4QQFA

Crystal structure of mitochondrial import inner membrane translocase subunit tim50
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
GSHMFNSMFTYFQEPPFPDLLPPPPPPPYQRPLTLVITLEDFLVHSEWSQKHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADDKLVRLIPFLEYLATQQTKDVRPILNSFEDKKNLAEEFDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Mitochondrial import inner membrane translocase subunit TIM5
publication title The structure of Tim50(164-361) suggests the mechanism by which Tim50 receives mitochondrial presequences.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 53
structure length 198
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4qqfA00
1TE2A 5ALRA 5AW3A 4G9BA 1J8DA 3NIWA 4Y2SA 1Z5UA 1AQ6A 4KNWA 4UMEA 3M1YA 4Y2UA 5AI6A 4UU0A 3W5BA 4JB3A 3L0YA 1ZRNA 2MSNA 2YMMA 4G63A 3ZTWA 1S8OA 2R8ZA 5ALOA 4DCCA 5ALUA 3W5AA 1Z4IA 3DNPA 4EELA 1FEZA 4YCNA 3ESRA 1L8OA 4NV0A 3U19A 3WKCA 1PW5A 2HCFA 3UM9A 3UMCA 5AK5A 2OM6A 2P27A 3NAMA 5AVSA 3QUBA 1ZOLA 4BEWA 2B82A 4OHFA 2IOFA 5AKKA 2R8XA 3WK4A 4Y2TA 3WK6A 2MU1A 2YN4A 2G08A 3QU9A 2OA0A 4DW8A 1RKUA 2GMWA 3HYCA 3ZVMA 5AW2A 3FPBA 1F5SA 2D2VA 5ALIA 3ZI4A 2YJ4A 3FM9A 1NRWA 3ED5A 1SU4A 4UMFA 1L8LA 1MH9A 2WF9A 4L6AA 3RF6A 3QUTA 4UM7A 2I33A 2JAOA 5ALEA 2YMLA 4UARA 5AVRA 2HHLA 5AM1A 3PGLA 3OCYA 1XPJA 4BNDB 2FEAA 1QH9A 3I76A 1ZD4A 4I9FA 5A3RA 2P11A 5AKGA 3L8HA 3E8MA 3K1ZA 1EK1A 1NNLA 2CFTA 5AK6A 4C4SA 4QJBA 2IOHA 2WF7A 4EX6A 2HF2A 2P9JA 3UMBA 4GIBA 5AI4A 2Q5EA 2NO4A 1CR6A 2G09A 5ALQA 3P96A 1U02A 1RKQA 5IS2A 4HGPA 2ZBEA 4AP9A 2OYCA 2ZOSA 3NUQA 5AKYA 2RBKA 1JUDA 5AVVA 2GHTA 3SKXA 4Y2VA 5E0OA 5AM3A 3R4CA 3WKDA 3SF0A 4L6CA 3KBBA 3S6JA 4YCMA 2YJ3A 2HX1A 3WKBA 3L0BA 2Q4TA 1QQ5A 1O08A 2CN1A 3PCTA 1VJRA 2W4MA 2B8JA 3FGOA 1XP5A 1TJ3A 1Z5GA 1SWVA 1U7PA 3W5CA 5AVXA 3W5DA 1RMTA 4NFLA 1TJ5A 2JAUA 2HEGA 1IWOA 5ALTA 4XE5A 3BA6A 2ODAA 3TLMA 3I1YA 3N1UA 3L5KA 5ALDA 2RB5A 2X4DA 1CQZA 2W11A 1QQ6A 3NASA 4UMVA 1Z4NA 1Q92A 2RARA 4MWOA 3AR4A 3EPRA 3MC1A 3QNMA 4XOUA 2YBDA 4Y2QA 3N8GA 5AI0A 3A1EA 4KX3A 4EX7A 3U26A 1RKVA 2YMQA 3OPXA 3OTQA 5AKXA 4YH1A 4Y2JA 2B0CA 5T41A 1U7OA 3QLEA 1ZD2P 3AR9A 3ZW7A 2G07A 4BNDA 1RMYA 4CF4A 1TA0A 4NAVA 3RFUA 3SLRA 2FI1A 5AW7A 1SWWA 4PNHA 5ALSA 3ZX5A 3F9RA 5AM0A 5AK3A 1U2SA 4F72A 3FPSA 4UAUA 2G0AA 3OCXA 2NO5A 1ZS9A 4UM5A 3U7HB 3ONNA 3AR3A 4BBJA 2NYVA 3OCUA 3QGMA 4YGYA 4O8CA 3AR5A 5AW5A 3WK9A 4EEKA 3B9BA 2BDEA 2CFRA 4KX5A 1N9KA 4Y3UA 1YNSA 2O2XA 3MMZA 5AVZA 1ZD3A 3VAYA 3FZQA 2HDOA 3L1UA 3AR2A 4CE6A 3QX7A 4C4TA 1T5TA 2EARA 3U13A 5AVQA 3ZTYA 5AVUA 2C88A 5ALGA 1Z4MA 5IT4A 3A1DA 2IYEA 4Y2RA 4Y2YA 5AI5A 3L8EA 1L6RA 2WF5A 5ALHA 1QYIA 2YJ5A 1YJ5A 2AMYA 4YIKA 5ALWA 3ZVNA 2GHQA 3WK5A 3IRUA 2JAWA 1Z4KA 3IB6A 4MUMA 2ZG6A 2ZBDA 4E88A 4CF3A 3SMVA 1RLMA 2QYHA 3AR7A 3WK7A 5AM4A 2IA5A 1Z4OA 4B6JA 4AS2A 2YY6A 4HGRA 2JARA 4FE3A 2O9JA 3CZ4A 1YDFA 4ZEWA 5AKIA 4IG4A 2FPWA 2IOFK 4BX3A 1L7MA 3I6BA 1K1EA 1T9ZA 2AH5A 3EF0A 1N8NA 3QU2A 2I54A 3DDHA 3QU7A 5ALFA 3WKAA 5AW0A 3NANA 4GXTA 4C4RA 2FPRA 3QU4A 5AM5A 4CNQA 3ESQA 4UMDA 2HSZA 2WHEA 1KYTA 2FUEA 2OBBA 5AKHA 3OCVA 2G06A 4HGOA 1Z4JA 1WPGA 2B30A 3N07A 5AW8A 2G1AA 3KD3A 2C8LA 3NALA 4KNVA 1RMQA 1J97A 2EAUA 2JGAA 5ALZA 4OCZA 5AKJA 4BX2A 4OFZA 3I28A 1Q91A 4EZEA 3E58A 5AICA 3IJ5A 1X42A 2FPXA 5AHXA 2C8KA 1WZCA 3BWVA 3KDPA 1ZD5A 2BY4A 5ALLA 2ZBGA 3FVVA 3OCZA 1RQNA 3SD7A 5AKEA 3MPOA 4OD0A 3QUCA 1RLOA 3B9RA 3SHQA 3N28A 1RQLA 3OCWA 1T5SA 2ZXEA 4RESA 5AI8A 3R9KA 4UAVA 1L7NA 2VKQA 4YIHA 5ALYA 5IT0A 3E84A 4HYTA 1Y8AA 1EK2A 2R8YA 4BKMA 3QYPA 3U7EB 3WKEA 3ET5A 2QLTA 2C9MA 3A1CA 1RRCA 4UASA 5AKLA 4XPZA 4Y2PA 4KN8A 2YMPA 2YFYA 3MN1A 4KYTA 4F71A 1U2TA 2B1RA 3QU5A 4JDPA 5ALMA 5AW1A 3SKYA 2I6XA 4FFDA 2GFHA 4FYPA 4J03A 2FPUA 5JJBA 2W43A 4HGNA 3L8GA 1LVHA 5ALVA 1Z4LA 5AW9A 3U7GA 2YJ6A 2CFSA 3L0CA 3CNHA 5ALXA 4J2TA 1QQ7A 3ET4A 3A3YA 1Z88A 2EATA 3GYGA 4HAIA 1TJ4A 2RAVA 1Z4PX 3EWIA 3ZX4A 2HOQA 1ZRMA 5AK4A 2PKEA 2R8EA 4DFDA 3U7FB 1XVIA 1RPZA 1RLTA 1WVIA 3WGUA 2FDRA 1YMQA 4UW9A 5AIAA 3EF1A 2B1QA 1RC8A 4NABA 2PR7A 3B8EA 2WFAA 4BYGA 4L57A 4QQFA 3ZWDA 4DWOA 3E81A 1L7PA 4BX0A 5AI9A 3NRJA 2B8EA 2HO4A 2WF8A 2HI0A 3R09A 3WGVA 2AUTA 5AM2A 5AVWA 3M9LA 2G80A 3UMGA 5AESA 2Q4RA 2GO7A 3ZWKA 3AR6A 5AVYA 3L7YA 5AW4A 2C4NA 2FPSA 5AVTA 5ALPA 3ZVLA 2FUCA 1NF2A 1WR8A 4CF5A 4Y2XA 4I9GA 2DQSA 4BEVA 1VJ5A 3KOOA 4ZEXA 2PQ0A 3ZU6A 3DAOA 2HF7A 3QUQA 3HLTA 3KZXA 1YS9A 3QXGA 3DV9A 3WK8A 4AS3A 3L8FA 2I34A 1Z4QA 3AR8A 1RDFA 1ZJJA 5AKZA 4EENA 4UU1A 5ALJA 3J7TA 3ZUPA 1YV9A 3L1VA 4XQ0A 3PGVA 4ZEVA 2AGVA 2I7DA 5AW6A 1LTQA 2WF6A 3PDWA 5A3QA 5ALKA 3D6JA 2WM8A 5AIBA 1VFPA 5A3SA 4YCLA 2BDUA 3N5KA 1L7OA 4IFTA 4H1WA 4NWIA 2ZBFA 2P69A 4RETA 3KC2A 4UATA 5FP0A 2I55A 5ALNA 1O03A 4HGQA 1S2OA
chains in the Genus database with same CATH superfamily
4E09A 3EGVA 4WEOA 4DWJA 4BE7B 2V65A 1TGYA 2LVBA 5FA8A 5JAMA 1U4NA 1X8KA 2QRNA 2ZUVA 1IYZA 3U49A 2V59A 1SXJC 2FKNA 4ENUA 4L50A 4IHKA 3R3VA 3W5BA 2ORYA 2WWHA 1YR7A 9GPBA 1UK9A 2FPLA 4L51A 4HWTA 2YMMA 4JSTA 2Q5HA 2VDWA 5I9LA 1F1JA 4QVKA 1ZXXA 1DAMA 3KUUA 3GVCA 3GUCA 4B6GA 4E2ZA 1DXYA 2IU6A 2IYZA 1F14A 4C7KA 4EMTA 1IXZA 3AVQA 1SHTX 5DGTA 4D0GA 4F8YA 3UM9A 3MCZA 2Q7OE 1WE2A 3BJRA 3RUAA 3IPAA 4JLNA 1JFFA 4HRYA 5JDIA 2B2NA 2Q3EA 1VE1A 4G8JA 1P2SA 4ZXFA 4XUGB 4IDPA 4LZWA 3CLTC 5JEEA 3WK6A 2R8XA 4RK5A 5MF6A 1QG6A 4OEHA 3T0GA 1LU9A 3DF7A 5ITVA 1SCJA 3DEKA 3ENVA 4DVJA 1JEQA 4PC6A 1ORWA 1SAYA 1ZGGA 2GN6A 3DTVD 2JCVA 4MKZA 121PA 2GLXA 2WE7A 4HN9A 2LPMA 1X1TA 2A1UA 1N2IA 2AG8A 2D2VA 4IUDS 2HF9A 2PUJA 1SHKA 1ULSA 1WD5A 1Z68A 3BMQB 2RJ3A 3TL3A 5AQEA 3VHRA 3ZGNA 5B30A 4ZDKA 1T0HB 1SQ0A 4X63A 3WA6A 4DABA 4K0KB 4WBSA 3A9TA 1KZHA 4PLTA 5A1JA 4PHCA 2P5YA 3LUJA 2DEUA 1U63A 4Q4JB 4XJVA 2DQ4A 2KX7A 4J2HA 3VO1A 4TTQA 4G0PA 1SBTA 3EQ8A 5ALEA 4KWCA 2IH4A 1VBKA 1HT3A 2C29D 2OSBA 1ULUA 2WKPA 3ECSA 4KPFC 3M0EA 3VA7A 3ZCPA 1GUAA 2JVIA 3I39X 2QT0A 3I9OA 3T7IA 1N3LA 4W9RA 4NONA 2UVPB 1KO5A 5DGIA 1Y0BA 2P11A 1M1UA 1SU6A 3I12A 3REGA 5C37A 2EIXA 3B89A 1A5SB 3HJGA 1JDSA 1QYRA 4P81A 2CFTA 2NZUG 3AHFA 1UPTA 1YS2X 2AK2A 1KAMA 2OPBA 2WP8J 1CY0A 1WUHS 1Z12A 3B60A 3BTVA 3PPWA 1L8QA 4IIUA 1A98A 4RAQA 3ZJYA 4XJSA 4Z1MD 4PCAA 3FRJA 3JU3A 3L4BC 1RWPA 1NI3A 3WWPA 2YXDA 4F2GA 2HBRA 4U2EA 3CLSC 3NHKA 4EUSA 4TZTA 4K1XA 4YMWA 2RGCA 3WVNA 1Y4DE 5T8KC 4MUYA 3K7EA 1U0SY 4DTIA 2QBYA 1TQ4A 2JLUA 2OFXA 2VUTA 2HCRA 3IQEA 1O6ZA 1Z7GA 3CR8A 4KUHA 4B3DA 1EXNA 5JD4A 1HC7A 2WD9A 1VZ3A 3KOYA 2F1IA 4G1UC 1A82A 1QF9A 3BWEA 3IE2A 1XALA 1T8YA 3PDIB 1GT91 2FWMX 1F2TA 2NADA 3KNZA 3KEQA 2QY6A 1M2KA 3R4CA 1UWCA 2Y68A 4ZC1A 4A8JC 4QO7A 3DFFA 1B7GO 3DZIA 1AZTA 1D2EA 3V7UA 1V6AA 3ZGZA 1SY7A 4BGEA 3WC4A 1A69A 3AB8A 1Y5LA 3C5HA 3PXAA 4D99A 4ZIRB 5F5XA 3K4PA 1FZQA 221PA 3W04A 4IS3A 1SWVA 2VZEA 1EDEA 1TC1A 3I8OA 1GPDG 3DM9B 4JEIA 3VTAA 5FI0B 3KQSA 3NRBA 1L5WA 3SF8A 4ZMSA 4TROA 2JJMA 3IAUA 3AVTA 1PJ8A 3BHMA 1BE8A 5HKLA 5K4AA 1U2DC 2REQB 3E9YA 3L82B 4L4ZA 4KREA 9MHTA 3T3IA 4ZI3A 4F3TA 1VPTA 4LHZA 5ES4B 3ZY3A 3FLEA 1N75A 5DH9A 4Q02A 2IS1A 1ZG3A 2DH5A 5JMPA 4RHTA 3MIZA 2XPCA 4KN5A 5H7XA 1R64A 4XD2A 2A2ZA 1ZNQO 1NVAA 4UEQA 4BFSA 1E3EA 4TVSA 4CBVA 5IXSA 2OE2A 1Z6ZA 3BWCA 4X20A 3K16A 1TCUA 1SQ6A 1RXIA 1Q0PA 3IQFA 4BWYA 5TIIA 3FUXA 2YC4C 3HCFA 3RLIA 5ISMA 3UPUA 4JH0A 4Q9LA 1EE2A 4DARA 4MVJI 5TE9A 4CQLA 3LDGA 4Z3KA 1RM4A 2W2KB 2PXXA 3IP8A 3N8GA 4NXMB 1JDNA 1EMDA 2FR1A 4LHVA 1ESMA 1G16A 1EP3B 1R7RA 3T7DA 5CM2Z 2WWGA 4N0MA 5CTJA 4W9MC 2GEVA 2OO5C 4CCWA 2WLTA 4HB0A 4CUZA 1DOZA 2AOXA 4HLUA 1KORA 2RHJA 2OYRA 4DR1B 4WBNB 1E1QD 2W2LA 3B1WA 4PTZA 4BEBA 2CHUA 4EFDA 4O29A 5MN4A 2IRWA 1TA0A 1SWWA 1ZNWA 4ZOEA 4DKXA 1XYYA 1LPOA 2A88A 3K9NA 2WSLA 4FDAA 4DXAA 4RFSA 1RKBA 3HUTA 4POOA 1FMCA 4KYUA 1G1AA 2G0AA 1J49A 2AFHE 2R6FA 2WU4A 3TCNA 3FOBA 1GGHA 2CYAA 3FKJA 2QZZA 4XUDA 5HMMA 5AJHA 4TKUB 2WDZA 3NTXA 4URUR 4WI1A 2Q2NA 3E05A 2ISQA 3RYIA 1BEZA 3B9BA 3F9CA 1YI1A 1GZ3A 1B8VA 2QU8A 4OK6A 3COJA 1GPKA 4CEHA 4X3OA 3PICA 5C7YA 3BMOA 3OU6A 4MB0A 1N36B 5HP4A 3AFNA 1DKMA 2H7XA 1DEOA 4WJLA 3A1WA 3AY6A 3IVXA 4ROSA 1ZD3A 2DPLA 3WGHA 3EZ2A 3UH0A 5A6VA 3WSTA 2I2DA 1E8NA 1YJXA 3EAQA 3PRHA 2O2JA 1QHHA 3D3EA 3NT4A 1JDJA 1FYXA 3H99A 2COEA 3O8RA 2ADMA 5CVUA 3TYXA 4D7AA 5IVHA 3H5OA 5SV2A 3LQ1A 2VJYA 5G40A 1B16A 3H11A 4MS3B 4B3CA 2HGZA 1DAKA 2V5VA 3B3AA 4OHPA 2O0LA 4D4JA 5CBPB 2VSOA 1E1NA 3PQDA 3KT8A 4NL4H 2C7QA 2D7DA 2PUEA 1T2UA 1WCWA 2J9FB 3BMCA 2AS0A 4V0MA 2V1UA 3DT6A 4OX9B 1OAOA 3F5QA 1G8GA 3G2MA 5BVHA 5A3JA 4ZI5A 1YJ5A 5LKAA 1QRUA 5LB2A 2VZ9A 1NUAA 1OC2A 2FP4A 5EMMA 3U4QB 1KZ4A 2X9VA 4HVTA 5DBGA 5BN1A 4XJTA 5CVVA 3RC3A 3TZEA 3BBLA 2R6HA 4IXMA 5JD6A 4I1SA 1Q0SA 4OHMA 4I6GA 3X1YA 1FQJA 1JIUA 5C8DA 3U3JA 1ZIOA 4AJPA 1EIZA 2PWBA 3K0BA 4F5WA 3OP1A 2G5CA 2RGEA 5LNK1 4AQ7A 3FDXA 3D4OA 2HLNA 1RSZA 1L5VA 1RLUA 2XZPA 5A4FS 1LWNA 3UEOA 2VNIA 2CV0A 4LC1A 4BO2A 5I47A 2O3UA 3MS7A 1RKXA 1S3IA 4WBXC 1XK6A 4JXXA 1ZLYA 4EDFA 2QE6A 2H6EA 2F9LA 3VVBA 1FRZA 2ZE6A 4R16A 5LXTF 4M0CA 1O97D 3W9BA 4YXFA 1I6LA 4G6ZA 2PVCA 1S7GA 3CRZA 3O74A 2FYTA 5BSGA 3WNCA 2CSXA 1IDN1 1WVGA 4YHBA 1VE9A 2Q4EA 2VS1A 3WKAA 4LMRA 1OQAA 1G2IA 1C7EA 2FPRA 2GZ2A 2DBZA 4I08A 1NMZA 3CZCA 3ESQA 4C43A 3F7OA 3FSGA 4I8DA 3PQ2A 4NNPA 4H4CA 4PR0A 1ECJA 3TUIC 1K5DA 3K0AA 5LWQA 1KAOA 4MZDA 3A06A 4CRWB 5HBRA 5I6DA 2F1JA 4LZAA 2P9GA 2Y1GA 2CBZA 3CONA 3KP1A 4HGOA 1UJ5A 5GV8A 2XYPA 2AJBA 3TLCA 3PE4A 3OIDA 4IUYA 5A9TA 2DY1A 3IEIA 3OKCA 5DEOA 3ZDRA 3C3KA 4DIMA 5JCOC 4G97A 1JAIA 3PYMA 5JC8A 4Z3DA 3RUPA 3DQZA 1IBKB 3HU5A 4ENVA 4TLBA 5AKJA 4BX9A 3CBGA 3KQHA 1C1HA 1V71A 2WSYB 4XYGA 1EG7A 3H84A 4LNAA 1Y1TA 2HQRA 2CF6A 4FP9A 1AO3A 2XDWA 2MT9A 4LV5B 4ZVNA 3LLUA 2AQIA 1TRHA 2IJGX 3NYIA 3QVWA 3TPCA 3S68A 4JT8A 1H94A 1V6SA 2ZBGA 3CKMA 4Q7JB 2Y3IA 2X0NA 4UBLA 5EOVA 1E1YA 2PFSA 3WHPA 2CC2A 1LW7A 2R1UA 4X24A 3W1WA 4PS1A 4QAQA 4BQNA 5AD1A 2HKIA 2O19A 1Z6QA 2GDZA 5D00A 1RU3A 2W98A 4X1IA 1O95D 1TB4A 3SHQA 4GQIA 1EUDA 3BOSA 3W8EA 4F3CA 4RK4A 3ECCA 1UUFA 1OASA 3OZIA 3CO0S 4RM2A 2W8ZA 3OIUA 5CAEB 5TEVA 1A9XA 2WTNA 3FI0A 4B80A 3G2KA 1E9BA 1CIVA 2AR0A 2JJ2A 4Q9AA 4KACA 4B7ZA 2B69A 2Q21A 2EF1A 4BKMA 3KT0A 4E08A 4B76A 1VKJA 4MEBA 3D7KA 3LT4A 3UQYS 3OTOB 1EXDA 2VPZA 3I9LA 2AOUB 4EI8A 4ZHQF 1MABB 3PL1A 1XAHA 2WJPA 5U4QA 1QB7A 3ZCTA 3K1AA 4EB8A 3HKEB 2ZYHA 3PEEA 2LKDA 3TLBA 1LK7A 1X7HA 2R7MA 4LJLA 4Q12A 5ALMA 3UJ8A 1UZNA 3NVDA 2PCLA 5A4KA 3PXEA 3ZCXA 4IIYA 5CCXA 1GPUA 1VTKA 1C7QA 2I6XA 1U65A 4RF2A 4O4JA 3BJZA 4HB3A 3RYCA 1D4AA 2JH8A 2ZYVX 5BNWA 1M72A 1GKYA 2CLCX 3GGCA 1I5EA 2W43A 1J22A 2YV1A 4BZQA 2YZ7A 4FI3C 4PW0A 2P75A 2QAGB 4KXWA 3RK1A 1GKLA 2VJKA 2Y9PB 2B4TO 1E2UA 5DW0A 2RIRA 1CUSA 5I9SA 3ZDYB 2G9NA 3I5AA 2ZRAA 3RJ9A 1VBFA 4RF3A 3N2YA 2C7VA 1S01A 1ZDMA 1F8FA 3DO8A 5ELLA 3SS8A 3WRWA 3WZ2A 5B64A 4CETA 1PT7A 2MSWA 1ENPA 1O6FA 3JQAA 3PXDA 4NF2A 5EERA 5J47A 3EFEA 4RGBA 5FPPA 1YK0A 1LCIA 3LT2A 4WZAA 3FTEA 2R8EA 1W87A 2BTOA 2CW5A 1PS0A 5FJIA 1ZD8A 2X15A 1NW5A 4HPJB 3COYA 4RIIA 3RVRA 1FVFA 2OYSA 2CNDA 4HATA 1KVTA 3PUWA 4RAOA 1BGXT 2QUIA 1HOTA 2CMDA 2XNDA 3LBAA 4G5YA 3TLAA 5IXYA 1HY3A 4NABA 3D4PA 2B20A 3PHIA 2PWYA 1K3FA 2QR2A 3WFZA 3ZWDA 4EZBA 16PKA 1EWTA 2Z2KA 4UTOA 1E20A 1OXUA 1ZCZA 3I9NA 4Q7KA 3ELWA 1DKPA 5HUQA 3IALA 4DR5B 4MW4A 2XDQB 3OVMA 1OFTA 4MQUA 1KBOA 3GJTA 3CKYA 3GT0A 4RGVA 4FHZA 3UMGA 2FR8A 1JEJA 2NXNA 1KI3A 5CM9C 1RBQA 2VG8A 4LXXA 1Y9AA 2CJYA 3ETNA 4KO4S 4O02B 4RSMA 4YP9A 1WR8A 1EX1A 3SQXA 1JDPA 1CF9A 4MOWA 2YIVX 1GRRA 3LLVA 4N7BA 2B5WA 5WRFA 5CH8A 5CFLA 5L4NA 4NCHA 2JANA 3ROQA 1Z07A 3A37A 3NEPX 1I7LA 1QVRA 1T1JA 1TD1A 2X2EA 4MR9A 3C5WP 1RBYA 4YO8A 5ITWA 4KHZA 3JD1A 1K6XA 1X87A 2AXEA 4BE4A 1QLJA 3TXYA 4ECEA 4TL6A 1ZUHA 2H5EA 5JSUA 1NW7A 3QXGA 1N8TA 1PYGA 1NPDA 4HDCA 5IN5A 3PC8A 1QJ4A 3OM1A 5LL6P 3PEYA 4XDYA 1CB0A 4FDMA 2AZDA 5CX1A 5KSPA 3S40A 3JPWA 4DCOA 4L4XA 4KMSA 2WDPA 4CHGA 1W2HA 2DWOA 2CYBA 5GZ1A 4GQAA 1M6NA 5IDVA 4XFDA 1H1LB 2B7LA 4XQ0A 3PGVA 2ZZMA 1J0EA 3NHZA 5ENZA 1XQ6A 4LAFA 4OI0A 4W5JA 4YYZA 1ZL2A 4CG3A 1OIXA 4UQLA 1E5TA 1I80A 2VA9A 4K6KA 2WG1A 5B58T 2JJQA 3B51X 1JIVA 4OQMA 2ZCUA 2ZIFA 1T24A 1V0JA 3DMFA 5L3QB 5I8PA 3GLFE 4I5FA 4Z5XA 2R6R1 2WMYA 4PNZA 4OJYA 1PFWA 4XGIA 1T1RA 3IVRA 1T8WA 2HSGA 2J4CA 4P4GA 1ZL0A 1SD5A 3AY0A 3DBRA 3E9NA 1O9HA 1TE2A 2Q50A 4FGSA 4JKIA 4MRMA 1X7GA 2DT5A 2AF3C 5AW3A 4LWQA 1J8DA 1FK8A 4LHYA 1ZITA 5FBQB 4TTRA 2J3LA 3D2BA 2WE8A 3GLHB 3DXYA 3HFGA 4Z9BA 3W4JA 3WLOA 4G1VA 4YAUA 4W9NA 2A0XA 2WU3A 1DI0A 1ZH0A 3MAGA 4G63A 4M9UA 4P84A 3AF2A 3QHAA 3KLPX 5EIXA 3A2NA 4AY6A 1EFUA 2R8RA 4YAJA 2HQBA 5LUBA 1EUCA 2BI8A 3MMXA 3FIUA 1U1IA 3OLVA 3THRA 2PU7A 1DUSA 2AW5A 3SZLA 3WDKA 4OTZA 4CMIB 1ZR2A 4YPVA 3QY0A 1WETA 2H0QA 4CIWA 2HCFA 4PGMA 3ISTA 4MV3A 1UAGA 2ZSEA 4PSUA 2ZJ2A 3BFVA 2AJLI 3AM3A 5AJYA 4DMUB 4EBFA 4IDHA 1PR6A 3CX6A 4DBVO 1MW8X 1WXIA 4JYAB 2RGGA 2TECE 4JAVC 1IZ0A 4BQPA 3CLUD 2YN4A 1TA4A 4KO8A 1VIMA 3DPIA 4FD2A 1G6Q1 1OFIA 2I62A 4HWRA 3ZLVA 3LBYA 2JI8A 4CMEA 4OUKX 3KQQA 4IIHA 2ZJFA 1S4QA 1DJQA 2I2FA 5FBKA 3WAKA 3VXKA 4DRXA 1RAFA 1BN6A 3ZI4A 4ENWA 2AUMA 2KLHA 3U31A 4Z0PA 2HC9A 1GUBA 1SU4A 2D2EA 2FSSA 4ZCQA 3SU8A 3A3NA 5J59A 5KCMA 2NUAB 4ZEMA 3VR4H 3G1UA 2B99A 2FRDC 2QPAA 1IHPA 1MJGM 2IOYA 3IAM1 3MAJA 4IDNA 2OHGA 5IKOA 5ESDA 3AF4A 5DI9A 2D0OB 2AB0A 2QOEA 2X9LA 2EGGA 4IQ0A 4ZV7A 2BEKA 4A91A 3UJCA 4RVGA 2Q28A 4DZZA 1XPJA 2FB9A 1MLDA 3FNRA 3QNUA 3UATA 3E3OA 3I76A 3LSYA 1ZD4A 1SVUA 2YVQA 3TW0A 4X7MA 3RRXA 1F38A 4N39A 2DP4E 2LD4A 5D6OA 2Z5VA 5H81A 4JUIA 3E9RA 4H0CA 1SHLA 3Q3CA 3TQFA 5CJ2A 1NIPA 1C4XA 3Q12A 1LDMA 1WM1A 4X91A 5C2JB 3IEXA 1O89A 2P9JA 2RSLA 1PJCA 3L0IB 1G19A 3R77A 4JVNA 5HKAA 5KMGA 3ZJUA 3AY7A 4F7WA 3P2EA 3X1DA 1H5UA 3LDFA 4MGZR 4B6SA 2QAIA 5D51S 1YRYE 4WNYA 3JWIA 3JQEA 4ME6A 1RKQA 5L3SA 2FGJA 4NI5A 3X1MA 4F3NA 3Q4GA 1ORDA 5DI3A 4PTLA 4Q19A 4URHA 1TOAA 3WMGA 4DW8A 5D3MA 4XX0A 4RCZA 1HFEL 1G60A 1AH2A 4CJXA 1JW9B 1PR3A 1A9OA 3X44A 3QF7A 1TFUA 3BERA 3DDOA 4U6NA 4ZV4A 1DARA 3LY5A 1U8TA 4INAA 1XCMA 1YD7A 3PWSA 3D0OA 1OFUA 3PHGA 4N3CA 1A9ZA 1RXCA 3UJHA 1SZPA 1SVIA 2WWTA 1P5ZB 3HUFA 3P1JA 2B1IA 2J7PA 5F5NA 4ARSA 4DLNA 1ZVKA 5ERXA 2CN1A 1XOIA 4C4OA 3LUDA 2REBA 3I9KA 5LQAA 2GDJA 3GQBA 4HDRA 2K2WA 2V0CA 2RGDA 4WH0A 1VKOA 4P0PB 1E9FA 4IEEA 1Z83A 5E8RA 3KX2A 1M33A 2JGIA 4TMKA 1HDGO 3A9SA 3ODGA 1SIUA 4ZCLA 2O8FB 1T5DX 4HYEA 3QRWA 5IW8A 4L15A 4NICA 3TIGA 4BASA 2PU5A 3L93A 1O97C 1NVMB 3HP4A 3HRKA 2I1WA 1IUNA 1E6MA 3ESDA 1FFSA 1HYQA 2WB4A 4JGIA 4JOQA 4YLGA 5P8WA 2CLHB 2VAWA 3FNBA 3W34A 2NVUA 2ZR8A 3FDIA 2GHIA 3ZWQA 2AQKA 3O4RA 3CXUA 3R3WA 3SJUA 4CKWB 4I50A 3KZOA 3H19A 5DGXA 2BGWA 3SSOA 1UP7A 4TYMA 4E5YA 4D6XA 1X1CA 3AUYA 3CY6A 1AA6A 5BPFA 1D0VA 1NWCA 1UM9A 2DVMA 4IJQA 4I4LA 4ZFNA 4E14A 4RIHA 2HBYA 5E7IA 4ZU6X 1CDDA 4C07A 2NMVA 3DP7A 1C7RA 4WL0A 4YWHA 1YR8A 4BVHA 5DWVA 1MRZA 4GLJA 3EPRA 1DQNA 3DMRA 1PUJA 4RGQA 2FQWA 4Y2QA 1NZFA 3UUGA 3BK2A 2ACVA 5ECDA 1DCTA 2WUVA 3S55A 3GWGA 1VL6A 1U2QA 2GEUA 3LPAA 1EP9A 4YXWA 3TOZA 1QO0A 5AKXA 4AVYA 2XI4A 4GBGA 5KTOA 2C7OA 2BGGA 1V5EA 5BNZA 3O90A 2NV0A 3OE7A 4HH4A 5J4VA 5LQMA 5EESA 1M1YE 3HU3A 4HDAA 2QL7A 1R8YA 4EHDA 2BP7B 1R27A 3IFSA 1NW4A 4FU0A 4PV7A 5KBYA 3B1ZA 4DV3B 3NGLA 4N5HX 3RFUA 1R10A 1TQ2A 1UKEA 1NZJA 3KZNA 4IDAA 4INJA 1WRBA 1UKYA 4FMCF 2D1TA 2PL1A 4KR2A 2XDYA 5EXXA 2PZEA 1USKA 3A1NA 4JU9A 4K9LA 5JQGA 1MJHA 2OQIA 4P36A 1EHIA 2JKYA 1QHEA 4KXLA 4MROA 4P35A 4RIEA 4FQ5A 1O95C 4X9XA 3RTCA 1VL1A 4YGYA 2WHXA 2Q0XA 4NOJA 5EKDA 3BRWA 3T5TA 3L6RA 2ZJ6A 4FNMA 3V3TA 1Q17A 1A1SA 3TSWA 3JWJA 2O8DA 2CMFA 2NVWA 1XZJA 1QZUA 1FDSA 2QM3A 3GA7A 4ZT7A 2BFCB 3V1MA 1XWIA 5JHHB 1CS0A 3PDUA 1DAOA 3VX4A 4A6DA 5AVZA 1SVNA 1VB5A 2H5LA 1KERA 1ZR4A 1J8VA 5DFAA 2OHJA 3MCTA 1PR4A 3IC5A 1Z6AA 5DNYB 4ZQBA 2VT3A 4XI9A 4OOFA 3QPBA 1UOOA 2R96A 5KQMA 1H5QA 3NVMB 3FNFA 5H1YA 1N5MA 5AVUA 1EFAA 4TQ9A 3FJOA 7MDHA 2VYVA 1PZNA 2K4MA 1AUQA 1UZUA 4KUGA 2RKOA 4WJKB 1KTIA 5TPZD 3DMTA 1DJNA 3EH1A 3P0EA 3P9YA 1NR7A 2CL5A 4MV5A 4OO3A 5JRDS 2Q8PA 4GBMA 1UT5A 4HGYA 1RQXA 2I6TA 2YZKA 5JSZA 1T1IA 3COVA 1E0DA 2C5AA 4RIGA 5KSZA 1XCOA 5KDLA 4PAOA 4KPUB 1O4VA 4GT1A 1PEDA 1ZGBA 3Q9SA 4ZTZB 2JCXA 3LH5A 3O8OA 3IBTA 1Z2EA 1BEUB 4X1YB 3VR6A 4AURA 5JAHA 4TZ0A 4MH0R 1RAAA 5EHGA 4ZVLA 3ZS8A 1I4LD 1ABBA 3GUHA 4P53A 5JEDA 3QSGA 1NZDA 3UUWA 3HYNA 4PPGA 4LDAA 5LXTB 1WLSA 4KRGA 1YJAA 3MELA 1VPEA 1KEZA 5F3WB 1RM0A 4RKFA 3WK7A 1BGVA 1THZA 1U8FO 1P0MA 1IXSB 1EDBA 4R8RA 3ABZA 2ZQ5A 2JARA 4LI0A 5KEIA 4XB1A 3BGSA 5U4XA 2XLBA 4O4JF 5IH3A 4MS1A 2RCYA 1LTKA 1T9CA 2EX0A 2SBTA 3AQ4A 4QTXA 2ZATA 5FI3A 1ZOSA 2IYQA 5E38A 5DV9A 3K70D 3H5TA 2GVNA 3T99A 2OGWA 1EXVA 2NZVG 4QGSA 1TYDE 5JBIA 1NJ6A 4G4SO 3FYUA 4HYQA 5K3AA 1XQWA 4XQCA 4TPKA 5DX1A 1UMCA 4FBMA 1WB9A 2JZOA 2ZSHA 3LE8A 2IODA 1YQTA 3NM5A 2XYQA 4KFSA 5IAAA 4P0QB 2OBBA 3PRYA 4K05A 4XLTA 2BC9A 4QSMA 3BDVA 2PKQP 4M1QA 5DTMA 2ATEA 3IMGA 4DCMA 3GP3A 4CG2A 2PXCA 1V5IA 3L01A 3DL4A 4FIZA 5FI5A 4GZ6A 2Y05A 3CWQA 3PI6A 2B5OA 3ASYA 1MTOA 3I73A 3RYTC 4ZMBA 1R88A 2ES4A 1T43A 1J99A 3U7QA 2HJRA 2J4FA 3EIOA 2PAAA 2E4UA 2RGXA 4MW9A 1R6UA 1T8SA 4QUJA 1A1VA 1LX6A 2QSYA 2RCNA 1FFEA 2C58A 3PQFA 1FNBA 2BE9A 2XQJA 5ECWA 1QBGA 1TK2A 4B4OA 5H02A 2XE7A 3TNFA 1RP7A 2C8KA 1OUMA 3LI2A 3V1YA 5AXAA 1JJ7A 3IIJA 1KRWA 2FJ0A 5FX2A 1ONOA 1A77A 2BY4A 1EUQA 3DFIA 4G3XA 3STUA 1ZNYA 3AI3A 2AN5A 4CEIA 4OD0A 1GRQA 1T10A 2H8KA 4MUBA 5K3OA 1NW8A 3A4LA 4RZQA 3H7AA 1N2GA 2K7ZA 4V0NA 5A2QA 3JZMA 2QRLA 1JFVA 1NW9B 1TM3E 1CRLA 3R0XA 3RFCA 5EJ4A 4BIMA 4P7GA 1N2SA 9ABPA 4YIHA 1Y6QA 1II8A 4NE2A 4FZRA 3SBEA 3WB9A 1GPYA 2GWHA 4D6PA 2ERCA 3A6LA 5C9ZA 3WRXC 3TRFA 5IC6A 1R74A 3OQIB 4EHLA 4EW3A 2PUAA 3IL2A 1RRCA 1VL2A 2P67A 3NHLA 5M7EA 4G2NA 3L92A 1T9DA 4OK5A 3KJIA 3LPNA 1U2TA 1M8KA 2Q6KA 5CIQA 2PRSA 3DWIA 3D6MA 5HWSA 1UDXA 4CIBA 1U2PA 2I4LA 3DOOA 4XWWA 2YWFA 1VDMA 3VC7A 2FCAA 4BNNA 4HGNA 2Y0PA 1AS3A 1STOA 2QPTA 1NY6A 1P1KA 2ZGVA 2AW3A 3NHJA 1R1DA 3LBHA 1I8TA 1XXHA 3FPKA 4YMGA 2WM3A 4QLAA 2ZDHA 3KPWA 4WCFC 1AIPA 1XN4A 3RTEA 3U1TA 5J23A 4R54A 1QCCA 1IEQA 2FFHA 4JGGA 4BNKA 4CU5A 1FDVA 3VPXA 4R1SA 4DV1B 5CGZA 1G2QA 1U2EA 3DCYA 2NV2B 4U7FA 1DMRA 1OLUA 4RYDA 4BCBA 1T4CA 3FPGA 4XIGS 4DA0A 1JHZA 4QUDA 2JI7A 2HEIA 4A9AA 4G5QA 1RZRA 3NBKA 1Q1GA 2GN0A 4KAAA 2QQFA 3AHJA 4HEA6 4RZSA 4YI5A 4ZHSA 5KTRA 2DERA 3EIEA 3UW3A 1SUIA 2O8BA 2JI6A 3MRXA 3D5EA 5HKOA 1JGTA 1VE3A 1VKZA 5BWOA 1TZKA 1WG8A 2FA9A 3O38A 2WAAA 3CC8A 1V41E 3I6YA 2BFAA 3IODA 1WQ3A 3NPAA 4BB0A 4L22A 4BMZA 5BQ3A 1TRKA 4RORA 1ACLA 3ZC3A 3DEZA 3P5BA 3JVEA 1FJHA 3R7SA 3ADPA 1JE0A 1YIDA 4X90A 1YCDA 4RLQA 1JFFB 1N32B 2JIOA 1SIBE 3SJZA 2GKSA 1FNDA 3GP5A 4FDTA 1P8JA 3ANXA 3U4DA 5HUJA 3WL8A 4IBOA 3OIYA 1YL6A 3LCMA 2B2XA 3NMUF 2H00A 4WFJA 4L8FA 3MT0A 4MCJA 4WKOA 2YHUA 2XB4A 4BVBA 4YJDA 4RXUA 3BXPA 1AX9A 2P9EA 4ND5A 3IPXA 4A15A 1N2CA 3J81k 1FSPA 1CP3A 1AKUA 2AI1A 1QIDA 2OCIA 2AFVA 3EMBA 2ROQA 5DTQA 5IDXA 1KFBB 3NC1C 4PRLA 1ZINA 1UBMS 1WUKS 4YACA 5CB0A 1BIFA 1VLHA 1Q0ZA 1AKEA 1DC8A 2JB9A 3OU2A 4YGXB 5FNVA 4GLLA 1OF1A 2FW6A 4LVUA 3UJBA 4F96A 2H1RA 4X93A 5AVOA 1ENOA 4AZ3A 2EW1A 2G8NA 2RD2A 3SR0A 3CA8A 4E22A 4HP8A 2WZQA 1UC8A 1IDOA 1U3FA 3E3LA 4LDRA 4S12A 3HJTA 2I87A 5EPEA 2IY8A 4ZAYA 4KR6A 4ZU3A 5TQ2A 4PVCA 1ZCJA 1GSOA 1QVWA 2HMTA 2J1LA 2MOKA 2EG5A 3EDOA 3KXKA 1KEVA 3ONEA 3B3FA 1BE6A 5I9TA 3C7DB 1PSDA 4FLEA 4D96A 1UQTA 3H9EO 4OA8A 5KSWB 3TPZA 1XHEA 3WHIA 2BFBA 2ZI6A 2ZUBA 2OV8A 1G2PA 3MBIA 4B2PA 1T8PA 5FLKA 3WWEA 1HE8B 3AKDA 3L7AA 2WWFA 1J07A 4ZVOA 4RHEA 5FEMA 1ZI8A 3U40A 1ONSA 4E03A 1ISHA 3RAJA 2QBYB 5HS6A 1G0OA 1DBSA 3Q3HA 1P6QA 4EJFA 3A6ZA 2F8MA 3H5LA 2OWDA 3ZQJA 2FFRA 3BIJA 1K97A 1U3GA 1H2XA 1IBRA 5EE9A 1EM8A 2TMKA 3LF2A 3CLVA 4XZ3A 3KTFA 3WXMA 1F2TB 1ML4A 2IHBA 2XNJA 2YS7A 3A6JA 4G9BA 4RPHA 4NTZA 3EDYA 2HFJA 2Z56A 4ML3A 3NIWA 2AQ8A 3PEUA 4Y9SA 1W0KA 4C5BA 1LDGA 1KKLA 3QE2A 4QBFA 3CM0A 2JPDA 4KQKA 5BN3A 1DAHA 1JMVA 3M89A 5AI6A 4YX9A 3GWZA 5B4TA 2Z98A 4RZXA 3RS7A 1AHIA 1CNMA 1SUAA 1TU4A 2VH5R 3PKJA 3LA8A 5KQGA 3P8ZA 1DTWA 5ALOA 5KTYA 3QVXA 1W1WA 4CFSA 1NW3A 1SVLA 1G8PA 3UG7A 3T8YA 1NWHA 2F43A 4Z2YA 4W6QA 5B36A 3TE6A 3SF8B 2D4AA 4N12A 2VZ8A 3A0RB 2PZGA 4N8EA 3TZ6A 5K09A 3MJHA 3GVPA 4RDXA 2IYNA 3ITKA 3BT7A 5LQUA 4H60A 5BNTA 2CDRA 1H2HA 2GNOA 2P7IA 3S2UA 2UZ1A 4OXIA 4D4IA 3LDHA 3C3CA 3FWYA 2YFHA 4KRXA 1CLEA 2H65A 3DULA 2OA0A 2FZ5A 4IW3B 1KKMA 4QHSA 4NZNA 4EGJA 1KAHA 1EGVB 4KXUA 3ZWPA 2JIPA 1DDIA 4X20B 4YAEA 1AQNA 4IJVA 3A4YA 4I50F 2OD7A 1U9ZA 2J5QA 4QYIA 4UFOA 1NRIA 2SKCA 4TYNA 4CQLB 2XYRA 4IINA 4PYNA 1A9QA 1MIHA 1TNDA 3IDQA 3G8DA 2XBLA 3JS5A 5B2FA 3PVCA 2VDOB 3SX2A 2PL5A 3G1WA 3KQNA 2YJNA 1UBEA 3O8BA 4JS0A 2O7NA 3MGBA 2WK1A 1J2EA 4Q3CA 4UE3S 1SBYA 2WWRA 5F78A 4BEJA 2C5BA 1EHYA 4IZIA 4X95A 1CR4A 3S2YA 4KHPB 1VG0B 2IYVA 1BRMA 2PFKA 1ZZGA 1BMTA 5C18A 4EF6A 1M66A 1CY2A 1B8NA 1W34A 3WI7A 3I62A 4PYKA 1G20B 5EE0A 3BF7A 4HGZA 3TTWA 3ZE1B 3MOIA 5EGSA 1C9DB 1VJTA 1NC3A 2G9QA 4MTCA 5G2OA 3L0OA 1I2AA 3K1ZA 4FEGA 2Z3VA 4J7CA 2JC3A 4KXMA 1U80A 4LXTA 4MRSA 4V24A 1P45A 1TL7C 4BNUA 4WKCA 4O33A 2NZXA 3HBLA 1YQWA 4TWAA 5IFLA 5KHOC 5ERGB 1EA5A 3Q9UA 3BQ9A 1BXZA 1X7ZA 4PZEA 3O7WA 1YIAA 3I5UA 5TNXA 2WYVA 3PNBA 1UXHA 1AF4A 2O0MA 2OESA 3IBFA 5ALQA 3C2QA 3K2BA 1K98A 3C3PA 1XPOA 2PJUA 3H5RA 4J4TA 4OP1A 5JQGF 2LR0A 1NJGA 1CVIA 2YY5A 2C0QA 3PXCX 4BGDA 1QK5A 4IDOA 3RASA 1NLFA 4KQFA 4NZ9A 3COWA 4U8GA 1Q7GA 2W7TA 3FRHA 4EGFA 1XRSB 5DLYA 2XIJA 3HJBA 4KVZA 1QB8A 1TLLA 3SKXA 5AVVA 2WJYA 1UL1X 3CPSA 1OV4A 5HOEA 3E0QA 4FFMA 4A10A 4Z7QB 1IJKA 3KFXA 4BU1A 3H11B 4JT2A 3S6JA 5I3ZA 1EAMA 2XB6A 3NONA 1IY8A 4EHKA 2G1PA 2WYOA 3BEOA 3ICWA 1IRXA 3E9EA 5LP6A 3SHWA 3BMCB 2XDAA 4LUCA 1PTKA 2WV7A 3IIMA 3O1IC 2M1ZA 4H3KB 5IMSA 2B8JA 3R5TA 2Q2WA 3JD2A 2PRIA 1K63A 3R6WA 3IPRA 4Q4HA 3KT6A 4XUEA 2WILA 5E9JA 4COOA 3DO5A 3W5CA 1LBQA 2O7SA 5EXSA 4DJTA 2QTRA 4ZT6A 2ZJ7A 1YKFA 2FQQA 4BTLA 4M1EA 3GFGA 2XZDA 1IJBA 4JJGA 4Y0AA 3SXPA 4AY4A 5KREA 3PQ5A 4WNCA 3MEQA 3SYLA 3BK7A 4C21A 5AVXA 2YYZA 1W25A 2XIQA 2Z5LA 1QNFA 3IOMA 2JCGA 4CTMA 1Y6RA 3I8SA 3K6RA 1FUEA 4U3JA 1GAJA 5IH7A 4R4JA 3K70C 1I6KA 3E4CA 3BA6A 3OMLA 3Q98A 1DIOB 1AXRA 5T5QA 3DOEA 3NGMA 4DMLA 2NTVA 4QBHA 1GNVA 2D0IA 4D80A 4V3BA 4J1QA 1W4CA 3DZDA 3RDPA 1T36B 2K7FA 1IN5A 5BSTA 4BUZA 5H3LA 1ESZA 3WL3A 4DL9A 1NQWA 1NJFA 3KCQA 4Z4IA 5AHKA 1KP3A 4LWOA 4EVSA 4FYYA 4PG8A 2QRJA 2R7KA 1HA3A 4OJNA 3P0IA 3IH5A 1ZMOA 1CNFA 2FGKA 2OEPA 4WW0A 3UC9A 1TKAA 3A6GA 2Q3DA 1C50A 4GOOD 2JFGA 4F0JA 1XZIA 4KR9A 4QO8A 2J3JA 3DDWA 1J42A 4FC6A 4FMCB 1H69A 5LMZA 1XAJA 4ZKDA 4I4TB 1B2RA 3I0MA 3ZLTA 2XUJA 5DO9A 3K0AB 3MHPA 4Q3DA 3UOWA 1X9HA 1E8DA 4S05A 4P32A 5EA2A 4DLLA 3L7NA 3SLRA 1NJ2A 3H2JA 3K09C 4OI1A 4GOND 1J9GA 3W06A 5CFPA 1QTQA 5CPBA 2F8LA 1SQSA 1T1SA 3GT7A 4IYJA 4J0HA 1RAEA 2IVZA 3WIBA 4D5GA 2EKLA 2X8BA 4F72A 5I4KA 4LBWA 2NTEA 5ITZB 2ORIA 3OCXA 2WT8A 1A8HA 1NUQA 5KINB 1PDOA 1QYDA 5CM8B 2POCA 3L84A 3AR3A 3ZXSA 3ZVRA 2COUA 5JPIA 1N0UA 4C76A 1B26A 1O2DA 2JLBA 4H27A 1B6TA 3WK9A 3GFOA 7AT1A 3IT0A 1G59A 5IXJA 2WJHA 1YFKA 2C9ZA 3F97A 5EWMA 3EVGA 1P39A 1KMMA 3I9V6 3HA2A 3MMZA 4OGLA 1CY6A 5FTWA 1XTQA 2NO1A 3IB3A 3BL6A 1V7QA 5MGBA 3S1SA 2ETVA 2GEJA 3PIDA 4CE6A 1XKTA 3Q1KA 3BEDA 4L7VA 3LC7O 1WO8A 4QG7A 3OIGA 3W7VA 3DAHA 4J16C 4H1UA 3ZHVA 1K86A 4C22A 4X1IB 3ZTYA 4K9RA 5ALGA 1ARZA 1EUDB 2PLWA 2HHAA 2IV7A 3LY7A 3PFFA 4OHUA 1NW6A 2Z95A 4IVNA 3A1DA 5DVZA 3UBMA 3PRKE 1A9XB 3AJ8A 4EHJA 2WPNA 5IAGA 1EP1B 4DPMA 1HZZC 2UYQA 5I4BA 2FOLA 2WU8A 4L76A 3HCDA 3U17A 3I5XA 2OXEA 3R5HA 2AMYA 3DE0X 1KZ1A 1SUCA 2C2XA 1NVWQ 2RGYA 2W5UA 2ZANA 4LHEA 4MWCA 4B4KA 4EA9A 3AFGA 1I1HA 1LZLA 2FF5A 4CDNA 1Z4KA 1OT3A 3IB6A 3K1AB 3O3CA 4GVPA 4AM8A 2EJWA 3M4NA 3NUZA 3D4LA 4Q48A 5EE5B 3NYRA 3KYCA 5FWAA 4DDVA 4REQB 3ND6A 2AN9A 2VAVA 5HGXA 1UZAA 1Y3DE 4W8GA 3G85A 4CI0B 4F3RA 5JI2E 5J4LA 4O4JB 1V4VA 4ZVSA 2AZTA 1M1ZA 3RYCB 1L4EA 4GO1A 4UTPA 1JXOA 3MILA 2GEBA 1CVRA 4PZLA 4G0ZA 3WWZA 1B6RA 3C4VA 3G0IA 3HWRA 1HSZA 1Z5ZA 1E1DA 2E6KA 4F86A 4E1AA 5IRCD 5FPQA 3L04A 1XD8A 2EEPA 1GUZA 4Y6QA 1EFCA 4PYIA 2HIHA 3JQDA 1YWGO 3IXQA 2OGSA 4HAWA 1NNUA 4HQLA 4IG4A 4DJDC 4EPRA 2C4UA 3VNVA 3Q6NA 4JC0A 3JQAB 2W2PA 1HNNA 4KQ6A 1M2FA 3W5JA 1K5HA 1GNLA 2CNWA 3I37X 4OX9Y 4U0KA 5IVDA 2ID8A 2GM4A 1CTQA 4HH0A 2AK3A 5BQXA 1M0WA 3FTQA 2ZB4A 5AM5A 3BJIC 4ARCA 4GGPA 3A10A 5GM1A 4MNTA 5JWHA 1XDWA 4RKRA 1C0KA 3VSDA 5HRCA 3TFOA 2HSZA 1ULHA 3KYDA 1JT2A 2FW8A 1IONA 1IPEA 2AD5A 1PL6A 3OF2A 1VSUA 4FK8A 4HX9A 3AXTA 2EP5A 4F56A 1TAQA 3QXHA 3IBGA 2B0JA 3F3SA 2VSYA 3EXHA 3RUHA 1QIGA 2NSHA 1VI5A 2IOQA 1Z18A 2XTAA 1DEKA 3GFPA 3V00A 2R66A 4B8WA 4OSEA 3FCCA 2C5HA 5ERYA 5LN1A 1DIBA 4Q6BA 4XB2A 2PT9A 2R97A 3C3JA 4C4XA 3AHHA 4F5YA 2HYIC 3O21A 3CVVA 1GILA 2OT3B 3IV7A 1I4DD 3GBSA 2AOVA 4FZ5A 2EFHB 1E5XA 4ZYTA 1ZKMA 4F6CA 1F0PA 1V47A 4MR9B 1D7OA 3F96A 5K4HA 2BSQA 1UC9A 2HREA 3N28A 5LDGA 5CCEA 1GFZA 4BO1A 4JUBA 4GDMA 3BKWA 4Y1FA 2H1CA 1Z2PX 4RESA 1Z17A 1EXMA 1MQSA 3HB4X 2Y1WA 2IU3A 1FMLA 1M74A 3HEAA 1X94A 1L7NA 4GPEA 4XSGA 4BMPB 5AQ1A 4M53A 3GDHA 5CX1B 3WQBA 1X13A 3P20A 5FNVF 2W6NA 4RA9A 1ZM4A 2ZI9A 5LA6A 4JYZA 1RQ2A 4E2XA 2D5LA 4BLOA 3A04A 1WZUA 3FR8A 4P22A 2GUWA 2XOKA 4QPPA 1K4MA 3HC7A 3VR2D 1RRKA 2AOWA 3WGOA 2F8SA 3HXLA 4DCJA 2AF4C 3D6AA 5AKLA 4NYIQ 4PYLA 1D8TA 3PE3A 4TTVA 4YNBA 1NVXQ 1XCGB 1ADGA 1FLAA 1M2NA 2IKQA 2JFBA 1C3EA 1GAQA 5JS1A 1JS1X 2JD2A 1C7IA 2JEOA 3FLBA 4HL6A 1J1UA 3C39A 3G0BA 1ISRA 1XL1A 3GZJA 5TSDA 3UB4A 2WSBA 2HDNB 1NBIA 1QIJA 2OZPA 4P08A 5BORA 1G21E 2BBWA 2GZSA 3PF9A 2VH1A 4DJJA 1E64A 4K7JA 1A27A 2HNBA 4I3FA 4O4IB 5FR2A 3RCBA 5L7TA 4W5TA 4AX8A 3BD9A 5GTDA 2PUHA 3DBRB 2VL7A 2WICA 4N40A 2E0IA 2WYHA 2EATA 4MRMB 4Q47A 4W7IA 3WAJA 2BCGY 3C45A 3RSQA 3PC6A 4PX5A 4TTTS 4XSVA 4D5EA 2HJGA 1CLUA 5C4IA 4O25A 3O3OB 2C1XA 3G8BA 3ZX4A 4G5GA 1ESNA 3VR6H 1KY3A 1I2DA 4S1PA 5FBWB 4CUKA 3CUWA 1KOFA 1M6WA 4DMRA 2QAGC 3CVUA 1BHQ1 4EY8A 3CCFA 2ZB2A 3FKSD 5AT1A 3ZHRA 1JG4A 3BREA 1XNHA 3GYBA 4ID3A 3TOSA 2ZWMA 1TVKA 5JBNA 1EB8A 3HZHA 3ZU4A 1CQWA 4RTRA 4S1NA 3FHJA 3LXRA 3O3NB 1A2QA 4URZR 1AS0A 4KLAA 2ZKIA 2IEYA 4QGGA 4Q4AA 4TL8A 2OHXA 4YTEA 2WFAA 3OTIA 2DFTA 2OFWA 1MHPA 2WJWA 4CMKA 1RZVA 1ADJA 1DG1G 2FOIA 2GZ3A 4PG7A 4DJAA 4QUKA 5DBOA 2CVQA 4FZ3A 1G7CA 1WD7A 4H59A 4TYYA 1LQUA 1W5AA 1YB5A 2P4HX 4DDWA 4QQRA 2P40A 1UT6A 1A7AA 2DWUA 2IDKA 1VCIA 3TQRA 1RPTA 2C7GA 5EJGA 2PGJA 2Y71A 4BWVA 1FYVA 2C4NA 4HDKA 3UAZA 4BHTA 2R85A 4QX6A 3JASA 4DRXB 3OZBA 1ZVQA 2O50A 2R8PA 4JVLA 5TPWA 3KPYA 1JAHA 1MMFB 4HDNA 2VHQA 2PSHA 2XXJA 3EW9A 4UM9D 2EKZA 3L1JA 3I2JA 1CUUA 5TS3A 2TYSB 1CUFA 3ZU6A 2HF7A 1L8XA 4XFKA 3ONWA 4FD3A 5DM0A 2DLNA 1UBLS 3T12A 5I7VA 4TSRA 4KXNA 2P91A 2ZTMA 1S7CA 5F3DA 3O3MB 3WK8A 4F8JA 2RBGA 4YQZA 4BO6A 4N41A 3LIPA 1SVKA 2O2EA 1AUPA 1ZJJA 4PZPA 2CK3A 1TJPB 3WWYA 2IIBA 5JU6A 3KB1A 4EECA 4QL3A 5DB4A 3NT5A 3PXUA 4I1PA 4Y6GB 2H18A 2FZWA 3E9ZA 3SC6A 1LLDA 1C29B 1YQXA 2NWQA 3PDWA 2HBQA 3GD5A 3QWHA 4C3UA 1M0TA 3KJQA 3UOAB 4ZJPA 6YASA 5IULC 3M82A 1J2RA 2G0NA 3KTAA 2OILA 2TMYA 4Q16A 5KMGB 1YACA 4NG5A 4MITA 1JN0A 4OU4A 2OP1A 1DWOA 2DAPA 1N5IA 3E1SA 1NJSA 4H1WA 1T2EA 1UJ4A 1W76A 3HABA 3G2PA 2XE4A 1W4BA 3Q2KA 3QLVC 1UODA 5E2IA 2OXTA 1KZYC 1QDUA 1KYYA 5L3SB 3I04A 4ZVQA 3MWEA 1SG6A 5DI3B 3C3BA 5EY5B 2BFWA 2FEWB 4H15A 2I8CA 4PQGA 2P5SA 4QPNA 2F9FA 2Y93A 3CUEF 3H2KA 2FZLA 4XX0B 5D3MB 1T5LA 4OBEA 1QGDA 3MXTA 1Y1SA 3GMSA 3QENA 1ODTC 4Z86A 2LIPA 2Z2IA 1DLIA 3NWPA 1F12A 1M2VA 3I23A 2I1LA 3ZHTA 4YUXA 2J0SA 4TYWA 4QYSA 3H5VA 2IS4A 4H7JA 2GF0A 4ESOA 2DB3A 1R2QA 4N7JA 5A4JA 3DE5X 1JA1A 5SICE 1IOWA 4LE0A 1FXWA 2EYQA 4C7JA 4JODA 5K51A 1M1XB 2QZ4A 1VLVA 5HE9A 4PSCA 2EYUA 5K3BA 2F6RA 3KVRA 3LT1A 2GFIA 3G23A 3KOZA 4F21A 3GQBB 4GXQA 1ZRNA 4K6MA 2OLEA 1G2OA 2ICAA 3GNLA 3VUEA 4BLQA 2QMHA 1G38A 4CYMA 3JYLA 1E2EA 4L02A 1O8BA 4BMVA 2HMWA 3MBOA 1ILEA 4F4HA 3QKWA 2ZTSA 1P1HA 3FJ1A 1EK6A 1U9IA 2JCBA 4K46A 3WSWA 3I92A 5LP6F 4WXYB 2W6PA 1JSZA 4JI8B 1GZ5A 4GFDA 3VH2A 2AJCA 1PW5A 1FLNA 2DHCA 4QWMA 1U6KA 3SSAA 3TIIA 2NVUB 3BE4A 5DTEA 2VJMA 3T9CA 2J6BA 4AC9A 3ZBUA 5AJWA 3QLJA 5C31A 4I50B 3EFBA 4E1VA 4DM3A 1JVNA 4IIGA 1TZMA 2IOFA 2NPIA 4BPBA 3M4ZA 4R3NA 1V96A 2GAJA 4CLEA 4LF8B 4RCYA 1QUFA 2AHRA 3GMTA 2BUCA 3WL7A 2Q49A 1UM9B 2CZQA 3B5IA 4HO1X 4IKEA 5AR1A 1GOTA 1YE8A 2H9YA 4FSHA 2HNAA 5KNBA 3BTSA 4P83A 2WU0A 5BO5A 1Q3KA 3ROMA 3S3TA 1A2BA 1ONNA 5ADUS 2X58A 4JHXA 4JLKA 3SSMA 3I0NA 4C7VA 4NS4A 3JATA 4UNPA 1JNYA 1U5AA 2CXPA 4QBKA 2P9BA 4MKGA 4MWBA 4NMLA 2J6HA 2AG0A 3F1KA 3IVCA 2AFIE 5KWIA 4YV2A 1E63A 1Q7RA 2GQ0A 2IYUA 4D81A 3W05A 4R2LA 3RADC 1HLFA 4B84A 2OBLA 2X5KO 4JWTA 4K0RA 5A9SA 1EA7A 3M7IA 1BQ3A 1CJSA 3HDGA 3LHKA 3NOOA 4HQKA 4NR0A 5DN6A 3TINA 4D4GA 3SZOA 5FOXA 1L5KA 4XIJA 2FAXA 1ZO8A 3WMRA 3KSUA 1XTTA 5JH7A 2XAUA 4ESEA 1RABA 1TM7E 1U3WA 3ODPA 5L3ZA 1F3LA 3NB0A 1G5HA 3BXOA 4PG5A 3WSVA 5FWXA 2GTIA 1NLMA 3MJTA 1J00A 4EG1A 2XUIA 5B6JA 3NXKA 1AKWA 3L8HA 3TQOA 5LMCA 2IW3A 3R5XA 4R2MA 4MW7A 1OIWA 1X6VA 1XF9A 2X3YA 4OXYA 3AF5A 1ACJA 2ZS7A 5JQGB 2ID4A 3IELA 3OJEA 4YUAA 4M21A 1P8AA 1QVAA 5IAKA 3O4VA 3WL6A 4YFYA 4X64B 1GEGA 1MO4A 2J07A 3BXZA 4MRAA 5K9ZA 3T9FA 3M5DA 4QKQA 2O8DB 5EMHA 2J45A 4DE5A 4PGHA 1A3CA 3IKVA 1TX4B 3IPYA 3OZSA 4G56A 2NUBA 1PK8A 3BGDA 2H1HA 4G81A 5A5GA 5TVKA 2HQOA 1CS0B 5DSZA 2O2GA 3QFRA 1B0AA 4R68A 3UKJA 2VK2A 3GEPA 2I4TA 2J3KA 1JAZA 2ZQYA 3BPSA 4QPCA 4YPOA 4EFMA 3V9AA 5IJ9A 1Y63A 2QTTA 1B6GA 4KV9A 4E30A 4R40A 1YAJA 2HA6A 1R12A 4D3FA 3URMA 1XVAA 4GMFA 1XD9A 3IT2A 4ROTA 1RM3A 2HX1A 1U0OC 4JI4B 1CJTC 2XUFA 3GEIA 2A0UA 4LXHA 1SUWA 4IJMA 5GGXA 5M3BA 1P19A 5A05A 4DVGA 5IZCA 1MD9A 3OECA 4GNKA 1C9EA 1ZK2A 5JSZB 2DPGA 1H3FA 3P0HA 4G09A 3DJFA 1EFKA 3C8ZA 4KDEA 3TIFA 4BWGA 1E79D 2QXUA 3DVQX 4M87A 3VR5A 3KT3A 3T4UA 3P19A 5AFSA 2CXOA 3O8OB 1QHNA 4RMHA 4NENA 4FFNA 4GL4A 5CU7A 2VPXA 4D92A 5F23A 1JIQA 1WIWA 2BMVA 3QPAA 2HEGA 4QTUB 3ICQB 1T4MA 3RD5A 4I99A 1TU3A 2ADFA 2ORED 4G2TA 4JGBA 5CT8A 2NVOA 5JNRA 4JXJA 621PA 2O3QA 4C2AA 2G9RA 1TZBA 3COZA 5KQPA 3GBVA 3NEYA 3W1EA 2FDCA 2MYNA 3GGOA 1D6MA 4Z51A 1BE0A 1ZHHA 3AF0A 4LQ4A 3GG9A 5H83A 3HRHA 4N9WA 3PNOA 4LQCA 4B3TB 2EHDA 3NTLA 1WNTA 1YQQA 3FETA 4MQ4A 1M2JA 5REQB 2C9DA 4IX9A 3LHFA 1URPA 1T5IA 4D8YA 1SG9A 4FMBB 1F0KA 4QOFA 3OG9A 5IK2D 4RLSA 1SXIA 3E5HA 4G1MB 1L1FA 4TV9A 3AL0C 2ZIUB 4XLZA 3JAKA 5TC4A 1QM5A 4Z0HO 2ZU6A 3AHDA 2B0CA 1O8CA 5B6PA 1TI7A 2QJWA 3C3XA 2CY0A 3KWJA 4AT1A 3IRVA 4OYLA 1HMPA 3AR9A 1JBEA 4RENA 2FV8A 4S24A 3WIEA 4AYTA 5G1PA 1VHJA 5B1HA 2ZZNA 1E7YA 5JY1A 1K7SN 2IUFA 5LYYA 4NH0A 1HT1E 1Z73A 1UFOA 3ZX5A 3M33A 2IYAA 3BHIA 5K4GA 4YRJA 3THWB 4RVUA 4JZKA 4PCVA 4YFVA 1U1DA 2MIIA 3R8FA 4AIIA 2GJ8A 1Q1ZA 3TTSA 1LI7A 3A6EA 2GVDC 2M32A 3U7QB 2QS9A 1YA8A 2IW1A 3GEEA 1K8XB 3FBWA 2JG3A 4P38A 3PIRA 4MPJA 4EO9A 2CFRA 2DM6A 4B74A 1RIFA 4L2IA 2I4MA 5DN9A 1J56A 2JGDA 3LLCA 3U09A 2C04A 3WNDA 4PPQA 3OUTA 3HVHA 3JZIA 4ZPJA 4R05A 4BKQA 3T3NA 1NVEA 1TUBA 4FOOA 4QDTA 4JBYA 3LF1A 4QATA 1JP7A 1JTVA 3K1YA 4CEIB 4OV6B 3ABSB 4YRBA 3LUBA 1ZIXA 4CWAA 4UOQA 2BIFA 4INOA 1XZKA 4P4SA 1BH6A 4OA5A 4RKYA 4UOEA 3CKKA 3CN7A 1LF5A 1M6EX 1YUBA 4ILKA 4KJXA 3CVJA 4EW1A 2R44A 3WNQA 5AJZA 3EN0A 4FXOA 3PDHA 1KR5A 3E1GA 4MKIA 4DY4A 4PYJA 2GEKA 2AFHB 1II8B 1ODIA 1WZIA 3QMMA 4FOSA 1HTBA 3QBJA 3ZE6A 5IFKA 4D1YA 1KI2A 1OXBB 1O7JA 3ZDCA 4GX1A 1M2WA 4PZ9A 4BNGA 1MENA 1UXGA 2E2WA 2BRUA 4FMDF 2ZTHA 5E1DA 4HNVA 1OYOA 1NYTA 2VYNA 3INTA 4ZQHA 1EKXA 3LVFO 1S3GA 3BD8A 3DFMA 3I5MA 5LA6F 4N6OA 4W5WA 3DKRA 2P4QA 5C5IA 1AC5A 1ITZA 2EQAA 3RFTA 3UHJA 2CJXA 2B1JA 4XQEA 3TPFA 1XDSA 2QYHA 3OZ7A 1ISPA 3AR7A 4IJ6A 4AICA 5BV7A 4ZK6A 2ZB8A 2CUTA 1O9GA 2ZUFA 3E15A 3UHOA 4P3PA 4NQZA 5SZHB 3EVDA 4CM9A 4Z7OB 2XB2A 3ID6C 1DFHA 2C2HA 4ND8A 3RQIA 2MSDB 1L0BA 3HDHA 3RUIA 3T3EA 1GL7A 1W581 5AKIA 2JFYA 2TSYB 2YWJA 3MA0A 1LC0A 2FMFA 1W46A 4MP8A 1KBQA 3REFA 1O94D 3PE6A 4DBLE 1FYEA 1W4ZA 2FFJA 3A4VA 3I6BA 2H7YA 3NEAA 1OLUB 1T4CB 4Q9JA 1G8SA 3EMDA 1Y6JA 1R50A 3SIPA 2E4VA 3MWKA 3B36A 4M8NE 4TVBA 3OZCA 5IABA 2O6LA 3G89A 4UEJA 5LPNA 2O8BB 4PZUA 4UMDA 4J7XA 1JHMA 3E22A 1NM5C 4IQGA 2GKGA 3L4EA 3DBLA 4PLPA 4ZJZA 5JAIA 3K8OE 2B7BA 1SCKA 1OYWA 5F52A 4E5DA 3PA6A 1G5QA 1OA1A 2XB8A 4RV5A 1YZFA 3STWA 2WR8A 3N3BC 4L5IA 3WDMA 5EJ5A 1D8AA 4R01A 2WAMA 2ZJZA 4N7MA 1LPAB 2Q9BA 4AMUA 4GH5A 2NXWA 1NPYA 3ZE2B 5IT5A 1I6WA 1NN0A 2JAHA 3HK2A 3F7MA 1TO1E 4GPTA 3VNBA 3KJEA 3VNSA 1JMKC 2EX1A 1LDYA 1OWLA 5ESWA 3OC0A 4KTTE 3MINA 5C7LO 5DNVA 4QT0A 4Y0NA 1VHWA 4OLAA 2FE4A 2R1VA 4LJRA 5L51A 4Z4EA 4YP0A 1EFRA 2CSUA 3NOQA 1N2CB 4XIIA 1Q1NA 3FVVA 1OKKA 1GTG1 3LC0A 2WTEA 5E3JA 2PNFA 1QLWA 1WP4A 1N5RA 1FU8A 3ZZTA 4Q3AA 3QTBA 2ZJ8A 5FNVB 4BNFA 3CSUA 1BDBA 3OQ6A 2GEDA 2GETA 1ZN8A 3LUPA 3FSGD 4DLUA 1W29A 1XRRA 2XEDA 3DONA 4AZ3B 3LQYA 2D5BA 1NTOA 1R5OA 2FPKA 1NOKA 2A57A 2QQEA 3IKJA 4NULA 4W1PA 1DJMA 2C9CA 4L0MA 3ZIUA 4MVJP 4WX2B 4A5OA 5TQ2B 3ZDFA 1O5IA 2OORA 3WLIA 5JANA 2MSKA 1EINA 1OFHA 4WVLA 3UKOA 3VUFA 1OREA 2WFZA 1DCMA 5ELMA 2VDUE 2WTMA 2BFBB 2R84A 4YCSA 1G7RA 2BW0A 1KI9A 3HGTA 4CM6A 5BSFA 3O7MA 4FILA 5FTMA 3C3AA 4CR7A 3IIEA 4XIFA 5KNDH 3T1YB 2CKMA 2G77B 4YQEA 1K3UB 4H1VA 2O52A 2ZW9A 3R9XA 1EVJA 3CNLA 1OPRA 3N76A 3BC1A 2FWBA 5CHYA 5IJAA 2WWVD 3VKUA 2VHYA 5EN4A 2IF0A 4Q3EA 1NL3A 3JARB 1EM8B 5JMOA 2ZIGA 1X74A 1D03A 1ZMTA 2J0UA 4TKVA 2Z5FA 3WOHA 3PEWA 1TTTA 3ND5A 3TD9A 1L5ZA 3N74A 3TGPA 1P1FA 2JBHA 2FEMA 1KHTA 1KH2A 1Q0HA 3EGIA 3RBZA 1UQRA 3MGCA 4E5SA 1C3JA 2GPSA 3MJVA 4GMKA 4JBIA 2O57A 2W37A 1WP9A 1DC3A 5BN3B 1H8HA 2JJ2D 2PA3A 3PSHA 4MUKA 3IP6A 2PMDA 3RVOA 1UPCA 3C6KA 2BKXA 2PKEA 2WNIA 3BGOS 4B79A 3U7FB 2Z30A 1PYOA 2HDHA 4L9RA 3URKA 4Z9XA 4ARZA 1THMA 5JVDA 1HL3A 4FQ7A 1OGIA 4UHBA 1FXWF 2O8NA 1Q0RA 3EB9A 2PRYA 1Y8CA 2F43B 3DWGA 3HY3A 1VYTA 4P33A 1RXVA 4WACA 4MVJE 1BW9A 5JZVA 4HVCA 2RKBA 2YASA 4QOJA 3OQBA 2H2GA 2X8WA 1NVTA 3PBKA 2QNIA 2BDTA 4ZN6A 1TMKA 3TNLA 5CA1B 1TPZA 1C8VB 2UZ1B 3EWSA 1W36D 2HI0A 2J5KA 3RUCA 3STXA 2QB5A 5KJEA 1KIMA 3NOVA 2R00A 2R7NA 2X8LA 3OU7A 4JQCA 4X62B 2O8CA 3NYQA 4CT5A 2NUTA 5COBA 1X9IA 3I1FA 5HHTA 2EQBA 1C4OA 1UEXC 2J9GA 3FBTA 3TQIA 5AVTA 1W8DA 2H07A 1Z62A 1AG9A 2H85A 1IN8A 3GRPA 4LGVA 4BP3A 1CETA 3FFTA 3B6IA 3MRSA 3OMXA 3PV0A 3FB4A 4OMFG 3NNDA 4ZO9A 1IK4A 5JDIC 1NMQA 3IAM6 4MI9A 1I4OA 3FDJA 3IEPA 1VBNA 1E2IA 2HSEA 3HO8A 3LP8A 1OLOA 5JZSA 3P4YA 1FUYB 4KQJA 3FTCA 1Z7BA 4KK3A 2BFDA 1FQWA 3DTTA 2X2FA 5IF9A 2O0HA 4MKHA 4UAGA 1FFGA 4R1PA 4KOEC 3H2SA 5DX8A 3A4TA 2KBEA 3IT3A 2IBSA 2I1QA 4AS3A 4C4PA 1N5JA 4YUZA 2ZDQA 4R8KA 3IE1A 3FFBA 4J9VA 5K8CA 3SYNA 3JZDA 2A30A 2A0FA 1Q2UA 3FOWA 3O8QA 1QPZA 1WOYA 1DV1A 5C46F 1NSYA 2CKDA 5JH7F 1ZUD1 3DHYA 2EZUA 3EZLA 5IU6A 4BJ5A 2R79A 1PUIA 2IZ0A 3G7UA 3OETA 2OCDA 4GUDA 3FHCB 4E07A 2B61A 3AI7A 2FZ4A 1A50B 4NE9A 2BZGA 2CNNA 3Q41A 1KO1A 2QQ0A 1FFCA 1VFPA 2ZVPX 3ONFA 3RK4A 1TF2A 2H9IA 4NG4A 2I7VA 2K2QB 2NM0A 3IQGX 4QUGA 1NUHA 1K8YB 1MAWA 1T0UA 2VNAA 1E4EA 2CXUA 2AI3A 4JYPA 2ZPTX 3EZYA 3ADBA 3BHNA 3KEFA 3VOAA 3NRCA 1LS6A 1OC4A 3P7MA 4ICIA 4C7BA 2VWGA 1DKOA 3PNPA 1DQPA 1JLLA 2PSFA 2VLIA 1W88A 3G13A 1B74A 3ANNA 1E89A 1E2NA 3HG7A 1SKAA 2REXB 1P4HA 1DC5A 1WV1A 3LUGA 4LZJA 4MRNA 4PIVA 1KNQA 1RCTE 2QW0X 2X42A 4N5LA 4OJQA 2JF0A 3B3JA 4Q1VA 1KQ3A 4CZ2A 2IDJA 3M6XA 3S1AA 3K71B 1ADCA 1CFZA 2XE8A 3N8IA 4X7BA 4L8VA 2HQ1A 1UK6A 1ZLXA 1M54A 2FW7A 2JBAA 1RVV1 4L7QA 1YA4A 3ZWCA 2WQ7A 1U6IA 1YFJA 3THXA 1OTXA 2R8ZA 3BIOA 2HMAA 3LZ6A 4Q4HB 3V6LA 4CCSA 4EY6A 3EZ7A 1ZD1A 1I5RA 2P3OA 3GL9A 1UMDA 5DISB 4EELA 2NNLD 4Y0VA 1O58A 2JGNA 4AQYB 5I9IA 2A8YA 2EKDA 2JAQA 2A14A 4NE7A 4OGWA 4XWYA 2FUKA 4LRTB 5D3ZA 1US8A 3ROXA 3SHVA 1G21A 5EJMA 3VO2A 4YMLA 3SCZA 1XMQB 5DRYA 4GRIA 3Q9NA 3G9QA 4OFXA 4TRNA 4U3JB 5K3SA 1KE1A 4R81A 1PLLA 5DSXA 1YIOA 1BQ4A 1HM5A 4UNRA 1UXOA 1P1IA 3E03A 4L8WB 3UK7A 1YUMA 1GTSA 4RQTA 1HYBA 2SECE 3RRYA 5HFJA 1YQDA 4BLPA 3E9DA 5DLDA 1USUA 3R7NA 2H4HA 4A3SA 4AFNA 2A9JA 3BH6A 3F6RA 4WJZA 1I51A 3KQKA 1SOWA 3MVEA 4X8MA 1XRQA 1UBFA 1PGOA 1AOXA 1F5SA 3KKPA 5CT5A 1CNEA 4ZQFA 4N9QA 2X3UA 3E8XA 1T4DA 1ECCA 1L4HA 2VQ6A 5EMNA 1WMAA 3RVSA 4K88A 3TB6A 3NDIA 2IUYA 3N2KB 3R24A 1ND5A 1Z22A 2DKNA 2YXBA 3ICOA 4QQKA 3FDZA 5G0UA 1TTQB 2BEVA 5L53A 3LBIA 4H7EA 1KQGA 5B1YA 4ZPXA 1QU2A 1A7JA 1ZNXA 3T7CA 1TGVA 4G0WA 1XVTA 5ILOA 3DAPA 4A36A 1A2KC 4EJ0A 1Y80A 1VCOA 3KTOA 3ML1A 2YN2A 1UAAA 3WFIA 4ZVPA 4TV9F 3TOXA 1MX5A 2J5RA 5HTOA 4JJZA 3BXFA 3BKXA 1H6CA 3S2IA 2DUMA 4PC1A 4QJBA 5K20A 2DHDA 3NATA 3C24A 4PPFA 3IP9A 2Z4RA 4FHGA 4MRVA 4C04A 4HLUC 2XITA 5ES3A 4MQEB 2W4IA 2NO4A 3B12A 3OEHA 3D7NA 1K5PA 1E1LA 1YRLA 3IJEB 1ODLA 4RE5A 5IARA 3VFDA 4MB2A 4MVYA 4BP9A 2P3QA 5EWMB 3L3BA 4BGIA 3RVJA 4HUQB 3P9ZA 3PD1A 2VDMB 3AUFA 3M3HA 1SXJE 1D04A 5GM2A 3Q72A 2OUIA 2AQHA 1LSOA 4H2DA 2I5PO 1CUXA 1DHTA 4TUYA 1XRPA 2B94A 1FP4A 1CR1A 3K5IA 2WWWA 2JD0A 4JA2A 4JIGA 4BWFB 1PG5A 3F67A 5A0FA 2PUBA 3PR1A 1FCJA 2X5XA 1N0HA 3WKBA 1R4ZA 3VR0A 3L0BA 3QITA 4EI2A 2YWBA 5B4UA 1SIOA 3K9WA 5T57A 4IOJA 3FOEC 2QRPA 2OOKA 1AGRA 1E2HA 1N2OA 3ZLBA 3CRNA 1WL8A 2QRQA 1CC1S 2QIPA 3M4YA 2GNPA 3AIKA 5HILA 3TS1A 4AJ9A 5SYMA 2V7TA 4OSOA 7YASA 4RWZA 2XKJE 3IYLW 3RH0A 4RACA 3CUVA 2C7RA 1QBKC 1MPXA 3QJYA 4LG1A 1YBHA 3PA8A 1LDNA 1R16A 4KWTA 3ZWYA 4CTKA 1P44A 4IH4A 1D0IA 4WN9A 4UHDA 2DR3A 2YQ4A 4WA8A 1H6AA 1N6LA 4O5OA 3HHEA 1X2BA 5EJFA 1SVOA 5FBZA 1GZHB 3EBOA 3K9LA 4FX5A 5EHQA 5BV8A 1Z45A 1R6TA 4BO0A 3K9GA 2O3SA 3I1YA 1S02A 5G4KB 5DCYA 4FJ1A 3B1XA 2FVXA 3KFVA 3DL2A 4XCQA 4ZGBA 2X4DA 3Q88A 2GBFA 4M7PA 1QQ6A 4MK4A 3ZDAA 2F8TA 1VJ0A 5T6BA 3Q5EA 2BKAA 2F3RA 3ENKA 3DL7A 1VJ1A 1YQGA 3MC1A 4GXNA 4H9GA 3UO8B 4HQ0A 1F17A 1EIWA 2YV4A 3PR3A 3UGJA 3QNWA 2CL6X 3LVQE 1LK5A 4CLDA 1L5LA 2Q6OA 1UM8A 1F9EA 1JLHA 2HRZA 2GPJA 3H8SA 1SBQA 1Z16A 3OZFA 4RHFA 5DLEA 3ZKWA 4G0UA 2C4HA 5J3JA 2PQ2A 2AG1A 1GUYA 2Q2QA 2HWXA 4N3NA 4UZEA 3G7NA 5I8ZA 3BXEA 3VNQA 4BCDA 5A03A 2XSZA 3SVTA 3VO8A 4RJJA 1BJTA 3H1AA 4FYVA 3IBYA 3KQVA 3KYDB 4TYPA 2W4QA 2BVNA 3F3KA 4MQ5A 4ARIA 4YMVA 3FROA 3F9RA 4EM6A 3M6MD 5JNSA 5KNBH 1AQJA 2OHOA 4AF8A 4FEYA 5KNDD 1NVVR 3H1BA 5LFAA 1TAGA 3H13A 2RG1A 3EXHB 1CPYA 1RHJA 4IDFA 4WTOA 5AH0A 1LRJA 1K3TA 2DHQA 1PBTA 4IICA 3V7YA 2YWDA 3L05A 3ZXUB 4HBGA 4D8WA 2OZKA 4KIJA 4DGSA 2PRKA 4NCXA 4D4KA 2ZE7A 3OCUA 3W2GA 2A0WA 1DLJA 3OQNA 4L3OA 4DR3B 1NLYA 4XX1A 4MV6A 4OLFA 3FVRA 2DZDA 1GZ7A 4FNOA 4RMIA 1GR0A 3BSSA 4XGQA 4MI6A 3UANA 4KLCA 1CIPA 3U39A 1IHYA 3GMIA 5G1OA 4XVQA 4P5DA 4R1LA 4Z4FA 5IUNC 4UVGA 5J2UA 1BEEA 1VHQA 2B4AA 2ZRCA 4ON9A 3KQTA 2FOXA 3EIUA 1BO6A 4B5LA 2FJUA 3KAPA 1DELA 5DHQA 5CBKA 3MHTA 1QO0D 5EFZA 3ZW8A 1J0BA 1T8RA 2YV3A 1V1JA 3K6KA 2C88A 4Q9IA 3OE7D 1GGMA 4DRZA 4BFVA 2R60A 1CIJA 4BLWA 1O0BA 1Y7PA 2PLAA 2C3MA 3VNUA 2PGIA 4FMDB 2XCSB 4YP1A 3O95A 5IC4A 2W93A 4EKGA 1V5FA 2ATVA 1WDMA 2Q1UA 1GZ4A 3AU8A 4ND2A 5LA6B 1WOMA 3FGNA 3RIGA 3V8PA 1YBMA 4G4SP 4KKVA 4E7PA 2AC2A 1GPAA 2QL6A 5LQJA 1AMOA 3C8UA 3WK5A 1BD4A 3ZOZA 4D97A 4F7DA 3D3JA 1ZVMA 1R6XA 4MUMA 3RODA 5ELXA 4YMSA 4DCSA 3ROPA 1DFIA 1JBQA 2BN4A 2LDXA 3QEKA 1NQUA 4P4LA 4C0LA 2I3ZA 3L7BA 3VI4B 3TLGA 1JIIA 1T29A 3BRWD 3F5DA 4JASB 3OQOA 4Q3NA 4AF6A 1WTAA 3EZGA 3HR8A 3FUTA 4B0OA 2X2OA 3M83A 4MXDA 4ER6A 4D0RA 1VSBA 3B20A 3NETA 1LJUA 1MOSA 4IDCA 5JISA 1TCBA 2JIQA 3QVSA 1OAKA 1S9HA 1RTKA 2LE0A 4U2BA 4WOJA 4XYBA 4BMDA 2WRZA 3VV2A 3WE7A 2YY6A 3C1OA 4JB8A 1Z5NA 4B33A 1U7WA 5KYXA 1OH7A 3WLJA 2AUNA 4FE3A 1FX1A 3IIKA 2O3JA 4G1BA 2QDKA 4A8HA 4E2FA 4ZGWA 4HK4A 3HUDA 4GC9A 3TUJC 1NQTA 3HSSA 4QU9A 5GJVC 2QY9A 2E1PA 1KDPA 4EA6A 3A7EA 1XEAA 4D9GA 2VYVD 1L5SA 1SK9A 2GD2A 2B4YA 1DEXA 3F5MA 1HWYA 1S8FA 4MRRA 4GOMD 4P3NA 4MGHA 1CQIA 1J9ZA 1E3IA 3VR5H 1W36C 4WECA 5HS4A 3VYVA 5LSAA 4B3SB 1RLJA 1NAHA 3JQGA 5BR8B 2FPGB 2V9ZA 3NANA 5E6SA 2XQVA 3F46A 2CXXA 1YB1A 4CNQA 3H4TA 1N5KA 4X8HA 3N2ZB 2VP5A 2X1VA 4LHXA 3AP1A 3OOYA 4YDRA 1SBCA 1TVKB 4ZYWA 3FCYA 5GZ3A 1ISFA 3ZDXB 2OLJA 1QHYA 2L0XA 3VR6D 1T6NA 2DYKA 4QOGA 4Q4AB 2Z43A 1U8ZA 4YLEA 2CB0A 4B8YA 1FQOA 5IHXA 2D1FA 2H48A 3FOFC 2HO5A 5CNJA 1T2VA 4L6IA 5JVDF 4R7ZA 5AUNB 3T61A 4PGAA 4KNYA 2Z6UA 3IOBA 1Z37A 1U0FA 4H6XA 2A9QA 3DUFA 2JGAA 4Q00A 3GFTA 5B6IA 1CERA 1Y5MA 1PWYE 1ZQ1A 2XWBF 5ED4A 4OHZA 5JYCA 2F3TA 4ZWNA 2H1LA 3V55A 2GB4A 1BE1A 1E9RA 2GERA 3AX6A 3DVRX 3AKCA 3GARA 1JA9A 1POXA 2GSWA 3O47A 3M4XA 3KVOA 4HDKB 4EGCB 1JHVA 2ESRA 3JASB 4OAPA 3QPWA 4RTNA 2H3EA 5TPWB 3HLKA 3R6LA 4QBIA 1SPXA 4DEXA 5TR9A 1ZGZA 3QSYA 4HDNB 4BLVA 1UKVY 3LGSA 1HLGA 2E49A 5TMPA 3TX6A 1E98A 4URVR 1RS0A 1Y33E 2IEAA 1RJWA 2HPZA 2QW1A 2WM2A 3EYWA 3ITDA 4B3JA 5LUAA 3SQWA 1N2BA 3CH6A 3CUSA 2Z58A 3IQZA 2XZOA 4CKZA 5IN4A 1O4WA 1QX3A 2HRDA 1Z2NX 4GEGA 5H82A 2FR8C 2OY0A 3SXUA 2Q29A 2YV2A 3R9KA 2NQ8A 4R71A 1JPVA 2GCGA 2IPNA 3HVJA 4UAVA 5F5LA 4QOEA 4BJHB 1G4AE 2HJSA 3GAAA 4RZUA 1RI5A 4ZO6A 1SBNE 1Y1RA 1NMEA 2Q99A 4GPAA 3IKTA 4M99A 3EF3A 1SXQA 1KOJA 3IEKA 3KLBA 5FAKA 1MX1A 1MRSA 4KSYA 1NNSA 3VAAA 2AKEA 3FPFA 4PRYA 3SZMA 5BP7A 1TF5A 1R66A 4P3XA 4RADA 4TS1A 2FEXA 1ZQ9A 3M70A 4S0XA 5EJ9A 3KTAB 3OX3A 1W49A 3QU5A 2PO7A 3LBNA 2O4UX 3PC8C 3WBBA 3MQFA 4K6OA 5GJCA 4D6YA 2HFKA 3OPNA 4JCOA 5F1OA 3BCHA 3LLMA 2QROA 1J6UA 1E7MA 4OGKA 2RK4A 4YROA 3IEMA 2PUDA 4JMLA 1JPJA 2HB6A 2QP9X 4IXDA 3MWEB 1NU6A 3DLPX 2AOTA 4LX8A 1A8QA 3M6IA 4JLUA 3V42A 3R3XA 1TIPA 4RVSA 3T35A 4FBGA 1RHUA 2F17A 3CSSA 3RVMA 4H35A 1RI4A 5ADVA 4X60A 2V4UA 1NVBA 1QQ7A 2P6OA 3AXSA 5ADWA 2EC5A 1M2VB