4ZVRA

Caspase-7 variant 4 (v4) with reprogrammed substrate specificity due to y230v/w232y/s234v/q276d substitutions bound to devd inhibitor.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
139
structure length
139
Chain Sequence
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
total genus 49
structure length 139
sequence length 139
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zvrA00
2AR9A 4NBNA 1RE1A 3UO8B 5IBCA 4ZVOA 1KMCA 4QULA 1PYOA 4JB8A 4HVAA 5IC6A 4NOKA 2QL9A 4JJEA 4NBKA 3K7EA 3V4OA 1BMQA 2H51A 2H5IA 4JR2A 4PS0A 4QUHA 4ZVSA 1CP3A 2J33A 1RWXA 4N6GA 3UOAB 2HBQA 3H13A 2C2ZA 3EDRA 2QLBA 3IBFA 3H1PA 4QUDA 2HBRA 4JR0A 5JFTA 2XYHA 4ZVTA 4DCPA 3DEKA 4N7MA 3R7BA 4QTYA 1NMQA 1RHJA 4JR1A 1SHLA 4EHKA 3R5JA 1CVRA 4FGUA 4AWBA 5IABA 3D6FA 3D6MA 1K88A 2H54A 4HQRA 4N5DA 4N6OA 2CDRA 3H11B 4NOJA 2NN3C 4IEFB 2C2MA 3P4UA 3PD1A 1NMEA 4D3YA 2H4YA 3NKFA 2K7ZA 3E4CA 4N6NA 1RHUA 1I4EB 3SIPA 3H0EA 2J31A 4FXOA 4NBLA 4ZVQA 5IAEA 3V4LA 1QX3A 3NS7A 4EHDA 5LUAA 3SIRA 5IARA 3DEIA 1NW9B 2XZTA 4LSZA 4PS1A 4AW9A 5IBPA 3ITNA 2CNKA 4QUAA 1K86A 1NMSA 2XZDA 4I1RA 1QDUA 3QNWA 2QLFA 1RWKA 4EHLA 1RWOA 3GJSA 2QL7A 4IYRA 4QUEA 3V55A 3V3KA 3R6GA 3S70A 2HBZA 1PAUA 2C2KA 4QUGA 2DKOA 3GJTA 3R5KA 4NOLA 2CJYA 2WDPA 2H4WA 2FP3A 4QU5A 4FDLA 1GFWA 5IC4A 4ZVRA 4DCJA 3GJRA 4I1PA 1RWMA 3R6LA 4D3XA 4QUJA 3OD5A 3P45A 4EHFA 1I3OA 1ICEA 5K20A 4QU8A 4ZVUA 4DCOA 1RHMA 5LUBA 4AWAA 5I9TA 5IANA 1SC1A 1RWPA 1RWVA 3KJNA 2QL5A 4NOMA 1JXQA 2XYPA 3R7NA 1RHQA 3PCXA 5IAJA 5LU9A 1SC4A 5H0IA 2Y0BA 3NR2A 4EHHA 1RWWA 3H11A 4QTXA 4M9RA 5IBRA 4QU0A 2QLJA 4FEAA 4JQZA 3D6HA 2CNOA 4QUIA 2Y1LA 5LU8A 3S8EA 2CNNA 4N7JA 1RWNA 2CNLA 4PRZA 5IAGA 3KJQA 1F1JA 4QU9A 2C1EA 4QUBA 3V6MA 2H48A 4EHNA 1RHRA 1SHJA 2C2OA 1IBCA 4EHAA 2J32A 5I9BA 3KJFA 2XYGA 2HBYA 4ZVPA 2FQQA 3BIJA 3V6LA 1RHKA 4JJ8A 1I51A 4D3ZA 3GJQA 3PD0A 5IAKA 2FUNB 1M72A 2P2CA 2H5JA 4HQ0A 3RJMA 3DEJA 1QTNA 2CJXA 2J30A 4JJ7A 3DEHA 3EDQA 4JQYA 4PRYA 2H65A 1F9EA 3R7SA 5IASA 1SC3A 4EJFA 1I4OA 1GQFA 3IBCA
chains in the Genus database with same CATH superfamily
5JSZA 4CLOB 2H8KA 2Z6AA 2WFZA 3NALA 5JYCA 1IXRC 1T35A 2B6NA 5JQGA 4QJ5A 4MKHA 3DB2A 5I8PA 3UXMA 2B21A 3BD8A 3ZCPA 5H5JA 2YC4C 3K7EA 3QJGA 5ALFA 4JU9A 4M6WB 2CE2X 3VH1A 5CMLA 5C5IA 5IVKA 3LGXA 4ETNA 5IFLA 2O8EA 2FMIA 4J7CA 3PHBE 1W2WB 1U65A 2WKPA 4WKNA 1OIWA 3RYIB 2O8CB 2R751 4MH0R 3BT7A 3ZE7A 4DQDA 3LL7A 1KH3A 1RXWA 2ZJ8A 3GHYA 2OPBA 1LZLA 3QBJA 1NVAA 4GX0A 6YASA 1B23P 5TF4A 3Q8KA 1YCDA 3QFSA 3IP6A 4LY6A 4C0JA 3FDJA 4GPBA 3SLGA 3HKBB 4OSOA 1LLQA 2V3VA 2BGWA 1OIVA 1G8MA 2IZ1A 3OH8A 3ASVA 5JO9A 3TKYA 4BNDA 1G2PA 3WV4A 2FEOA 2JIQA 3I8XA 4RY2A 5EHQA 2RAPA 4TTVA 2SCUA 3DMYA 3OE1A 4BEBA 3N7UA 3FFAA 1GTVA 1QFXA 2NN3C 5FWXA 1JLMA 3HY6A 1C7FA 4LZOA 3L1IA 3G6WA 2O50A 4J91A 3QVGB 1K2VN 4Z0TA 1G8AA 4AF7A 2QSJA 3E4DA 4URFA 4BRWA 4C0XA 1FFXB 1FY2A 2YVAA 4PW0A 3ZHYA 3T52A 4EMTA 1T5IA 1K7SN 5J4LA 4ARZB 4I4TF 2XMZA 1WDWB 3PA8A 4J1QA 4Q7KA 4EG8A 4MYUA 1S8NA 2D7CA 1JFRA 4Q9AA 5EUQB 2P9QA 2ROQA 2JK1A 3RVMA 4QARA 3EISA 5GZ1A 4WZBE 2WJ6A 4KFUA 3M7IA 4X1IB 1XN1A 3MLBA 1JJIA 2PU5A 1DEAA 2VRCA 3FVRA 5IJAA 1CRZA 2EFGA 2C9YA 2ZJ0A 3WLFA 4DNPA 3ZH2A 2JLVA 1X7ZA 1RRPA 4QU5A 1QQBA 1GFWA 3N5CA 4I5FA 4Q34A 4BGVA 3MBOA 3EXEB 5BOVA 2HLPA 4TTPA 4HQKA 5C4GB 1Y8ZA 2R47A 4QDXA 4CR8A 3U6BA 4ZYVA 4LE2A 1Q7BA 4N4AA 1HA3A 1OAOC 4YAKA 4TVBA 1A9XB 2O3JA 2ON6A 2DUMA 2FXIA 3CFYA 2VPPA 2DJIA 1SC1A 2HIGA 3QITA 4DYHA 4F56A 3A58B 4I08A 4OO3A 3PQEA 3PDJA 1E1RD 2C7VA 4LF6B 3AP1A 1E89A 5LDGA 4X9XA 4C29A 2FZ5A 2OAQ1 3FLAA 4JZYA 3RHTA 1S3FA 3IULA 1NHGA 1T5DX 3MGKA 4EUEA 3WICA 3PC8A 2BLNA 3MOIA 1EVIA 3EF0A 4LZPA 3F4KA 4JI4B 3D1LA 2C4TA 4X95A 3OZ7A 1YIOA 2XDQB 4DV1B 2WJVA 1XDGA 3OEWA 1H93A 2AJDA 4FGLA 1J6UA 4IFBA 2SKCA 6CHYA 1A2QA 4KXLA 4AY5A 2JEYA 2AV6A 1AKWA 2QMHA 5B12A 3MB5A 1RT9A 3TZ6A 3SE7A 4PZPA 1DUSA 2XYQA 3REFA 3QVMA 3OKPA 4UE2A 1HI9A 4N3BA 4EHNA 1UQTA 5EWMB 4E4TA 2VQFB 2YWDA 5FR2A 1DJMA 4G01B 2UXBB 4ZZ0A 5HS4A 3BILA 4I0WB 4E12A 2F90A 2G09A 4FGZA 3AILA 1DWPA 2RCNA 4HNSA 3S3TA 2VWPA 1GAQA 2NT4A 2R6GA 1GJRA 3CURA 1AZSC 5KYXA 4JLBA 5HPYB 1OAKA 3ANNA 1XRMA 3MIZA 4C0AC 1EWQA 5AKKA 1DQPA 1R4MA 1XTUA 2LPMA 4FFWA 5HFNA 4EW2A 1MO6A 3MGAA 2CLHB 3VC7A 2GZ1A 5BMVB 2VK8A 1SBCA 3OQPA 3AG6A 3FOCA 4GIBA 1W29A 2F8LA 2QL9A 4W82A 3EH2A 4MRSA 3RLIA 1HT0A 3FE2A 3BK1A 3FIJA 3BTOA 1J07A 1FUIA 1QFMA 2CWDA 1RM0A 1MQ9A 5GIOE 2HMAA 3SC2B 3K73O 1JLLA 1SAYA 4Q9JA 1BE1A 2I67A 2V03A 2CVZA 2W2KA 2G76A 3C8DA 5CDSA 3GLGA 4NV3A 3D7RA 3L5KA 3WNQA 2V6JA 1EVQA 2XDQA 1H1LA 3DT8A 4TWBA 3GRPA 2WTBA 2WKWA 3OJOA 2R1VB 3VZQA 4CKXA 3IKMB 4Q1EA 4DMUB 2O2DA 1SHTX 3FB1A 1CB0A 3GMTA 3TRIA 4BWYA 4PNEA 1EP3B 1CUVA 2IE0A 4MW4A 4ZMBA 3UUWA 4ONEA 4X3PA 3LRPA 1O8BA 1B00A 2HA4A 1C9DB 5KTRA 2QRVB 4BXOB 1AG9A 3MJDA 2QP3A 4HBZA 3ULKA 4EYQA 2PAAA 4KIJA 4OX9Y 4MEAA 4AMBA 1VZ3A 2ZSJA 3OHSX 4A8TA 3GD5A 4XIFA 3SHFA 1DB3A 2X3FA 2GZRA 2XYVA 3NAMA 3OIGA 2G9ZA 3OZIA 3PXUA 4QBFA 3GAZA 4XPIB 3A6ZA 5SZIA 3TVYA 3E2MA 1IJFA 3OFND 4QHYA 5FIUA 3R74A 4E5UA 1XZMA 4Z3KA 2CV2A 4OIMA 5MFZA 5HF8A 2YH2A 2D2FA 2NQ8A 2OHJA 1U31A 1BRMA 3WLMA 2N42A 3FF4A 1OJLA 3L1UA 1NVBA 3ZUGA 4EOGA 4QU8A 4TV8F 4JSRA 4CG3A 1C0PA 1VGQA 3CU5A 4TLLB 5B7QA 2WHEA 4LKRA 4BO2A 4CLRA 2GH1A 1JHAA 2GAAA 3QOXA 2X0FA 3W4JA 1XZLA 2FW1A 1Q7GA 1HURA 5KMGB 1NPDA 1GUZA 4MO2A 3CX6A 3O4FA 4HAVA 3S2YA 1ZD3A 3T61A 3W2HA 3WWZA 1RLUA 2VF4X 4F4CA 1NNEA 2N3ZA 2OO5C 1QZZA 3RSCA 4CEJA 1WW3A 2YHIB 1IXSB 3DE2X 4RTRA 3JQRA 3PWKA 4S1OA 3SZ3A 2ARKA 4IIJB 2QRKA 3A2KA 5AOVA 4Z49A 2CUTA 5L53A 4QOJA 3GVHA 4KXFB 2HREA 2VT7A 4NS4A 3RFFA 4DV2B 2XADA 1KYXA 4L4UA 3IODA 3IL2A 2JFPA 3DL2A 3F6SA 1ZHOA 2FSSA 5B1DA 4EPVA 1N4DA 3NOQA 3ZDAA 5JAUA 2BIFA 1M0WA 2FCAA 2VP4A 2CHQA 3C6QA 3OO1A 3X1KA 3A3OA 2J48A 4ENPA 4XX1A 3X1YA 2QN2A 1SIWA 2VAVA 1MV8A 2HUPA 4C5BA 3DEHA 1EE2A 5AW1A 1DP4A 5IASA 2ZSEA 2P7IA 4FDTA 4K3VA 1MB4A 4HPJB 3JCZA 2YFHA 3MBKA 3P94A 5K45A 3MB8A 4ND8A 3K53A 3AERB 2X5OA 3H05A 3UUGA 4EGAA 4MUKA 2P2GA 3A6PC 3UYLA 3PDCA 3FMOB 4BKMA 1Z0FA 3FNHA 1UFKA 3I0ZA 1GUFA 4FFPA 2JLCA 2Q2WA 3PWZA 4MTLA 1L4YA 1RAHA 2AFHB 1G21B 1Q2XA 3QX7A 4BCCA 1RZUA 2F6RA 3G1TA 2MT9A 3MWGA 3ZWYA 5KQLA 4C0SA 2J0UB 2QYOA 1DQYA 4LRTB 3ZK9A 1I30A 1B73A 3OY7A 4NJMB 1U1EA 2X4LA 4MMYB 1QE0A 1QMGA 4I55A 4U8HA 4XASA 2FPLA 1EG7A 4LGVA 1UBNA 4RHTA 1JDUA 1FX0B 1JG1A 3ANLA 4XGNA 4LE0A 4PIVA 1D2MA 2JZNA 3SSAA 4HH0A 4ZCQA 3RFXA 2OBNA 4E14A 1KAEA 4QYWA 1AN9A 1W1IA 3A1VA 1V1RA 3VMMA 4G63A 2YV3A 4LJ7A 4BX9A 2PUWA 4AJJA 1L4GA 1DO8A 4Q37A 2AMVA 4ABYA 3BMQB 1YJBA 1DOHA 5G4KB 4D3SA 2VDUE 4A4DA 3RTAA 5ESXA 1FMTA 1HDEA 1P74A 3UV6A 3W8FA 1ZI9A 4AQDA 2AHOA 3NS7A 3QOYA 4LZNA 4Q7EA 4ZO9A 4UHKA 1GCUA 1UL1X 4JI0B 1KFCB 3HB0A 5EMHA 1JFVA 4BWGA 4TROA 3N6RA 5HVNA 2YY6A 1KI6A 3T7RA 2P2YA 1N2JA 3G17A 4G23A 4WADA 2AI2A 2AXEA 2JASA 5IUKC 5AI9A 4ZOLB 7AT1A 5IZCC 3EGDB 1WR8A 4CODB 3FR8A 4IDHA 2JJ1A 4ECEA 3K8OE 5BUCA 1OV6A 3BL6A 3KOOA 2FQ1A 1ODFA 3H8JA 3LP5A 2C5AA 3PYLA 4FS8A 3QY0A 2ZTMA 2M6LA 2O52A 5D5HA 4U7JA 2VK4A 3GN1A 2IOQA 3EZFA 2JGKA 2JFVA 4D3XA 2Y9PB 2UZIR 1DDGA 3GK3A 3QYPA 3S6JA 3UAZA 1R9MA 2EJVA 1FRZA 5I3ZA 2UYYA 2VJMA 3E3MA 5EP4A 1QCCA 3ZE6A 3AEKB 4HR7A 3HCPA 2AEMA 2CXXA 3OCCA 4PSUA 5KCMA 2PZKA 2YDYA 4B6EA 5M5BA 3C3XA 1JU9A 2FA9A 2D5IA 3LKZA 3KELA 3GRCA 5LLSA 4BNVA 5JVDF 1DC3A 1DJLA 4HRYA 4FIDA 4LWZA 1SC4A 1MD9A 4H3KB 4MTCA 3L0IB 1CE8A 3H2ZA 4H1HA 2BHTA 2WWYA 1N5JA 1RLIA 6PFKA 5FWYA 2PR2A 4FX5A 1NTRA 3N2IA 1VMKA 2QSUA 4TS4A 4YMWA 5TS2A 3TNDA 4IICA 3UHFA 4CQMB 1ESZA 5HGXA 3S8EA 2NZ8A 1AVTA 3RARA 4YRNA 5KUTA 5AO9A 2NACA 1H0SA 1YV9A 3UY4A 2AUNA 1Z15A 4RMNA 5HM8A 1K27A 1GTG1 2DF8A 2GO1A 2AFIA 1WEKA 3BFJA 2NU7B 3SIWA 1IUPA 4OQEA 1P0FA 4KUEA 3LPNA 1V2HE 1QVRA 1CPYA 2H4JA 1KQNA 1TQDA 2OV2A 4U2EA 3KR1A 2O59A 1W5FA 2QY9A 3H9EO 5KTNA 4L73A 1NLZA 3T9FA 1CS4C 3BBLA 5B3AA 5F7XA 3MAAC 3PE3A 3TIFA 5CNMA 4LXXA 5ABPA 1YBFA 3PQFA 1AOXA 1H0RA 2WUVA 2PWPA 4QVIA 4G0OA 5CK4A 1NG1A 2AE1A 1I4OA 2AYZA 2B34A 2QN8A 4Q9DA 3UF0A 5C7OO 2CD9A 1ABFA 1RLMA 1U3VA 1E0DA 3ZHQA 2CBZA 3RWBA 3HG7A 2EIHA 3IDFA 4NBKA 2PH5A 1OZGA 3C7DB 3CEPB 4XYGA 4AXXA 4NARA 1XTKA 1SBIA 3V7UA 1JQLB 5KJ6A 3GJZA 1P4RA 1DIHA 2SICE 4M8IA 5CCBA 3CVYA 4LS3A 4BUJA 3GJ5A 3UQZA 1Y8RA 3TIIA 1TJ3A 1JFLA 3GLGE 2B3TA 2ONZA 2G7MC 4L0MA 5TMPA 4JKOA 2V7VA 1W5TA 3W77A 4WGGA 4CT4B 1YKSA 2QRLA 3PUHA 1G291 4OBXA 3TQQA 4R7GA 2IBTA 1NVTA 4TWZA 1AO3A 4HB4A 1KJ8A 4CCAA 2EKZA 4CQMA 5D51S 3IT2A 1X86B 3O4IA 4R05A 2C77A 4FFMA 1Q19A 4JDPA 3L02A 3VMFA 4B1FA 2D6FA 5LCXA 1EX1A 1DPFA 1Y5NA 3IAS6 4DBLC 1XNRB 3EC1A 3KSBC 4M7WA 4I50B 4PANA 1KHTA 5CLLA 5EE0A 1XHLA 3SX4A 4RDHA 1YRBA 3VYRB 4CCWA 1ZGJA 3IUNA 1ZZEA 2EEPA 1Q50A 3PI7A 1HFJA 1IZYA 3F47A 2I7VA 5BV2P 1DI0A 1FYDA 1DRJA 1NW9B 2XKBA 1I0IA 3EMVA 5CB6A 5CIYA 4HDSB 2IELA 3RROA 2KX7A 3T1NA 3H5IA 4PSCA 3QVUA 5CA0F 1SY7A 3TQOA 1Q1QA 1ZSVA 3RWMB 1D09A 1A8UA 3R6GA 4PZEA 5AKJA 3AIKA 3RO7A 3RS9A 1VPWA 3K6SA 3R4VA 5JIBA 2Q0SA 1HSOA 4MPTA 1UKZA 2JW5A 1B6GA 1ZGAA 4PG7A 4DCJA 2WY2D 1RP1A 4DWOA 4HEHA 2BM9A 1KZ6A 4QDOA 2XUQA 2AJTA 2XLBA 1KPIA 1SKBA 1P1FA 1JIJA 3TE7A 4DNFA 4DMKA 4EUSA 1O8CA 2BR4A 3EVNA 4WTOA 3KSMA 1GEEA 3HUDA 4A7PA 4AMYA 4C22A 2ZAIA 3IMGA 4N0QA 3WMXA 1IE3A 4JXJA 1TO2E 2WU0A 4RF5A 5ALRA 2ASEA 4A2CA 2DFVA 1W25A 3FKSA 1YNOA 4HXFB 3DJYA 2O5EA 2XSZA 3BXPA 5IDYA 1U5AA 1PGJA 3UM9A 1ZG3A 3C3JA 3EAGA 1FTGA 4FD3A 1GDHA 4UOZA 4MYSA 5EE3A 3S1AB 5IJ9B 4JQZA 1ZAYA 3GMDA 2CXTA 4OKIA 1G3QA 3QKTA 2NU8A 2HDWA 5A3SA 3SK0A 3KHTA 3BMOA 4K9MA 3EZ7A 3R5XA 5IKXA 1RCFA 3CLSC 4N8EA 2FX3A 4ZOAA 1Y3FE 1LV8A 4GMDA 5E4JA 1H2RS 2IP1A 4FBGA 3RYFA 2QQFA 2X2PA 1ORRA 4H1VA 4K9KA 1VCHA 3V6LA 1YR2A 2HFKA 1ZO8A 2YASA 1RQNA 5D3MA 4QFCA 5A4DA 3OP4A 1E3LA 2LCIA 4ADSG 3I1FA 2AHRA 2FETA 3TL3A 2C9BA 5H3LA 1TYDE 1Z8FA 3B3FA 3RK4A 4JC0A 1XP5A 2QTRA 5EESA 1BWRA 2OXFA 2PLRA 4E5YA 4I9UA 2X8JB 4N8DA 4CM9A 1YDMA 5ECYA 2ZPUA 4PZ0A 3OJWA 3PIRA 2VJKA 5H7XA 2WKSA 3KLNA 4WFJA 3WYEA 3BEOA 3CZ5A 3BQ9A 3PPIA 4IF4A 4U2FA 4RHFA 2ECKA 2GXSA 5BYKA 1XSEA 6ABPA 3MFYA 4ZYWA 2HKIA 1JG4A 2G3YA 4M76B 3JYQA 4Q1VA 2BTOA 3LQKA 3LD9A 2UZ0A 3EFBA 4IPTA 4LOJA 2J0VA 1GTZA 5HK8A 2G4LA 3UGQA 3EZ2A 1XNQB 1QQ5A 1YDGA 3QE0A 4G07A 3EG9A 3L7JA 5DT2A 3I72A 3LLUA 2XUJA 1NQWA 1DTEA 4WDQA 1ISPA 5IVPA 4XCQA 4L4RA 5HRAA 1PJCA 2Q27A 4UUNA 5IW8A 4BY9E 3Q9UA 3PD1A 2EU8A 3U13A 2X7JA 4D96A 4EY3A 1XC7A 3C70A 1J0CA 3ROZA 3V32A 1J8DA 1MJHA 5D6NA 1DOZA 3WRYA 4I1IA 2CLEB 4IV0A 3U3XA 4E5DA 5JC1A 4B7CA 3HYRA 1BW9B 1RRVA 2FFHA 5ESWA 1WVMA 5EY5B 4I9NA 4KN8A 5BMOA 3TZHA 4HVCA 1RBYA 1HDCA 4DA9A 5JTUA 3II6X 3RFTA 4KBYA 1KWKA 3CNNA 3VSBA 3I28A 4F9TA 3U3RA 1FVXA 1HLDA 1BDBA 2O2EA 3L84A 3I4LA 2AQ8A 4QLOA 2DWOA 5CTJA 2WJJA 1Q92A 1TJPB 2YX1A 4I4NA 1YFKA 3LE8A 4ZYUA 3HC7A 3NPMA 3AIIA 1HK7A 3OLZA 1U6JA 2ZRQA 1TPZA 2R68A 3TE6A 1OCEA 1C8VB 1YJCA 1TMOA 3JD3A 1XDDA 3IH5A 3E9EA 5TQ2B 2V1XA 2W6ZA 3HU3A 2NOAA 4ZT6A 1GSOA 3EUFA 4BRUA 1EM6A 1WCIA 4NAVA 3W2IA 2VNHA 4KBGA 2C5GA 4IIHA 3WGOA 1EBUA 3KEGA 4GGOA 4ER6A 4OMCA 1J42A 1PW7A 5EIBC 2JLWA 3VNUA 2VF2A 2QQ0A 4Q3CA 2JARA 3BTVA 2H7CA 3KWJA 4Q3AA 1UBOS 1JNYA 2G7ZA 3CZCA 1TIPA 2BMAA 1JEQB 2CNNA 2OO5A 2ZZKA 3NXSA 3O4GA 4ID9A 5ALKA 3B2QA 1E64A 2IYOA 2FXVA 5J9FA 2ZITA 1E77A 2NYAA 4YASA 3V46A 5GIPE 2VP6A 4S24A 1KKUA 1W9HA 3M49A 1TYEB 3FYSA 1DPGA 2EFHB 3MLEA 1SXJA 3G1WA 4FFOA 4MMXB 4RSRA 1BAPA 3ESYA 1QKJA 4IIFA 5KYWA 1DCFA 1QUEA 3QVSA 1CJSA 1QYVA 2A86A 3PUZA 2AIRA 3L0OA 4RY8A 4K26A 1MR3F 3U61B 2PKEA 1KR5A 4RZ2A 4FYXA 4BXOA 4K8OA 1GHTA 3M83A 1YAHA 2MOKA 1TW3A 4HQOA 3UV7A 4CKEB 3VJMA 3VX3A 2C59A 1Z4NA 4JSTA 2H2DA 4YLYA 3EXEA 5AVVA 4C1BA 4F2PA 3HCOA 3N8KA 4BZXA 2Z8YA 1CR6A 1CVLA 2GM5A 1Q0ZA 5COQA 4PYJA 1HSZA 1NVDA 5DWVA 2FQWA 3GH3A 4LMAA 5I51A 4PONA 1ZOLA 1GV1A 4MV7A 1M1NA 2CEAA 2VUUA 2V8OA 2WIJA 1RDFA 4CM7A 1VB3A 1HG0A 4EA7A 5LOVB 1OX5A 2YN2A 5K0FA 2FX2A 3AL0C 3KR2A 1E94E 3HCAA 1EYZA 1P2SA 4FS3A 2WWTA 4JR0A 4K9SA 4KACA 1IUKA 5B58C 1LSJA 1R12A 4WRRA 2JIZD 4EVIA 3ONEA 4BQRA 1VIDA 2X0DA 3WDSA 1KYQA 3LK6A 4YAJA 2GSDA 3VU9B 4RZXA 3IX7A 1RMQA 1YONA 1YQTA 2W4IA 4CM9D 1D2RA 1P31A 3NRJA 2Q5FA 5F7OA 1K88A 1YJ8A 2ZBGA 2Z5GA 3PA6A 5TJ9A 3ZNNA 2QUKA 3BWYA 3QPDA 3QEJA 1ORTA 3ENVA 4AFNA 4CEJB 1H5NA 2BUCA 3PFHA 4CV3A 3G7NA 5J43A 3G02A 3O92A 2VHYA 4BKPA 3AESB 2PKRA 3AHIA 1ZUWA 1PIWA 4I99A 4K5QA 5EWMA 4N40A 2PH3A 4U7HA 4Z7JA 4DRXA 5E4YA 5C1DA 3EVEA 3O8OB 2Z6UA 3IEPA 1L7QA 5JADA 3QUBA 3IP8A 3DDOA 2ZAYA 4CEHA 3GBVA 1ZJ4A 1Q1EA 1U0SY 1ONPA 2ZATA 1JHUA 1TJNA 2PBZA 3TM4A 4JJFA 3L49A 1XRPA 1KAQA 2QU8A 3NM5A 3LQ2A 1RPAA 1TF5A 3QLEA 3SXPA 3UFBA 1HE3A 1J99A 2RARA 1KGDA 1G59A 1BG6A 4TLBA 4R2KA 1SUSA 2J0QA 3RS4A 1A5SB 3GNTA 1GPKA 4IOLA 5IUNC 4WJZA 3TCNA 1RRCA 1W9MA 3KXIA 1WF3A 1NMXA 2ISSD 1ZC4A 1SCIA 2OV8A 2XX3A 5CXUA 4PX5A 1MH1A 2VQ6A 2YIMA 2Z1MA 1Y1TA 4AMGA 3TOXA 4IDGA 1TCCA 4DA0A 1RADA 4TLMB 5E7MA 2XITA 3RC7A 4EPYA 3I04A 3IUQA 4O4LF 2RGEA 1IY8A 1F2DA 2PGAA 4XUEA 4BNYA 5L6MB 1RWPA 5LSAA 3Q7QA 1MAVA 1RJDA 2HK9A 4LEIA 5CA0B 2EGGA 3PC6A 3CWCA 3Q1KA 1YZHA 3WIOA 3UMYA 2PDAA 3GJ8A 3COJA 2G0AA 3ZZNA 4PC6A 2WAMA 2EFEB 2C4KA 1WOYA 3CIOA 3DCIA 3ZBQA 2JLXA 2B4TO 1NKSA 2HU5A 1SCDA 2LCFA 1MRZA 1XYGA 3NXKA 4P3YA 5EQTA 1H3EA 3R1IA 2PCLA 3FMGA 5JD3A 5EP2A 2ZIAA 4LX0A 2ODBA 1B8OA 3AESA 5FKJA 5LBTA 3GZNA 1RVV1 3DWGA 1CR1A 4FNAA 4OAQA 3KJQA 4I5GA 4PVDA 4UEOA 5AHXA 2Z5FA 2ZUTA 5JC8A 1D9XA 3I42A 4ENRA 2B7BA 2F4NA 3LY9A 3QF4B 4ICIA 1JSZA 3O47A 5DLEA 5BN3B 4Q12A 1I3KA 4TLAA 4URXR 2DHEA 2X3UA 4S1NA 4CNQA 1HNWB 4GZ6A 4BGEA 5JAHA 1PUXA 4OP3A 3BFPA 2RHGB 5ADUS 5JI3E 1NI3A 5JH7A 1BNCA 3CC8A 1W48A 4U5QA 4CL8A 2BOVA 3QA3E 3WWYA 2WILA 1P1BA 3TPCA 4Q24A 3RANA 1P61B 5TGTA 2O2GA 1H6DA 2UUOA 4FZJA 2FSHA 3RUEA 3ZCUA 2PUHA 5AICA 2VBFA 4TL7A 1N2SA 3CKMA 4HH3C 3EQZA 3DOIA 1M2EA 4MVJH 3SYTA 4F9GA 4PO8A 2NPOA 3ABQB 3PR3A 1EJBA 3PI6A 2PZEA 4QECA 2HGZA 1JG2A 5K0NA 4LC9A 4BV8A 2VQ3A 1PUJA 1M10A 3OLYA 1XZJA 3CVJA 2D1QA 5DHUA 4YMIA 4RTJA 1YB5A 4B09A 1NC1A 2C5FA 4ALNA 1A96A 4B81A 3JQFA 2EYQA 3HN6A 1JHZA 3A3PA 3UOAB 5JWOA 5CXSA 1UDRA 4HUQA 3DBHA 4LQCA 4IJKA 2CC2A 4P5PA 1M2HA 3OM1A 2BZSA 3GEHA 3G9TA 4FGJA 3WMFA 1M2OA 3I5UA 3T7AA 4BNNA 2IHJA 4FGWA 1KJQA 2WSBA 4ISCA 4NATA 5E4TA 4QHTA 1J25A 4Q1DA 4DQXA 1YJ5A 2XMQA 5BPFA 3IQZA 3VOBA 1P2DA 4AJ4A 4AX8A 2A5DA 3FYUB 1F0PA 5J63A 5C3UA 5HRCA 1XPOA 2JIBA 3ZLBA 3E3OA 1BKSB 3AKZA 1H65A 3MWKA 3BCUA 3SZMA 4HNHA 4BRZA 2GNPA 1I4EB 1E4EB 1G3IA 1IBSA 2FSVA 3KXLA 5LUAA 1SXJE 3KPWA 5ITZB 1F2VA 1PYDA 1DAMA 1JYSA 1V7QA 3GO4A 1JPVA 3ESXA 4URHA 4Z2YA 1BOFA 5A2QA 4KLNA 3N8NA 3L8YA 1RBQA 1XXHE 2IYVA 2MIIA 1NMSA 1EE9A 3AF2A 1ADCA 1KSHA 2NM0A 5B7GA 2FUEA 1MC5A 1Z7WA 4M7PA 1ZQ1A 4BQQA 3D2CA 4AZVA 2PUFA 4G0XA 1HL7A 3V8MA 1N2BA 5A4JA 4LW8A 2VPQA 2RK4A 3I52A 2NWQA 3AF1A 3R3YA 2IEIA 1PWZA 2E85A 3IAXA 1PV2A 1XELA 3NWPA 4UNSA 4W5TA 2G71A 1L7VC 3FI0A 4IJVA 1ZFNA 3HK2A 1CDOA 1OREA 4EP1A 1Q1AA 1P1HA 3GNLA 1RW4A 1RAAA 4A6EA 1PK7A 3WHKA 1E62A 4QAQA 1HF3A 2JG3A 3O82A 2VSXA 4HB0A 1Q74A 1STOA 5G40A 3LW7A 4D8YA 2I4RA 3GFBA 3ZV4A 4O08A 3SG0A 4DF3A 3K0AA 4RVDA 3I9LA 4G5RA 3DOUA 4Q82A 4EPTA 5JPCA 4W4TA 4JI8B 5LP1A 3KRTA 4AY3A 5B1EA 5KIAA 3BSWA 1L5HA 3NR2A 5BNTA 3THYB 1EE1A 4PSAA 1P2UA 1U2TA 2JGDB 2O48X 1CY0A 3LWDA 1V6CA 5EIFA 4HWRA 5FOVA 3UJ7A 3ZCXA 5KNDH 3ZHSA 4AECA 4FSHA 2P8SA 2D1SA 1NDUA 4ZI2A 4RTKA 2CZQA 5FB3A 2C61A 1PV4A 5FQOA 1VRWA 4EH1A 5ED4A 2RIPA 2GZ2A 4WBNF 2H00A 2BONA 4YROA 1JGTA 3O73A 5EZYB 5HJ5A 1V8ZA 2ZSFA 3O4HA 3AU8A 5F78A 1RR6A 4CUKA 2BGGA 1HEUA 3X2FA 2FFJA 1VIVA 5E6RB 2BHSA 2PIAA 2QJRA 1Y6JA 4RD0A 3PT9A 1NW8A 3R7DA 2XXAA 3TOVA 4NL4H 4D3ZA 4U7TB 2AQKA 1DFHA 2XY4A 4L4ZA 3VGPA 1TVCA 2I8CA 4K2AA 4O2AA 3QU7A 4I2VA 5K1ZA 1AUXA 3NIFB 5SY6A 2H65A 2ZSBA 1ZXXA 5HKOA 5KREA 1G8JA 2ZRGA 2IHTA 3AI7A 2I4LA 3SYLA 1WUKS 3OU6A 5AI5A 3GNQA 2DT8A 4L3VA 4Y1RB 4OM7A 1DBWA 1YBMA 4J6FA 2QMOA 4K9NA 3TAHA 3TTVA 3JWGA 3RUFA 3VNQA 4Z86A 4BQFA 1XWWA 3SI7A 1L6RA 1C9YA 2Z2IA 1KSFX 4CG0A 2GQ0A 1C8BA 2QLBA 9LDTA 1VCIA 3UG6A 3I37X 4JBWA 3VHXA 5EIEA 2VJPA 2WIBA 2ZQZA 2RGUA 3AXSA 2GJSA 3BRQA 4XPZA 3USES 4F6CA 5ALLA 4NC9A 2HI0A 3CY6A 4J6EA 1KFBB 1SRQA 1YGPA 1IJEA 1TVKA 2WWFA 4D9BA 1K4MA 1U7ZA 1LWNA 3RK1A 5HJ7A 1QG6A 1UJNA 1XTZA 1ZNQO 4YMGA 4ZJYA 3G0GA 3AUSA 5AUNB 1O4VA 4IXWA 3KUCA 5MF6A 3VOAA 5BORA 2MJLA 2WUDA 1CJBA 4L8FA 4XUDA 4RVFA 3V3TA 1ID8A 3ZDEA 2OT3B 3SIPA 1X77A 2ZXEA 3HRKA 5EWLB 1TMYA 3DAPA 4FHZA 1NP3A 4EEXA 1X2BA 1HE1C 2FWMX 4K3UA 5HIIA 4EJ0A 2YHAA 2Q8PA 4D82A 2Z9DA 1FQWA 3HWSA 2GBGA 3ZJYA 1MRNA 4AU1A 5EE1A 2PH1A 1TQ2A 3V8BA 4ZCIA 5I6DA 2XWSA 5IS2A 3KAQA 2OP1A 3WGMA 1IQRA 3PNMA 1SH7A 4Y6SA 4XZ3A 4HH1A 3EQ9A 5KVSA 3B1ZA 1Q21A 1NYQA 1RI4A 3GUYA 5LDDC 2UXDB 5I4BA 4X6UA 3Q9NA 4URWR 4WEOA 2ZIEA 4UCWA 4XX0A 2ORIA 1SB9A 5AIAA 1LTHR 2X58A 3N05A 4K88A 5DBOA 1VGRA 4HAZA 3H5VA 3B78A 2N46A 3ZE1B 1KPHA 1ECLA 3PEVA 4PBSA 1XP8A 3U17A 3GRZA 3U7RA 3JQAD 1I1HA 4GPIB 4U7GA 3ZJTA 1TKCA 3RFUA 2X9QA 3TVTA 2FKAA 2VPXA 2BY4A 2WM2A 5A3RA 1OIXA 4L4YA 4Y98A 2JCXA 4YS6A 3WLEA 4D1YA 5BV7A 2HX1A 5LLTA 1G5TA 3TPZA 1PWHA 2K2QB 3W2EA 4XYMA 1WPRA 1X7XA 4N65A 2CFSA 1JQ5A 1DS6A 2Q1YA 3QYFA 4ND3A 4RKYA 2GHQA 3T7DA 3R24A 1QRTA 3I23A 5JXJA 2PX2A 3DBRB 3S2GA 1HQDA 4XGRA 1LBEA 2YZKA 3THWA 4NZZA 1BC5A 2JRLA 2WICA 2XVYA 1P6QA 2IXBA 1ZVKA 2JJYA 4DTCA 2Z5LA 3UGTA 5CFMA 1Z7EA 3WBFA 3SC6A 4MW1A 5TE9A 1SKUA 2SCUB 3PKZA 5D1HA 2N75A 2OV3A 2XUPA 3DTYA 1MIOB 3EQ8A 3FZEA 2B5VA 4A6PA 2ZI4A 5DBGA 2R8PA 1LLFA 4BECA 2ZJ1A 4AS3A 3CTPA 1L8LA 2A0XA 3B13B 4WACA 3O2JA 1K3TA 4NEGA 4TWIA 3C3WA 3L6UA 5DSTA 4ZQEA 1BEUB 2ZKLA 3NRCA 1U9IA 2J9YB 4CL0A 1QVVA 3BH6A 4PRYA 5JPIA 4TTQA 4QFMA 5BSEA 2WV7A 2CL0X 3OP1A 4NYIQ 1NXXA 2F9FA 1PLJA 1WDTA 3X0DA 5EYPB 4L07A 4BNHA 4TMYA 3EDMA 3SXUB 3AOEC 3REQA 2BSQA 1LY1A 3L2OB 1QHFA 3AEQB 5KJ1A 3R6DA 5E7QA 3JQGB 4KEAA 1M6VB 1R0ZA 1UWLA 2CN1A 3PB3A 4MAFA 4K87A 1CIJA 3PHIA 3PNQA 4MNTA 1OWLA 2PX0A 4UPDA 4ZO7A 1FA9A 3IQXA 1N9GA 2EZ9A 4KO1S 4PM4A 4U00A 1UPFA 3U7EB 1BN6A 2G1AA 1H8ED 3ZS8A 4EJMA 1LC3A 1SFRA 1SOAA 4LFBB 4JL5A 3P9CA 4ZKDA 1D04A 1I7PA 2QT0A 1O2DA 4OK6A 3WA7A 2R6AA 4CIAA 1QKKA 3D9QX 5CVCA 5JEDA 5IF3A 2J6HA 3GLVA 1XJQA 3A4LA 3WK5A 5ICSA 2D8AA 3V8VA 3ZNPA 3KX2A 3CVWA 1R7RA 2RG7A 2ZVJA 2FJ0A 3PV0A 4PQEA 1QQAA 1XG5A 1LK5A 1NIPA 5EMJA 1R27A 1T4GA 1S9HA 3E7XA 4I5DA 4BQNA 4D3YA 5KB3A 3J80A 3U62A 3DKPA 4MX8A 2P6MA 4B0OA 1N6LA 1U7UA 2PSSA 1VI2A 2MSKA 2V3WA 3B82A 2K4MA 2E6UX 3DFUA 4AZSA 4YQFA 5IKPA 1OLUB 1A8IA 3TEMA 1UF9A 2PCJA 3C85A 4KAFA 4M0UA 4YBZA 4H1WA 3SBDA 3L1KA 4KJZA 1IBKB 3PUVA 1N7IA 4GPTA 4O1MA 3ZUPA 3OIFA 5CX1A 2O4UX 1IG3A 4D99A 3DV2A 4BATA 4BLVA 4Q1FA 1LEHA 3OURA 1DWQA 4QRIA 4YMSA 4ZVVA 4DNOA 4EJ6A 4AQ7A 3V1TC 5I01A 2PLAA 2DBRA 2ZYDA 3LA6A 1OX4B 3IOYA 5C8YA 3W90A 3PT5A 4NIMA 3B1FA 3B7WA 4AZ0A 3G0HA 4MLDA 4XVHA 3RT1A 3QUTA 1M6VA 1WVGA 2Q4EA 3QOFA 1EGVB 3LUGA 3NHKA 2VDLB 5C31A 5J4KA 3QIAA 4DV0B 1Q20A 2WM3A 5JEEA 1LRKA 4KQFA 1T3TA 2BYTA 4GT1A 5EUCA 3H4MA 3R0VA 1SU6A 5EMMA 2VP3A 1FTQA 4QBKA 1XZBA 5C81A 1BVHA 2H9AA 1S7CA 4CKWB 5EKSA 1JG6A 1FRQA 4GU5A 2J3MA 5K0LA 3DB1A 3KWMA 3PLRA 2IKSA 1ZGCA 2UVDA 2EGUA 2P3SA 4ZU3A 2GERA 3ZOZA 5FV7A 1V48A 5A0VA 3QEMA 4ARSA 1CRPA 1J0DA 4FMCF 3LP6A 4IDBA 4QQ8A 3RBZA 3RT9A 3I61A 4TRMA 1NBIA 3NHRA 1FXUA 3EPJA 5AJVB 1NHWA 1NU6A 2A7XA 3NB0A 1XPRA 2V8BA 4PPYA 2WWWA 3V2HA 1W85B 3KOWA 3PYMA 4Y7CA 1N25A 1FP4B 3H9UA 3PGVA 1C1XA 1XU9A 1JTFA 3IAM1 4PCUA 1KMHA 2X76A 2FR8C 4UQOA 5ALEA 2R7LA 3O3CA 1KZGB 2C92A 4MIYA 1WRBA 3TO5A 2YUTA 1UKYA 2PHZA 1NRJB 1YKFA 2CYAA 4BP1A 5IF9A 1S2OA 4C89A 4U7DA 3I6QA 3LVQE 4ENTA 5K99A 3BL5A 1DRKA 3KK0A 4KKVA 4QC2A 5U1PA 3FFWA 1I1NA 4OFXA 1Y6ZA 5DLPA 4BVKA 4EQ6B 2GKGA 3V4PB 2JGJA 3IBCA 2H18A 3FKQA 4K0RA 3RRXA 3W2GA 5KOYA 3E7FA 1D6SA 3PGA1 5JCJD 2HDOA 5KQPA 1IIRA 1DSSG 1IN8A 1MB9A 1N1GA 1SRRA 3K94A 3O91A 5T8KA 3GP5A 3EIUA 1KJWA 3IOCA 3ZGOA 3JSXA 1N6IA 4CT5A 5TQ2A 1MQSA 4PG6A 4GSLA 4S2UA 4MI1A 4MR8A 1WTAA 1HFEL 3BX1A 4ZICA 1A9ZA 4EY7A 3NO4A 3RKSA 1V25A 2UZ1A 4HJRA 1Y5MA 3ZGYA 5MN4A 4YR9A 1A88A 4EW1A 3VR6H 1QGYA 2CLMB 4JSYA 3I6YA 3SX2A 5C9ZA 4FGUA 4TT3D 3RIGA 4JLPA 4WK4B 2TMGA 4FW9A 1NQTA 4MYTA 4S35A 1N1MA 3TBKA 1K68A 1A8SA 1RQ2A 5GQSA 5ADWA 1U7DA 4Q6WA 5FOUA 5HQ3B 1YBVA 1YFZA 4NOJA 4B47A 2RKWA 3I01M 2GM9A 1BD3A 3JQBA 4IKEA 4L5BA 2PA3A 3C7AA 5BN5B 4KCGA 1CUFA 3NP7A 1JQBA 1OTHA 1QX3A 3CWZA 3QFTA 3FPJA 3K0CC 5EP1A 4AJ1A 4F5DA 4BVBA 3RAPR 5ITVA 3K31A 3RRYA 4B6RA 1RBZA 5F7ZA 4P4LA 2E37A 3GEPA 2IWRA 2M6KA 1IZ8A 4O4JA 4OKSA 3V80A 1EAMA 1M6EX 3QHQA 3GCDA 3C7CB 4C6RA 3DOJA 1GZ4A 4M1YA 3TIXB 5I7SA 1IOWA 5HZMA 5K6RA 1TI7A 4RSMA 2QMYA 4CF6A 1Y1RA 4DLBA 1OC2A 5JH7F 1KJJA 4NEQA 3A32A 3I1IA 3TCKA 4HLNA 1I10A 3FUWA 1EK6A 3DPIA 4H7FA 3WS7A 2OCYC 1U9YA 1M0TA 5IT9A 1VE6A 1MGPA 3ZI0A 1CEXA 1G4AE 1O95A 4Q6BA 2VT6A 4PO3X 4XW2A 1UZNA 4J2OA 4XM1A 4ND8B 4M9SA 1KIFA 4LBWA 1T1IA 1RHMA 2J41A 1IG0A 3OLXA 4YMTA 5CA1A 3QEKA 3HFRA 3E05A 1JHDA 4R8MA 3AZOA 3HVUA 3ITEA 4FEYA 4RIEA 2AFHA 2ZK7A 8GPBA 5EE9A 2ECQA 2CBGA 3ZVMA 4QGFA 5K8VA 5AKHA 5CJPA 1AB6A 3OOHA 4HDOB 4HXEB 3RT7A 1JR3A 3ZDCA 2PJUA 1R1DA 1JPNA 1OA1A 2AN5A 3RWOA 6REQA 4DWVA 4B4OA 1G7CA 2PK3A 4O4LA 3BXEA 2FPOA 4NECA 3UHJA 1YR3A 4DV6B 1CY1A 5FUYA 1JG7A 3K70D 2HHHB 5EKUA 2BRUC 4KK4A 4B3TB 2DBVO 2WHRA 1GKUB 5JZ9A 4YRZA 1A8QA 3KJZA 4C2UA 1MT3A 1NTOA 3VJRA 3AUTA 3TZQA 4BU1A 1XAJA 1JKFA 1JEAA 1TAUA 3PITA 2FGKA 1Z4PX 5K0EA 1DKNA 5KQMA 3QBVA 3QKRA 5REQA 2H2FA 2BP7A 5F9FA 3TZCA 1KI6B 1PZGA 5A4IS 2X2EA 3G9ZA 3U3DA 4QNRA 2JLUA 2B5OA 3AFNA 2IS6A 5KSOA 5ELMA 3T3HA 1CY8A 5ITSA 5JDIA 1VHLA 5C52B 4D6YA 4DR6B 4RD2A 3MRTA 3ODPA 3PR1A 2Q6IA 4H0CA 4B84A 1L1EA 2Q3MA 4L8VA 2B2XA 1EUZA 4MVJD 3SKVA 4ER5A 2DULA 4PS0A 2P4HX 3Q87B 2PMWB 4FP9A 3GHHA 5FLYA 3MJVA 3DLTA 4KI7A 3S55A 5EEHA 2ISQA 2PX3A 1XKTA 3MMPA 4J0DA 4PG4A 2PKQP 3Q1LA 1IU9A 4Q4HB 1FL9A 4LI0A 5EWJB 3UAVA 1KYTA 3AHJA 3H1BA 1W44A 4JI2B 2CLSA 1HEIA 5EMKA 1E4VA 3WGTA 2BKAA 5JFGA 3AF6A 5AXDA 4MW6A 2VDMB 3TZLA 1R0WA 3JZIA 1VCMA 4H15A 3T1TA 3ZHVA 1V4NA 5DLYA 4K6KA 4ESVA 2IPLA 1TK2A 4TLDA 5ENDA 4E94A 4ZIRB 5J5VA 1NL3A 1FVHA 2ZWVA 4IIBA 4NMLA 5D2CA 1P2GA 1KC1A 4I1VA 3RIHA 3WK8A 4BFZA 1A5AB 1V95A 3OZUA 5CYFA 4OJQA 3F5QA 1AKUA 1QSGA 1YZKA 3EIFA 4MS4B 3ZV3A 2ADMA 2VCYA 4OHZA 4CFZA 5ENZA 1VBMA 1C3JA 5JH7B 3ROFA 2ID4A 3DAHA 5F3RA 4GL2A 3LRTA 1I7DA 3CPHA 4IBOA 4B71A 3Q5GA 4NXMB 3ZH9B 3CLTD 1J7KA 4AKIA 3AXTA 3ER6A 1CQIA 4TMVA 2AT1A 2YCBA 3F3KA 3RRZA 4ZDWA 2W93A 2H57A 3LLCA 5I4KA 5GJBA 1L4FA 4QYIB 3MW8A 3R0ZA 4N7BA 5J2UA 2DHDA 2QX6A 1NP7A 1OAOA 2A57A 4L85A 5DFAA 3QU9A 1ODTC 3A9WA 5LWHA 3UOWA 1ZXBA 1I2MA 3M9XA 4EA6A 1VKNA 5AVJA 1KK0A 1UDXA 3NVAA 1XVLA 1WE2A 1G20A 2FHSA 2P6UA 4WZZA 1QBGA 3C87A 2QTTA 2CXOA 2ZBVA 3DA8A 3F5SA 2B36A 1EK2A 3MD9A 5FPKA 2I2WA 5F1PA 2ACWA 1EDBA 1NZFA 1TEHA 1ULZA 1JYFA 2ODPA 5G1NA 5C3MA 5JY6A 4F9EA 3OG9A 3OFNA 4CFSA 4DQ0A 4E46A 1TAGA 1S4MA 2IPAB 2OV1A 4MV3A 3KJIA 2P3QA 1PDWA 3HJTA 4QU0A 1QAMA 2CNOA 2OCKA 2ONKA 3ASZA 3GEBA 4ZZ3A 5ARBA 4YCLA 3WLNA 2HRZA 2TECE 3K1AB 3UBMA 3L7YA 1SVSA 2HC9A 1O0CA 1SBTA 4PO1A 3UB2A 1Y8QA 2O8VA 2ST1A 1ZD8A 1ZISA 1PTJA 3GDWA 2MTBA 4KR9A 1UP4A 4HQNA 1AZLA 1I5RA 2AR0A 3LQQA 1ZSYA 5JVDA 4YNBA 3IDQA 1N6PA 4X97A 4J16A 1K75A 3DE6X 1EFDN 4G8CA 2GLTA 5KS2A 1XRLA 2VRCD 3ECAA 4QQRA 4GKJB 4R31A 1CP2A 4KXWA 2QM3A 3MOGA 4F1WA 2RGNC 1ZM9A 5IVDA 4QGGA 2I55A 4H35A 3S4YA 4X24A 3WNDA 4A92A 3VSEA 3ROMA 1XRNA 3DG9A 5HM6A 1PU2A 3NIDB 1VYHA 4OHXA 1ST2A 4AG3A 3OQMA 2HW8A 3LK7A 1T34A 5DNCA 5EKTA 5J47A 1E1QA 1MOSA 1Z2NX 3W0LB 3C3DA 5EMNA 2EV9A 2OOSA 3IP1A 4KC0A 2PQ6A 5HRUA 3C15C 3NC4A 4G67A 3O4RA 1RLOA 3TF5A 1C29B 2PA0A 2YXBA 3KQVA 4LY0A 4QUDA 5A62A 5ILQA 2QTBA 3WV5A 4OFBA 3OC6A 3USCS 3OFVA 1P17A 1PZFA 1X9IA 1NLUA 2PKXA 1NLMA 3R0QA 5K3EA 5FNVA 2JGDA 1E5VA 3DGFC 4I4LA 4BGIA 1QHXA 2R8XA 4ARAA 4XR4A 2B4KA 1FFBA 2PRKA 2ORYA 5KKNB 4JJKA 5F73A 1GZUA 3C7TA 3D6FA 3HXKA 3NTVA 3WYCA 1U8TA 2PKYX 1GL6A 2JH3A 3CLRD 1WX1A 4GI2A 4OQ4A 2A9JA 3QLTA 3AYZB 4M0EA 4MK4A 4NZNA 5JAOA 1CRQA 1WSBA 2A2ZA 1OXUA 3S1SA 3RVKA 2H4YA 2A94A 2E48A 4EDFA 4QVGA 2X8WA 3EPHA 3H0EA 4I4CA 2LGJA 2FWRA 2XXAB 1NLYA 2B20A 1CUBA 1KZ1A 1M6YA 3GLKA 1EVKA 1ICIA 2WA1A 3GPDG 3MPUA 5DX8A 3U0BA 2DBZA 2H1WA 1KMNA 3IUEA 4QBIA 4R3WA 4UBIA 4DDVA 3RTDA 1ZD2P 3A4TA 3LDGA 3QMWA 2NTNA 4GKVA 2VSNA 3ZG6A 5D3MB 3WL7A 5DM60 3JPYA 2I2BA 2J9RA 2GXQA 3EXG1 3UH1A 3T1YB 2E4YA 1GT6A 2C2WA 2HV9A 5K0SA 4C03A 4B6FA 2OC4A 3GIWA 4CLOA 1VMEA 1OYVA 4YCCA 5CH3A 3JASB 1RNLA 4Y6PA 1VLHA 3DCYA 3I8OA 4JYAB 2BMVA 2PPLA 1DO2A 4Q3BA 3E53A 3OT5A 4IOMA 4WT7A 5A5DA 4ILKA 4WN9A 4X3OA 5GAJA 2VWHA 4O2BB 5IT4A 1WXHA 2O20A 3N2YA 1JWBB 1PJQA 3AHGA 1OZHA 1TIBA 2AFHE 4OF4A 1GPMA 4US0R 5IBCA 3IEVA 2CLIB 3C43A 4RY9A 4AD8A 1PX2A 1B76A 4B7UA 2NP6A 2WU3A 1S8FA 1AHHA 1HORA 1SKYE 2JI8A 2ZETA 3S2UA 3NMUF 3P9PA 5CK5A 3WMWA 5IN4A 1EP9A 1E18A 4Y2GA 3P9ZA 3D6HA 3W9UA 4C6HA 5BSGA 3H18A 5L3SA 5KVQA 1ACMA 3LUDA 1JSCA 4MV5A 2CUNA 2DPMA 5B1YA 2RK3A 3P5SA 4RE5A 3RJ9A 1UBJS 1U3TA 2ZJAA 4Q9IA 1THZA 2NADA 5AI6A 4ZGGA 3KQHA 2QM0A 4OX9B 3BULA 1G4UR 4P4TA 1AXRA 1GU1A 1E0AA 1JQJC 4L2IA 1NKTA 4A03A 1KVUA 1GPUA 4JJ8A 1L5ZA 1NMZA 4I4IA 1SIUA 4DSZA 2XDAA 5T41A 4XX0B 2MWMA 5K51A 2R6HA 2XECA 4ARZA 2CJXA 2IIPA 2OBXA 3B6IA 2YWEA 3WLJA 4EKYA 2QRPA 4OGKA 2QJFA 1R10A 2I3GA 4INAA 3DCJA 1KO7A 5ADVA 4Q02A 2PMKA 4GOXA 4U2GA 4B3GA 4H7DA 5AT1A 4EO7A 1YR9A 1NYLA 3NIBA 4EO4A 3LCRA 1M2NA 1MPXA 2HA0A 2YZGA 3HACA 3NEPX 4UNIA 3COYA 5FQNA 2I78A 1LU9A 1AT1A 4QEZA 1L8XA 3CG4A 3N9IA 1WO8A 1X8JA 1VKJA 2PY6A 3O75A 4IS3A 2OG2A 4AZ0B 2C1ZA 1XKXA 2BMJA 1FFGA 3GT7A 4BE9A 4GI7A 3B9RA 4C3OB 3AKCA 4DSNA 2IU0A 4YV0A 3W5VA 4DG5A 2QT9A 5B4UA 3IEIA 1RZVA 5CFOA 3EZNA 3MWJA 3R3HA 2HNBA 5DSZA 3HUEA 1T3SA 3IAFA 4Q1AA 1F17A 4TZKA 5F98A 5KTKA 2AOWA 3LO8A 1OZFA 1OU0A 1NF8A 1YMUA 2CE7A 2FPGB 2HMSA 2ZQYA 3KPYA 4TXHA 1AXGA 1RE0A 2EBUA 4Y6LA 4YVFA 4TVOA 3UB4A 5ICEA 2Z4SA 4JYPA 4JLAA 1LX6A 1Z82A 2XWJI 2GBCA 3HDHA 2X5XA 3OLCX 3OU2A 1Z06A 4KUHA 4Q4JB 3WIDA 1OC4A 2H1VA 4QOIA 4BRSA 4WEQA 4UVIA 1RTKA 2FOLA 4IIJF 10MHA 3FH0A 1JDBC 4R9RA 1Z28A 2BMWA 5KKAA 3RC3A 2WQZA 5E9WA 1PRYA 1TCVA 4ZQGA 1Z4MA 2ZSKA 3CKKA 2AOXA 3GDHA 2SHKA 4ZOQI 3CVVA 1YF3A 1EQ2A 3R0IA 1MVNA 3NZEA 5JLAA 4EVRA 521PA 4GMFA 2HJ9A 5F9HA 1IY9A 4IJWA 4A36A 4ZK2A 2VXYA 3ZZ1A 1XZQA 4PLPA 2XZDA 3L0PA 3AP2A 1A82A 4M1MA 5IKEA 4K9OA 4M21A 2CMKA 4H59A 4FN4A 3WBBA 3GGGA 3HKDA 1L5RA 1DRVA 4CM4B 1R50A 3FX2A 1CCWA 3OM9A 2VS1A 3RIMA 3CEJA 3KYDB 2OBFA 3P9KA 2NTVA 1RYDA 4AJHA 4CL2A 3U5TA 1V6SA 1WP9A 1QZ3A 4N0PA 4C3VA 1W59A 5IX8A 1PFUA 2JGEA 3WJ7A 1KOGA 2L42A 1SR8A 3LYAA 4PLYA 3IMEA 3DOEA 4H7EA 4B3BA 1CUIA 4UUBA 2CL7X 4YQZA 1KI9A 4AUMA 1XWIA 1Y3IA 2Z1DA 2BH2A 2C2GA 1F0KA 2V65A 5D86A 1C9JA 1L2TA 1C1DB 4KP7A 3T7SA 2PGLA 1NWCA 3OJCA 3ZQ6A 1BOOA 2G88A 3SYRA 1FF9A 3BD7A 4GYYA 3R7NA 2W2QA 1R0RE 4AN4A 4H7PA 4EG3A 3OZVA 4WSOA 5EIBD 2ALJA 1KK1A 3RVOA 3VOTA 3IAM6 1CUHA 5GOTA 3KZNA 5HSGA 1M8KA 3FFBA 2QI9C 3OQ6A 2ZRNA 1CF9A 3O90A 4ZO6A 2E4UA 4IIYA 2DFTA 5IK2A 5LZ2A 5B6JA 2YZ7A 1U8UA 4M49A 3WK4A 3AFGA 2IYWA 3EOZA 3ROEA 1NUSA 5DHQA 3W3ZB 2Z6QA 3BGIA 2A9QA 1Y6QA 4PG8A 3QKUA 4AT1A 3HBMA 2YRWA 1W581 2OESA 2PZMA 4XVRA 4ATNA 1BW9A 1SHJA 2AVNA 3OZRA 1Z4IA 3ZBUA 4GE3A 4O2LA 3VDXA 3E15A 3ILXA 3TQCA 5JNSA 4CM1A 1Z8HA 2FSPA 4RK4A 1Z2PX 4TOIA 3DVSX 3W79A 3I6BA 4BP9A 3BHJA 4XVCA 1WXGA 2O2HA 4CEHB 1NPYA 3B3AA 3T3GA 4Y6OA 3NATA 1GL9B 1XU7A 2R62A 4J75A 4JBXA 3L6RA 1DDIA 1HYHA 3UZUA 4FVTA 3RVLA 2HXYA 4P4UA 4J07A 3WGJA 4PEVA 3QENA 4LWOA 3L8EA 3A6DA 4H6WA 4KSBA 3LFTA 4BVEA 4E70A 4YRAA 4Q9KA 1S2LA 4US1R 3K8YA 3ZWDA 1WNTA 1Q0TA 1GTRA 1JI3A 2FN9A 2FPMA 4DIDA 1C1DA 1IVYA 2C4NA 3GMIA 5JSQA 4ES6A 3PXXA 4BZPA 4GOKA 1FDWA 3CLRC 5CP8A 1NX9A 2X19A 2KE5A 1WCIB 3M5DA 3KXPA 4PPFA 1YVPA 3JQ6A 3JZAA 1H4VB 3OE4A 4Y6QA 1NNI1 2ZUVA 2A59A 2HRQA 2JAPA 4GPAA 2GD6A 5IRCD 3V8RA 3IDSA 1GLVA 2FR8A 3I4FA 1B6RA 5SY9A 3LUFA 1QHGA 2WP0A 3NHWA 4HDQB 4ILEA 4OK5A 3SE0A 3NCHA 4Y67A 3LGAA 3NGXA 4IR7A 2UZ3A 2YW9A 2VZ0A 5K3OA 4ZHSA 2OMEA 4QJBA 2HJGA 3DWEX 4I7EA 6REQB 2C2MA 1KVTA 2OHVA 1TZJA 3E6AA 5FI0B 4YT8A 2JFQA 3PHJA 4NNPA 1TK3A 2ZCUA 3O74A 4P9NA 3UGKA 2FEXA 2PD4A 4HUJA 3FUCA 3ZIAD 2DQSA 3TW4A 3QWFA 4LZAA 2RHBA 4M4SA 2X9NA 4TTTS 5HDBB 3PDIA 1F14A 4UNPA 2PEYA 4Z53A 1G19A 1M1ZA 1KEZA 2HQBA 3A2MA 3N6VA 3KO8A 1OXSC 3CE6A 3OMWA 4NMMA 4MI9A 2V6IA 2BFWA 3TXYA 3WZLA 4ECAA 3QFHA 3VTKA 3EPLA 3ITKA 3UJNA 3GEDA 1KERA 3H8SA 3ZLUA 5CFQA 2ZSIA 4KGXA 1I24A 4KWTA 4Q3LA 2VEOA 3L0CA 4CWAA 3OIDA 3DHNA 4OFZA 4R5MA 4UHCA 3LTNC 4OU5A 1D4FA 4OATA 4RQUA 2C5SA 2RGYA 4MP6A 4Z4FA 3P45A 2EDAA 3WK6A 5E1MA 3FYHA 4IZ6A 5B55A 3W8DA 4IXMA 4WLFA 1Z07A 4A8JB 3DHEA 1PEKE 1E7QA 1T29A 2ZJYA 3EEBA 3W9SA 1L1QA 1NJSA 4IRXA 1XAHA 2FZLA 1W8DA 2Y77A 5KNBD 2IOFA 2VPTA 2X0NA 3CINA 5KPJA 3GMSA 3EWAA 5H0IA 2ZBFA 4EJSC 5KQSA 4F5EA 4IS2A 4LRWA 1EVEA 1Z0SA 4HRXA 4R1OA 3NT4A 4IMRA 1AK1A 1BFDA 1XTRA 1Z2EA 2FPKA 3D4OA 3DOHA 3ZEAA 1ZNZA 2VPIA 1O9GA 1ZGZA 3LNCA 5MFPA 4F6RB 4PU0A 4CMAA 1YDFA 3LDAA 4HZUB 4XB2A 1IIBA 4AZWA 3GLFE 2O0MA 4NULA 3HCRA 3TIGA 1CYDA 2I7CA 2NVWA 3KFLA 3ZIDA 4ESEA 3RVDA 2E3JA 3DXFA 1W88B 6NULA 4B3MB 4DJ5X 3EX7C 1UH5A 4XWKA 1E3DA 3A9TA 1MLDA 3DMNA 2IV3A 1PNRA 3T1OA 2IA5A 4ZEWA 1L8AA 3B7PA 2RJ3A 4OLAA 4GP6A 2BTQB 4UJ5A 5DYWA 2GNOA 1CUXA 5GV7A 4D4KA 1KNQA 4Z8XA 3R7SA 4B3FX 4W9MC 3SVTA 1B14A 3DMGA 5DULA 2V7BA 2IYAA 3ETGA 1QC5A 4FWBA 4CKBA 1RLTA 3OTQA 5IDVA 1JLSA 1NUHA 4OP1A 3HYSA 5CT8A 3W1WA 3T94A 3HFGA 3P9YA 1B6TA 3OA0A 4XEHA 3ZKAA 5BQ3A 4GYKA 4N7RA 1WZ2A 3QW2A 2WJWA 4MWOA 2I54A 2VO1A 4ZV4A 1U2PA 2GBFA 3R44A 3DEKA 3BD6A 3IO3A 4R7TA 3BF7A 3LRXA 2VJMB 3O6VA 3OIYA 1H94A 2YWCA 4OHWA 4TQ9A 2I03A 3M6VA 3RYHA 3L8ZA 2J4CA 2QRMA 2IP2A 4MQBA 1G41A 1X39A 4I1YA 4O63O 4QO7A 5A5FA 4M8NE 1EAYA 1KXJA 4JMLA 4X3CA 3I9NA 3CRRA 3HVHA 2JFOA 4QPJC 4G5HA 4PSDA 2G83A 2QVXX 2BVNA 3X43A 1Q0LA 1ZIYA 4FT4A 3OICA 4CVNA 1QP7A 2OQ2A 1WMSA 3TLMA 1QFJA 2J3JA 2QORA 4HLUC 5DB4A 5C80A 4CDRA 4H6XA 1P1JA 4B2YA 5THXA 1RABA 5H82A 4FNMA 1T8RA 2QQ5A 4UOEA 1Z25A 3FB4A 3Q2OA 5BR1A 3I58A 4HSGA 2A67A 4II2A 3V1MA 3HCBA 4WCDA 1A5TA 4QWWA 1PL7A 1WB4A 1OOEA 3HA3A 3L7DA 3Q41A 4G5OA 4W9NA 3RUCA 4N8SA 3MT9A 1V16A 1ISIA 4UQLA 3FW1A 1KYYA 2IOHA 1IOVA 1SXHA 2QL7A 4PZ9A 3EBPA 3E81A 5K8JB 3VVMA 1PAUA 4O2AB 3OWHA 1YZ3A 1ZRHA 2W71A 1Z2CA 4C5CA 1QCZA 2RCYA 3AGQA 1DKPA 5EHGA 3SQOA 5FPSA 1MU0A 2CF6A 3M0EA 1B0AA 1OBOA 1YVUA 2DY0A 3TLEA 4WLEA 1MN6A 3ZLJA 5EJMA 3VDQA 2CCJA 2ZRLA 1VHTA 4RV5A 2IYUA 2O8NA 4R01A 3MHTA 2HF7A 3A4IA 2VDWA 1T36A 1BWPA 3H5AA 1G17A 1UPAA 2P9HA 3ONWA 1G66A 3FLMA 3QEOA 4QBTA 4X6LA 1PDVA 3LQ4A 5IANA 2OD2A 5JMTA 3ZQJA 2OAP1 4M0LA 1M2OB 4DS3A 1U9CA 4LVCA 4YJHB 5EE5B 3FNQA 3BICA 1YD7A 1V5EA 3DFKA 5EJFA 1EM8A 1PDOA 5I5GA 4MQMA 4RK0A 3UWDA 5E6SA 2CLCX 4CF7A 3QX3A 4GOOD 4B32A 3MWDA 1MMFB 1RD4A 1XFDA 4D0LB 2QI9F 1WLSA 1QR6A 1NUUA 4NTZA 3A3KA 3ILYA 2BEVB 3KQNA 2H08A 2DHRA 4LDRA 4Q1CA 4PYQA 3C24A 2I3AA 4IEIA 4ER3A 4W63A 1J7JA 3FOBA 4LZLA 4TKVA 2H48A 1D1SA 5TQ0B 1ANKA 4ZDIA 1PFQA 4LOAA 4DMHA 3GEMA 5FBVB 4O8ZA 2GN4A 3UCXA 3ZI4A 2I4MA 2XUDA 3P71T 4UAUA 1Q1ZA 3WYAA 5DW3A 4DLKA 4EI9A 1CQXA 2J85A 1G16A 3C3PA 4A0RA 1ZAKA 5GINE 4J0JA 1Z88A 1C14A 1FP6A 4JJ7A 3BCHA 3ZD6A 4BO8A 4PO9A 3UUEA 2C42A 5ALWA 4I6EA 1T3ZA 1PL0A 3IQWA 3GQVA 4G37A 3U9SA 5CEEA 5G1PA 2Q99A 1Y48E 3TFWA 2O0LA 3RVBA 1WPXA 2DC1A 3E1SA 3QFFA 1DZ3A 4YJ2B 4D5EA 1HDOA 2NPFA 1PT9A 4TSFA 4EJSB 1QKIA 4HEA1 4TGLA 1O5OA 1YK1A 2ZIUB 4HLQB 4EENA 2HBRA 1JAZA 2BKUA 1UWCA 4QJIA 4RAOA 3RRBA 3SQNA 3WL3A 3K20A 1Y1SA 4RD6A 4ZCRA 3U4GA 4HFMA 1C9MA 1X7YB 4QXAA 2AZXA 4Y2PA 1I80A 2ONYA 3FY4A 2H52A 3ZU2A 2JEZA 2DY1A 5D1NA 1D07A 1B2LA 5G3YA 3AM4A 4HQRA 1TTQB 2GJ9A 4JA2A 4WIAA 1VC2A 5D7NA 2ZI7A 3VBEA 3ZY5A 4EYEA 2NO1A 3DBRA 4JGGA 1V47A 2G17A 1V35A 5J40A 1C7IA 3OT1B 4WZ6A 2K7ZA 2Q5OA 3F7TA 3TJZA 3DKVA 5B36A 1SBZA 1U8XX 1ECFA 2WQ7A 3D6UA 3I9KA 1R4ZA 2QVZX 2GK6A 3L7NA 5T6BA 3WGKA 4G86A 2GFIA 4G65A 4MVWA 4AQYB 4UFNA 2F9LA 3T3OA 3RJTA 1J1ZA 2WM9B 4RM2A 2ODWA 3PHGA 3UXYA 1A0OA 1DJQA 1CY7A 3VKGA 3ZK7A 2V7QA 4NS1A 1JE0A 1Z62A 1QDLB 2ZYHA 4A5OA 1XLUA 4CQLA 2C1XA 3QVJA 3M1YA 4NV0A 4R9UC 1FP2A 1PCXA 3G0IA 5LA6B 1RMTA 3VNAA 2PWZA 1ZD1A 2IEZA 3AR5A 2P11A 3R5KA 5L3QB 3HLYA 2VG8A 5C4MA 3QVXA 3B85A 4GBJA 4PHTA 3GYBA 4BFSA 5F1YA 4V2IA 1LUAA 2WTEA 1E9AA 3ZWBA 4C06A 4PLWA 4ZQFA 1RFLA 2QKYA 1TUBB 3KEFA 3S99A 4RF4A 2XB2A 3CLUC 3GFGA 3T5TA 1P6UA 3F6RA 1KY4A 2OSBA 3ZW8A 2QLNA 3LWBA 1Z73A 3F4BA 3OM0A 3CLUD 5I8WA 4KFCA 2I2FA 2PQ2A 1DLIA 2VJBA 3GXBA 4B2IA 3PSAA 4DCGA 5LU9A 3S8MA 4MW9A 4RH3A 3B2NA 1V4VA 3I2FA 3PEUA 4KODA 1BCSB 2A1UB 2I71A 2QRQA 3PWSA 4FX2A 1NGSA 2IY7A 3MT0A 4QBHA 5EKDA 3UENA 3ZYCA 3H4VA 4E1VA 1VJDA 2EFDB 1ZHFA 1M5UA 3B5EA 5EFOA 4BMVA 2QY6A 1FS6A 3DTVB 1YJAA 5FD8A 3V8QA 1LX7A 4DLXA 1SD2A 4RTNA 1XTVA 2G4VA 1QGAA 4IGFA 3FHOA 4NU5A 3T3IA 3ZTTA 3ICVA 3M6MD 3SEFA 1JBKA 4EL5A 2PRJA 3NNDA 2O7SA 5HEKA 1XKLA 3LYUA 3OPYB 2ZZNA 5IJXA 3FVTA 5AVWA 1DBPA 2P2SA 1EBBA 2AZ4A 2BF4A 2PWAA 3N8HA 4IO0A 4KOEC 1L5VA 2Z57A 3A10A 4OHPA 2EW1A 3R7AA 2OQRA 4N3NA 4P22A 4BFCA 1QH9A 2W48A 3J7TA 2DGDA 3P96A 1XEWX 1ESEA 1CUWA 3QUQA 3F7MA 4MVJM 4G3XA 4YT5A 4E09A 4QULA 4QWMA 4MOWA 4D8TA 4YRSA 4TMZA 4X5OA 1QDEA 3WKBA 2JJ1D 4B40A 2O2SA 2EQBA 3JWPA 3VJLA 4CMEA 2FPIB 2XMSA 4DDMA 3ZV6A 4B2LA 3QV1A 4DWWA 4JR2A 1QE5A 1T9GR 1R74A 4D0SA 1GPBA 1TYZA 2WU8A 1SCKA 3V4SA 3U9TA 5TIIA 3WOHA 2VZ9A 2GYYA 5DIFA 3PDHA 4QGHA 4NMXB 2Q29A 1E2GA 1SG6A 3N2KB 5SYAA 3FOAA 3VPSA 4M0KA 1SXGA 4G4SO 2C2XA 1EFKA 3ZHTA 4XIGS 4KYIB 2WJPA 1ADJA 4KN6A 1GIAA 3PQ8A 1QV9A 1JILA 3R9WA 4XGIA 4XQ0A 2H54A 4OIFA 3D59A 5AKXA 4YUZA 2O23A 4NPAA 1L5FA 2Z3WA 3TW8B 2H2WA 2UYQA 2GTIA 2K2WA 3OTOB 1LLDA 2GMWA 5JAPA 4U2CA 1W87A 2IP4A 1M2FA 4BKQA 1JECA 3N59A 4NPHA 1K4YA 1RBMA 2ODAA 3EXIA 1W85A 3UATA 2RD2A 5KWJA 2C8VA 2FSIA 3F67A 4HLDA 4PGAA 1V6AA 5TPZA 3UVEA 4HS9A 5DN9A 4C07A 1RXVA 2J4FA 1QGUA 3M5PA 2FP4A 3UTDA 3AM1A 5CITA 4P3XA 2WR8A 3R2JA 1EZ1A 1H6AA 3KQTA 5K3DA 4OYHA 3VR1A 1F7UA 4OL9A 4G0QA 3QE3A 3E9RA 4H1UA 4XRGA 3RU9A 2P8JA 3W5IA 1DV1A 3DP9A 4M6WA 2BTEA 2YVUA 4MV4A 2Z30A 3D02A 2VK1A 1HUQA 3JQGA 3L18A 4FINA 5F3DA 4EI8A 5BQXA 4GLFA 5D00A 2ZBQA 4ZDKA 1FU7A 2M32A 3HO8A 3N58A 4TPKA 5D3QA 1JT2A 4OYLA 3ZOKA 4PQRA 4MVJP 3W7AA 3IT3A 3LKBA 1O54A 2FR1A 5HF9A 5IG2A 1VKHA 3BIFA 4R51A 2GK3A 2OHGA 4XLZA 4QE3A 4MYRA 1KJNA 3SC2A 3K09C 4M9CA 4RW0A 4W1QA 3LCUA 3MC1A 1PK8A 1HDGO 2EP7A 2H1CA 2W8BA 2DCUA 3W5UA 1T2VA 4POOA 5IHXA 4LSGA 4HZIA 2RG1A 1YK0A 4TL6A 1OH5A 3A2NA 1H8HD 3MBIA 1RWNA 1E92A 3RVRA 1G9TA 2HRRA 3HS3A 3IA7A 1WVIA 4DUGD 2DECA 1DOAA 1QHEA 2I4NA 3GLIE 1DL5A 1VECA 3IBGA 1O94D 2JGIA 4RC9A 2UU9B 4Z4QA 5ALQA 4L3OA 2BFMA 4AROA 1GGVA 3TLXA 1GG8A 5EXTA 3A0RB 3UAGA 4RACA 2JANA 3WXMA 5E8JA 3RC8A 4DC1A 1J4AA 1T9GS 1XQWA 2OM2A 4JBIA 4QQKA 2VXOA 4FYKA 4OMDA 2C96A 4ND5A 4LOIA 5E95A 4B9EA 3D8TA 5CAEA 5KX5B 3FJYA 4J03A 4WOBA 1RXSA 2PUDA 1K92A 2Q5LA 5H16A 3IP9A 4BCDA 2R0QC 4DDWA 4KGVA 4XD7A 1TFUA 3SCZA 4G5QA 4OJTA 3H1AA 1PK9A 1TM4E 3GP3A 3ND6A 2J5QA 3TXAA 4C4AA 2ZZMA 1KGSA 2O6LA 4FCCA 1YH3A 2NQ2C 4I2NA 3RAEC 2PZAA 2OVFA 2QNRA 3ER9A 1V5IA 3KT8A 1I7SB 2WW8A 3K4HA 1C7JA 1PJBA 3ZWOA 3L7MA 2PJDA 5NLLA 5KO2A 1FDUA 4Q7LA 4WKOA 3ELYA 4NONA 5DCLA 1ATZA 1WXIA 4GYJA 4YXWA 3IDAA 3LDHA 3PJRA 3AU9A 2CJWB 3C4JA 3GJ6A 4JYZA 1Q0UA 1M2VA 3DDWA 3KLBA 3LLVA 1HEYA 4EKIA 2VT3A 4BX3A 1JIKA 3NHSA 4ML3A 1JEQA 3KB8A 4INPA 4ZI5A 1T5LA 1XZPA 3ZI7A 1CB7A 2NGRA 4CF5A 3U4QB 5HCUA 1MDFA 3INYA 4L9WA 2Y9MB 2XSZD 1H85A 4CXMA 4LV5B 1QHYA 3UK1A 5JYEA 1JSRA 1S2IA 4NMWA 3IV6A 5FOSA 2PZLA 1FLNA 2X9GA 1US8B 3KZKA 5BR7A 5K5EA 2P5TB 5ALOA 3FI9A 3E48A 3SFZA 5TLSA 3L6EA 4PS1A 4TTRA 1WBDA 3BGSA 3D8UA 4IJ5A 2VCHA 3HRIA 5JS6A 3AR4A 4UHDA 4EZEA 3QG1A 5CJJA 2W6IA 2VNKA 4REQA 1P7WA 1UMBA 3FDZA 2VRBA 2QN7A 4CN9A 2JB9A 4EGJA 1BIFA 1CG6A 1YXMA 3UPTA 2CLOB 1D3AA 2HZ7A 4E15A 2IYZA 3N6XA 1TC2A 4UHFA 1U63A 3ZD8A 1JSLA 2OBYA 2R7MA 2HT6A 3S7ZA 3UAWA 5LQKA 1ODKA 3OEHA 4PLHA 3LXMA 5EIOA 4YCSA 4XQGA 1TAHA 2VF7A 1S2GA 2ZE8A 3KJEA 4MR8B 4M0MA 3RNLA 1V3UA 3HP7A 4W5OA 1VJCA 5F7JA 1VI5A 3QBDA 4DCOA 1I4LD 2CZCA 3ILVA 2C54A 1QV7A 4GKAA 4OA8A 3VNBA 2XDWA 3A1NA 3PUYA 3SD7A 1VCOA 4EG0A 5KBYA 3I9OA 4HAWA 1OH8A 5E1DA 4Y0AA 4G1UC 1RHQA 2R87A 3H19A 4G2NA 2QMZA 3A06A 3K32A 3QXHA 1TQHA 4XQCA 4FKBA 5H4GA 3L4BC 2PSFA 3EVCA 4MLZA 1A95A 3P9RA 2AC4A 3K70C 2XMGA 5FNVF 1P44A 1VYVA 2YWBA 3HJBA 3S2FA 2WE8A 3WWCA 4AKTA 3LHIA 4G0WA 5KJFA 3F7OA 5HILA 2NXEA 1F1JA 3ADOA 3L8MA 5CIWA 5K3SA 1MZPA 3BGOS 4AMZA 4BNTA 5JS8A 5FOTA 3OPXA 1UM8A 5FL7A 4MJLA 5IZCA 1Q14A 4HK4A 1PD0A 1ECJA 3CN9A 1Y0BA 3AWIA 4EAAA 2XXJA 4PTZA 3FJOA 3K5HA 4MW5A 4DDKA 1HDRA 4FI3F 4IEEA 4NPCA 4ON9A 4RD3A 1VG0B 1YFLA 5FUVA 1VLVA 5KI6A 4D7AA 5I3CA 3FPHA 2RC6A 3DQPA 4EY5A 1D4AA 1FOEB 1Z0KA 3UMSA 5K09A 1I7QB 4EMBA 3T95A 2XMBA 3RADC 3G2MA 4TKUB 2BGNA 1MQAA 2AOUB 2V55B 1Q6ZA 1EZZA 4BQIA 3LWNA 4A8JA 3AEXA 5H70A 1CNEA 1G6OA 2X77A 3TLCA 2D4AA 1JT9A 1U0JA 5DHRA 3T5CA 1JDJA 4HXGA 4PNZA 4AKGA 1UM9A 2ZVQX 3FCSB 4EI2A 2BISA 2Q4RA 1CNFA 1V8FA 1SURA 2VYVD 3B3GA 1JNXX 3N28A 3TG8A 3N8DA 3SN6A 1TRKA 3KQYA 4HN4B 3L7IA 3OCXA 4M1QA 1RHJA 1N8NA 2HIHA 1I3CA 3D6JA 2Z08A 4D9KA 5JW6A 3ZGZA 2C98A 2RH9B 2BPOA 1OU4A 2HHAA 1QG2A 1ODCA 1KK2A 1QH1A 3L8DA 4J16C 2XE8A 4XD7D 3UUFA 2BGJA 5CM2Z 1A50B 3GJ7A 3VHQA 2R65A 1TTPB 2PMDA 2ENWA 4G0ZA 3VPCA 1OLSB 221PA 2ENUA 1ZH2A 3A9RA 2J7PD 1VKOA 4R9VA 4TYWA 2Y92A 3QVOA 1RHUA 3ACBA 4ZCLA 2BFDB 2NG1A 2YOHA 2GEFA 4K2HA 5JQGF 1WXEA 4JB2A 4TN5A 2X0JA 4EUFA 1QP0A 1OFIA 4RPCA 1K98A 1ZJYA 2AEJA 3DUWA 4UNRA 3LOQA 3RUAA 1SOVA 3RFVA 4JAVC 3SU8A 3VRHA 1GKLA 2ZEJA 3EE6A 3HB5X 4A1FA 4B7ZA 2VJLA 3T9EA 3HADA 2W6JD 4MWZA 4BL5A 1Q6YA 2Q3LA 1X8KA 3N86A 1X7WA 4GMGA 2B8NA 5M34A 4ZEMA 1H9AA 3B12A 3ER8A 1XJWA 4H77A 3UJ9A 2RHWA 2HY7A 1YR8A 2CUZA 3HJGA 4C6SA 4Q66C 4U5XA 2VKQA 3VZPA 5JZMA 1KO8A 1O5TA 1GPDG 1HLGA 2GR9A 3CLVA 3QG5A 2H1FA 1G3MA 1WDKA 1ZGGA 3H83A 4RPHA 4BVGA 1TKRA 1PEYA 3EA5A 1ONOA 4DB2A 3MZ0A 3PXCX 1JDPA 3CHYA 3KXKA 5JBNA 5FO0A 1GQ2A 1FX0A 5KWSA 1RWVA 3HNRA 5EZSA 4OQLA 3RASA 5JJCA 1QYXA 1XMQB 3VYWA 2HEGA 4IJMA 1DDOA 3VHXB 2V74B 4WUVA 2PX6A 1R9GA 4LBYA 2OLKA 4FDMA 4TXNA 4FK8A 2P4EA 1FYEA 3G5LA 3D0QA 5G4KA 3KVOA 3L79A 4H17A 3SSOA 2YQ5A 2ZDGA 1BDMA 4OJKA 3U44A 2R4QA 2QR3A 4NJEB 2G63A 1N34B 1QO0A 2BM0A 1FYVA 1ODJA 2WIDA 3EVAA 3R5SA 4BX2A 4DUZB 1EHCA 1DIAA 4KQIA 2QW8A 4EYKA 2QE6A 1Y4SA 2FDCA 4KLRA 4PYOA 1MRSA 1XQYA 1F8FA 1VHQA 3NHUA 4DV7B 1HBJA 2BI8A 3JVVA 1M8GA 2FQQA 4WOJA 3T6KA 2EXXA 3MF4A 5L7YA 1Y4DE 1ZRNA 1UC8A 2DUUA 2Z04A 3GJQA 3L07A 3QXSA 4G9BA 1CDEA 2H5JA 3AUKA 1LNSA 3Q10A 3PWTA 4HAOA 2PUGA 2DWUA 2G06A 1R8YA 2E4AA 2FHPA 2VH5R 4XD2A 1EZ4A 4P0TA 2BFBB 3TBFA 4EYGA 2PUAA 1E5DA 3G85A 1TXGA 1N7JA 1SUFA 4W9RA 5CX4A 3MUNA 1S89A 1MB0A 4JJEA 3JZMA 1RI2A 5L4NA 1E5LA 2H4HA 1UBGA 3ILSA 3I9JA 5AI4A 1LBHA 2GEUA 3BFKA 2WG2A 1UK9A 1BS9A 4MI3A 3N2ZB 4CMIA 1XYYA 2WT9A 2WVJA 4YCDA 1M73E 2W4MA 4CL3A 1PQPA 2AMJA 1ZBQA 2EIXA 3IMKA 4N7MA 1DKOA 3K09A 4L5JA 4MKIA 1P80A 2HHLA 4EFMA 5BNIA 2JAXA 3HGQA 1ZL0A 3GJ0A 4EDHA 1CUGA 1W5EA 2YV5A 1M54A 1I0LA 3IPCA 2C95A 3QGMA 1YS1X 3P9QA 5IABA 4F4JA 1XXLA 5IJWA 2AMLA 1G64A 3EXG2 3O2NA 4Y7DA 5IDXA 1BDJA 1E1YA 2LIPA 3PQ3A 3NBXX 4EECA 4EHIA 1H6BA 2NP7A 3AKEA 4HQLA 1DTSA 3TFOA 3DR3A 2OYCA 4O29A 2MINB 2QTLA 3HHEA 3IEMA 3C1AA 2CDAA 1UK7A 1U8FO 5CLQA 2VYND 2FN3A 1B16A 1JR2A 1C8KA 1K7YA 1X92A 3IVRA 3ZWNA 1E1LA 2C07A 3GWGA 2Y1DA 4C4SA 3AINA 2GDJA 3PRKE 2WTMA 1KORA 1BMFA 4DVGA 4DLUA 2C5LA 3SJUA 3WGNA 1O96B 1YJQA 4KE6A 3UKJA 5BOSA 4K1XA 2J07A 4OQZA 1IDN1 1PT5A 5FTNA 1IN6A 1KBZA 3KC2A 4URZR 2WB2A 1H2BA 1J06A 1E4OA 3R0XA 3UJDA 4C7XA 3IQHX 1I3OA 1NF3A 3FHTA 1DARA 4XIIA 3SXUA 2ES4A 4CF4A 3BWBA 1WCV1 1U7XA 3NNSA 1AS2A 2GBLA 3Q6MA 3ZIUA 4F46A 1VIMA 4A9AA 1LPPA 3PC7A 1Y4ZA 1O4WA 3WLOA 1E7SA 5FYDA 3OX4A 1HMPA 1TCUA 3U0VA 5LJIA 2Y0BA 1YZQA 2QR5A 2AK3A 3CRNA 3IPRA 4MR7B 3KOXA 1UBTS 1JA9A 1GAJA 1LQ2A 1WM1A 5FBKA 2R48A 3HKBA 2I7XA 2C2BA 1FDTA 1EFLA 3NHPA 4RZUA 2IOFK 4DSOA 2YHSA 2ZIWB 2XH8A 1AMUA 4CMEC 5BV1A 4MVJE 1TTTA 5A6SA 1RKXA 2GZAA 5HYVA 5CB4F 1QZTA 1P2BA 2P79A 4FHFA 1K8QA 4YHBA 1Z5VA 1H1DA 2YHBA 3GRFA 4EHAA 2V7WA 2ECFA 3PPYA 1TL7C 1W4CA 5IPFA 2SKEA 5L7TA 3VM6A 3G2KA 1V8PA 2FU5C 4X1YA 3O94A 4OA5A 3VO8A 1P5FA 4FI3C 4C2AA 4F4HA 5KAPA 2D4HA 4Z4GA 4FEGA 3RJZA 1E6MA 2FWIA 3FDFA 2V9PA 3G59A 2VSOA 4MGYR 2J5XA 5F4BA 1KMCA 4LF4B 3GLUA 3DZKA 4MZDA 3NGLA 4KO8A 3MUEA 5HGJA 3JD1A 3PYXA 3SVLA 3SX0A 2KYRA 2R6ZA 5FYQA 5TPWA 4MWTA 1ZBDA 3JX9A 5H02A 3KYCB 5FA6A 1FB5A 5BN4B 1E1NA 2C94A 4RMIA 4WNCA 1DKLA 1G7RA 1YR7A 2GTPA 3MOSA 3OE7A 4G0VA 1ISMA 1C3EA 2E1RA 2YXDA 5I9SA 3HB4X 4I81A 4RK1A 3OOEA 3BB1A 2AJ8A 3VR0A 3ERCA 1Y8AA 1WIWA 16PKA 3EODA 1DC4A 1S1CA 2HFJA 4XUCA 4D9FA 5DTQA 4OAPA 1WOMA 3DNFA 1CVRA 1DBSA 2NMVA 4ARUA 4DFDA 4P31A 3RYCB 1E9RA 3B6ZA 4M1WA 1G42A 1JP7A 1F4VA 3G7SA 4E2ZA 1V45E 2J3HA 2JCSA 4V24A 4HX2A 1XZKA 3BRSA 3HLTA 3ZXIA 2LVBA 4UOQA 4AMUA 1PWYE 1PL8A 1XX6A 5E9AA 3WBKA 3FG9A 3MWLA 4HNAA 4NY1A 2OPHA 3ZGXA