4J8PA

Crystal structure of a putative flavoprotein (bacuni_04544) from bacteroides uniformis atcc 8492 at 1.50 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
156
structure length
156
Chain Sequence
KGGKTLVAYFSATGTTARAAKLVAEAVDGTFYEIQPAKKYTAADLDWHDKASRSSVEMSDSKSRPALYSKLGSLAEYDTIYIGFPIWWNLAPRIINTFIESGDFAGKTVIPFATSGSSSISNAEKELQTNYPGINWGKGRLLNGASRETVKQWIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Flavodoxin
publication title Crystal structure of a Putative flavoprotein (BACUNI_04544) from Bacteroides uniformis ATCC 8492 at 1.50 A resolution
rcsb
source organism Bacteroides uniformis
total genus 47
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12682 Flavodoxin_4 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j8pA00
4YAUA 4U7FA 1VMEA 1CZRA 3F6RA 1T0IA 1AKTA 1AG9A 4QOIA 4S24A 1V4BA 1RLIA 1WSBA 4Y9RA 3QFCA 5EA2A 5LBUA 3NLLA 1FTGA 3K1YA 1DXQA 4R81A 2FVXA 1YRHA 2Z9DA 3FJOA 5LLDA 3NHSA 1NNI1 5LVAA 2Q9UA 3B6MA 5TGZA 4GR9A 3NHLA 4PTZA 3QE2A 2AMJA 3NHRA 2Q62A 3ESZA 3ESYA 4GQIA 4LTNA 3W79A 3N39C 3W78A 1AKUA 3HR4A 1AKQA 3NFRA 4LTDA 5ULLA 2FAXA 3OJWA 3F2VA 2OHJA 2BZSA 4J8PA 5FX2A 2ZKIA 2FOXA 1OBOA 3RPEA 2QX6A 2A5LA 5JROA 1CZUA 1J8QA 3HLYA 3GFSA 2WC1A 4PTYA 3NHYA 2OYSA 4CETA 3NHWA 5BUCA 1XYYA 4DIKA 4QOEA 4ZVMA 1CZHA 3EYWA 3NHJA 4YAWA 1XT6A 4BMOB 2HPVA 1J9ZA 2X2PA 3N3AC 2V9CA 1YCFA 1H66A 1DX9A 3FX2A 1XYVA 3U7RA 2QMYA 4N82A 1YOBA 1J9EA 1T5BA 3NHFA 1C7FA 4DILA 2GSWA 5FUQA 3QFRA 1DXOA 4ZVLA 4Y9UA 2BF4A 2F1OA 3S2YA 1QBGA 5LJIA 4FGJA 2BN4A 3TE7A 3N3BC 1RLJA 1B1CA 3TZBA 1BVYF 4QOJA 6NULA 1J9GA 4H2DA 2R96A 5NULA 4LAFA 4QOFA 1YCGA 3KLBA 3UXEA 1KBQA 3NHKA 1FLVA 1FLNA 3R6WA 3L9XA 1QRDA 4H6PA 1CZLA 4GI5A 3L9WA 1I1OA 4ZVNA 1SG0A 3LCMA 3GFQA 2BPOA 1ZWLA 3JSXA 3ESXA 5F12A 3UXHA 5EMNA 2BMVA 2D5IA 2Z9CA 1QR2A 1OBVA 3B6KA 1AHNA 4BMPB 2XODA 4ICIA 1X77A 4YALA 3K20A 4C14A 1FX1A 3OWHA 3HA2A 1AKWA 3OJXA 5FA6A 3P0RA 4NULA 3B6IA 1RTTA 4QOGA 3KAQA 3ZHOA 5B3KA 3SVLA 2FDXA 4FX2A 3OX2A 4NLLA 5LMCA 1CZKA 1CZOA 1YCHA 1GG5A 1YKGA 4U7GA 1ZWKA 4FGKA 1C7EA 2MT9A 1FUEA 3TEMA 3EDOA 4Y7CA 3OX3A 3W7AA 1SQSA 2XOEA 1AKRA 3FW1A 4LTMA 3F6SA 5EAIA 2QX8A 1AZLA 4YAOA 2HNAA 4CF6A 4HS4A 4DY4A 2N1MA 2KLBA 2FZ5A 2M6RA 1BU5A 4QOHA 4D02A 4YQEA 2FZVA 3LT5A 5F51A 1RCFA 1KBOA 5LJLA 4C0XA 1H69A 3O73A 2ARKA 4PU0A 3FNIA 2FLVA 2Z98A 2W5UA 3FVWA 2M6SA 4OXXA 2MOKA 4ZVKA 3OX1A 3B6JA 5NLLA 5LBTA 2V5VA 3GFRA 2RG1A 3OWXA 1FLAA 3OVMA 4ESEA 1TLLA 2OHIA 4C76A 1YDGA 4XDGA 2QX9A 1D04A 3GAMA 3F90A 4U7HA 4FGLA 1D03A 4C0WA 2MWMA 4HEQA 3KAPA 4N65A 1JA1A 2QMZA 2FCRA 4M0CA 3U7IA 4F8YA 3ES9A 3NHPA 2KQUA 5F4BA 3G5MA 1CZNA 1WSWA 2V5UA 2QX4A 5B3LA 1QHEA 3KEGA 2FX2A 1TIKA 5A4KA 1XI2A 2QWXA 2Z9BA 3D7NA 1FLDA 1OFVA 3W77A 1F4PA 1FVXA 3NHUA 1E5DA 2QR2A 2OHHA 4LA4A 4XDHA 2B3DA 4QODA 2R97A 1AKVA 3O2NA 4N9QA 2X2OA 2HNBA 4YAFA 1ZX1A 2MTBA 1D4AA 1JA0A 1AMOA
chains in the Genus database with same CATH superfamily
3KDPA 4U9IS 4JGBA 4EHFA 3BL6A 2AMVA 2Q4RA 5KMGA 1YD7A 3CLRC 2C5HA 3Q7IA 5KSWB 3FA2A 3K9LA 4L4XA 4KIJA 1II0A 3JZFA 3D3WA 2X13A 3Q6NA 4KWIA 3VU9B 5KMGB 3KSMA 4RC9A 3SBXA 3D3WB 5I4KA 1WCWA 1Z4MA 2VP4A 2ZSIA 1C0LA 5JSFA 2PXAA 3OUZA 2FPWA 3GMSA 2ODEA 4RNDB 4TOIA 2Y67A 3RSSA 4AO8A 3FTCA 2I1WA 2RD2A 3JD0A 2V7QD 1SHUX 4WKNA 1A8SA 1UBRS 1Y98A 1QK4A 1UC9A 4G67A 4Y2QA 2QZSA 1XB2A 4XCVA 1DWOA 2EJBA 4IGFA 1Y63A 2VAPA 5ERGB 2VHQA 1MJNA 4XAQA 2J0UA 2DCUA 3UCXA 1CE8A 2C88A 3VR5H 4C5CA 2AJDA 3BAZA 2RGCA 2J0UB 4FQ7A 1KJJA 1EFPA 2ZI9A 4A8JA 3BT7A 4KNVA 1LDBA 2JGIA 2YWGA 2Q5IA 4WOPA 3URMA 5GZ6A 1UEIA 2FFJA 5C8VA 3JX9A 1I94B 1EFPB 1UXJA 4RIIA 2CWWA 2C61A 4RTRA 4X90A 5CXQA 2GBLA 2QN8A 4G5QA 5ALKA 3FPHA 1RS0A 4L57A 1ONBA 4AXXA 2ZB3A 4ZHSA 1OXVA 2CSXA 1J8VA 5BQOA 8MHTA 3A1NA 2CY0A 4UXIA 4D4IA 4DCTA 1TLFA 1C0IA 1DKPA 3TMKA 5BW4A 4OHUA 2EWWA 2FEAA 3HV2A 1R15A 2HK6A 3QVMA 3GMTA 4UHKA 3VNAA 1G0OA 1J2EA 4Q4CA 4WXEA 4H59A 5DNYB 5J2UB 4P3KA 4XA8A 3SSNA 2C7OA 5HZGA 1F7VA 3OZUA 1XLUA 1BTOA 2JI6A 4EPTA 2KBEA 1C9MA 2H51A 5HWSA 4ZRNA 1R0YA 5BPHA 4AMGA 5KYXA 1KYXA 1J39A 2BKUA 2RGEA 2HEIA 1F51E 4MMYB 5AM2A 2RGWA 2Y0BA 4JJ4A 2P8SA 4I46A 1RABA 4GE3A 5KYXB 3U3OA 4O2AF 4JU8A 5HA5A 1P1CA 5AKHA 2BZSA 1YJQA 1YMUA 3ZWVA 3LK6A 3RVPA 1IEWA 5KTOA 2XMZA 4YROA 5F4ZA 1HA3A 4NZOA 3EWIA 3L93A 3DMRA 3WWDA 2QRUA 3GI1A 4BYGA 2PX4A 4CDGA 5EXEA 4DM4A 2P1RA 5EIBC 2HRBA 3NBYC 3OTHA 2A5LA 4QO7A 5LZ4A 5FO0A 3FG9A 4QJIA 1OWLA 4UU1A 2P2DA 3CISA 2A0YA 3DE6X 1FEZA 4DJDC 1TIBA 3UCFA 3HKBA 4Z7NB 4IUBS 1T2NA 1FP2A 1MMFB 5DF1A 2QP9X 2RMKA 2ERXA 5G02A 4J0FA 2HXGA 4FCCA 3ZZ1A 5FLXA 3VZPA 2VOJA 5IC6A 4CF7A 1PP4A 2XZTA 4UE2A 5JNUA 5EHZA 2OORC 4FTWA 4H17A 1QNLA 4QPDA 4JP8A 1A1SA 1AK2A 2AN1A 1LNSA 1OXSC 3ZPXA 4YMTA 4TTJA 3IFSA 3L1JA 1QIDA 3C8HA 3KVYA 3JATB 3AIMA 1ADBA 3OHMA 5C5DA 4LY6A 4JC5A 4P98A 1QIHA 3TRHA 1QPZA 1T10A 4CM9A 5CFNA 5IWCA 1TVMA 3IC5A 3K0KA 3ZVLA 3O4IA 4FFOA 3KRTA 4DEYA 4BO7A 4HC4A 1G8SA 4LC0A 1DLIA 1D09A 3QBDA 5LB4A 1OB2A 3OAAD 5DNWA 5THQA 1G55A 3DYVA 1VDMA 1LVHA 4YP9A 4WERA 5AJYA 2WKWA 3K9FC 1Y7IA 1DX9A 2FPUA 3DOFA 5E95A 5I5GA 4US2R 3A2KA 4ITVA 5TJ9A 4KIUA 2I8LA 2QIPA 3F6PA 2PBZA 3TFQA 1DWUA 4F06A 3OEHA 2H18A 3FNBA 1MQ8B 1TA4A 4FSDA 4KAAA 1GCUA 4WNAB 1ZAKA 2TYSB 4HLNA 4KG7A 3C2QA 4OOFA 3RUAA 2EWMA 3Q0EA 4ZYVA 5BXQC 2HI0A 2AEJA 4LE1A 2IYXA 3K0AA 1VPEA 3GJ6A 1C5KA 2ZSDA 2PT9A 3I6QA 3G5UA 4LSWA 3FWYA 1SAYA 3GL9A 3OC6A 3K0AB 1L7XA 4JQOA 5AKKA 3CF4G 1NJ6A 3E05A 5LD2B 1NWCA 1V11A 4LDZA 4NENA 1W1WA 4UASA 5ALRA 4ARZA 2VKTA 4LRXA 3T9FA 3WGHA 1LLFA 3JPYA 5HCIA 5JS6A 1IATA 1T1SA 1V11B 4NENB 2PV0A 4ARZB 4EFDA 1T9CA 3QFRA 4Y6OA 5H3CA 3HC7A 1IUNA 1I32A 2JAUA 1RJFA 1CUFA 4GX0A 2YVLA 3CX4A 4RETA 4ZVLA 4CR7A 4DFDA 2W37A 3X1YA 4TMVA 1X2EA 4LUCA 2KWIA 4XLZA 5LJIA 3LPAA 1MDFA 1KGSA 3L8CA 4KO8A 4KQWA 5IVPA 3ZU3A 3GRZA 3DFFA 1V5FA 3HVUA 1TTHA 2NVOA 3NBAA 3SZGA 4OBXA 4UD2A 4C05A 2HQSA 4QHYA 3QWFA 1VB3A 3H97A 3MT0A 3PCXA 4MAAA 2Q3EA 1T1GA 1UBJS 2AYZA 4X94A 3TZBA 4EUHA 3QA9A 1KK3A 2WFMA 2YVKA 1KO7A 1MAUA 3MMXA 4LOLA 4OGFA 3RVMA 2ZBRA 1ZRSA 2CSUA 1JDBC 2ZIUB 4L6IA 1DBQA 5TNXA 1JMKC 1K5DA 5ICGA 4UUPA 2VNHA 4YLEA 4D9CA 3TLCA 3MWJA 4L0MA 4EKYA 5E1OA 1TQ6A 3TOZA 2HXYA 3W5BA 2AKYA 1JVNA 3NBUA 4C3UA 3EZ7A 4LMPA 2HDHA 5DGXA 4Y1GA 4QYXA 2PX5A 2G0TA 5KVAA 4IDHA 2ZSUA 2NG1A 2VT3A 3R4CA 4GGOA 1V96A 1MV5A 3M3PA 2Q45A 3AF4A 2FF5A 1A2BA 3ZK8A 4DYVA 1EX7A 5L7WA 5E2AA 1X8KA 3L7BA 3ID6C 3NHBA 2BMEA 1T29A 2QGZA 2HLNA 5KJ1A 1KH3A 4NARA 4IJMA 2JLSA 2L19A 1ZD4A 3D4PA 1Y1RA 2DPMA 2HUPA 2XWPA 1HNWB 3K70B 3EIEA 1QRDA 2CT8A 2GGSA 2D8MA 2VPYA 2RB4A 2ZBUA 2QSJA 4ZALA 2QG4A 1DKQA 1NVMB 3INNA 4Q3NA 3RQSA 4U00A 3AFGA 3W4KA 2AN4A 4BMXA 1XXHE 1E3MA 5J4LA 2ZRHA 1RHMA 5IT9A 1N0HA 4XQ0A 1RI4A 2QTVA 4BAUA 4HGRA 5E9AA 5JU6A 2PSEA 1NC1A 1PR4A 3ESXA 3LD9A 4XYGA 1Q50A 2ZJ0A 4AZ3B 1EP3B 2QTVB 4DEVA 3KR0A 1RQ2A 5B2EA 5BORA 5JD4A 3U61B 4W9RA 4M1QA 4IV5A 2I4NA 7MDHA 1KXJA 1VKZA 1QR2A 4J03A 1NBHA 1N6HA 5EZYB 4D81A 1Q1EA 5EOVA 3ISVA 3SK0A 4YGYA 4H1UA 4IMJB 3A4IA 2D74A 4B81A 1W1UA 4GDMA 3ZE1B 1DMRA 1O97D 3FKSD 1M74A 3NWEA 3PDWA 1HYHA 3G2JA 3LKVA 4MUMA 4LC1A 4WEOA 5EVJA 2X9NA 4YALA 3UJCA 4B4KA 1OH7A 2V6IA 4UAUA 1LBSA 3K20A 3DVRX 2BE7A 2QTHA 4MX8A 1HNXB 2YHSA 4C14A 3SMVA 3HSYA 4NFYA 1QHHA 1U3WA 1JFLA 5CXXA 5JPCA 2WJZB 1NQTA 3HA2A 2X0KA 2Y92A 3QJYA 1O54A 4YJDA 1IN4A 5BURA 4MQFA 1KJQA 1TXGA 4FFLA 4U2BA 4V0ME 1QHHB 5L3RA 4ER3A 3N87A 4AULA 1Y6RA 2JIDA 2L82A 1DS6A 2OEPA 4MQFB 2V6JA 1PUXA 5AMXA 2QM8A 1C3LA 1Q3TA 1SKUA 2IOFK 3KWFA 3P0RA 4P86A 1UWVA 1P73A 3W5AA 4NULA 3HA3A 4NCXA 3NETA 3FCYA 1IY0A 2Y0EA 4HFNA 1E7RA 3WKAA 2UZ0A 3EXIB 3HCFA 4UBJA 2C2ZA 1DAPA 3E7WA 5D6NA 4E07A 1ILWA 2ZRKA 3A0RB 5DCLA 5LP6C 1T3TA 1JI3A 1YXMA 3HH8A 2PWYA 3DOIA 3GVPA 2Q5CA 4NCIA 1SXJA 1XGKA 1Z6QA 2EZ9A 4B6RA 2MSNA 3HCOA 4BLRA 4BNGA 4R6XA 3N53A 1MH1A 2J59A 4C0SA 3O4HA 5LIPA 1MNQA 1CUDA 3EVEA 1KC3A 4TZKA 1SXJB 3CEAA 4DZRA 2NU6A 1Z3CA 1PFQA 4BAZA 1YKGA 3IKTA 2VYCA 3RSLA 1E60A 1H8HA 3QKWA 4LJ4A 3H0CA 4AYTA 1WXDA 4E22A 3PLAE 5TQVA 2QRGA 4JKYA 3UH1A 1JTEA 3VPAA 2IPNA 2PWZA 2H3HA 2OQRA 3M3HA 1CJKC 3OM1A 1ZU4A 4KSYA 4TRNA 3I5XA 4X54A 4R1UA 1CRZA 4RTMA 3RFFA 1CQWA 3GFVA 4DLSA 1QVWA 1V8PA 3R75A 1E1DA 1L5QA 3QMMA 3VYVA 3EXHA 2WSLA 2C58A 4X95A 1H5UA 1L5SA 2IYSA 3DD5A 3ZCRA 4BQOA 3RRNA 4BP3A 1PZMA 4CHTA 4RVUA 5HF8A 5JZSA 3EXHB 1S02A 2O0LA 2V74B 3UANA 3HGMA 3T4UA 4BO1A 4F4FA 1SHJA 1XZQA 2GXUA 4WXRA 1IG0A 5I48A 3TVDA 1IOZA 1PNTA 2H2AA 2QTNA 2PFGA 3BFVA 4RUKA 2G9UA 4E11A 3HJHA 1JAYA 1L1EA 2K87A 3NTRA 3KSDO 4OHPA 5EXDA 4DC9A 4Z9YA 3I9OA 1EUQA 1CQZA 5DIFA 2G1PA 3ZQUA 2CF5A 2JJ1A 3SJAA 4AMZA 1PGPA 2WTNA 4MQ4A 2SCUA 4DDTA 1PJQA 4PU0A 4ZDJA 4PSVA 4PGFA 4P4NA 3LLUA 1H8EA 5J4VA 3COYA 3QVJA 1U5AA 2SCUB 5FI3A 4LF6B 3ZD8A 3CT6A 3BK7A 4J7UA 5PGMA 4KUHA 1WOYA 4JLMA 3WGGA 3KTDA 4EPYA 1AMUA 4OI0A 1TYBE 2HU2A 4QNNA 4Y9TA 3ZTWA 2Z2ZA 3WHLA 5CGQB 4PW0A 4BE7B 5JXWA 3UC9A 1KI4A 2VSQA 1Y82A 4BIMA 3EN0A 3QVSA 2CXQA 4Y2RA 4JITA 3BVPA 1UP4A 3G9ZA 3GEPA 3ZHSA 3QLTA 1XEWX 3VA7A 4RQUA 4WN3A 5D7BA 3L1KA 2P1ZA 4IFIA 2JBHA 4X5OA 3R6GA 2XNSA 3WIEA 3T1HB 2YR0A 3BREA 3K92A 4P81A 1I4LD 1O7JA 3ABOB 5KSYA 4I50A 2BV3A 2VH2A 4FYPA 4XQEA 2HBYA 3GA7A 4JR0A 2VDLB 1WDMA 1U28C 5JXGA 3WZ2A 4II7A 5A6VA 2AKAB 5CD9A 1U1IA 1COZA 4M46A 4PZ0A 2WICA 1E6KA 5KHAA 2WJPA 1FYWA 4DSUA 1C4WA 1CRQA 3PXCX 5BO5A 5JQWA 2JBAA 1O08A 4IMPA 3GAMA 3C45A 5HQ3A 4RJTA 1UM8A 1DG3A 1U7ZA 2JBAB 4HFRA 2I7XA 1WVIA 2J48A 5AK6A 1HE5A 4GOOD 3DUWA 2CNNA 2VZ9A 1XEWY 5CTJA 3DAOA 3G3EA 5DTQA 4OA8A 4EBFA 1U8FO 5HQ3B 4JD5A 5IKMA 3T3EA 1OMOA 3TXAA 1TUIA 2VHEA 4G01B 1KAOA 1EA5A 1PT8A 4CKCA 4F9TA 3KPUA 3U7IA 4MEJA 2ILVA 3F7TA 1STOA 1TJPB 4K9NA 1SZDA 4L15A 1JKMA 3CTPA 3HCCA 4KV7A 4CKCB 5FBHA 3TVYA 1RAEA 3I12A 4FUTA 1GTG1 2VZLA 3LY5A 4D6XA 4DUGA 3VR4A 5BSFA 5JH7F 2ID8A 3GCWA 4B79A 1YKSA 2W2KA 2QS9A 2J6IA 3FZYA 1AC5A 3KSUA 2ADFA 4RHUA 5HZKA 2FEOA 3K1ZA 1OZHA 3VHLB 3OTGA 3WWOA 5JBQA 1QGYA 2W2KB 3RVLA 5KWVA 1GGFA 4HNAA 2AIRA 1EZZA 3KKOA 1DIBA 4BQNA 1ENZA 3QUCA 4DMFA 5B3LA 2BYTA 3E0QA 1RKBA 3ILXA 4B8YA 1YCDA 2FX2A 5C80A 7YASA 2EJWA 2JCGA 2AOXA 1UPAA 4HNAB 4YP1A 1BAPA 4U1RA 5IG2A 3KLNA 2Z9BA 2CFIA 1EVKA 1Y9EA 2ECQA 5HOQA 2EZTA 3CS3A 3EA0A 4NBUA 4PXAA 4W99A 1WW2A 3OECA 4DJTA 1DCFA 3L49A 3OURA 1H23A 2X0FA 4KR2A 1LPOA 2QL5A 2FR8A 5CVDA 1RKVA 1WOMA 4B09A 3W1WA 3C87A 1L5VA 4AWXA 4CL0A 4HEHA 2WTEA 2TECE 3UMYA 1OAOA 1JR4A 4G63A 2NPFA 3LT4A 4F5YA 5CFRA 3ANMA 3O75A 4GWLA 2EATA 5EIFA 1X0VA 3AM3A 3GMDA 5EJ8A 4AFNA 3CU5A 1C3OA 1QHIA 4O4IA 1Z08A 1J2UA 3O2NA 1IZ7A 4ESOA 1V3QE 4PSCA 4N9QA 1C3OB 3BD9A 1XD8A 4JBHA 4HDKA 3RRYA 5ALWA 2A4KA 1XJ0A 1N2CA 4Z1MD 3I9NA 2FZEA 5MFPA 2VS1A 3CC8A 3TI7A 2F64A 2ENWA 4HDKB 3VJMA 3KETA 1HDRA 4RAQA 5L3SB 3AI7A 3R5JA 4O63O 1HE2A 1N2CB 4O1IA 4DRXA 2F8TA 1ZSVA 3LYHA 4N12A 2QU8A 3NTOA 1NC3A 1RWQA 2NPIA 2VHVA 4KQ1A 2NXNA 2REOA 4L74A 5LQMA 4DRXB 1NNEA 1M6VA 4N8EA 4EFKA 3I9FA 3P9KA 1MQAA 4LHSA 1HKUA 4OHCA 2IUYA 1Y3CE 4WNYA 1KWGA 3KVNA 2YJ3A 4RZIA 4LRWA 2FPIA 2NO6A 3PGXA 4RULA 4HAXA 3L7DA 5KYYB 2BTQB 2G7MC 1XE3A 3IEXA 4JJ6A 4KQFA 1KRHA 2FPIB 1PQ4A 2IU0A 3MBKA 3EPLA 4FHCA 1NLZA 2IWRA 4UHFA 8GPBA 1VPTA 2HA3A 2QAJA 2IS2A 1NAHA 2H5JA 4GWKA 3CCBA 3GELA 4MKIA 3G89A 9LDBA 3OCWA 1YRHA 2DPGA 1N9ZA 5K51A 2Z2JA 2VSXA 4UAGA 5CT9A 4IFTA 3F97A 3PVCA 5IM5A 4AP9A 3SU8A 1CPYA 1RPNA 4WJKB 4M1OA 3FZGA 3WGJA 3TWOA 2ZR9A 5EIEA 3VR2A 2G0AA 1TEXA 2O7VA 2KPOA 4ZYXA 3D6TB 4QG3A 1YS6A 5SY4A 1DAMA 3DMNA 2AHRA 1JDJA 1T6XA 4OPMA 4PO9A 2RHJA 5EQFA 4A8TA 1YI1A 3QE2A 4LJRA 2O05A 1BMQA 3PPIA 3TAXA 2C03A 4TXJA 3U6BA 5EE3A 3IUSA 4JI2B 2M1ZA 2OCDA 3CZ4A 2AH5A 1ONNA 1UL1X 2JH8A 2JLAA 4IGKA 2VAXA 2ZT5A 5DCYA 4CHGA 1RPJA 1GNLA 1L3CA 3JARA 3LWBA 2DR0A 4MP8A 2WM9B 2PX8A 4EHBA 4JK3A 3KDAA 3JARB 4CV1A 3I73A 2E4ZA 4QU0A 1ID8A 1PR9A 1G8PA 4YDSA 3VH2A 2O6LA 4BKRA 1RCTE 5EJMA 3AR6A 1Y6ZA 1DT5A 4L6CA 2FSVC 3T8YA 2CW5A 3IT2A 3M7IA 1EDZA 1QCYA 2BRUA 2HCJB 3GAAA 3ZC3A 1HFEL 5INTA 3TX6A 4JB0A 1HPLA 3L8YA 3PFIA 4I4IA 5ADUS 1DO0A 1DC4A 2ZUUA 3UMSA 2IE8A 5LLTA 1LJUA 1T5TA 1ECCA 1LUAA 3A28A 3GT0A 3KALA 3S99A 2CFCA 1C41A 4QXRA 5AW1A 4LOAA 1G38A 2WSMA 3NJ8A 5IBRA 4PG4A 1DNPA 4LECA 4CM3A 3WGZA 2E82A 3MNFA 1X80B 4WKPA 2V0NA 2C2YA 1OBOA 2VA9A 5DGHA 2MSLA 4RM3A 1L1QA 121PA 1GFSA 3M9XA 4RVSA 4IIJB 4EAQA 3KHKA 3CEJA 2GUWA 4MI3A 2QHXA 1FFBA 4WCFC 1MLDA 2PO5A 2QP4A 1ZI9A 4EATA 2O1SA 3I23A 4I9NA 5KTRA 1V25A 3ROXA 3H16A 3VZRA 2H4YA 2QTAA 1I3OA 3MTBA 3GLRA 1P6UA 1B41A 5DW0A 5K20A 2XB2A 5MN4A 2AI1A 1TO2E 1PNQA 1BMDA 2XXBA 3CLRD 3D54D 1CYDA 2E21A 2FPXA 4G25A 4HGOA 1XJCA 4ITUA 4OLHA 4PTYA 2GWHA 3TIIA 5LA6F 1NMQA 2GZDA 4RFLA 1WG8A 2RGGA 2RBGA 2X8JA 3ITKA 4RY2A 4G4SO 1P1FA 3PFBA 4K1XA 1TYCA 4F9FA 1RCUA 4QLBA 1JPUA 2X8JB 3T7CA 2C84A 1XYYA 4RWZA 1R8QA 1VHLA 2GO7A 4QOEA 1EPUA 3EMKA 1YB1A 3OKPA 4XFDA 2HIGA 2ZIVB 5FEUA 4AY2A 3NDIA 1CD5A 4JJAA 3ZHCA 2HCRA 3M9WA 4BMOB 4EZEA 1NBIA 4DR5B 3LRTA 1NBOA 4P33A 1VKOA 4BNFA 1W0CA 3V8EA 3CKYA 4Q15A 2GBPA 3HM9A 4MA0A 4GP6A 2GKOA 1LRLA 1T1EA 3B1JA 3GP3A 5CLGA 5CP8A 2V7XA 2ZUFA 3VYWA 5F2OA 1TMOA 5B1YA 2WIKA 4KWEA 2BMWA 2QUHA 3NT2A 3E5MA 1T8PA 1HGXA 1E8DA 1NMEA 1UBFA 1NF3A 2FY8A 2KSQA 5KNLA 4HVCA 1I0LA 1REQA 1T2AA 4PPYA 5D87A 4BGIA 8ATCA 1CDEA 4ENSA 1N36B 2JHAA 1D2RA 4RGQA 5HFJA 3VR3D 2C7GA 3C6MA 2NUBA 4EGJA 2PL1A 3B7GA 4UHBA 1FXSA 1U2GA 4URWR 4P5DA 5DOZA 1UKYA 5TS2A 3T9AA 1MAAA 4PF1A 4JSYA 4V03A 1GEEA 1HEIA 4P4LA 5FPPA 2Z43A 2E3JA 2XMRA 1MG5A 2Q4TA 3KOOA 4F2PA 2GXAA 3B60A 3ZZTA 4MULA 3A05A 3AUKA 1BMTA 3RSQA 4KJXA 1L5HB 3RVBA 1LK0A 1IN7A 4OK3A 2Y6UA 3H9UA 1FSPA 2FPPA 1LWNA 2O2EA 3NRCA 1ZK3A 2BZ0A 5JLJA 2IV3A 4XW2A 3UG7A 4G1MB 3IBYA 5BUQA 5CG1A 4O59O 5KVVA 1Z7BA 2FPPB 2EC5A 1FSFA 1UODA 2GHTA 7GPBA 1E7WA 2FQQA 3AUJB 5DCWA 4D99A 5B55A 3R23A 3EBOA 2I22A 1YF3A 2WZCA 1ZIYA 3KT6A 4B6PA 4LSGA 1WZCA 1B1CA 2POCA 3H3FA 4RHXA 3IV6A 4ZQCB 3T61A 3EFBA 5T4BA 4DIOA 1O2DA 3RS2A 4IICA 5CIQA 3P9PA 3LTNC 2A3RA 4DIFA 4PG6A 2Q2NA 1SC6A 3IKLA 2NVUA 1IFXA 3FCEA 5H68A 5JJCA 1DCTA 2BFEA 1M1ZA 2IDJA 4XKJA 4DUZB 4U4AA 1GUFA 1CDZA 3RT1A 1MO2A 4XOUA 2XZLA 1L5GB 2NVUB 5DXFA 2BFEB 3QKSA 3CKKA 1BXGA 4M0EA 1DDOA 4JKOA 4KX5A 3DOEA 3T52A 4I08A 4G85A 3QKSB 2GILA 4OHXA 4F2WA 1BXGB 2BJWA 4RH0A 5COBA 1ZJZA 4WKBA 4XSVA 2W00A 4ZAVA 5CPFA 5EL0A 3FN4A 1QO7A 3SXUA 3DPIA 4R69A 2G6TA 5EMMA 4JQSA 4UAVA 4K9PA 5K6AA 3WKEA 4EEXA 1TW3A 3SXUB 1J5PA 1XMIA 1PS8A 3DTYA 2A4MA 1Z12A 1ZK0A 1NHWA 4BGUA 1VL8A 1ZA2A 2A57A 1GSIA 3F7OA 4MRAA 2UZIR 3QLVA 3I5MA 2BOVA 1M10A 2NSDA 3LHSA 4M22A 2A6PA 2IXDA 1R8XA 3N5CA 2F1JA 3AW9A 4ZREA 3SEAA 4C43A 1Y6FA 1VM6A 1V5EA 3C1OA 2G04A 1I4WA 3W4IA 3GFBA 1OJ7A 2FPOA 1QUEA 4XQ9A 4R0MA 5B1EA 5KU7A 2PEZA 1CRPA 4M9XA 1W9MA 4RKYA 4B6OA 2CDNA 1OHHD 2Q7XA 3C24A 5FI0B 1KS9A 1WNTA 3QTBA 3L4EA 4OCZA 5L9AA 3V2HA 2N46A 4BKOA 2BMVA 2QLBA 5CX4A 4EY5A 3GLFB 3HP7A 3LUGA 4N0MA 3CZMA 4NI5A 1E5QA 1WUKS 3QEOA 4Q9AA 4W1QA 5LOVF 2GAIA 1P1BA 1DAKA 3EPPA 1EKXA 3WBKA 2QLNA 3BE5A 4LDQA 3VVBA 1CEYA 3G5LA 1QV7A 1CUYA 1GKYA 2ORYA 3HG7A 4ICIA 5IXJA 1AN0A 4DDHA 5HSGA 5JV5A 1RXUA 4MA5A 1GWNA 3BFXA 3GEMA 3TPCA 3AFOA 3H2KA 4LG1A 1KYVA 1XRRA 1XN4A 1NKSA 5C37A 1SCJA 2X5KO 3EFEA 2GO1A 4CM7A 4G5OA 1V5IA 1G6Q1 3HLKA 3P9YA 4HKTA 4YX9A 1KI7A 4GKBA 2DTEA 3KG2A 5J2TA 2D7DA 4A26A 3L1IA 3VHQA 3C8ZA 2UXCB 2XBMA 5FNVA 1E3LA 1J8DA 3BD6A 4J3FA 3NGXA 2OGWA 5FNVB 1XPJA 3LUFA 1JXMA 2B37A 1CUEA 5JIBA 2FCAA 3PC8A 3PYLA 4URZR 2QX7A 2WSBA 1WETA 2QB5A 4ZVQA 4XTCS 4FNMA 2EBFX 2C2BA 2GTHA 3BQMB 1Z0JA 3OLCX 2QVXX 2BMAA 4O25A 1MB4A 3LIIA 4MH0R 3AP2A 3TTYA 1OI4A 1J6UA 4P84A 3ZLTA 2O59A 2R751 3KL4A 2ZYHA 3ZW7A 5K0EA 1HF3A 1GUZA 3NANA 3U4HA 4N0PA 4ARIA 3MT9A 4FT4A 1GRQA 4YC7A 3SDZA 4EO9A 2OFWA 4MV1A 4S1NA 3KJIA 3LBHA 2Y0DA 2C0PA 5IW8A 3H5IA 2XNCA 1WUHS 1ZMRA 2WPNA 4WVLA 2EV9A 3IOMA 4C2TA 3SC2A 4NNJA 1TQDA 1FXWF 3E9YA 5HUHA 5K09A 5IVKA 4R8KA 3QU7A 4JC4A 4KVZA 1FUKA 1VGRA 1AV6A 1DRVA 1NP7A 3ND6A 3SC2B 2YJ5A 3OX3A 2GQ0A 1JQ3A 1W88A 4YHBA 3RAJA 4M1KA 3UXMA 2Q46A 3UG6A 4G8JA 5FR2A 1PKEA 1W88B 2EF0A 2QMEA 1KEUA 3FNEA 4M9RA 1UT6A 3CMMA 2ATVA 4XE5A 5EZ6B 3N8IA 4Z7JA 4YCCA 1GUAA 3JZAA 1VC2A 2HNAA 3S3TA 4P0QB 5KINB 3IEMA 1ISJA 1QF9A 2H7XA 1M75A 4G8CA 2GJAA 3L07A 4XI9A 2SNIE 2XTZA 1RZUA 1UJ2A 3A4LA 3QFHA 3UJBA 4BPBA 3OZXA 4UUOA 2JIQA 3LT5A 3TD6A 3OIWA 3PL5A 3ZTYA 2HMYB 5IKPA 5YASA 3OE5A 3W6NA 1VE7A 3E2PA 1UXIA 1BO6A 2ISQA 2HSJA 2VRCD 3L02A 3PKIA 4PX3A 1DGQA 1X86B 3FSGA 1P1HA 1FA9A 4WA7A 1RTKA 3I28A 3MCTA 2Q3BA 1G20A 2A0KA 3R40A 2FLVA 2IYAA 2JHCA 5J40A 3HWX1 1JSLA 2B83A 4CM9D 4R1SA 4NZ9A 4NNOA 1A8HA 1WMSA 1G20B 3IHWA 1BKYA 3FVWA 1IOVA 3ILSA 3JZMA 4HGQA 4JJIA 4YJKA 3LUAA 4FK8A 2QW0X 1ZISA 4MS3A 4OXXA 5ENDA 1OSNA 2RGNA 4D4KA 1BQ4A 4G0ZA 1KJIA 3K9QO 4WY5A 5CDSA 2HO4A 4KLAA 3BX1A 3ZNNA 5ALQA 4I55B 2YV5A 1XVVA 3L6RA 2F4NA 2FZWA 1EFRD 1DBRA 1Q2UA 3PYMA 4L28A 4IL5A 1PL0A 5A3SA 4ZIRA 1B15A 4KO3S 1VIMA 3H42B 1YDFA 3EW9A 1XVIA 1O0SA 4ZIRB 1FQJA 2W6MA 4Q4JA 5F2EA 1Z5NA 1Y9DA 5KYGA 1IVSA 4RPCA 4EGQA 3G9TA 4OK6A 5F5NA 4YRKA 2ZWVA 2I6QA 2XH8A 4NBNA 5KNBA 3CW2A 1PCXA 1BA2A 1USUA 2F17A 5HILA 2XZPA 1D3AA 4QJ4A 1S8NA 1ZC4A 3VM6A 2M9MA 3KB8A 4Z9BA 3LBAA 1MOPA 4HYTA 4XDGA 5EJ9A 3WQHA 2MYTA 3RF7A 1PO7A 2WV7A 5HBRA 1AVTA 2HWYA 2O2IA 4JBGA 4C0LA 3R6LA 3W2TA 2PFSA 4CI0B 2JG3A 2R1VB 4QQRA 2I3ZA 3QW2A 4BZXA 3MIZA 4L72A 1KI3A 3GG2A 2PKXA 3KAPA 4N7RA 1SY7A 3C3JA 5DNVA 4YY3B 3AXSA 1QRTA 4TTTS 1W59A 1FY2A 1X1TA 2GEBA 5K5EA 2NTVA 1P7VA 1QZZA 1I2ZA 2OGUA 1UC5B 2X9VA 3P71T 3MFYA 4ZGWA 4L5BA 4TSFA 1T0BA 4NK5A 2H2GA 3IQXA 5BNFA 4AY3A 5BV8A 4MCJA 5EKUA 1N6OA 4OFWA 5F4BA 2QE7D 5FH9A 1UPBA 3JWGA 2NU8A 4UHEA 1B1AA 2AFIE 4R68A 4D8WA 5FBRB 3I6IA 4OLBA 5G41A 2EQAA 2XGMA 4XJXA 2NU8B 1GSAA 2WG2A 4HWRA 3KSAC 1EBFA 1Q1ZA 3P26A 1W4RA 5BWNA 3ZQKA 1VL6A 1NTRA 2OZEA 1XMVA 2WUWE 3SMQA 5A3JA 1TKBA 5E9WA 2RHOA 1XTRA 2ERYA 1X1EA 3DLHA 1IPFA 3QWHA 1WUIS 3L6OO 4AECA 1SC1A 1R5BA 4O29A 1X92A 4QC2A 5DBFA 4YPFA 3FYUC 5EIXA 4QXQA 1KK2A 2GK4A 4KAFA 3JQQA 4PYKA 3SHOA 2IYZA 3K70D 3ZDAA 2YVUA 2O2CA 1LS1A 2JFVA 2PPVA 3QMVA 4MVJP 4WDQA 3AY6A 4WECA 4B73A 5AVVA 1QDLB 4OQYA 4JGGA 3WLQA 2GN0A 1FRNA 2VP0A 5C8XA 1YJ8A 2PZAA 3UT5B 3ECSA 2YMPA 4QGAA 5EQJB 3E9CA 1M8FA 1LC0A 3DH0A 4NMWA 1TCUA 3UXYA 4FBLA 1R4ZA 4WHMA 5DBHX 1XVTA 2FFHA 3WISA 2Z5FA 3MCZA 5DYYA 4DHEA 2BM0A 5CB4F 1Z56C 5K3FA 5A5GA 4LBZA 2D5LA 4ANFA 1ENYA 3FYHA 2X2OA 3M9LA 1V6CA 2YWBA 4RCYA 4TS4A 2BR5A 5K3FB 3TFWA 3V8NA 5I7WA 3G2QA 1O57A 3N7TA 3LCJA 5FTNA 3GXBA 1WO8A 2XRMA 1T24A 1MORA 3BDVA 1TUBB 2ALJA 1RBMA 1A9ZA 3CPHA 5DXAA 3HZOA 1DRUA 3HR7A 1RWBA 2PSJA 4A6PA 1CZRA 2JIPA 3F6RA 3EEYA 3CEPB 5AI5A 4JVLA 2CEKA 2XKKA 4S35A 5T4FA 4QOIA 2H1RA 2ZJ8A 1G5PA 3GZNB 4S24A 4H0CA 4E12A 2RK4A 1RAIA 4HG2A 2ODNA 1JT9A 1OKKA 1RI2A 4QUEA 4UTNA 1H3FA 1N2SA 1VCNA 2X14A 3GT3A 2O2ZA 2PS9A 5HMMA 1OWOA 4RDIA 3DZDA 3NCHA 1UQTA 1K63A 2GB4A 4J0QA 2Q8QA 2QUZA 3LBIA 1DJNA 2G5GX 2QLMA 2YQ4A 5EPOA 3UWKA 2IUEA 3GR6A 2P8JA 2I8AA 1LSOA 5EE9A 2J33A 1RMYA 4G0UA 1XA3A 2LP4Y 4M0DA 1I2CA 1T2VA 5TQJA 5TX7A 4ECEA 3CVOA 5M5BA 1N25A 1GU7A 3DKKA 4KPUA 4UE3S 2MSDB 3L7CA 2XBLA 1U94A 1N4DA 4F21A 2NV6A 4FPXA 3ECAA 5EE0A 1E2PA 4CMGA 2XZDA 4NCHA 1SXJD 3PIIA 3CRNA 2DY1A 3OLWA 3HEAA 1WCXA 3EDCA 3PIRA 2FEPA 3MINA 4BX8A 4NCAA 3C5VA 1Q0ZA 2RGAA 4MW6A 4WZAE 5IDQA 3TOCA 3CLSC 3MINB 4CGZA 1V8ZA 1H8HD 4Y2GA 5J47A 4FYMA 3KU4A 2IDMA 5JZMA 3RTAA 4ZCLA 1US8A 1SU7A 2PT5A 2Q2QA 3PF9A 2YJTD 4L8LA 1N2OA 4PC3A 4CIWA 4QFDA 1EVIA 1US8B 2CVOA 4UCFA 3IMCA 3SPXA 3WNQA 4H3SA 4OFBA 3U16A 2YNMC 3QUSA 3WOVA 3VVCA 5ENVA 5ICSA 3IHKA 3ER8A 1DELA 1DARA 4LXHA 2B5WA 1SBCA 2HCTA 3OJWA 3GFFA 2GD1O 2QIOA 2SKCA 4IDFA 4MWSA 2C9OA 2F8LA 3MCWA 1JHPA 1CP2A 1QQ6A 3CQ9A 3MWFA 4JT9A 1SPXA 3H8VA 5I9TA 1J97A 3NUGA 4FDVA 4DARA 4KMSA 3HYSA 1BZYA 5FV7A 5EPEA 5A4JA 2XUAA 2G06A 1V35A 4KV9A 3SSAA 5IANA 1Y5MA 2C57A 4PZDA 2V0CA 2P0EA 4Q1FA 2WJWA 1S3SA 1VMIA 2EQ5A 2RHBA 3E7DA 3KM0A 4P80A 1JEOA 4JJ8A 3TQRA 1RHRA 3T1OA 2IH4A 2J9YB 1D8TA 3AB7A 4QDKA 5F7JA 2H4HA 3HLYA 4OIMA 4YXWA 4KE7A 3FSEA 1WTCA 1E18A 1XDWA 2WYIA 1CNMA 3O74A 1H8ED 3SYKA 3ITEA 2D0OB 4QEZA 1IBLB 5G0UA 3HBFA 3RO7A 4Z7OB 4L5AA 4FYVA 3W2EA 2DVMA 2CL5A 2L2QA 4YRSA 4C0JA 1NIJA 1ULUA 5KCZA 5HKKA 1PL6A 3BEOA 1C50A 3HK2A 5BUCA 1GNQA 4EDHA 4QQ8A 3UVEA 4OOEA 3QV1A 5F5LA 2I99A 2OXCA 3EYWA 3OA2A 2FN4A 2LKDA 1NBEA 3OOEA 5IH3A 3LY9A 4ZZIA 2R47A 2HSZA 2D5CA 2ZDHA 3N2IA 1WMFA 1J0BA 2ZSBA 1RFLA 4E09A 1XRPA 1ICEA 1PE0A 3B48A 4BGDA 5K0NA 1MG0A 4LE2A 5FRDA 2FKAA 3N3AC 1BVHA 2ZSAA 1Y0BA 2ZI4A 2QRVA 3RS4A 1CEQA 4L8WB 1IN5A 3QVTA 2HBQA 1XLTA 3BXPA 4CMCA 1MJFA 1XXHA 2JK1A 2Q0QA 3BILA 3HJAA 3N2KB 2QRVB 2GNPA 1SQ0A 2A0XA 3CNOA 1XXHB 1CWUA 5CXSA 3ANTA 4V39A 3TH5A 1R9NA 3P2MA 1SURA 5I9SA 2D59A 4LZNA 5EYPA 4N82A 4QTXA 2O2YA 2BC9A 4J1NA 5JY6A 2QRMA 3E5HA 1EDBA 1H2RS 5EYPB 1Z25A 3IT0A 5FULA 5FCDA 1IB0A 3R5TA 1NN0A 1S7GA 3LGAA 2O8VA 3G5TA 3AEQA 3GRRA 3E9ZA 2P6NA 3GH1A 1T4CA 1XEXA 4POOA 2XGGA 4IIDA 3ZXUB 3NHFA 3H1EA 2C07A 2HLDA 4RD2A 2B4YA 1PVVA 1RXYA 3AEQB 4NU8X 4MUIA 1XEXB 3TTTA 4Q1BA 4O08A 5F35A 5HRAA 2YL2A 4QNRA 3FLBA 2AX4A 1P77A 4I4TA 4XEUA 5JYDA 1CQJA 3DL4A 1K6XA 2CJPA 3V3KA 1C4KA 3MWLA 4DUGD 5EHQA 3LFHA 4QIHA 2GWRA 3ORQA 2DFDA 4KLNA 4I4TB 1VBFA 5L45A 1CQJB 1WU8A 1YQDA 4PINA 4X6YA 2ZE7A 1TQ4A 1RRVA 2RCYA 3PX2A 4FGJA 4IGAA 5IAAA 2Y1KA 2JAHA 3HA5A 3NYRA 4PO3X 1GYRA 2QPAA 3V8BA 4NVRA 1JJAA 3WHKA 3E84A 3CJTA 3MC1A 3AEXA 5JCJA 1HNZB 2BBOA 3TKLA 1Q1QA 2JIZD 1Z4PX 2AK3A 2NXWA 3GCZA 2PH3A 4J1TC 3V1LA 3ZI4A 1GQYA 5E8JA 3HZZA 1OXMA 1PYDA 4RIGA 4WESA 4MPRA 4H08A 4CJXA 4L4RA 1HDEA 1R6XA 2FRDC 5DEOA 1L1FA 3ZGLA 1CR6A 4AQDA 1N2XA 1LTQA 1NIPA 2CL6X 1S9HA 3MK31 4TQ9A 4WESB 3P9RA 2VQEB 2WE8A 4Z0NA 4IIVA 1N2JA 3A1UA 4E2ZA 2BP7A 4V0QA 1NBAA 5JD5A 5KSPA 2BBWA 3VHXA 1YRBA 1FTWA 4CQMD 3FY4A 4RJKA 1WLYA 2YWFA 2IUUA 1QYWA 3TECE 3VHXB 2WFLA 3BXEA 4UULA 1CXZA 2IA5A 1Y7HA 2CFSA 1L1RA 1DX4A 2R87A 1COWA 1BWPA 2YYZA 2ZUWA 4K2AA 4LDAA 1R9MA 5T6BA 2QQEA 4IRXA 3WLKX 1SOUA 5JBIA 2ZM6B 3ZJVA 1SCKA 4M0LA 1TO1E 3U0BA 2O7SA 3OE7D 1SELA 1XELA 1YAHA 3FB1A 2HU5A 2PNJA 3DM9B 2UXBB 1QQ5A 2ID7A 3A4YA 2D2VA 2WWTA 1E61A 1N33B 1QH8A 2BPOA 1NVDA 2HD4A 3JD4A 5IVIA 1M2OA 2CUZA 5JO0A 2IYPA 1XKQA 3OP1A 1QH8B 2H5LA 3A04A 4XGRA 1DMSA 1M2OB 4J7XA 5KTPA 4BE9A 3QI7A 1K3FA 1ECBA 4DLVA 4ACAA 4HDAA 5C1OA 1KFJB 2OSBA 3DT9A 3ECCA 3IP9A 4IQ8A 3EVDA 4QPNA 1PG0A 3RSOA 5BV2P 1E9CA 5C46F 1UP6A 3X0DA 5JW6A 1S4QA 1YO6A 1SHTX 3MMPA 4WOCA 1SZJG 4CF3A 3PEWA 3NORA 3UWDA 1Y1KE 2W6JA 3AUXA 3CLVA 3G8CA 3ORHA 4N1AA 4PRZA 3TAHA 4E5PA 4H7JA 4M53A 2O8FA 3OLQA 4AKGA 4G86A 3K2EA 1NJGA 2Z8ZA 4M1EA 2C2MA 2C98A 3EE6A 3WNCA 4Z51A 3MTAA 3I64A 1ST3A 4EJFA 1SRRA 3TL2A 4A7PA 4ATNA 3FLEA 1DEAA 4MIEA 1Z4NA 4JLPA 2JKVA 2XSZD 1SK8A 1L5YA 3TNYA 1XNGA 2BSAA 3COZA 2HN9A 1CK4A 1P2FA 2VPIA 4GZ6A 5HUQA 3BWEA 1YJ5A 3M70A 1ZVJA 2R7LA 5LYJA 3BERA 1CY8A 1L0BA 2IXAA 4CYMA 5MF6A 3UPTA 1WCYA 5AK4A 4CF5A 1OASA 2N47A 4WX2B 3VNQA 3WLOA 4R8SA 4ARBA 4KKXB 4QOGA 4JENA 1WMDA 1SVSA 1B4DA 1B00A 4QD3A 4YJHA 3BTOA 3ZEAA 1W29A 1CS0B 5B4TA 4BP1A 4DDVA 4LXGA 2X1VA 1FB5A 4YJHB 3MOSA 2BDEA 3CBQA 3L0ZA 5AOAA 3OX2A 5GINE 2OV2A 3RYIA 4UOZA 2HJRA 3LIPA 4JV5B 4Q1VA 1CZKA 1ZM7A 1ZN9A 3Q40A 4WV3A 1Z47A 2ZB8A 2WHRA 1DSSG 1JLSA 2Z8YA 3BRQA 4JYCA 2FZCA 1JLMA 3RYIB 5BUZA 1DV1A 5C3UA 1POXA 1NMZA 1P0FA 2XCLA 2Z1DA 2Z5GA 3D2AA 1AE1A 3L2OB 4UNSA 5HJ5A 1QUFA 2G09A 2OO7A 4GM4A 4KXWA 2PLFA 1H9BA 4FGKA 3THRA 1WQ4A 1G19A 5AW4A 1E4VA 4K03A 3DLPX 5HIJA 3TDMA 4O5OA 3EFOA 3HCNA 3W5SA 2FV8A 4G0PA 2VPZA 5H7XA 4RABA 3AC0A 2PVCA 3PT9A 3EFOB 3I6MA 1DQRA 1ZXLA 4EJ2A 4ID3A 1GZDA 1V3VA 1NQ5A 4O4JA 4U2KA 1VCMA 2NZWA 1NI4A 1XUOA 3JYLA 4HBZA 2G08A 1FFCA 1PDOA 2D8AA 3ASZA 3J7TA 3PDCA 4ZODA 1KSJA 3G8DA 3IDAA 3DE2X 4K88A 4WADA 1VLVA 2PUCA 1E94E 1F2TB 1EK6A 1J2RA 1LPSA 1U6JA 1UQUA 2VDRB 4HS4A 4IF6A 4OBEA 3WI7A 4DT1A 4EF5A 1SUIA 2I4TA 1X1DA 1MENA 4U7DA 3BIWA 4DT1B 4YVFA 1GGHA 2WKRA 1H22A 3M6FA 2WT9A 1RCFA 5K2OA 3G0OA 3JD3A 4JLSA 4BGVA 5A03A 2ZJ5A 2JRCA 4XGIA 4ZMRA 3NRBA 3JYPA 5HQJA 2KW5A 5FA8A 2GJ9A 2GRUA 3R7DA 4CU2A 1NY6A 4LJAA 1KYYA 4L8FA 3I39X 4DABA 1D6NA 2YW2A 1FQOA 3IKJA 3KTOA 4NBWA 1AXEA 1WEKA 1YQWA 3B2QA 3BXFA 1DQNA 2M6SA 4G0YA 4K9RA 2WU3A 3VTZA 4HR7A 3MCUA 1QU3A 1DTWA 3T7DA 1YBVA 1V8FA 4HYYA 4P4UA 5ALPA 2QDXA 4KR9A 1VE1A 1ZRMA 3INGA 4C4AA 4DA8A 3EOAI 2VJAA 2JFXA 2FUG1 3ZWMA 4RK5A 5LC1A 3BM5A 4OSEA 2F9FA 3V80A 4MPDA 4EKDA 2R6HA 4M1WA 2GMWA 2XCOA 2PZKA 4C89A 4I50F 4NBVA 2GPWA 4LVUA 2FDCA 3LO8A 1E77A 4Z4FA 4ZTBA 5TPZD 4E2FA 2Q2OA 3H9QA 5CG2A 4N3CA 2PUGA 3H5OA 1O1YA 4C21A 4Q4AA 1LPAB 5EJAA 1D8AA 3O9VA 3CH7A 5A3QA 1B6TA 3A2LA 4J76A 1H94A 4G4IA 5ETJA 4MRPA 4Q4AB 4D4LA 2GKSA 2F67A 4IFEA 1SOMA 1N78A 4HJRA 5EQTA 1GZ3A 1HSOA 2AD1A 4AC9A 3CN9A 2X8WA 3D3NA 4BU0A 2C9MA 1MX5A 1FK8A 3L5KA 3OEED 3OE1A 5AOCA 4FXOA 2A9RA 5DTMA 5GV7A 2ATXA 2XGSA 1U8YA 1E7YA 3FIJA 3UWOA 4F6LA 1PG2A 1KO8A 3A31A 1HURA 2G67A 4FGLA 1K8XB 4D0GA 2MWMA 1BW9A 2BY4A 3R5HA 1O96B 5DWVA 2FEWB 5JG7A 1JLRA 1T3ZA 4DMHA 1BW9B 2P9ZA 3GG9A 5AR1A 4UU7A 5ADHA 2ECPA 6CHYA 1JGTA 5B1DA 1JIJA 3E27A 4ZAFA 1PWXA 1LQTA 1DKRA 3ODPA 1M6NA 1Z06A 3IH5A 3I09A 4TRJA 3DONA 3H1BA 1KZHA 4E15A 5C8ZA 2WQ7A 5F21A 1KP3A 2AG6A 4FGWA 3ZGXA 2ABWA 1BHQ1 1UMCB 1KMHA 2W2TA 4HAIA 4JEUA 4P8RA 5TMEA 1JVBA 1AKMA 3I83A 2G9VA 3S68A 3JRWA 3AF2A 3Q2KA 2BEVA 1KMHB 4FGZA 1K4YA 4QQNA 4ZVSA 2ZYWX 1BEUB 1QHEA 1XTQA 1PQPA 2M2IA 1RJGA 3B3FA 2BEVB 1HEYA 1N6RA 3OQJA 3MOGA 3O4VA 4NCNA 3SQXA 2BGNA 5L51A 1CJMA 3ACBA 4XIGS 3ROZA 5K6TA 3B2EA 2CZGA 4L85A 4I3HA 2YX1A 3OZTA 2ZIXA 1L3IA 2B0JA 5JTTA 4X65B 3N0WA 1NW5A 2HGZA 1P2UA 2JLCA 2QR2A 3QNMA 5SY9A 2ZIXB 2B7LA 1FNDA 3F78A 1R0WA 3NOVA 4IS3A 3T3IA 4NICA 4D82A 4O4IF 2NYAA 1FZTA 3WK5A 4BB9A 3H9BA 1YE3A 4XDHA 4E5YA 4F04A 2A58A 1OI7A 4UCQA 1M2FA 1BN6A 2RHMA 1NYLA 2X2EA 2VYVA 2XQJA 4US1R 1XZKA 4M98A 1DPFA 4DCVA 4YRAA 1CUVA 2FG5A 4ALJA 4S05A 2QM0A 1ORRA 2WDPA 3EJ6A 3UATA 1U4NA 4D8UA 1MGPA 5EZ5A 4S1VA 4WCDA 4A23A 4OP3A 5KNBH 5LP6A 1V16A 1UR5A 2Z3WA 2KMLA 4HX2A 2CL0X 1MQSA 1H4VB 3HS3A 3TAUA 1JA0A 2CDCA 3A27A 3DL0A 4M0MA 4QRHA 4RMIA 4V3BA 4CZ2A 5LP6B 1V16B 2WP0A 3PNMA 1KJYA 2P65A 2P9JA 3T5DA 3Q9NA 2BI4A 1VMEA 2RAVA 5DTRA 3QYPA 1G5HA 4Z8XA 4E14A 3P2JA 4P6VF 2ZIEA 1GQRA 2H7CA 3C8MA 2GA8A 2HRRA 1K7SN 5TJHA 4G24A 2X41A 4CDRA 5BWBA 4LYAA 3THWA 5I7RA 1PNVA 2DETA 1HT2E 4S1PA 3UF0A 3VC7A 2FETA 1WSBA 2I1VB 3THWB 1YJCA 2GEFA 1XYGA 3OM8A 2R1UA 4LQ4A 4M76B 1LQUA 3USZA 4TL8A 2J8ZA 4L75A 4X93A 1HTBA 3X2EA 3MHPA 1UDRA 2VH5R 4M1YA 2V6BA 2VRWA 2WIGA 4RXTA 1XNJA 2Q9UA 3DE7X 3C74A 4BLPA 5JS1A 2J3QA 1LI7A 3K4PA 4XWTA 3AEZA 3UUGA 5BUSA 2JGFA 5IN4A 3OOHA 4BEBA 4ZZ3A 3TNDA 1K92A 4FI3F 1GFIA 3Q41A 1E4EA 3E2IA 1I7DA 3D8NA 1EXNA 2I2XB 4NCKA 1TM3E 3Q1KA 1IPEA 2QD4A 1E4EB 3DOHA 4CT4B 1P4RA 4MQUA 1L4LA 5DM70 2BUCA 3HE3A 5IJ9A 2R4QA 4UOEA 3U31A 3O2QB 2YHUA 5IJ9B 5AIBA 4GBED 2EYQA 2OKGA 2RHGB 4TTRA 5P8WA 4F38A 5B30A 1VJRA 5GIPE 2YDXA 4JWTA 4HX5A 2HH9A 3JQFC 4P58A 5HCUA 3SSOA 1U9JA 3HKCA 3Q5DA 1Y3IA 3TLBA 1HX7A 1VPVA 4INAA 4GVLA 4C0BA 3BJEA 3FJYA 1KYQA 1PEAA 3UGKA 2W43A 4A0SA 3W78A 3WP1B 2HHCA 1MHPA 3DAYA 4COOA 5F77A 4EO7A 4MZDA 2QI9C 5K05A 4IH9A 1IQUA 2P9BA 3K5HA 4NYJQ 2XLCA 5BNIA 2ZJFA 5LU9A 2J3LA 2E4VA 2WNIA 1Y4UA 1E2DA 1F6WA 2PG3A 1ZN2A 2OHJA 4IIJF 3RSCA 1MXFA 1DX6A 3RFVA 3OPQA 3P9ZA 4HNSA 3RVSA 3BXZA 3T3GA 5AXAA 4PC7A 3TQIA 1TPYA 2R6AA 5KNDA 2WTBA 4L95C 2ZRGA 3VGJA 3OETA 3D0RA 5DTEA 5EQDA 1YNOA 4G41A 3ZCQA 1B8PA 4XRGA 1T9HA 3OZ7A 2GSDA 4HN9A 2CUNA 4OHVA 5JROA 4ARAA 1A04A 3GRKA 2V5AA 2E87A 4E33A 3RNLA 1EBBA 3IAAA 2E4UA 4L8VA 3AV3A 1QX4A 3EGOA 5ALZA 3NTVA 4R2LA 3ENVA 3GJQA 3C8UA 3OKFA 4KP7A 3WNVA 1XL1A 3IL2A 2WC1A 1KZ6A 2ZREA 3C3KA 3LW7A 1U9CA 4B5KA 3K9BA 3VNSA 1BD4A 4KIWA 1VYHA 2J5BA 3QBJA 5CW2A 2EX0A 5HGJA 1WXHA 4D79A 1A97A 2JDIA 3M6VA 1H1DA 3QI2A 4JUDX 2B6NA 2FQWA 1IHUA 3M6IA 4UDOA 4UHHA 4CKEA 4ZDIA 2M98A 4DCCA 5I8PA 3HJUA 4LJ8A 4CKEB 1J99A 2UVDA 3KB2A 4GOMD 3F3MA 4EEKA 3DJYA 3SHTA 3GC6A 2MU1A 1ZH8A 2JHFA 2QPOA 1L6RA 3K0BA 1DO8A 1QYRA 3RH0A 4BWFB 5BMVA 5AT1A 2JA2A 2OZVA 3L7NA 4YT8A 3RTGA 4HLDA 3ICCA 4MV4A 3A7EA 3C3BA 5BMVB 4B3GA 2MHCA 4NY1A 1E2HA 4JLDA 2G1JA 3SR3A 2WFAA 5AVRA 1FJHA 1M1XB 4M21A 1XLVA 2X86A 5DLEA 2PR2A 1KK1A 2QMYA 2A7QA 1DCKA 1GRNA 2CXSA 2CHGA 3DVAA 3EA4A 3LXUX 1WY5A 3PWZA 4GX1A 4AJ9A 3CR3C 2NV0A 4IMRA 1PAUA 2CKDA 1H2FA 2C4MA 3IVRA 5FTMA 3WK9A 1G5RA 2FFAA 2IQ5A 2P6PA 2W2LD 3LUPA 4L5CA 3RARA 4ZPJA 3L8MA 1S96A 1AGRA 1XTSA 4EHNA 2ZDQA 4G5GA 4TXLA 3M6LA 4FXPA 1Y3AA 1NGSA 3I01M 4HCJA 2A0UA 3CLSD 2HA2A 1QRRA 1NDQA 4V3CA 2ZRDA 5GM1A 4G0QA 4MGYR 4F3RA 4P7KA 2IEDA 3G17A 2GSWA 3PNVA 1U2PA 2MIIA 1KP2A 1I1QB 2AUMA 1I5RA 2FVYA 1RC8A 4RWEA 3QUTA 3LUBA 2RK6A 2ZAMA 4CMKA 3VNBA 4JB3A 3BB1A 2OCBA 1W0JA 2O20A 4V2IA 4KXXA 2W6OA 1X19A 2YNMD 5CVUA 5L53A 1BHSA 2QP3A 3N2ZB 4RVFA 1OZFA 3LP5A 4JEIA 4II2A 4RXMA 1QV9A 1LS6A 1U2SA 1JLKA 1KJ9A 3CPSA 4J2OA 3Q0TA 4MW1A 5AKYA 3THYA 4JZYA 2X3UA 4C2UA 1W87A 4P31A 3WB0A 7ADHA 2X5XA 5T3YA 3THYB 3DTNA 2OVBA 2XUOA 2Z3ZA 3VFDA 4PZUA 1BVYF 1W0KD 3F4KA 2A5JA 1D4OA 3AFNA 4H1TA 3RFXA 3PPYA 1J2JA 4AY5A 2X1LA 1OB5A 2HRDA 2X7JA 3CLUC 3D43A 1DEOA 4YA6A 4ZAYA 3PJGA 4KJZA 3R7BA 1RDFA 1M2JA 3H3XA 2WNHA 4EL5A 1V2GA 3H5VA 4ZU6X 3WWPA 4GPTA 1AXRA 2P0YA 2IEGA 2NU9A 3WMEA 2AQKA 5AI6A 3U7EB 3EIUA 3SXJA 4JBLA 1WL8A 3T34A 4ARVA 4E51A 2NU9B 2VLBA 4FYIA 3BXXA 1DV2A 1Y5LA 3KLBA 1O95C 2V3WA 4COKA 1D2HA 4TTVA 2BFMA 3KOZA 2GF9A 1R4MA 1ISGA 1XCOA 3FD8A 3LBFA 4Y2HA 3ZXSA 2H00A 1BHO1 4J9VA 4JS0A 4X41A 3R6WA 3I2YX 4A3SA 4Q7KA 3G6WA 5C4MA 3HZHA 4JYMA 2G77B 3JWIA 3PNKA 4TKMA 4TSKA 4H27A 1X9IA 4AROA 1SU4A 4OHRA 5FQOA 1TM5E 3LS2A 1II9A 2V7PA 1UBHS 3ND9A 1XX6A 2UYOA 3RI3A 3RJTA 3ROMA 1OTXA 1GN9A 2NACA 4IWYA 1CJUC 3C3MA 3TRJA 3PLNA 3BWXA 4HVLA 3M49A 4KPGA 1PL8A 2GYUA 1SD5A 2ZAYA 1HLDA 2DFLA 3C85A 2PZ8A 1JW9B 4LWPA 3ZY4A 1EE1A 5EMKA 3LYAA 4FNAA 5GAJA 4C88A 1ADYA 1SU8A 1X3SA 4BPRA 2E6KA 1WS6A 3DUFA 2G5TA 4YN3A 3UW3A 1X7ZA 3WZMA 4AG6A 5CDYA 2TS1A 2IW3A 3T15A 4F93B 5HKBA 5EKTA 2C2HA 4EBBA 3DUFB 1NW3A 4FHDA 1X7ZB 4RQAA 4FFNA 3Q7SA 4P92A 3UFBA 3A37A 4RA9A 4JROA 5FPQA 1VIYA 1P2BA 2NQTA 4RD4A 3UGTA 2IYNA 5F1PA 4ZVPA 3CRZA 3MJVA 3VO9A 4H1WA 3FLAA 3JU3A 4OQQA 2IZ5A 5FNVF 1MT0A 5HKLA 5FI1B 1K5GA 2CVPA 1Z8DA 1A1VA 1DKMA 3AF0A 3KDSE 4OHYA 2V8OA 3U7QA 5AW3A 4EAAA 3LC7O 4FCVA 4LSMA 4GQBA 1QLHA 1NBME 2ZI6A 3U7QB 3MJRA 2WHQA 3BQ9A 4D9HA 5F9HA 1GPUA 1KO5A 3I1IA 4R1QA 4E03A 3WY9A 1W36B 1QIFA 1ZNXA 1L8LA 2ZSJA 1H2BA 3EEBA 3IP6A 4QX6A 4UEJA 1PTJA 1ORIA 4M7WA 3C98A 4DGSA 2H06A 4PHFA 3FCOA 2WUVA 3DDUA 2ZANA 5LZ5A 4TS1A 5FUVA 4Q66C 1VHTA 4URYR 3ET5A 1QP4A 4G8DA 3A14A 4UBLA 5G2OA 2G8LA 1CZOA 2Q6TA 3ZNQA 5FTWA 4BYMA 1GQFA 1YS2X 5KQSA 1ZD3A 5C7OO 1WXFA 3CZ5A 1ZR2A 1WRBA 3JAMA 1I2DA 4O8ZA 2Z56A 1KOFA 2WDZA 3WAKA 2E4AA 1GP2A 2ZRQA 1S89A 3DLIA 1PZXA 2ZULA 3ADPA 3DP9A 4NJMA 1N1MA 3I6ZA 3KLMX 3NCTA 3AH8A 4AYXA 5ELXA 1SKQA 3WLEA 4CBVA 3OZBA 4BNJA 2IHVA 4CM8A 1Y3DE 2C5GA 2UKDA 2XOEA 3HFJA 4HXEB 2ZJYA 2YFQA 1K7XB 5CDGA 3TZHA 2H0RA 4MIOA 3I92A 1WPQA 3A9SA 3PHLA 4CM8B 1MEEA 2ZIWB 1J0EA 1TCCA 1VIDA 2AFIA 2WJ3A 3VNVA 4JI4B 2JFUA 4OU5A 1IK6A 4BC0A 2AFIB 4CF6A 5CDHA 1BE6A 2IYYA 2OC9A 1KFCB 2H29A 2R8ZA 3CNHA 3K9WA 4X85A 4PEVA 4YXWD 3E3AA 5ITZA 2ANCA 4FC6A 10MHA 4NOLA 1AM4D 3PGKA 2QK4A 1H69A 4DLBA 3SICE 1Z6PA 4U3JB 5HKKD 3Q2IA 5CVEA 2RBKA 1NURA 4GL4A 4O0MA 3MN1A 3QX8A 4GU5A 2WZQA 3M3DA 4Y1FA 3FMPB 4DLKA 4I55F 1C8BA 1WDWB 4IIHA 1RXEA 2KLHA 4JC0A 1TGYA 1PJ8A 4LMAA 4MW9A 3U3RA 3WLIA 4A2QA 5JRZA 3OBIA 1HE1C 4GGPA 4IFBA 1I2BA 4Y8VA 3T7TA 2X40A 3PWTA 5B53A 5TQ2A 1J24A 4E31A 1P7WA 2CLFB 3X2SA 3D7RA 3WB1A 1SH7A 4KWHA 3ZLJA 4LRTB 5DHSA 5TQ2B 2H17A 3TLJA 1IULA 4D4HA 5MN6A 2CVZA 2ZB2A 3F6EX 1ZFNA 4HVAA 4LN1A 3L6CA 1G42A 5I9BA 4Z0TA 1I4TD 3ETEA 3K09C 4N6GA 4JOCA 4ND4A 4X8OA 5G3ZA 3RTBA 3O8BA 2NOAA 4MVJE 4PFKA 4ZJZA 1W4AA 3Q85A 3H05A 3OFNA 4R9VA 4G2TA 1B93A 1IOWA 2X0DA 1IXYA 1KVUA 3ZBQA 2PLWA 3EAFA 2HIAA 4KB5A 3IV9A 3FUXA 3KQVA 4L5IA 4Q18A 4TRRA 1OUMA 621PA 2I4LA 2AC2A 3JQ9A 4NYJR 2IC5A 2J5QA 4L4ZA 3AOEA 3TKAA 3PQ2A 2PVPA 1GKIA 2PCLA 3NHAA 4KODA 3SQDA 4TPKA 2HLDD 2Q3HA 3M33A 1YZGA 3DVQX 3N8DA 3OJCA 5KC8A 1N2HA 1YBAA 3L4JA 3ROFA 2IBSA 2YCLA 4KZKA 1T9GS 3N07A 2F3QA 1P1IA 3QLUC 4IOLA 4MUJA 3P2EA 2F4VB 4OSOA 1RQ7A 5JC1A 1WXWA 4AI6A 5ALHA 4BLWA 1TEZA 2WI8A 3NOQA 1TAQA 2QMZA 3AEUA 5DP2A 3L01A 2O5EA 2FOLA 1ORWA 5BV1A 3S55A 3I34X 1WV0A 5T41A 4XUDA 2VYND 1MX9A 3DZBA 4K9MA 3E4DA 3IPCA 1EQUA 5GV8A 4XGNA 3ND8A 3TCNA 3PXEA 3MFQA 4ON9A 1GNPA 1TM7E 5EGSA 1JBEA 2WF7A 3LYUA 1ZVKA 4IIBA 1BE8A 1QH0A 3UENA 5JNVA 4P9NA 5K0BA 4RV5A 4UJ5A 3IUJA 4ZCMA 3DXYA 3NAZA 2H2HA 4PZ9A 4F3YA 8OHMA 4CL2A 1XQWA 3H1FA 2PU5A 1XF1A 4JNCA 3MWDA 5BQPA 4CW7A 4CTNA 5LQNA 3D1LA 3HB1A 3D6JA 4L07A 1RQLA 2BCEA 2W6IA 1B8NA 3FWKA 4JOQA 1L8OA 3DE3X 3MWDB 4B1FA 5ARCA 5A4FS 5DWDA 1XRMA 2BJHA 1RYBA 1LLDA 4WZAA 2KYRA 4PYRA 3IRUA 4F8JA 3THOA 4GRDA 4JNKA 1YGPA 2ZJZA 2QMUA 4PNPA 5A9SA 4WZAB 5BYAA 1COWD 2PGAA 3F46A 4U63A 3VX4A 1M1YE 3E7XA 2XCQA 5A9SB 2PIDA 1U7OA 3SLKA 2JLBA 2CFTA 4QO8A 3IAS1 1LW6E 3SR4A 1EFDN 1ISIA 3K0CA 3T7AA 1IDN1 1P6QA 2II6A 3SQOA 5I4IA 1JMVA 4I4NA 4QVGA 3H0EA 3NXSA 2CD9A 4CKBA 1OWMA 3WADA 2ADMA 1VCIA 2CBXA 2OWDA 3AY3A 2VHZA 4C1BA 5EE5B 4DEXA 2JK0A 4CKBB 4J0IA 1FVFA 4RTLA 5BV7A 1E64A 1YR1A 1A5TA 1C1YA 5HIAA 1G291 1ZCAA 1VLQA 4WPGA 3T5CA 3W6OA 4QKQA 4BVJA 1P2GA 3FFBA 4HNVA 3DDSA 1DWPA 4OQZA 4WLEA 4I5DA 3BDIA 9ABPA 2JARA 3AGQA 1JQ5A 1ZOPA 1FBNA 3GVHA 4FNOA 3KJXA 5DU2A 1TKRA 4C4ZA 2LIVA 3L8EA 3RS7A 4AS3A 2YV3A 2W6JD 3QU5A 1XR3A 3ETJA 5HZMA 3JQCA 1NKVA 1HT3A 4JHXA 2J9FA 1Y80A 1NVBA 1V4BA 3EGCA 4IG9A 2I7TA 2O5VA 2ZYGA 3WYEA 2EFGA 1SQFA 2G3YA 2J9FB 2BTOA 3PFHA 1U81A 1F0YA 3RGWS 1RKUA 3NLLA 5DM2A 4EEZA 4TV9A 5FV4A 1PD0A 3QK7A 3ICEA 2YN0A 4C6RA 5BSVA 3FTQA 3NPAA 4TV9B 2WTUA 3TM4A 2X4DA 1EWQA 5HKAA 1SB8A 3VPCA 2NUPA 4DMUB 4J90A 1PEDA 3BWCA 5TT0A 4HH1A 3ZXIA 5FOSA 4FWBA 2F3UA 5HR5A 5K0CA 5I8WA 1YFZA 1JDZA 4E32A 2EBWA 2NUPB 3ABZA 4RM2A 5J63A 2QM3A 4DN6A 1UMDB 2CD7A 4U7PB 3ANYB 2NSLA 2O0MA 1LTHR 2OBLA 3O95A 5FI5A 3SF8A 2BGWA 2J3IA 1YDWA 1JG6A 4NFHA 5LQDA 4K9KA 3REFA 4KGXA 3SF8B 4YMUA 1IK4A 3VUFA 4XIYA 1MBZA 1NMYA 4Z4CA 1YS9A 3HRHA 6YASA 1IHPA 4JR2A 4HMOA 4LTNA 2R79A 3R7SA 3OSZA 4OL0A 4Y6PA 5AVYA 3ZV6A 5EPUA 1SCQA 5EWLA 5LZ8A 1JJIA 2HCFA 3DTTA 3EXG2 3HYCA 2VJLA 4Q6BA 4CR6A 3B9BA 2LCIA 5EWLB 3BIJA 3ZUGA 1U6IA 1E89A 1E1NA 2AFRA 3F7MA 1UBEA 3I4CA 3L5OA 2EG5A 1YK0A 3V9PA 1NUQA 1YIOA 3BL8A 3UV6A 3WGUA 1W44A 3QU2A 4K6MA 4NZNA 4XX0A 1FFYA 4EJSA 3U4QA 2DPXA 2ZKLA 3R5SA 4NYIR 4OQNA 4UUBA 1DIRA 3U6KA 3A9UA 4EJSB 3U4QB 1SUBA 1YNSA 2AJTA 4B32A 3ONNA 1AQNA 1FIUA 3QIAA 5EVCA 2XQIA 1P9NA 3QWAA 1OFUX 1RYHA 3JQEA 3R3ZA 2OO5C 5J23A 5BOVA 5DULA 2WPDD 3FFAA 3NIDB 1OX5A 5KVSA 3TZ6A 3SZMA 5AM5A 5IT5A 2AE2A 3V4VB 1O03A 3I2GA 1KZYC 1AK1A 4ZA2A 2WVJA 5TEVA 1U5BB 4S1TA 1U3UA 4K0KB 1Y4AE 1N2ZA 1OZGA 2JFHA 2YJZA 2ZBGA 2XWJI 3V97A 5M29A 4G9GA 2WHYA 2O1XA 5AK5A 2OHOA 4GLOA 1RE0A 2C7BA 3GFSA 4KH1A 3O1HB 1VXRA 3RSFA 4AKSA 5M7EA 3T1TA 2ZI7A 3O1LA 4ZFNA 3LVBA 3QPWA 3KAJA 4W6ZA 2O2JA 1VRVA 4A0GA 4NNPA 2LBPA 3DZJA 1LF5A 1SXGA 4L27A 1IAVA 3A3NA 2V7VA 4JFAA 3ZXYA 2O19A 3PNPA 2A5GA 4KKVA 3WJ7A 5A0FA 1UXKA 4B6JA 3CWZA 1KOLA 2KHZA 4RF4A 2F55A 3HPQA 2WKSA 1CZHA 3FCCA 4XVQA 1H1LB 4ZCQA 5CFMA 4UHCA 3QOFA 4YLYA 2LV8A 3FAKA 4H4EA 2VRBA 1R18A 2QTZA 1ZD9A 2FHSA 2OESA 4BCCA 5CB0A 3H5WA 5JCXA 1PW7A 1U9YA 1P4AA 1U1DA 2HPVA 3JQAA 4IP0A 3SY8A 1J8FA 3TGWA 3CBGA 3DLBA 1AZWA 1RW4A 4IUCS 1NI3A 3IP3A 4FHZA 2OXTA 1IM2A 3JQAB 1HR0B 1R5NA 1PTKA 1RWNA 4F4HA 4M60A 6ADHA 3C7KA 3QYAA 5E7QA 1D4FA 1ZCZA 3JQ8A 1XYVA 2JCVA 3K72B 3ZZNA 4DVJA 5FR1A 3MA0A 3CF2A 1PFGA 3AFIA 4PYJA 3O8RA 2H85A 1UT8A 3ADCA 3MMZA 3KEQA 4OG2A 3NHZA 2ZUEA 4PYOA 3PL1A 1NASA 1YE5A 4M9ZA 2FN8A 2WTAA 2JLUA 3FZQA 5LQCA 3QY9A 1GKUB 4C78A 2QTRA 3GB9A 4HQOA 4PN7A 5CA1B 2JS7A 3DV0A 3PQ7A 1DJQA 5LB2A 4ZYUA 1SVOA 3O93A 3H7AA 3RK1A 1WWKA 3D64A 4UVIA 1UBCA 1EQ2A 3IILA 3DV0B 3P97A 4I4TF 1T91A 5KDOA 4ITRC 4C29A 4Q24A 2ZWMA 2O2XA 2XMDA 2YZ7A 4IVQA 3ER6A 5IJAA 1K7EB 4EKGA 1C7QA 5FOWA 1JI0A 1LLQA 1ZLYA 2XNDA 3HZRA 3KV1A 4XFJA 3UK7A 1GGMA 2J45A 4D5GA 1SEVA 1VJ0A 3S29A 3EF3A 2QN9A 4NE2A 4EH1A 3CXRA 2BONA 3N59A 3Q7RA 4M83A 1MEOA 1ZSYA 1D5CA 3QUQA 5GOZA 1X1BA 1XCJA 1EWVA 5T3UA 1VIVA 4O1MA 3QVGA 3U37A 1I6KA 5CITA 3GPBA 2WMNB 5FHQA 2A33A 5LSAA 1H2AS 4YMVA 3QVGB 4AT1A 2F62A 1DEXA 4QOJA 2HDOA 3HY6A 4D1YA 1U1CA 3NWBA 4LPSA 5CJJA 5ESRA 2Y93A 5TVGA 4ZTZB 1W6UA 2KM1A 2AC7A 3GZJA 4OKNA 1DO2A 2HXSA 2QYOA 4B80A 4BWYA 2FN3A 5A5FA 4PC6A 1RXVA 4J7CA 3UN1A 1V1RA 1Z8HA 4GHWA 4UBOA 3NC0C 2JANA 4EB6A 1JV2B 1QO9A 3WHPA 2XNHA 4OXQA 4YPOA 4TYNA 4EKEA 1AUQA 2BUBA 721PA 5LNK1 3OO0A 4H16A 3FDJA 1VRWA 3CTMA 2IWHA 3KEOA 2IIPA 3PF8A 3LUKA 2Q5HA 5A02A 2EU8A 2IP2A 2Q3DA 3A9VA 1WLSA 3ONDA 4Q1DA 4X45A 2QN6A 4YDHB 1LV7A 3ZHZA 4GI5A 3WA7A 3NUZA 4BO3A 4PZLA 4AIIA 2ATIA 1LBIA 3T94A 2FR1A 4L76A 3Q7TA 4EYQA 3GJ3A 4MLCA 4YJGA 2IH2A 1X70A 5KDLA 3KNZA 4OAOA 3BRWD 5KIAA 3BSWA 1UFQA 2OP0A 1AA6A 4RIEA 4YJGB 2JF0A 1Y7LA 5AJWA 4AJHA 4C08A 1W5BA 3GFPA 3INRA 3DO6A 3O83A 2CZQA 3NBZC 4DPMA 4UNPA 4KPFC 2VK1A 3DQZA 4G5RA 1SIOA 4O33A 4MSUA 3VBEA 2I7CA 5EJ5A 3OZAA 1SXQA 5FTLA 4KI0A 3VR4H 3VYTB 5ECGC 3AHHA 4H7FA 5AHXA 1OH5A 4UVHA 5J1SB 1ZCFA 2RI6A 4Z9FA 1GXSA 4OREX 4M1MA 5DFAA 4QGGA 3IP5A 3ETCA 4BX0A 2W71A 3HDQA 1JBKA 1GXSB 3WIBA 2VRNA 1JLLA 2FA9A 1Z29A 2FDRA 2J1LA 2O9JA 3FMVA 3NTQA 4G1CA 3E15A 1TGVA 2DKOA 4GD3Q 2GZMA 3M81A 2ZJ7A 4OHBA 4KTTE 4U02A 5CFPA 5H4GA 1YBFA 1JLLB 3UKJA 1MXHA 3EEFA 2I78A 4WH0A 2OAEA 4FGSA 2G40A 1FUYB 4G5YA 4QDUA 4D0NA 5AM4A 4B7ZA 1PHRA 4W5JA 4UVDA 5DYNA 4PHHA 1URPA 4EB0A 3PVZA 4NH0A 1BKDR 2WJGA 4LY0A 3CB4A 4PS0A 2Q3JA 3DL7A 5DZSA 3ZV5A 3VR5D 4CM5A 4E6EA 5F23A 2XPCA 3E9QA 4GICA 3LGSA 3MJDA 1RI1A 3UUWA 1U8AA 1O94C 4N6OA 4NF2A 3EIFA 2FQ1A 5B37A 1QZUA 3UMJA 1YZ3A 2YQZA 3FLMA 4AWAA 3HB5X 5DMHA 5TV2A 1F3OA 2L42A 4QRIA 1A9YA 2K2QB 1EDOA 1B73A 5K1ZA 4DA4A 1G4AE 1JIXA 1Q77A 1UFRA 3BRCA 3IEPA 4PZPA 4CFSA 1DAIA 1I30A 4RS4A 4W5NA 1VHDA 2PJRA 1N57A 4CM4B 1GNSA 3V33A 2KX7A 3PXGA 3A36A 1G6OA 4TMWA 3LUCA 2V9ZA 4EPWA 4EUFA 1DC5A 3EC1A 5JMOA 1Q5PA 2OFFA 1E1MA 4I5GA 1L4FA 2WKPA 1FFDA 5ALXA 3W5VA 2XAAA 2P4UA 3PXUA 1F14A 3E81A 4O0LA 3ZQJA 3R5XA 4KQMA 3JAKA 3RRFA 4PCUA 1TM4E 2AEFA 2HMUA 4U5QA 4ASUA 4B44A 4C1NA 4FYWA 1ZMTA 2H3EA 1IXSB 3JAKB 1ZM2A 3DAPA 3VNUA 1EUDA 2QY9A 3S2SA 3DEFA 2Y1WA 3ZOZA 1Y5RA 3BGSA 3V7UA 5EP4A 1M34E 4LXTA 3RLIA 3FBWA 3JWHA 3IX7A 4HATA 5PNTA 1M54A 3F73A 4LSZA 4P83A 5FAXA 4ZHQA 2G9QA 3CVWA 1ZBDA 1NRXA 2GFIA 2WMDA 4LMBA 3SAJA 3C3CA 3CR7A 2HY7A 2ON6A 3PUIA 4BLQA 2Q4DA 1A71A 5ALYA 4EHKA 4ZHQB 3AFHA 3LC0A 3BRSA 2FPRA 3PQFA 1RM3A 2IEYA 4NSNA 4NEGA 1ZQ1A 2O4CA 4CKWB 2BI7A 2P7HA 4NE7A 1KBOA 1TK3A 5LJLA 1FZQA 2Q5QA 5B3AA 4DG8A 3CH6A 2O7RA 2RHLA 2ZRMA 3A8TA 1QHGA 2IHJA 2JDID 1KQ3A 2CNDA 3D0OA 2ZIAA 3CHYA 1A8IA 2E49A 2F6RA 2DPYA 3EZGA 5DE3A 1RRPA 3FNIA 4YRPA 4WLNA 4BHTA 4EG0A 4B7AA 1DRJA 5EIAA 4IS2A 5E4FA 2O8BA 2OUIA 1ELOA 4Q7MB 3L4KA 3GRCA 3PB3A 3C1TA 3IBTA 2O8BB 1OT3A 3QHQA 3LPLA 4D6YA 1BCSA 1NM5A 2F3SA 3LQ4A 1QWSA 3QLEA 2UV8A 1E9DA 1JJBA 3E4CA 3MTDA 1BCSB 3IAS6 5C9ZA 2CJFA 1WCV1 2ZBFA 2AF4C 3UJPA 1XIVA 2ZYRA 3GJTA 3KO8A 4BFWA 2HHHB 2C77A 2C8VA 5F1YA 1SUCA 4YV0A 4U6SA 2QZ4A 1FLAA 2COKA 2VJDA 1M76A 1K2WA 5HJEA 3AHCA 3F0TA 2AGVA 4JIGA 4UE6A 5BP7A 3SVZA 3U7GA 4UBKA 3B9QA 3BJIC 1QFMA 3R0ZA 3EWAA 1H93A 1M1UA 1UZLA 1SVNA 4RHYA 4D42A 5JNWA 2ZRNA 4CDMA 1M7HA 2JLQA 3NBQA 1L5NA 3VH3A 4C76A 5E0KB 3QBTA 2VDKB 1PUJA 1NN1A 3B2NA 4IXDA 3OLVA 3CNEA 1JG1A 2A0FA 4EW1A 3LM8A 2DQSA 1FRZA 2Q8PA 4WUVA 3BA1A 3NM6B 2O23A 3AKDA 3KLPX 4FFMA 1CUAA 2VG8A 4KOAA 5JZVA 1P0IA 5CYGA 5K3OA 2VUHB 1PG5A 4BE4A 4OY3A 5CRIA 5FPYA 4PHTA 1X74A 4TLLB 3DFUA 3NUQA 1W0JD 2E7ZA 1Y1QA 5B4UA 3ZH9B 4GECA 5KJCA 1R5JA 1QKKA 3GCDA 2P2CA 1QONA 3A1WA 3BGOS 3DFZA 3IIIA 3OMXA 1JDTA 5CEEA 4DR6B 1L8XA 1V43A 2ZPTX 2DJ5A 3RUFA 1Z62A 5LIRA 1RAFA 1JJVA 1W25A 4G1FA 4JYAB 1PR0A 4EVQA 4TTPA 1ZIDA 5B3JC 1A76A 1G1MA 5JTUA 1NVTA 3ZIUA 4Q4LA 2CNWD 3ZS9A 4NG5A 4Z4IA 2C9BA 4C6TA 1WDTA 3UJ9A 4ZT6A 4O2BB 5KB3A 3P2IA 2F3RA 3BSFA 3GRVA 4KXYA 3Q2OA 3IB3A 2IKQA 4PQEA 2V5UA 3O3CA 1W52X 3CE9A 4C6TB 1B2RA 2E5WA 2OFOA 3T0FA 1J22A 3Q8XB 4OMFG 3TR5A 4A03A 4TN5A 2V0GA 1B8VA 2Z5LA 3UT6A 1SZPA 1R0XA 4ESVA 1K4KA 4Q34A 3V1KA 2QN2A 4M87A 2QUAA 2BGMA 1XZPA 2QWXA 4MEBA 3CV3A 4O5AA 2D00A 3ZJTA 3GAZA 4NQRA 2Z6UA 2FB9A 3TOSA 3SR0A 1ZD5A 4MKRA 1WVMA 1YMQA 4L3WA 3SC6A 1Y81A 2JLXA 4CLXA 3DPUA 4J0DA 4QEKA 2HTFA 1DU4A 1NXTA 4BBAA 1XN1A 3HB9A 2JJQA 4XDYA 3FRJA 3KELA 2N3ZA 3AINA 5I7UA 4G3XA 3Q8LA 1LRJA 4FP9A 4I1IA 3EVCA 2WWHA 3D6NB 4NBLA 4LCEA 3KXIA 4MGIR 3VZCA 2PD3A 3D2CA 4GBGA 1CJTC 1II8A 3AVTA 4XDZA 1CHDA 3EGEA 3D6MA 3GLUA 4G26A 1L5FA 1IEVA 2AZTA 3KT8A 1EK5A 4QODA 1II8B 1LK5A 4AF8A 5JQGA 1AGNA 3DEIA 1JE0A 1JQDA 2YIVX 4RYLA 3SJUA 5LP6F 1RHUA 2IEIA 3LF1A 1KEZA 4Z0PA 5I7FA 1NW9B 4IYJA 5JQGB 3QXHA 5SYNA 4UPVA 4XR9A 1M67A 2WUDA 3FF4A 3W8EA 3PSAA 4ALMA 3DW3X 2MTBA 1SU6A 3FZEA 3PT5A 1IQRA 1CY6A 2A9PA 2WWRA 4K9QA 5AJUA 5JJIA 4DRYA 4PX9A 4D9JA 2DPLA 1XU4A 1M8GA 1WCIA 3KXLA 4RGVA 4Y1EA 2X76A 3QX7A 1QAMA 4BFVA 2AB0A 2ZOSA 3C0KA 2H0QA 3IUYA 4C4TA 3I37X 3OIFA 1WCIB 3WRYC 3RBVA 2PSFA 2JGDA 4I81A 5IVDA 2UZ3A 1DAFA 1ZVMA 2Y4OA 4IRMA 2LDBA 4S04A 1DIGA 1RWKA 1HYBA 2JGDB 4J07A 2BCGY 1I14A 1JEYB 3MMNA 4Z2YA 5JAZA