA 1V37A 3VO2A 5LUBA 3BB1A 4BNXA 4W9NA 5T41A 3ZK8A 2QZSA 1BS1A 1E0KA 5BR4A 4H7EA 5FQNA 3HADA 3FMOB 3M1YA 5IJ9B 2DY1A 3H18A 4IV8A 4LJYA 4EX7A 3HDYA 4F5YA 2P5YA 1TM5E 2WM3A 1SAYA 4ZI7B 3JQRA 3FOFC 3N6VA 2MYPA 3FVRA 4H3VA 4CFSA 3AHIA 4JODA 3UM9A 4GZMA 4JNCA 1UBFA 2D5BA 3D2BA 3PNQA 3QLVC 1JR3D 3ITDA 4RFSB 5FL7A 1YS2X 1ZHOA 4CIWA 1YGPA 2P0YA 2Q5FA 1E7RA 2FMUA 1T4BA 3LP5A 1A9QA 2C42A 2OCYC 3KQVA 4HLCA 4LPKA 5KYNA 3OCWA 4IHJB 4M9QA 4Y2UA 1XLTC 3FYCA 5BOVA 3SQNA 3TFQA 3URMA 4ZMSA 1EP9A 3ZKWA 2X0IA 1ZK2A 1RWWA 1HDEA 1TAQA 2ZR9A 4PHCA 5BSEA 3TW8B 4B83A 2DWQA 5ALGA 5LQKA 3ILVA 4RCYA 4B7ZA 1QF9A 4E6EA 2IQIA 1HXHA 2YVUA 1SBYA 3CB2A 4ADSG 4CTMA 2XVMA 3UK7A 4JEMA 2WUWE 4EG4A 1ZEJA 4B4WA 5H68A 4WUTA 4B47A 4RV4A 2QV7A 5HF5A 3S81A 2ACKA 5CFZA 3NATA 1OWLA 3NHZA 1W4CA 3IQWA 4FGZA 1SQSA 1NYQA 1U3WA 1VC2A 3BMCB 3L49A 4L8GA 5DHAA 1AQIA 2NPIA 4B6EA 1BW9A 2NUPA 4G5OA 5COAA 1E7QA 5ALLA 4AUNA 1QV9A 3GIWA 4KE8A 4CR7A 1IJFA 2VPYA 1S3FA 4HGYA 1FNNA 3TMYA 4H1UA 1AN9A 2QDXA 4YAWA 4UDXX 1Z36A 5BSWA 3X44A 1UK9A 4K9DA 3SSAA 2HR1A 2XKJE 2Z2KA 1XD2A 2Q4RA 2X3YA 2P78A 2HADA 2P11A 2WABA 4HYEA 1NTOA 4R1NA 3O8CA 1NXTA 1VDMA 2CHGA 3RI3A 4YMGA 3GNSA 4LZAA 3ST7A 3VPGA 3SJCA 1VBMA 3O7WA 3PNLA 1D2GA 1RQNA 4XLZA 3DUWA 2E9SA 5B2EA 3RIHA 1RP1A 3DO8A 1HE1C 3DE4X 5JNUA 2PWYA 1RACA 3NG1A 1M7GA 2W6NA 3S55A 3SYRA 1SVIA 4XB6B 4YV1A 1B6RA 5ILGA 3HN7A 1OXXK 4XKJA 5NULA 4FOOA 2WP8J 4PYMA 4N3AA 3OZRA 4UD2A 1J1UA 2GD6A 3KFLA 2AEMA 2IL1A 2UYQA 4X1KA 1P0MA 3HMQA 4RTMA 2J5KA 2GK6A 4FE3A 2IHTA 4WXEA 1RE0A 3B6ZA 1RBYA 4R2LA 5HMLA 5I7AA 4RDIA 4NMXB 1CZRA 2B92A 3DGEC 3ZNNA 1R8SA 4O4LA 2XZLA 2F7SA 2RC6A 3OQIB 4A6DA 4DLUA 2F3SA 4ZGGA 1W36C 2EFHB 5A4KA 4P3KA 3STVA 4RD0A 3T7IA 4PR0A 3H17A 1CETA 3EG9A 4Z0HO 3JYNA 5BT8A 2ET6A 5EPEA 2XV1A 1V47A 3T7DA 2ZSJA 1GPWB 2OC4A 1UEIA 4RIFA 4TTRA 3VPXA 1WBJB 1KE2A 5KDOA 5HJ7A 2XRFA 3R1IA 4NPAA 3PK0A 2F9MA 3O31A 3RNOA 1U8TA 1RRFA 1OLSA 3ONFA 3QLVA 3TM5A 4FSHA 5JTTA 1E77A 1QF6A 3ERCA 4D9IA 1NT4A 3V97A 2FQ1A 2GCIA 1GSIA 1T2VA 3KJHA 1CT9A 1G63A 3BIFA 1N0HA 1KK3A 2N1BA 2I2DA 3BMOB 3ND5A 3FCXA 3QF7A 4JJAA 2KW5A 4KIWA 1XLTA 5GADl 5JROA 2X22A 4HHEA 3FE2A 3MJFA 4I81A 4PLZA 2OHHA 4PRZA 4DLVA 8AT1A 5EP3A 4P53A 2W8ZA 1D2HA 4XYMA 1Q83A 3MWFA 2IHKA 4R3WA 3TOXA 3ZS8A 2P9FA 1W0JA 2IYZA 2PS0A 1LPOA 4EYKA 5H0IA 3NBAA 1UBMS 5AKYA 5AKXA 2WKQA 5JO9A 4ZYTA 2FFAA 4JS0A 4AS3A 1X7YB 4P82A 1NQWA 2C5BA 4DIUA 4EEXA 3MCAA 1L5QA 1RXEA 1LNZA 1Q0HA 3U81A 2PSJA 3K4PA 1SA0B 4IFTA 4IZHA 2WVJA 4BIMA 3PX2A 3IODA 4MZXA 1E2JA 3WP1B 3U3OA 3VC7A 4B6GA 4IAOA 1XL0A 4LS3A 3D5QA 4LFCB 2AD5A 3L7MA 1LJLA 5DOZA 5LFAA 3KB2A 3FTNA 3G5MA 3T5BA 3I39X 3P5SA 5CTAA 2OO7A 3NOVA 2X42A 1KK2A 3FBGA 4XEHA 2C0CA 5CP8A 4FJ1A 5IM5A 1JDNA 2R5WA 1P2VA 1XKLA 4NMWA 1IPHA 4EGAA 5TRTA 5A6SB 3GG9A 1KQPA 2GEDA 3JATB 1QLJA 3C8ZA 2IUFA 4M88A 3EZ9A 4EHHA 1G38A 3B6JA 1Z4MA 3DL0A 3KSZO 3R0QA 4DUYB 4M46A 3CZCA 3UXHA 3FPAA 1AF4A 1BQ3A 2I99A 2W9XA 4LECA 4BN4A 5CFRA 1G60A 5LP1A 4WLNA 4IIXA 2F4VB 1TU3A 3OCXA 4YIKA 3R74A 4EP1A 3U7JA 4Y8VA 2DETA 4KQXA 1RHQA 4OMCA 2CDBA 3R7AA 2D0OB 1XVUA 2ZETA 1SBHA 3C3EA 1UAAA 1AKVA 1X7ZB 1EVLA 4FCTA 4UNRA 4DVJA 1M54A 2ID9A 2Z04A 3QVVA 5KJCA 4JDPA 3I53A 2X4GA 4Q3LA 5IN5A 5AW4A 4MKXA 4DCPA 5LIRA 1IVYA 4IIVA 2CF6A 2PKXA 2WUFA 5JS8A 2G76A 1A27A 2VBCA 4JBNA 2JL1A 1DKLA 1RYDA 3EFEA 3SZOA 2J9RA 3ZG6A 3WA7A 3HB9A 3NDIA 1HDYA 2DWCA 4FI3C 4JJIA 2HFJA 3AEKB 1UJBA 5HF8A 4ZEWA 2FWIA 1OX4A 2P3SA 4FIDA 3UA4A 4MI3A 2HHAA 3DAYA 4WV3A 1ID8A 1QGUB 4C6TB 1J2UA 4YMLA 2D0DA 1FRZA 2UUBB 3VR2D 3NHAA 1Y6ZA 1YJBA 3WICA 1H9BA 2CSXA 2C4UA 4UM7A 5D5HA 2REQB 5KSPA 1KJ9A 1DSSG 2QY9A 4QBKA 5KNBD 3PSAA 2G07A 1BDMA 2FEOA 2PXAA 3QOFA 2ZJ3A 4YAGA 4YAKA 1E4EB 3CURA 4TM8A 4OLJA 3U26A 4ACAA 3OOHA 3VNAA 1WG8A 2XAUA 4BP9A 1I7DA 2AG6A 3SS7X 2RGYA 1QKIA 4XTRA 5DK6A 1HKUA 1FDIA 4GPTA 3N5CA 3RQIA 4ND5A 3OCZA 4LYJA 2VH1A 2JCSA 3NQ41 1K88A 4QYMA 4F5EA 2QMEA 3RTAA 5BMVA 3TEFA 1P29A 1ADGA 4C43A 5C1IA 5K0CA 4O3MA 5EWLA 4ENQA 4ZFNA 2ZP1A 3FZQA 1Y8AA 1RAIA 1WHSA 3IHWA 3VJMA 1JIXA 4E5NA 5JDCC 1K8RA 5BYJA 5KOYA 5A3VA 3W4IA 1P0QA 1WXEA 1ULZA 2XMSA 3GJ0A 4JBYA 4U7DA 2EVWX 2CLCX 2J07A 1I2MA 4NAUA 4PZYA 3HJBA 3V8MA 4EPRA 3U61B 4GZ3A 1ZRSA 2BAGA 1OPXA 5CT9A 4PCAA 5TQ2B 2CXXA 3P9XA 3Q2OA 3RVQA 2ZBGA 1GFSA 1EGHA 2HT1A 1VZ3A 5E6RB 4HPJB 3MEQA 3PF8A 1C0EA 2QL5A 1Q0PA 2FEKA 3KXLA 3MC1A 4JL6A 2JI8A 2WINI 1CQWA 5KDLA 4B3HA 1U0BB 1DAIA 3GH1A 2C2HA 1OFGA 1SUWA 1TQ6A 2IXFA 2WTAA 4IJQA 3RK0A 4K26A 3VZRA 4EGFA 5HX7A 3RKSA 5KC9A 3WAGA 2QW1A 2GARA 3G7SA 4TS4A 1CUYA 1COZA 4LSMA 1Z4IA 3TIXB 1GV0A 3MBKA 1VYHA 5EE0A 3P5BA 3OTWA 4PHHA 1NFFA 3NFRA 4HUQA 1QG2A 1JTFA