2AYYA

Solution structure of the e.coli rcsc c-terminus (residues 700-816) containing linker region
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
121
structure length
121
Chain Sequence
MGGSGVEGLSGKRCWLAVRNASLCQFLETSLQRSGIVVTTYEGQEPTPEDVLITDEVVSKKWQGRAVVTFCRRHIGIPLEKAPGEWVHSVAAPHELPALLARIYLIEMESDDPANALPSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor kinase protein rcsC
publication title A New Structural Domain in the Escherichia coli RcsC Hybrid Sensor Kinase Connects Histidine Kinase and Phosphoreceiver Domains
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 121
sequence length 121
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09456 RcsC RcsC Alpha-Beta-Loop (ABL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ayyA01
2AYYA 2AYXA
chains in the Genus database with same CATH superfamily
2HCFA 3Q5DA 5IYZF 1SCIA 3W8EA 1WP9A 1EPUA 2Q9AA 1G8MA 2ZITA 1TUBA 3IALA 3CPHA 2VEOA 2ZB3A 3CMMA 4IH4A 1GPUA 4DLXA 4EYOA 5JECA 1N4DA 5ALEA 1PZHA 1H1LA 2V7TA 2WF6A 3HB9A 5BMOA 1XZIA 4RDCA 1DIAA 1KRHA 3UCXA 5LM3A 4Z53A 1PZFA 2OKGA 2AXNA 2B3DA 3TLXA 4DW8A 4Q18A 3GQBB 4Q3NA 2QPLA 2OL4A 2Q50A 2NO6A 1S3GA 4KE7A 3MSCA 3FLBA 5JS1A 2AE1A 5AVVA 4ER0A 1R88A 4CLXA 4B87A 1G18A 2QVYX 3NIWA 1AKNA 1OGJA 3CFYA 1OWOA 3ONVA 2N3ZA 2C31A 2QJOA 4HFJA 3JVUA 4MW7A 3OZXA 2I9PA 3WQSB 1AUPA 5JO9A 5AW6A 1L7XA 2ZBDA 3AR9A 1JYEA 1I9CA 1UQTA 2B78A 4RKEA 1E9RA 4YASA 3ZLVA 3TZCA 1XU4A 2IYOA 2PZEA 3GJXC 4YO8A 1XZFA 4FGZA 5HS4A 5L7TA 3WJ2A 621PA 3AOEC 5DK6A 3UHPA 5J4KA 1Y4UA 2CMDA 3KJXA 4YRJA 2JEZA 3KEFA 3D3KA 3VPHA 1KERA 2GVNA 4UCXA 1VJ0A 4CKCB 4D3SA 1W5TA 1NMEA 2DBRA 3RRFA 2JJ2D 1D9ZA 3GDWA 1CLUA 1DIGA 5C53B 4M4SA 2OPHA 1FW6A 5A02A 4LMPA 2G7MC 4BVKA 2IYPA 1E3IA 2X7JA 2XE8A 3CM0A 1F1JA 1JHXA 3H3XA 4ZDWA 3FNIA 1KP9A 3M6MD 3PPXA 4FHGA 3QU9A 4HWTA 4Q82A 2XIJA 3CVWA 3NHPA 3NWOA 3R0IA 5EWJA 4YUVA 4FZJA 5I3CA 1DDGA 1K98A 4IV5A 5AXDA 1LH0A 5FBLB 5IPFA 5JVDB 3SDSA 5D84A 3L0YA 3AHJA 4KQEA 1YZHA 1KGDA 4CI0B 4ND2A 2RH8A 3B13B 1U0TA 1LJUA 4R8SA 4DM3A 3IBYA 4ZIRA 4DV5B 3IP6A 1BA3A 3QKSB 3PPWA 4I9UA 5HF5A 1M66A 4A03A 1UXGA 4OL0A 3FDIA 4ROTA 4Y9UA 5DMXA 4XWYA 3BS4A 3G2JA 2CB0A 4B5KA 4D8TA 3GLGE 5LQMA 1DQZA 3DC2A 2WSSD 3GJ5A 2Q0QA 5D2CA 2OBFA 1A2QA 3UIEA 2BLNA 4A8PA 5LOVA 1N78A 4LXUA 2B8JA 1PJLA 4G25A 2JJ8A 3B5IA 5L45A 1DQYA 4YY3B 4B2YA 4QDKA 1LD3A 1NW6A 1ZWLA 4S3MA 1C1XB 2QT9A 3CZMA 3KZCA 2PSSA 1QJ4A 3BIOA 4JJEA 4UJ5A 5KYWA 2RGDA 3AVQA 2DSTA 1UJ4A 3MGBA 3QNUA 4XPIB 4ZQIA 1IVNA 1OBHA 3GLGB 2FJUA 1YQ9A 1E9BA 3HKEA 5BWNA 3LFTA 5EIAA 2VAVA 3FUWA 4IICA 1KZYC 3HGTA 3ZCTA 2IUEA 1K6JA 1FSZA 3B3JA 5L3QA 1T8UA 2FMIA 4NZMA 3M4NA 3TZ6A 2KBFA 3NHUA 1K1EA 1Q1ZA 4NCAA 1RBMA 1L5YA 3K9LA 3CEPB 3R77A 1XTVA 2Z1DA 1QRTA 3BD7A 5DWVA 1Y81A 3BL8A 3OEHD 4LXIA 1ODKA 2ISSD 3KTOA 3A4IA 3A11A 1GTSA 1ZRNA 4I19A 4P93A 4KUGA 5C8ZA 2KLHA 5EPEA 4Y1FA 1MOSA 2QX7A 1KDRA 1LNQA 1UJBA 4BNYA 3QEKA 2H31A 1GSIA 2ERXA 1E4EB 4AG5A 4N3GA 4PHCA 1KDOA 3QFSA 4MARA 3ZU2A 5A3QA 1NVDA 3TLZA 3NBUA 4ZPJA 1W4ZA 3BMQA 4R2IA 4TS1A 3KB1A 4QOGA 2R97A 1R8JA 4IFIA 4LJ9A 4NBKA 5KEIA 3LX5A 3B52X 3KLOA 3LY7A 1QQ6A 4MVXA 1ZGHA 3W79A 5JTUA 5KVSA 4DV2B 1ICIA 2G9VA 4EABA 4EARA 1RMTA 2GHRA 4I14A 4MOWA 4DV7B 4Q4AA 2HPAA 4WQMA 4QM7A 3AR5A 3H0EA 2XUIA 5K6RA 4QQRA 1FB5A 1UK6A 1PQPA 4K6KA 2XGGA 3DXXA 1T24A 3CUTA 1SA0B 2IXAA 2Z4SA 4MRRA 3FAZA 4N5HX 3I5YA 3RVQA 1IIRA 1C41A 4RTMA 3DMTC 3GX1A 3H11B 3ZWAA 1AQUA 5FF9A 3S2FA 1BCRA 1IBLB 1U2PA 3ZV4A 3M7IA 2K2QB 2N46A 1Z12A 1YZVA 3CLKA 3LHIA 3LQFA 2GHQA 3JQQA 4ACBA 4BMYA 2HEIA 5F3DA 4DA9A 4CMJA 1QIIA 2AJDA 2JLYA 4QXRA 2HWXA 3AEZA 2J9ZB 1T10A 3SHQA 5JWOA 1DCTA 2NV0A 2NXCA 2PN1A 4CR8A 4B6SA 3SYNA 4OAQA 1FTYA 3GRCA 3BH7A 2AV6A 3N2KB 1BXGA 4KRXA 1H9BA 2EL9A 5HJEA 5DX8A 4G85A 4P4SB 3FYDA 2BFPA 1HEYA 1ONNA 1W47A 3SBOA 2GVZC 1I5OA 2X13A 3I8XA 2BCJQ 1B0AA 3ZHOA 4XGQA 2C92A 4DLYA 2EARA 3IE1A 2Y0EA 2WKQA 4B7AA 2BJHA 5DXFA 3U3XA 3U7FB 4OQPA 2X58A 3HZHA 3G0GA 5MN4A 1JQLB 3VKFA 2FZ4A 2PXXA 4DQDA 2D2XA 3P9NA 5A06A 1W36B 1ADGA 1IFXA 2AQKA 3WBKA 1EUQA 3AUYA 1PO7A 3KUUA 3TE7A 1EG7A 3D1JA 3DWEX 4ODIA 5KOYA 4KWEA 4JQOA 4TMWA 3BSYA 4R83A 5F5XA 4D43A 1G8JA 1L5WA 5EOVA 1PG0A 4KBFA 4V0LA 2WZBA 2JHAA 2Q6VA 4IOLA 1VLMA 3B6KA 4F6LA 1E7SA 5CB4B 4V0MA 2V0GA 3G5TA 1YR8A 2WYOA 4ZOLB 4YJGB 3TL3A 2R2GA 3LMKA 3K9WA 5SY6A 1N75A 3RYCA 2GVDC 2YWRA 5AOCA 1XMSA 3H2SA 4M9ZA 2KE5A 1EVJA 4N6GA 2W6CX 2AOTA 1IN4A 2G82A 1X9HA 4BX9A 1GSAA 1EFVA 2YRWA 1RM0A 1QC5B 2XTJA 3RIMA 2O6HA 3VPGA 5BQOA 1O54A 1PK7A 4GX1A 2BSQA 2EQAA 3MSXA 4BNIA 2V74B 4L4XA 2VQEB 3FTPA 3LO5A 5HF9A 4DEXA 2UXBB 3TOCA 1WQ3A 4C05A 2WW8A 5ALIA 3K6SA 5EJ7A 3E9EA 1D2RA 2PMWB 2VIIA 4UJ3A 1D7OA 5FJIA 4I55B 1WU7A 2EOAA 1GG9A 2I7VA 2NQ2C 2ODQA 2WIAA 3FHOA 1L8XA 2GAIA 5DI3B 5IUJC 3LPMA 4IRMA 5KTYA 3KQTA 1WEHA 1ZI9A 4E5VA 5IN4A 1YA6A 2QTLA 5EE1A 4AMYA 4B8YA 2VNAA 3OLXA 3OX1A 4M99A 1BH2A 1WPGA 3DB2A 4BO9A 2OD9A 2Y0DA 1NDQA 1E2UA 4ZV7A 4QODA 3PC8C 3FZGA 3U9TA 5BWOA 1U0FA 2C77A 3DVAA 1RPNA 2BDTA 4D1YA 4J6FA 5DYTA 4PLYA 5B30A 1ZJ5A 3FMOB 3OIFA 3FOCA 4D4KA 1TU3A 2PO5A 1A7UA 2Z5GA 2VT2A 4EUKA 2AOUB 3X0DA 5J5AA 4BO0A 4XARA 4RIGA 4US2R 3GWZA 4QKQA 3I72A 5TT0A 1HEIA 4QDOA 3RNLA 1KOJA 3IHKA 4PQYA 2J6BA 1GDDA 1RWPA 4ZCLA 1CUVA 4XWGA 4N3AA 1HE2A 2G9UA 3KVOA 5BYKA 4CEJA 4ZRDA 3LA6A 4J90A 1A9QA 2BM0A 1GUYA 5E38A 1UZAA 1B23P 4UOZA 2J87A 3QE0A 3GGDA 2EBHX 3OICA 3VR2D 3P8ZA 1ECFA 4DQKA 4PQEA 3BXFA 4TS9A 3CY6A 5KYXA 1D6NA 1DX9A 5YASA 1NVWQ 3DA8A 5KX5A 2I6SA 4QU5A 3U7GA 4GI3A 1BZYA 2NVUA 4F8JA 3UFXA 2B83A 5BVHA 1CZUA 2XWJI 5ALGA 1OFHA 1YONA 4KXYA 1T8YA 1YGYA 2I76A 3GZNA 2A0YA 4XYEA 3WNVA 3RVMA 3RNOA 3ZU3A 4J0FA 4D56A 1Z4MA 2WFLB 1EGVB 1IM5A 1ZNQO 4R1LA 4RHUA 4J0QA 3ZGLA 5ARBA 5F33A 1EFRD 4HLCA 3AEQA 4M0CA 3PX3A 2HGSA 4M98A 3FTFA 2ZGVA 5FBVB 1GFWA 2QRLA 4RVGA 1TYZA 1Z7BA 1BEEA 5A1JA 2PS9A 1GL9B 2BF7A 4KYVA 2OECA 4OOFA 2HRCA 4WD3A 3COVA 5K3BA 5TE9A 1LK5A 1VM6A 2DU8A 3DO6A 4LA4A 3UJBA 5IDXA 1V1MA 3PEWA 1PWXA 4DLNA 3IV9A 4X7PA 3IUSA 1ZISA 4JODA 4GBGA 4QDXA 3OZBA 2EKPA 2I4OA 5BN5A 3THSA 4ETMA 4RY2A 5L3SB 1S2LA 2CHUA 1DADA 4IXDA 4ARZB 2ZXFA 4YCJA 3U3RA 1XL0A 3W6UA 1A5BB 2A1UB 2AFHE 3R74A 5AHWA 4CDNA 2WKRA 4OQXA 3JSAA 2ZSEA 1LF5A 1MG5A 5G41A 1UCFA 1TQ8A 2JGDB 4FT2A 4JOCA 1ZFNA 1AF7A 1CR1A 2AR7A 2QRJA 2WSMA 2H52A 2O7NA 1UDBA 1OTYA 4MS3B 1GUDA 2B98A 4MV1A 4LVCA 1B2LA 3WLQA 3U1BA 3NALA 1U0HC 2ADMA 3S99A 3W5DA 4BC0A 2P4EA 4G9GA 4HWRA 4DQXA 2NPOA 5EZ6B 1V16A 4F4CA 5CHEA 1LDYA 2C9MA 4FW8A 3HCWA 1NNUA 1FMCA 1NJFA 1NQWA 1PK9A 2A5YB 1P17A 1V45E 2HBQA 3PRHA 2DR0A 3KXDA 3IAS6 3Q7SA 2VT3A 4N7RA 5FI1B 4D4HA 4YAKA 2IWHA 2XD9A 2R1TA 4WZAB 1BGWA 2VATA 1X8KA 3L8EA 1YAJA 2OQ2A 1JG1A 1T8RA 2ZI6A 2CKMA 5LQDA 1HNXB 1R6DA 2EFYA 4EFMA 4MDFA 3OJLA 2V8OA 4D82A 3E35A 1CQPA 1EFPA 1KYWA 1MQ9A 1SBYA 3UMGA 3HZZA 3TJRA 3V7UA 4N8DA 2XCIA 3DV2A 3GFPA 4O4JB 1B00A 3LGAA 1BDHA 5MDHA 3KLMX 3WGKA 3IQWA 1E4YA 2ZI3A 4ERNA 4FTWA 1CQIA 1R74A 2WB2A 4P4UA 3QKRA 2M6KA 4J16C 1K8QA 4HNSA 4IS3A 3V1KA 4EA9A 1QORA 5KC9A 4BQSA 1VBKA 1ZAKA 2VZEA 3NB0A 2XKAA 3T0GA 2FW7A 2PLRA 2V6BA 1IU9A 4OHBA 3FOWA 4E2YA 2A94A 4Q15A 3U37A 1L5RA 1PGQA 2VBCA 4BQEA 3ND5A 2IYNA 2XTAA 1H5NA 3DHWC 4Y98A 4HAOA 3RVNA 5DOVA 1G3IA 3BGWA 4LYEA 3FSEA 4RK4A 4WA8A 5B1HA 3TZHA 1IRIA 1ZA1A 3KCNA 2QG4A 1DT5A 4BBJA 1VIVA 1TAQA 4I4CA 6PFKA 4C29A 1I3NA 1QLHA 4GZ5A 4L5CA 3JVVA 1Z0UA 4W4TA 1ZY2A 4QGSA 4JQSA 3QVVA 2Q5OA 1STOA 4HDNA 1JHYA 2FG5A 2R96A 2OHIA 1CUAA 2BBOA 5I8WA 3FI0A 5KI6A 5J2UA 4FYHA 4G4IA 4TLDA 4YB8A 1TEHA 4E21A 3TECE 3R24A 1U2DC 1N8SA 1RKUA 2C3UA 3JX9A 3RASA 2IELA 4DYVA 5KSYA 1WXFA 4Y3UA 1U28A 1OAAA 2AS0A 2CWDA 1H22A 2ET6A 3KTFA 3L3BA 3FE2A 1SBNE 3LYAA 3T7RA 3AYZB 1L5HA 3TRFA 1WA5A 2IDJA 4F84A 4Y9RA 3HO6A 4RK7A 2QMQA 5IUNC 1ECLA 2BGUA 3E5NA 3KXPA 3ZWCA 4ZMRA 4R1SA 3PR3A 2QTCA 2FZGA 4LE1A 3KBOA 4WNYA 4RGQA 3AVVA 4OH1A 3WTCA 3A4YA 3HLKA 3LO8A 2IVFA 4KXWA 4YMSA 3T1VA 1G60A 3Q7EA 5CFLA 3ZD6A 1PJBA 1VZ3A 1E3LA 2MYPA 5BW5A 5C8YB 2BFDA 1Y63A 4G9EA 3AXTA 3D2AA 1YFLA 1T1SA 5ER9A 3SGLA 5JYEA 1JALA 4GP6A 4P4GA 3TIGA 1E58A 1NUUA 4X8HA 1R6XA 2X0DA 3TQSA 2BF4A 3UA4A 1QOZA 2HLDD 2UVPB 1JPJA 3ZW7A 1EUZA 1KAHA 1YBVA 4FCWA 1P4JA 1FRFS 2VKTA 4HCJA 4RLFA 4PX9A 5EIBD 1VIYA 2J6HA 3WJAA 4PNPA 4V03A 4AJIA 3JQ8B 3T3MB 3TSYA 4CR6A 2F3SA 3PD1A 4BX8A 3H2KA 1RNLA 1YI8A 3EQ7A 1N34B 1F60A 1UBGA 2AL7A 3U3ZA 4C6SA 1P4AA 5HCUA 1D4ZA 2EX4A 2O8FA 4J4TA 3MYYA 4WECA 3QA3E 4YROA 2GUGA 1OYYA 2Z5FA 1YUNA 1E98A 4LV5B 3KLPX 1JEQA 1I5EA 3H97A 1XVAA 2GFHA 4NPCA 2GN1A 2W83A 1W6UA 3MTEA 4GOKA 2QZSA 5BOSB 5KHOC 4BPBA 7ADHA 2R6ZA 1U7DA 4DCOA 1Y9AA 2YN4A 4MVJH 3OZFA 4LSMA 2FV8A 2WFZA 2H08A 2VDQB 4EFDA 1F2UA 5CBKA 2LP4Y 4CEHA 2HJWA 1PI3A 2ZKLA 1NMXA 4E2XA 3LGSA 3WS7A 3ELUA 4OEHA 4AQYB 1P3DA 5CVCA 2RGCA 3OMXA 2DSNA 2GBCA 2WP8J 2H2WA 3LCMA 1UOQA 3A31A 4J7CA 1GSOA 2FMFA 3RK0A 2XA9A 3PYLA 3UC9A 2IYEA 4O5AA 1KNXA 1XTSA 1PD0A 4BO7A 4YYZA 5C1DA 4URUR 2GEFA 5EMNA 9LDTA 5A0FA 4O4LF 1PV2A 2GN4A 2DWQA 2FF7A 3PSHA 2P6MA 5HP4A 3CZ5A 4P3OA 2PYIA 1H9CA 5AK4A 5EJ9A 1ORWA 1PNTA 1QHHA 3QGMA 1IIBA 5I9BA 3UAGA 4EQZA 2R1VA 5CBPB 4LF5B 2D6FA 5ALVA 4HY3A 5JCJA 5A3SA 4IQ0A 4WKOA 4DC0A 4QGGA 2XB8A 4DARA 4YLGA 1JVBA 2EJVA 2G17A 1C4XA 1K7FB 1V2HE 5H0IA 4Q4JB 2FWNA 2WE7A 2WWGA 3BB1A 3GJZA 3KD2A 1Y82A 3WADA 1RLOA 3ZEAA 2HJHA 2Q7XA 4M88A 5JROA 4PLWA 1RHMA 4FT4A 4YJ3F 2ZAMA 5K6AA 1N1EA 1CRQA 3I5AA 4S1PA 1YT5A 3NWPA 4J9VA 4LI0A 3V4OA 4RNCA 2XODA 2G5PA 3EDQA 3JV7A 4OP3A 2R84A 2EZTA 3N2GB 1UDRA 3RFFA 3IVGA 1RZRD 3DP7A 2E85A 2I54A 1AE1A 2WM2A 5KMGB 2JA1A 2IHKA 5BSWA 2YWGA 1E5XA 2DPGA 4BQFA 4Z4QA 3SSNA 3VNQA 2HUPA 1E2HA 4IUDS 1CVIA 3L7YA 1GLVA 5AESA 4MDEA 2BKLA 4D46A 3DTVD 2ZJAA 3AF6A 2OMKA 2FFQA 5TV2A 5C1BA 3K5PA 3TDKA 1MQSA 1YL5A 1C7FA 2Q45A 2D4HA 1YDMA 3LT4A 3KPUA 4IO1A 3DE2X 1JAIA 4M49A 4XLTA 3TR6A 3T0IA 1JJ7A 2Y2UA 3DE4X 3EIFA 3PC3A 4KXUA 5BSVA 3MWEA 4N12A 2I03A 3B9PA 8ATCA 4WXMA 2Q3BA 3WXMA 1W73A 1ULUA 2QD4A 2VHQA 1VMDA 2XB9A 4K87A 1OH5A 3RTEA 1W1UA 2ES4A 2JBWA 3C7AA 3P26A 2JEYA 2EEZA 2QUIA 3D8RA 3H2YA 4BECA 1OF1A 1WCYA 3P0HA 3WL8A 2ORWA 1E8MA 4PNEA 4RM2A 3N3BC 3ESAA 1V4VA 5EFOA 1NQTA 1CUXA 4EJMA 1OI4A 1ICEA 5A4IS 2R6FA 4L8FA 1ODIA 4AMGA 4ON9A 4FYIA 1E2NA 2IXGA 1J0CA 3WB1A 3DUFB 1UPXA 4ZCPA 1YJBA 2NXWA 4KGZA 5EFZA 4PX5A 2BELA 3G7SA 1MVLA 4ENWA 5BR4A 4JJ4A 1EFAA 1GADO 3O82A 1WMDA 2QYTA 2P6RA 3FFXA 1DKPA 2B30A 2OFWA 2PKQO 3PE6A 4CMGA 2WPDD 1TJ5A 1QFXA 2NVOA 3WGOA 3LUBA 3V2HA 5K4AA 1Q0LA 5KQGA 1XD2A 1P2GA 2O57A 4FFMA 3O2QB 1QQTA 5EMKA 2QE7D 3TSWA 2JAOA 3WK6A 3DM9B 2R6DA 3WLOA 3ZGNA 4HVCA 2E5WA 4HDAA 4N5DA 4URXR 1SD2A 2F1RA 3GQVA 4W7SA 4OK3A 1Z4IA 2V7PA 3EISA 4LNUA 3HJFA 1JLLA 1G19A 2Q0SA 1K6EA 2WINI 1BO6A 4ZQGA 3ZGZA 3IE2A 3Q2OA 3RE1A 1QCDA 1T3ZA 1W88A 4CMIB 4N40A 2GF0A 2GCGA 5EVJA 5B7GA 4B3MB 821PA 3GAMA 3Q1KA 1M73E 2WUDA 4U2EA 1IB0A 4ZQEA 4OFWA 1FVHA 1K6IA 4D8VA 1RFGE 1D8TA 2CZQA 3B6ZA 1SBHA 5KDOA 2ZM5A 3QLUA 2WHEA 3K15A 1U2TA 5CFOA 2JGRA 2M1ZA 4NESA 2AD5A 1I9GA 4YALA 3RLFA 3IR6A 4DDHA 2J4DA 3B3FA 1WE2A 2BEKA 1I1QB 1JPUA 2OORA 4PLTA 4UUBA 5IJAA 3NEYA 3PFNA 2EV9A 3K16A 4JLKA 3RLIA 2XRZA 1UFVA 1W4AA 3QLVA 2H00A 3JRNA 1GNQA 4FFSA 4GQIA 3PYXA 1ZNXA 4PBTA 2W6IA 1A9PA 3L18A 4JLJA 1NQAO 3RU7A 3DW1X 3OFKA 1IZZA 1MB4A 4RKYA 1YR7A 4C0LA 3GUZA 3NPAA 2IV3A 4MV0A 1TAUA 1H9AA 2OO5A 2O0JA 1MNQA 3U5TA 3VYSB 1KQNA 1WKVA 2GKGA 4HVAA 4EMSA 3IRUA 3JALB 4E1AA 1UWVA 2BCEA 3IQDB 4G4GA 1GA6A 3ORHA 3G8CA 2ERYA 3VZBA 1MC8A 1OI7A 3K2IA 3B9RA 5CNJA 2CUZA 2J3DA 1NJ2A 1U3CA 1U0EA 2MTBA 2OGWA 2O05A 4RYDA 4C6TB 1XNRB 5KUTA 3AJAA 3HMQA 3Q9NA 1P7WA 4OUDB 2VAPA 4I9FA 3OF2A 1S9HA 3FRIA 5E6RB 1UAAA 2FR0A 4JJAA 3L1VA 3QVSA 1S2GA 1NJ1A 2RGNA 4JCOA 1TC2A 1WEKA 2KX7A 3IAHA 1L0BA 1BMQA 1GAQA 1NQ5A 4M8LA 2AOXA 4RSGA 2A9FA 5F77A 3ZZMA 4BNUA 4PSKA 4BNNA 4DBLC 3NTUA 5AKJA 5B2FA 3JRXA 4UDXX 4XCVA 1PDVA 3UVEA 3LNTA 1FZQA 5C8VA 2XXAA 1PJSA 3L05A 4PX2A 2XVMA 3SJAA 1GTMA 2VNKA 3CWCA 4IGEA 1PQWA 3KJEA 1UBOS 4W82A 1MUUA 2VHUA 2J5RA 4D9BA 3H19A 1XCPA 4GLBA 4E09A 1H2BA 5AKZA 5E1OA 1P9RA 1GCOA 4GHWA 3EZ9A 3USCS 5CM2Z 5BT9A 1CEEA 1QFYA 4WN9A 3C3AA 3D2BA 2ACKA 2G80A 1KK1A 3IO5A 3PGMA 1EJBA 4LYHA 1ITZA 2BR4A 2EZ8A 3EXG2 1QH1B 2PU5A 1PKEA 4GPBA 4EH1A 1PWHA 2A9RA 5CDTA 1Z4OA 2WZDA 1EHYA 1C5KA 1X7HA 3L8ZA 4PYKA 3Q8LA 1CCWA 2EW2A 5EN4A 1HDIA 1JT2A 4RU1A 4KL8S 1LW7A 4K86A 3N1UA 4ESEA 1NZFA 4EJ2A 2P3SA 4M36A 4PN3A 1E7WA 3KAKA 3NZEA 2LRHA 3CZQA 1TJYA 1SOWA 3GRAA 3NJ4A 5GV8A 3F5MA 3ZIDA 3KZVA 3RARA 2N1BA 2NXJA 4ZC8A 1SD1A 1E9CA 3THWA 2EIHA 4FEEA 2WJ4A 5HRAA 4MR9A 1A82A 4HOYA 4FMDB 1CZHA 5F78A 2G88A 5IWAB 2EGHA 4AJ4A 1CVRA 1JXOA 1RCFA 2I71A 1U8ZA 1RXCA 2F1JA 2NUPA 3Q1LA 4KXNA 4DRXB 2PUVA 1NA5A 4RH3A 1OAOC 3KYCA 3TVYA 2GBLA 1EXVA 2H2IA 2QN7A 2YYSA 3RS2A 1T9BA 3NTXA 1NWCA 5CFQA 1P2SA 1TAHA 3INYA 4MQEB 1YFKA 3DFZA 4MB2A 1M72A 3P27A 2PGJA 4HZIA 5T8KA 3RHZA 3WMRA 2NN3C 3E7XA 3TM5A 3E9ZA 4MV8A 4EHLA 1UIRA 1XZCA 1ZSYA 3GO4A 4NONA 3SNKA 4B6EA 4DEVA 5FOTA 2ZYAA 2PD4A 1EVKA 2YASA 3R3JA 3HUEA 5K8LA 3A6PC 5IAJA 2ZI5A 2PZMA 3AEXA 3B6JA 4YACA 3CN9A 1IAQA 2CLIB 3IBSA 4BP8A 5CDSA 3MT9A 1H85A 5TJHA 3T4EA 2G1UA 1NYRA 4FQ7A 5FBRB 2JCYA 5BV1A 2XMZA 3UHJA 2QQGA 4KVFA 2J6IA 4LYDA 2VDJA 2AQIA 1T0BA 1GFSA 3CBQA 3L04A 3FSJX 4E12A 1K7YA 2EBFX 1VHWA 2JFGA 2QOEA 2WAAA 4EGCB 3ILVA 2PZ8A 3HDTA 4FUQA 4JV5B 2ZSJA 3OUUA 4B3IA 4F9GA 3V8EA 3AQIA 4XWOA 3VC1A 4C1NA 2FK7A 2QRVA 2VJKA 4E5KA 4Y2YA 2ZYHA 1X7YB 5IXJA 1KF0A 1T3HA 2OMEA 4KKVA 1B8OA 3Q9LA 1YKFA 2DCMA 3I83A 3JS5A 3K09C 5EYPB 4UHHA 5G40A 3DDOA 5TQ0A 4ZXFA 5F1OA 1TM2A 3ZDRA 5G1OA 1EE9A 3QLJA 4XX1A 4AZVA 1ZU5A 1Z2AA 1UDAA 4KQ6A 1EUYA 2C4MA 4KH1A 4RFVA 2RCYA 1RD4A 2WB4A 5C3MA 1SVSA 2C8LA 4P86A 3E2IA 4I1PA 3ZV5A 3A06A 2O2SA 1QB8A 4DZZA 1NXQA 1L7BA 2V9PA 3L6DA 3EQ9A 2Z8XA 2PMCA 2R25B 1E3DA 1D1TA 4DCJA 4ER6A 1W96A 2ZUWA 1QU3A 2CDAA 3L0BA 4Z7QB 4I8DA 9MHTA 2VWHA 4XI9A 1Y3AA 3QA9A 1Q3TA 4JFAA 4K81B 3AU9A 4MUKA 4W6ZA 2E7ZA 2GK6A 3O9MA 1TFUA 3AFHA 4O6VA 2P35A 4R9UC 1U6KA 1HI9A 5JI2E 4G0QA 1N2OA 1TW2A 1H8HA 3FMIA 5JRDS 2M1XA 3UT0A 4PZYA 1W5AA 1GYPA 2RHRA 3FTQA 1WXHA 4CFSA 4F3YA 1QRUA 1YB5A 3J7TA 4P35A 2FZLA 1WXGA 2IF0A 1Z4QA 3PR1A 4GX0A 4Q4HB 1ISIA 3S1AB 3VR3A 1N33B 2RHTA 3CRNA 1J97A 3WYFA 4LAFA 1G42A 3RIHA 2I2XB 3DOOA 4KR0A 3UMBA 4AG6A 4AWXA 2QR5A 4TYQA 4P1ZA 1SBIA 3EC7A 3EVAA 3KZ1E 4KACA 3W2GA 4RA9A 4W5JA 4F46A 1S01A 5C7OO 3MMSA 3ZCPA 3A10A 4FDVA 4IEIA 3OPNA 1LBEA 3MUFA 4U2FA 4FU0A 1TM3E 2R5NA 2C57A 3A04A 2ZSFA 3H2JA 1EK5A 1OFVA 3KJFA 4QBGB 4CL8A 1PUXA 1Z75A 3FB4A 3FSGA 5JAOA 2ST1A 2XNDD 4PSVA 2VDPB 4HGNA 5EUCA 3W7AA 3M4ZA 4ZCIA 1XR3A 1N6OA 5H83A 2HWUA 2OYCA 3DO5A 3VPSA 3PL1A 5I7HA 2P2SA 3S1SA 1RSZA 3CR8A 2REQB 1NULA 3H5TA 2YVUA 4HAWA 4B4WA 3PX7A 2BEWB 3GLUA 2AG8A 3DLCA 4M6WA 3KKZA 3IUYA 3QQPA 3T5CA 3ONEA 4UPVA 2H0AA 2O5CA 3G0CA 3PFKA 3MRSA 2VZLA 4NC9A 4CQJA 4KSYA 3IT3A 3HYNA 3H8SA 1BW9A 2P9TA 2RHLA 2O8CB 3VVMA 3N8DA 2SHKA 4DJTA 1OXMA 4GO1A 4TXJA 1CR0A 4ZKDA 3LPCA 4NICA 3ES9A 1PS9A 1XMIA 3RYTC 5ITSA 1LQTA 5SYNA 1CF9A 2OSVA 3QXHA 4LRXA 3UBTA 3TSCA 3NT5A 4QOHA 2CLFB 2B4AA 4D6PA 4ZGBA 2PSDA 5CH5A 5AJUA 1D4AA 1J25A 1JVNA 3LCUA 4MQFA 2PWPA 3P9ZA 4YJKA 4BVBA 3AM5A 4X60A 2NG1A 4H31A 2C95A 1TCCA 5ALKA 4ZI3A 5JASA 1KEPA 2TMKA 2AUTA 2IL1A 4C0XA 2NV2B 1VJGA 1WVIA 1XTJA 2QVLA 3O47A 3I01A 5KPJA 3KHKA 4YCDA 4RGVA 2F90A 3LLCA 2UXDB 1AU9A 1FDWA 4JLWA 2PEZA 5L6LB 2B94A 4HR7A 3TUJC 5I4IA 1W6RA 3WC4A 2IU0A 2PG3A 3H2HA 1UPBA 4M1SA 1DC7A 3ZGXA 5CFMA 3DW3X 4ZV4A 2R6GA 4MWOA 1SXJC 4PR3A 3C3BA 4RZXA 1J0EA 1P2DA 1PYOA 4HTAA 3TOXA 4XE5A 2CN1A 4FLFA 3FWHA 3H18A 1WOYA 4H16A 2QBYA 1R5JA 3NHZA 2O8BB 3G88A 3IMGA 3UWOA 1B0ZA 5HK9A 4KKXB 3A4VA 2FSIA 4LZZA 3REFA 4LXGA 5EJGA 2OHOA 1TQ4A 1KMQA 4OBEA 1JWBB 5TQ2B 3RODA 3PQ6A 4AP6A 5H1YA 1G3MA 2D2EA 4MQUA 1S4MA 3DD1A 1N2IA 3ZDZB 4MA5A 2QU7A 2QMOA 4MV6A 1ZH8A 2H9AA 5IXYA 4YJDA 2YVLA 3L82B 5TMPA 1XNQB 4RTKA 5B3KA 2EDAA 4QOSA 2QB5A 3OIVA 1IHUA 1X9IA 3PNYA 3QFFA 2Z95A 4NP6A 2W70A 4EI9A 3SIRA 1N77A 3EXIB 4LSGA 5J59A 1MP0A 2QJRA 1VMEA 2QM7A 2VDLB 3ENQA 1N2CB 2XA2A 3LQQA 5ARCA 3ZCRA 3EFBA 1VPLA 3BIJA 3GUYA 3C4JA 5IK2D 3O4HA 2J85A 3MBKA 1LSJA 5LZ2A 1U8XX 3AR6A 5JNWA 2HJSA 2Q3MA 2CNWA 3GMTA 2QZ9A 4Q3EA 3H75A 3GJ0A 2C84A 5DHRA 5ALFA 3VPDA 5ISMA 5BR8B 4N54A 3SLKA 5JDCC 3JQAD 3LP5A 2QRNA 4ND5A 4BLWA 3M5CA 4BNHA 3GVHA 3K92A 3SI7A 2HHCA 4HJXA 2R1ZA 3FZEA 4YP6A 4JA2A 1DPGA 2H1SA 3DAGA 4I1VA 4M55A 2H0QA 2FLKA 3DTNA 1H8EA 1MIHA 4IIJF 4KCGA 3T7KA 4TKVA 4X66B 4DPLA 1HA3A 1QV9A 4OGKA 5EP3A 2J5BA 2BGIA 4J2HA 3IRVA 1VB3A 2C58A 2LCFA 3C39A 3FKSD 4OOEA 4XSVA 4UU0A 2JHPA 5ILOA 5GTDA 3EPKA 4R40A 4BE4A 2Z98A 3AKCA 2PNJA 2OFOA 2WIBA 3GPBA 2I3GA 4CR7A 1ZQ9A 3U60B 2CD9A 3W5JA 1EVZA 3MJTA 1ZC4A 4QU8A 2GAAA 2PJRA 3OEED 1M1YA 2IHNA 2YR0A 4QDUA 3IAUA 3LBHA 5BOVA 1UL1X 4NL4H 4RLHA 1U81A 2JVIA 2YWXA 4LSWA 2NO7A 4B6GA 3IDSA 3P2OA 1RI1A 1D1SA 3LNCA 5SZHB 1ZSNA 1Z22A 3H9UA 4LE2A 2GWRA 1P74A 1XNHA 4RJJA 2AYZA 1FQOA 1W85A 1YULA 3PYMA 1V6AA 4S1TA 1VFPA 3LCCA 3MRXA 4FCCA 5DBIA 3QPAA 4PGHA 2B7CA 4M53A 2FWMX 3RHSA 2XE6A 1XBTA 1VOTA 1B76A 3ADKA 4NEHB 2BGWA 4G5GA 1P5HA 4YRCA 1RKXA 2WNIA 3EGXB 3IJPA 1M0SA 1CRLA 3NVDA 4N3CA 5JQGF 3R3HA 3D3WB 4WLFA 3NT4A 4L4UA 5DCWA 1VKNA 1LWNA 5B58T 4E11A 1II0A 1U8UA 4J0HA 2SKDA 1E3WA 1N2HA 2Y92A 3Q3IA 5FA8A 5HTOA 5JHHB 3ROPA 3X2SA 1WD7A 2A9PA 4IJVA 3ETEA 3WK8A 3R5SA 1UXHA 5DNEA 3VAZA 3N58A 3HDJA 4KQXA 5J43A 3ZIAA 4GAEA 2GLXA 3ABOB 4K9PA 1JG3A 1NVGA 1P8AA 4IHQA 2X9GA 2B2NA 4O2AB 4DMGA 1L4FA 1UFRA 2Q07A 3A2NA 2IDMA 3NYQA 4F2WA 5CAEA 3ZUPA 3G3EA 2CFOA 1FDOA 1YCDA 1ZUNB 2CYBA 7MDHA 1A2OA 2PUGA 3Q72A 5FRDA 4B45A 1YHZA 1Y3BE 3CIFA 4FONA 5HR5A 1DX6A 5JC1A 4BMVA 5GONB 2UYHA 2XUKA 4IFTA 3Q7RA 1FEZA 3S8EA 3BD6A 1MC1A 5I48A 3Q3CA 3LP6A 1N5MA 1CP2A 4WNAB 2G5TA 4KN9S 4O2BF 2R7AA 4OCZA 4B79A 1NRJB 1OTXA 4PS0A 5FI0B 2GARA 3P32A 4M3NA 1UINA 4BAUA 4EG4A 1J2YA 2NWQA 2PFSA 1AUVA 1JHVA 2EQBA 4GYKA 4Q9DA 3VR1A 4EGJA 1RAEA 1D0SA 1RHQA 2GNAA 4IJUA 5IFLA 4G41A 3CLHA 1RHKA 3PA8A 2NUAA 3LFHA 1LI5A 4FYVA 3CUEF 2ZUVA 5FFMA 4TYMA 3D8NA 4LF8B 2P5UA 4OGFA 5AOBA 4IDGA 4Z2AA 3UQYS 1OHHA 5EUBA 4EUSA 4XZ3A 3D6VA 3IOMA 4E14A 4AYXA 3ZXXA 2FW1A 3Q40A 1XAJA 2IYXA 4F4IA 3KM0A 1FK8A 1KMMA 1RJGA 1BGXT 2RG1A 4DR2B 3U0VA 1KIAA 3AZPA 3KYJB 2Q4EA 3HZOA 4DC9A 4MUEA 2PXAA 1NPYA 2O8DA 2G4LA 2QXUA 4AF6A 4URWR 2IZOA 2JRLA 2F43B 2D1FA 4DY4A 1C1XA 1OXSC 2CHEA 3K1TA 4GC9A 3PNSA 4NBTA 4RHYA 4I9NA 3Q5GA 3GLGA 3R7LA 3W6PA 3HP4A 1R1DA 3ZI7A 1UQRA 1DEAA 3FPJA 2BHRA 3HBJA 3MT7A 3OAAD 3C87A 3V4FA 5CCEA 4TV9B 2YTZA 2H0RA 4ESHA 1AG9A 3OCYA 5DBGA 1IJBA 1WRBA 1H94A 2J8ZA 5F5NA 4LV6A 2EDCA 2XD4A 4QELA 2W5UA 1ACJA 1FXUA 4JBIA 2MR6A 3OQOA 2WYIA 2SBTA 4D3YA 5IHPA 4IDOA 2CBGA 1Q57A 3ZS8A 3LXRA 3LWDA 1ZOPA 4KPUB 2FXIA 3I9MA 3HYLA 1LLCA 3D4PA 1UC8A 3WFJA 5E6SB 3VI4B 3SIWA 1DRVA 1EM6A 1V4NA 5CDFE 4L51A 3SX0A 4P3YA 4A0GA 4RHTA 6YASA 3QWHA 2YKGA 3PIIA 4DB2A 3B2EA 2X4LA 4LK3A 4Q19A 4CKXA 1DBRA 2RIPA 4A8JC 3E7PA 2OAGA 3STTA 1PX2A 3ZV7A 5G0UA 3F97A 1T3SA 3EDYA 4IGKA 1S3SA 3DEJA 3I9NA 4MS4B 1ZEJA 3DLIA 2VPQA 3KR0A 1FP2A 3C5VA 3RVRA 1DMRA 1DAGA 1Y7IA 5HILA 4CG3A 3P96A 2ZVQX 5FEMA 1G5TA 3GT7A 4GD3Q 4AP5A 1AB6A 5JJCA 4YXFA 2CXUA 4RTJA 4W99A 3SJZA 1VL8A 5C5EA 1O9BA 3I0MA 4Z0NA 4DA0A 1KMIY 4EHHA 4IJMA 1W4CA 2AC7A 5FNVB 4UTPA 2IYVA 4HAVA 5KDDA 2Z04A 4AKGA 4GECA 3H11A 4IGAA 3OZ7A 4I4LA 3CUSA 3DAOA 2NTEA 1F4LA 3MINA 1XQ6A 2IQIA 4DDMA 1Q7TA 4DSNA 4PCUA 3ESDA 4NOMA 4DPKA 2AT1A 3OPYB 2OCGA 2ESRA 4R0NA 3FUVA 1REQB 4D26A 4A23A 4NIMA 1M2JA 5B3JC 2HSEA 3GIDA 3F4BA 4KQ9A 2C99A 1VXOA 2DUNA 1KSFX 3L8GA 4RVUA 4BB6A 2PQ2A 1PVOA 2JANA 3W1EA 3FOZA 3FAKA 2GN8A 1R15A 2VJQA 4DLZA 1HTBA 2YS7A 4N3NA 4ND8B 3VDNB 2CV1A 1LLUA 1NN3A 1YS4A 4YV2A 4C9BA 2VNIA 2H16A 2RGRA 2ALJA 2QX6A 3CT6A 4KMOA 4HUJA 2HTFA 4X20A 1ISJA 2AC2A 5CW2A 1X8LA 5H68A 2HT1A 2GZ1A 4FC6A 4P7GA 1SURA 4W1PA 2BT4A 2ZULA 4YDHB 3I6YA 2GEBA 3AB8A 3T5GA 4CM7A 1TT5B 1M1XB 2IEYA 3IUJA 3NX4A 2HRQA 1NE2A 3KQSA 4LJ4A 4NCNA 3SZLA 3VKVA 3R3VA 3U7QB 1UBFA 4IHJF 2O8VA 3NWEA 5MHTA 3THXA 1LTQA 2YVQA 5HUQA 2CJXA 2XCRB 4UNRA 2BTOA 1JA0A 4KODA 3RPEA 4I4IA 1G55A 2BKVA 1CHDA 3X1YA 5F52A 5K8JB 4D3ZA 2Q4BA 3IAXA 1Z2NX 3L1JA 4HN2A 2O3QA 1EWVA 4IJKA 2YFHA 4B7XA 1DAFA 4LWQA 4C4AA 4KO8A 4JI2B 5AKEA 4WAUA 4XDYA 1X1BA 1U90A 3STUA 4Z1MD 2MIIA 5HHTA 2IF2A 3EZ7A 2DF8A 2JJ2A 4MCAA 5GINE 2BMWA 2GKOA 3ZWKA 2I62A 4ZEVA 1UJMA 1F1BA 1S1MA 3O83A 1U4OA 3SXUB 1NZDA 1QC5A 3UUGA 4N5LA 3RF6A 3AL0C 2DC1A 2PBZA 4CKEB 1CUBA 3C6XA 1IVSA 5DM60 4HWOA 1KVRA 4BVGA 1O5OA 1NVVR 2H2AA 2HCTA 3OD1A 3GYGA 3IA2A 3EXEB 4EMBA 3LDHA 1R5OA 3LAWA 5FWDA 2H4JA 4OK6A 2N0SA 1GSHA 2ZDGA 3NVMB 5DI3A 5TF4A 4HADA 4EATA 2QD5A 1KZ4A 1KI8A 4RCVA 3NTRA 5FOVA 4BNLA 4NAVA 5CB8A 1DE0A 1HURA 2XUPA 3FBGA 3FVVA 4QVIA 5K0GA 3HMKA 3Q0EA 4TUYB 2PX8A 1XOIA 4O4IB 4GQBA 1KO7A 1I51A 3EZFA 3ILSA 3SF8B 3IUBA 1TCBA 2Q5JA 1X86B 2C03A 2AG6A 3LUGA 5BNTA 1OB5A 4B3RB 4X92A 4MGEA 4O33A 3RU2A 2B8WA 3CRW1 4JELA 4C4PA 5KOIA 1ABBA 4R01A 4N01A 4AF7A 4M8NE 1KH2A 3EVCA 2IOFK 1YDEA 5EUMA 3BWDD 3CLTC 3MGGA 5AJWA 2CXPA 2Q4TA 2GTIA 2YJNA 4KO4S 1SHLA 2CCGA 2G9ZA 2HXSA 5JJKA 4I08A 1A9YA 3LCRA 4G86A 1JE0A 1UBUS 1WMFA 4RK1A 3TEJA 3TNYA 4YPFA 1S3IA 3H5VA 1Q74A 2LCIA 2MSDB 2ZIAA 3KPJA 4KP7A 4PXAA 3ENNA 1EM8B 1G7RA 5DU2A 5F1PA 3V4SA 1OV6A 1YQTA 1J22A 3WWDA 5MGNA 4AJOA 1V5EA 2X3UA 2AJBA 4UM7A 2O8EA 3OQ1A 2FPSA 5C34B 4G1BA 5M2QA 1VYUA 1B8UA 1L4YA 3FKQA 2CVQA 3NDJA 2QUJA 3GJ3A 3H3JA 1ZVVA 1OPRA 3Q3GE 1H05A 1X7WB 5HX7A 1VIDA 4YCSA 3QBDA 2VQ3A 2ZAGA 3PRYA 4BMOB 2PSEA 1XAHA 2HPHA 4YP9A 1A9ZA 1MW9X 3H5AA 5L53A 3GCWA 4LXQA 5FOSA 3FY4A 3KSZO 1DG9A 3DMPA 3PEVA 4OM7A 3SHWA 1N6HA 4D4GA 3E70C 3PFIA 5IP5A 3DT8A 2WFLA 4C5AA 2Y27A 1KO8A 4JLMA 4PC2A 1PGPA 2I87A 5JCZA 1SVIA 2X2OA 4ICIA 4N5IX 4NZYA 4RGBA 2C5FA 1CQWA 3JZMA 3A7DA 3SQOA 4QRIA 1LBIA 4HWSA 5ARDA 4XX0B 3SR4A 3WICA 3AUAA 3GRPA 4FYMA 3UKOA 5L40A 2WNHA 4NKRA 3JQCA 2YY5A 3LU1A 1FY2A 4BZZA 1KZ6A 3O1LA 5KCZA 2P6PA 5JAPA 1G5FA 1KBQA 2VUSA 2XGJA 2AEJA 2WT9A 1XRJA 5L3SA 3M3PA 4J75A 3U9SA 2DETA 4PZZA 5ILQA 1VCIA 4ARZA 1A8IA 1SBTA 4LGCA 5BSUA 2GCPA 3CSSA 3JQGA 4IQGA 2AOWA 4PO9A 4C7JA 1KI4A 3M2TA 3JQ7A 4EPRA 1AGYA 1V9SA 3DMHA 1CJUC 3PFFA 5FQOA 1TK3A 3C6YA 3DKRA 1YD7A 2AW3A 4IO0A 2IYWA 1FIUA 2XHEA 1E6CA 3BFKA 5HKAA 3I01M 1GQOA 4MS3A 3RVJA 1XKXA 2QTVA 2QL9A 4OPMA 2AFHA 5LU9A 1W2WB 2CWWA 3LPDA 5LZ5A 3HJGA 3IH5A 1XZHA 4XQGA 1MHPA 2FPOA 4Y6PA 2R8OA 1HM5A 1M6VA 3IIEA 1RLIA 1XJ0A 2C5BA 4OI4A 1GZ5A 5CYPA 1Q7CA 4MUMA 5H16A 4LHZA 3HO1A 2AI1A 4J4BA 3G0IA 3KZKA 4B48A 2H1FA 1E94E 3GRRA 4LCEA 2BFEB 5I7VA 1V41E 1YU9A 1KEWA 3LBYA 1BG6A 5LUAA 3ZE0B 4HXGA 2CCKA 4H6XA 4QU9A 4R1QA 2JCGA 4BY9E 2XWBF 3L06A 2PUCA 2QD2A 4MGKR 1YTUA 3AFNA 3PGXA 1SKBA 3EW9A 3LHSA 2CCJA 5EEGA 4FFVA 4RJIA 1A95A 2QSUA 3EGIA 5DJ5A 2OB2A 1WZ2A 3MM4A 2XMGA 4G81A 4B34A 1BE6A 3GRYA 3OQVA 4N8SA 2H8KA 3AIIA 4XGNA 4ZVMA 2OBLA 4WIAA 1KAGA 4XWAA 3EF3A 3VUFA 4ZZ1A 3OIUA 4C03A 4F60A 4QRHA 1UMKA 2E4XA 4XIYA 3TZLA 1FX1A 1Z0AA 3EVTA 3FH0A 4J94A 1Q7RA 1R4AA 2QQEA 4C0WA 3H84A 1ZBQA 4RUKA 1Z62A 1C2TA 3ENKA 4PQGA 1VSBA 1G41A 5C31A 1AY0A 1GWNA 1YE3A 3QU7A 4KR9A 4F1KA 1T0JB 4EEKA 2IXBA 2V4ZA 1CD5A 2FZEA 2V98A 2VF8A 1AMUA 3LX4A 1C3OA 4D41A 3E4CA 1SUSA 2VTEA 4IZOA 4UASA 3TB4A 3QMPA 4Z3KA 3L0ZA 1PZGA 2BHTA 5EJ8A 2BH2A 1QIEA 3GZTB 4HMOA 3RJ5A 4WCDA 2FPGB 1C4WA 2PSJA 2YFKA 5BYJA 3UTDA 3DDUA 1MT0A 3I5MA 3MGKA 1GOTA 4FFNA 2I55A 3HN7A 3EOZA 1VHJA 3GVIA 2YICA 2O20A 4IHJA 1YDFA 3BE8A 1KSGA 4ZJZA 5JQWA 3PTAA 3DJYA 2EL7A 2P75A 3AP2A 1U2GA 3FWYA 4WGFA 1YHNA 3RRBA 4PONA 5LP6A 2J33A 4BXOA 4MI3A 3JQFC 1BVUA 1JJFA 3L40A 3VH3A 3UC5A 3LC2O 3LOQA 1KPHA 3JYOA 4GW3A 1I2BA 1V8DA 3SZOA 4JVLA 1N0VC 2F64A 1HMPA 1EIWA 2SCUB 1CNMA 1NKSA 1U8EA 1ZH4A 3F46A 1ABEA 2Z2ZA 1NLFA 3K9GA 2FWPA 3WGUA 3UJ9A 5C8YA 2Z8YM 3R8XA 2QUZA 2R65A 3GJ6A 1ZRMA 2GF9A 2JKVA 2Y4NA 1X1TA 3TPFA 2FSVA 2G8NA 3L1HA 5CXQA 5TS3A 5CNIA 2CW5A 4B47A 3WJ1A 1C8VB 5AKGA 4X1IB 3N2ZB 4ZFNA 2X7XA 1W9HA 1Q17A 3MBIA 2MYTA 3TPZA 4K8RB 1QS0A 1EGQA 2FEWB 3PRJA 2WBLC 4PZUA 1VL2A 5HF8A 1L1FA 4DE5A 4EY7A 3VR2A 2QJTA 4CV3A 1K75A 1RQ2A 1OX5A 3E48A 1LJLA 3BKXA 4GLFA 3FVRA 4X97A 3JQ8A 2IKSA 5E0KB 1Z2PX 1THZA 3CT4A 1SHJA 5KNCD 4UEOA 1FFAA 2ZWAA 3BXGA 3EZXA 3KOOA 1C9KA 2CNOA 4YAOA 4KVGA 4B80A 1PG5A 2LDXA 4HLDA 3ZY3A 4IDPA 3W4KA 1S02A 5BOSA 4AZSA 1R0SA 1SC9A 3B12A 4UM9B 1ATZA 2DFDA 1IATA 3T5AA 1FU7A 3KSDO 1TT7A 3G5LA 4UNIA 3NHYA 1GR1A 2R8XA 1I4TD 2G83A 4NYJQ 5M3BA 4Z4HA 4M7OA 3RWMB 4B3TB 5F98A 3FPGA 4CLOB 4L9SA 1T91A 3T38A 4PZ9A 2ZREA 2FTKE 3BOSA 2C8JA 2Y1OA 4HYQA 3G0OA 3H1EA 2IBSA 1K7EB 1PHPA 1VCOA 5FD8A 1OJLA 1ZQ1A 1OMOA 1BAPA 2FW8A 4IMJB 1ZSVA 1JILA 1OASA 1TJNA 2X5KO 3FCXA 4LYJA 4U5XA 2J6CA 4GMXA 3AXSA 3E3NA 3FPFA 4IDNA 5TSDA 4DBLE 4XWKA 2MYNA 4ALNA 1OWNA 5B3LA 4TVOA 3IBFA 3TX6A 2I80A 5JRZA 1U3VA 2NZJA 4PO1A 3OPQA 2O2EA 2Z6VA 4RTNA 4P5DA 1M2OA 2ORIA 3F98A 4GFDA 4MAFA 1QONA 4P7KA 5G0WA 3KE9A 4NCIA 3UK0A 3RSFA 1I4WA 1A97A 4CUJA 3RS5A 3E4DA 1CUFA 5CBPA 2IYQA 1EVYA 1QF9A 3ZD9A 3ZJ5A 4JCCA 2GEDA 1XVTA 4M38A 4ALKA 5ICEA 1JKJB 4XUDA 4YQEA 2FW0A 3R9KA 3PD0A 2BKXA 3NV9A 3VC7A 1IXYA 2JASA 4S05A 1S2IA 4ID3A 3CVVA 1TA9A 4P8RA 4Q4JA 3HDYA 2R751 2FN3A 3AF4A 5MFPA 4B71A 4R8RA 2XDWA 3V9PA 3CF4A 2BJVA 5DHUA 5HEKA 3E8MA 1CJSA 3PQ3A 3MJCA 1CNFA 2NSDA 3EXAA 3MJRA 1Z4LA 4QJ5A 3WLEA 1GV1A 4ZVUA 4BMXA 2YZ2A 1HO3A 3FN4A 2YJZA 2YXNA 3U7RA 6ABPA 1DZIA 1O77A 1IXSB 1NUTA 1BXRB 3CSDA 1K89A 2YJGA 1G5QA 1TF2A 1C1YA 2PH3A 3A6GA 4IH1A 1W30A 3G2IA 3S8MA 4CCYB 1XD8A 1YC2A 4QTTB 3NATA 3WISA 2Q41A 3I52A 1FP7A 3G2OA 5C81A 4Q9LA 1DHTA 1AK2A 121PA 5HJ5A 2VI5A 1TXGA 4NU5A 2IW3A 1LS1A 2I0FA 2ZWMA 4DM7A 3PQ8A 4C4ZA 2W6ZA 4BNVA 4YRLA 3OU7A 3W06A 4I2NA 3DFKA 4X90A 5DXAA 3W2TA 4OYHA 3MBOA 4Q1FA 3WO1A 2PUBA 5CA0A 2JJYA 2PGXA 1IPFA 2G6BA 1M10A 3KWJA 3SE0A 5KJFA 3ZE2B 5HBGA 3KQYA 4AQ7A 3E22B 4LZPA 4FB5A 2D5CA 3EY9A 1U2RA 2FFAA 3N8IA 4P9NA 2FWBA 3NAGA 2I3ZA 3AVUA 4BB9A 4O2LA 1D8AA 5HIMA 4F45A 3OE1A 1NNSA 3A1DA 5IC5A 4I4TA 2YV5A 2I6TA 4V0NA 1VRVA 1EFTA 1FXWA 1ZINA 4PYOA 3SC3A 4DAEA 1LLDA 2FEXA 4QPZA 4Y2GA 1MH9A 2VWPA 5F4ZA 5K8CA 3LXMA 4BNDB 3Q10A 4RY0A 3PXCX 4B73A 1D04A 1SXJD 2F9LA 4Z4GA 1YNSA 5KJCA 4AKSA 2ID9A 3HU5A 3IOYA 1GCAA 3WIUA 1W8IA 1PR0A 1YR6A 5DGDA 2WK1A 2VYFA 4MCJA 5J63A 4HQKA 5KJ6A 4CEIB 2HFJA 1HV8A 1RZVA 4D0NA 2ZRGA 5JADA 2BFWA 1QDUA 2ON6A 4MHSA 1A0OA 4FWIB 4M54A 3HVIA 2DQSA 3IV7A 4NQZA 1P1CA 2J9FB 2UYYA 3GU3A 2B37A 2BWJA 1RLJA 1GTL1 3QELB 4FEGA 5ENZA 3NMUF 4ZO4A 1NVTA 2ZB2A 3G2LA 3HH8A 3QY9A 4MVJE 4WKNA 4L6AA 1CY2A 1NUQA 4CNQA 1KJ8A 5AOVA 4Q3CA 2PRYA 2P9QA 2C5HA 5AI6A 3AI3A 3AUSA 3EGCA 5AI0A 4JI8B 3A9SA 2HLDA 3QJYA 5BW8A 1EFDN 3HUDA 5K4HA 2WD8A 1NATA 4ETIA 2JK0A 1KFJB 2WJJA 3UT6A 2DZDA 1B26A 4PG4A 1A8PA 1QBGA 1QGAA 2CMKA 3FDJA 4MP8A 4XIGS 3L6EA 5JBQA 3WLIA 2RE8A 3H2ZA 1KJJA 1Z2OX 5CXXA 2DLNA 2XDAA 4XB1A 3ZHUA 5LQSA 1VHLA 1ZXBA 5BN3B 3EZNA 4KIUA 4OLHA 5HJ2A 2RBKA 1J2UA 2VHYA 3JSXA 3Q87B 2E4YA 1K63A 3FZYA 3DZJA 4WOCA 1MDFA 1OX4B 3DEKA 4KX5A 1EUCA 2VJMA 3PT5A 3O3MB 1YK1A 1QUEA 1YAHA 4FCVA 3RAJA 2Q99A 4RABA 4MYTA 3GEBA 1FFWA 4CHGA 1GAJA 2W2LD 1G98A 1E6LA 3BWYA 3R4VA 4R9VA 4WZZA 1PX0A 1HT0A 4ZU1X 5IKXA 1SQFA 1MJ5A 5BW6B 1SJ9A 3C43A 5CVJA 5E2AA 5SY4A 1QDEA 3HJBA 4EELA 5F1YA 4R2JA 1J2RA 1MPTA 4EVRA 2JFYA 6REQB 4IAOA 3CNQS 4H17A 3SFTA 2L69A 2DFPA 2YHSA 4GQAA 1A7JA 4K05A 3CTMA 4H1HA 1RAHA 2NZYA 3AM4A 4JZYA 5E6RA 5AK3A 4LOHA 4QYIB 4W1QA 3VHQA 3T1YB 4HZUB 3DBLB 3ELYA 3OWXA 5K3FB 3UMCA 1WPQA 2HJVA 1PT6A 1KQFA 5E4JA 4EJSA 2Q3EA 4RULA 1QXSA 2DUUA 1OLUB 3K0HA 4TVKA 5JAIA 4WH0A 4X41A 3FWKA 1U8CB 3K6RA 5T41A 3ZV3A 4Z7JA 4LWZA 2H2DA 4RW0A 2FN9A 3BEDA 3H4MA 3F6CA 5FI5A 1B0PA 1IY8A 5GGXA 5F23A 3TNJA 3R5TA 3FVTA 1TU0A 1XZBA 2V9CA 4NZOA 4ABTA 3JPYA 4OHYA 3ADOA 1CC1S 1L1RA 3AI2A 2QSYA 2P69A 2VDMB 4YP0A 1E3EA 1WZEA 3KEGA 3PC7A 1PNRA 4D8YA 2VF7A 3A1WA 4FHFA 2RCNA 6GPBA 5EXEA 5AK0A 1XTTA 2X6QA 1DIOB 3VAAA 1GHTA 1F4VA 4PS1A 2QG6A 1GPH1 3R3UA 1F06A 5GAJA 2QN2A 3K53A 1MC5A 2GXUA 2I6GA 4TZKA 2OXIA 4AKTA 2VTBB 3Q8KA 3TSZA 1QO7A 3I37X 1L3CA 2JK1A 3MAJA 1HK7A 1ZWKA 2DCUA 4I50B 2IWRA 2QRPA 4B0PA 5CA1F 5JEEA 1GNLA 4HFMA 4QPDA 4EHAA 4JIGA 3CEAA 2HNAA 4JUFA 5JZSA 2BM1A 2V7QA 1TEVA 5JXIA 3VJKA 4CMCA 5DASA 8MHTA 1IXRC 2FE4A 2WU1A 4URHA 3RRJA 4MKRA 1Y3CE 3ZWXA 5ICFA 1I36A 1P4RA 1PUJA 2P4SA 4IM7A 3FA2A 1EVQA 3CXUA 4JL8A 1E1LA 3DG9A 3SZGA 1Z25A 3WGLA 4CMEA 2NNWB 3SWWA 1Y5MA 2PKRA 2W8BB 3DCIA 4G0YA 4LYGA 4MVJI 2QP9X 4LVOA 4MVJG 1YVDA 1XYVA 3AG5A 5EP1A 3VU0A 2FCAA 3G13A 3WYNA 4BATA 5HIAA 1QKIA 1JFFB 2ZTVA 4K1LA 3RKRA 1E4OA 4ID9A 1K4KA 3QSGA 1T2NA 4DRXA 3HY4A 4TQGA 2I22A 1FFEA 2EYQA 5B36A 3PVSA 5CLJA 2QHXA 1DCMA 1G6Q1 1SXJE 2AK2A 2FQ1A 2X8BA 3VKUA 4LMBA 1NDHA 1DUVG 4IDHA 3AL3A 2AR0A 2J59A 3UH0A 1XMQB 1BDBA 1N0HA 4BWYA 5JG7A 1ZN7A 3LY9A 1O8CA 1MN6A 1VG0B 4RQAA 4BASA 1Z13A 3V00A 2QL7A 4NTZA 4HB2A 2OLJA 3SIPA 4NDZA 2WY2D 3VTZA 4D4LA 3B8EA 3O94A 4U9HS 5GM2A 1FSPA 1I3OA 5DGXA 4DIEA 3MC1A 3MQ2A 2ARKA 1H2FA 1SXJB 1J8YF 13PKA 3OOWA 4B3HA 2X9NA 3F1LA 3BIFA 1OC4A 3OKFA 2ZPUA 1XRSB 2KBEA 3L1KA 4MQMA 3ZLBA 2WPDA 4C4RA 1HFEL 5B64A 1CDOA 2X23A 1SKQA 1GKKA 2ZJ6A 4QDJA 2WTAA 2P79A 2GXQA 1Y1PA 1H42A 2FPUA 3DM5A 4U1RA 2IH2A 2QE7A 3T1OA 3ZNPA 4F93B 2X6RA 3R09A 5A5DA 3WXBA 1I94B 1Q92A 4UDOA 1V8FA 1SB9A 4KHPB 2G40A 3BF8A 3BGOS 3LDFA 2J30A 4MX8A 2VSNA 2LIPA 1QZTA 2ZJOA 4AC9A 3VR5D 2YHIB 3NGXA 1CVLA 3LK7A 5ICCA 1JE1A 4IMIB 4JYZA 1M2WA 2YOHA 2NW6A 1N2JA 3K0CA 3TDNA 5TMEA 3EEYA 4ZRNA 5EYPA 1Q14A 3FNBA 1RRCA 4JQYA 1D6SA 1HMYA 1OLXA 2B61A 1Z3IX 2FLWA 1G5PA 2AX4A 1K3TA 3T41A 5KQLA 5JANA 2WVJA 3PNKA 1XNGA 1GG5A 5H70A 1XCMA 2VYQA 3EE6A 2CDBA 2Y1KA 3N0WA 2O1XA 1NUSA 1O0SA 1K0FA 4NS1A 1Y1SA 3HL0A 1X7ZB 1QZXA 2TMYA 5T4EA 5KBYA 3F5SA 3PQ7A 4TZ0A 5L3VA 2ECQA 1XWWA 2AI2A 3ILXA 3DAFA 2P3LA 3HSKA 3D6JA 3CX8A 4JZKA 4G24A 4II7A 4D98A 4ZA2A 2QWXA 1THMA 4HH0A 1LDEA 1GILA 2CC2A 1MEJA 4XLZA 2PUHA 4FZ5A 4HQOA 3WRXC 4A8HA 3DEIA 4MLCA 4E5YA 3DZKA 4YJ2A 4JT9A 5C4IA 4PZ0A 2QD1A 3BVPA 4N18A 1UBHS 2X0KA 1NVKA 2ZVPX 1Y42X 2NPFA 3DVQX 2BM9A 1IUPA 4K2HA 3Q8WA 5L7WA 1W76A 1OIWA 1YXMA 2VTVA 1WU8A 2YXLA 4B5LA 4CM1A 5EEHA 4R1TA 1V35A 1WSAA 3UV3A 3W2IA 2FRDA 1GGNA 3FRJA 4PLHA 4QXMA 2GESA 4R3NA 1HDZA 4AL4A 5LBIA 1YRQA 3ACBA 1IUOA 3AUTA 3T9FA 4EAAA 4F0JA 1XCLA 4KREA 1MCZA 4RY9A 2KYRA 1C7IA 3LQKA 4UCFA 3T9DA 2RHBA 4BP1A 3UXMA 2GH1A 2QYOA 3H5NA 1N0UA 4YRGA 5F2KA 4GR5A 5IVPA 4X1YA 1P80A 4EW3A 1SZPA 1CE8A 2BE7A 3TNLA 2QAGC 1ZOSA 2CNLA 2NU9B 5JBIA 4BNGA 1YR1A 4H1UA 1Z8NA 1GZHB 1HZJA 3H9EO 3RVLA 3A37A 1JS1X 3DSRA 2FSSA 4XPZA 1H0RA 2BFBB 3BEOA 4H0FA 3TSOA 3UXYA 2ZPAA 4BJ5A 3SC2B 4GRDA 4R1UA 1E0DA 1SCUB 1UP7A 3EGDA 5A7GA 2I29A 2IK8A 3PVCA 4GPAA 3CR3C 4LC9A 2GOYA 4I1SA 4PZAA 1MW8X 2D62A 4OHZA 2FQWA 4TV8F 1M8JA 1TO6A 5COQA 3II6X 4FHDA 3OVMA 3IFSA 2JD2A 1R0WA 1XVLA 4D99A 3GLIE 3EODA 4MWCA 2H5JA 4AMVA 2WIKA 2O7RA 4JXXA 2NMVA 3PXDA 4RVSA 4X93A 1RYDA 2HXYA 2B9VA 2QTMA 4AN0A 3H99A 3B60A 4GI5A 1DEXA 2FCRA 5IN5A 3EEQA 4UAGA 3HM2A 3OE7D 4HRXA 5BQ3A 1H4VB 3JAWB 3O9VA 5G4KB 1NG1A 4HS4A 4DMLA 5JXWA 1F0NA 2VEDA 4HDMA 4PV7A 1POWA 4BN5A 4EJFA 3GLIB 3FTDA 3RC2A 4C1BA 1FJGB 4W5WA 1AXRA 1GA4A 1TU4A 2GGSA 5SZJA 1W93A 3D4BA 3KT8A 3OA2A 2C4HA 4QQFA 5THXA 3WRVA 2YV3A 5F21A 3S40A 1AS3A 4JT2A 2O8NA 2WSLA 4JU9A 3M9WA 4II3A 1FYEA 1LB1B 2GQ0A 3WB9A 1U0OC 4JLNA 4DXDA 1KI6A 2QIPA 5AVJA 2GSWA 3RTGA 2HWWA 3BE4A 3IHWA 2I2DA 4M7PA 4MVWA 4DYDA 1OT5A 5K8VA 3C7DB 5I7RA 4C7KA 4IW3B 4BP9A 5JV5A 2KLBA 4Q9NA 4XVHA 1FU8A 4O1MA 3J80A 1B73A 4DDWA 2ZRDA 4CUKA 1IH8A 2C7BA 4FC7A 1QGOA 4AY2A 1JSZA 2ZM6B 1M1NA 1GUAA 2QX4A 3HDQA 2V3CC 5CFRA 1XWIA 2PT7A 3ANNA 4FWBA 5DLEA 5H3LA 4K6MA 3MVEA 4NJEB 1TUIA 3P2MA 4Q37A 5D1NA 5HZKA 3EBOA 4I8XA 1AO0A 3LH5A 4ESVA 3TKYA 5KO2A 2DFVA 2DH5A 4LRYA 2O8BA 2OCKA 3ROGA 2QM3A 3U1VA 3CR7A 3P9IA 1N5IA 1R2QA 2A59A 2QZZA 4WFIA 4CF5A 4UTNA 1W25A 4UBLA 2HR1A 3D8UA 2C3PA 3EZGA 4NJMB 2O0HA 2R4QA 2D2IA 2PBLA 3L7IA 4M60A 1ZMBA 2ECFA 5M29A 3GROA 1SD5A 3DZIA 5JS6A 5EXXA 4RTOA 4KQCA 1HLGA 1O5IA 4CXMA 3EUWA 2DHEA 3GY0A 2RC5A 4INOA 1OBVA 5CB6A 3RAPR 3CLTD 3W6ZA 3ZOZA 4ASUD 3AVWA 4L5IA 5FTKA 1UIMA 4TSKA 4PIVA 5IJZA 4BDSA 1T9GR 2V4UA 5AM4A 5E9AA 1X14A 3EG9A 1EWRA 5IAAA 3OQ6A 1CY1A 2D5BA 1YBAA 4NE9A 2XR1A 1JQKA 3CO0S 3EXIA 3DYVA 4UHBA 4AKIA 3ZD8A 3N59A 1RWVA 4RD6A 1Z16A 5FAXA 2LW7A 5EE9A 1APBA 1PFKA 2G08A 4R98A 5EJFA 2QSJA 1CDEA 2YW2A 4DLKA 1CR4A 3NJRA 1NJSA 1F8XA 1KZ1A 2FFRA 4YGXB 1RQPA 3DBRB 2I8LA 5G4LA 1AK9A 1NMSA 4PPYA 5D85A 1Y89A 1BN6A 1AA6A 4NMLA 3KBBA 1KJ9A 1R66A 2GJAA 3AJ9A 3GL9A 1YMUA 1QCZA 2FSHA 4G8CA 4GDMA 4WXYB 2PUEA 3SM9A 1ID8A 3LOPA 2MSNA 3C85A 1ZOIA 2ZTSA 2CJWB 3C41J 1GKUB 3JWJA 3NWBA 4DIFA 2OUIA 2YJTD 3MUNA 3WIVA 3RRXA 4DRYA 4TT3D 4RVHA 4OTZA 3D6NB 4PVDA 3A6LA 1K8YB 1QR6A 2K6GA 4X7RA 5ELXA 3QYPA 3HPQA 1I5RA 1PFGA 1M2HA 4FFWA 2WP0A 3NC1C 3H1PA 3OZTA 2HBRA 2AFIA 3D2LA 2FETA 2XNCA 1R64A 3PITA 3WGGA 4ZICA 1JVSA 2O2YA 3N39C 3U62A 2B8TA 2MJLA 2RB4A 1Z4PX 4MRSA 3RWBA 3T7DA 3T3EA 4BYMA 4ENPA 2FZ5A 1I2ZA 3DMTA 4II2A 2P7IA 1QK5A 2AK3A 1VG9B 1PBTA 4M9CA 2KPOA 4MW5A 4LCJA 1YHYA 1BIFA 1UDWA 4WERA 2OWEA 4UU8A 2Y6UA 3OP1A 2VJNA 2WWHA 4C0SA 4DF3A 2HQ1A 3N74A 3QVUA 1HNWB 5H3CA 3PI7A 5K3DA 3E9MA 5E1BA 1V43A 4RX1A 4DGSA 3FPAA 4HB0A 4QT0A 4Q1CA 5IZ4A 3AFOA 3QVJA 2QV7A 2YRXA 1I14A 4HXFB 3KQUA 3TRHA 5ESXA 1NJGA 2H07A 2W2OA 2XNDA 3PXXA 5BSGA 1P0FA 1UBRS 3T0FA 3TBHA 4G2TA 3GJ8A 2Q1UA 3GGPA 1Z73A 4R1MA 3S0JA 1ZNWA 1Z9BA 1TKCA 2GI4A 4K6OA 4X91A 5I7OA 3RWOA 3LDUA 3COWA 3U6BA 3AINA 3R6TA 1YS9A 3MMNA 3MS4A 2F4VB 5C46F 1P4SA 3SJCA 3HKDB 1YC5A 4LYAA 1LBHA 1KYVA 1ZN8A 2I1LA 5J2TF 1ZIXA 2NTJA 1D03A 3W7BA 1IAVA 3E23A 1KO5A 4DMCA 1M33A 4YDQA 1JR6A 3BK2A 1QIGA 3GP5A 4IILA 2OXRA 2Y9MB 4MWSA 4OB6A 4GYYA 5K09A 2EG9A 2P68A 2C04A 1KQGA 2XJ9A 1BJTA 5FAKA 1N6RA 5FB3A 5IABA 1IBRA 5EZQA 2D7JA 1OZFA 1DP4A 1O96A 4CLEA 4QNMA 4OMDA 5HQTA 1THTA 3AUKA 2ROQA 2BFNA 1UZMA 2FUG1 1ZIPA 3T3GA 4F3NA 5KTOA 1UH5A 5A0TA 2PJDA 3IP9A 3A2MA 4U6NA 3SVLA 5DGIA 4YN3A 4KPFC 2MHCA 4E1BA 1KJQA 2Z2IA 2HOQA 1O9GA 2HQSA 2YCLA 3D7NA 3NONA 4JEIA 1A7KA 4YT4A 5I01A 4G4SO 4K9SA 4TKVB 3MMXA 1C8LA 4FE7A 3OO1A 1XEXB 2QENA 4PGGA 4GL2A 2VYVA 2CL7X 2PGOA 2WPNA 3UPDA 3AEYA 4RVOA 2CLKB 2X2PA 4RA6A 1CZNA 5FTNA 4U8GA 4X95A 4BRSA 2JFUA 5L3RA 1DJNA 4AZ3B 5BR7A 4HQFA 4Q02A 3H9JA 3KE8A 4GBJA 2IYLD 3T4PA 3FMGA 1Z5ZA 3BFXA 3DV0B 4JL5A 3HJUA 2BMAA 4RF5A 1TW3A 2YV2A 2J3IA 4U7HA 4PGMA 1VYVA 4YH1A 4BOYA 1HQKA 3OEWA 4TTJA 3OEYA 2CYCA 2H1CA 3OT1B 3HJRA 4RQTA 2NO4A 4X6LA 3RUFA 3SMQA 4E5PA 1LEHA 4HHEA 4FHZA 4QUJA 4OAOA 3RM3A 4OQYA 1E9EA 3ADPA 4HAXA 2ZZKA 3TW0A 3HN2A 4JI6B 2Z1MA 4P34A 1E20A 1TM4E 4H18A 1A5TA 4LOIA 4QGAA 4YQYA 2RGYA 1Q1QA 1CDZA 3IEPA 2F2TA 4LNAA 4A16A 1HOXA 4M1ZA 1HSZA 2QRKA 1K97A 2WF8A 2X42A 4E4TA 4GKKB 2D00A 1IONA 3SG0A 3ZWDA 5MF6A 4YNBA 1E5DA 1Q2UA 5AH0A 4EHIA 4MKZA 3PC8A 3SQXA 3AB7A 1P1BA 2GBGA 1T9GS 4MEBA 1OFTA 3GDGA 3TQFA 3ZK9A 5JPDA 3BZWA 2JHCA 3D0QA 4ZK6A 3R9XB 3ZYZA 5BXYA 5REQB 3R8CA 1X94A 1IN6A 3BPSA 3IESA 4YCAA 2VYND 4UUNA 2J45A 9GPBA 4BLSA 1SUPA 4RFLA 2CF5A 3F5QA 2PL3A 2YBDA 3ANMA 4GPD1 4Z9XA 2VSOA 3GUCA 3GGSA 2R7LA 3HEAA 4RETA 4JUIA 4OAPA 4TLBA 1JHRA 1QHYA 4CQLB 4Z5XA 5JVDF 2JLZA 1U9IC 1R37A 2IU3A 5GGYA 1PTJC 1TB4A 4WJZA 5L51A 4MQBA 1EX7A 1TO2E 3EPPA 3M83A 5CVUA 1G0NA 5IK2A 3TO5A 4EPYA 2FUEA 1HNZB 4CMHA 5CVTA 1QO9A 1T3GA 2PKXA 2R79A 2ZUCA 3R0VA 3S70A 5F7XA 4WW0A 2OCIA 2OZLA 5JFOA 5DRTA 4PCLA 2JI9A 3JQAA 3VNUA 4TKLA 2QNBA 3U81A 2Z2KA 5A4KA 1JWLA 1KH3A 2I67A 3CZ9A 4GRAA 3DFMA 3ZDEA 3HL4A 2ZIVB 1KJWA 4W7IA 4ZOQI 2PR2A 4PU0A 2Q6IA 2GLTA 2FP3A 3WNCA 2J1LA 3IXQA 2O0MA 1F20A 3H65A 2X9QA 1PS8A 2PS3A 3OZEA 4C87A 1I8TA 3V4LA 2ZSIA 3N2EA 1MHTA 1ECGA 4CJXA 2NT4A 3D4OA 4R7GA 2F6RA 3P1JA 1CV2A 3BB3A 3STWA 1E2GA 2Q8PA 1X39A 3OC0A 3PFHA 4OJNA 4NVRA 4XTCS 3VNAA 3ZVRA 4D3XA 5HZHA 2J07A 1N1MA 3WA7A 3RADC 3AEKB 5TR9A 3CH7A 5FNVA 1BYUA 2CGEA 1Y1LA 3SBEA 3UFBA 1Q6YA 1XA0A 1L5LA 4TXNA 4ZT2A 1UEIA 3COYA 2C0QA 2AUMA 2ZJZA 4MWEA 1M67A 1SPXA 2SICE 2Y1WA 1G21A 3C5CA 2QSZA 3AHGA 4LK2A 2JIMA 4L4SA 4LJAA 4Y18A 1VL1A 1WCIA 1PJTA 4E6EA 2BAGA 4G5YA 3OPYA 2P2CA 2FHSA 1Y3HA 4GOOD 2E5LB 2WMNB 4X7MA 3BTSA 1QH0A 3EIXA 1M0TA 4IXNA 1TZBA 4QEZA 1SWWA 3RAFC 1IE3A 1RXEA 2AG0A 1BHJA 5FUMA 5L4NA 2Q28A 3FMFA 3FM9A 3VSEA 1E0AA 1NVFA 1M8GA 4B81A 1RQNA 1E60A 2Z6QA 4XB2A 4G1MB 4WBNF 5GZ3A 1P77A 1U0GA 2PZKA 3QPVA 3SC4A 1Z6PA 2LIVA 3IQEA 3ZJYA 5AUPB 4TLLB 2GAJA 5INTA 2BC9A 1RJ9A 3ZDAA 2BY4A 3ZE9A 1FNCA 1LVGA 2CL6X 4WLNA 3A7EA 2OPBA 1NF2A 4UUOA 1UMBB 1QVRA 4NYMR 4H3HB 3UH1A 5C1PA 3BC1A 4B17A 3FNQA 1HYQA 5CX1A 3BMOB 1EGHA 3OCVA 4AJHA 3KV1A 4J3JA 2Q8NA 2C8KA 2BOVA 4QUAA 1TUBB 4R8KA 3U7QA 5IT4A 5CLLA 5GM1A 3L4JA 4AUNA 2PUWA 3ZWPA 3VVLA 1DO2A 2OQVA 2A58A 2GPJA 5IZCC 4GG1A 1A8QA 3NTOA 1Z0SA 3P0JA 4AI6A 3OCWA 1NXTA 4KE6A 1XHLA 1NXPA 3I2YX 3JTMA 5I7WA 2IUFA 3PHGA 1JLMA 3QX8A 4MRVA 2B92A 3DMFA 5CTJA 3GNSA 2VUHB 3EN0A 4IDCA 3IUQA 1XVIA 5K0LA 4DCVA 1VDMA 4V0RA 4MNTA 1JBKA 5FCDA 4V24A 5E9QA 3SXUA 3LKZA 2QE6A 1JAZA 5HWSA 4OMFG 4DYHA 4KO1S 3HC7A 3RYHA 1OYWA 3D54D 1YQXA 1JG2A 3JR7A 4LVUA 1YQGA 1TKRA 4LZJA 2EFCB 4XD7A 2DT5A 3KKKA 3OFVA 5JARA 3W2FA 1GNTA 3MMPA 1E7RA 1XJCA 1M34E 1NF8A 5AOAA 4UTVA 4TS3A 2BMVA 4KXQA 1JT9A 2HF8A 4G8JA 5JMWA 5BQXA 3FD8A 1DTWB 3AVXA 4BN4A 1V3QE 2BZ0A 5LQCA 2FYTA 5C7LO 5CJJA 1YUMA 1F5SA 1U2DA 3GFBA 1VPVA 1ZD1A 2LWIA 2VZ8A 3WYGA 2W43A 3IELA 2GJ4A 1ADCA 1Z2CA 3QBTA 3OY2A 2JBHA 1U3TA 1MEEA 2IHYA 4MUHA 4S12A 4PLCA 2FJ0A 1CF4A 1SRRA 3A9CA 3SF8A 3CRMA 3EX7C 4PXSA 5EWJB 1UC9A 2BCGY 5KVQA 3KWFA 4LDRA 5CB4F 4ZOLF 2V55B 3MCVA 4DUGD 4WKCA 1XK6A 1MGOA 1HE3A 1BN7A 1RVDA 4HFNA 3WLFA 2XE7A 1KMNA 1OYVA 3L0IB 4GMGA 5DM0A 4JT8A 4R51A 3OAAA 4MW9A 4E46A 3B6MA 1YJAA 2DH6A 4NULA 5LWHA 1J56A 1MPXA 4NNOA 1PT8A 5A04A 2VZ9A 2WAYA 4IDEA 3WGHA 1Z6YA 4ETNA 3QW2A 1T4DA 3MXTA 2IX3A 4OX9B 5F1KA 1CZLA 1YUBA 1UC4B 5IJ9A 1LV7A 5LOVB 2BGKA 2QI9F 3H3FA 3O1HB 3V8BA 1MO5A 3MWDA 2W6MA 3JD4A 4JYPA 3ZLUA 1T3LA 1SWVA 3MN1A 4PPQA 1W87A 2P41A 2I2AA 1XEFA 2KB0A 4KMRA 1KEUA 5BRAA 2KSQA 5KYWB 4I7EA 5K0BA 2OZEA 4URFA 3VSAA 4I55F 5CFZA 2R8ZA 3Q2IA 3TVTA 3HA7A 4MUNA 3EG5A 4ND7A 4RJ2A 5GJBA 3JQBC 1X7WA 3VBEA 5I9IA 1GT91 2JJQA 2P5YA 3HKEB 3WL3A 5C51B 1KY4A 2EKLA 4ZAVA 4BX2A 4Q3KA 2XSZD 4PCVA 4FHCA 4FYKA 5L3QB 2F48A 3GG9A 2XVAA 1VKHA 3DOFA 5DHQA 1SBZA 2BMDA 1FLDA 3MB8A 4KDFA 4LJ5A 5EG5A 3B82A 4M0DA 1P2FA 1ZI8A 4EY5A 2YDXA 2W9XA 3B48A 1GYRA 1GITA 5U4XA 5KC8A 1O97C 4WLUA 1Y5IA 5ALPA 1XN1A 1ZPDA 5NULA 4QULA 2VBGA 4CTOA 5FA5A 4YS6A 2H7XA 5COAA 3D5QA 1VP3A 4BO5A 4ZN6A 3DHEA 3E9NA 3WKCA 4UVHA 2BKAA 3I92A 1WQ4A 1F7UA 3CA8A 2VZ0A 1KNQA 3HDVA 1NLZA 4IV0A 4PYQA 1ULZA 2X3FA 2YCBA 2VJCA 2DFKB 3BMQB 1CUCA 3P2JA 3PQ2A 1E0JA 2P9FA 4UBKA 1T1IA 1KWKA 3PDCA 1IRXA 4N6NA 1M2VA 2O2IA 3FLEA 3PICA 4S0ZA 5IDYA 2VJAA 1TF7A 2ODBA 1O7JA 3BDIA 4G5SA 2PSHA 3H8JA 2VF2A 2ASEA 3PE3A 4GXNA 4YJ2F 4Q4AB 2FEMA 2EIXA 4R05A 3LL7A 1WS6A 2Y8EA 3BD8A 2HO4A 1RI4A 4FX5A 4MAAA 2ZIUB 3FMPB 4PY2A 5FPPA 3KR2A 1X0XA 1T36A 4GKBA 4WT7A 4Y0AA 5CPBA 3TR5A 3G23A 3N05A 4OF4A 2ODTX 4TSRA 1RI5A 1ZW6A 3ZCXA 4Q7MB 1OWMA 1NBOA 3ZHVA 4DCCA 3SK0A 1NVBA 2QMEA 3EEIA 4AAYA 2JVKA 3GXOA 3K4QA 3MJFA 1NM5C 4EY3A 3UB4A 3KQOA 4Y2UA 3RT7A 3RIXA 2X4DA 4J3FA 1PJCA 3Q88A 1XJQA 4HNVA 1YB7A 3G2QA 3OSZA 2G1KA 3EFOB 3ZYCA 1T5BA 3EZ6A 2J0EA 3WFIA 2BFEA 3PHIA 3GHYA 2WYHA 3WGVA 3W9BA 4EKGA 4UNQA 1Z07A 5JTTA 1JQ3A 1XZDA 3AILA 1XQWA 4S1OA 2AW5A 3HE3A 5H81A 1OCEA 4KE8A 1A4RA 5GPBA 1JKMA 1ZMTA 1N2GA 3TBKA 2GM4A 2B0CA 1A9TA 3HVKA 2Y68A 1A4UA 3OUZA 3GPLA 1YL6A 4R9SA 4Z1MA 3IS3A 2EW1A 2ZVDA 1IULA 1C9EA 4MWZA 1H2EA 4BFYA 1GZ4A 2CUNA 4A1OA 4CG2A 1DRJA 3OG9A 1IC6A 1SFRA 4U2CA 1VYHA 2BUAA 4V0ME 1MB2A 4BV3A 1P2TA 1EHIA 1QO0D 3MGCA 2IBTA 2QKYA 1NNEA 3SEQA 4CYMA 3GLVA 3RGGA 3IKMB 4C08A 1M74A 1FP1D 4R8LA 3S6JA 1GUZA 4AU1A 1MXFA 4Z7OB 3I04A 1BX0A 3UBMA 4J1TC 1D2NA 4KXVA 2DQKA 4R1NA 4MV3A 3WLPA 4FINA 1B43A 2QGFA 1G0OA 2ATCA 3VISA 1RPAA 2YY6A 3L0SA 3QPWA 3UF0A 3QHAA 3RYCB 3GW8A 1HLPA 4INZA 1JJVA 2DRIA 2TSYB 5SZKB 3EXHB 3NASA 2AOTB 4G0MA 4L8LA 3R5KA 5CFNA 4MR7B 2WAXA 4QFCA 1ZOOA 1EFVB 1BMTA 1HORA 3C8HA 4O4JF 4JAVC 4LF7B 1BEZA 3OQBA 3PQFA 5FOXA 1RE0A 3AO0B 1A5AB 3HSSA 1L7PA 2GZDA 2ZIEA 1UP4A 2JFPA 2VK4A 3DE7X 4NARA 4OQDA 4U9UA 2UZ3A 4J7UA 4FCTA 2HLNA 3HXTA 4TTPA 5DH9A 5HMLA 5KSPA 2IITA 3RSSA 3K6SB 4EY6A 1RXVA 3O9ZA 1ZHOA 3ZVKA 4MJLA 1KU6A 4FUTA 1Y4SA 2BRUC 1QIMA 5K0FA 4L15A 2MSKA 1UJ5A 2IIPA 4OQ4A 3CCBA 4C7XA 4LHVA 1JMYA 2VFAA 1GAXA 2NVWA 2D1YA 4YBZA 3BULA 2XMPA 4Y30A 4OQLA 3IP5A 1E9DA 4L3OA 1TTTA 3OTGA 1NR7A 4L85A 2WVGA 1ZU4A 5K45A 3LQ4A 2MCFA 2V45A 3DVAB 3QFCA 3GJYA 2IS6A 4OXQA 2KMLA 3RBAA 1SQ6A 3ADBA 3TLGA 2RIRA 3GOQA 3HBLA 3HVHA 2P2DA 3NJ8A 1E8NA 1Q7EA 1GQSA 2JI4A 3B38A 3T3IA 4KJXA 1SVMA 3N0VA 4Z99A 1IWOA 3C1AA 3EZYA 5CIQA 5JZMA 4J2OA 4RHEA 2FPXA 1W49A 1HDGO 1PDWA 1L7AA 3OMLA 1Z5OA 3TFWA 2M32A 3WR5A 3QIVA 2VC2B 3DF7A 2YDYA 3JD3A 2GD1O 2C4KA 1B74A 3DWFA 3FF4A 4KN5A 3T9CA 3ZK7A 2AD1A 3VKHA 5KCMA 1XC7A 4Z0HO 4EA7A 5T64A 3FCOA 1NGSA 1ECBA 1J99A 5IM4F 3WLSA 5KYXB 4W5RA 4H3VA 1ZK3A 1NFQA 4EEXA 1DIBA 3S2EA 3QJGA 2NVUB 4CFYA 4EHBA 1JAHA 1V8PA 3MS7A 3UFXB 5BVHB 3ZKWA 3HB0A 1ZR4A 2X1MA 4ZJPA 4A15A 1BQ3A 1RQGA 3ZVMA 2FZCA 5T6BA 3GZNB 1FL9A 2HD4A 3BBLA 1MA0A 4JXKA 4P32A 3A36A 3DWIA 1DG3A 2PRSA 2C59A 3WSTA 3I61A 2WG2A 1RTKA 4E0BA 3X1XA 4R6XA 2HRRA 4PRLA 3TL2A 4D6YA 2IIQA 3OT5A 3AEQB 1I0IA 1ZCJA 2VPYA