4J8PA

Crystal structure of a putative flavoprotein (bacuni_04544) from bacteroides uniformis atcc 8492 at 1.50 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
156
structure length
156
Chain Sequence
KGGKTLVAYFSATGTTARAAKLVAEAVDGTFYEIQPAKKYTAADLDWHDKASRSSVEMSDSKSRPALYSKLGSLAEYDTIYIGFPIWWNLAPRIINTFIESGDFAGKTVIPFATSGSSSISNAEKELQTNYPGINWGKGRLLNGASRETVKQWIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Crystal structure of a Putative flavoprotein (BACUNI_04544) from Bacteroides uniformis ATCC 8492 at 1.50 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Flavoprotein
total genus 47
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12682 Flavodoxin_4 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j8pA00
4H2DA 5LBUA 1XYYA 1FX1A 1T5BA 2QR2A 3QE2A 1H66A 1DX9A 4ICIA 1AKUA 3FJOA 2FX2A 2OYSA 3FW1A 2W5UA 3GFSA 4HEQA 3NHSA 1SG0A 3FX2A 5LLDA 4ESEA 1YOBA 2QX4A 2WC1A 3B6MA 2HNAA 2FZVA 1C7FA 3K1YA 1AKQA 4C0XA 1CZKA 4GI5A 5F4BA 2X2OA 1KBQA 3W78A 1OBOA 1J9ZA 3NHJA 4FGJA 2MWMA 1D4AA 4U7HA 5LBTA 4DILA 3NHRA 4YAOA 3OJXA 1OBVA 2OHJA 2QX8A 4ZVMA 6NULA 1KBOA 3OJWA 4H6PA 3B6JA 3G5MA 3OX1A 1AKVA 4NULA 4CF6A 5FUQA 1JA0A 5EA2A 1QRDA 3FVWA 2M6RA 4LTNA 2R96A 5ULLA 1RCFA 3LT5A 2FZ5A 3GFRA 3NHKA 2MTBA 1E5DA 1J8QA 1CZOA 3ESZA 4QOHA 3UXEA 3JSXA 3EDOA 3HA2A 2HPVA 5LVAA 4YQEA 5FA6A 3L9WA 4PTZA 4ZVNA 5NLLA 2BMVA 2BZSA 1AG9A 2R97A 4Y9UA 3RPEA 3FNIA 3GFQA 3TZBA 4YAFA 2Q62A 4C0WA 4OXXA 1YCGA 4QOJA 1DXQA 1NNI1 2BF4A 3NHUA 4Y9RA 1AHNA 1DXOA 1J9GA 1FUEA 1TIKA 3ESYA 4DY4A 2QWXA 4GR9A 3O73A 3LCMA 1CZUA 2QX9A 3OX2A 1J9EA 2BN4A 4D02A 2N1MA 3ESXA 4XDGA 3N3AC 3K20A 4LA4A 4C76A 1F4PA 4GQIA 1GG5A 2RG1A 4PTYA 1ZWLA 1CZRA 1SQSA 4FX2A 4BMOB 3UXHA 3KAQA 3KEGA 4QOGA 1OFVA 4U7FA 1XT6A 4QOIA 2FDXA 3NHWA 5B3KA 3NHFA 1RLIA 1XYVA 2QMZA 2X2PA 1CZHA 3O2NA 3NHYA 1AMOA 1FLNA 4YALA 5F51A 3U7IA 3W7AA 3R6WA 2Z9CA 1QR2A 1FLDA 2BPOA 3NHLA 3HR4A 4N65A 4Y7CA 5LMCA 4BMPB 4FGLA 1AKRA 2MT9A 3TE7A 4J8PA 4ZVKA 1QHEA 3SVLA 3NLLA 2FOXA 1FTGA 1YDGA 2KLBA 1YCHA 3F2VA 3QFRA 5BUCA 2HNBA 2V5UA 4QOEA 3OVMA 1BVYF 2Z98A 2V9CA 4N9QA 1H69A 5FX2A 1AKTA 1VMEA 1RTTA 2MOKA 2XODA 4LTMA 3N39C 2Q9UA 3OX3A 1YRHA 4R81A 1TLLA 3GAMA 4LTDA 3NFRA 4YAWA 3P0RA 3KAPA 1XI2A 3F6RA 1FLAA 1X77A 1ZWKA 5F12A 2Z9BA 5EMNA 5LJIA 1C7EA 3B6IA 4S24A 1WSBA 1AZLA 3HLYA 3D7NA 3EYWA 1JA1A 5EAIA 1YCFA 1ZX1A 2D5IA 3L9XA 4C14A 4ZVLA 4QODA 4FGKA 4HS4A 2ARKA 2GSWA 2Z9DA 1CZNA 3W79A 3OWXA 5NULA 1FVXA 2KQUA 4CETA 3ES9A 3NHPA 4XDHA 2FLVA 1D03A 2QX6A 3KLBA 4M0CA 2OHIA 3U7RA 5JROA 1FLVA 1BU5A 3B6KA 5B3LA 2FAXA 4LAFA 4U7GA 2FCRA 2A5LA 1AKWA 4NLLA 3QFCA 5A4KA 4PU0A 2AMJA 2ZKIA 4QOFA 5LJLA 1CZLA 1I1OA 3S2YA 1T0IA 1B1CA 2QMYA 1D04A 2M6SA 4DIKA 3F6SA 1YKGA 3F90A 3ZHOA 2B3DA 4F8YA 1QBGA 4YAUA 2FVXA 2OHHA 2F1OA 2V5VA 3N3BC 2XOEA 3W77A 1WSWA 5TGZA 4N82A 1RLJA 1V4BA 3TEMA 3OWHA
chains in the Genus database with same CATH superfamily
2A7XA 4W1QA 3ADBA 4U39A 2QLNA 2W6PA 1AIPA 3FI0A 3KUXA 3DZKA 2ET6A 2O05A 2C4HA 4ZO7A 4TYNA 1P7PA 4MVJF 3CLRC 3EVAA 5A3SA 4FXOA 3UV7A 2FEWB 2ZRMA 4FFSA 1GV0A 1LS1A 1C1DB 1M6HA 1EFCA 3EZGA 3IBGA 2JKVA 4D98A 3BD6A 3HADA 1JXQA 3PS9A 4MVJM 4Q03A 1DCMA 3D6TB 3SHTA 1F3LA 4ZJPA 2XDQA 5JAOA 2IHVA 1IBLB 4XJVA 4DA0A 1B8PA 1XDDA 1Z26A 4Y30A 1C50A 3A4IA 3UC9A 2RSLA 3HN7A 4P5PA 1P4AA 1X7DA 2H63A 3PXGA 2R8XA 1O77A 2A4KA 2O3UA 1DOZA 1YF3A 3DHWC 4QXAA 3RDPA 3DM9B 4X1OA 1IZ7A 4XX0A 5FI5A 4NATA 3CZQA 3R5FA 1FC0A 5DI3B 2OCGA 1M54A 2Q1YA 3OUZA 3IULA 3OIVA 4TLMB 5ITZA 4CIAA 3DZJA 3MCTA 5BMVB 1SOWA 2HU8A 1Q21A 3IUSA 4B76A 4O3FA 2GK4A 4DLVA 1SC6A 2AYYA 4LQDA 2Z08A 1M0WA 4YDQA 4HEQA 4PZ9A 4D4JA 1TF2A 3MWDA 2NZYA 2CLSA 1DRVA 2IU3A 1XLVA 4LDJA 4OAOA 3SS8A 3PGVA 3NB0A 3ZDCA 2DBQA 4CDRA 3HCPA 2JLAA 2FN4A 5L3SB 3FDIA 4YLYA 3KETA 1ZW1A 4I50B 1CNMA 3FUXA 3I2YX 4RQTA 3G2MA 2CUZA 3ETGA 3X3HA 1PEYA 2YYSA 3KCQA 4Y1RA 3UF0A 2MDTA 1E3LA 1NA5A 1U81A 4KIUA 3FHTA 4W4TA 4NHEA 3O92A 2QTCA 3M1IA 2XHZA 4K05A 4BX0A 1TQ2A 5CCXA 3SBXA 1AUQA 3T7CA 4GNKA 3QA9A 2X0FA 5C1BA 5C1OA 4AZSA 1W7AA 4DCUA 1MV8A 5JZMA 2DH6A 3F5SA 3N0RA 2P2YA 1P0QA 3WLOA 3FWHA 1L4BA 2ZVDA 1CUIA 1Q92A 2JLCA 1KY3A 3I6QA 4JA2A 4KXYA 4U0KA 1DJNA 1ZESA 3UCFA 1C3OB 3QUBA 3WGGA 1N32B 1RCTE 3OBBA 1XUOA 1EIZA 3OOHA 3WMGA 3VPBA 2X1LA 4Y6RA 1W46A 1P2SA 4YRNA 2FMXA 1DT3A 2BYTA 1SBNE 5B3JC 2BFDB 2IYNA 3D3QA 2G9RA 3QYAA 3JU3A 2QD1A 1VYUA 4PZZA 1Z68A 3G7NA 3IV6A 4M88A 5E9WA 1NN5A 2HQBA 5DKFA 1H0HA 3IQFA 3OESA 4I5IA 5HK8A 4N7RA 3RROA 5JAIA 3HB9A 2MWMA 4FINA 1D4AA 1T2DA 2GTPA 2PXHA 3MRXA 2O8CA 3AJ9A 5JXGA 3STYA 1K6JA 3DZ8A 4YAOA 5DM4A 4WLUA 4GMHA 3WA6A 2AEFA 3CX8A 4OQZA 1JIIA 1LK5A 1CUXA 3DGFC 1DQYA 3QY0A 4KR0A 2G36A 1JG7A 1QH8B 2A0YA 4MPJA 5EZYF 2XIJA 3F8TA 4AECA 1WVIA 2QX8A 2WJ4A 5DPMA 3D6HA 3JQ7A 3L1IA 4ZRMA 3JAKA 4XX1A 6NULA 4GE0A 4BU1A 4GR5A 2Q6LA 4BJ5A 2GPAA 2B7CA 4GG1A 4R2WA 2HDNB 3IQHX 4ALLA 4FBMA 1BZYA 2CLHB 2PXCA 4JITA 4DBLE 3RUDA 3N07A 3A1WA 1QV6A 2JGMA 1JA0A 4PLPA 1FS4A 3COYA 5H83A 1II8A 5EKTA 3WFZA 1Q5PA 2X8WA 2H2GA 3IKJA 4KTTE 4O2RA 5LIRA 4JP5A 3HEMA 4J94A 1QSGA 1RLUA 1T29A 2IW1A 4ZV9A 4TUYA 3EDCA 2QSUA 2E4YA 3HU1A 1P19A 2R5WA 5JNVA 4K6CA 1PFVA 2FSVA 1R1DA 2ZUSA 2VTBA 4ZTZB 2F43A 3LT5A 2VH2A 3M5WA 2X9VA 1FQWA 5AHRA 4E33A 4AO7A 1FXWA 1L5MA 3W4KA 4DJEC 2O2SA 3AVPA 1KEUA 3GFRA 4R9RA 1FB5A 1Z83A 2Z5LA 3BXXA 4OLAA 5E0KB 1BE8A 2A67A 4J0GA 1SAYA 2O1SA 2DWUA 4AIRA 3AF5A 1JAIA 3HVKA 2WUFA 4WKBA 3ADOA 2X0KA 2Z1DA 1C2YA 2BTQB 3NBZC 5HCUA 2PWBA 2XUGA 2ZU6A 5A04A 3LO5A 2J4CA 3TLMA 4HWOA 3CSSA 1WCWA 1LRKA 2MYTA 2GBGA 5D6NA 4D6PA 4JVMA 3WDMA 4MR8A 4Z3KA 5J2UF 3VO2A 4NV0A 1MBZA 1CDOA 4HUQA 3LQRA 3KR0A 4NCIA 1AH2A 5J2TB 2Q0XA 4IKOA 2JG3A 2ZZMA 3FCCA 4L57A 5BN3A 2X4DA 1HX7A 1Q14A 3WWEA 3GFTA 5K8UA 2J3IA 1ZEJA 3HACA 4P4SA 2J6IA 1VI6A 4UBIA 4H6VA 3WK8A 4P98A 3DB2A 3TW0A 1LW6E 4WXEA 3LLMA 1EVJA 3PL1A 1YS2X 5EIHA 1IOWA 1WLYA 1F4LA 1KJJA 4LXGA 2ZE7A 3VR3D 3BMOB 4KIJA 3WGVA 2R3SA 2BSXA 1K6IA 4EG4A 3D7MA 2PGOA 3ENVA 3UWSA 1ZJYA 1HOXA 3ASZA 1MB3A 4LI3X 1NNI1 1KY2A 3AIIA 4BJ1A 2AMYA 2IDJA 3EZFA 3OZBA 5I9TA 1OE0A 2HWWA 2XBLA 2IV3A 3RVPA 4K9QA 4XRGA 3L4KA 1N2CE 2YHIB 3RSQA 1MPXA 3V4SA 4UOEA 3P2JA 5FFNA 1LDYA 5SYAA 3RBZA 3T4EA 3VR1A 5AI5A 3RRBA 1XXHE 3G1TA 3K35A 2GPYA 5CVVA 2VYND 3WYBA 1QFYA 2B78A 1LVUA 2OBNA 1BWPA 1OLXB 4QBTA 3LCMA 3ZCUA 3KOXA 4YP9A 4HOYA 3TO5A 1J9EA 3WJ7A 2UZIR 4H77A 1O8BA 4XI9A 2OK7A 3R41A 5FWXA 1CDEA 2GVDC 3IS3A 3H0EA 3RTGA 3WVNA 3X0DA 3D0OA 3U3JA 3ROKA 5J5AA 5JMOA 1GTJ1 3Q72A 3ND7A 3USES 1ACJA 4HYQA 3AZQA 4X97A 1QXSA 4COKA 1F4PA 2QRKA 2SNIE 4OGKA 5KQRA 5TJ9A 2EYUA 3O84A 3MT7A 3IP1A 4X9XA 1FVOA 1U2RA 5K03A 2PGAA 2WU0A 3KJGA 1E62A 1F2UB 1VRWA 3KJQA 4ZOLB 1PG5A 4ZKEA 5C8YF 1YJCA 5DULA 4N8SA 5EFZA 1G19A 2WQZA 4GKAA 5AT1A 2HA6A 3D5EA 1SKAA 5COQA 4BASA 3INNA 1U3VA 1K89A 4M0EA 4MSUA 3UAOA 4TVBA 1OXKB 2J9XB 3QEMB 3KT6A 2DHCA 4G8JA 4K9OA 3ZNOA 3FDFA 2I8AA 3DDSA 3Q0EA 2FHPA 3S68A 2PKQP 3DWIA 3U3XA 4H7PA 3FFAA 1OLUB 3H5RA 5CFOA 1EGMB 4P6VF 2IEGA 2IOFA 2GGSA 4JYPA 5A5DA 3ZCXA 4LBZA 3GEPA 3V46A 2Q21A 3IJPA 3NDPA 4FN5A 4PWZA 3IAM1 3QPWA 3SY8A 2W0SA 3I61A 1Y80A 3F0TA 1VFPA 3K0FA 2AQKA 3VC3A 5KU1A 3JYLA 4HEA1 5EIEA 1XYVA 1ZN9A 2AFHB 3KKMA 1DO2A 4R69A 3H2BA 1H0KA 1SRRA 2HYIC 4G5SA 3E7DA 4XFDA 4BN4A 3MAAC 3K1TA 5KSOA 3GARA 3OIFA 3JD4A 1Z56C 2ODEA 3RKUA 2BEUA 4OMDA 4UMEA 1KF0A 4NABA 4HBGA 1YD7A 5KAMA 2R87A 4ZCLA 4LSWA 4C6TA 1YZQA 3DOUA 2QOEA 1CVRA 2O9JA 2QW8A 2QLMA 5F2EA 2OXRA 2JW5A 3IA7A 4YO7A 1LNSA 3OP4A 2PZEA 4IUCS 1HFJA 2IWRA 1TPZA 1RM5A 4KWCA 4BMPB 4DYDA 4FR0A 5KYTA 1OVMA 5JMTA 2Y0DA 1OTYA 4ZVKA 2BEJA 3L07A 1LPNA 3F7TA 3FNGA 3ZQJA 2IYXA 2I80A 4K3UA 1KYZA 5C35A 1U0OC 1V7PC 1JDJA 1EPUA 3ZDZB 4H1VA 5EOVA 2GAOA 2UZ1B 2WE7A 1KNXA 4RPGA 2Q3JA 3HN2A 5IVKA 1RC0A 3INRA 3IP9A 3WBKA 1T9DA 3ZBPA 5HWSA 2Z98A 1O94A 4KFTA 3WA7A 2XYPA 4PGHA 2C1EA 1XZQA 2V9CA 4JK3A 4NX2A 1CBUA 1OKKD 1J2EA 3LOQA 4JP8A 4YI5A 5EE3A 2WB2A 2PU7A 3ZVMA 2H2FA 3DXYA 4F11A 3JQBC 3GZJA 3RBXA 4WKPA 1RI1A 3SZLA 4A16A 1JFFB 3G79A 2HF8A 1GTVA 2J08A 4LISA 3RWBA 4KXMA 1QQ7A 3UGTA 4D3DA 4HQFA 5DHUA 3O7MA 1I3CA 2FP4A 4EF4A 3S7ZA 1QH0A 4XSVA 1DC8A 1O97C 2FZKA 2P4EA 3W5DA 2P6MA 2O2ZA 3TLCA 5LP6F 1FU7A 2IK8A 1ETHA 2RKWA 3OECA 4Q34A 1TLLA 1VG8A 4R81A 4TTPA 1MX5A 1YJBA 5FJJA 4RGQA 1CY4A 1DIRA 4W7IA 1U0EA 3I42A 3ZCPA 4ALIA 5JI2E 3V4RA 3KAPA 4YDHB 2WOOA 2QTVA 4NPCA 4LJ9A 4WW0A 1QOQB 1NDHA 1PFKA 4G24A 4UAUA 1ONNA 4W9NA 3W3ZB 3ZHYA 4AJLA 3SF8B 4F0JA 1N0WA 5KNCD 3HK2A 2GK7A 4N39A 3WB2A 1QGDA 2PUAA 3G89A 4JJIA 3PT5A 4A2CA 1PYOA 4BDSA 3KSRA 1D4ZA 4FYMA 2HO4A 3SIPA 1WSBA 3DV0A 4D3FA 2J59A 4BIIA 4FFBA 1IUOA 3NTXA 4JT4A 4DRZA 4EUSA 3FM9A 1GZHB 1MT3A 3LPDA 2GN2A 4HAZA 4QO8A 3ZHUA 2ZRDA 5K0NA 4ZVTA 3FE2A 1MVLA 2XVYA 2AFVA 2J0UB 2VDRB 3B3AA 2YZ7A 5G4KB 4X90A 3PXAA 2B2NA 4BB5A 3WKDA 1G2QA 2YWRA 1G0NA 1J99A 2WF9A 3IO3A 4L22A 4WASA 4ZVLA 1I6LA 1GYRA 2GN6A 4X0EA 3DLAA 2WZCA 4TYYA 2YZ2A 4UE3S 2GSWA 4NKRA 2WIAA 3BH0A 3GZ4A 4KAXA 3B6EA 4UULA 4Y2QA 4BNWA 1G17A 2AMVA 4R8SA 2ZR8A 1KORA 2FEPA 2XX3A 2ORVA 3BDAA 3INTA 1XOIA 2C3MA 3MOGA 4ZCSA 3T3OA 5KJEA 3SX4A 2NV0A 1E2DA 2XW6A 3QW4B 4P3YA 4MS3B 3LYUA 4HMOA 4YJ2B 4BNMA 2IPOA 1GN9A 1QX4A 3ONEA 2VPPA 2WTBA 3PDIA 1B26A 1UPUA 4XQGA 3V7UA 3ZZUA 4PR3A 1JXAA 2IELA 2P11A 1PL8A 2VXOA 1YZLA 3PHIA 4G36A 4QBIA 4WADA 1D03A 4WPGA 4XDZA 1V25A 3NETA 4ZCTA 2RH4A 1RHMA 2ZJAA 1Z4MA 2XMCA 3WQQA 5AI4A 2AOXA 2C0QA 2I2DA 4M0CA 4CGZA 2J0EA 3TSOA 1KHTA 3D4LA 3AL3A 3LY9A 2XE8A 2I4MA 3L06A 4V0OA 5J9FA 2ZE8A 3V6MA 3V1KA 2G82A 3ZE1B 5A02A 3RHTA 4BQFA 4ZYTA 3WGUA 1G5IA 3MWEA 2QV0A 3DB1A 4DR6B 2N3ZA 4L0QA 5CVUA 5BWCA 4B09A 1N4DA 3HI4A 1T4CA 3A9VA 3PRJA 3Q2IA 3DCYA 1NQXA 4KXFB 1HETA 5K45A 1E2KA 3DKVA 1U31A 3GGOA 2Y4NA 3I28A 1TQ8A 3OZCA 1HDRA 4L8GA 4NFSA 1NX6A 3BFXA 3JQQA 3W06A 5JBQA 1E2EA 2FETA 5L51A 2GKSA 3IX7A 4INJA 2ZSFA 1WX1A 2QJTA 3KU4A 4O02B 3WLIA 1OV6A 1S4QA 1T9KA 3NNSA 1JWBB 3B1KA 4G8DA 3LA6A 3TNJA 4OOEA 2WYIA 2A7QA 3K9QO 1G8MA 1K0UA 1JG1A 1TQHA 1G3MA 3KB2A 3LCRA 1D04A 4JC4A 5A03A 3BIJA 4BFXA 4QUIA 4ZAZA 3K15A 3L8FA 1PR9A 3LGXA 3WK7A 2DPLA 4FDTA 2XSZD 3Q5DA 1T5LA 2OORA 2VHTA 2PS3A 1EFRD 2F64A 1T8SA 4EDFA 2BM0A 3HABA 5CFNA 3HV0A 1IZ9A 1ZVJA 5FFMA 5KNLA 2R2AA 4LYAA 3DG9A 3W1EA 1U0RA 3DKPA 5LB4A 4P7JA 5JD3A 5JLJA 1VG0B 2V7WA 3I9NA 4LKRA 3F96A 2Y6UA 4WNIA 3AF0A 3BKWA 4PGGA 5SYMA 2F1OA 4DLWA 3T38A 4YUWA 3NEJA 3WB1A 1YJXA 3TDKA 1U11A 2A9OA 5LB2A 1YWGO 4HDRA 1ICIA 4OI4A 2PMDA 2IHBA 3UAWA 3OZEA 1HK7A 4MQFA 1UWKA 3STHA 5MN6A 3IE1A 1QKJA 1CHDA 3L7NA 3FIUA 1DTEA 4MRSA 4FQ5A 4RO0A 1ZCAA 4RAOA 3GPBA 1RXVA 1SPXA 4HPJB 1F0KA 3DE2X 4CIXA 4OY3A 2NZ8A 1QJ4A 2HN9A 1TU0A 1ZA2A 3D3WB 3ENNA 3P94A 4K28A 4MS4A 3FD8A 1OYWA 5KTYA 4RVCA 2XQJA 3WNZA 3BGSA 4A3SA 5DYTA 1GZ6A 4G5YA 4TMVA 3KJEA 3OPQA 1XQXA 4R1MA 2EKDA 5LUBA 4A1FA 4BMCA 4EUHA 3ESCA 3ICWA 5DW3A 1SXJA 1MIOB 2ZAGA 4HZGA 3C5HA 3FMPB 4J6FA 2XWBF 1S9DA 3H2HA 5IFLA 4WA7A 1N6OA 5IH7A 2A88A 4ZOAA 2BFCB 3H7AA 1GNSA 2ZYRA 4LIPD 4I9NA 3ICCA 3B7PA 5ALXA 3IVGA 4RFVA 1PJBA 1X7ZA 3D64A 1RWBA 2P2GA 3DEHA 4TKUA 3K1ZA 3WDLA 2DQSA 3F5FA 2AIRA 3EMKA 2XMSA 3PNQA 4TQGA 3I5XA 1W52X 1T6YA 2JFUA 4YXWA 3FHLA 4D3YA 3SGLA 1LW7A 5I4KA 2Y66A 4KI0A 5A0TA 5EI5A 2ZBVA 1MRSA 1YQ9A 2P1RA 3GWGA 4IXWA 3ET5A 2JI7A 3FY4A 4TZKA 3PFNA 1AQLA 2W6NA 4V3BA 5JTUA 1TB4A 1UT5A 1VBNA 2D1TA 4CLOA 4DHEA 4F3RA 3MGCA 1RLMA 1JJIA 4UNSA 2H6EA 4PX3A 4A82A 3PR2B 2H11A 4DABA 3SIXA 1IONA 2ZREA 5CDGA 1MC4A 3SC4A 1J8YF 1IL0A 4TS1A 4TN1A 5JDCC 2QX4A 2ZBEA 1P1RA 3B6MA 3HFSA 1F8YA 2Q4BA 4O63O 2P35A 3HP7A 4PCAA 3VOSA 4LWQA 4WXHA 4ECEA 2OMEA 4RTNA 2QPTA 1DUSA 3PITA 5EUMA 2OECA 5K0ZA 1RXCA 5IW8A 1GLVA 4XUDA 4DIOA 4TQ9A 2FFRA 2JFZA 3NJ4A 3IT0A 5DN6A 4RNCA 3V32A 5A5EA 1OI7A 1DAIA 2Q6VA 3BJZA 5CTAA 3ROZA 4M8SA 1EA5A 4JSYA 4QXPA 4LF5B 2E5WA 4PHHA 4YRSA 2V98A 4V0LA 2OM6A 1NHGA 4JLDA 4JIMA 5H3HA 1M67A 3EASA 5C32A 4DR1B 1ZJJA 4HAIA 4I4NA 3HMQA 3DKRA 4IH1A 1PLJA 2HMWA 2X40A 4QAQA 5LFAA 2AFIB 2P5UA 1WETA 1QK5A 2VZLA 1DLJA 4CU5A 3HFJA 3S81A 1L4GA 1Z7YA 3JWGA 3DBRA 3O0DA 5E6RB 4AWBA 2V7QD 4B84A 1H3FA 2EFHB 2IBMA 1EM8B 1KARA 2DECA 2JJ2A 3MJHA 1S2IA 1C1YA 4TTAA 3H86A 1LX6A 1T2UA 2IPMA 3MJFA 1NXXA 1W5FA 1REQB 3WGNA 3WP0A 4C04A 4ZZ3A 3F6EX 4MR7B 3ZQ6A 3EZLA 1FDOA 3LCVB 1FQOA 1LFAA 5EZQA 4LHSA 4RVNA 2FRVA 3D31A 3QMWA 3TI7A 4XWOA 1W94A 2G1UA 3IOBA 4LDAA 3ICQB 2CLLB 3GUUA 4DJFC 1M1XB 1NV9A 3OM1A 3EOZA 2XI4A 3FDXA 3G8CA 1HDIA 4ER6A 3LZCA 2NUPA 3AK4A 4HWPA 4JLOA 4OQPA 4OQNA 5EFOA 1ODFA 2CK3D 2QN8A 2XHEA 4JU9A 5DSZA 2YZMA 4BP9A 3TAHA 1TQ4A 3G5MA 3WHKA 5LQCA 3AVTA 5FUQA 4A6XA 2B5WA 5IK2D 3HBMA 1AE1A 3G6KA 2DT8A 4N03A 1SY7A 2J85A 4FDUA 4RKFA 2P2LA 3OLXA 4D92A 4CMHA 4DRXA 3PHHA 2HREA 4LHVA 4RPJA 3PQEA 2IVFA 4YWJA 2QN6A 5FTLA 3GJ7A 4GU5A 2XXAB 2R7LA 4RKWA 3K3PA 3B13B 3DL2A 2OBBA 5IUNC 1ZS9A 2QQFA 1I1HA 1YB4A 1BIFA 3AFNA 3AF4A 4J7XA 5CBKA 1PDOA 3NPAA 1EUZA 4ZQFA 4C4PA 2WFMA 5CVTA 1K5PA 2XXBA 1MC5A 2FSGA 2ZWVA 3EOBI 4RU1A 3ZY5A 2I33A 5AICA 1QBKC 1U9IA 3GLHB 3Q6NA 1W5AA 4Q1AA 3ZDQA 4BFSA 3OC0A 4DWOA 3BSFA 5EZYB 3SQOA 3QQPA 4RA9A 6REQA 1CVIA 5F1KA 1TTTA 1PDVA 3PUHA 3BFPA 4DXDA 5LYJB 1TKAA 1C8VB 3PWSA 2PS9A 1R74A 2XITA 3OHSX 3RYHB 3L41A 1UC4B 3I3SR 1I6KA 2C4UA 3GD5A 4QQRA 4GC5A 3N8GA 2NV2B 1V35A 5GGXA 2WF8A 4IGAA 4C5BA 3ZK9A 4AMUA 3M7IA 3OOWA 1EX6A 1SQ5A 4JLPA 1NDUA 4Q12A 1GO2A 3WJ1A 3FB1A 3LK7A 5A06A 2XMPA 2LIVA 5HGXA 4EHDA 2HUNA 4GKKB 1R0BA 5BWMA 1J5PA 5KPDA 3OZVA 4BNNA 1APBA 1N6RA 2A9KA 3DLPX 3P4YA 3CQ9A 2Q27A 1XCMA 2ZXEA 2CFIA 4IM7A 4P53A 4ID3A 3L4JA 4ZO6A 1KI9A 2UXBB 3NVMB 3ZHSA 1E99A 1Z35A 4RSRA 2BDUA 4OFBA 1NFRA 4OUKX 1RMQA 1J49A 3AFHA 5FTWA 3RR2A 3V4VB 1JKJB 2YVQA 3AVUA 3BWYA 1OX4A 2D59A 4RWEA 2Q62A 1PJ3A 3HMKA 1CY6A 3K6JA 3UW1A 1ZH6A 4D4LA 3H5AA 5JAMA 1SOMA 4YR7A 4P80A 4ITRC 5REQA 3DMHA 3GW8A 3CVOA 4NBWA 4QPZA 2XWJI 4R0VA 2AXPA 1MF7A 4TLEA 4CIWA 2CFTA 3RH0A 5G1OA 5J2UB 4B3CA 1MXFA 2LKDA 5BNWA 3DP9A 4XUCA 5FRDA 2QN2A 2RHTA 4ZAFA 3UJPA 1CUEA 1P7WA 5DTQA 3RLFA 1PZGA 5B2FA 5IVPA 3RVBA 1FFSA 3K0SA 1D5CA 1UFOA 3QSGA 4V0KA 5BV8A 1ACMA 4N3NA 5JDIA 3WYFA 2WZBA 5I4BA 4MH0R 2JLQA 3GLFB 1N0HA 1UAGA 5HW0A 3EXEA 3BXEA 1UJ6A 4Y2GA 3IA2A 1ID8A 4M6WB 1SC9A 5CIQA 4MKGA 5D5QA 1RBYA 1Z6PA 5LMNB 2I62A 4I19A 4QYIA 2QGZA 4K6MA 4WESB 4BFVA 1GITA 1MV5A 3MYRA 1BH6A 1I51A 1V96A 3BXOA 3HO6A 2HFJA 5BSVA 1KI4A 3H05A 2VHZA 3I2KA 4FIZA 4OH7A 2BFPA 1NMSA 2OGWA 3CHYA 1A1SA 2QAGA 2P90A 1PCXA 1J1ZA 2A8YA 3L05A 1V9SA 2D1QA 2WDPA 3E5MA 1Z0UA 2WLSA 1NW7A 3K9GA 3KZMA 1KEEA 3ZZTA 2RAUA 2BFFA 4QUBA 4OVKA 1BMTA 4HH3C 2BEVA 2Q5IA 3B89A 1EAYA 4KO1S 5AOVA 1T3ZA 2WKRA 3GO4A 2W4IA 3SKVA 4EB6A 1G9XA 2QF7A 3GEGA 5LZ7A 4N3AA 1V5WA 1L5WA 4CQJA 1FXUA 2ZZKA 3ENKA 3A1CA 5B3KA 4YREA 3MWLA 1UXHA 5AVZA 2IY8A 5EE5B 4W1RA 3DQPA 4N4AA 4BFWA 2HMVA 4KLCA 2CSUA 3FA2A 5IYZB 3COVA 2JCGA 2Y99A 4MLDA 4L08A 3VAYA 2VDOB 5C8YB 5AW3A 2WTUA 5AJYA 1WP9A 4FGSA 4E1VA 1YRBA 1ZOPA 8OHMA 3AEQB 4DCGA 3LE8A 5A9TA 4LZWA 3FOWA 4QT4A 2Y2UA 1KGDA 3INYA 4L6IA 4KV9A 1QIKA 4G0NA 4INPA 2ROQA 2QYOA 721PA 1MJNA 3W5UA 5B1YA 2EIXA 2ESRA 2PRYA 3ZEAA 2WZQA 1WWKA 4YECA 4D3SA 3TFWA 2W2KB 1YR8A 3CLSD 3N2NA 4HDNA 3SPXA 4GDFA 1USKA 1EFRA 4C87A 1EWQA 2B1GA 1GKKA 4CT5A 1UJ4A 3EA4A 3HCNA 2MCFA 4D8VA 2GKOA 5C3MA 1RXEA 1KMIY 2D62A 2X9GA 4UM9B 1OLSB 1HE2A 1M2VA 3QWHA 1FW6A 1DVRA 1G21A 1YCHA 3BQ9A 3DD5A 3H99A 3ILVA 1U7UA 3NOQA 3QFRA 4L6AA 4RZIA 2OC9A 2HNBA 4UQPA 4QA9A 4PSUA 1WQ3A 3VSDA 1W59A 2JI6A 5LOVB 2AKEA 4W5JA 1P9RA 2BZ0A 2GWRA 3NWPA 5CVJA 1R6UA 2AR0A 4U9IS 5T6MA 5AMXA 3WWZA 2ODNA 1A9TA 3O03A 5KJ6A 2OZEA 1SUAA 1ZH8A 4ZAXA 3CRZA 1Z36A 1M8GA 5HK9A 3I09A 5ALIA 3H2JA 4C3VA 5IT5A 3AZOA 3T3DA 4MP6A 1XEWX 1B0PA 1TZBA 2K87A 2WPDD 1CJMA 1NQWA 1R6XA 3AF2A 4L7VA 1XVIA 2IH4A 2WSMA 1EESA 1TIPA 3FRJA 4NAUA 1E3QA 3QIVA 3CN9A 1NOIA 1T6BY 4UXJA 4O08A 4ENWA 4RV9A 1X0XA 2AJLI 4KQIA 4QM6A 4BTEA 1LDGA 1PEDA 1OX5A 4LTDA 3H11A 1Y4SA 1AB6A 2NSHA 1QS0B 2DBRA 4IR7A 5LP6C 3WAGA 1XMQB 4GWLA 2LPMA 1G38A 5AVJA 3HXKA 5AHWA 4DLPA 1PR3A 3K31A 4TM8A 1L4KA 1JLSA 2QBYB 3T9EA 3J81A 2C98A 3B52X 5ALFA 5TPWA 2PLAA 1Q0ZA 4J2TA 4S24A 4WKGA 4YJFA 3TLXA 5J4VA 2DCUA 3HA3A 3TLZA 4RPLA 3LQQA 4DDHA 3P52A 2A35A 4G5QA 5FB3A 5JPIA 1QRTA 1GLGA 1EWKA 1I1NA 1HYHA 2Z3VA 3PL5A 2DHQA 1XTRA 1HXHA 2JD2A 4ITUA 4OYRA 1OYYA 2ATXA 1QWOA 2X7XA 3LYLA 2P5YA 3GFBA 1IOVA 4M9RA 3Q7PA 3GAFA 3MGKA 4COOA 5LP6B 2A3RA 4NXMB 3PVZA 4IS3A 3CO5A 5JVDF 2PX2A 1IK4A 1QHFA 2NO6A 3IIKA 4G2NA 2VK1A 4L5YA 4MWEA 2XQFA 1JFRA 3W79A 4MDEA 5F73A 4G5HA 1C7JA 4BKOA 3OE5A 3UMRA 3BPSA 1CJSA 1ZJ4A 2VVTA 4G1EB 4Q9NA 2E3JA 2OKGA 5FLYA 2ONJA 4A0RA 3EIFA 5IASA 4DSOA 3SFZA 3REQB 4L6CA 1BCSB 3L6UA 4EFKA 4UEKA 2E87A 4DIEA 3EFOA 4BUZA 2VJMA 3O38A 1WHTA 1PFUA 1XZBA 1PWYE 4G0OA 4RIEA 2VRWA 2VPXA 1HTTA 2Q5OA 5EJ6A 1GUDA 5FBRB 3V2HA 4HADA 4TX1A 1PGJA 2JIQA 3AIMA 1USWA 3GLKA 4IMPA 3VO1A 2OCLA 1KAHA 3FCSB 4K0RA 3HPRA 1X1EA 4EGAA 2GLXA 2V7QA 2Z2YA 1ILEA 1TO2E 1YZYA 3RAEC 3OA0A 4D9FA 2OO5C 3QY9A 4KNWA 3C39A 5EKUA 1U02A 1D3AA 2A5LA 4BBAA 5JBIA 2PZMA 1Y8RB 2X3FA 4Q3KA 1CK4A 5COBA 1BVUA 3V42A 1P39A 2LVBA 2Q99A 3DXFA 4Z8XA 3DFZA 4JT8A 3RD5A 4W8OA 1GG9A 2HT6A 2VWQA 1PHPA 3V6LA 5K3EA 5AW8A 2P0EA 1CZLA 1PN3A 3ZDFA 2UUOA 2Y1LA 2OUKA 3K30A 3R3YA 4OHPA 4NYIR 1VHJA 3JVIA 4J90A 1CUYA 1H1TA 4Q9KA 5HJEA 1DZ3A 2QIPA 1QRAA 2VDKB 3IPXA 2CK3A 4NFLA 4ZU6X 3U3KA 3V4PB 4PHGA 1Q1EA 4UREA 1WF6A 5IK2A 2GQ0A 1P0IA 4UHKA 4LKOA 2GPSA 4ME6A 4AP5A 3RFVA 2BUBA 3HYLA 2X8LA 4GP7A 5I7VA 5LZ8A 4OM7A 4V03A 4DKJA 3VPAA 2P62A 2B30A 3GT3A 4N7MA 1FFGA 3IMEA 3IYLW 2B3DA 3Q3GE 2IP4A 5A3VA 1F2VA 1Y5MA 3LC2O 2C7RA 4F72A 4EMTA 1WNTA 2A0WA 2JIDA 3CX6A 2V45A 5EN4A 2W90A 2OV8A 2J3JA 4H7EA 1AY0A 3SQWA 1Z28A 1SVKA 4M83A 1ODIA 4NE9A 2OAP1 3IEKA 4C89A 4ZT4A 4O4IA 1CUGA 1DWQA 1HBJA 4TXNA 1PJ8A 4TV8A 1IEVA 3O8QA 2GDJA 3TEMA 3ZVLA 2PTHA 5IJZA 2E5LB 1RHRA 1QQTA 3EVFA 3CB4A 4MJLA 3VYRB 3G02A 4AJ4A 1V5IA 3O4IA 2Y1XA 3FPEA 2DRIA 3M9XA 4M0FA 1N7HA 5D51S 1U8XX 4B81A 3G7UA 3ZWQA 5IX8A 4F1WA 2BHRA 4MKHA 4B6PA 1W4AA 4AQ7A 1ZZEA 3U09A 1TUIA 1L7VC 4H1TA 4YJKA 1I32A 5IDQA 4IDAA 1FS6A 2UU9B 3VPDA 4KOEC 3L7LA 3QXCA 5EIOA 3N70A 4P3NA 2DBYA 2EDAA 3OOYA 1BW9A 5DZSA 5JCOA 3DUFB 1FSSA 3RUAA 2G6TA 3ED1A 4BMDA 3VH3A 3NIGB 3BJEA 5AW7A 3CX4A 2C92A 5BQPA 5LCXA 3I76A 5G3ZA 1E7YA 1I33A 1QGUB 2QN9A 4P3OA 3L8HA 4A7PA 4BGDA 2IEZA 1KOGA 4HD8A 3N6RA 1YJAA 2I6QA 3P2YA 2BRUA 1C81A 2CVHA 2NO4A 2DFPA 1B6SA 1KRHA 1V2GA 5JQWA 4ONEA 3WIBA 3HSYA 2C7VA 4F1KA 4HNUA 4K6HA 4N5NA 2GXUA 4BZXA 4YY3B 4JP3A 4PC7A 2EJUA 4XQ9A 5AM1A 1U2EA 4JOQA 4YR9A 1L7XA 3KXPA 4MI9A 1S8NA 4HDKA 1H4SA 1N5MA 1TA0A 1TI7A 3OMWA 5AW6A 5FUYA 4YPVA 4CKZA 4XOUA 1XCLA 1AV7A 5DISB 2P9TA 2V58A 4AURA 5HMMA 1OPXA 2ZPTX 3QTTA 5FTMA 1INLA 3G0OA 1C3JA 2ZJZA 1IWBB 2Q9CA 4TQUS 1G6HA 3KJFA 4UZSA 1CIJA 3MFQA 3KKEA 4LDPA 4IIBA 3EAQA 2A5JA 4OYHA 1OPRA 3AYZB 5ILGA 3KWMA 3WP1B 3PP8A 4UCWA 4DB4A 5JS2A 3FMFA 1U5BB 3JVVA 1YBMA 2RJOA 2WVJA 2HHLA 3DNPA 4CLRA 1EM6A 3EVGA 5JPDA 4JWKA 2P2DA 1T6ZA 4MRPA 4OHKA 1SIBE 1T3LA 3MJEA 4GI7A 1L5LA 3ZH2A 2VAWA 4U7TB 5BYJA 3ECCA 1WV0A 3ZEIA 5DTRA 1KAMA 3A6EA 3OPYA 5TV2A 1CU1A 4R51A 3CNOA 3CSDA 3DJYA 1IXSB 3AX6A 3EXFB 4IXNA 2C97A 4QELA 5KDOA 1H9CA 2C07A 2OV6A 3C48A 2CHQA 4FEAA 3IMGA 1Q22A 4HTFB 1DAMA 4FFPA 4D9IA 3H2YA 4BNTA 4HAVA 5A0VA 3A6KA 1U98A 3ESBA 4YUVA 1HC7A 1N2XA 1R0WA 2GK3A 2P3LA 2YJGA 5E6SA 2D7CA 2XCLA 1T43A 1L9XA 3GDHA 1E0KA 3M3HA 4DE5A 9GPBA 4MEJA 2FPGA 1E2HA 4WXMA 1MO2A 1AUXA 3PENA 4QLAA 2B98A 4B75A 4LHEA 3RSLA 3CRRA 1VQ1A 2EATA 3VVLA 4MYSA 4JGIA 1BXKA 2NWQA 5JZBA 1O4WA 4KW7A 4FYHA 2E1PA 1RKBA 4I9GA 3IR7A 5DHRA 2BTEA 1K5DA 3IODA 2B4AA 5JMPA 3VV3A 5DTMA 4WGGA 4DJ5X 5BVGB 3WL8A 1DBIA 1KMHB 1W0JD 1Z74A 3I1JA 1PYDA 2X7JA 4JDUA 4EARA 2V7PA 4FJ1A 5IKMA 1ZMBA 1G59A 3BL8A 3UJNA 2YXLA 4D0GA 3CKKA 1TZCA 1T8WA 2Q3MA 5LA6A 3UWPA 4RDHA 3UZUA 2AOUB 3CNHA 1PS9A 1JSCA 5B1HA 5HMLA 2XVAA 3LAWA 4YUAA 3OC6A 2XMDA 5SZKB 1F17A 3ORYA 4CI0B 3TGPA 3OPVA 5FAXA 1YB5A 4RK4A 1WZNA 3ABRB 1Y8CA 5CX1A 5TX7A 5C5CA 2HSGA 1XPOA 1A50B 1ESEA 4Q9HA 4OTZA 2E21A 2GCIA 3WYEA 2ZVPX 1Q6YA 3V55A 2BH2A 2ZTMA 4ND5A 3OFSA 4LC0A 4DIUA 5AW0A 1YDEA 4GOMD 4XCQA 4IHJA 4DYVA 3E9YA 4C06A 1P6XA 2FDRA 3DDHA 3OQVA 3RSHA 5CVCA 4IDCA 4JJZA 4QTXA 4V24A 1R0YA 1KPGA 2O8FB 4EG5A 1EVIA 4HY3A 3RU3A 1NVVQ 2FZ5A 4A15A 3CKYA 1SKYE 3WGLA 4C1BA 4F5EA 3CZ5A 1NKVA 5GZ3A 3PIRA 2K7FA 3CLHA 5JQGF 1ODTC 3KRTA 2EFYA 2PL1A 4ND6A 1TUBB 2ZT6A 4H7FA 4R1QA 4XVQA 1H6BA 4I3GA 2CLMB 1R6DA 3O8OA 1TM5E 5JISA 1D1TA 1JIKA 5C8XA 3JQ9A 2DSNA 5CTJA 2CYAA 4PYKA 1KZ6A 2GYWA 4AZ0B 3KPJA 3MJSA 4MW0A 3JWJA 4BU0A 4F9FA 2E4AA 5DYYA 1PR0A 3A6DA 4DQDA 2G07A 2PG3A 4B5LA 4WLNA 5KSPA 2WT8A 4H1HA 1VLMA 2NO0A 3AHEA 3P2OA 2J3EA 4GEKA 2VS1A 3L7MA 3HKBA 2QUZA 2FQQA 1T9CA 4KO2S 4YO8A 1GZ3A 3ZW7A 4NYMR 1P0CA 3DOJA 3RS4A 3JWEA 4RKQA 3T3GA 1FMLA 3I64A 2WPDA 3TLKA 4Q48A 1XZAA 2YICA 5EE1A 3LUBA 5KVQA 3T7IA 1SQFA 4KQ1A 1QIHA 2P69A 1HNNA 1VPTA 1A9PA 4DSTA 5HX7A 1EFTA 4AK9A 2ID4A 1JJBA 3BTVA 4JI5B 2ZYHA 1AG9A 1M6VA 1LJUA 2X1MA 3M4ZA 4C4YA 4XM2A 2HXGA 5JSZB 2O8EA 5K99A 3OTOB 5F7OA 2XLBA 4KFUA 3SI7A 2HGSA 2FPUA 4GKVA 5JU6A 3RS8A 1EP9A 2CV0A 1WDKA 2ERXA 2HQOA 1Y9JA 4IYRA 2VA8A 3FKSD 4FOOA 1ENOA 2GCOA 2IQIA 2C2OA 1PS8A 2W4MA 1C30A 4UUBA 3NAZA 1BA3A 4CKBA 4RXMA 5E2AA 1CETA 4BIMA 5JJ5A 3ED5A 1ONPA 3FDJA 5IUKC 1OHHD 4EHBA 1GFWA 1WXDA 2O0MA 2XZTA 4HTAA 4RF3A 4DTIA 5J58A 1DFHA 3ERCA 5JCZA 4DG9A 1E63A 1GL3A 1GA1A 1H6CA 4DXHA 2I4RA 5KTKA 3TQOA 3BICA 1RHKA 3FYUC 3D81A 5KOHB 3C70A 1L8XA 1QKKA 1QYIA 2EG9A 4IF4A 5DMHA 5SZIA 4D02A 5JPCA 3EXG2 2XRYA 3JQAA 3VGJA 4KTVE 1JHMA 2GBPA 3OA2A 3DEZA 4KPUA 1AGPA 1ESZA 3KTOA 3PJGA 4G67A 4MW7A 3K20A 3SQMA 1W85B 4OK6A 1JTVA 2ZDQA 1U2DA 1MG0A 3A05A 1J33A 1Z5WA 3QVUA 5U1PA 1EFDN 2ZVQX 2V8BA 4TTVA 3T95A 1X9GA 1GILA 4KRYA 4PNPA 4Q01A 2RFLA 4JOCA 1E2UA 2F3QA 2JFWA 4Q3LA 4S1OA 4U9UA 5BN4B 3KSBC 2FSUA 3AHGA 2FKAA 4H0FA 5GADl 3G5LA 4RW0A 1YASA 2XZDA 2K6GA 4Q9JA 3H8VA 5LU9A 4Z4EA 4N54A 4YAIA 1A2OA 4RS4A 3N74A 3L1KA 2V8OA 4BMOB 5B6IA 1SUIA 5U9CA 4S1VA 2RGWA 1NUHA 3TD6A 1BROA 2G71A 2GM9A 4JBYA 4X71A 1M5RA 2ORIA 3LMKA 4QPPA 4LJSA 1OQAA 5B7PA 1VPLA 4LJ5A 4WT7A 4QM7A 3I0NA 3KEGA 3NX4A 3HBAA 2V7VA 4KDCA 5J59A 2BLLA 4HAYA 4CPDA 2JAUA 4LJKA 4PF1A 1TO1E 1KFBB 4D9KA 3GLGA 5CT9A 3P9CA 4P3KA 2VG8A 1KO7A 2ISCA 3HLTA 1L6IA 1OSNA 2LWIA 2XTZA 3ETCA 3O0TA 4TQAA 1YB6A 5BORA 1GP2A 1JYSA 4F86A 2TMKA 1VKNA 1E0SA 4GX5A 5KINB 2Q28A 1BRTA 4RJJA 3R9XB 1OFUX 4L9SA 4XW2A 5JG7A 1AMOA 3O21A 5FOUA 2C3OA 3ICPA 2EP7A 5JYDA 5GOTA 1M83A 2FFHA 1OFHA 4WZAE 1XF1A 4OFXA 1ZBDA 5AK0A 3OZRA 1FFXB 3QLVC 4MZXA 4D7AA 3PI7A 3R6WA 2I29A 1HMPA 3WWDA 3JYQA 1GCIA 3DVRX 4DLRA 2AR9A 2WWFA 3KB6A 2WD7B 3KWJA 4MJ3A 1WDWB 2B20A 1MZPA 4CG0A 1EFHA 3GMIA 4ZEVA 2MT9A 3AM3A 4DMRA 3NGXA 1ZKMA 4J8PA 2TSYB 3RVQA 3SZUA 3F67A 3O8DA 2B69A 1Q0PA 3WLLA 4YRBA 2Q49A 1TT5A 2BFEA 2X8JB 3HO8A 3L3BA 4I8XA 1W4RA 3FDZB 3FR7A 3LGAA 3GQBA 4P4TA 1YDGA 1HI9A 2KLBA 2QP9X 3IOEA 5K0LA 3F9IA 3NI2A 4HPXB 3A3KA 1PK7A 2C54A 4K87A 2CT8A 1W73A 1VLVA 1A5BB 4RH3A 1KDZA 1MX9A 4WH0A 1ZI8A 3CZRA 3FHOA 3IV9A 3DL0A 4OXQA 1CC1S 3H5TA 3SM9A 1TEVA 4FR5A 4EUNA 1H4VB 4WY8A 4XQEA 2CL6X 4PNEA 3QELA 3COWA 3UKOA 4LI0A 3Q7RA 3UMMA 1NR7A 5BW5A 3ONWA 1A72A 1E8NA 3B3FA 4OB7A 3VNSA 4D9HA 2FWBA 1JHZA 4Q4CA 4XGQA 5CDTA 4JD5A 1LBTA 5LMUB 2BP7A 1XZKA 4AN0A 3DGEC 4DGSA 5G1NA 3C4VA 4WJKB 2Q1TA 3UEOA 1DTWB 2RHMA 1SPBS 4IO1A 4MZDA 2RHRA 3GVIA 4PW0A 1EX1A 4N9WA 5EWLB 3K09A 3NGLA 3GAMA 1M73E 4JUBA 2WV9A 1D1QA 1RI2A 2O57A 2P9QA 1SVUA 2Q8NA 1Z6ZA 4BO8A 2YWXA 3NJ8A 2CXRA 5K6AA 1UBJS 2JK1A 3ELYA 2O8DA 2FSPA 1SVNA 3HBFA 4TL8A 3J7TA 3HCFA 4BP8A 4RHCA 1J0XO 3QX8A 3QK7A 5THXA 4HF7A 3SZGA 1U2SA 5F1OA 1SVWA 2D00A 1Y0BA 4R16A 1YS6A 3MLEA 3HP1A 1TQDA 5BV1A 1KGSA 1EX7A 3A7DA 4M89A 4CU2A 1NBAA 3EQZA 3BCSA 1PJSA 2GAJA 2H5EA 3EYWA 1WW2A 3IIEA 3H84A 3ZQ4A 2JEZA 4CQMD 1K3FA 2DPMA 2QVCA 3MN1A 2VHYA 1E2IA 3IJ5A 2ZT5A 3CZ9A 4V0RA 4Z4HA 1EXVA 2E4WA 3HVUA 3K4QA 2WU4A 5DCWA 3SX0A 4X64B 1XSEA 1I01A 3A1TA 1Q0HA 1KFEB 5ITSA 2JARA 3CXRA 1CEQA 1YA6A 1MJFA 4NH4A 4BQSA 1E0JA 1NBEA 1XTQA 3LX8A 4OP1A 4CCYB 3CIFA 4OHUA 1FP1D 1WKCA 2SBTA 4G5GA 4LFCB 2BM8A 2B4KA 1TRHA 3HBLA 3OWXA 1FVXA 4PZ0A 4UFNA 1KE1A 1LBHA 3UK0A 3TL6A 4LJ8A 3O82A 2VOEA 2AJBA 2QRZA 4G0ZA 3GLQA 2Y93A 2VWHA 2JHCA 4LXHA 2IXBA 3L7YA 1H2FA 2V6GA 4EKYA 2Y0PA 3AL2A 2ZBDA 3KZ1E 3PYXA 4X91A 3SR3A 5LP6A 4P5DA 5EJ8A 1QHSA 3DZCA 4G26A 2GLTA 4QG7A 4U5XA 2VHEA 1TK2A 1GPNA 1G8SA 3NQ41 4D6YA 3IHLA 3L6DA 1DAFA 2X0NA 4XOIA 4IDGA 1V1RB 4Q1CA 5JEDA 3DTVB 1M34E 3U7RA 5C5DA 4C3UA 3DEYX 2OHXA 2QX7A 1J07A 3DYIA 3DC2A 2VAMA 1AGNA 1QYVA 2ECPA 2ILTA 2PGJA 2HDHA 2XMBA 2VDLB 4XFKA 4BQRA 2HYDA 2WAMA 4P9NA 1HYEA 3FUWA 2A78A 1N1DA 4KQFA 3PHBE 2XDQB 5JVDB 3D6NB 1JLKA 3FI9A 1CR2A 5HJ5A 4PN3A 5TVGA 1HSOA 3VO8A 5IG2A 4WCFA 5DI9A 1AKWA 4AKHA 2H2WA 3G7SA 3ROTA 4XX0B 5HE9A 2B99A 2CNLA 2YHUA 1W0JA 2IIQA 2ZYVX 3AHJA 3EIOA 4H17A 2E4UA 3W7VA 1NLMA 1VLQA 4ER7A 3QXSA 4LWPA 4YAKA 3ELWA 2QI9F 2DUWA 4QREA 1D1SA 3H9UA 3PC2A 2PD3A 3FYSA 4ZI7F 2EERA 4I99A 4X7MA 3VNUA 3R9WA 4BGVA 1VIMA 5KYUA 3WNQA 2JEYA 1ES9A 1EB9A 1NP6A 3DBHB 4X20A 3D9QX 3CF2A 2UYYA 1LDMA 4FX5A 4QEDA 4REQB 1UK6A 5IN5A 1KDVA 3V1NA 1UC5B 1AK1A 4HDSA 1AS0A 3WIOA 3ENQA 2C2XA 2ZEJA 2H1RA 1ZGCA 4RF4A 2POCA 3V33A 1I3OA 2J4FA 2RBEA 4AL4A 2E37A 3ND9A 1NIPA 4LOKA 3VJKA 2VPWA 3A1SA 5FQNA 3UWMA 3CMCO 5FR1A 4CM8A 4WBNA 1YR3A 3NBXX 1Q12A 1Z4LA 1GPDG 5TGZA 3UJ9A 1YDHA 1OBFO 2W6OA 3SBOA 1MVNA 4PSCA 3RREA 3A3PA 4FEEA 1V4BA 4OGWA 1QG4A 4R4JA 4FQ8A 2GNOA 5IF9A 3L92A 3CRW1 4BY9E 3K8QA 2CFOA 4DQLA 2VSYA 1P3Y1 1QYDA 3G1WA 4FHGA 4TL9A 1T4GA 3DOIA 3OETA 4RZ2A 4OHWA 1ODLA 4P81A 1KE2A 4KR9A 3VJLA 5JALA 1A77A 3BHJA 3DZDA 1LDBA 1NVXQ 4QOSA 3L0BA 3R9IA 1H2YA 1DCKA 5I8PA 3P8ZA 1VMAA 2O2YA 2ZR9A 1VYTA 3IUYA 1G6OA 1KR2A 2O8CB 4KE8A 4BKUA 1G8KA 4AWXA 4QRHA 4J1TC 2DKNA 4QTYA 1QQAA 3T7TA 4EA8A 4RHTA 1O5IA 1R5BA 3THRA 2QHXA 4MROA 5K0EA 3CLTC 4FFMA 4NHOA 5L95A 2D74A 1N3BA 2DFNA 4RGBA 5EZSA 3P1JA 3PB3A 3WMRA 3JAKB 4LGYA 1SU7A 2BAGA 2DCMA 3CEHA 5IEBA 1AN9A 1UWCA 4EVRA 3O8LA 2AOWA 5B30A 5B57C 5CNMA 5FT9A 4UCXA 5K3BA 2WI8A 1QIDA 4IFEA 2BZ1A 3GGCA 1E59A 3FKSA 4IS2A 3OQHA 4D99A 1WRBA 3X1WA 2RONA 3BCUA 4WN3A 1UJ2A 2QN7A 3I04A 3LWNA 4R2IA 5JSFA 1NXTA 2Q45A 3N87A 2L19A 1TM3E 5TC4A 4B0PA 4C0SA 1NUAA 1IHPA 1OHHA 1ZI6A 3BQNB 3HKEB 3VYSB 1LH0A 4ETMA 2QORA 2F43B 5CK4A 7GPBA 4AKEA 3OFVA 3E2IA 3K9WA 3KTAA 4TSFD 5THKA 2F8SA 2B5VA 4C0XA 4I6JA 2OFFA 2QD4A 3R7WB 5F4BA 5LNK1 3KSMA 2REQA 4JB0A 3THXB 2H59A 5LQMA 3V97A 2VA9A 1O96B 1UPXA 2XUOA 3NV7A 3G68A 4ON9A 4YA6A 3R75A 4QFCA 4AKIA 3QBVA 4J7CA 1XZGA 4MQEA 3LT1A 2BISA 2FF7A 5FIUA 1GPLA 2R86A 1D9ZA 1KP3A 2B4QA 3R74A 4NS4A 2AN1A 3VMMA 4MR8B 3ZE9A 3DWEX 4Q15A 2NXEA 2GFIA 4PAQA 4WJLA 1MABA 3GG9A 4HUQB 4G86A 1J6UA 3PNBA 3ANNA 1AQJA 3ADCA 3MQ4A 2DPYA 1T5SA 4FB4A 1WTAA 5BYKA 1AQNA 2HAEA 3AF3A 5B55A 3M9LA 1DBSA 3R3ZA 1QM5A 4P4SB 1VA4A 3U4MA 2NP6A 1BFKA 4D1YA 3TNFA 1SEVA 5FBQB 1GYQA 5B7QA 2R7NA 4F46A 1Y6RA 1VMDA 1HO3A 4HAOA 5DLPA 3RK1A 1E6MA 3A32A 4EYKA 1X1RA 5ICEA 1O95C 2WHPA 3GJRA 3W1WA 3AW9A 1CG6A 4DR5B 3WWOA 3MMSA 5ALQA 3PC4A 2C99A 3C3CA 4PC6A 4NMWA 4QUDA 2FPLA 1B6GA 4RHYA 2CYCA 1XRRA 3P45A 5TQJA 1P9WA 4OL9A 5L6LB 5AO9A 2X0IA 2RHBA 4LC1A 3UMFA 4YMWA 4L9RA 2PL9A 3CLRD 1SUFA 1G5FA 2QE6A 3CUYA 2H1HA 1A88A 1Q17A 4AY5A 2WA2A 1JT9A 3E9MA 1NJ1A 1Z0FA 3GJ3A 1QF6A 1SKBA 2H3EA 3UJ6A 1M2NA 2C5FA 2BKLA 5KKNB 1J2TA 3LTNC 3UV6A 3GK3A 1EDZA 1GQYA 4I36A 4YDSA 5HNKA 3LFTA 1NURA 5KI6A 3E3NA 3O83A 3E23A 1BKYA 1YHYA 5CDYA 3MW8A 2EHJA 4MMZB 1OR8A 2O48X 4GZ5A 1MD9A 4KU4A 3OOEA 1TTQB 4DNOA 1BGWA 1N1GA 2ODQA 3D8RA 3IE0A 1DSSG 3LI2A 1R00A 4JT9A 3OZXA 3IRVA 1A9QA 3SJAA 2YS6A 4KXQA 1MAWA 1LBIA 2JLXA 1I4LD 4PR0A 3QU9A 4O3MA 2VPYA 4GNRA 2GESA 4G3XA 2VAVA 4O33A 2B1QA 1H6DA 4HDCA 4FHZA 2WM8A 3MQFA 4XIFA 1M8JA 1L4YA 4RMHA 5HBGA 3BRSA 5KKAA 3VH4A 1AJEA 3JQGA 4JI1B 1T1JA 4P33A 2Q46A 4ZDJA 3EGXA 2OGZA 4CM4B 1KI2A 4NBVA 2O0HA 3H5LA 3OIUA 5H1YA 4U2DA 2ENUA 3B78A 3EMBA 4R6XA 5DRYA 4LDQA 4IQGA 1QFXA 2VQ3A 5JADA 4Y98A 521PA 4YQEA 1M2KA 3GRRA 3BA6A 1JNYA 1KERA 3FGOA 3OO1A 4M9CA 1G60A 1NLZA 2HKIA 4X45A 3GVHA 1FDSA 1FUYB 2XVZA 3TFQA 5ALPA 4B3MB 1UIMA 3D4IA 1YQXA 2O54A 2ENWA 1O7JA 5JQGB 3IQGX 3KXDA 3I9JA 3EFHA 1N1MA 1PX2A 4Q1VA 1ORTA 2BDEA 3UAXA 1PT7A 3L1HA 1HA3A 5JRJA 1PR6A 4CV2A 3EIWA 4O2BA 4B44A 3L43A 2VHCA 3HYCA 3PJRA 2BF4A 4PLFA 3KQHA 5JYEA 1C3VA 3QLJA 4J07A 4K6OA 2WYOA 5IAKA 2YXNA 3RU9A 5BSUA 3K70C 1FP4A 1R10A 2PYIA 1V48A 2BEUB 4HB0A 4KCGA 5BOVA 1BU8A 1ILWA 2HLDA 3EWIA 3KUUA 4HNQA 4KYUA 1EG2A 1O9HA 3GRVA 2WSIA 4C6TB 2PSHA 1NY5A 1RM4A 3BK7A 3UMJA 1TE2A 1T5OA 3CNQS 4BNGA 4CQMA 3O73A 5J1SB 2AQHA 3HM9A 5LQJA 2JBWA 5FKJA 3IIJA 1SU4A 2V7EA 1VGQA 3KALA 3AR3A 3KVNA 3KHTA 1N2CA 4INAA 1W8DA 4PZLA 5DBEX 4YRZA 1FU8A 2OCKA 4AUKA 3G2NA 4KWHA 2BGGA 1V4NA 4D96A 3OD1A 1OAOC 1ISJA 1XXHA 4OL0A 3UMBA 1QO7A 2YZKA 3M49A 1NXOA 4P8RA 5EUQB 5J4LA 5IKPA 4MPRA 2Q1UA 2ZTVA 4Y9DA 2QTTA 1YE3A 4QSHA 1IN7A 1QIMA 5BSKA 1R6BX 2ZWPA 4KFSA 3M5CA 2D3WA 4LRYA 2J7PD 5AUQA 5LC1A 2WMYA 5LR6A 1PJAA 2IYEA 2WFAA 2Q3EA 4BAGA 4F8JA 3QBEA 3VZPA 3PSAA 3MK31 4E1BA 4Q93A 1A9ZA 5I3ZA 4GL2A 3UKJA 1R16A 3TQTA 1E1YA 2BMJA 3EGEA 3F2IA 3I5MA 5K4HA 1YUNA 3HCWA 4L78A 3W8DA 2YINC 2P6RA 1Y34E 3CH6A 5COAA 3AR2A 2FP4B 3QVMA 5I8WA 1NQTA 1XU4A 3R7NA 3R77A 3PUJA 2C3YA 5EVJA 3WHPA 1K1EA 3O74A 5BY2A 1RRKA 5A9SA 3SHQA 3DLIA 1QRSA 2JASA 4EG1A 1RQGA 4ZANA 1NLUA 5A5VA 1P61B 4BGEA 1UXGA 2IGTA 2QTRA 3EF0A 1YE5A 1X7YA 3T1NA 3U1BA 1TECE 2QTVB 4QGFA 4YHHB 2XNKA 4U7PB 5EJEA 5DFAA 1JXOA 2H4WA 1YVPA 5CDFA 4F3CA 4GMGA 4JC0A 2C5AA 3QMVA 2RCYA 3RE1A 2FWJA 4Q6WA 2OFPA 5B1SA 5KWVA 1IG3A 5CD1A 1T6XA 2GD6A 3W2EA 2V7GA 2ZAIA 4TOIA 2BFWA 3NHYA 1BQ3A 1QH1A 3C6YA 3I9MA 4HAWA 4NWIA 2ODBA 5FNZA 5HKKD 4G4IA 2J48A 3KYIB 3DV0B 4KK4A 1SVLA 4GMKA 4FFBB 3U5TA 4OJTA 3NDIA 1LD3A 3KHKA 5ALTA 5AVSA 3FPSA 3ILYA 1GQSA 1PK9A 1W93A 1P62B 4DG8A 3G5UA 1ZGZA 1YQDA 3P9YA 1C9DB 3WX0A 3I05A 3EZNA 1GGHA 4Y7CA 2G1KA 2IHKA 3D4PA 4CV3A 1R4MB 4HGZA 1Q7GA 4CXMA 2KX7A 1EXWA 1NM5A 1XK6A 3O93A 3PNOA 4Y9TA 2VK4A 2Z6QA 4B4DA 2I67A 2Q2NA 1L4UA 2R8YA 1J97A 2JIZD 1U8CB 1GTRA 1D0IA 4CQLA 3ITEA 2G0AA 1T8RA 1J8VA 5E2IA 4DM3A 5LZ4A 1MJ5A 1GNQA 3LT4A 2YOHA 2RGNC 2O1EA 1D2NA 3KQOA 2IE0A 3LOUA 4ZPJA 3TH5A 4O2AF 2IBTA 1GFZA 2NVWA 3H2ZA 1IRXA 2YN0A 3KZKA 2ZWOA 3PDIB 1W1UA 3Q41A 3LBFA 3A28A 2C5BA 1PBNA 2PN1A 4HWGA 1Y6ZA 1BMQA 5FX2A 1RPZA 2C7OA 3U44A 3OPYI 3AOEA 3T1HB 1UPAA 1TADA 2ZJBA 1JEYB 4AY6A 4F3TA 3KT8A 1CS0A 1JSXA 4OMFG 2VP6A 2QN3A 4EPXA 2C2ZA 1RTTA 1UKYA 2AJCA 2FJPA 3VFDA 4IDFA 1WZ2A 1DMRA 1XLUA 3C3WA 2BELA 2XMGA 3I8XA 4FE4A 4ZV4A 4CKWA 3R0ZA 4LNHA 2JNWA 1YDWA 3R8XA 3JD2A 3MWEB 1NPTO 1SIOA 4P22A 3WGJA 5AXAA 2YV2A 3WGIA 1FSPA 4DHWA 2OORC 2H4ZA 4QRDA 4B2PA 1H1LA 4R0MA 3HXLA 4DWVA 1P7YA 1T8UA 3N2KA 3ODGA 4TL7A 3HXMA 2NIPA 1H6AA 3RADC 2IYSA 2V03A 1DKQA 3WLPA 1WKBA 1F2TA 1E3IA 1CRLA 4RELA 3I34X 4LVOA 4FMCF 4MYHA 2VBCA 3ZNNA 3HB1A 3L0DA 3OLQA 5D7BA 3V7NA 4DIFA 1GPJA 2BJWA 1ZRNA 4AJ9A 4KXWA 1EVQA 2R8OA 2SKEA 1MIHA 4TV8F 1BXRA 1ZITA 4J49A 3TQQA 1Y9ZA 4UZFA 2VUUA 1LSSA 1OT5A 3LYAA 2FEAA 3KOMA 4QULA 3EVBA 3IIMA 1JFTA 5KX5A 5FFFA 5IDXA 4DV3B 3AKCA 4ZOBA 5TSDA 1YCFA 1ZX1A 4KYTA 4RGYA 4TXHA 2PZ8A 2ZAOA 3AHIA 3O4JA 4I9UA 4DIDA 1SXHA 3ZLBA 2AI3A 6AT1A 1VCOA 1R37A 3DBVO 2ARKA 3G8YA 2FUKA 2ICAA 3FVRA 4YP0A 1BEEA 2QXUA 4N8EA 4BTLA 1K6MA 3AEKA 1QX3A 5AI8A 1LNZA 1SXJC 3V34A 4AY2A 1RZRD 3AUTA 2PZAA 3PUYA 4OJNA 5K2MA 3GJSA 3QW2A 3ZOZA 4E6PA 3HJFA 2WW8A 4CKBB 1ZR4A 2Y76A 1EUDB 1I8TA 1SUEA 4TSFA 5JD5A 4HDRB 2NTYC 1VJ1A 3DV9A 5JS8A 1E8MA 3FGNA 1O6BA 1TM1E 2A86A 4MQFB 1RQ7A 4MMYB 4RVHA 4QJ4A 5FQOA 4AG3A 1C41A 2C8JA 1GQRA 2E4ZA 4MQUA 2PCJA 3NKVA 1PUIA 3ORHA 4RFSB 3IBYA 1L7OA 2IWHA 4A8JC 4MQ4A 4Q7KA 4G1CA 4BBZA 1G4AE 2I3BA 3IR5A 4B4UA 1F20A 4HYYA 3Q3IA 4YV2A 4UNQA 3S1SA 3JD3A 2AC4A 3OJEA 4BXOA 1FLVA 5HPYB 3IAS1 3DL7A 3AR7A 3MJRA 3OM9A 1U94A 2FRDA 2R6FA 1N2ZA 3A6FA 3NKLA 4L3OA 3T5BA 3VAZA 4AUMA 3GJ8A 1A95A 3N1UA 5FXMA 1SXJB 3ZC3A 2GRJA 3FNBA 2BIFA 3IMFA 3TJMA 1LLQA 1T9HA 2K2QB 4Z0TA 2XMZA 4ZO4A 4J3NA 1RHUA 4OQEA 1T1RA 4B3FX 4DMMA 5B6JA 1YBHA 1DRJA 1X7ZB 4NLLA 2R00A 3C6ZA 5H9VA 4TKUB 4PCUA 2CNDA 1BX3A 1YDMA 3S5JA 4EY8A 5G1PA 4ARUA 5LJLA 4AN4A 4DM7A 4A8JB 3RKRA 5HS6A 3WLHA 4BVLA 1KETA 1WG8A 1JB1A 2WF6A 3U13A 3WICA 3IBCA 2QMEA 2XQGA 2Y77A 1ZK1A 4JVSB 3RUPA 4JQYA 4O4JF 3HEAA 4PYQA 4W7HA 5EUCA 4CLOB 4D4MA 1F12A 2C0CA 1S8FA 3F6SA 3QA3E 2JJMA 1O97D 2JZCA 3OU2A 2ZSAA 4XWYA 2JGNA 1E3EA 1T10A 2G08A 2HLHA 4XR9A 5JNRA 5JANA 2UUPA 1LLUA 2HIGA 3CM0A 1XDUA 1Z0JA 1BWQA 4E15A 4M1SA 3W6ZA 2H2AA 3COZA 2JAOA 3DCIA 2P2NA 3OCWA 2OV3A 2RAPA 4Z99A 5B4TA 5EPEA 5L3SA 3VYVA 2OHHA 4WOJA 1JEDA 3AGQA 2F9FA 2QROA 2Z5FA 4O8ZA 4ANFA 2C31A 3ABSB 2I7XA 4AICA 5AUOB 2RHHA 1E69A 4UUNA 3BT7A 1Y3BE 4RY8A 4EABA 1CR6A 2QL7A 2D5CA 2VEOA 3I6MA 2IJGX 3FGPA 2Q3LA 3IQIX 4J6EA 4X63A 4AUEA 4KKXB 5KDLA 3B12A 4ZMRA 3IDSA 2WA1A 1WSWA 1I2AA 4FUQA 3VGPA 1JJ7A 1EP2B 1ECGA 1EZZA 1Q0UA 2HV9A 2O0KA 3H3XA 4N82A 4N5LA 4P4LA 3TN7A 3ZXXA 5AKGA 5AKZA 3ZDAA 5T4EA 1VKRA 3CBQA 2QUJA 5I47A 1Z75A 1ZFNA 3TOCA 5GZ1A 4MKRA 3Q0TA 4BO9A 1KA9H 1D1PA 5DLEA 2YY5A 4A5OA 1ISMA 1XLTC 5EIXA 2PUDA 5K5EA 4FDMA 3TPZA 1ABFA 1XYYA 1VE7A 1YU9A 2V97A 4F85A 1N6PA 2YWJA 4EATA 5EJ7A 1JRLA 2QQ5A 2ADOA 1KI8A 2QSJA 2C9DA 3O4VA 1P29A 3MRSA 1VHQA 5L7WA 3C15C 3OEWA 1T0HB 2O2DA 4FWTA 3MBIA 3VC1A 4OI0A 2ZFUA 1P9NA 3K9LA 1T5BA 2AYZA 4M9QA 1NP3A 1PT5A 1DX9A 4ROTA 2B37A 4B3DA 4G01B 1UQUA 4REOA 2Q4OA 4MV1A 4WFKA 5E8JA 4BAUA 3MWKA 1BFUA 4ZGGA 4IX9A 3ZVKA 4K26A 2IYAA 2FSHA 3HWWA 4LXXA 3TGLA 1DO0A 3NZEA 1HUQA 2C9MA 2O1XA 3D1JA 4V1CB 1A7AA 3I8SA 1G2IA 2XT0A 1VL8A 2FXIA 2AYXA 2NUPB 1VL2A 3ZWBA 4ZICA 4QU9A 3O3CA 3SSNA 4Q3DA 4JJ8A 1TAHA 1Y1TA 4WD3A 3TDNA 2ZPUA 3SKYA 3PIDA 1OAAA 1VCIA 3LRXA 3V4LA 5IPFA 2W5UA 4I4LA 4YTEA 3OM8A 1FJGB 1CUCA 1UBKS 1SHLA 4DRXB 2KWIA 1M8KA 1OWNA 2IXTA 1YMVA 2XYHA 2ZRAA 2YCLA 1T0JB 2ZM5A 3WMWA 2ZJ6A 4KV7A 2BFNA 2EJBA 2VATA 2X1HA 3EBLA 3JASB 2B7LA 3N2GA 5DK4A 2IYQA 3ELDA 4N40A 1A2QA 1TNDA 2GETA 2FZVA 3Q40A 4NCAA 2QP3A 2C2WA 2ZS8A 3M0EA 4RPHA 4R6WA 4HQNA 4D8TA 1QTRA 1VHWA 3BE6A 4Z9YA 4BNDA 4ZVUA 1JKIA 1P1BA 1OGJA 1VZ2A 4XYLA 4TRNA 3ONDA 3NAMA 4I1SA 3VR6H 4XVUA 4Z7NB 4RA9B 3VR5H 2F1JA 6REQB 5JW6A 1IXZA 2WB4A 2QQ0A 3OQ6A 2OCYC 3RVDA 4Q7QA 4Q47A 5HTOA 3Q2KA 3H2KA 3GLTA 2TMYA 4OHBA 4ZU1X 3ZHCA 4TTIA 1QGZA 1S3GA 2IDKA 2XUDA 1Y5RA 3FOCA 5AHOA 3M6VA 5H3CA 3OUUA 1E1LA 4UVDA 2H5JA 4IIDA 1DC7A 3W8NA 1CS4C 2QT1A 2C9YA 4KDEA 3WRVA 4BCBA 3OCUA 4BZWA 2JBAB 4ID9A 1TTPB 2AZDA 4QQFA 3GNLA 5B53A 4OH1A 3DLBA 2HQ1A 3HYNA 3LV8A 1DC4A 1GGJA 3Q9SA 4A92A 4P0QB 2VO1A 5FWNA 3GJ4A 2Y1GA 5ERGB 4OKIA 5D01A 3K9FC 3HVIA 2OZPA 1KDRA 1TYAE 1JFLA 1I6MA 1ZD3A 3RC9A 4IDQA 2IZ5A 4AYXA 1TFRA 4ZYZA 1GGFA 2HIHA 1ADYA 3BOSA 3I2GA 1X1BA 4KGDA 4NH0A 3IQXA 4JZKA 4QYTA 3G49A 3R7DA 3W9UA 3T1VA 3UTCA 4EY7A 1PL7A 1T91A 4JCOA 2BFAA 1CW2B 3H1GA 4IY1A 4M0MA 2R6HA 5E95A 4TYWA 5BWLA 3KM0A 5ALRA 1E9AA 1OX4B 1OROA 2AC7A 4GXNA 4NEGA 4DZRA 4YMLA 3BMOA 5BOSB 1Q1QA 1P17A 2V6IA 3LDGA 3BS4A 2OCXA 1VYVA 2HF2A 5H68A 3U5ZB 2GEUA 1O5TA 5KMGA 5HKKA 1PVVA 2HSWA 4PPGA 1MC1A 1NNLA 3PJFA 4Q3CA 5CLQA 4MVJD 4E14A 4AS1A 3OJCA 1U7XA 3OQPA 3RARA 4NBRA 4OBEA 2ZTLA 2J33A 1BS2A 1K3TA 4K9LA 3DT9A 1C9KA 2C88A 3NRJA 3C97A 3O4RA 3TR0A 3AV3A 3KQPA 3NO4A 4L8WB 3TKAA 3AH8A 3D54D 2JFNA 2PZBA 4F9GA 1FYFA 2EX1A 1GKLA 1OLXA 3FWZA 4RJKA 3RG8A 4A8TA 3C7KA 2OXCA 4N6GA 1PQUA 2CF5A 5DN9A 3ZXIA 2MSDB 2YJTD 4CR6A 3W5CA 2WEKA 5DP2A 1LJ8A 3EXEB 1KI6A 4MQMA 1E5DA 2JIZA 3FWNA 2I6GA 2ZANA 7REQA 1Y3DE 3ESZA 1PJ4A 1IBCA 1WPXA 1JIUA 4KO4S 3ZU4A 4JI4B 1SBZA 1XZLA 4QYIB 3V2GA 2PAFA 2DQZA 4PHCA 1X80B 5DV9A 3QBDA 1JR3D 1B7GO 3BEDA 4F6CA 1OVGA 2W2OA 3AG6A 3KQVA 4M0LA 1ABBA 4YRAA 1OYOA 4ZOLA 2G0NA 2WMOB 1EWTA 4P3PA 4LY6A 1LY1A 2QAGB 3U1VA 2OC4A 4YCNA 1JDSA 3IPCA 3S2IA 1ATZA 1RQLA 3UH1A 5C9ZA 5FA6A 2QY9A 3NVKI 1GN8A 1BN7A 3EC2A 4ZRDA 4QJIA 2VT2A 2YV5A 4UQOA 2YKGA 4ZI5A 1KEEB 5NLLA 2GS9A 2ZSDA 3C6KA 2WOJA 3HRHA 5DJ5A 5IKOA 3ZTWA 3EX7C 5FOQA 5TEWA 1KK3A 1ZSVA 1SHKA 3BMXA 2ADMA 1OLUA 3D2BA 4LJ6A 5T4HA 4EB6B 1UZUA 1DX6A 1M7HA 4MGZR 1YRYE 2GZAA 4GGPA 3HY3A 5M29A 2O7RA 4M8IA 4II7A 4QE3A 5JSKA 3TGWA 3Q3CA 2EBUA 2CKMA 5CLLA 4DDWA 1SBYA 1D0VA 4WEQA 2X41A 4WKNA 3NHUA 5LXTF 2DC1A 3IJRA 4B8ZA 4KQXA 4FM9A 5LZ2A 4WAUA 3U4CA 4CM9D 3TL2A 4IILA 1ZHOA 3M89A 1I7QB 5KVAA 4KSYA 1X6VA 4L4RA 3SIWA 4I8DA 1Z5NA 2XTMA 4DY4A 1PWEA 1VIDA 1A4UA 5HXAA 5K20A 4UW9A 4RJTA 1P6QA 4YXWD 1IIRA 3PUKA 1QE3A 1K63A 1YZFA 4LJ4A 1DIHA 1FNCA 1HL7A 1R66A 4R2LA 1C3EA 2Y1CA 3C3DA 3SEFA 4AKTA 2QENA 1O6CA 2QX9A 2TS1A 4TKZA 1XIVA 4AKSA 2OWEA 3H7IA 5KC9A 2BH9A 2CMKA 2XQKA 4UTVA 4PE5B 5KU7A 1JFSA 2IP1A 1DRWA 4XJSA 1MTOA 3N3AC 2B1JA 4DPKA 4RD4A 2FP3A 3EXG1 1G21B 5HZKA 2WTXA 3HYSA 1CFJA 4YPOA 3DPIA 4QDXA 4C76A 1DHTA 3DR3A 1RZRA 2P1ZA 4GC9A 2WJAA 4Q7LA 4B32A 1BWSA 2H4HA 4IIHA 1LBSA 2QUBA 2RG1A 4JEHA 4PTYA 4YMGA 5H9WA 3QKTA 2IH2A 3DV2A 2BE7A 4RWZA 5FPSA 3TTUA 5ALMA 2LV8A 1ZO8A 2HBQA 1YGPA 3HUFA 4KN9S 3DDUA 3NYQA 3EC1A 4ENQA 4AJIA 4B4VA 1M6YA 1LNQA 1Y7IA 3IAHA 2AX4A 3H8WA 3IC5A 2G28A 4F7WA 4IKPA 1LWNA 3C3EA 2NTNA 5H4GA 1JFFA 4JJ4A 3HB4X 2V4UA 4RTMA 4JR1A 1P7CA 3B8EA 2VZ8A 2BBTA 2XMQA 4M7WA 1UJBA 2Q41A 2JB9A 4GBJA 4KN5A 4FYWA 3H11B 3KLOA 1CEEA 4MUFA 1P1IA 5BNFA 1QZTA 5LZ5A 4BEJA 3ZGVA 1N3YA 4QDJA 2DTDA 4DFDA 4R7ZA 3EUEA 2C3UA 5SY9A 4DJTA 4E7PA 4Q7MB 4HGOA 5BWOA 1Q91A 2X2PA 4IGFA 4A5SA 2PPVA 2VF2A 1RHQA 4I55A 1VBFA 3O2NA 1IEQA 3EC7A 5TPWB 1FLNA 4BV8A 2FN9A 4LF4B 4YJFB 5ECDA 5FPYA 1MCZA 1U9JA 3JQBA 4QHTA 5JWOA 1YIDA 4R84A 2ZBRA 2IU6A 3KBOA 3DOFA 5JS1A 5HSGA 1CFZA 1U0HC 1IY1A 4PBRA 4NNOA 4NFHA 2OO3A 5JI3E 3HKDA 2DU8A 2C4KA 5HJ2A 4PCLA 5FPHA 4BFZA 1YQUA 1IYZA 3W4JA 4RZQA 5CHEA 3AKDA 2Y1EA 4KPEC 4FMDF 2J0UA 4UBMA 1P80A 3HFRA 3E8MA 5G4KA 2OOKA 3DMTC 2G04A 4KQKA 5EYPB 2FLWA 2IS1A 2W0MA 1UZAA 1ZY2A 1IN6A 1DQNA 1XWWA 2WQ7A 3LIIA 1FU4A 4KXXA 1NYTA 3W04A 1GTSA 1H2RS 3BILA 3CKMA 1S2DA 3NXSA 4DCJA 4G4SO 5CYGA 4ZOCA 1E6WA 5A4AA 3LX5A 1BO6A 3LPMA 2KM1A 4PAGA 5DRTA 2DQYA 1HQKA 1B76A 3NC1C 2ZJ0A 4HYTA 4UAJA 3VR0A 3T7JA 10MHA 4MS3A 3TS1A 3PIIA 5JCJA 2X5KO 3EFOB 3RNLA 1KH3A 2VJMB 4OU5A 1WHTB 5K3FA 2YVKA 3H6KA 4UC0A 4Y2RA 1VMEA 3MWFA 3HXTA 3H0KA 5A5GA 3QOXA 2ZB3A 2II6A 3DE1X 1RE1A 1WD5A 4NCHA 3FOZA 2HGZA 2WLTA 4LTMA 4YLGA 5FBLB 4ZPXA 4J0IA 3RVLA 1ODSA 3E1GA 1DBVO 1KYWA 4BO4A 1RI4A 5IAOA 3NBUA 1Z12A 3WFJA 3BL5A 3SBEA 4HSEA 4AY4A 4OK3A 3L6CA 2GHTA 3BFJA 4DA7A 1DS6A 4FHCA 2CHFA 1YRHA 2FOIA 3SXPA 2ZRBA 3LWBA 3JSAA 4IJ5A 3G2OA 4GPTA 4EEKA 4ETIA 2DH5A 4PSDA 2W2NA 2J07A 4KFRA 3FJ1A 4UHEA 4F6LA 2FWAA 4INZA 3AG5A 4ZCMA 1GEGA 1QTIA 2WJWA 4YDRA 4H18A 3USZA 1KTIA 1EE1A 1AQIA 1XTSA 2XWSA 4B2IA 1MW9X 1N5IA 4PSVA 1GQQA 3S1LA 2I7DA 2RHJA 2ZCUA 5TRTA 2GVNA 2Z8YA 4H1UA 3SJZA 3H5WA 4ZQCB 1GPH1 5C4GB 2C42A 1YV9A 3ADPA 2HF9A 4P4UA 1RWOA 2XE6A 1ISIA 1TC1A 2FZ4A 4PZCA 3UUFA 1OXUA 4I1OA 3K2QA 3KZXA 5HE8A 5CW1A 1VKJA 3KFVA 1C4KA 5KJCA 3VR4D 1OXVA 3KKLA 2OBFA 5E4FA 2C82A 2W83A 1CUBA 1UJNA 4WIAA 4EX6A 1ZICA 1KEZA 1OI3A 2AZTA 2J3HA 3OE4A 4KJXA 1ZRSA 3RHSA 4DDMA 1FZTA 1NSYA 5HRCA 4QFBA 2R0QC 1R5OA 1JQDA 1I3KA 1HYQA 2P5TB 2RGXA 2C7BA 2PX6A 4YMTA 2IX9A 3GIWA 4UM9D 3A8TA 5CG1A 2OBYA 5JCOC 1SC1A 4B17A 2IYPA 1U90A 9LDTA 1FNNA 4FMCB 4Y3UA 4EK9A 5FYQA 4ASUD 1ISHA 4OJYA 3RS9A 3GMDA 2JH9A 3VI3B 1VGVA 3WMFA 4O4IB 2C4VA 4WLEA 1PGOA 5C52B 4G4JA 3O8CA 4L3WA 4EYSA 2PUEA 4TV8B 1FP2A 1Z9BA 2Y8EA 3O8QB 1GRRA 3PEUA 3W3AD 4F4UA 2F4VB 2LDXA 5ADHA 4EY5A 1E79D 3ORQA 4AF8A 2IDZA 4ZCRA 3S8EA 2J30A 1PYGA 4FR2A 2JLUA 3FYCA 2A84A 1ZINA 1H5UA 3RWMB 4E2WA 4EUFA 3B6KA 4QGSA 1AUOA 4Y1GA 3SEZA 3GRYA 2GN8A 4XIYA 2ERCA 4IDNA 1RI3A 3PUVA 5G0TA 2CMDA 5AKHA 1J1UA 3LSTA 3UAZA 2IXAA 3NM4A 4BLTA 1DADA 1Z45A 1ZN7A 1KJQA 1N57A 1Y7PA 2OO7A 3RIEA 1MIOA 2ZSEA 1BHO1 1F6WA 2J5RA 2K4MA 2ATVA 1UWVA 3KD3A 1E3JA 3L49A 4G63A 3EG5A 2BFCA 2NVUA 3PVCA 4LRQA 2WYUA 3ADKA 4BP1A 4L5CA 2FB9A 2I4LA 4M1QA 4OQFA 2D6FA 3FZGA 3EPLA 2RI6A 4UJ5A 4P35A 3TWOA 2OGSA 1S1MA 4BNIA 4C4AA 5B7NA 2UXCB 1NQOA 2XAUA 4BNFA 2W11A 1KVQA 3B1XA 3EAGA 3PT9A 2D06A 3RRYA 4DVGA 3PFBA 1TOAA 2XCIA 4LQCA 4DUGD 5CPBA 2OV4A 4QUGA 1DQSA 1DEXA 1B0UA 3CF4A 3GP3A 1ZIYA 2YHBA 5FO1A 2H06A 3UW3A 4ETWA 3F90A 3ZDBA 2VAPA 2VSQA 5FHRA 3D3KA 4QUEA 1TVCA 3ZXSA 3HC7A 2XF2A 1RABA 3HNRA 3EVZA 3C3KA 4MVJA 4UNPA 3FVQA 1D8AA 4OHYA 3B2NA 3KQMA 4F6RB 2YCBA 5C4MA 3SQXA 1G6KA 2PA0A 4RMJA 3E3AA 2ZBPA 1TU4A 3EGOA 5IXJA 3H83A 1GL9B 1JI3A 1KC1A 3N3BC 1RAGA 2I9KA 1UDBA 1KDOA 3ZTTA 4MLPA 4KR7A 2XKJE 5AW5A 1NFQA 3RANA 5CCDA 2WWYA 1WUTA 3OLZA 1OGIA 3R7BA 1XCGB 2QVBA 4Q4DA 2I6TA 1XZNA 1Y9EA 1C4OA 4G8CA 3P9ZA 4DANA 4F1JA 3DAYA 3K1AA 3HWSA 4EITA 1KPHA 4PRKA 2HCBA 1RQPA 1SIUA 3A6PC 4JYAB 3L8EA 5E6SB 1PR1A 2PFGA 3R6DA 2NAFA 4O4LF 4ZCQA 3VHRA 4EFDA 2AFIA 2PWZA 1FVFA 4TXJA 2DUJA 2FPGB 5JDCA 3AL0C 3O1IC 3OIYA 1P4SA 5E6RA 5DX1A 5HFJA 4D8XA 1OYVA 1WO8A 1GUZA 3BC1A 5BRAA 4RTOA 1IPEA 2ETVA 3Q3JB 4YCBA 5KOIA 3KSAC 5D3MA 1EM8A 3GN2A 5JSHA 3TXXA 4S1NA 4Y2SA 2JJQA 4MCHA 3DCJA 4MR7A 1CB0A 2W6JD 3ELUA 1BS9A 1MEEA 3HRIA 3I2JA 3KEFA 3RB8A 4LMRA 4EENA 2HDOA 1M1UA 5FPQA 3C8DA 4BNJA 4C0LA 4F91B 5LA6B 1US8A 3Q9LA 1R27A 2C2GA 2XCOA 1UT8A 4KIWA 4PZYA 1ECBA 5E4YA 1LI7A 4HQKA 2QTNA 4ISBA 5E9AA 2HXSA 3QUSA 5C53B 1HGXA 2FSSA 5TIIA 4OXYA 3BWMA