4ZVRA

Caspase-7 variant 4 (v4) with reprogrammed substrate specificity due to y230v/w232y/s234v/q276d substitutions bound to devd inhibitor.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
139
structure length
139
Chain Sequence
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 139
sequence length 139
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zvrA00
4PRZA 4N6GA 4EHLA 4FGUA 3E4CA 2H48A 4D3YA 2H5JA 4EJFA 2C2ZA 4QTYA 3H0EA 4I1PA 3V55A 1RWPA 3PD1A 2P2CA 1NMQA 3DEIA 5LUBA 4EHAA 1NMSA 1RHRA 3NR2A 2QL7A 4QTXA 3D6FA 1JXQA 2H65A 4QUEA 5I9TA 2HBYA 4QU9A 3SIRA 2CDRA 2FQQA 1F9EA 3NKFA 5IANA 3IBFA 4PS1A 5IAEA 4ZVTA 1NW9B 1K86A 4NBKA 4EHNA 2H4YA 2CJYA 4JB8A 4N6NA 2H5IA 4N6OA 4QULA 5IC6A 2QLJA 3NS7A 2C2OA 3V4LA 2Y1LA 1PAUA 3K7EA 4EHFA 3S8EA 1M72A 3BIJA 1RHUA 3DEKA 3KJNA 4N5DA 1F1JA 1RWMA 3H11A 5JFTA 5IASA 3V3KA 3DEHA 4HQ0A 3V4OA 1SC1A 1IBCA 1RWVA 1K88A 5IAJA 2HBZA 1QTNA 4EHDA 3H1PA 1RWKA 1QDUA 5IBCA 1SHJA 2Y0BA 4ZVRA 3PCXA 4JJ7A 4LSZA 2FUNB 1RHQA 4N7JA 4ZVQA 5LU9A 4JQZA 4QUJA 5IARA 5LU8A 2J33A 4QU5A 4JR2A 2FP3A 4NBNA 3H13A 2WDPA 2AR9A 2CNOA 4ZVPA 3R5JA 3SIPA 3H11B 3ITNA 1ICEA 4HQRA 5IAGA 4EHHA 4QUAA 4FDLA 1SHLA 4AWAA 1RWOA 3V6MA 4NOMA 4QUBA 2HBQA 4FXOA 1I4OA 4ZVUA 1I3OA 4EHKA 3R7NA 1QX3A 4NOKA 3GJTA 3P4UA 4IYRA 2C2MA 3GJQA 2H54A 4FEAA 3UOAB 2XYHA 1CVRA 3QNWA 2HBRA 4PRYA 1RWNA 4HVAA 4JJEA 3OD5A 4QUGA 1RWWA 2J30A 4QUDA 4JJ8A 3KJQA 1KMCA 2QL5A 1SC3A 2C1EA 5IABA 5LUAA 4NOJA 2XZTA 3KJFA 3S70A 1I51A 3R6LA 2DKOA 4QUIA 3V6LA 1GQFA 4IEFB 4DCJA 3GJRA 5IC4A 3GJSA 3RJMA 2QLFA 4D3ZA 1I4EB 2C2KA 3EDQA 2XZDA 2CJXA 5IBRA 4JQYA 4DCOA 1CP3A 1RE1A 4I1RA 2K7ZA 3IBCA 1BMQA 2CNNA 4ZVOA 5IBPA 2CNKA 4QU0A 4QUHA 3P45A 4QU8A 4NOLA 1NMEA 3UO8B 2NN3C 1GFWA 3PD0A 4ZVSA 2J31A 5H0IA 1RHMA 3R7BA 2XYPA 4JR0A 3EDRA 3DEJA 4PS0A 4DCPA 1RHKA 5IAKA 4NBLA 4AW9A 5I9BA 4M9RA 2XYGA 2H51A 1SC4A 2QLBA 3R7SA 3R5KA 4JR1A 3D6MA 3R6GA 1PYOA 1RWXA 4AWBA 1RHJA 2H4WA 2J32A 5K20A 2CNLA 2QL9A 4N7MA 4D3XA 3D6HA
chains in the Genus database with same CATH superfamily
3LSYA 1G2IA 1NUPA 1GEGA 3DF9A 4RF5A 1ZEJA 1HMYA 1G8YA 4LCEA 5TPWB 5HKAA 1TZMA 2VQSA 1ZBQA 1SUBA 3Q6IA 4Q82A 1AKYA 4PU0A 2IY8A 4XDYA 1JAIA 4HNRA 4F4CA 1V4VA 2ZYRA 5D3QA 3L8YA 5LXTB 2O14A 3QBDA 4GX2A 5B3JA 4DFDA 2I8LA 5CM8B 4OHPA 2C58A 4UBLA 4CLOA 3RK1A 4ZVTA 1QKKA 1JTVA 4P34A 5E2AA 4EL5A 1FVHA 2OCAA 2W37A 4JJAA 8LDHA 5K0BA 2IEBA 1M76A 2PVSA 3VU3A 2IQ5A 5EIBC 4P54A 4WINA 4PM4A 5COAA 1J5EB 1O95D 4YMHA 3K7EA 3NHLA 1TGYA 1YQDA 2BWJA 3DHNA 1L5FA 4PX9A 3QOXA 4S2UA 2JGDA 1F5NA 2QAGB 1H1DA 2R7AA 2R96A 4UPVA 4D9FA 2WZBA 2YJ4A 3PDCA 4B32A 2DU8A 3PFNA 3B51X 1AHHA 2AN1A 3VPAA 3VYUB 3R3YA 1X80B 4KXLA 1D5CA 2F1HA 4LXXA 3C45A 2J6CA 4CF7A 3THOA 1L5WA 4NYMQ 3Q87B 4X54A 3GUCA 3B60A 3MAAC 4RF4A 1F51E 2HJVA 2G36A 3EF3A 3N0VA 3C5CA 4J0GA 4AG5A 1P9WA 5ALUA 2YZ2A 1XWWA 2XMCA 3EE6A 5LN1A 4DR4B 3A06A 3KLMX 3U7IA 2NXEA 1EFPB 3ANNA 3EXHA 3TZLA 1EGQA 3DWGA 4RSGA 3GNQA 3IAUA 4QPZA 1KY3A 3V8VA 3QMVA 2PGOA 2CFRA 4HUQA 3TW6A 1DRJA 1K08A 1NJ1A 3LO5A 3EC1A 1QLHA 4PZDA 5FLYA 3ZCTA 1OC2A 2O8NA 3UOAB 1R0ZA 1L2TA 3R9XB 5K0LA 2XQGA 2CLDX 3LDGA 4P82A 2ZIFA 1GEEA 4JY7A 4ZRNA 3VAYA 2W83A 4Q4DA 4TZKA 1VLMA 2GRAA 1KMCA 2CE7A 2NPOA 4H6WA 5A7FA 1QKJA 3KJGA 3ER9A 4HXGA 4A26A 1QG4A 1TCVA 4M1WA 1Y33E 4BAZA 1N77A 3ZU6A 2D74A 2OHOA 4MV5A 2WWXA 3WRWA 1FJXA 3WTBA 2I7VA 1RLJA 4LJ5A 1KMMA 2R8XA 3DF7A 3ZQ4A 3WICA 3FOCA 3FTEA 1G4UR 4L4RA 2WYUA 4P84A 2E4UA 2ZSBA 3E9EA 1K5PA 1N34B 4MV0A 1BEZA 1GTVA 4HPJB 3OFKA 3COSA 1NKVA 2B36A 3KKLA 2D0OB 3KQKA 4QRHA 1K5GA 1G8GA 1NTRA 5FI3A 1HQDA 1U7PA 4B87A 2Q0QA 1DAPA 4X64B 1JEYA 5T8KC 3HXQA 4FZ3A 3SE0A 2P68A 3V8MA 3WBBA 1LPOA 4XB6B 3UMSA 1NVFA 1DLJA 1QTIA 1VTKA 1XVLA 1ZK3A 4GLJA 2VRCD 4JQCA 1WHTA 3G0CA 4C4RA 5J4HA 2H1OA 1RSZA 1XF1A 1XZIA 1U65A 4ZI7F 5KTPA 2ZWMA 4S1VA 1Z16A 2B35A 2GUGA 3D64A 4P7FA 2VZEA 4HFRA 4TKVB 1O5TA 1C9DB 2YQZA 2FSHA 4CV1A 1YC5A 5JXJA 4Q4HA 3OQMA 3L8ZA 2GN0A 3GRAA 1EXMA 3U7QB 4PPYA 2NTYC 3VYSB 4I55A 4X66B 1U1GA 1K89A 3RAGA 5K7SA 5FNVB 5KAPA 3H04A 4BNUA 3K8ZA 4P7BA 1A71A 3O84A 1T15A 3N2KB 4OBEA 1VMKA 1ZWKA 2G8LA 4V39A 3TEMA 2H2HA 4ZWNA 4ALNA 3HTXA 3ESZA 4G0UA 3RT9A 4R1PA 5KWVA 2G04A 3I45A 2PQ0A 4YJ2F 1KI2A 4B5LA 1ZOIA 5FTLA 3L9WA 4I36A 1H6DA 5G0SA 4XE5A 3L6BA 3ABSB 4XWAA 5DBHX 3TPZA 5IWAB 4ZOLA 4C5BA 3MJVA 5LLTA 2YYZA 3QUTA 5GZ3A 1WVIA 3ETEA 4REMA 3UT5B 1DXQA 4FBGA 4G07A 2PUWA 3ZS8A 1GL6A 1TYZA 2H1LA 2R7KA 3EVEA 1Z6YA 1P5FA 4MAMA 2V0CA 4HX5A 4MITA 1S9DA 1P9LA 3KE9A 3CNBA 4D6PA 3B20A 2RONA 4M54A 3IELA 1B8PA 4NCJA 4QTZA 3MOIA 1SBCA 4E3ZA 4ETNA 1CPYA 1TQHA 3OOWA 1MHTA 3C3XA 4DADA 2CGEA 2G7ZA 4HL6A 5EESA 3A4VA 3GH1A 4N41A 1BSVA 1B26A 3TXAA 3GIDA 4R2KA 5DV9A 3K71B 3CUTA 4J1TA 3PUVA 3E9NA 4GGOA 3LF2A 1F38A 3KK0A 4WFJA 5KVVA 3USCS 4D9CA 2G7MC 1RM3A 4DSOA 1KI1A 3FUTA 5KQSA 5TT0A 4F93B 2B34A 4U2BA 1MIHA 1OX4A 3SF8B 1LC3A 2XQKA 1WBDA 1XZJA 5ANRB 4B6JA 1IYZA 1PWZA 3OOEA 4L85A 5TIIA 3GBSA 2R6AA 5A06A 4GC9A 1XWFA 4MPRA 3ZOKA 2HUNA 5A3JA 2JB9A 3GNSA 4J0KA 2ORWA 5JV5A 5TT1A 2I4TA 3DTYA 4URFA 4DYVA 2LCFA 3OESA 4E1VA 3PNMA 1U5CA 1NJFA 3S2IA 4P2BA 2PZ8A 1L7BA 4G0QA 5DNDA 7ABPA 4YYEA 2JDIA 5C5CA 1JG7A 3DQQA 2Q8NA 2YIDA 4N0EA 2A3NA 2XZDA 2NXWA 3NALA 4OXYA 1NUTA 5BWLA 3SM9A 1N4DA 2XUOA 2Y4NA 3QM1A 4JDUA 4JOQA 1E6MA 5FUVA 3EK2A 1G98A 3CINA 1SHTX 3GU3A 2D62A 4HUJA 3RPEA 1RPZA 3AVYA 2IU0A 2IW1A 1DE0A 1SUFA 5JRZA 5IBPA 3LFUA 3KVRA 2OO5A 3G59A 1TECE 2FPGB 3JY6A 4NOLA 4TL7A 2PUBA 2DPXA 3OPVA 4K9LA 3B1VA 1GPDG 3D6JA 1CZOA 5DTMA 1PNOA 1AKRA 2P0EA 2XJ4A 1D6SA 4HOYA 3O5AA 4JBWA 2GXQA 4ADSG 1E1QA 5LMUB 3W2HA 2YINC 3GUHA 3IT0A 2HF7A 2YYSA 4RZXA 4C6TA 3C39A 1M54A 5KKCA 1M1NB 3JWPA 3BD9A 4F4UA 3MWEB 4Z2YA 1E8NA 2ASEA 4MJLA 4UW9A 3TOVA 2COUA 2FN7A 2RHJA 3MT8A 2OPHA 3DCJA 1TGVA 3D4PA 3L0ZA 1YZUA 3SG0A 3U39A 5HCIA 4NPCA 4TTTS 1FBNA 2EKPA 2P9QA 1JLLA 1WXFA 2ZRIA 2GJAA 4PVDA 5ALPA 1QU2A 4AYXA 2QX4A 1N7GA 2Q9CA 4NDAA 3BFXA 3C3MA 3ZW7A 4BNLA 3WIUA 3OCCA 3HR7A 3EPLA 4N3GA 1YB1A 2JIBA 1HY3A 1NX9A 1I7SB 2D3WA 1FIUA 2BFPA 2QHXA 3U26A 5IZ4A 1PTJC 1XZDA 3M6VA 1A27A 3OCZA 5JZSA 1Z18A 5HHTA 2Q21A 1XYGA 2VDMB 2WT9A 4B83A 2EDCA 3I1JA 1JHPA 2EXXA 2UYGA 1AOXA 4TMKA 1KI3A 5BMOA 3UB4A 3BRSA 4Q05A 3TRDA 3DFUA 1IBCA 4WK6A 3ZE7A 4BCBA 2QEQA 5IUJC 2AG0A 3H1PA 1Y3CE 2N75A 3SDSA 3IOCA 3PWZA 3A2NA 1JXMA 4A2CA 1UBTS 1JYEA 1XJ5A 1OWOA 3C41J 4UDOA 5ES3A 4RYLA 2PS3A 3DC7A 2PKWA 1R6BX 4LNAA 1PLKA 1LW7A 1ODTC 1OT5A 3B2EA 2Q6VA 4IF6A 5AW0A 2HLPA 4ESVA 4X00A 4QUJA 5IARA 4E5VA 5E9WA 1ZUWA 2WIKA 2QXUA 3O3MB 3WGIA 3GAMA 3ZWPA 2PX6A 1ZVVA 3ZJ4A 3HYTA 1O03A 3WFZA 2ISSD 4Y2XA 3ZX4A 4CMBA 4EMTA 2XUGA 4AZSA 4CKWB 4HP8A 1G3MA 3ZWAA 2LR0A 1Y5RA 3SU8A 3X3HA 3INGA 3DE3X 3PGXA 2PQMA 4IJQA 1L4HA 3IEMA 5CB8A 4RTRA 2AJBA 1DAMA 2GZRA 1EGMB 1NJGA 3VYTB 2O05A 1AT1A 4DJJA 1PGNA 1QX4A 2WJIA 4R0NA 3V00A 3HBMA 1QGAA 1X39A 3TSOA 4FDTA 3WKBA 3E5HA 2B92A 3GYGA 4MPTA 2X8JA 2J9ZB 3EZFA 3OPYI 521PA 2EW1A 3CX7A 3RVBA 4YQZA 3ZUPA 2DBYA 2RGAA 4KNWA 2IZ0A 2OSBA 2WYVA 3G5MA 3RROA 5B6IA 5F52A 4Z0HO 2IIVA 4L7VA 2F17A 5J2UB 4PR3A 5T8KA 3TR0A 3ORQA 6LDHA 3SYTA 2W2PA 1IM5A 3R6WA 2NU8A 4L2IA 3KAKA 4IQ4A 2QZSA 1PTKA 1KJZA 1HDZA 1BRTA 1N5MA 4H27A 1A9PA 4DABA 2W8BB 1UFRA 3OUTA 3THRA 3NCHA 3PFBA 4PR0A 3B5JA 4P5DA 1JLRA 2XOEA 2EV9A 3LK6A 5F51A 1S2DA 3SSNA 4ML3A 3UO8B 3BWMA 3H5RA 4FS3A 2HLHA 5I9LA 2ICAA 2PSSA 1F0YA 3QLUC 3DEJA 2WAYA 1PEYA 3PFWO 1T9KA 1PVVA 4NZZA 1ECBA 2B99A 4KB5A 3MRSA 1TUBA 4ROTA 1U99A 5FOSA 2XOKA 3RS2A 3QU4A 4JLJA 4B17A 1M8KA 2FCAA 2P8SA 1IOZA 3AM4A 3FLEA 3G8BA 2PFSA 1IXSB 3GFBA 2WWIA 5C8YF 3S5UA 4G5QA 2ZE8A 1XA3A 1Z12A 3ZGXA 5FH9A 4B71A 5HBGA 3L7MA 5BNTA 2IU6A 3OURA 3WIBA 1DRUA 1OOEA 4B73A 3B6ZA 3DVSX 4QA9A 4U2FA 3VDXA 1ZIPA 4BNKA 4R3UC 2FGJA 2JAQA 5EXTA 4K9DA 4K9RA 3D8UA 4U3JB 1BQ3A 3JZIA 4L0MA 1B0ZA 4WKGA 2OXIA 2I4IA 5JI2E 2C7QA 3I4LA 1GPJA 1N6NA 3RC7A 3TTVA 2ZATA 3ETNA 4RSMA 2IYNA 5FV7A 3A0UA 3TLZA 4EFDA 3N76A 1MC4A 5FPSA 4B74A 1MPTA 1ZCZA 3OE1A 4XB2A 1K86A 1NVEA 1Y80A 5JS6A 2X0EA 3UK6A 1C7QA 1JR2A 3FYTA 3QXCA 2WJVA 1V41E 4LY3A 4RIGA 5FOQA 1GDTA 2VDKB 2QTWB 3D3KA 3FZGA 1H4SA 1T5TA 1Y4AE 3QBVA 4IKOA 3PQ8A 4O4HB 1TM3E 2ANBA 2GKSA 5EQJB 3TQCA 4ZVMA 1U6KA 3BRWA 3PGJA 1VSBA 1E79D 3W3AD 4ZZ1A 5K8JB 2PMDA 2OFPA 3OZGA 3HVJA 2FW7A 1E2NA 2I7CA 2QD1A 3GEMA 4FSDA 2IEYA 2GPBA 3KSUA 1J06A 1UJ4A 4IHJB 5FOWA 1SEPA 2ZAGA 3CEAA 2QZZA 4JGBA 3HJAA 3T4XA 2WHRA 1WXEA 5FQNA 4MQ5A 2VK1A 3KEFA 3TOCA 1F4LA 2DJIA 5AP9A 1RZUA 1CZNA 3EDOA 3FJOA 5K01A 3SHFA 3FDZA 2J48A 2QAJA 2HDNB 1LV8A 2GD2A 2A5LA 3RYHA 1YZVA 1P7CA 3FVRA 4EZIA 3DT9A 3FRIA 3T52A 5TE9A 2P41A 4YIHA 1KJYA 1LBTA 3QLVC 4FFSA 2Q9UA 3KYDB 1K3FA 3K8OE 1KO7A 3ZJ5A 3MQ4A 1D7AA 1RBMA 2MR5A 1R0XA 3GLQA 3VYVA 5FHQA 4J3FA 3W6UA 3MT9A 1PR2A 3OQBA 4Y6GB 3PXBA 1W75A 3GLGE 1GD1O 2VRNA 3MG9A 10MHA 2HJHA 2R1UA 4PIPA 4HXFB 4OKIA 4K2HA 4ZDWA 5T57A 4HWOA 4EITA 9ABPA 5K9ZA 1E9CA 4J7CA 5LYJB 4BC1A 3GQBB 2GPAA 3OWXA 3Q10A 3BSYA 4H7DA 5C80A 2WINI 2WAXA 3LT2A 3FVTA 2RHTA 4ZYVA 1MDFA 3I1IA 4A36A 4D9KA 1RQXA 2A67A 2EKDA 1WSAA 1ZY2A 3Q11A 2FLVA 5BN4A 5BXQC 1J0EA 4X93A 1IHOA 3K0SA 5CP8A 4DY6A 3BDAA 5E9JA 1YVEI 3ZWNA 1ZINA 1Y6ZA 1NIJA 5C7IO 2MYPA 1RXSA 3V1TC 5C3UA 3C85A 3SKVA 5HTOA 4RHEA 1G4AE 1C3OB 2HWYA 1DBIA 3KU4A 3DDNA 3P9CA 3WOHA 5JFTA 1W59A 1LNZA 3VO8A 5T7BA 4E94A 5GZ1A 5A9RA 4P31A 5DM70 3DMRA 1V9CA 2PZJA 3G9UA 1DELA 1UKBA 1DVRA 5CTJA 1VPVA 3DOEA 3A1NA 1TUGA 2NZXA 2P62A 3IR6A 4IIJF 4C4OA 4DA6A 5I5EA 4LHYA 1OZFA 3HRHA 2QG4A 3AEXA 3MWDA 4MJ3A 1N8SA 4X6YA 1W9MA 1YD7A 4IX1A 3HR4A 2G17A 4FE4A 3VDMA 3EQ7A 1QIEA 3QXXA 1XVVA 1JFRA 4HQOA 4TYPA 1OTYA 3T38A 2DPMA 4M0DA 3WKCA 1PJTA 3GEHA 5JOQA 2PBFA 4OF4A 3QUQA 4EG4A 4ZMBA 1A72A 1JPNA 3L7CA 5F7ZA 3TRFA 1OFUA 2FWIA 1ZVQA 4GW3A 1E1YA 3ACCA 3ANSA 1PTJA 3C98A 1Z68A 4YAFA 5G53C 4IVQA 3UXYA 5K2MA 1SJ9A 2YBDA 3BRQA 4NULA 3SEFA 2RGCA 3EIEA 4ZMRA 3B85A 4PYMA 4PS1A 2AFRA 3KLOA 3PVCA 1KXJA 4MI1A 4C08A 2KWIA 4GMXA 4ND4A 4Q9AA 5FBHA 5G3ZA 3AETB 4CKBB 3T5DA 4D8TA 4EMUA 2CLCX 3NX4A 1E3TA 3R5FA 3KYCA 3C3KA 2QLJA 4OAQA 5IBQA 4PC7A 2PJUA 3I9MA 4F6LA 4WA7A 4OI2A 1AUQA 1CZHA 4G5SA 1EWTA 5IASA 4CMIA 1ZOSA 2NQ8A 2V4UA 2OOSA 3U0BA 4GICA 4B8ZA 4NONA 1KEVA 1W0CA 3PE3A 3WE7A 2O8DB 2OFXA 1GNVA 3DVQX 2LTAA 1YIDA 4UBNA 4BFUA 4ZHQB 5D84A 1Y3BE 3DDUA 1DC8A 2ZBPA 4UDXX 1UXGA 1DTEA 2LBPA 3BFVA 3A6EA 1P44A 2A9KA 4UJ3A 4YMGA 1MV8A 4OFBA 5KQLA 4YGYA 2F3UA 1PN3A 2CW5A 3QWHA 3TGWA 4WXHA 5C8DA 5LJIA 1WMBA 2FE4A 3IEIA 3ND5A 5LNK1 4NSNA 5H70A 3I9JA 9LDBA 1E92A 2QM7A 2MMGA 5B58C 1F12A 2GI4A 4GS5A 1EKXA 1HQCA 4EEKA 5DLDA 4CEJB 1NKTA 1FTYA 4NOKA 2YW9A 3VTAA 2W6ZA 4A6EA 3QVKA 2XMDA 3D0OA 4UU0A 1HZZA 4F11A 4RLSA 4WGGA 1JIVA 5H7XA 5EXPA 3H9BA 4DREA 1AKTA 5C5IA 2EQBA 5JZVA 3L0OA 1GGVA 3KT0A 3RLIA 4DGSA 2JLYA 1J97A 5ALLA 1IY2A 4CFZA 4EHBA 2HNBA 4K9MA 4LF7B 1U7UA 1KQPA 2ZAIA 3KM0A 2NU9B 1MP0A 4HCJA 3V2HA 3W2GA 4B2IA 1GQFA 4N48A 1BZYA 4M8SA 3TI9A 2JAWA 3LHFA 4P7JA 4G1MB 1KFEB 1YFJA 2IK8A 4I9UA 2H2WA 1GAQA 3C7DB 5AXCA 3S5JA 1OPXA 5JJLA 3QVMA 3EGIA 1C0LA 1TYDE 2J85A 5GVRA 4BNIA 3GLIB 3FRJA 1P1FA 1Z33A 1L5SA 2AK2A 4CF6A 1QV6A 1GPWB 1TCBA 4GPBA 2E18A 3VGJA 1SQ0A 4BXOA 2AW3A 4HI0E 1D4AA 4ZCQA 1USGA 3QLUA 3RTCA 4ZJZA 5CFMA 5DXFA 3C3EA 4GKJB 1NP6A 5JBIA 3F2VA 4GWKA 2LDXA 1YF3A 3V9PA 1HNZB 5DIZA 1NMEA 5MHTA 1P73A 3A9UA 4DBVO 2H0RA 1E2PA 2XRFA 3OQVA 2I6FA 1U0NA 4A6XA 4EELA 2BC9A 3S4YA 4FGSA 3WHKA 1ZLXA 2FNAA 3FPHA 2J7KA 1L5HB 4RLQA 4TVSA 4U7WA 4HDKB 1L7MA 2RCNA 4D9JA 5CBPA 3JD0A 2WUEA 1TLTA 1SK9A 3KBOA 4YBZA 5E4FA 4PLPA 4C0HA 4EJ0A 1E1CB 1X1QA 1YDMA 4A0FA 5DP2A 3SR0A 2XDQA 2I2DA 3ZNQA 3IPAA 2VPWA 4NJMB 2ZVJA 3H0EA 2ZYWX 3HDVA 4UU1A 4IH4A 2JD2A 4L3VA 1Z4PX 2DAPA 2ZS8A 4TWBA 4MIEA 2HKIA 3QJYA 1MC1A 6ABPA 1Z0UA 2BHSA 4TWIA 3U4GA 5KO2A 3E22B 1SHKA 3HUTA 3R3VA 4MV1A 5CYFA 1Z3IX 3O8CA 1YRAA 2I91A 1BROA 4EBBA 3KV3O 1HE5A 2UVDA 4D9NA 1HYHA 3VKFA 2R00C 1FCJA 3QX7A 5KSZA 1PGPA 4OK5A 3UVEA 4O02B 4ZRMA 2JH3A 1Q6YA 4EOGA 4BNXA 2H5IA 2B78A 3HMKA 1RXWA 4RNCA 4MIKA 1NRXA 1S89A 3QXHA 4TV8B 4K6GA 3P2MA 1EFRD 2FN4A 2CZQA 1EGHA 2IPLA 3K0CA 4MGEA 1YNSA 4MHOA 5DYWA 3G7SA 5ARBA 5GTDA 1N25A 5LFAA 5JJKA 4Y8VA 4K0RA 3ZBTA 1PSWA 1E3MA 3PFKA 1J09A 5B53A 5HPYB 4G1CA 1Z75A 4J3NA 1I6MA 3EIXA 1X7XB 3OMLA 5JSZA 1VGVA 1VLVA 3GT7A 3DKKA 3QKIA 3PVZA 1USVA 1WOYA 1GTMA 1K6MA 1R37A 2NO6A 3EGDA 3ZZUA 4AMVA 5J47A 3L02A 4I9NA 5SV2A 3ZHBA 1SZDA 3UMVA 1ZNWA 2PUJA 3QLVA 1QF6A 2PMWB 2VCHA 1QIKA 1Y4SA 3QU7A 3P8ZA 4HJRA 3V48A 2GWHA 3BA1A 3OCUA 3JD4A 5TB5A 3N2EA 5IKOA 3WLLA 3WXMA 3PKZA 4DSAA 3LG2A 1XT6A 4CM3A 1T8YA 2W00A 4MKXA 3Q3EA 4WXEA 4EY5A 1Z4NA 1TC1A 5EHNA 4XYLA 2DTXA 2H54A 2JJ2A 2VHEA 4MWGA 3RWOA 3FFTA 3MERA 3VZRA 2XSZD 2HT6A 3ZJUA 3DLCA 1P4GA 2GEVA 3PNBA 4O4IA 5KTYA 5JSQA 3VH2A 1X7WA 1VDMA 1VMIA 2O0KA 1O8CA 2OUKA 2WUFA 3NTQA 5FBRB 1OI4A 5EMHA 3RU7A 3VJRA 4PN7A 4BEJA 1TZKA 3BQ9A 4TSKA 2QR5A 2ZIGA 2HW8A 4UMEA 2E4VA 3AKYA 3S1AB 2HA5A 1X94A 1WPGA 3MLEA 2NMVA 4OLBA 3PPYA 2COEA 1T0IA 2D5BA 5GGXA 1X1CA 1QIMA 2G9RA 4B7UA 5T4BA 3H5AA 4C7XA 4HB0A 4I4NA 4HZUA 4D99A 1G9TA 3NDPA 4OLJA 1NM5A 1VJTA 2NP7A 1XTBA 2ETVA 1BMQA 2CV0A 3INNA 2ZITA 4HDCA 2VEOA 4IIYA 4KGZA 4AO7A 2BI8A 1D1PA 1HE1C 3COVA 3DDCA 4HMQA 1HLGA 3GW8A 4MP6A 2GUWA 4PY2A 1J1UA 4DAEA 1EAYA 2IZ7A 1U1DA 3PPIA 4I1OA 4KN5A 1KYQA 5LQCA 2JFVA 4LK3A 5I9MA 5JYEA 1H4QA 2PVCA 1EE1A 4S12A 4CEHB 3JQGB 1PLJA 1GVHA 2GZHA 3KDAA 4KPGA 4WJZA 5JS8A 2KX7A 2X0JA 1NV9A 1JG2A 1JG1A 2ZOSA 2DQYA 4M1ZA 4DLNA 3NVAA 2A0FA 5CYGA 1KO4A 3PG5A 2HFKA 3HCDA 4XQGA 5GMOA 2Q9AA 3WDLA 4WOPA 3R0XA 4RSHA 2H48A 4GSYA 4K6OA 2WMYA 4BJ6A 2FQXA 1V25A 3UA3A 5JT1A 1EA7A 4E11A 2YH2A 3GRPA 3JAWA 1K75A 5BQOA 3RS7A 2B4TO 2C2WA 4NYJR 3EPHA 1T1RA 1LSOA 1R5NA 4Z6KA 4JXXA 2QKYA 3TBHA 3MMPA 2WP8J 3TECE 5JY1A 2X5XA 3OFVA 1Z8FA 1C9EA 3DAGA 3H5WA 3K2IA 3UV3A 1CVLA 4KP7A 2RBKA 4DIFA 3ZIAA 3RRMA 2XMRA 4HNAB 3QUCA 1SUWA 3MGCA 1W5SA 3K94A 1IZ7A 4ZT4A 4U0KA 4BVBA 4S0ZA 1UQUA 1ZHHA 2XUQA 3IP8A 4DNPA 2BLLA 5HK8A 5A62A 4J9UE 3CO0S 3DBOB 3AB3A 3AUUA 3LBHA 4ZHSA 2F3SA 2BLNA 1DJOA 3K2EA 1T3SA 2Y71A 5AUPB 2H57A 3WA6A 4AAYA 1U0LA 3DJFA 3RUCA 2QRPA 4MWDA 3CLSC 5J2TB 4OHKA 3V42A 5LU8A 3WWYA 4JR2A 3HU1A 5ED4A 2VAVA 5J4KA 2G25A 4EW6A 1XA0A 4X7PA 5EE0A 2AKEA 4URVR 2OHXA 2W6JA 1A7KA 1P7PA 3GP3A 2DTDA 3ZZ1A 4PCAA 2ZP1A 5BSUA 3RU3A 1VJ0A 1BDHA 1U2ZA 2DBRA 4C1NA 1HPLA 1H2HA 1Q0LA 2CD9A 2E4XA 3MB5A 2CK3A 4JCOA 4P81A 2IXDA 3IUMA 4GZ6A 4B9AA 1YR1A 5EJ2A 5H59A 5C1OA 4ATNA 2WV7A 5FWXB 5LZ2A 5JJBA 3UMYA 1XTZA 1T1EA 1UMBB 1XROA 1OY1A 2C1EA 2KM1A 2REOA 3H6KA 4E2WA 2QN1A 3O8LA 6ADHA 4J7XA 2Y4OA 4C0BA 1SIWA 4M21A 1EVEA 2SKEA 1SU8A 1AGPA 2R2AA 3EZGA 3P94A 5JAOA 1KDYA 1TCCA 4HRYA 5NLLA 3VR5A 2OILA 1XJ0A 1KI8A 4PTZA 4C7MA 2GT1A 1JHOA 5ICCA 4LDQA 2HPHA 3DBLB 2P2ZA 4M8NE 4DJTA 1C30B 1UOOA 1G5FA 4X20B 5ELLA 4AKEA 4RCYA 1MORA 3WV5A 4JEUA 5ER6A 1EFUA 2ATCA 4RTJA 4NYJQ 4Q9LA 1KEUA 3RTDA 3T4UA 1VHTA 4HD8A 4QO8A 3U5ZB 1K0FA 2PXXA 4QHSA 1L5YA 4EFNA 5J5AA 2PUVA 1NT2A 2FP4B 2GM9A 4KIFA 1JWBB 4RWZA 3VOBA 1JZSA 4MV7A 3UK0A 3S40A 1XHLA 1R0LA 2X7XA 4GZLA 4M36A 3MELA 3L0BA 4CU2A 1YL6A 3A1CA 5IC5A 3H2JA 2BFFA 3HG7A 2O7VA 3IAM6 4R3WA 5H02A 2V7WA 4A0HA 4NE9A 1KGSA 4PXYA 3UOGA 3H4MA 1P17A 2RGUA 4G84A 4TROA 3U7RA 5T4HA 4EDFA 4EFKA 2PA3A 4EUEA 4MH0R 4O2AB 2R00A 5FB3A 1JWLA 1D4ZA 2ZUEA 3NR2A 3NDRA 1IUPA 1FFEA 2L69A 1P3DA 1EXDA 3HYCA 3GF4A 3AF5A 1LFDB 2O5CA 1P0CA 1Y4UA 3N8DA 4D8WA 1Z63A 1KP3A 5BNFA 1DS6A 1RM4A 2GD6A 2GJKA 1WDTA 5CX1A 2G71A 3ZLUA 5F2NA 3Q3HA 2VF5X 1U7XA 4DMCA 3I01M 2FWJA 2GYWA 4P4TA 5EAIA 2QG9A 1TM7E 5KQMA 5J5CA 3WK9A 4IIXA 1DBQA 4JITA 3GLGB 1P6UA 1VG9B 3FOZA 2XGOA 3IMEA 1P2DA 3GJYA 3UYKA 3V3KA 2YFKA 3KSDO 4R1TA 2IUYA 2XMPA 3WYAA 4AJIA 1NG1A 1QHYA 3UWMA 3G68A 4ZYTA 2R68A 2RKOA 1UK9A 1AA6A 1UPBA 3ZVNA 4G0XA 1YR9A 3T3NA 1YA6A 4CNBA 4LSZA 4YRQA 5KYVA 4FB4A 4WBNA 4UNNA 3SZOA 4I9GA 4LKRA 1KAEA 2OFOA 3ABZA 1OFUX 1H2RS 1T1GA 2W11A 2QJFA 4HXYA 4RZIA 2IP4A 5BMVA 1W4ZA 4J91A 4MI3A 3I52A 1PUJA 4MR9A 1MD9A 3CSDA 4DV0B 2XNDD 1G6HA 4MQFA 2YY7A 3WZ2A 1KYXA 4KFUA 1C3EA 1DIAA 3HNRA 1PFVA 1XCPA 1MOSA 3KKMA 2ZS7A 4N76A 1W1WA 3CUSA 1SEVA 2BFEA 4REOA 2PS9A 4X44A 1W8DA 4DG5A 5DHRA 1KEEB 4RTSA 1CQJA 3VR2D 3HJCA 4R0VA 2FCRA 2VSXA 4HMOA 3OLXA 1I5EA 3H2KA 3L7OA 4PRYA 3V34A 1ZA2A 2GH1A 1TJ3A 1V2HE 3QVSA 1KHTA 1NPYA 4Q1AA 1AZWA 4BX3A 1P7VA 4HZGA 1AUPA 3SXUA 1O5IA 4U0JA 1GSIA 4MW1A 2QYSA 3RC3A 4I4TA 4NS1A 1ODIA 1EVLA 2Q0SA 4IFEA 5ALFA 3RIMA 3S70A 1EXNA 5HW0A 3E18A 3GVCA 1P2FA 1BKDR 3RD5A 2W2LA 5EMNA 4DQXA 4YRMA 4H7JA 2ATIA 1COZA 3KR0A 1OXMA 2ZRQA 4RD2A 1PDWA 2QXYA 4RX1A 3M8KA 4DANA 4W7IA 2Q4TA 4XLZA 1B3RA 3EPJA 2AQHA 4YHBA 3O1HB 1NBMD 1E2MA 5FWYA 1B8VA 1NXWA 1H42A 1YQXA 4HFNA 4GX5A 4Y9DA 1E0DA 2N9UA 4DPKA 4RS4A 1DBSA 5DBGA 4BJHB 2LWIA 5C18A 5HRUA 5GONB 1V9SA 2HA2A 3PWKA 5G1OA 3CX8A 3OIDA 3OZIA 2ZYAA 4Z9YA 5FTWA 4O29A 2IWHA 5BSGA 1SOAA 1U1IA 3BMNA 4H77A 2Q5CA 3PZBA 1RJFA 5ITSA 5GOTA 3ZLVA 3F6SA 3D3WB 4YCLA 2A5JA 1SZCA 2FSUA 1SG9A 1RLIA 1O94D 3GG9A 3OKFA 2IE8A 4D4GA 3B38A 2RBGA 4JUAA 1J0XO 2XA2A 5CDFA 3KPWA 2QL9A 4GPTA 1E2HA 2GS9A 4Y30A 3RSOA 4L76A 1QH8B 3D6HA 1BXRB 2JI4A 4GPD1 1EP1B 5FQOA 2R60A 4BYMA 4PPFA 1Y98A 3OICA 2BZSA 1W4LA 2RJ3A 3PQ4A 3RJ5A 2JCSA 3E8SA 1DXHA 4Q9JA 5AVJA 2JEYA 4B81A 2EWVA 2IDJA 2PSJA 1N1EA 5I7HA 4WZAA 3R9KA 2BBWA 3TDNA 1TKAA 1MG0A 1VPEA 1T8UA 3B3AA 3NWJA 1QBGA 5IAEA 3ROFA 1MO2A 1L1FA 2HWWA 3FHCB 2B4AA 2I29A 3DL7A 3ZE1B 4RAQA 3R5TA 1AQLA 1VOTA 4DLYA 1G7SA 4X94A 4XUEA 3JQ7A 3OZ7A 3HXOA 4IM7A 1BG6A 1MX1A 1UUFA 3UCXA 3WK7A 3L04A 4Q12A 5LP6F 3RSHA 3AZQA 1KYZA 4XD7A 1P60A 4QYIA 1PJ2A 2CB0A 2Z5LA 3DVRX 5H9VA 1X7GA 1ABFA 5ICFA 3FYUC 1PVOA 1JFVA 2J46A 1QTNA 2ZIXB 4O2BA 2JGKA 5AOAA 5A2QA 2J9FB 1PFYA 5AJUA 5CLLA 4UXHA 1JDZA 4A73A 4LOAA 5JTTA 1D4OA 4JASB 3RHTA 4WKNA 2XVYA 4KFCA 3LVRE 1ZH4A 3T3DA 4EA9A 3IBGA 2HGZA 3IQWA 4BO4A 1LZLA 4OFXA 5J58A 3H99A 1GQYA 1L5KA 4HGOA 2HIGA 1TPZA 3F6PA 3HFGA 3OLVA 2EJBA 3JQPA 2Z6VA 3HV0A 1ZD5A 3OQIB 4KYTA 3LY8A 3P1JA 2FA9A 3SQLA 5JVDF 2PE5A 1YJQA 3OEED 1PHRA 1V5WA 1V9LA 1E4OA 1VP3A 2PKXA 4LSMA 4QM7A 4W5JA 5LQDA 1Z5GA 3FTNA 4HRAA 1DWUA 1PX2A 2VH2A 1L7QA 4RE6A 3UHFA 3EXEA 1GSHA 2R44A 4X1KA 3W8NA 2R4UA 3EEFA 1V8BA 3IJEB 1QIGA 2ZSIA 4I50A 4O3FA 3DUFA 2JFUA 1SGWA 1DG1G 3A2LA 4AJ2A 3FZNA 1E18A 2NP6A 3R7WB 2RIPA 3PA8A 4DV5B 2Q2OA 2WVAA 3E27A 3HKDA 2AYYA 2J0UB 4OK6A 4IGIA 5C53B 4IXMA 2EHJA 1ZESA 4B0OA 1KTIA 4OV6B 2ZW9A 3OEHD 5BN5B 1N6LA 3I05A 2VJDA 1JPUA 4OJYA 2ISQA 3T7SA 5M04A 1L1EA 2WB4A 1WZCA 1QRRA 2F1JA 2VBIA 4JQSA 2WLTA 5DM0A 4BB9A 1FDTA 1M5RA 1U80A 1HQYE 2IYLD 4OHYA 5BVHA 3VBCA 1EDEA 1JB1A 2JIDA 1E1LA 2GXUA 4XIGS 4BTVA 4Z4GA 3VV3A 2H85A 5KX5B 4R9NA 3L06A 3FOEC 4IUYA 3EVTA 1FS4A 1DV1A 1VRWA 4B6EA 2OHGA 4HQNA 5GY7A 1CNEA 7REQA 4DCGA 2VYFA 3DLHA 3H2HA 3NFYA 4ZVLA 3UAOA 4P7KA 2C92A 2BMWA 4F92B 2P4QA 3OT1B 5DMXA 2AZXA 2XBLA 4Y6LA 3EHEA 1V7ZA 4XKJA 4EF4A 1WZEA 6NULA 3R0JA 2D2EA 1K4MA 1YL7A 2FUEA 4DNOA 2WJAA 3D1VA 3PJEA 3R8FA 1PR6A 2A9RA 1B2RA 5ERGB 4G9EA 2XNJA 3RRZA 1JH9A 4L5AA 4FZVA 1PIWA 4PYLA 2CBXA 2XDWA 2P1RA 4TLLB 2A9FA 3J81k 2XDYA 3T6KA 1U0BB 2AZ4A 1WU7A 3TR6A 4J2OA 3UJ9A 1LCIA 3FCEA 5ENZA 3THSA 3QPVA 1YKGA 2HB6A 4B2YA 1W0KA 1PV1A 2ZUSA 2JI8A 2ANCA 3MRVA 4QGAA 2A7XA 5ECDA 2ID9A 2P4UA 3N8IA 2PFKA 1Y6QA 3BZUA 4OHMA 2PZKA 1QNFA 2OZKA 2RG1A 1WIWA 4P3OA 1AGYA 3A2MA 4K03A 5EHQA 3ZGOA 4DMFA 4MWSA 1EFVA 4CL8A 4OGLA 2FF7A 4HYYA 4TL6A 5IK2D 4RHCA 4HF7A 3CF0A 4ZZ2A 5DX8A 3GZJA 2PRYA 5EWMB 5A6VA 2EWMA 1T9HA 1XWIA 3JD2A 2I4MA 4ZAXA 2IJGX 2XVMA 3S68A 2C84A 3CFYA 3IEUA 4CLDA 3VPFA 1JKMA 3ILYA 5AK5A 3STUA 3FR7A 4HEQA 3TKYA 3ZI0A 4LC0A 2PR7A 3HS3A 3LKDA 2ZLBA 1Q74A 4RM2A 1ZCAA 3SS7X 3ZVLA 2UZ4A 2XIJA 1ZVJA 1TD1A 3K3PA 4PG8A 1A76A 2LNDA 5DYIA 2XUKA 4TQAA 2Z98A 1DQSA 3SXPA 2ENWA 3UWPA 2P4EA 4OHVA 3CVUA 3OCXA 5DOZA 1WG8A 4HKTA 4LEIA 3U31A 3N74A 5E4YA 1A88A 3C1AA 3U4DA 4ND6A 3K31A 2UUAB 3BULA 2WD8A 4BKPA 1E2EA 1NLMA 4IMJB 2APJA 2F43A 2L82A 2OXEA 4N5IX 1EUCB 1ZW1A 1VL2A 1MB3A 1OXSC 1KO5A 3OQ1A 5EPEA 2HJGA 4KVGA 3ADCA 1TKBA 5BV1A 1M2GA 4U4AA 1JVNA 2OG2A 2TMGA 3HRKA 2C4MA 2EJWA 4LBVA 1DBPA 1LA2A 1R88A 3F7TA 3KJHA 2XB4A 4I2NA 4Q3EA 5A5GA 3DA8A 4DM4A 1IE3A 3CWZA 4P2GA 2XQVA 1GZHB 2NUAA 4WH0A 2BGKA 3SJCA 6AT1A 1Z5PA 2NZ8A 3EWNA 4EUSA 5I45A 1K7FB 1UC4B 3PK0A 4Q3NA 5A05A 2NM0A 1JB9A 3MTGA 1QK4A 2GLUA 4RY8A 1Z08A 4LWQA 3AY0A 3RVPA 5HR5A 3DBHA 4H7EA 2H1WA 2WWHA 1X8XA 4H60A 3HPQA 2OXCA 3MLBA 2AFIA 3JALA 2O0MA 3N6RA 3ML1A 1ES9A 3R77A 4WXMA 4EPYA 4YWJA 4DKXA 2B5WA 5CR9A 1NNSA 4MR8B 2GN4A 4XLTA 2CFCA 2P9BA 3GGPA 3ICPA 3G0GA 1W0JD 1W4CA 3LPLA 3LBYA 3HCCA 3A10A 5K0NA 4DWJA 1UFOA 3UJCA 1QR2A 3V33A 1TDJA 3D54D 2X0IA 2V4MA 4NZPA 4Z1MA 1E2IA 1QRAA 4A92A 4QBHA 3NW9A 4UNRA 3G88A 1NHWA 1WDKA 4MKHA 4YP0A 3IBTA 4RVUA 4JBYA 3GEDA 3KAJA 4EYGA 5LA6B 2D2FA 2G72A 3VTFA 3G7NA 3RC8A 2ATEA 1DZIA 3G9XA 3HUEA 2Y6VA 3GLVA 4KIUA 4ZOCA 4YYZA 1X9HA 3ZDXB 3MNFA 1E1DA 4M86A 1KH1A 1QMGA 2Q3LA 2QVGA 1ZD3A 2IY7A 3MRTA 1C5KA 3NONA 4U6QA 2O5EA 2YV4A 1V6CA 4N0MA 4TTAA 3NAGA 4ODIA 1DJNA 1QYRA 2DFKB 2MWMA 3IB3A 3BHJA 3KZ1E 1VYHA 1XD2B 4HYEA 4AF8A 3KYJB 3WRXC 2GFIA 2CHVA 2RH9B 5FUXA 1IFXA 3ZHVA 5FX2A 1DIBA 1N7HA 2QRVB 3SQDA 2VJMA 3A6JA 5FA6A 3LL7A 5JAHA 4UE3S 3TQQA 3S99A 2OKGA 4NCKA 4XWYA 2I8AA 4DA9A 4LFAB 1B14A 2QY6A 2H18A 4IGKA 5T41A 2BGLA 4BUJA 2ADOA 1NAHA 1L5VA 1E7SA 3O73A 4RZUA 1EXVA 4GRIA 4ZT7A 3FYUA 4IMRA 5T5QA 3RT1A 3ST7A 1QH1B 2CBZA 1K7CA 2B3DA 2FPPB 4NHEA 4RVGA 2WSIA 2Q07A 1ID8A 5L53A 2Q1SA 4RKRA 1PT5A 3C3YA 1G7RA 1WMFA 3RVLA 1YRWA 5L6MB 2XHZA 1R3DA 2CVZA 3PV0A 4KWTA 2PD4A 1YS6A 3ZC3A 4PC1A 3M4JA 1NL3A 2A30A 1GILA 3SK0A 1AHNA 3NHYA 5JXHA 3O8DA 3JSAA 1QIFA 2WJPA 3OJ0A 3R4VA 4FP9A 1I33A 2AN4A 3RAJA 4PC3A 3EMKA 5LZ7A 4F1JA 4F4FA 5MF6A 4WBSA 3W3ZB 3FF4A 5ADWA 2WKRA 2VHVA 3OWOA 2JFBA 4QXAA 5KOJA 3BMOB 4A5SA 4BEBA 2NSHA 1A97A 3KOUA 4P4SA 2FX5A 3ETDA 1IQUA 1H8EA 1SA0A 4EG6A 4OGFA 1ZR4A 2C59A 4BPRA 5LNK6 2BGGA 1RAHA 1H9BA 2YASA 1KETA 4F0JA 4EPTA 3UHPA 1IN6A 3H3FA 5JNLA 4Y1RB 4NU6A 3AEZA 2M32A 3MAGA 1G8FA 1U8XX 1GZDA 3H65A 1Y82A 3L6EA 4Y2YA 3VC2A 4YPVA 5B4UA 4QC2A 1K3TA 4O4LB 3PQDA 4W9RA 1KAOA 1SUSA 1UPTA 4FYYA 4HG2A 4D42A 2I99A 2V5AA 3F3KA 2I6UA 3RBXA 3JRWA 3OMXA 5AO9A 1CIJA 3FWPA 3SYKA 1YGPA 1CVIA 2GCGA 3CEMA 2FSGA 3LGAA 3OH8A 4OXIA 3UENA 3WNBA 3X1ZA 1RPTA 2RGWA 4MPDA 4FT2A 1K92A 1VCMA 1R15A 4IIEA 4J2HA 2HXGA 4R98A 2OKCA 4MUXA 1IHXA 3T8YA 3VZDA 1FS5A 4YCNA 4LRQA 2WAOA 3B89A 1PG5A 3UAYA 2PEZA 4JT2A 1HKUA 1P1KA 1J7KA 1KDRA 2E37A 2VZ0A 5F35A 3ZIDA 3C7AA 2AEMA 3SMQA 1DL5A 4JH0A 2BKUA 4C87A 1CW2B 1EG7A 4ND8B 1QHHA 2JHFA 2X2FA 3IPLA 4AF7A 1XG5A 1ADBA 3IP3A 4KGVA 3QA9A 4ZREA 1THMA 1U2GC 1GPLA 1N2IA 1BGVA 1CJVC 3CLUD 1NI3A 3IAXA 1SXJC 2XZPA 5A5VA 4BMXA 3JYNA 2X0FA 1JR3E 4ME6A 2J4CA 4Z49A 3ZXYA 2V54A 1QAOA 1ONSA 2PGAA 2ZU0C 4QQRA 4YAUA 1Y5IA 2XRYA 4ZO7A 3H9UA 3LBIA 1IXZA 2RGEA 1NVXQ 1Y42X 3CBQA 3CUVA 3CNQS 3PRHA 4P3XA 4OQQA 6CHYA 5LLSA 1CZRA 5JMPA 4ALIA 2R2GA 1QO7A 2JFGA 4BNDA 3KKZA 2X2EA 4TUYB 3VZSA 1TZBA 2ZJZA 3PI6A 3R3XA 1ESCA 1FFCA 2HNAA 3GRZA 4P0TA 1MZVA 2MDTA 1W46A 2YV1A 3TNLA 5IDVA 1TAUA 3DKIA 4LYEA 3CZ9A 5F9MA 4UBOA 4CG0A 3KT8A 1DCTA 4GI3A 3ZY6A 1N3BA 1VHWA 2AN9A 4LMPA 6GPBA 3UJ7A 2QT9A 4WK0B 4GR4A 1P2TA 1EFHA 1QS0B 2X22A 1CJCA 1M6YA 3L7IA 3WNVA 2E85A 2QUKA 2H4JA 3ESQA 4IIUA 2AD5A 2C0PA 4BE9A 4F9FA 4UMFA 5AI9A 2R5NA 2DM6A 1M72A 1OREA 2H0AA 5I51A 4CLXA 4KPEC 4EK9A 4I1SA 1GSAA 1UKEA 1P7ZA 1LS6A 3DMYA 1Q0ZA 3ZDQA 1Z74A 5LD2B 4ZTBA 4IILA 3B78A 2V96A 3IOBA 4PAMA 3QU9A 4CR6A 1XSEA 3AO0B 4OQNA 3SJBA 1FYWA 4HTFB 1J5PA 3IOEA 5HKLA 3QNMA 5ELMA 3FJ1A 2ST1A 3DMDA 4FONA 4B45A 5JSUA 2NPIA 4GO1A 1SVNA 2G1AA 4UUBA 3ZVMA 4K9QA 4OREX 5AOVA 1PJLA 3Q7QA 3G6WA 3ISVA 1A9SA 4FLEA 4RH1A 5AK0A 2EIHA 2H1RA 3I8XA 3K9BA 1UC5B 4EG8A 4QT4A 3QYPA 3ZZ0A 4DDMA 5HUQA 4H08A 4TSFA 5EIHA 2AQKA 5IDXA 5FD8A 2AXEA 4OXXA 1ZXLA 2Q1WA 1ZM7A 3TN7A 3CMCO 4BGEA 1MZPA 1QDEA 1NJSA 1E32A 4DMRA 1XN4A 4YUWA 1CUEA 4DB4A 4FIZA 3IIIA 2KLBA 1W48A 4EZBA 2YFHA 2ORIA 1YL5A 4JROA 5AK4A 4KQWA 2PPVA 3II6X 4YAKA 1LBHA 1V1RA 3GDGA 4M0EA 2WKPA 4YMLA 3WL4A 4JJEA 2CUZA 3L1JA 1ZNXA 4EJ2A 3BD8A 3DSRA 3QYAA 4DCVA 1KVQA 4N4AA 4GP7A 1UKAA 5H81A 4RMJA 3UGKA 1YK1A 3ESBA 4XCVA 2EW2A 1NXSA 4QXQA 2XCIA 1AM4D 4M8KA 2QRUA 3N6XA 5AI4A 1DADA 3S28A 1P9OA 5TY0A 3A26A 3VKHA 3FAZA 1AD2A 4MKFA 4B85A 3GG2A 5IBRA 4JI3B 3V4ZA 1RMQA 3AILA 2ZR7A 3DOHA 2Q46A 1HE3A 1A5AB 3GXBA 3PJRA 2C7VA 3ZU2A 3DWEX 4D7AA 2YWFA 4XYMA 2D13A 4M88A 3JX9A 4MRSA 3CC8A 1BS1A 4ZIRA 5LJLA 2IOYA 4J07A 3SHTA 5HG0A 3LVFO 5TJHA 2HLDA 2OBXA 1J24A 2RGGA 4M98A 4LBYA 4LXQA 4MRNA 5HWSA 4JSYA 1ENYA 5IUNC 3AMVA 2B83A 1RVV1 2CNBA 3E9ZA 4OUDA 4YP6A 2GZ3A 3X1KA 5G0UA 3QJGA 3OZXA 4H7PA 3Q3IA 2OWEA 1M83A 3BEOA 4IDHA 1BKYA 4Y7DA 5KYKA 3SLGA 2VXYA 1TRHA 3KWMA 4HAXA 3FCAA 4MHTA 1HT1E 1RAGA 4CIVA 1JFLA 1I6WA 2X76A 3CCBA 4LZWA 4Q1BA 5C4GB 1NMSA 3NWPA 4GNRA 1GGEA 1GV1A 2B6NA 2Q5EA 4HMPA 1JN0A 2W0SA 4PO3X 1YDGA 5F33A 4ZCTA 2CCGA 1BW9B 4IP0A 1J9GA 1QCZA 1ZKMA 2A1UA 2E6KA 3JZMA 1Z0IA 2Q62A 3HJRA 4UBJA 3R44A 1N7IA 4EHIA 3GJ5A 1Z7WA 2GARA 4LXIA 2V8BA 2H08A 4C3UA 4BFLA 3U61B 2A88A 3VX3A 1DUIA 3OE7A 4U8HA 2XT0A 2CLFB 3HFJA 3O4IA 1X13A 2OO7A 2PUCA 2KBEA 1KEZA 3PQ5A 4QVIA 4MVCA 1MIOA 2AOTA 1T8WA 1FVXA 1REQB 4NJEB 1YRLA 3K1JA 3WGYA 5EHXA 4NLLA 3LYAA 3ICOA 1H2EA 4WLUA 5I7OA 5HGJA 3MILA 1QHXA 2BUCA 1XMOB 1U9IC 4BECA 2CDBA 2PDAA 4ZEWA 5LIRA 4Q7QA 3ETLA 1RBZA 4LMRA 1L5NA 3LQ1A 1CETA 4H7HA 1JEEA 3FTFA 1W85B 1KGDA 2L18A 1EUDB 2J3QA 5BRAA 1ZVMA 3GN1A 3L1VA 2WPNA 1OBOA 1RJ9B 3EIFA 2RK6A 3ZV6A 1Z38A 3A8TA 3LCUA 2WQ6A 4FMDF 4LHXA 2W70A 1F7UA 1XK6A 2DQ4A 3R6DA 4F5EA 4DNXA 4G0ZA 3MB8A 1DKLA 4AJ4A 4DGQA 1V48A 4UEJA 3F74A 2O5VA 1T9ZA 2VP3A 4ID9A 4PBRA 1OBCA 1I4OA 2A33A 5AKLA 2FPMA 2IA5A 5SY4A 1EVKA 4PYKA 4KRFA 1FJ2A 1U8ZA 4O4HF 3ZW8A 3ITKA 1PZFA 1OFVA 4DQVA 3CS3A 5CLIA 2BR3A 3RI3A 4EFLA 1IEWA 5LOVF 2UXDB 1HORA 3RV4A 3QF7A 1CT9A 3PR3A 1I0LA 1RRGA 5J43A 3QOWA 1UBNA 2OY0A 2HRZA 2WG0A 1RWBA 2H1VA 1E9BA 1YRBA 2HN9A 2XZTA 3B9RA 3ED5A 3EFHA 3OY7A 2NG1A 3IDAA 2WILA 4AT1A 3SQOA 1ZM3A 2ZK7A 4YCAA 2WFMA 4RPGA 1KYWA 4M9CA 2Q45A 4YRBA 3LTNC 4XYBA 2ZAYA 5ALYA 1XP8A 1FNMA 2SCUB 4EA7A 3QX3A 3UWOA 1U2GA 1DJLA 3KNZA 3T3OA 1SXJA 3OUUA 4I1RA 4XPIA 4BN0A 4FHEA 3EEBA 2BGMA 1T6BY 4Q9NA 4YCCA 1V11B 4P0PB 1ND6A 3AW8A 5G0TA 1SCDA 1P4JA 5E1MA 4B1FA 3ZQUA 3FUXA 4AP9A 1EA5A 3FPKA 4Q7KA 4ENWA 1A5ZA 1X6VA 4Y2GA 5EWJA 1KVSA 3B3QA 1P31A 2GZ1A 2XH8A 3JWHA 4P36A 4OTZA 1LLQA 4F6RA 2E4WA 3F97A 1N1MA 3KFVA 3G0IA 3F8SA 3H5LA 4PZ0A 1LK7A 2JVKA 3KKOA 1ZC4A 2B1JA 4KXMA 4RK5A 2J6BA 3INTA 1GZ5A 3E7PA 3IEVA 3AERB 4PONA 5AJYA 4ZT6A 1A69A 1SBHA 4BRWA 2E4AA 3OIGA 1WB9A 3OJCA 2C4WA 1Z0KA 5D6OA 4ESEA 4F3YA 2FHSA 4RZ3A 2X19A 1EXWA 3AB8A 2ZJ8A 2WWTA 4HGNA 4X62B 2YCBA 1JEAA 3BBLA 3P7MA 4PFQA 1SXGA 3OJFA 4UTRA 5K3EA 3PWSA 4EGQA 3F8WA 3QVWA 3UAWA 1KI6B 4RXTA 1G6KA 1Q6ZA 4RK0A 3H1AA 1DFHA 3B1YA 4QHYA 2J5BA 3WFJA 3THWB 3QPCA 3TSWA 4C7OA 3AX6A 5DYYA 1U28C 3A25A 1EK5A 2WICA 4WLVA 5E9QA 5KYTA 2H1SA 1WWKA 4X1YA 1IOWA 4ARBA 4IV8A 2R1TA 1UDWA 3ODGA 4PLFA 2Q1UA 4N5DA 2R8RA 2X8LA 1VA4A 2R1VA 4HNTA 2RH8A 1UZMA 2XMGA 4ENQA 1MO4A 5K0JA 4U7HA 1KF0A 1RIFA 3R5XA 1P2GA 2I2FA 3FYCA 4N49A 4YUZA 4KMSA 1E1MA 9LDTA 3A7EA 3BERA 3VO9A 4ARZB 3GZTB 4YAEA 3WRYA 2B5OA 4BLUA 4OCZA 5FUYA 1K8QA 4QU5A 4B6OA 3T3IA 1N6HA 1JHDA 2NU6A 1HDYA 2Z5FA 3KKNA 3HCBA 3QPDA 4RADA 4X97A 4ALMA 4DMGA 1K4KA 1G2OA 3I3OA 2O20A 3O90A 1F17A 1BMFA 221PA 2H52A 3KUUA 4GEGA 4YREA 2CN1A 5FLKA 5CAEB 4ZV4A 3BE8A 3FG9A 5J4YA 4CQMD 4R7TA 2Q4OA 4NOMA 5LZ8A 1SBQA 1TD9A 1AKNA 4M6WB 3RG2A 4B2LA 3PQ6A 2P3QA 4JX8A 4ZVNA 3U7HB 3U4CA 3W5SA 5ICEA 3FYDA 4HDNA 1HT0A 3M5WA 1PU2A 2VP6A 3DNFA 1B0AA 2ZTUA 5A3RA 3ADKA 5KNDH 1KO1A 1AXRA 5MN6A 2FHPA 1BXGB 1LI5A 4Q7LA 5DM4A 5G0WA 2WT4A 5KJFA 1R5JA 1B15A 1VMAA 2VF7A 2O59A 1GGNA 3C6XA 3D7KA 4AJ1A 2PXAA 4LSGA 2XJ9A 1ONBA 3EQ9A 1LBSA 1RQGA 2IYOA 1F2TB 1KK1A 1QHNA 2JHCA 2WSSD 4FGZA 4LE1A 4XJSA 3E15A 4ZALA 5FBZA 4RHFA 3EDQA 5I7AA 3SX4A 4EVIA 1LJLA 1J1IA 2RI0A 1YZGA 4GPIB 4YALA 4ZCPA 1OI7A 3UJ8A 2DUMA 4C7JA 5BW8A 4X6XA 4MVJP 4EY6A 2YNMD 1FX0A 2VXOA 3BXOA 4HAIA 3HDGA 1OWLA 3MPUA 4LHEA 5JZMA 1JI3A 4GPAA 1BRMA 4WCDA 1QYDA 1KZ4A 1JLKA 1ZO8A 1ST3A 1U2TA 4BP9A 1QUEA 1JFTA 1P33A 2C7BA 1NP7A 4JB0A 2ABWA 1V5FA 3M3HA 3M5DA 2GCOA 4R2LA 2FMIA 2P6UA 2GTHA 3KEGA 3LLVA 3NB0A 3P0JA 2YQ4A 1R6XA 4JOCA 2C5GA 4RGQA 1BFUA 2C29D 2GJ4A 3R7SA 3SOPA 5IM5A 4R8MA 2Y92A 4Q1DA 2P4HX 1A4RA 2OV6A 1P0PA 1W25A 3FBWA 2ZKIA 3MJRA 4HNSA 4QKQA 3KSBC 1GKLA 5DGCA 5E2IA 2V03A 1ORIA 2G9UA 1W29A 1TRKA 1VSTA 2D2IA 2IEZA 4II7A 4ASUD 2J45A 1YDHA 3N53A 2JASA 4BVKA 3GGGA 5B12A 3M89A 1RWPA 1TMKA 5K51A 1V3QE 1KPIA 4F8EA 4NE2A 4GKAA 4R8RA 3EUFA 5DEIA 2N0SA 3EOAI 4DDWA 1GAXA 1JHMA 5DP1A 4EYOA 2Q8PA 2GEJA 1PZNA 4AYTA 1PKEA 3QVGB 4MV6A 2AR7A 1IK6A 3L6OO 4UUPA 3HVRA 3DM5A 3ONDA 3EQ8A 1N3LA 3EN0A 2ZIEA 4KRGA 3RVQA 2WWWA 5FO0A 3WLOA 3Q8MA 2EAUA 2AK3A 1RJDA 3WY9A 1E7QA 1M33A 1U9IA 3D8TA 4IRMA 3FPCA 2JJ8A 3TL3A 3BIJA 2W43A 2OGUA 3B48A 3OAAA 1C7RA 4GLFA 2VBFA 1S2NA 2O3QA 4UHKA 4V02A 3PYMA 1M2VA 2VK8A 4Q47A 3STHA 2D1RA 4G1EB 4DSUA 3DVAA 4CM5A 5JEEA 1IBSA 4KQ9A 4ZVRA 4P8RA 4WESB 1CD5A 3QW4B 1XAGA 4C20A 3PIIA 3B9PA 2WIDA 1PD0A 4PZAA 5JCJA 1ZD2P 2GERA 4AMUA 3HYSA 1NQ5A 3SHVA 1IXYA 4PZZA 1A3CA 1P9NA 1TM2A 3AG5A 3PUXA 4NX2A 4Q7EA 2HA7A 1E0JA 3TL2A 1SCAA 4ZU6X 1K63A 2AX4A 5D85A 3URKA 1M2OB 2CYCA 3A14A 4M1EA 4HH1A 4A5OA 3NHSA 3FLMA 3S7ZA 4TKZA 3U7JA 4N54A 3JARA 1RP1A 3O9ZA 3PHCA 4LPKA 4U7TB 5DH9A 2PNJA 4Q4JB 5EXXA 3C5HA 2JBAB 1YS7A 1V47A 4NENA 4C07A 3NVDA 2C07A 3ORFA 3VU8A 2HLNA 4MVJD 3EFOB 4V0QA 1D2EA 3NU1A 3WSVA 1Y4DE 1LDBA 4R6XA 3FD8A 3EUWA 3QP9A 2QLLA 1UXIA 4K9OA 5D87A 5DRTA 5AJWA 4L9SA 1O2DA 3CR3C 4I19A 2DXIA 4QBKA 1OU4A 5ITVA 4N7BA 1J6UA 3QX9A 4S3MA 2CL5A 1FUEA 1DO8A 3MK31 1ZAKA 2HCFA 4NCBA 3OSUA 2P5YA 3L4EA 1I6KA 3PGVA 3NETA 5DU2A 3TJRA 4BWYA 4EB6A 2AOUA 2PAFA 4CMGA 3B82A 5F1YA 1MABB 3DMTC 2HRCA 4PLYA 4CQMB 5HE9A 1RP7A 1SVKA 3G2QA 2CNDA 4WAUA 3RRNA 1MFZA 2JCGA 2GM4A 4CCYA 1T6ZA 2V6JA 1BH6A 5HRCA 4CNQA 1GFIA 5KBYA 4MX8A 5DKFA 2FOIA 5E6RB 4XDZA 5L3RA 2KMLA 3ZE0B 2XCTB 3N2ZB 4MGZR 4MVJI 1R9JA 2YWCA 3H5OA 4HYTA 2XT9A 3IO5A 5SZHB 1XTVA 4I1VA 3KTAB 4CQNA 4JUFA 2ZU6A 1SC4A 5AXDA 3A1UA 5CA1B 1GYQA 1ND5A 3L8CA 5JMTA 1Q50A 5CDUA 3WISA 1ESMA 5JH7A 3QBJA 1ZJ5A 4ICIA 4L57A 2XGJA 2AV6A 2EYUA 3KKPA 3SGLA 4PX2A 4H3HB 1R4MB 2JFFA 2IT1A 1VB5A 3RYFA 1GZ4A 5K3SA 2HA6A 1DGQA 4FC7A 1U28A 1N9ZA 3A1FA 1C14A 2G9VA 5TJ9A 2HT1A 1TK9A 3BBPA 2IIPA 1BO6A 3G1WA 4FWIB 3RUFA 4BMYA 5I3ZA 1MRSA 1X7YA 2BI4A 1XZLA 2EJUA 1BCSA 1E9FA 1R4NB 3K0FB 3PQ2A 3FZEA 3CLKA 3HNOA 4UZEA 3ULKA 4CQJA 4ZZIA 1LRLA 4CCSA 3W34A 2ZPTX 4DMMA 4CPDA 3KSRA 2TSYB 1MR3F 4YMTA 3LGXA 4U00A 2WJHA 3E5MA 3J7TA 5DN6A 4WNAA 5KNLA 4Q1CA 4COOA 4K26A 4QT0A 5CH5A 1IN1A 4I55F 3GCGA 3ISJA 3TAXA 5FP0A 2P9CA 1YRQA 4D9MA 3OQNA 2EYQA 5ICSA 1VYVA 3K0KA 3H5IA 1PQYA 4IL5A 5HF5A 4EHDA 4NAHA 4N39A 5K3DA 4RM3A 1FLVA 1NLYA 2FK7A 2IFTA 4LX8A 2EDAA 3HB7A 3U48A 5AW6A 1JSLA 2X2OA 3MIZA 5ALIA 3HCEA 2W6IA 4WE3A 4J16C 4CI0B 1EBUA 2ZYVX 5JMWA 1V71A 5ECGC 4AYWA 3FE2A 5CU7A 1BVHA 5ELXA 3NVKI 1F2VA 2V6GA 5KTOA 1Q12A 5JS2A 4NBNA 3G49A 2B8EA 3OBBA 4ZOLF 4O33A 2IIBA 3SIPA 3GFRA 2NW6A 3JQAD 3T7TA 3Q9NA 5KINB 5DK4A 3DMHA 3TD9A 5C8YA 4KLAA 4I5FA 2HQ1A 1QIHA 3NIGB 1RRKA 5DT9A 2H2AA 3NTOA 1SKYE 3QOFA 1YR8A 3PE4A 1YIAA 4Y9UA 2RHBA 4BVFA 1V8ZA 1IOVA 2CV1A 2W6OA 2OWDA 1RXEA 2WABA 1J8MF 3LUJA 3UC5A 4J0HA 4KQXA 3TRKA 2QVZX 2X3FA 5HMMA 1DLIA 2DF8A 3T3MB 2OE2A 3G1UA 3IV6A 4CQLA 3KKQA 2H3HA 4IX9A 4KNVA 4US0R 4QX6A 1KQFA 1EUZA 4DJ5X 1MNAA 1GNLA 1JPJA 4HQLA 4O0MA 3U4IA 5C1BA 1XKQA 3PS9A 2I2AA 5I7FA 3H16A 2H1IA 4Q21A 1SCBA 5IP5A 1JHXA 2PJZA 1OUMA 2R5WA 2X15A 3U4QB 3GCXA 3VNAA 4W1SA 1B8OA 1B6SA 1O89A 3R41A 1E60A 5AW9A 2JGDB 4DJEC 2JVIA 2XD4A 1JG4A 3AUFA 3ELUA 4Y18A 5KYXA 3IALA 4GOKA 2HEGA 1E5LA 1DQNA 1BXZA 1ISGA 1FU8A 1VA5A 2RK3A 3RTBA 4OX9Y 5D01A 4DWVA 3LMKA 2HDOA 5AVTA 1WKCA 3K92A 4U2GA 1HE8B 2HHJA 4XEHA 4YXWD 3WP1B 2CSUA 9ATCA 3IUJA 1KBQA 4NHOA 1YFZA 3FZQA 2DBZA 4MDEA 3EPPA 2PZAA 5H5JA 4EW2A 4BNJA 3EXHB 4W1RA 3X1XA 4JS0A 4C1BA 2AXQA 2QLNA 2XYGA 4H1VA 2CUTA 4Q01A 1ZK0A 4E4YA 2A58A 5KUTA 1Y1LA 2XF2A 4JT4A 5BRJA 2YXBA 3JYLA 2QR2A 4KVFA 5K20A 2A6PA 3REQB 1RPNA 3FGNA 5HM6A 1P4RA 4JGIA 3NKLA 4A8JA 2BPOA 4CZ2A 4N12A 4F4HA 5JQGA 3GUVA 2BDEA 4IYJA 4YDSA 2AA3A 2EX0A 4R8VA 1QRUA 2VYND 1C2TA 2DBVO 3HN6A 2C57A 4XVCA 1HG1A 3WQSB 1SBTA 2X0DA 3BB4A 2BISA 1QGDA 2BEWB 4JENA 2DEUA 4F72A 2JFOA 4A91A 5MDHA 3K1ZA 2A0WA 2QW1A 1G20A 5CLQA 1OX6A 3SEAA 1CUAA 2CJYA 3ZN2A 5K45A 2P2NA 1DUSA 4E21A 3V8PA 2BKEA 4EIWA 5E9AA 2AN3A 3U37A 2R6DA 3EVGA 1Z6XA 2ACKA 2WEKA 2Z3WA 3RHFA 2VS1A 3M1IA 4Q3BA 3LW7A 2QX7A 1IY1A 1IHYA 2FPWA 2IRWA 3SSMA 5JADA 2BGIA 5AM3A 1X92A 4NBTA 1JEYB 1OI2A 4RVOA 2LKCA 5DBFA 1ZI9A 3AOGA 3EF1A 4O2AF 2RE8A 2E3JA 3CG0A 2RBEA 3COWA 2AUMA 4MUEA 4EKDA 4EY4A 1WHTB 1H66A 1NJ8A 4HNGA 1A9ZA 4O6VA 3VHRA 2QGZA 1UZAA 2X0KA 3PNYA 4IH9A 4IIJA 4E7PA 5ALQA 1J2TA 4K28A 1LPAB 5EKXA 4F3KA 1OGIA 2X14A 1U02A 3H13A 2H4FA 3B1JA 1CRQA 1TW2A 1XCMA 2AR9A 2QRMA 5F5LA 5JJ5A 2CFSA 4Q4HB 3EBLA 5J1SB 4X9XA 3AEQA 4MAAA 2NO7A 3DDWA 3D3QA 5GJWC 5EXEA 1AE1A 3HEMA 4JZYA 3KVNA 4X7RA 1OYWA 2BP7A 1YCHA 4I99A 4F9TA 2YL2A 3RB8A 1EB8A 3BXFA 2WFZA 1T2VA 2FPOA 3V8RA 1SY7A 1A77A 1LNQA 2X8BA 3GMIA 3BWCA 2EP7A 2C3UA 2XLCA 4GP9A 3I8SA 4MS1A 4R41A 2PMBA 1OLSB 4UD6A 3A3NA 4WZBA 3V1NA 3LCJA 1V8FA 5CM9C 5JAZA 4RMGA 4IKEA 1PNQA 5LUAA 1Y8CA 3NI2A 3V3TA 4ER5A 2GQ0A 4CM1A 1JW9B 4TLDA 4V38A 3O82A 4UM9D 2D2VA 2O2SA 2Q50A 4I66A 1CY0A 4M87A 2V74B 5DNEA 4DDKA 2OCYC 2ZZKA 2PL5A 3DMTA 2QVLA 1L7PA 3OKCA 3IURA 1QQBA 2Q3JA 1BE1A 4LZNA 3TPFA 4BO0A 3JQAB 2QTCA 4RD0A 2QQEA 2I67A 3KELA 5EGNA 3E2IA 2DHDA 1FE8A 5CVUA 3SP1A 1GLVA 3WHPA 1S2IA 3Q72A 1XTQA 4H59A 3B5EA 4YQYA 4C3ZA 3SR4A 4YIKA 2OFFA 3BXPA 4G41A 4O4JB 2IV3A 1NYTA 2QN6A 1E20A 3ZWOA 3ZY4A 5CFOA 3AR3A 3FHJA 2NVWA 2GJSA 4LCJA 1MJGM 1FDUA 1RI4A 5GGYA 3TVDA 1H1TA 4GAEA 3DZJA 2JJMA 9MHTA 3K53A 5HCUA 2WJWA 3E48A 4H6XA 3RFVA 1I1OA 2DX7A 1XHFA 4EA6A 2H51A 5DWDA 1DTSA 3FWNA 2L0XA 2FWBA 3WK4A 2J7PA 3QK7A 4YV7A 3I01A 1IAQA 1O6FA 5T67A 4LQCA 4CMHA 1OX4B 2GAIA 5ENVA 2QV0A 5JG7A 3NHKA 3QPWA 1XCOA 3OZUA 4YC7A 5CD9A 1I9GA 5GINE 4NEQA 3BJEA 1HBJA 4G3XA 3NHRA 4UREA 7MDHA 1EUQA 3DAFA 4Q03A 4GPZA 1CWUA 3LRXA 1PS0A 3O2QB 3BTSA 4HEJA 4ND7A 4ALKA 2AG1A 5BN1A 3AKZA 2F55A 1GARA 2JC3A 3OOYA 5BT8A 2A92A 2F8LA 4LHZA 4OHFA 4X45A 1KSFX 2BFOA 2BSAA 1SFRA 2JGAA 2HXSA 2Y77A 5EPUA 3CGWA 3AFGA 2QRKA 2WM8A 3C5WP 3M6LA 4P3NA 2NAPA 3H18A 1JFFA 2PX4A 3WG9A 1T9DA 3HE3A 4WXRA 4AF6A 2ODAA 2CY0A 3W9BA 5BSHA 2WWRA 4NXMB 3DEYX 3BYZA 1E3JA 4X8OA 4ZV7A 3L8GA 3QU2A 5TDHA 3DCYA 1R0CA 4J16A 1UMDA 3HCRA 3UV7A 2PUFA 3CTMA 3CPEA 3REFA 1OR8A 2Z43A 3ENKA 5UKDA 3K1AB 2YHAA 4EHJA 3CRVA 5EJGA 1X15A 5HSGA 3VM6A 3E9DA 5IRCD 4OJTA 1T35A 2GDZA 2ZWAA 3ENWA 1NNI1 4E2XA 5JECA 2PMKA 3CH7A 3CRQA 4UHCA 3ZD6A 3C3JA 5J40A 5SZIA 1P91A 4MLPA 1O97C 5WRFA 4TL9A 1UFVA 1P2VA 1DOHA 1KIMA 4AKSA 3AI2A 3W5AA 3HU3A 2OLEA 3N8KA 2A9JA 4BWGA 1SB9A 2QUZA 5AIAA 1XDGA 3AJAA 3AJ9A 3WJ2A 3B53X 3FFWA 2ARKA 1OZGA 3CB4A 1JLLB 2C82A 4KW7A 4BRSA 5HJEA 4GSKA 5KJ1A 1F2UA 1OIVA 1CBUA 4GL4A 2GKOA 5CW2A 1Q0SA 2NLOA 1U3CA 3LQ4A 3P9RA 2YQ5A 4G2NA 1KI9A 4OBBA 1KFKB 1P80A 2Y2UA 1GNRA 1QPBA 4TVKA 4BU0A 3QNUA 2YXLA 3HBJA 2GGSA 3O4JA 4ZRDA 4G36A 1WBBA 3K05A 3P0HA 5I7VA 1OXKB 2CLSA 4PGGA 2ID4A 5BWCA 1PNRA 4NOJA 1Y1TA 3IKTA 4NP6A 2JGRA 4Q34A 5FI0B 4V03A 4BDTA 1Q2XA 4WD3A 4DARA 5IC4A 3TZHA 1U04A 5DEOA 1N57A 3DQZA 1I94B 2OCPA 2X3YA 3PYXA 4F4DA 3CRRA 4F84A 3QYFA 5DIFA 1EH5A 1KZ1A 1P1HA 4PGAA 3JQRA 3E8MA 2P7HA 4C01A 1KR2A 4DXAA 1NVMB 5KQPA 5LQNA 1QP7A 3GGOA 2OM2A 3WGJA 5EYPB 1OLUB 4RFLA 1ODSA 5KDOA 4J90A 4JBNA 3HV2A 1T36A 1Y7TA 3U56A 1XTKA 1SQGA 3OIYA 3BILA 1ZRNA 4PLVA 4IHQA 4ITUA 3RRJA 4UBIA 4AW9A 1M1ZA 4LJRA 2FB9A 2WSYB 3FDXA 1T2AA 3KUXA 3LQKA 2ZUDA 2E1PA 2KSQA 4GOOD 1GDHA 5CGZA 2C4KA 3AEUB 4BGDA 5TNXA 4UM9B 2DLCX 3PYLA 3H8VA 1PZEA 4JJ6A 3VR6D 3AR6A 2VTVA 4CMAA 4M9UA 4PNEA 2ALJA 1RVDA 2CUNA 2J41A 4P4NA 3OJLA 1OW3B 3ZD8A 1XPUA 1P81A 1CB0A 3O94A 1I4TD 1J9ZA 4K88A 1G5IA 1GXSA 1DB3A 5KYGA 4P83A 2W4MA 4TPKA 3UUFA 2X8JB 5DMHA 1JSCA 3SIRA 3T9FA 4K0KB 2IS1A 1FRZA 3LZ6A 4GYKA 5MFZA 4MTLA 1NV8A 4ZDIA 4R31A 4ECEA 3THYB 1GG5A 2WK1A 2Y1CA 2WY2D 3RSSA 2VCEA 4E32A 2IUSA 3JYOA 3P71T 3MVEA 2UZ0A 1F48A 2XBMA 3OQ6A 4G23A 1Z4JA 1KZHA 1VIYA 4Z4CA 2FGKA 4GP6A 1M6EX 2C2OA 4YUXA 4F91B 2PX0A 4J6EA 3SIWA 3DH0A 1TA0A 1UP4A 1KNQA 1AQ6A 1KU6A 1TTHA 2GN2A 3D59A 1FPQA 3HC7A 2IYAA 3PFHA 4II3A 4L4UA 4ROSA 3N0WA 1N3YA 2JK1A 5BYKA 3EMVA 4I4CA 4E5KA 5IJWA 1QP0A 4HNQA 3KZMA 2Q49A 4MRPA 5CXUA 4IDCA 4J7AA 5C4MA 4FFDA 1Q1ZA 4QUKA 3GH3A 4KACA 3WX0A 2D59A 1TUBB 1TKRA 4AY3A 3FWHA 3NIBA 1U3DA 1OFHA 4HH3C 4C7KA 4ETIA 4FFPA 4N8SA 4WX2B 5KSOA 4D8YA 3NWEA 5GV8A 1JJIA 8ABPA 3MMSA 1M0TA 1N7JA 2G6TA 1IQ0A 3H4VA 4JIMA 5IDQA 2DFPA 3ZS9A 3FYSA 4QUBA 1DFIA 2DSNA 1OVMA 2RI6A 2XTAA 3AT1A 3GJTA 3MUOA 4C3OB 3ZBPA 3HWSA 5KNCD 2BR5A 1SBNE 2DHEA 2Q3DA 1T3TA 4ACBA 1B76A 2AFHA 3IV7A 1L0BA 3ESXA 2ZTHA 4TTQA 3CB2A 5KMGB 1IZ9A 4ABYA 5BQFA 3AINA 2IEDA 4X91A 2D3TA 2VHZA 3REOA 2Z2JA 4JOBA 4Y6PA 1AO3A 1GGKA 4PANA 3CCCA 5DJ5A 4B5KA 3ETJA 5JAMA 3BC1A 4EL0A 1XDSA 2ZETA 2DFVA 3D6AA 3EMBA 4RDHA 2WR8A 2MCFA 4AJ9A 4PG4A 3P9XA 4WBXC 3U19A 5CA0F 2C2KA 3PFIA 1E69A 2B7CA 4AJHA 2F59A 4MA0A 4QNRA 2EFHB 5JCPA 3FNEA 4RVNA 3QELA 2UUCB 3X1YA 2A0XA 3DD5A 3E82A 2F1IA 3G13A 5K6AA 1H22A 2I87A 3A2KA 2C97A 3NYQA 1NBAA 3L7JA 4QYMA 4ERXA 2EEPA 3N2YA 1K68A 1QCDA 1IAVA 3TGPA 4C43A 5LQMA 3GB9A 4UXJA 4YCDA 1TU4A 4OJKA 1BGWA 1BDMA 3OX1A 3ZJYA 1D7OA 1WCIA 3HB1A 1XTUA 2RAFA 2ZBDA 4DIOA 1HEIA 2FRVA 3KOOA 2CE2X 4K05A 1BX1A 1KKLA 3SHQA 3S8MA 1CRWG 1PYOA 5G4KA 1Y3FE 7ADHA 2ZJ2A 3JSXA 3ILHA 5FFMA 3EGXA 1WDLA 2VTBA 1MRZA 2YRXA 3OD5A 3V46A 5KJEA 1WQ1R 3C1OA 3AKDA 3O8QB 3MBIA 1ISIA 5DGIA 1VKOA 3L18A 1BE6A 1M74A 2GETA 1CR4A 2NXCA 2ISCA 3A4LA 3CLRD 1KNXA 3OO1A 4H15A 4OHWA 4CM9A 1W36D 1XRJA 4MXDA 1UZUA 1LPPA 5G4LA 1RLMA 3RBAA 2P9TA 4NECA 1NVBA 2JFZA 5EFOA 3KB2A 1C3VA 1GRVA 2FF5A 4JUCA 4F7DA 5L3SA 3TBKA 2GPWA 2LPMA 1YJCA 5IXYA 1XPRA 1TM4E 2WNSA 3QHQA 4CRWB 2WIGA 4G81A 1WETA 5BN4B 1ULZA 4OGKA 1PR4A 4QQKA 1J22A 4PG7A 4QG3A 1Q91A 4JLUA 5AJXA 5I9NA 1PNTA 4W5TA 1RYNA 1YVUA 4KQCA 2Y1LA 3HB9A 1M0SA 3OE5A 4X3OA 4ZN6A 1HDCA 3AWIA 4H6PA 3LXUX 4I9FA 1A9RA 1XZBA 1FYVA 3MFYA 3CNNA 5DNUA 1N5IA 1W88A 1GPAA 2O2GA 1T5LA 3Q8XB 3VYWA 2JH9A 1MEEA 3I0ZA 4JP8A 4WERA 4IMIB 1WHSA 1AS0A 3BFPA 3K35A 3M70A 3OPQA 1XDZA 4LGVA 1SOUA 2JCYA 4ZQIA 1FXUA 4I3HA 1POWA 4XRGA 4MVJG 2PD3A 5DTEA 3VR1A 1AS3A 4I6GA 4Q4LA 1N2EA 3LKBA 4L8FA 4B76A 2EHDA 3OX4A 1WF6A 4O8CA 1U7DA 3BVPA 5AUQA 3A1DA 1PFWA 1YMUA 3T7EA 4AUKA 1ZD8A 2NO4A 1QHGA 4MYRA 3F73A 1O58A 3QKSB 3ZJVA 1Y3AA 2AE2A 2EG9A 3NOQA 3S27A 2JJYA 1E0KA 3TM4A 1YQQA 4C0AC 1X7ZA 2JCVA 2PWBA 1EM6A 1TVKA 3AIMA 3NT5A 2QP3A 2GHTA 3Q7PA 5JDIC 1COWA 4I1YA 3O6VA 3KT6A 3CJQA 3ZDCA 1TIBA 1PK7A 2PUHA 3ENNA 4RZSA 1YR7A 5JSKA 1ORVA 2YCLA 4HJXA 5EE1A 3L4JA 1WUIS 2Q3FA 5FOTA 1PZHA 3WI7A 1YZNA 3HLTA 3PXEA 4LVCA 1FDVA 1X1BA 3UMGA 4D45A 4UJ5A 3CT6A 3BCRA 4O2RA 1YDWA 4UAVA 1SQ6A 4UPDA 2O2ZA 1TEHA 3EZ6A 2JZOA 1UODA 2ZRLA 4N5MA 1VIVA 5C34B 4L5JA 1PK8A 1IL0A 2CHQA 2HK7A 1L5MA 2Q3CA 3HSKA 2H7CA 3TIIA 3LW8A 1NDHA 5CDFE 4HDSA 1MF7A 1A4XA 1RKQA 121PA 1QYWA 3DYVA 4AJLA 2QF7A 3D9QX 5KKNB 3VHXB 3BCSA 2ZROA 4QU0A 1XTRA 3DKPA 2ZSAA 1CY1A 1OTXA 1WXWA 5SYAA 2EKZA 4B3CA 2VSQA 2ZJ7A 3KP1A 3LNTA 1E3LA 4D46A 1Y5NA 1YQEA 5T64A 4DM7A 4WZAE 3ZGNA 1P0MA 2UXCB 3AQ4A 1PZMA 3V2IA 2IYRA 2XZOA 1OC4A 2VDQB 4Z5XA 3TOZA 5IX8A 2QX6A 1TMGE 3EB9A 1VXOA 1ICIA 3G9QA 3M49A 3DZIA 2H17A 1MJ5A 3PGKA 1OIWA 2RK4A 4LISA 4N8DA 2EJTA 4OM7A 4RKWA 5EWLB 3E3NA 1KH3A 3NANA 4RPIA 3K6RA 2MOKA 2BOVA 1MTOA 2MINB 2QE7A 4L5YA 3ASZA 4G09A 3WGLA 3IC5A 3G79A 1I6LA 5ITZB 3VA7A 3RYIB 3EIQA 1FJHA 1EBFA 2ZBEA 3BJIC 4N9QA 3COZA 5B4VA 1QHFA 3TTUA 4B40A 1F06A 1Z47A 1Y8QB 2I33A 3GLUA 4MYSA 2HBYA 2OORC 2PRKA 3W4IA 2ZRPA 2P79A 4PPNA 4PLHA 3GMTA 2WM2A 2P6OA 1R66A 1TK2A 3LOUA 2CLLB 3HVKA 2HCTA 3HUFA 2HZ7A 1FTQA 3FOBA 4KZPA 1FFAA 2QAGC 1DDGA 4FCWA 1V7QA 4U9HS 4KITB 3MCTA 1A2BA 1Y9AA 2XE4A 2WM9B 2R6GA 3QVUA 4X8MA 2OCLA 5BUZA 1DEHA 3QV2A 3K0AB 3SZRA 1AQJA 1MV5A 1R4AA 5EP3A 5EUCA 2R97A 1I1QB 1CUWA 4J1QA 3DS8A 4H6VA 3FSGA 1TI7A 4OK3A 3U9SA 3UUWA 4Q6BA 3LTEA 3GJ8A 4BZPA 2LZ0A 3DG9A 2XXAA 2YS6A 3WADA 4PC6A 1D2MA 3HWRA 1ZN9A 4BLSA 1WDMA 1ZLYA 3ID6C 1NQWA 1ZI8A 1KEPA 3NNNA 5D1NA 2G80A 3LP5A 2GPSA 3BGWA 4LZPA 3HU5A 3ZIAD 1W36B 1Q7TA 1MEOA 2GA8A 1AU9A 4FFNA 4CR8A 4D8VA 4UHHA 3OF3A 4ND5A 5B6PA 1P18A 4I1IA 4FILA 4G9GA 3RBZA 5AHWA 1X9GA 3LWDA 2JIPA 5DSTA 2WWVD 2I55A 2RMKA 5K8IA 2CXPA 1A2OA 5PGMA 2HREA 4EYKA 5CT5A 1FTGA 2BMVA 4PZYA 1XEWY 2J6HA 4G5OA 5A03A 5BR8B 2GF9A 2PKCA 2CL6X 2C88A 4BQRA 2ZXEA 1KJ8A 3FWZA 4YRTA 5BNIA 1Y8AA 4F1KA 3CJRA 2DPYA