4QQFA

Crystal structure of mitochondrial import inner membrane translocase subunit tim50
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
GSHMFNSMFTYFQEPPFPDLLPPPPPPPYQRPLTLVITLEDFLVHSEWSQKHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADDKLVRLIPFLEYLATQQTKDVRPILNSFEDKKNLAEEFDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Tim50(164-361) suggests the mechanism by which Tim50 receives mitochondrial presequences.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords Mitochondrial import inner membrane translocase subunit TIM5
total genus 53
structure length 198
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4qqfA00
4OCZA 3L8GA 1XP5A 4UARA 4Y2SA 4JB3A 2YMMA 1J97A 5AK6A 1Z4NA 4L6CA 4BEVA 2AGVA 1ZD2P 3A3YA 2GMWA 1ZRNA 2ZBDA 2WF8A 3WK4A 1Z4KA 4FFDA 1PW5A 2R8YA 3GYGA 4EENA 1AQ6A 4NABA 3WGUA 2HSZA 3RF6A 2RARA 3AR4A 2R8XA 3QUTA 5AICA 3B9BA 2FPXA 1J8DA 2EAUA 3A1DA 4BEWA 3N28A 2G06A 5AM3A 5AVZA 4YH1A 2QLTA 4G9BA 3ZX5A 2G09A 3U7EB 1RKUA 3E84A 3FVVA 5AKIA 1RQNA 3QLEA 3KBBA 4Y2UA 5ALZA 3SMVA 2I7DA 4PNHA 5AM5A 4Y2TA 5JJBA 1YS9A 3OCYA 3R09A 3ZW7A 1NF2A 3ZVMA 2Q4RA 2YBDA 2GFHA 1YDFA 2QYHA 5AVWA 2FPSA 3MPOA 3WKBA 4UU1A 1QH9A 2C8LA 2HI0A 4YIHA 2HHLA 2IOFA 2FEAA 1QYIA 4UMFA 2HX1A 1T5SA 2WF6A 5AW2A 3N1UA 4Y2RA 4XOUA 1T9ZA 2G07A 2NO4A 1Z5UA 4O8CA 3U26A 5A3SA 3QUBA 3MC1A 3ESRA 1CQZA 5AHXA 4UM7A 4XQ0A 1WPGA 5ALVA 3WKAA 3NALA 2OYCA 2YJ6A 3MN1A 3HYCA 5AW0A 3WKDA 2CFRA 4BX0A 3D6JA 4C4TA 2P11A 1Y8AA 5AW5A 1WVIA 3ZTWA 4C4SA 3FGOA 4J03A 3NRJA 4BKMA 1YNSA 5AM1A 2HEGA 5AVXA 5AW6A 4YCLA 1K1EA 2CFTA 2EARA 3ZI4A 1RLOA 3PCTA 4JDPA 5ALNA 3OCVA 1L7MA 2EATA 4UU0A 2ZBGA 3DDHA 1VJ5A 4Y2VA 2JGAA 5AKGA 5AI8A 3QUCA 4DFDA 1TJ3A 2I54A 4Y2YA 2C9MA 1QQ6A 4Y2JA 2RBKA 4BX3A 2C88A 2G08A 2W43A 4FYPA 4BYGA 1FEZA 2B8JA 2PKEA 1Z4LA 5AKKA 5AVYA 1MH9A 2G80A 2OM6A 4L6AA 4CF5A 4UW9A 4CF3A 3SKXA 3HLTA 1S2OA 1Z4PX 2HF2A 1X42A 2G1AA 4QJBA 2ZXEA 5AK3A 1Z4JA 5ALXA 1ZRMA 3L1UA 3W5CA 1ZOLA 4GIBA 5ALPA 3WK5A 3PDWA 1Z4QA 4KX5A 2P27A 4KNWA 5AW3A 4IG4A 5AVTA 2FPRA 3L5KA 1SWVA 5AI9A 1RLTA 3ZVNA 4UM5A 3QU7A 3U19A 1RKQA 3AR3A 3QNMA 1YV9A 1IWOA 3U13A 3N5KA 3EPRA 4ZEXA 3UM9A 4BNDB 3DV9A 1RPZA 2AMYA 1N8NA 1VJRA 1WZCA 2X4DA 4OD0A 4HGRA 1JUDA 1RLMA 2I33A 4NFLA 4UMDA 2B1QA 3E81A 4J2TA 3U7HB 1L6RA 3EWIA 5AKHA 4AS3A 4HGPA 2HO4A 3U7GA 4XE5A 3B9RA 2I6XA 4I9FA 1RMQA 5AW9A 5AW1A 2O2XA 3FPBA 4NWIA 3UMBA 1ZD4A 1F5SA 2YY6A 3MMZA 5AM0A 2R8ZA 3IRUA 3OPXA 1Z88A 3R4CA 1TE2A 2FUEA 3QYPA 4YIKA 3BWVA 3FM9A 3KZXA 2IOHA 5ALEA 3SF0A 5ALGA 1Q91A 2YMLA 3SHQA 4UATA 2NYVA 1U02A 5AIAA 5AKJA 3J7TA 3QGMA 1O03A 3QXGA 4CNQA 4YCNA 2ZBFA 4HYTA 2WM8A 1CR6A 1L7OA 4I9GA 1NRWA 3I1YA 3OTQA 1LVHA 3E8MA 1RRCA 4AP9A 5AVVA 3WK8A 2DQSA 1KYTA 1Z4OA 1ZJJA 3UMCA 3WGVA 3S6JA 4EZEA 2B0CA 4UMVA 2PR7A 3I28A 1T5TA 2JAOA 2VKQA 4YGYA 5ALOA 3QU2A 1ZD5A 3ET4A 5ALDA 2RB5A 2OBBA 3KC2A 3WK6A 2BY4A 3NASA 3L8HA 4QQFA 5AKEA 1RMYA 3M1YA 1SU4A 2G0AA 3CNHA 3KD3A 4RESA 3SLRA 5AVUA 2WF9A 1VFPA 3ZTYA 1EK2A 1QQ5A 4EX7A 2WFAA 1YMQA 3ED5A 5AESA 1TJ4A 4MWOA 5ALKA 5A3RA 2W4MA 3WKEA 1RDFA 2P9JA 5AW7A 2I34A 2W11A 2YMPA 1RKVA 4Y2PA 5ALQA 1XVIA 3W5DA 1S8OA 2RAVA 3KDPA 2FUCA 2IA5A 4HGOA 3L8FA 3W5AA 3ONNA 2ODAA 4UAUA 1RMTA 5IT0A 3A1CA 4F72A 3AR7A 5ALRA 4EEKA 4NAVA 3W5BA 5A3QA 4OHFA 3FPSA 3CZ4A 2GO7A 4G63A 4UMEA 1Z4IA 3P96A 4L57A 5ALUA 2JAUA 2ZBEA 5AKLA 4RETA 3F9RA 3QX7A 3IB6A 2HOQA 3VAYA 2WF7A 1U7OA 2I55A 3ZU6A 2BDUA 3N8GA 1Z4MA 1YJ5A 1L7PA 3FZQA 2YJ3A 1U2SA 4BBJA 1RC8A 2JAWA 2HF7A 2CFSA 3NAMA 3A1EA 3EF0A 3SKYA 2YFYA 2B8EA 4BNDA 3NIWA 5ALIA 2C4NA 3L8EA 3DNPA 2C8KA 3NANA 3QU4A 1EK1A 3L0YA 3R9KA 2NO5A 4OFZA 2FPWA 4Y2XA 1XPJA 2BDEA 5ALMA 3BA6A 5ALFA 3DAOA 2P69A 4UASA 3KOOA 3B8EA 3L7YA 5ALYA 3AR2A 4HAIA 2FPUA 2FI1A 5ALWA 5AKZA 5AIBA 5AVQA 5AVSA 3QUQA 1ZD3A 4MUMA 4IFTA 4HGNA 1N9KA 3EF1A 2Q5EA 3OCXA 5E0OA 3UMGA 4E88A 3OCZA 3OCWA 3RFUA 4ZEVA 2HCFA 5AI4A 2FDRA 3PGLA 1QQ7A 3AR5A 1RQLA 5AI6A 4YCMA 2YMQA 5ALJA 2PQ0A 3AR8A 4CF4A 4Y3UA 5ALHA 1Z5GA 1U2TA 3ZUPA 4GXTA 1TA0A 3TLMA 4KX3A 3SD7A 4Y2QA 4CE6A 5AI5A 4FE3A 3ZWKA 5ALSA 5T41A 5AW8A 2GHQA 3U7FB 1NNLA 3I6BA 4DWOA 1Q92A 1TJ5A 3IJ5A 5AI0A 2WF5A 2YN4A 2WHEA 2IOFK 2O9JA 3AR6A 4DW8A 5IS2A 4AS2A 2AH5A 2Q4TA 1U7PA 1L7NA 1WR8A 5ALTA 1O08A 3ZWDA 2YJ4A 3L1VA 3ET5A 2HDOA 3N07A 1SWWA 2ZG6A 2B82A 1LTQA 4C4RA 4ZEWA 3I76A 4EELA 4H1WA 3QU9A 3ZX4A 2YJ5A 3OCUA 2R8EA 2OA0A 4F71A 3ZVLA 1ZS9A 5AM4A 4BX2A 4XPZA 5FP0A 3K1ZA 3L0CA 3AR9A 3L0BA 2D2VA 3M9LA 4KN8A 3E58A 5AW4A 1L8LA 5IT4A 3PGVA 4HGQA 3WK9A 5AKYA 2IYEA 5AVRA 2ZOSA 5AKXA 2B30A 3ESQA 5AK4A 4EX6A 2JARA 4UAVA 3QU5A 4B6JA 2GHTA 4NV0A 5ALLA 2MSNA 2B1RA 3WK7A 1L8OA 2AUTA 3WKCA 5AM2A 4KNVA 4DCCA 5AK5A 4KYTA 3NUQA 2CN1A 2MU1A
chains in the Genus database with same CATH superfamily
4MRVA 3K1JA 1E7SA 3SS9X 1UMDB 2OWDA 3M4ZA 1XP5A 3L7AA 4N9QA 5DBGA 4D43A 5B4UA 5KOYA 1D9XA 1FJ2A 3OT4A 1FSPA 1EVJA 6PFKA 1J07A 3R3YA 4FYVA 5M29A 1RXVA 3VO1A 3CVXA 1PJSA 1TEVA 1TU0A 2PUBA 1VG0B 4B8WA 3F7MA 3JQAD 3EEOA 3JQGB 2JCXA 2OV1A 1UBKS 2TSYB 3Q10A 3C4QA 1O5IA 3IBCA 4U7PB 4HP8A 2XUIA 3CV3A 4OOFA 4X90A 1JBQA 1EA5A 1HQCA 2WSMA 3L05A 4QBTA 2HIAA 5CA0A 5U4QA 1YU9A 3THYB 1PNVA 3IP9A 4CDMA 5HS6A 2Z2YA 1YFKA 1JZSA 3G9TA 1C30A 1YDHA 3F1LA 5H3HA 4RHUA 3X1WA 3QUTA 1QSGA 5KDOA 1QHSA 5TS3A 1SHUX 2FPXA 3R3JA 5JQGB 1IOVA 1KOJA 1JR3E 3ESCA 5CJ2A 3V8QA 3WMEA 6ABPA 2AQHA 2BM9A 2X0JA 2R8BA 4RH0A 1CF4A 1KMHB 4J16A 1IY8A 1S3SA 1XR3A 1YQDA 2OLEA 1NP7A 2XCLA 4BVBA 4K9KA 3ORHA 3U56A 2QLTA 4G0NA 4ZKEA 4GZ6A 5G4KB 4YRCA 4DG9A 5A04A 3IDOA 3PFKA 3MYYA 2P78A 1DP4A 1OH6A 2HPVA 3KT3A 4G09A 4PGMA 2WUVA 2UV8A 1QIGA 1QLWA 3PITA 5AKIA 1E3WA 2A84A 3LWDA 1F2TB 2W42A 4U7GA 1U0TA 2DTDA 2GEKA 3CVUA 5CT8A 3N76A 2PGAA 4NH0A 1B73A 2X76A 1TAHA 3QVGB 4GOND 4DQLA 3KWMA 1M6EX 3IUJA 3U2QA 4TYWA 4AUNA 3EJWA 1NBAA 3IKLA 1T5BA 3P2YA 5DHQA 4RMHA 1AK1A 3UMFA 3G5MA 3GPCA 1PVVA 2PZKA 3BCSA 1ZOOA 1Z18A 1NFRA 2IYVA 2FUKA 1FLDA 1U8TA 2WU1A 3FYTA 3R5KA 2I1LA 1W6RA 4RL6A 1KSGA 3VNVA 3DTVD 1BA3A 3BN3A 4N3CA 3KOUA 4GMDA 4ESHA 2JH3A 2HD4A 1KSFX 2WV9A 2VJMB 3Q7TA 2C77A 4Q1VA 2GK3A 3K0KA 3OE1A 5DHSA 2H17A 1L6IA 4OVKA 3PDIA 3T1YB 5EJEA 1V9CA 1A76A 1V1MA 2E49A 2G5GX 3GRZA 1GIAA 3W5JA 5K6TA 3QIVA 1H2AS 1W6UA 5DU2A 1JIJA 1XTRA 2G07A 2ZKIA 2VVTA 3PQ5A 5TT1A 3TIIA 1WXIA 4INAA 2YHSA 3B82A 4MVJE 3ZGZA 4O1HA 2GYVA 1YB1A 2BC9A 1MO6A 3LUAA 4K8OA 3KL4A 5E4TA 1M6VA 4ER0A 1TGYA 3DOHA 4GM4A 1FUIA 3AKEA 4CVNA 2XKJE 3GIDA 1LCIA 3JZIA 1U1IA 4XRGA 1LRJA 1WNFA 1VPDA 2I8LA 3HCEA 1EAYA 1V3VA 3ZCXA 2N9UA 3H2SA 3OVMA 3QKIA 2D5BA 1QDEA 3N6VA 4ZCSA 1FBNA 1WM1A 2OK8A 4CN9A 4KQJA 2JLUA 4R5HA 2GDZA 4RTPA 4LPSA 5EIXA 1XAGA 1AKEA 1QHNA 3S0JA 1XHEA 4UUQA 3Q8XB 1YNSA 4IV5A 3LBAA 2IYSA 4HXYA 1MPXA 1JTFA 4BO0A 4LDQA 2M1XA 5K45A 2E4ZA 4OFBA 4HX2A 1AZTA 4H4CA 1SKBA 4OXIA 3LMKA 5DM4A 2PH1A 1O89A 1V9LA 4HXEB 4OATA 4YR7A 5KQMA 1EGQA 2WB4A 3HYSA 2GK6A 3RJ9A 3ZR4B 1QLJA 1N2IA 2R4QA 3HVIA 2Y0CA 5LP6C 2QRUA 2ZCUA 4BAZA 3I04A 4ES6A 2ZSIA 3E48A 3F6EX 1FQKA 1Z3CA 4UE3S 5C46F 3D3WA 1YQGA 1KQPA 2O3TA 3RT9A 1KEVA 3THSA 1ZUIA 5JEDA 2GCOB 3BXOA 4RS3A 5JNUA 1U9CA 2C83A 3EFOA 1EWVA 5T3UA 3AINA 2XNJA 3PFIA 4R4JA 1KE2A 3VSBA 2W9XA 1JB9A 2P2ZA 3CMMA 4B43A 1Q7EA 1LLDA 1H0SA 3SM3A 4II3A 1Y7TA 5LYJA 2IODA 2Q9UA 2YHIB 2VTDA 4FNAA 5EXPA 4KYVA 4DSTA 2R0QC 2GEUA 2RC5A 3EHEA 1MJHA 1HT0A 3FMIA 9GPBA 3S8YA 3ACBA 2PKXA 5BSHA 1Z4PX 2WDPA 1X42A 3BE5A 3CJTA 4JGGA 2IUSA 1LFAA 1G9TA 2UUOA 3AY3A 3W5UA 1E1DA 2AW5A 2FMXA 3CVOA 4D9KA 3GEIA 4OYLA 1UQRA 2I1WA 3NHLA 1GZ7A 5F7ZA 5DHFA 2FHPA 1CRPA 2O7SA 1S1MA 1GPNA 1GTJ1 2EEPA 4PVDA 1PT7A 3GARA 5C5CA 4EM6A 4PYIA 3F2VA 2PUVA 1TVEA 2FFAA 1G8GA 5BRJA 3G13A 2A9KA 2CV1A 3UJHA 1KRWA 2Z6AA 2W0SA 3O1JC 1PV1A 4RSRA 1I9CA 1QKIA 4R69A 5C4MA 2YX1A 1Q15A 3GJYA 1REQB 3RK1A 1EZ4A 3JZAA 2P9HA 3AFIA 4R31A 1P0FA 1OREA 3LVBA 1YC5A 2BMWA 4ZQFA 4R1UA 4BVLA 5L4NA 3K9QO 3T95A 1R8JA 3G2LA 4CV2A 4JEUA 1PZHA 3LFHA 2H00A 1CFZA 1MC1A 4KLNA 4XIYA 2FRDA 3A6PC 3HLYA 3B51X 3AJRA 3JY6A 4J1NA 4KXYA 4M0EA 1U5AA 3RLFA 4WBNA 2HXGA 1IJBA 4EFDA 4Z49A 1QWOA 2PSJA 3AEQB 1DO2A 3Q85A 3ZWPA 4REQA 4PS0A 2R8RA 2F1OA 4C0QC 2VO1A 3CLTC 3O8RA 1GY8A 1PYDA 1XD2B 3H9BA 4ZRMA 2R8OA 3AQ4A 4PQEA 3TQTA 1OZ0A 5K4AA 1Z38A 2HMUA 5FOQA 1JMYA 2VQ6A 5CA1B 2VTKA 4K40A 3VHLB 3ZCPA 5LB4A 5JALA 4JZKA 3R5XA 1XX6A 3N70A 3QG5A 1XRRA 1R4MA 1GQRA 1NBHA 1X9GA 3O3NB 1KI9A 1N5RA 1NQUA 3O2SB 5CYFA 3K70C 1P62B 4I50B 4M21A 4RORA 1DJPA 2BP7B 3F1KA 3GU3A 5ALEA 3IEIA 1XJQA 3KQYA 2P2CA 3K4PA 1IBKB 1W2WB 4IDFA 2I9KA 1JFFB 4P08A 2TECE 4F92B 2C59A 2HSWA 1PJRA 1E1RD 4ZVTA 4D3SA 1WX1A 3ZCTA 1UMCA 2Q5QA 3IYLW 3DHWC 2YKGA 1YRWA 4RY8A 3KQHA 1GAWA 3CUVA 2I6FA 4YWJA 4DHWA 3MOSA 5BVGA 4H15A 2VG8A 4KXXA 5JISA 4K0RA 3DPUA 3QPDA 4HXGA 3LRPA 3L4KA 1VHTA 2KPOA 1QORA 4J90A 2IYWA 3B6EA 3CTPA 3I1YA 4I50A 2R84A 1KAQA 4QDJA 3O73A 4WACA 3WLAA 4B7UA 4TVSA 3DJYA 1RRCA 3PV0A 4MKFA 2FXVA 1DG1G 4XIFA 4D0SA 1RXUA 2C00A 1XZBA 5JDCC 3H5WA 6GPBA 1Z4OA 3ZDBA 3UWPA 3L7BA 4FW8A 4BMOB 3HUTA 3RF7A 2CHGA 3WGVA 2VS1A 2CXQA 5BV7A 3UUFA 3DBRA 5JU6A 3CSDA 1ZNXA 2QYOA 1WMEA 2FX3A 1S2NA 2J33A 4YMIA 1KK0A 1Z0SA 4OUDA 5IUKC 1Z5VA 1Z5PA 4ETNA 5KVSA 3VKFA 3CLSD 1AV6A 3ET4A 2HA5A 5G53C 3SVTA 4GI2A 4G1EB 4I9UA 5SY4A 3NASA 4U2BA 2WFMA 3KB2A 4N39A 1OXXK 2BFDA 1XCPA 2P7IA 2W7TA 4EI2A 2ZIAA 3UB2A 1VFPA 4BO7A 2IYYA 1N6HA 1E59A 3EGXA 4LYEA 1V8DA 1ORDA 4ZCIA 3DBVO 1X0VA 2EKLA 1F6WA 1WPQA 3QE9Y 1C3EA 3QPAA 3W8NA 1ES9A 3UW1A 2LWIA 5K0TA 1WTCA 1U3VA 1F6BA 3BH0A 1VL5A 2AXQA 4XLZA 3TGLA 3DAGA 3JQBC 2V58A 1II9A 4TKMA 4Y2PA 3W78A 3H87A 2INGX 1LPPA 2XUFA 2ZS9A 3VH1A 3H11B 5BNIA 1U5BA 1VMEA 4PLCA 4QBGB 3WZMA 4WNAB 4DV3B 2IUFA 2H31A 2DBRA 2NZXA 2C2BA 2V1XA 4RMIA 1SIUA 4J6FA 1F8FA 1QIIA 2HV9A 4AURA 1A04A 5ES4B 4JYAB 1ICIA 1KHTA 3A27A 1QH0A 4HOYA 3VRHA 5LD2C 4MKIA 1WD7A 4L8LA 4G86A 1P0QA 4NCHA 3W5BA 2C7QA 2IEIA 1UM9B 3KWJA 1E6KA 1K3TA 1Z4IA 3P96A 1N1EA 4GU5A 4HDAA 1C7IA 1SHJA 5ALUA 2C5AA 2NVUA 4ENRA 1N1MA 3TGPA 1YCHA 1OJLA 1P7CA 1UR5A 4MUBA 3QX7A 2ZUTA 1TO1E 4B6PA 4NOLA 1W76A 1EFPB 2BDUA 1QUEA 2QQGA 4N49A 2YJ3A 3CRQA 1SUAA 4PHGA 2QBYB 1XZCA 4H1TA 4FCVA 3NZEA 1DZIA 2HCJB 3I30X 1KK3A 4K9DA 4LRWA 3SIRA 4DA6A 4MK4A 5K0ZA 3INYA 1GGNA 3AL3A 3C7TA 4B2LA 4C4YA 5GINE 4DUZB 2F00A 3ID6C 3LWBA 3TZKA 3GHHA 4BMSA 3NANA 1VP9A 3DD1A 3PSHA 2JFXA 5D7BA 4DKJA 5G4LA 1YR3A 4R1MA 1FFHA 4TMZA 3NTOA 1XPJA 3KEMA 2Q50A 5L3ZA 4FHCA 2JKVA 3MOGA 1PJ2A 4IZHA 1K8QA 2OV4A 3KG2A 3ZU2A 2QM8A 2YXNA 3TZHA 2AN5A 3AR2A 4C04A 3FPHA 1RYBA 1JR4A 2FI1A 5AVSA 5IK2D 1YZKA 3GRFA 4JNCA 5EINA 4HGZA 3A0RB 1EUCB 2W6ZA 1UBRS 4IOKA 2MYUA 3LCJA 5E1MA 3OCXA 4CDRA 4PLPA 2XRYA 3QVTA 1H2XA 5JMWA 4MDEA 1R0LA 3RU3A 1FYXA 3QWFA 1WXGA 1P6XA 3BD8A 2BR5A 5AI6A 1MG0A 4FFOA 5H5JA 3RABA 3ZZNA 4Q47A 1EP2B 1SVNA 2H16A 4IMPA 2R7AA 4ZV9A 5LBIA 4BFWA 2RC6A 4ND2A 4Q3BA 4CF4A 5A0TA 4RFSA 5IBPA 4BQEA 5C34B 3ZUPA 4B6FA 3ND5A 4G24A 4K9NA 2GPYA 1M8JA 1J0EA 1Z0DA 3IR5A 3QQPA 3DTNA 1M1XB 3SD7A 4WNAA 1MOPA 3STXA 4AU1A 3OKAA 4XYBA 4J4HA 5DW3A 5H82A 4BO4A 4Z0TA 2PMWB 1FJHA 2O59A 1J2JA 4XQ9A 1DZ3A 1PKEA 1TJ5A 1YT5A 1LNZA 4ER6A 3I6YA 3AJAA 1WD5A 4AZSA 1SZDA 5C80A 4YJ3B 3WA7A 1WCV1 1L5VA 4CR7A 3PHIA 4AKGA 2YV2A 2HSGA 4DZTA 2WFZA 1Z26A 3F0TA 3GFGA 1JLKA 2XA9A 3GG9A 5AHKA 4EJ6A 4J1SA 4Q1CA 4AI6A 3GMSA 4J49A 3VDNB 4S24A 5JS7A 2VF8A 4C5CA 4Q4DA 4FMCB 1NVWQ 3L1VA 5BWOA 2VH5R 2Y93A 4DVGA 3KAJA 2OO7A 3GVPA 2VHTA 3BM5A 2W6JD 1DIOB 4MW4A 4TLDA 1GG9A 3NRBA 3BFKA 4X1IA 3L6DA 4LY6A 4YK7A 3I0ZA 4PZDA 4D4GA 4EF6A 4NBRA 1BXRA 3OKPA 2FETA 4EFLA 3JVUA 4NR0A 4TWZA 1NMZA 3UK1A 1EG2A 1F38A 1T8SA 1XXLA 2IZ0A 4IGIA 5A3VA 3V4PB 3ZVLA 1XTZA 3TLKA 4IM7A 1TZJA 1RABA 2QLBA 1A3CA 3L7JA 4HAVA 2AQ8A 1HYBA 3TRFA 2IU4A 4WKNA 2J0QA 1V1RA 3HA2A 4RTJA 5BY2A 4YBZA 5SY6A 4RYDA 2WU8A 3LPAA 3V2HA 4QPZA 2FPIA 4EAQA 2PLAA 3G8YA 4BMDA 2RHMA 3QI2A 3NEJA 4Q3EA 4P54A 2IS1A 3LG2A 3AVVA 1HOXA 3UV3A 4JOSA 1ORVA 1Z6XA 4ILKA 2WR8A 2HA6A 3DE2X 4BIMA 1HFJA 2V1UA 1ZICA 2QRGA 5TLSA 4JYPA 1C7QA 1H1DA 3SC6A 4DHEA 3IDSA 4M0FA 3IBYA 2DU8A 4R6WA 1FP4A 5ALLA 4C7XA 1IDN1 4BN5A 3X43A 4O4JA 1ZGJA 2WPNA 1RQ7A 1KXZA 1E7WA 1EGVB 3GJRA 1SIBE 1Y34E 4N8EA 2WUGA 2CVPA 4DIKA 1YB6A 1P7WA 1RYFA 2XRFA 3BKWA 4RY0A 4EECA 1BHJA 1UADA 2GFIA 4F7DA 1I30A 1R0RE 4JLAA 3SE0A 1SHZA 2VSNA 4F21A 1IHYA 3WBBA 3DTYA 3TQFA 4M1ZA 1ZW6A 2GCPA 1BKSB 1WMAA 4Q3DA 1Y80A 2ZAYA 4BEVA 3JQFA 2FR8C 5FQOA 3K3PA 3OT1A 1UZUA 2GMWA 1EYZA 3R0QA 4HPXB 2AE2A 4D4LA 1KU0A 3ZPXA 3TL2A 1SQFA 2XQIA 4FFDA 3T41A 4AJPA 5DLEA 3LXMA 1VE1A 2P8JA 3HWX1 1CZUA 1U2GC 2ZJ1A 2L18A 4ARCA 1P4HA 5IYZB 2IYXA 3C6KA 3WGUA 8ADHA 5JVDB 1VJ1A 5LM3A 2JF0A 1ZN8A 1FMFA 3O82A 5IN5A 1GD1O 3NFYA 1QR2A 2H1VA 2EIXA 1EX7A 3CA8A 3NTLA 1AF7A 3WYGA 3EISA 2H1RA 1TTHA 3AUSA 4J0JA 1D5WA 1SD2A 1HGXA 2G06A 3JQ8B 1NIPA 1XRJA 2W6MA 4IQFA 4N5MA 5TQ0B 1XQYA 1UJCA 1KY3A 2HBQA 2V98A 4C43A 3RUCA 1Y9ZA 1CRZA 3ZDEA 1V43A 3E84A 3FVVA 3SYMA 3NM5A 1YZQA 3EVNA 3L46A 1G2PA 5H16A 4AS1A 4Y2UA 2HRDA 3H4VA 9ATCA 2FSPA 3D1VA 3FPLA 1Z6TA 2PAAA 1XRPA 2Q3MA 4W1PA 3KSBC 5GAJA 4LWZA 4OHCA 3STTA 2GJAA 1ZKDA 1W96A 4QSHA 1E2GA 2PS0A 5KU1A 1FLNA 1JDUA 3RVSA 1XP8A 2J87A 4K87A 4PIVA 1W87A 1GL7A 1LQTA 2X77A 4FFWA 4O2LA 4EYOA 2EQBA 2JBAB 1T36A 2OZLA 2VZ9A 3GQBB 4PWYA 1ZR4A 1QR6A 1OHHD 1VJCA 4NATA 2RGWA 4U63A 4QVIA 3W9BA 1S0UA 2IEZA 1MVOA 4PICA 4F1WA 4C88A 3AILA 1UXHA 5JS8A 4E5DA 2W0MA 3EXEA 3I72A 5LQMA 5KZMB 1U7UA 3OZEA 4J1TA 4R1PA 4TVKA 4YIHA 1ZUNB 3V34A 3SR3A 3TTUA 5KO2A 4QVKA 4KAAA 3P4YA 2EKZA 5EN4A 2GX6A 3EFEA 1CWUA 4QECA 4P4TA 1NNI1 4ZAYA 3OESA 4N9WA 4BP8A 3HJAA 4G5SA 4IAOA 2P75A 1T9ZA 1GU0A 3KB1A 4O4JF 3IMEA 1DDOA 3A6LA 2OV6A 4FMPA 4M0UA 3V8VA 4NPCA 5J4VA 1ML3A 5A4DA 4JXZA 2O1WA 1IY0A 1Z56C 2IZ1A 5ESRA 1RPTA 5KWSA 3VPCA 3FFBA 1PDVA 2D1YA 2PA3A 1V35A 2C2KA 2ONZA 2XYRA 4UM7A 1WPGA 1VE3A 4C2TA 4OJTA 1J8YF 2Q9BA 2B7CA 3K70D 1EIWA 3NP9A 1QNLA 4OHWA 2D54A 1BNCA 4NDAA 1YZGA 3H04A 5FLXA 2ONCA 1PJCA 2A86A 2GERA 3PVZA 2WICA 5KSOA 4E03A 5BWCA 4OIFA 2I4MA 4DCOA 4JJEA 3E1GA 3IALA 3MOIA 4FSXA 1GJRA 4J4TA 1GZ6A 1Z34A 1QMGA 3IE0A 2X1HA 4J0QA 1LF5A 1G63A 1OAKA 1QGOA 1UJBA 3FCAA 5MF6A 5LDHA 1S8AA 4BKMA 2PTHA 3EGDB 1QVAA 1VSQA 4QUJA 5D51S 5EZ5A 4Z3OA 4ETMA 3SYNA 1HLPA 5HE9A 1NY6A 2CLFB 4HFJA 2XWJI 4MXDA 1FXSA 1D8AA 2ZJ4A 2ZRQA 4RKYA 1GA6A 5LQJA 3OCVA 2QPAA 1RWOA 2UZIR 2O2YA 4B3XA 4Z0PA 4H7FA 4F93B 1SA0B 1Q16A 3GLKA 3K0AB 2YXDA 5BNWA 5K0JA 1K68A 3VH3A 4HAYA 3R9XA 1GAEO 2YWEA 4OXKA 4QICA 3T35A 2RK3A 3BG5A 3KCNA 4OXRA 1RQGA 3ANMA 1MOZA 3BVPA 1A9ZA 1NG9A 2VWHA 1G64A 1TRKA 2ZRLA 4ZVVA 1LBQA 4NIMA 3L8DA 4XQEA 4IDAA 4LBWA 3IJRA 3ZVRA 2OAQ1 3MEQA 1PDOA 3MQFA 3PTLA 4E22A 1Y89A 1ZX1A 1OX6A 2C4VA 3ASYA 1MH9A 3KZKA 1GRNA 4YONB 2QJFA 4G0WA 4DT1B 3UHFA 3QSYA 1V45E 3RBVA 2VA9A 1AS3A 5FOXA 1O94A 1QK5A 1YULA 2FX5A 3O4IA 4KJZA 1GZ4A 4URWR 1C1XA 3SZUA 2G1AA 4F45A 4AFNA 4O2AF 4ZARA 1IBLB 3W3AH 5C2JB 3O03A 4RM2A 5BPHA 4I6JA 5JZVA 1XZJA 2HRBA 2Z6VA 1R6XA 5DFAA 2PMBA 1W36D 1SVOA 1DQRA 2F1JA 4CFSA 2OGWA 1CE8B 1PLKA 1BXZA 4RCYA 3FFXA 1W85A 4U4AA 4KQXA 1Q83A 2NZVG 5G02A 1LLCA 2JIOA 1XHFA 4ITVA 3H8JA 3JWEA 3EQZA 1D1PA 1DAFA 1QTIA 1CZOA 1HT1E 2B4TO 3CYFA 4V1CI 1MDFA 1Q17A 4RHTA 3I62A 1ZSVA 1WHTB 2QRQA 2VRWA 4HAXA 3K9GA 2CZCA 2IE8A 2EF1A 1Z6YA 4YHBA 4GMGA 4M1QA 3LT0A 4Y1EA 1Y1SA 2WJVA 5JUWA 3D2LA 4HRYA 4QTTB 2AMYA 1UOPA 1PHRA 4M1KA 1L1RA 2Y27A 2E21A 3EEYA 4OK3A 4F4CA 1KZ1A 2JEZA 4J2TA 7YASA 3NAQA 2E18A 1QFSA 4KR3A 2HO4A 2YWDA 4KOEC 1EFDN 4PSKA 3KVVA 3R40A 4IIFA 3A9CA 2WPDD 5EP3A 2WB2A 3O8OB 3GH3A 2O48X 1CC1S 1OXTA 2VF5X 2WG2A 1H1LB 2XAUA 4HGYA 3SFVA 2OBYA 2ZM5A 1NJ5A 2AJLI 2VPQA 1DX6A 3Q6IA 4YV2A 1ZMBA 3EXHB 1QO7A 1F5SA 3MMZA 3AXSA 2W6PA 3DYIA 3NWBA 1I7SB 1EFTA 4AKSA 1RZ3A 3A4MA 5EJIA 5IK2A 3FUVA 2J5KA 2JC3A 3RRMA 1BHSA 2GAJA 1Y98A 4CEIB 1JMVA 4MQEB 2XVXA 1IMJA 2Q8QA 2D1QA 1TK9A 1SCAA 3MINA 1EUDB 3CEHA 4UDNA 4AMBA 1U4NA 4O5AA 1H2YA 4P3OA 2BUAA 1VQ1A 1KTVA 4UATA 3X1XA 1E3QA 2PQ2A 3NGXA 1R4AA 2O2IA 3Q8KA 5H7XA 2ACEA 4NK5A 4AMUA 4L4YA 3WSVA 1OZGA 1UODA 2XF2A 1YJBA 3CW2A 4UEOA 3QXGA 4K9SA 3LOQA 3O83A 1BQ4A 3AIMA 2ZBFA 1YQQA 4XEUA 4BTEA 4RPJA 4PG5A 3VVBA 3STYA 2XXAA 4I9GA 2SKDA 1M2WA 3QFRA 2OORC 1QYCA 2FK8A 5A06A 2IS4A 1PJZA 1ZGHA 2X5JO 5M7EA 3TLGA 1U8ZA 1LW6E 2P5YA 2JJ8A 3O8QA 4HQOA 4QXAA 1KYTA 1GTMA 5J1TB 3LZDA 4ERXA 3LUKA 4CIVA 4E30A 5TPWA 4YMTA 1QGZA 2VBIA 4LJRA 3IKTA 4EAAA 5JJKA 1JG1A 4MGZR 5D3MB 1OWOA 4IS2A 4UMVA 5G0WA 4UD2A 3PEFA 3SC3A 1KQFA 3D4OA 4KPFC 4XUEA 2XMZA 1UXJA 3PQ7A 2GD1O 1LFDB 3ILXA 1M6NA 1TK2A 1UAAA 3IQIX 4FYMA 2DERA 3G2KA 4YMWA 5CX4A 5ALDA 3AK4A 3ZOKA 1GITA 2BWJA 3FSRA 3KC2A 1D4FA 1FA9A 4K46A 2ZVDA 5E6UA 1QU3A 3PF9A 1CUCA 3CE9A 4NBNA 1KNQA 4GUAA 4XM1A 5EWJA 5JCJA 6AT1A 5LWHA 5IC6A 3GPDG 4MUJA 4RESA 5C7OO 1KAEA 1QFJA 2WF9A 1HK7A 2VSYA 3LXXA 4ZP1A 1HDEA 3IDZA 3LXUX 1P1JA 4TT8A 3S3TA 5C7YA 5KKCA 1OVMA 2CJWB 2JAHA 3L0ZA 4G25A 4HAOA 1I7DA 1A4RA 2ZRKA 4XW2A 2PSEA 4KQFA 4S1VA 3RWOA 1A27A 3WKEA 5LOVA 3PVSA 3U17A 3W4KA 1E7RA 2QPTA 3WRVA 2W11A 1SD5A 2VYQA 3MSXA 3PR2B 3OIFA 3WWCA 1C1DA 5HTOA 3FRHA 2BFPA 2QD3A 3KVOA 3BAFA 2VT6A 1RBZA 2DX7A 3PNOA 4L22A 4MIKA 1K89A 5T4EA 3RTGA 1U6KA 3QVMA 3OURA 4C76A 4PHTA 3EPPA 5EG5A 1AA6A 4I50F 1YS6A 4ZVPA 1J20A 1AKUA 4E94A 4GW3A 1JW9B 2A4MA 2AOWA 1Y5RA 2YWRA 2R60A 4MW2A 3AO0B 1VTKA 4LXQA 3ERCA 3GC6A 1OILA 2OGZA 4GLOA 2GA9A 3FPSA 4PQGA 2QF7A 1NTOA 3CONA 4OBEA 5AO9A 2FWNA 4BOYA 4JI7B 4XB2A 2A92A 2JIZD 4X65B 1Q2XA 2WG1A 3SXJA 1GFWA 2WMOB 1PG5A 4AN4A 2DGDA 1PUXA 2HOQA 2PT5A 4I81A 2UXBB 3HJRA 3QA9A 4MRRA 5DSZA 3WSTA 3HM9A 1FZTA 4F6RB 1PQUA 2FJPA 4R9SA 4ZZ1A 2J9FA 4MI3A 4D3FA 2FEWB 4ZT7A 2G8NA 3QF4A 4UTVA 3T7RA 1ZUD1 3N8IA 3DL7A 1NULA 5JI2E 4LZLA 4Q7MB 3ADDA 2YFYA 1YR7A 4EL5A 5JWOA 3AV3A 3JAWA 3B38A 4NZYA 1XDZA 3WWZA 1UDXA 4X00A 1ZIOA 4CKBA 3BXZA 5FWXA 4G8JA 1HEUA 1Y4ZA 1KZ7B 2X5KO 5EHQA 4QQKA 1TXGA 3IQZA 4ESOA 3L0YA 3O26A 3A6FA 2ATXA 4ZYYA 5EKTA 1PZMA 1PR0A 2FPWA 1A82A 2HCBA 3CZ9A 1OF1A 3E0QA 3N2GB 3DBIA 4IIDA 2R11A 1IL0A 2BDEA 2QUIA 2B69A 1IONA 1GGJA 1P3DA 3UBTA 3BMXA 3D6AA 1HDXA 4D0GA 3ZCRA 2W6OA 1JT9A 3AEKB 1B6TA 3ITNA 1FFSA 4FE4A 3CNEA 3L7YA 4HPJB 3KK0A 1MA0A 4W1SA 3SIXA 5AKZA 5AVQA 3C3EA 3GA0A 3IJPA 3ZY6A 5I9SA 2DQ4A 2C9BA 1N7HA 1PKXA 2VP6A 3HB7A 4CXMA 1JJBA 3UXMA 1P7PA 4XR4A 2OUIA 2OSVA 1QAMA 2GHIA 2P6PA 2LD4A 3PGLA 3RS5A 2ROQA 2IS6A 4DLBA 7AT1A 3MHPA 3OFSA 2QBYA 4N76A 3F90A 1KYYA 4L16A 3H9EO 2REQB 1I24A 1WPRA 4XCXA 1NSTA 1S3GA 1J9EA 4BFVA 1NR7A 1RI4A 1DV2A 2A5FA 2QRPA 4JP3A 1C9KA 1KZ9A 2PUHA 4QGHA 3C7CB 3V3KA 2BKAA 2AA3A 2ADMA 3NWJA 4MUYA 4CKCA 1N5JA 3J81k 1TA0A 1M34E 1SBZA 3PX3A 1YTLA 4MITA 1X9HA 3ZEIA 4BLSA 2EEZA 3MCWA 4QVGA 1Y9AA 2A5YB 3GFFA 3P4XA 3VGJA 3QELB 5HVNA 3NVDA 1YQTA 2JCSA 5B58C 1EP3B 5DX1A 5IP5A 4B73A 1WCYA 4KGDA 3CPEA 2XMCA 1NVBA 4UHFA 1YDMA 3RKUA 5JPIA 3OOYA 2O2DA 4OQZA 3RRNA 4QQ8A 2PNJA 3EXHC 3JD0A 2XZOA 5BW4A 1VI6A 1RLIA 3UPUA 2NU6A 1MRNA 2IPOA 2DPHA 3LQRA 3RKRA 4BGIA 5LQRA 4J0EA 2NXJA 4IIUA 3EXG2 3T5MA 2Y1CA 3KWFA 4M9QA 3S29A 4FHDA 3ZWWA 5C32A 1P9LA 2K5UA 2XTMA 1Q0SA 5CM8B 4ZT5A 2GNOA 3DMDA 1BVYF 1HEIA 1SOVA 1Q0HA 2LCFA 1GADO 4KOAA 1ENYA 4DE5A 2IK8A 2C54A 2QE7A 3AP3A 2PJZA 3FNRA 3HYLA 4V0OA 3ETDA 3M3PA 5DT2A 4RKQA 5LZ9A 4D6PA 2ZVQX 3CSUA 2NTJA 4CKCB 4REQB 3VAZA 1Z2NX 4XPZA 4A0HA 1Y9DA 5GIOE 2OCPA 3CCFA 3VMFA 3VDXA 1GEGA 1KO4A 4PV7A 4KDRA 1K2WA 3IEVA 1EQ2A 2DVMA 2G5TA 4W9NA 4Z9XA 5BMVF 1L7VC 3LA8A 1FUKA 1DO0A 4OQQA 3FFTA 4YNBA 1P2TA 2WOJA 1IHXA 1X7ZB 1YK1A 5IW8A 5BSGA 4W6QA 1CHNA 1P1CA 2DQYA 1UDBA 1WW3A 2PXAA 2RJ3A 3C6MA 5BSTA 2LGJA 3PJDA 3ESQA 2YJNA 3VPAA 1A69A 5DB4A 3I32A 3U9TA 3LL4A 3NM6B 3D8TA 1MB2A 4AO8A 3OX2A 4L8FA 1TF2A 1XZMA 2QAGA 1O95A 2C2OA 4R6XA 4S1PA 4D4IA 3UANA 4RDHA 4QYMA 2YUTA 3ZE8A 1YHYA 2BT4A 2JL1A 2ODEA 2W93A 4TLBA 4WKOA 2D7CA 2PH5A 4W5HA 5G1OA 2IL1A 3TLYA 2QUJA 4NLLA 1VPVA 1NRIA 1PSWA 4IKOA 3STUA 4XJXA 2VP3A 3DFFA 1PS9A 1DUIA 3WLJA 1QO0A 3U49A 1ZVJA 5DM60 1C29B 5JC1A 3SYKA 5ADVA 4PSCA 4DA7A 1S5PA 5JTUA 3IAM6 1UT5A 2JJMA 1UOQA 3EGEA 4HLNA 4X8LA 2P65A 3AJ8A 4ZI2A 4Y2SA 2E3JA 1M2OB 2ODPA 4WUVA 3RQSA 1N0WA 1C3JA 4YRTA 3Q8MA 2X4GA 4BNXA 4KREA 2C2GA 5EKUA 1L2TA 1UEJA 2VF2A 4NMWA 1D9ZA 1FTGA 2ASVA 4RUKA 5IBCA 2NT4A 1YFZA 1OLUB 2A2ZA 3KXIA 3A31A 3OWOA 5LYJB 1JEQB 2QRVA 2GEVA 2CZQA 3LAWA 2A0XA 1V1RB 3L79A 4F9GA 4D7AA 1RIFA 4XARA 4ZOAA 4POOA 5KQLA 1JQBA 5B3LA 3GVXA 2IY9A 3QLUA 5E95A 4DCGA 2YH2A 4EHLA 3SP1A 2AEEA 4L5YA 2JVKA 3T38A 4PSVA 3K9LA 3AVTA 3CINA 1J8DA 4IEIA 3FWHA 1APBA 1Y1KE 2OP1A 1FCJA 4ZU3A 1F3LA 3G0DA 1OXMA 3GXBA 1KVSA 1K5HA 3RSGA 1EEXB 2HWKA 3SBOA 4F85A 3T7IA 4HX9A 4YT8A 4EW3A 2BKVA 4NSNA 2QTFA 3HUFA 2Y1DA 4NZMA 1SVIA 2QM3A 2BGKA 1KSHA 4UHCA 4MMYB 1U9IC 3CRW1 4PFSA 3A6ZA 1E9CA 4AY5A 4BVEA 4D9IA 5K03A 2Q21A 5KSWB 2OD9A 2HNBA 2QRJA 1VJ0A 1X1TA 4DJAA 3QBVA 1Y4SA 5C4IA 3KZNA 1ODKA 1U8CB 2X9QA 3R77A 4XCQA 1HRKA 4M83A 1KDRA 1KI8A 5F64A 3MAAC 5LLSA 5JS2A 1T10A 4KWIA 1XCGB 3GBSA 4O08A 1Y6RA 1RJGA 3DULA 3FKSA 1JXAA 3KU1A 2XCSB 2CMGA 4DNFA 1T8UA 4JLBA 3C3MA 2J0UA 2O8DA 3FHOA 3ROXA 1DELA 2QX9A 2VPYA 3CLUD 1GFSA 1ORIA 2BRUA 2PSFA 1CUEA 1D6SA 4HYEA 1N92A 2QYHA 3PJGA 1X2EA 3VPSA 3MPOA 1UZMA 1L0BA 1H1LA 4URFA 2ZK7A 2LKDA 2HHLA 1HNNA 1XTBA 3UW3A 1JPJA 5D3ZA 1HLGA 2Q2WA 3BFPA 2DT8A 2KQUA 5IBQA 2QTZA 2RGNA 4U7JA 3QPCA 4WA7A 1F0YA 4PBRA 3V2UA 5J9FA 3RHFA 1UDAA 1HYGA 1GOTA 2AEFA 1BJKA 2H18A 2QP4A 2YHIA 4ZRDA 4PZCA 1SM4A 4X6YA 2DKFA 3I9V1 3PR3A 3LCUA 2BONA 3RUEA 3IV9A 4GE0A 2P2DA 1PQWA 3BQNB 4WEOA 2O8CB 2QSZA 2C94A 2X8BA 3NQ41 4M6WA 5DXAA 2IBTA 3S1AA 2BZSA 3K32A 4EG3A 4XQ0A 2JIZA 2BSAA 2VI5A 5CX1A 3MXOA 5LP1A 2TRSB 1XMIA 1HH4A 5TC4A 4ZZ0A 5B1SA 2UZ3A 4DMRA 4BKQA 1E1YA 1BCSB 4FPXA 4EHDA 2UVPB 3RVNA 3D3EA 3RFCA 4MR8B 4EL0A 2XKKA 2XE8A 5DI3A 3R8XA 1J23A 4OSPA 5JPDA 2F8SA 1CZRA 2GPSA 4EG4A 2E1PA 2QI9C 4UE2A 4V0QA 3TKLA 4IF6A 3R3XA 1RCUA 3QRWA 4D0RA 2WTEA 2YJZA 3AHCA 3D1JA 1VL8A 2P3QA 3EH1A 4WZAA 1N77A 3HGMA 3UH0A 4EKIA 3NIFB 4BWGA 1G17A 3WISA 3DO6A 5GP1A 3WYNA 1XEWY 2QN3A 2WIGA 5CB4B 2UZ4A 2VKTA 3DDHA 5DULA 5ED0A 2JJ2A 5EIWA 1DEAA 4KG7A 1UZLA 3F98A 1HRDA 4HYYA 4K5QA 5TMEA 3BQMB 1ZG3A 4KB5A 4WK0B 2BE7A 1YZNA 2O7QA 1J7KA 3SHFA 2JGFA 3FSGD 1S2MA 1Y1PA 2F1IA 2QN2A 4ID9A 3T9DA 3KQTA 2RGXA 3CF6R 3QOFA 4L9SA 3GZ4A 3TXXA 3HABA 3QOYA 4NICA 4UNIA 2A1TR 4G26A 1C50A 3FWYA 1RWXA 4XYMA 4KPYA 1QS0A 2XMBA 2EP7A 5KJ1A 4GEGA 5K3SA 2ZXEA 1CDZA 3A3KA 3FDIA 2DAPA 3JU3A 4RVDA 1Q1BA 1TAGA 2FG7C 4NBWA 5E2AA 3L1UA 2JLWA 5LA6B 4ZPXA 4L08A 4FOLA 3AI3A 4TQ9A 3K31A 3S2SA 4EF5A 1IN7A 3NHBA 3ZQUA 3LWZA 3NONA 4UFNA 4YRJA 3WMFA 5K8TA 5C5DA 4WZAB 1K7CA 5AXDA 3TNLA 1A88A 2BEVA 1NHGA 3HY3A 4QL3A 3I6QA 4TV9F 2WVGA 4V0RA 3VISA 4QPCA 2FPRA 1SWVA 1RBYA 1R00A 5AI9A 2OESA 4HMOA 2C97A 3C5HA 5A5GA 4HCJA 3X1MA 1FNCA 5DASA 1EXWA 3E53A 2DKOA 3D0QA 4KI0A 3AM3A 1V4BA 1TO2E 1PT8A 4KE8A 1YV9A 1IWOA 4ZYVA 1YOVB 4FMDF 1YCFA 4FFBA 1PJ8A 2FZWA 3IT3A 3UM9A 2V7PA 4LJ7A 1MQ8B 4BNDB 4TKUB 4IUBS 4JU8A 2YRWA 1XL0A 1E0KA 2VSOA 2H7CA 4HB3A 4L4ZA 3RPEA 3B3GA 3X44A 2A9FA 1YB2A 3KPWA 5E6UB 5IMBA 3RGGA 2ZI7A 2CL7X 4KO4S 3U7QB 3WHKA 2XBMA 3U7HB 4WX2B 1VSBA 5DNDA 4C7MA 2VQDA 1E1CA 1SXJE 1WU8A 5CTAA 3X1KA 4XE5A 2FX2A 1XI2A 2PAFA 1FX0B 1JQ3A 4DMFA 4KQGA 5I7SA 2DEUA 1HYQA 1X6VA 3FNFA 4MO9A 3IGFA 3EAFA 1JDSA 2ZS7A 5I7VA 1NXXA 2PD4A 5BWNA 5I51A 1QH8A 2H9AA 1A2BA 1QOPB 3OPYI 3P52A 4N6NA 2X6QA 4LAFA 4KAJA 4WI1A 2C5SA 2MMCA 1HXHA 4UDXX 2CNNA 3NHSA 4CQMB 2ZJ8A 1T0HB 3DE1X 4U7TB 5CLQA 5B1IA 4EHHA 1A4IA 5CEEA 3FM9A 1JSZA 1W75A 4IO1A 1NJGA 4GC9A 2PZ8A 3QPBA 3F97A 3UQZA 2PU7A 4V0NA 3RVPA 5AKJA 2PCLA 3RHZA 1NVDA 1TJNA 1XK6A 3VR6H 5IT9A 2CHQA 2CYCA 5C7IO 3C24A 4X9XA 4D9MA 4FLEA 3IIKA 5E4JA 3OZRA 4QTYA 4EKYA 3WWPA 1CQJB 3KWLA 1DFHA 2BKEA 4V0MA 1AK9A 1U7TA 2VTVA 3W04A 1II0A 4A8JB 4Z2AA 1L4NA 4M8IA 4L4RA 4R2IA 4LZZA 1YJQA 3DVLA 2ZUCA 4RGVA 4QDXA 3OLCX 5KYWB 1F9EA 1LVHA 3E8MA 4JKIA 2WWYA 2ZUDA 2PS9A 3PXDA 1J0BA 1XC7A 5D8DA 3ZV3A 4P0QB 4B4UA 3G8BA 1MO2A 1SC6A 4ZO8A 2IY7A 4OMFG 4PLFA 1XG5A 4WA8A 2Z3VA 2IKQA 1XLTC 4WKGA 1Q1NA 3GRAA 3D6HA 2QOEA 4YJHB 4H6PA 5C1PA 3OWHA 1M5RA 2UUAB 3N74A 2G3YA 4WBNB 2XVZA 2H0QA 2QA5A 5EIBC 2CLEB 2YIMA 2ZP1A 3FLAA 3ME5A 1WKVA 5HKKA 5GJWC 2KM1A 4EG7A 1DNPA 3C1TA 1GU1A 1O8CA 5I7UA 1KH1A 4J07A 1QV9A 4UVDA 4REMA 3HKBB 3KKNA 5D00A 3RREA 1BDHA 4OHYA 1D0SA 1D0VA 1GT91 3RUDA 3G0BA 1FK8A 4I14A 3D64A 3HKEB 4XVHA 3KD3A 4N8DA 3LY9A 1R18A 1SO8A 4UE6A 5DN6A 1QQ5A 4ZYWA 2F6RA 4A26A 4CCSA 2IZZA 2CVZA 4B3MB 1EVEA 1GFZA 5A1JA 1XRMA 4DIMA 4D9HA 5IAAA 1DFGA 3FGZA 2A9JA 4EJFA 1Z74A 4F3TA 5HE8A 2IQ5A 4OJYA 5EJ9A 2WJZB 3MBIA 4JYZA 2ZZKA 4U3JB 5AW7A 1MLDA 2JHAA 3CR3C 3Q3JB 1D2MA 2ABWA 1DIAA 2NSLA 4FDUA 1E92A 3CRMA 4LXTA 1DRWA 3FZEA 4R9UC 4RJTA 3TW8A 3NHFA 4KGZA 1SQ6A 4JVNA 4OKIA 3DDCA 4UM8B 3KP1A 4Y1GA 5CGZA 5BW6B 5BMVB 3OH8A 3V8MA 4MQUA 4Q05A 721PA 4PC6A 3U4DA 4DA8A 2C0QA 5JZMA 1OKKD 4MRSA 4PEVA 3VI4B 1G18A 3GGPA 2GM9A 1IN8A 2Y0EA 4BJ5A 3IPAA 4NQRA 5F5XA 3SOPA 3KFXA 5EPUA 4HWKA 1Y6ZA 2RHDA 2X1MA 4M7PA 4M54A 1BN6A 1LPBB 1HE1C 1E2MA 1CUIA 1DADA 1FFXA 2YIDA 3CX3A 3PFCA 4MDYA 4WOBA 3MCZA 2CUNA 2F4NA 3H2ZA 3IILA 4WXRA 4BB9A 16PKA 4M3NA 5AKLA 1U28A 1V3TA 5D3QA 4ZQEA 2OXEA 3DZBA 1U3DA 1UFVA 2Q29A 3FYSA 3Q87B 4HWRA 4RD4A 4U9HS 5CP8A 5EHIA 3WBJA 4DLVA 5LQCA 3KJIA 1X1SA 2BEJA 3C98A 3NHPA 1U8UA 5DRYA 1BMTA 1YJ5A 4C3OB 5JVDA 2C7GA 1L4GA 1Q0QA 1V3UA 4EW6A 4OM7A 1LV7A 4RTNA 1JDJA 3GUVA 4XSGA 3QE3A 4FOSA 1DBPA 5B1DA 3U62A 3DB2A 1A98A 3NHAA 3OZXA 3LVFO 4ZODA 4E14A 1Y3HA 2B8EA 5P8WA 4YMUA 1ADBA 1VIDA 2NV0A 3BJZA 4F9FA 2RHGB 3T9CA 3ZDFA 2D8MA 2A0YA 3DLTA 2ATVA 3ZQ4A 4CDGA 5BWBA 3VU3A 1MV5A 3IP5A 4K9MA 4Q6BA 5HGJA 3I0MA 1O6BA 3R9KA 3FUUA 5SY9A 1FSZA 1TVMA 7REQB 4J8PA 4WJKB 3I8XA 3AM5A 4G1FA 4OA8A 2PUCA 2QUHA 4XRRA 1SXPA 2ZRIA 2ZB7A 2F3RA 3BA6A 5ALFA 3OI7A 4NF2A 3OLVA 4KEAA 2G71A 4NH4A 2WZQA 1RE0A 1R5OA 4QT4A 4FEEA 4DUYB 1G41A 1QS0B 3RUFA 2B5VA 5JH7A 4LTMA 4ZVSA 5J2TB 2Z2ZA 3PFGA 3ZHXA 4INZA 4HWTA 2EGHA 1PGQA 3TXAA 4L8VA 3HCDA 1CP2A 4UAJA 2WD8A 1Y6QA 3O8OA 1H69A 1KEWA 1PFGA 1OCEA 3MJVA 1Q3HA 2IXFA 5U4XA 4ZEVA 1QF6A 1LDNA 2FDRA 5MFPA 2J9RA 3QPUA 2C4KA 3NBUA 1NZDA 3USCS 1HPLA 4BNZA 4YXFA 2JEOA 2XKAA 3EZGA 3GXOA 3MGKA 1ZI6A 4D8UA 4FBMA 1BGWA 3BTOA 4L2IA 1CUFA 2C3UA 2UDPA 2V0NA 1T8PA 3A3OA 3H9QA 3NAZA 4DLPA 3WAGA 1EUQA 4H17A 1PU2A 4GXTA 1K27A 5HKOA 1CIVA 3CRZA 4IQGA 2QZJA 1WP9A 5L7YA 1C9DB 4EMBA 1CUWA 5CA1F 3DLHA 4EUHA 2OVBA 5HF5A 2VQSA 3C74A 5F7OA 2W2KB 4FC6A 4QTZA 3CVWA 3WADA 3P0JA 4E4TA 1QYWA 1U3FA 4PZPA 2VPWA 4WFIA 5SYNA 4JBNA 2XUJA 2PY6A 3MCVA 2BZ1A 4KV9A 3PYLA 4Q82A 3CZPA 4A6XA 2NPIA 3UUEA 5F2NA 4H27A 4ESEA 2ZTUA 5KWVA 3HFSA 4U7FA 4UVEA 4M8KA 1G2IA 1T4DA 5DXJA 1KZ4A 1FDRA 2WQZA 1COZA 3LI2A 1O87A 4LSWA 4ECEA 5CDTA 3IXMA 1JEDA 3LOUA 4B1FA 1DB3A 4GSYA 4E5UA 4AUKA 1RAIA 4LJAA 2ZSKA 5I7RA 4AYXA 4CIAA 1Z16A 3F4LA 5FA8A 3ZJYA 4G65A 3T94A 2B82A 3GH1A 3UC5A 5LA6A 3H42B 4DQXA 3O3OB 1F17A 3IEUA 5TF4A 1G8HA 4WPGA 4Z4HA 1XAJA 5TQ2A 2K2QB 4UPDA 4C21A 1RSZA 5D3MA 4DDVA 1RRGA 3M70A 4RCVA 2PUEA 4QLAA 5KVAA 4G1MB 4YQYA 5H9WA 1JIXA 1FDUA 4CCWA 4EB6A 3EK2A 3L1HA 3ZQJA 4ONEA 5DTJA 4N5HX 4Q37A 4DSNA 5C8DA 5BN5B 1SVWA 3CURA 1SN7A 3JV7A 3NO4A 4P84A 5IAOA 2VATA 1ZVKA 2Z0MA 4ZOBA 5LDDC 1GTSA 2XAAA 4XD7A 3MJDA 4JLVA 3MYRA 4DIUA 4YHHB 2ZAMA 1GZVA 3IAS6 2O2ZA 5KTTA 4NBUA 1ZU4A 1KJIA 3OE7D 2DWOA 3EIEA 1ULUA 3OAAD 1FX1A 4HH3C 4W5RA 1TECE 3MUEA 4LECA 3WIVA 3A1SA 4LTNA 4IP0A 2EERA 1ZK0A 3TRDA 5TRTA 2IHNA 3OA0A 4D80A 2BBOA 4MYRA 3OZGA 1D3AA 4A27A 3AVYA 1DX4A 4BAGA 4ER5A 2IX9A 3CS3A 3AF3A 1XEAA 5EVJA 3L07A 3VOSA 2MU1A 1VKNA 2V9CA 1ZA1A 4FZRA 2HDHA 2W2LD 3T4XA 4B2PA 4WLOA 4FQ5A 5KJEA 2GFQA 4D9JA 1HYEA 4ZVOA 3SQLA 2C0PA 1ZH4A 1DJQA 1FFEA 4QU8A 1U8FO 3G2JA 3SLGA 1AKMA 3O0TA 5EL0A 5DV9A 1EFHA 3N75A 1XRSB 4MULA 4IOMA 4ISCA 1Z22A 1DVRA 2AYZA 2XPCA 2WF8A 1DV1A 3COZA 3WK4A 1A7AA 3PDCA 1G20B 4OO3A 3T61A 1JJFA 4XGIA 3S40A 2AMFA 1QH8B 1ARZA 1RYYA 5EJ6A 3QY9A 3WWEA 4I4NA 1ECCA 5EMMA 2Q6KA 4DGQA 2O8CA 3Q7EA 4RELA 3UHPA 2RG7A 1HY3A 4FYIA 1PBTA 1HFEL 5AJYA 3ZGNA 4WZZA 3N59A 1DEHA 3OHPA 4C20A 3PQCA 4E08A 1WSWA 1RLUA 1VBMA 4OHKA 3BFJA 4FK8A 2W00A 4YYEA 3ELBA 1A0OA 3OX3A 4AF6A 1FNDA 4C6HA 4ARIA 2VHWA 2X5XA 4LJ9A 4M87A 3DBOB 1KMIY 3ZK8A 3GFRA 4N7BA 4QXMA 4C2UA 2E82A 3UOWA 1FSFA 221PA 3KBBA 1OH8A 7MHTA 2JG3A 1YOVA 3QTTA 3HH8A 1WU7A 3OJOA 3WZ2A 1BH6A 3SMVA 4CMKA 1KI3A 5TEVA 2GILA 2Z4SA 3P19A 2WTMA 3IV7A 2ZBPA 2ZYAA 2OYSA 4JLDA 1S2IA 1DRJA 5AR1A 5HBGA 2WNIA 4BFLA 3SNHA 4A0RA 4B75A 1NQOA 1TAUA 4RPIA 3GLFE 3KKZA 5IYZF 4KDCA 4C29A 4KK4A 2VFAA 3QA3E 3UIEA 4QM6A 2CNWD 3GROA 4G1CA 5B53A 4C7VA 3U80A 5KQRA 3GEEA 1IVNA 4BXOB 1UDCA 4JDUA 3F6CA 1X7ZA 2OLJA 2VDNB 3A11A 4MVJI 3DTVA 5H02A 4LDJA 3ORYA 3VOAA 4AG5A 2AZDA 5CW1A 1C8KA 3WB2A 4RTSA 3E61A 2I22A 3F74A 4H1HA 4EKDA 1T6ZA 3M6IA 1FVFA 3PXXA 4LMBA 1RRVA 2I8CA 4PNZA 5I8WA 2C5LA 1G66A 2WUDA 3KTOA 1Z5UA 1BEEA 2CKDA 5B3JC 1C1HA 2XUKA 1QAOA 4WLVA 3SS7X 4KRXA 1JHVA 1G7SA 1GKIA 1KKMA 3FUWA 3KUXA 4JKYA 4N0PA 3QYJA 4OGWA 1P0IA 4X7RA 3PXCX 2YW2A 4AN1A 1CQIA 1Q22A 1XMXA 3JQ6A 4GRDA 2FK7A 4OP3A 1RCTE 1ZCBA 2XECA 5FTJA 2WLTA 3UZUA 3ZLVA 1DO8A 2GN1A 4MQ4A 1LY1A 3WLRA 1NXTA 3NTQA 4HNAB 2ZRFA 3CNQS 1QQBA 4BX0A 3U61B 2P11A 1E60A 2P2SA 3KUKA 4FGUA 4LYYA 5JFTA 2HSEA 3BRWD 4GOJA 1P8AA 4KCGA 3WRWA 1U2GA 4KW7A 1V4VA 3AI1A 2NP6A 2P9ZA 5M3BA 4EYKA 3NVMB 4D6XA 2B3DA 3USES 2B25A 4P83A 1DEXA 4PTYA 2DR0A 3RS2A 5HDQA 1EGHA 1XUOA 1GKYA 4QFMA 1I4TD 1XIVA 1E1QA 3FXAA 5C51B 4Z4QA 1ZZEA 2XXBA 5AW6A 4FKZA 4GQIA 4EMTA 2BH2A 1EI9A 4PYNA 2W4QA 1QFZA 1BN7A 2X2PA 2GRAA 4M89A 3JVDA 2BP7A 1J0CA 1L4LA 2JIQA 1MGPA 1YXMA 2FWBA 1A8QA 1CHDA 3UMJA 2QN9A 1IPHA 1MEEA 1C4XA 2O2EA 2JGAA 2VPXA 4JBYA 1KO7A 1KPHA 3WL3A 1P2SA 4QG7A 4O4IA 4DR4B 1WSAA 4LJSA 3ZNPA 1WRBA 2FP3A 3L77A 5U9CA 5EMNA 4ZMRA 3TN7A 1I2MA 1EGMB 1FY2A 2Z56A 2GZMA 4X7MA 2FLKA 1YMVA 3KLNA 4FB5A 4ZYUA 2R1VA 5BR1A 4YTEA 3DKPA 2EHDA 3LGAA 4NYMQ 5DBFA 5FX2A 1MD9A 1R5JA 2D59A 1NVXQ 2Q8NA 3I9JA 1D2EA 4YJGA 1O3YA 2B35A 5CR9A 4F5WA 5LMUB 3LX8A 1P18A 1KI2A 1TZMA 1XCMA 1ZCJA 3PFFA 4YDHB 3SJUA 1V7QA 3C7AA 3UQYS 2D2EA 5BVHA 1H66A 4I1SA 3HRKA 2G0NA 2FW7A 2RHBA 1FFWA 2ZREA 3L0OA 1SCDA 1JDVA 1KJNA 2BLNA 1XAIA 3H84A 4LXIA 4ZREA 3RQIA 3FTCA 1O96A 2ACKA 1AUVA 1D03A 4JYMA 3V8BA 2A5LA 3GK3A 5L3VA 4L4UA 3P0FA 1H8ED 1UC4B 1JI0A 3F96A 2JGJA 3ZHSA 4UVIA 1XMJA 5CDSA 1US8A 1YMUA 4OK6A 2XCUA 2FZCA 2HHAA 3IRVA 2W2PA 2CXPA 1HL3A 3HV0A 3PZBA 5KHAA 5BPFA 3ZS8A 3ZH2A 3DUFA 1Z62A 4QHTA 6ADHA 2G1PA 4YRZA 1ZPDA 3AR3A 2IPLA 4EIWA 3Q7PA 1SC1A 4KLCA 2WHXA 3GB9A 1VG9B 3NTVA 4QE3A 1DDIA 3U13A 5KINB 2ES4A 2Y1GA 4NE2A 3AWDA 5L6LB 3EC7A 5EXXA 4M7WA 3HYRA 3YASA 1R0ZA 4DIOA 4J16C 2GRUA 4JJKA 2Q4DA 2OOKA 1IMOA 4ZXPA 2PYZA 3K9WA 2QNRA 4NFLA 3I92A 4X91A 3HCBA 3WX0A 3A04A 4BGEA 2ZYVX 4CQJA 5LU9A 1QU2A 2AG1A 3EWIA 3IP1A 4MKRA 4DADA 2PUFA 3ROMA 1LVUA 5JAIA 1L5NA 3R9WA 3P71T 3ULKA 3WGMA 4ETWA 3RG2A 1Y0BA 3EPKA 1C7RA 3AFGA 3IA7A 4GS5A 2W2OA 1OFHA 5AW9A 3ROZA 3O6VA 2IPAB 1NG1A 3N7AA 1R8XA 3T4UA 4BRZA 3QVXA 4UCXA 2OFFA 1QV7A 1U1CA 3ML1A 3EVCA 4P5EA 4Y0AA 2Y2VA 1LJ8A 3D3WB 4FR0A 1RAAA 1ZGGA 4ZZIA 1M83A 3IRUA 3R4CA 3OPXA 1LC0A 4NC9A 1TE2A 1P80A 1Z3IX 3CPSA 4L73A 1N3YA 1L8AA 2GBPA 3JAKA 5KAPA 1BD4A 3AESA 5PNTA 1RWWA 5JAPA 4Z86A 3VKUA 3BWVA 2P1RA 1FPQA 1AZSC 4B7AA 4F8EA 4IDGA 2ZYIA 1U4SA 4RNDB 3ZCSA 3AEKA 1SBCA 3ZY2A 1JYFA 1RAHA 3MHTA 3UGQA 1KBZA 2MMGA 3WQQA 2JASA 3GQBA 1WDWB 1JI3A 5FB3A 4D3XA 4EYQA 3OD5A 4E5VA 3DF9A 3SDSA 1P5FA 3J7TA 5E7IA 2VRCA 5CD1A 2CK3A 1JPNA 1XLVA 2B9VA 4MUNA 1MTOA 2BVNA 2Y3IA 1NM5A 2GYWA 3K2EA 2BSXA 3MW8A 3MXTA 4F46A 5AJWA 5CDFE 1CR6A 3VAAA 2VP2A 3F67A 2REXB 4NU5A 4GPBA 2NO0A 1JG2A 3LX5A 3QUSA 4B45A 4P4UA 2QT0A 2QL6A 4AP9A 3A1WA 4BQNA 4RY9A 2YV1A 3CLVA 4M99A 2UAGA 4QJ4A 2FOXA 1A7UA 1SVUA 5I6DA 2EWVA 1CNMA 3P9RA 3OIUA 1GEEA 1FRQA 4XWKA 2H2AA 4R2JA 3Q3IA 4M88A 1HE5A 3ZNQA 1BVUA 1Y9JA 2W2LA 4DV1B 2EYQA 3VV3A 2H07A 2JAOA 1J2UA 4JXXA 3HA7A 2VKQA 3B7WA 3AB3A 1NKSA 1XHLA 3HR7A 4JB8A 1SURA 4R9VA 1BGXT 1W30A 4TTTS 5JSZB 4L74A 1AD2A 3IMCA 1X7YA 4YAUA 5JT1A 5EIEA 2F43A 1B6RA 5T4HA 1EHIA 4JYCA 5CG1A 4TTPA 3ED5A 4FSHA 4ZOEA 4BVHA 1V16B 3E2MA 5EZSA 1XFDA 4MYHA 4X54A 4G9EA 3TSCA 4MCHA 3EPHA 4X97A 2AKEA 1KKLA 4QYXA 4TTAA 3RTAA 2P9JA 2P62A 4YAFA 2J59A 4PX3A 2ZJFA 5JJIA 1EK5A 3RVDA 1SEPA 4MRMA 2IU6A 1PWEA 4CEJA 3KOYA 4O4JB 4RJLA 3KBOA 5JI3E 2ET6A 1XKLA 1SZJG 2NTEA 4FXPA 4LZAA 4M49A 4OK5A 5F1YA 3HB1A 3WL8A 3DC7A 3NDIA 1KF0A 2D0PB 3K6JA 5K6RA 4Q39A 5TQJA 3RSHA 4TXJA 1CUBA 2ZYTX 1R50A 4RE6A 5IZCA 4NAVA 5A3QA 3G9QA 2YTZA 1HFKA 3ONVA 5JWRA 1IN1A 1QF9A 1ZAKA 1ND6A 3O95A 1AKRA 2VBGA 5MFZA 3DB1A 4M9XA 4V3BA 1VIMA 3ABSB 1Y8RA 3VSDA 2HK9A 4P98A 2DFNA 3OKFA 4FWTA 1CLEA 2YVLA 4LHEA 3AG5A 1P5HA 1WXFA 1AA9A 2WTAA 2WHPA 3IQHX 1A4XA 4WCVA 2ZJBA 1IBCA 1ZOPA 2BV3A 4ND7A 4B4VA 1V7PC 2OD2A 5F3RA 5B4VA 4BY9E 5A9TA 1E63A 2Z5LA 3LDGA 2WAXA 4IOJA 3RUPA 1UBUS 5A5EA 4EA7A 5LSAA 2X1LA 4TT3D 1N7JA 2ZBUA 3ZW9A 4QAQA 1XZEA 4CODB 3MRXA 2DCUA 2DFPA 3R7NA 3VZDA 3FMFA 2IRWA 4HPWA 3REOA 2XQVA 1EXDA 1KC3A 1E3SA 1AH2A 1GUDA 4Q1BA 4B7CA 3FF1A 1TUEA 2YZ7A 3L84A 4MS1B 1DIGA 2AN4A 4OFZA 1EVKA 3WAKA 3M1LA 2XE4A 4KPEC 2MYNA 2ZE5A 4X64B 1B14A 2RK6A 3JX9A 1WXQA 2ZSAA 4OP2A 4B34A 2D8AA 2BDTA 2Z1MA 3OY7A 4MCJA 4PCVA 1AGNA 1A9XA 3U09A 1VDMA 4Y6QA 1ACMA 1EZZA 1PT6A 1T13A 4FJ1A 1UJMA 2ZQZA 3HCRA 4GPIB 4KVZA 4YLGA 4YWHA 1T9DA 1XWIA 2F1HA 3EIOA 4D9CA 2VSXA 4E51A 4GPD1 3U60B 3IJEB 2I4RA 3ZHRA 1ZD3A 3LO5A 2AYXA 3HEMA 4HGNA 3KR9A 2OHFA 5IAKA 1HNXB 4TLCA 3SJ7A 3ZD7A 3CZMA 1M3SA 5CNMA 1ZSYA 1JILA 4OLHA 2YWGA 3RFUA 4FQ8A 3TM4A 1KJ8A 3ODPA 1AUPA 5GV7A 1LTHR 1STOA 2VHJA 5I45A 4PFJA 4L9WA 2IE0A 1T0PA 3CLRD 1SPBS 3CO5A 3O4RA 2YMQA 1ZESA 2H59A 3H5IA 4TWBA 3TNJA 1XB2A 3RAEC 1R12A 3ETJA 2RSLA 3R9XB 3TMKA 1UZNA 4TKZA 4AZ3B 4UDOA 3HCPA 4HQLA 4BB6A 1VPTA 3A1VA 4XKJA 4RKEA 4FBLA 4DRZA 4KZPA 1HTBA 1MB9A 2PKQP 1F5NA 3MILA 4QSMA 4Y2QA 3MRTA 3OZVA 1U0NA 2A94A 1YH3A 2Q49A 3TQSA 3ZDAA 3U7FB 1DXHA 4F4UA 3L4SO 1R6TA 1NKVA 3KEFA 3CUEF 1Q92A 2FFJA 3NUZA 5YASA 3U3OA 2IXTA 3WTCA 1JXQA 1N7GA 2VHVA 1EM6A 4BGUA 2G5PA 1GPWB 4K05A 4JBLA 1V2HE 2GZ3A 1INLA 4BCBA 4EP1A 1NQXA 4JX9A 1UFQA 4CR6A 4BFUA 2ZGVA 4KN5A 1YZHA 4F3CA 1T6BY 1SCKA 4QOEA 4TMFA 1WR8A 3ABIA 3DBHB 3TRHA 3OA2A 5BP7A 4QGSA 5KOHB 1QG6A 2M6KA 4F5DA 3PHCA 1CFJA 1EXNA 4X62B 5JAHA 4BX8A 3LSTA 4EY3A 1NDHA 4HNHA 3A9VA 1SKYE 2OA0A 3GOQA 1NAHA 3V32A 4G1BA 4R41A 5B3JA 1S7GA 3C3DA 3BPSA 1GTG1 2R25B 4R3UC 3L0CA 4C08A 2DHCA 3KKPA 3R20A 4FFLA 4WKBA 3FF4A 2PUTA 2NLOA 13PKA 1ISMA 2P6MA 2Q3EA 3DSRA 3HB4X 4FFRA 4IV8A 5IT4A 4WFKA 4ZU6X 3IEXA 2YWFA 3L9XA 5K0GA 2R751 1CNEA 3N8NA 3IVXA 3RIMA 3FFAA 3CZ5A 2ZOSA 1A4UA 1JN0A 1RAEA 4TROA 3S5JA 4C06A 1AZLA 4FYKA 1NN1A 4DXDA 1P2BA 4HBGA 3IEKA 3DZIA 4F5EA 3AKZA 1JFVA 2JS7A 2PIAA 3HXOA 2XBUA 1L4HA 4E0BA 4KXQA 4BIIA 5EZQA 2P91A 3U4AA 3C41J 2YYZA 4QFCA 4F5YA 3WKCA 2VJOA 3VR3D 5A7GA 3F5SA 3DE5X 4OXQA 1NF9A 2NAPA 2PL5A 3O8CA 3LT1A 1VXRA 3QE4A 4PAGA 2XUQA 5FLYA 5HMMA 3RIEA 4Y1RA 3VZPA 5AQ1A 1KH2A 3CG4A 3S2GA 2RGEA 4JFRA 3JW8A 5BQPA 3L8GA 3QK7A 3GZNB 3S55A 4QBHA 3PCXA 2QG4A 3EVDA 3N2IA 1FXUA 4PPGA 1N5KA 5DNWA 4DZZA 1MG5A 4Z3KA 1O5OA 4GDFA 4FP9A 1EMDA 4GQBA 3EODA 2VYVD 4JL8A 4KFCA 3F7NA 2FOLA 4JJIA 5EXEA 3LCCA 1U5CA 2BLLA 1SCUA 4MEJA 1P1RA 4XWTA 3AL2A 1TU4A 2B0JA 3GY0A 1GQFA 2C92A 3AT1A 1E2KA 4HC4A 1PW5A 1OV6A 3BGVA 4L0CA 5FI5A 4F3RA 4ZN6A 3BD7A 1B15A 5FUMA 4Q7JB 1RHJA 5JEEA 2Y9PB 1KJJA 4JS0A 1VYTA 2WAYA 2C29D 2PN1A 3MM4A 1ID8A 3W5HA 1E9VA 2P4SA 5EA2A 4J0IA 1SIOA 2PBZA 2WT4A 1F2DA 1P45A 3AUKA 3EUWA 2LVBA 5ER9A 1I3LA 3EEFA 5TB5A 3OMWA 4DBZA 3ABOB 2ENUA 3SC2A 1GLNA 4X20A 3UA4A 3Q3CA 4JR0A 2FSIA 4LUCA 1E3LA 1HG1A 5J4KA 1T5IA 1PGNA 2FR1A 1MH1A 2WTBA 1RHKA 3E7DA 4G0ZA 4JC4A 2YWCA 3HXKA 2HMSA 5JSYA 3UHJA 1RHMA 3UN1A 4MWGA 1M33A 3EDCA 3SQMA 2D62A 1CZKA 4AC9A 4B76A 2BMFA 1N2SA 1QXSA 1IRXA 1SUCA 3PUVA 4PNHA 4CM3A 3M81A 3USZA 3J80A 1K9SA 4PC1A 4W9MC 5CK5A 2PR2A 3ZGXA 1JKFA 1KI7A 2XWSA 4KDFA 3H6KA 4AZ0A 1KP9A 3GLGE 1B26A 1X1DA 4TYQA 1OTHA 2QZSA 3SBEA 3VOBA 4ILEA 3S1LA 3TDMA 1XDDA 3N2KA 3FRJA 1FMLA 3DDZX 1B8PA 2BEKA 5G4KA 5E9QA 1VLJA 2PV0A 1ZLXA 1X1RA 2H4YA 5AVWA 2PNFA 4RQTA 2JEYA 2XVMA 5CAEB 1U2DC 5ARCA 1N2GA 1MEOA 3L4JA 2BHTA 1E2NA 3AIIA 1S6YA 5JANA 4Y7DA 1FRZA 1COWA 1JHDA 2C04A 2C5FA 4CM9A 4RGBA 3CEAA 3HDGA 3WWDA 3G7UA 2JH9A 4YCCA 3VQTA 3E05A 5LZ7A 1V7CA 3IT2A 4G01B 5JFOA 1YI1A 3WGIA 2II6A 4ZDKA 2IELA 4AVYA 3F6PA 2D7JA 2XTZA 4BRUA 1Z73A 4FCTA 2GXAA 1OZFA 2VRCD 4AP6A 1ID1A 3JQGA 1PFWA 3OIDA 2YASA 4KXUA 3RC8A 5AHXA 1NVUQ 3OU2A 2GBLA 4N41A 2YWXA 4Q01A 1NI4B 5BV0A 2FKAA 2QB5A 1XVTA 2BYTA 1J70A 2BMAA 2CFRA 4G4GA 5T8KA 3IAS1 3HN6A 4QJIA 3TNDA 4NENB 4EYGA 3K92A 4EUKA 4E13A 2RH9B 4DY4A 2FRDC 1V6SA 4DDMA 3ABZA 3ORFA 2QR5A 2X2EA 4E2YA 1KS2A 2ZE7A 4F38A 3IMFA 1F2VA 2CJYA 2P9BA 2VHXA 3P5BA 3QLUC 4RLSA 3VZCA 4J03A 4NCKA 3V33A 1VSTA 2CD7A 4AO6A 1LQUA 3AFOA 1W88A 2QVCA 1G3MA 1PJQA 1ZBDA 2NIPA 2QMOA 3WO0A 3SS8A 1C9YA 3WGOA 4NARA 1CUYA 1CF9A 3SPXA 4ALMA 3ADCA 4Y2HA 5JNSA 2Q2QA 3D5QA 1XDBA 2ZI4A 3NH6A 3OEHD 2LZ0A 3Q4GA 1IWPB 4WNIA 1L9KA 5NULA 2R96A 4M1SA 1G291 4M60A 1KFEB 5DLDA 3L40A 1M0TA 5A5VA 5JCZA 4BWVA 2XITA 4DFDA 1B2LA 4NPHA 5SICE 4MKZA 4CM5A 4R1OA 1A2QA 4CG3A 3D6TB 3HS3A 1NAIA 1W5SA 1C9JA 1ZINA 3NAGA 1K4KA 1W59A 3ZE9A 1EFVA 5AJTA 3D81A 1FP1D 1W5EA 2WKQA 2ZPTX 3PLNA 1W35A 2B1IA 4IW3B 3TUIC 4AJ4A 5H3LA 2BGRA 3FPAA 2DFDA 4RAQA 1ECPA 1PF7E 4EB3A 1JYEA 1XTUA 3PHGA 2QT9A 4N3NA 3D7NA 4Q12A 1DFIA 8ABPA 1GNRA 1LBHA 1WDTA 4JENA 4IWNA 4U5QA 3SF8B 3WHLA 2MDTA 1JE0A 4CHGA 4YMGA 5BUCA 5IEJA 1Y42X 1M2VA 2WVAA 4JLWA 1Z4JA 1OGIA 2GAIA 2W2XA 1E98A 1XQXA 2IPNA 3OZFA 4MB0A 5FNZA 3VR4H 4DEXA 1A7KA 4PAOA 5UKDA 3Q5GA 3COJA 4LV5B 3RVMA 3M4JA 2BFFA 2NSHA 4LHXA 4OSEA 2ZTVA 1GCGA 4FJ0A 3OF3A 1GA4A 3QBEA 5DGIA 3BICA 3LYUA 4BLWA 5JAUA 2C1XA 3W7VA 5D1HA 4KX5A 3BIWA 2ZFUA 3ZE6A 5A4IS 3OTOB 5FFFA 4OLJA 5CHYA 3PFBA 4DJEC 2WIDA 3GVIA 4L6IA 4E09A 1P0CA 3AUTA 3FJ1A 5B1YA 2FZ5A 2B1JA 2XCQA 4BNNA 2XGJA 3R7WA 3QYFA 3ONFA 1YRYE 4V03A 1KXJA 1P7VA 4HFMA 4IQ4A 1P2DA 3WHPA 1KEKA 1V6AA 4GOKA 1VKRA 2O2SA 2ZIWB 3TRJA 3EPRA 2XUGA 1OKKA 4RA9B 1Z0JA 3BXHA 1IM2A 1VIYA 3B8HA 3NYQA 5KNDH 2HA2A 1IJEA 2B98A 3F6YA 1LDYA 4UEKA 3LSYA 4M0MA 4XWYA 1LWNA 1TZKA 3BIXA 4ATNA 2ZRPA 4TWIA 3Q72A 4OD0A 3OFVA 3KTAA 2I33A 3F9IA 5HCIA 5CDHA 3FZGA 4BZWA 2WSSD 1RC1A 2ECPA 2CWWA 4EVIA 2JLAA 3LHKA 1DHRA 4CQLB 1ESDA 2Z9DA 1NVTA 5BT8A 1PZFA 4N5NA 3B9RA 3ETLA 4H16A 3FI9A 4FSDA 1B8OA 3TX2A 3V7FA 3ZDQA 3ZUGA 4F86A 3C3KA 2C9ZA 3QQ5A 4DM3A 4J75A 4WKPA 3QE2A 2R66A 4M76B 5CNIA 1TPYA 4YP5A 4DWWA 2YY6A 3IVGA 4IJUA 5JS6A 4WLEA 1EFAA 3DQZA 1T6NA 1Z88A 4Z0HO 1L7RA 5KWEA 4HFNA 5JD4A 2O8EB 3ENZA 1NVFA 1Q0RA 4FWBA 4GSLA 4QU5A 3W1WA 4GM0A 4YMSA 3ZHYA 2B2NA 4QRHA 2BBSA 4OXNA 1CRQA 4LBZA 3AUXA 4F3NA 1KOLA 2JI6A 4KU4A 5HKLA 4ITUA 2PV7A 3C5EA 1JR6A 1NT4A 1BWPA 3GDFA 1TEHA 3HDYA 4UUOA 3TGWA 3WJ1A 2FZ4A 4Q4HB 4O1IA 2JA2A 3N3AC 4TQAA 1DBRA 3FAZA 4RZ2A 4X1OA 4CLOA 3UJ6A 5E1OA 1BD3A 3A4LA 3F5DA 5D5PA 2X4LA 3DYBA 3SXUA 1GP2A 1N5IA 4YCNA 2CMDA 2P79A 1G9SA 3M4XA 5KQGA 3H99A 1W8IA 1G5PA 2IXEA 3BDAA 5E6RB 1L7OA 2AB0A 1B74A 1DUVG 2WBLC 4MTCA 4Q9LA 3WGJA 3WNBA 3ZHZA 2F55A 1ADJA 1ONSA 3VVLA 3M6MD 1I7LA 9LDTA 1U7HA 3L0DA 1SCNE 5AVVA 4CV1A 2Q46A 5I7EA 1M2NA 1PJ3A 2IP1A 2IY8A 4HWSA 1VB3A 4NECA 4U8HA 2OPBA 5HCUA 4NYJR 3THXA 2N3ZA 1DARA 2CFOA 4JR1A 3W2HA 3VJRA 1EH5A 1M5TA 3A3NA 5JC8A 4M0LA 1WUJS 5KNLA 5DGXA 3R7FA 5FF9A 2UVDA 3KQQA 4P6VF 3FWPA 4WADA 3T0IA 2FF7A 5JOQA 1T9GS 5MGBA 3H16A 1TUBA 4UTNA 1SKAA 1LQ2A 3I53A 3IUNA 1T0JB 4WZ6A 3V8RA 3SSMA 1KGDA 1ZD5A 2QSYA 4BTVA 3NTXA 3ONDA 5DLPA 2RHRA 3H17A 3KRTA 4FZ3A 5DISB 5E1BA 1W48A 2QG9A 3I9FA 3IKVA 5TPWB 3U1TA 1U63A 1CSEE 1UKVY 5EQDA 3CNHA 3SLRA 2A57A 2QVBA 4NG4A 3NEYA 5JH7F 4PO1A 1FNNA 1OI2A 4JBHA 2NZJA 5CTJA 1I6KA 2XMQA 3JRXA 4FLFA 4TMTA 1F0NA 4L5AA 4Q66C 3ASZA 5ALKA 4DABA 4MVJH 3RS8A 4EVSA 3C1OA 2ZB3A 1G0OA 4MRMB 1XA4A 4ICIA 2FSSA 2YFHA 5BRAA 1I3CA 1UQTA 2DJ5A 2YMPA 5WRFA 2QR2A 1M0WA 3ESBA 1KMMA 1F8XA 7REQA 3JWGA 2XOKA 5J40A 1S8OA 2ESRA 1N25A 3LBYA 3NEPX 4EZIA 4Q21A 2BPOA 4C87A 4LSMA 4HDSB 2A5JA 4R01A 1MOQA 3L02A 5CT6A 1R64A 4UAUA 1RMTA 3KQPA 3VTZA 3QUAA 2H92A 2AV6A 3I23A 4G37A 3KS9A 3JD4A 5IVIA 2FRXA 2AUNA 1ZP6A 1DQSA 3NVKI 3D6VA 4MLDA 2BE9A 3H3FA 1SOAA 3PIRA 5H4HA 5TX7A 2H1CA 1W9MA 3EVGA 3EEIA 3JWPA 3P27A 5KYTA 5KTMA 1QF7A 2QM0A 3PNKA 3WR5A 5JHGB 2J0VA 3H3JA 5K0FA 2CYAA 1Y1QA 2ORED 2IW3A 4HUJA 5DYTA 5JLJA 2BFBA 2P35A 1BDBA 4RSHA 5E9AA 4ZAZA 3OJFA 3RSLA 5K8JB 3EXIB 4JUIA 3KR1A 5CVTA 5JCJD 3O2JA 4PXSA 5TR9A 2Q0XA 4XJVA 3EZNA 3DFIA 1F60A 2HF7A 1LB1B 1W5BA 5COQA 4KWHA 2PRKA 4QPJC 1TQ4A 1EHYA 4KV7A 4B3HA 1Z8FA 1TX4B 3WRXC 1J7JA 2ZUFA 3WLLA 2ZR8A 2V7QD 4FD2A 4K86A 3GNTA 1HE2A 3UATA 3LOPA 1GUAA 4F4JA 2C8KA 3BMNB 4OAPA 4DLLA 1OLOA 1QCZA 5KOIA 2O0HA 2O6HA 3DFMA 5FOUA 2IHZA 4RULA 3H2IA 1Q74A 3EQ8A 4MARA 1BMFA 1UFKA 2LPMA 4G8CA 4MQ5A 5FBRB 3RV4A 1PR9A 4INJA 2P9QA 3UT0A 2JATA 2ZSFA 3LRXA 4IIJB 2Q5FA 3U3XA 5ABPA 1S2LA 5EEHA 4N5LA 2WOOA 4Q16A 2QD5A 4MJXA 3ZJ5A 1O94C 4L5JA 3DHVA 3B8EA 3X2FA 2NOAA 3FNBA 4ML3A 3BGIA 2XMPA 2C3YA 2PUJA 3OIWA 5AIBA 1Z82A 3I9MA 1A5TA 3UAVA 3WLSA 1ISPA 4D4KA 4YUWA 1QE0A 3M6WA 4B32A 1CUDA 1K0FA 4FUQA