2AYYA

Solution structure of the e.coli rcsc c-terminus (residues 700-816) containing linker region
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
121
structure length
121
Chain Sequence
MGGSGVEGLSGKRCWLAVRNASLCQFLETSLQRSGIVVTTYEGQEPTPEDVLITDEVVSKKWQGRAVVTFCRRHIGIPLEKAPGEWVHSVAAPHELPALLARIYLIEMESDDPANALPSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A New Structural Domain in the Escherichia coli RcsC Hybrid Sensor Kinase Connects Histidine Kinase and Phosphoreceiver Domains
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Sensor kinase protein rcsC
total genus 28
structure length 121
sequence length 121
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09456 RcsC RcsC Alpha-Beta-Loop (ABL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ayyA01
2AYYA 2AYXA
chains in the Genus database with same CATH superfamily
2JFVA 2AJ8A 2Q5OA 2PCLA 3GPBA 3JQCA 2M1XA 3ZDEA 5FOTA 1MHTA 1SVNA 1QTNA 5BVGB 2W98A 7REQA 3QPCA 2RARA 5F2KA 1SBNE 3P9PA 3OIYA 3OOJA 4XOUA 5EIEA 4FBMA 1XVTA 2V65A 3N59A 4MVJD 3ZNQA 1J0BA 16PKA 4AM8A 2R8RA 4WKNA 1PS0A 3AHJA 3ASYA 4OD0A 2NYRA 1N5LA 1QAQA 4WNAA 4MGHA 2VJAA 4RF5A 4C4PA 3G0BA 1MAAA 4E21A 3QEMB 3GFFA 1QYXA 4BO4A 3P9YA 1PGOA 3DULA 1FRQA 1KZ1A 4PZZA 1TIPA 4WASA 2WIJA 3SGLA 3N2ZB 4EG1A 2FE1A 4A2WA 3S8YA 3KV1A 1GKKA 1CNEA 4WERA 3VAZA 1KO5A 1MOPA 4DKXA 4CL2A 5L53A 1ZCJA 3DF9A 1H6DA 2GTPA 2UV8A 1RC1A 2CJFA 4TVBA 4GXNA 3O1IC 1UF9A 1N3LA 3O8OB 1NVEA 4LVNA 2QTBA 2JKYA 4HLNA 3QBEA 3U2QA 1X42A 3V7WA 4R01A 2XOEA 4U0KA 2Z5FA 5FLXA 2AJBA 3V34A 3PQDA 2GOYA 1FJ2A 4FYYA 4G07A 2J0VA 4UCXA 4RSHA 3ZX5A 5DNYB 3WJ2A 4C4XA 4GSLA 4HBGA 1Y3CE 2GBLA 5FCDA 2CJXA 1DC5A 1JRLA 1V1MA 3PV0A 3ZHSA 2PT6A 5DNAA 1D4OA 2O5VA 1P81A 3AEXA 3D7LA 4COKA 2QHXA 4JI6B 2E37A 3UWKA 2I91A 1RYMA 2PRIA 4LJ9A 4JXZA 4N40A 3WGHA 3T9FA 3IUMA 4LOAA 2V4ZA 5JUWA 1E1KA 1JDSA 2CXTA 2ZEJA 5EE0A 5EXDA 4EPRA 1DEAA 3RIYA 3TOXA 3BZBA 2P9ZA 2Y4NA 1FP6A 3T7AA 3ZWCA 4EJSA 4BN0A 1XLUA 3OM8A 4P5PA 1REQB 5EZQA 4UQOA 1SXPA 2G8LA 3GBVA 5JOQA 2QYTA 3L3BA 1MGPA 1LGYA 1R5JA 4L5CA 5ELLA 2N1BA 1V8BA 3RJTA 1BC5A 5I7RA 3ZZMA 4N48A 1W6UA 1WSBA 3K4PA 4IFBA 2DTXA 1G21B 1J2YA 2O9JA 3K5WA 5AW6A 3VKHA 3WJ1A 2P2LA 3V97A 2VRCA 5CGZA 3CKMA 1SG9A 3KEFA 1A5ZA 2ZRCA 3HADA 2IU3A 3FM9A 3ICOA 3PFGA 4U7WA 4WI1A 4Q7QA 1BSVA 3T1OA 2QW0X 2JHPA 2IUEA 2C4WA 4J8PA 1WKCA 2HRDA 2I3DA 5KYTA 4YJ2A 4H15A 3Q3HA 3DMTA 3G2MA 3R7DA 1LNSA 1PYGA 3BIWA 3PYXA 1VYUA 5C46F 5AKXA 2DPHA 5HK8A 2WWWA 4PSAA 2GS9A 3KRTA 2XJ4A 1RABA 2BHSA 4FPXA 4IVRA 3ZU5A 4JVOA 4OFWA 1B8OA 4EY8A 4B6SA 4ZYYA 4P0PB 1UBCA 1MVNA 1ODIA 1U90A 2G08A 2YW2A 3CT6A 3GUZA 1PJ3A 4FD2A 4ESEA 4YUZA 3DQQA 4QO7A 4Z0NA 4I4TA 3X2FA 4CNBA 1X7XA 4F2DA 5EIXA 2AQKA 3LBYA 4MIYA 2NTYC 4NF2A 2B4KA 3OTIA 4WADA 1AHIA 3G23A 3GGDA 1JXQA 3NR2A 4Q4DA 4OXXA 4HZIA 2Z5VA 2DPMA 3G2OA 4DIDA 1H2FA 2B35A 2GNAA 4IG9A 2UYCA 2RC5A 1SHKA 2Q7DA 3QE9Y 2G9NA 2H2FA 4OXIA 4UOZA 3B70A 3IQZA 2PWBA 4CN9A 1DB3A 2AUTA 4NCBA 1JHOA 1T8SA 3CNEA 4CM4A 1DJOA 3TLGB 2RGEA 4G4IA 3UT5B 4DY4A 5JSFA 5CR9A 4JLUA 1E3TA 3K6RA 3EG9B 4WCFA 3OWXA 2R6HA 2JZOA 4RVDA 3RC9A 1Y1SA 3PA8A 4KQJA 4XD7D 3H5VA 3VR4A 2GM3A 2XE6A 5IXYA 3H0CA 3IVGA 1NVVR 4XRRA 2P9JA 1Y1TA 2YJZA 3P9KA 2Y0CA 4DLZA 2GCPA 2WW8A 2XMRA 1QBGA 1M5UA 2LVBA 1X7HA 4S1NA 4UNNA 1E1LA 2BFFB 3OHMA 1DPFA 1G2PA 1NJSA 1QH1B 1J5PA 2H7VA 2OL4A 3R5FA 1XAJA 5J2UB 3SM3A 4BLOA 1G0OA 4LXXA 1QPZA 3REQA 5IFLA 2G9RA 2IYNA 5IDYA 1WULS 5IX8A 4AY6A 5FNVA 1B8PA 3DEKA 1F2TB 4INJA 2NP6A 3DKPA 4HUQA 1TAUA 4M99A 3STTA 4DCGA 1MD9A 1MV8A 4GOJA 5GM2A 1CCWA 1CUUA 1LLFA 2ASEA 3FWYA 3OQHA 2AF4C 4BGIA 2HIMA 2IIPA 3DMRA 3AIKA 4FUQA 5DI9A 3VSAA 1GA4A 1Q92A 4RXMA 3U7EB 3VZPA 3V6MA 1YZQA 1PU2A 4GZMA 1MMFB 1XCPA 4N7MA 5LVAA 1XIVA 4ZO9A 5EIBC 2ZIVB 3ER6A 2XMQA 4KB5A 3ZD9A 1WTAA 1BXZA 2B2XA 3QEOA 4G84A 3LLCA 2VT3A 2JLVA 3F98A 3KQWA 2HHLA 3SX0A 2KWIA 2CLLB 4E70A 3PZRA 2W2MA 1SPXA 4MS1B 4A6XA 2IYPA 4CRWB 2WWTA 1JG3A 2YVKA 5BWLA 2AG6A 2O2ZA 2PLNA 1HE3A 1Y1PA 3HJNA 5KZMB 2H4XA 4WJKB 4B0PA 3FUUA 3THYA 1IN6A 4O1MA 1A5SB 2QTRA 3HVHA 3L7OA 2EJVA 4RE5A 4E5MA 3KFXA 4B3CA 3NBKA 4O33A 3D31A 1SU4A 2I6QA 3URKA 3FI0A 3ITEA 4AO6A 4C3OB 3W5BA 4TT3A 1E3EA 1LA2A 2VPWA 3HJUA 3O21A 4G56A 1P4GA 4L28A 3S7TA 1QGDA 1O03A 2GN4A 4TS1A 1VP9A 1VJ0A 2O8FA 3WXBA 1NNSA 4HH1A 2MSNA 1EB8A 1OUMA 1QH9A 1R00A 2HN9A 2Q1XA 3JWGA 3OOYA 1SBQA 2QLBA 4JHLA 1R12A 4RKEA 2RB4A 3GCGA 1WWKA 4LJLA 5LSAA 3L7MA 3ZCXA 2W2KA 2GSDA 2ZB3A 2FPGA 2QTGA 4MUHA 1D1SA 5DE3A 2CJWB 1CFZA 1U0OC 2QNRA 4GG1A 4AX8A 3FVQA 1MAWA 3E0QA 4II2A 5IG2A 1OQAA 3F4BA 4CQMD 2HJWA 4WBNA 2XZTA 5ABPA 1PYDA 2OAGA 4CCAA 3JZDA 2XUZA 4HNUA 3HDVA 1RQRA 2C94A 1GIAA 4XDGA 2J30A 3EY4A 2RK4A 4Y2SA 1CETA 1FX1A 1PUXA 2PNFA 1PR3A 2R6FA 3QEJA 3QOXA 4HEJA 5AOBA 5LB4A 3FKJA 1NW8A 4MHSA 3OESA 4QJ4A 1KS9A 1ZI9A 2XB6A 3NUQA 3OQ1A 2D13A 2RHMA 1KI4A 4HDMA 1RWBA 3Q6IA 1I7QB 3U7HB 3INGA 4QULA 1J20A 1XRJA 4IXDA 4OSOA 4PYQA 1RAAA 2XD4A 2GZSA 3DZCA 3EPLA 1ZGJA 4DCPA 3T54A 4AYXA 2XB2A 5KSPA 3BTVA 5DLEA 4IOJA 1KFBB 3PNLA 1F4LA 2ERCA 3D4NA 4J1QA 4RUKA 3HNRA 5G4KA 1PKEA 5TMPA 3LP8A 4RY2A 2WILA 4FQ7A 5ECGC 4JLNA 2JLRA 1PR2A 2ZT6A 1TAGA 1AHNA 1Y6ZA 4IRXA 3T0GA 3P97A 5JCZA 3AKEA 5L7TA 1P0FA 2H7XA 2CWWA 1G1AA 3UMCA 4JHXA 1YIDA 1LSOA 1ZWKA 1P2GA 2WYVA 3MXTA 1SXJE 3OCZA 4ZXFA 4EW1A 4XUCA 1LW6E 3HU5A 4B6JA 5IU6A 4MKGA 3H8WA 1GZ5A 2XIJA 5AVYA 1NJ1A 4P5DA 1GPLA 2BKVA 4KK4A 4L2IB 2H7CA 2GDJA 2J3KA 4MUIA 4N3NA 2RAVA 4ZOBA 4D3XA 1DKQA 1W73A 1IHOA 2BZ1A 2XTJA 2IU6A 3I45A 2NAFA 4IZ6A 5UKDA 3WS7A 4BASA 2HR1A 1N6LA 1JG7A 1H5UA 2KB0A 2QP3A 3PQ3A 1Z15A 4R4JA 1FFXA 4O2RA 2H8GA 5AR1A 4IGIA 4NBKA 3PQEA 2BMAA 3MWKA 2LE0A 3IHWA 1LY1A 5EL0A 5LDHA 2ZRMA 4DV5B 1YCHA 1E5LA 2ADFA 2WHPA 4PPQA 5K20A 2V9PA 2XVYA 2X8WA 5CA1F 5DNCA 3BD9A 5FWXB 3QHQA 3D3KA 2PRYA 3X1YA 1CRPA 5KYUB 2FZ5A 2QL6A 2J5QA 1DWQA 3D8RA 4WGFA 5CH5A 2YWJA 4EO9A 2WUFA 2MYTA 2ZB8A 3O3CA 3SE7A 5LXTA 4ZT2A 3HUEA 3MJEA 1ZD9A 3WGTA 4OTZA 2ID9A 3KHTA 1VRVA 1GVHA 4S1WA 5EP2A 3RUIA 3BREA 2EARA 4J0EA 2HK6A 1BH6A 2NYUA 3GLHA 5DMXA 1P7ZA 1Y8CA 5CT9A 1EFPA 4URXR 5EJFA 1QQ5A 4G86A 3UNXA 3TFOA 2HHHB 4NCNA 3FYTA 5IAEA 5LXTB 1FYFA 1QNFA 4N1AA 1CZRA 1WUIS 2AS0A 3AFMA 4GX2A 2ZTHA 1B6TA 1C3OB 1I4DD 2VRNA 1N8KA 1BEEA 1P2UA 2GAOA 1N6RA 2QAJA 4BX2A 1O97D 1S2DA 1NC1A 2C31A 3JRNA 4DVGA 1P39A 4LFBB 3DOUA 1Q0LA 2YFYA 3R4CA 4RPIA 4QLBA 3E7DA 3OJ0A 3HJBA 1D6MA 5JNWA 2BONA 1H2WA 4PF1A 5EMJA 5T64A 3RHZA 4MV5A 3C1UA 2D2FA 1EVJA 1KYWA 4BB9A 1VFPA 3EAGA 2FP4A 4WZZA 5H7XA 3ACBA 2VPTA 3I83A 2AN9A 1H2AS 2C3MA 4KLNA 3UQZA 2H2GA 1QYWA 1PEDA 3DDHA 1L8QA 2ILTA 1DNPA 2OFPA 2B82A 3CYFA 4GD3Q 3W3AA 2RI1A 4CMIB 3FB4A 3UZUA 4YRNA 1VKOA 1C2YA 2UKDA 3FPAA 3T3IA 4DLAA 5AFSA 1BWSA 2J67A 4Y98A 3TQOA 3NONA 4Q1EA 1OB2A 2WIAA 2AKYA 2P2CA 2GXSA 5FOXA 1SCUB 1ZM4A 2PU7A 4WVLA 4RLQA 4R83A 3VBCA 3FSRA 1R0LA 3ESDA 1FUUA 1GITA 2FPKA 4N82A 5EQJB 2ZYTX 4KFRA 3E18A 3R3UA 1TNDA 4PZ9A 5THKA 2TS1A 1K8ZB 3EIWA 2Z6QA 1NVFA 1B0AA 4R3NA 2FJUA 3UAGA 2ISQA 1SBHA 1M73E 3AO0B 1T0BA 1E6KA 2VDQB 2NTVA 2XSZD 2NUTA 3V46A 5BQFA 1YA6A 3N7TA 3L7LA 1UC8A 4GP6A 5KQGA 5CLHA 2FXVA 4TOIA 3FGPA 1JG1A 2VH5R 2MINA 5EXTA 2F9MA 5HJ7A 1XZBA 3TECE 1NQUA 3PI6A 4HTFB 3I42A 4RNDB 4DC9A 3RYCB 1GQ2A 1XXLA 3QVJA 2RK3A 5A71A 2ZPUA 2B6HA 2CVZA 4JEIA 1R8XA 1SA0B 2A5DA 4FOSA 1QHHA 4D3YA 4LJ7A 3GDGA 5GJCA 2XNSA 1J8MF 3VKFA 2ZDHA 1KEEB 3UK6A 3SWWA 1PGPA 1EFVB 3G6WA 1A5BB 4EMUA 4B3RB 3AY3A 2YDXA 1SHJA 2GN9A 3H1AA 3VDNB 4BKQA 2J87A 3HVJA 1PVOA 4DADA 4ZQFA 5LJIA 4F5WA 1CUIA 2JIBA 2OTCA 2JFZA 3GLFA 3QU7A 1CUXA 1C81A 1KR5A 3X2EA 3OWHA 4AVYA 3FOZA 1DFGA 3SBOA 1Z0ZA 2ZYVX 4I1RA 1VYHA 3O8LA 3T5MA 2YTZA 5IKMA 5EIFA 1A8PA 2D2VA 1MW9X 2JAWA 1G16A 4K9RA 1BWPA 1WCIA 1MIHA 1OAOC 1R6TA 2DY1A 2LBPA 2YJ4A 4NYJR 4IJMA 3DM5A 5F35A 2GCOB 2F8TA 3ROFA 4FB5A 3QPBA 2OZLB 1G8MA 1L5VA 2AFHB 2VT2A 3DKIA 2FR1A 3O38A 4NJMB 5C8VA 1B26A 2WJVA 1MVOA 3AF4A 3HJCA 4QATA 3ZX4A 4XWAA 2ARKA 3R75A 1TCAA 2YVLA 4RDCA 1CW2B 4UDOA 1E61A 1WKBA 1FDWA 2HLPA 5CK5A 4CGYA 2Z43A 4JYBA 2ZSUA 2OCIA 4KWCA 3WADA 3BH7A 4R1UA 4DCCA 2KMLA 3PTZA 3E9MA 2AZMA 4PZDA 5E6SA 2FZWA 4G5RA 2IT1A 5HJ5A 3ZV6A 1T91A 2HSJA 4MUFA 4P36A 3OY2A 1PJSA 5J5VA 5AJVB 2WV9A 2F17A 5ALQA 3DV9A 1YV9A 4BTLA 5I5EA 2VBFA 4GUAA 2ZDGA 4CTKA 4EGQA 2GKGA 3KTOA 1R8SA 4RW0A 4KPUB 1ORRA 2H1LA 2ZJ2A 3CRVA 5EPOA 1E9RA 1DARA 2YQ5A 3VVCA 4MV6A 2V55B 4RL6A 5IT4A 4TLEA 2NG1A 2L17A 1TM4E 3QPAA 3PYLA 4MX8A 4CG1A 4CM8A 2ZSKA 4DLBA 2HBYA 2VYNA 1R0XA 1QE3A 3VNVA 5EP4A 1R88A 3R3YA 3THXB 1PW7A 2HQBA 5AHOA 4JKYA 1CWUA 1X8JA 2OR3A 3GARA 4KAAA 1T4DA 4KOAA 5C5CA 5ALEA 4E5DA 3E3MA 1XHEA 2JGIA 3W1WA 4F7DA 4HNGA 1TUBB 1SIBE 3VVMA 3UF0A 1M2EA 4QKQA 1MR3F 2AMJA 4Q4AA 4Q9AA 1QZXA 2YOHA 1IWPB 4J29A 2BKAA 3BQMB 4BYGA 3G13A 3BM5A 2HUPA 1Y3HA 2QTMA 3ZIAA 3NEJA 1J99A 3M34A 3ZKAA 2EX1A 2IYOA 2BKLA 1XQ6A 4JH0A 1KRXA 2RHRA 1XU9A 4Z7JA 1DBPA 2A9RA 3QOFA 4FHCA 3FAKA 4RVSA 5BNWA 3QXSA 4GPD1 4YAOA 3GEBA 3NHLA 4DCVA 4M1OA 5KYWB 2Y1FA 4OMDA 2GF9A 2WLTA 1TYEB 1D1TA 1MAVA 1R8JA 1T3HA 4KL8S 4X64B 1US8A 2QMEA 1PL7A 1MEOA 2IZ6A 3QVKA 4KFSA 4Z86A 3AUYA 1RQPA 4E3WA 1H5NA 2ZIWB 4BFSA 3EPRA 2Z6VA 4YJFB 3DAPA 1FL9A 4E32A 4A23A 4DMLA 1O0BA 5BN4A 1AZSC 2C3OA 1WMDA 2VA9A 3KOXA 3NNNA 4H6WA 3KR0A 4MTLA 1A9QA 2BCGY 4WEOA 1SHTX 2JI6A 5AI5A 4BZPA 2JEYA 4X3OA 2OLJA 2VTVA 2OUKA 3GMSA 3OIDA 3BCHA 1YR8A 1UBTS 3P9ZA 4H4CA 3QHAA 4ZIRB 1BMQA 2V7UA 2LIVA 1YZLA 4Y1FA 2EP8A 2HY7A 3DKVA 3OC0A 5FT9A 3S8MA 3OQPA 1BMFD 1EUCB 4A91A 4ECEA 4EATA 1K6XA 5T4FA 2ZYHA 3PYMA 4OQEA 4CHTA 4YRTA 3TJRA 3TXAA 4M0KA 4WBSA 3MLEA 3RV3A 5U4XA 5LWHA 4HD8A 4A73A 4AAYA 3TIIA 1RJDA 2HC9A 3ZLBA 3IKLA 1LRJA 3B36A 1YL5A 2FE4A 4DEVA 3C4VA 3THSA 1VPLA 1L5RA 4BWYA 1A9XA 2AQ8A 1J21A 3LTEA 3QYFA 1GQFA 3JY6A 3A6JA 3QKSB 1GRQA 2ZI4A 1ICIA 3SVTA 1IZ7A 4W5HA 3PWZA 4JUCA 4DXAA 1GPUA 2NU8A 1RHRA 1RT9A 1C8VB 1MENA 2G9ZA 1J2UA 3G8CA 5DRYA 4R16A 1EDDA 1YVDA 3IRUA 3JALB 1SY7A 1RYBA 2DUNA 5F1YA 1SOWA 3TQQA 4MEBA 1VBKA 3OETA 2FWRA 4N65A 3UXYA 4L4UA 5CG1A 1G8SA 2ZJAA 3KB6A 1SKYE 2O2XA 1E20A 1FX0B 1VSUA 2Z5LA 4Z3OA 1TQ8A 3PR1A 3W79A 1NVAA 4LRUA 2PX6A 4C4OA 2DQZA 4FFBA 1XVIA 1E1MA 2NZXA 2WZBA 3PL1A 4RX1A 3RSGA 1WEHA 5ESRA 1L8OA 2FGJA 2NVUB 1OFUA 1H85A 5A62A 1EP3B 4WJZA 4NZYA 1NM5C 1XLWA 1Z8FA 4G4JA 4MLDA 2VF8A 4WZAE 2POQX 4JIGA 4DWWA 3KKNA 4ENQA 3IT3A 4ZMSA 3H83A 1V45E 1VL6A 2E4XA 1T8RA 1H65A 3OZDA 4FQ5A 3VSDA 1A77A 3OHSX 4Z4FA 4LXYA 1EPUA 2B4TO 3RTEA 4AI6A 1T3LA 2FWIA 5FF9A 1GNQA 1Q22A 1YTUA 2A9QA 2B20A 2ZWAA 3DT6A 3WSWA 3PDIA 3FTNA 3H18A 3K30A 4Z9AA 3RDPA 3RS3A 1SU8A 1E2EA 3WL6A 2A5YB 4ASUD 4C03A 4A3SA 1R2QA 2W6MA 5A02A 2KX7A 4PQRA 1VIVA 4KIFA 3UMVA 5JYDA 3CRZA 5KTSA 2EFDB 2Z8YA 1UBLS 1V39A 2XMCA 5AVXA 4CTJA 2HW8A 4F56A 2C3UA 1IVSA 5JE8A 2HK8A 4JP8A 3RVBA 1ZJ6A 2BRUC 4W99A 3F67A 3OF5A 1KI6B 1MEEA 1Q21A 3Q12A 1JWLA 3VYTB 4XJVA 1D5WA 2HD4A 1YR1A 4GX1A 3C6ZA 1VL8A 2D7DA 5DBEX 4DPLA 3UW1A 4J1NA 5LM3A 1GYQA 5ICMA 1X7DA 3IODA 3AW9A 4S2EA 1T9HA 2VAPA 1A76A 3QXGA 4GM4A 2UYGA 3IBTA 4NJEA 4CMBA 4EYOA 5BUQA 4Q1FA 1T4CA 5CRIA 1OY1A 2X3UA 1T3SA 3IYLW 1A82A 4M46A 2PS9A 4WKBA 2IYFA 1XEWY 1AHPA 2DSTA 2G77B 3C3PA 1N77A 3W5HA 1C8KA 2FU5C 4ZZ2A 2J3HA 1UZLA 2J59A 2P5SA 3CJRA 3H0EA 3KZNA 1S1MA 1ZC4A 5TGZA 3IEKA 3PPYA 2X13A 4ZHQA 3DB1A 4C20A 4JI0B 1QVRA 4WXRA 3LOQA 1S89A 3VUEA 1COWA 3C3YA 3FUXA 3LC7O 4M9QA 2WIFA 3L5OA 4CIDA 2H9YA 1P6QA 1W88B 1P7YA 3CLHA 4IQGA 4P2BA 4BFLA 4ZCPA 1AS2A 3SQOA 3SR3A 4Q9KA 2BFPA 5G53C 5CDSA 4NCXA 1N3YA 4O4JF 4X54A 1P9WA 2Q0XA 1CS4C 3RYIB 2QW1A 3S2SA 4TMFA 2VLIA 3R7SA 1XU4A 2XUAA 4CKZA 3ID6C 1FMJA 1FC0A 1EZ1A 4G4GA 3INNA 1RXSA 4L9SA 4PQEA 5DHRA 5A3RA 1L4BA 2QGFA 4K6KA 1R6AA 1R0YA 2PPVA 3HFGA 6ABPA 3GJRA 3B9RA 3OFND 1C1DA 4PWZA 2C2KA 2EIXA 2AA3A 2IY8A 4NEGA 4N49A 4HO1X 2VA8A 1R4ZA 3NZEA 5LA6A 4HZGA 3N53A 3BDIA 5DTQA 3AB3A 3THXA 4I14A 4UJ5A 1E2GA 2N75A 4KR9A 3LT1A 3S2EA 1O0SA 3CURA 1J0DA 1JMVA 2G76A 5TV2A 4ZK2A 4DLKA 4EPYA 2Y1DA 3S29A 1M76A 3DVAB 3W04A 5K6AA 3CLRD 2AZ4A 4DA9A 5T8KA 2QU7A 4X6YA 2X9NA 4PONA 1GNVA 2Z2KA 3NB0A 3V4ZA 4HOYA 3D6VA 2NXNA 1Q6YA 2I2AA 1WU8A 4B6RA 3MJRA 1GTSA 3NQ41 2F1JA 4CDNA 4X62B 2ZVPX 5I6DA 4ALMA 1I2MA 2YWGA 2BMEA 1CE8A 1YB1A 3MT8A 1QIKA 3Q7QA 3TD2A 1CUJA 3D7MA 4UZFA 2G04A 2PKQP 1AQ6A 2CLCX 2J6CA 2XNDA 2ZRFA 4MWOA 4PGGA 5F51A 2CMHA 5TB5A 1M0TA 3FZYA 4Z99A 5ERYA 1IK6A 1CJBA 1QGUB 4O25A 3TLKA 2F48A 5J9FA 4E46A 3KR9A 5ED4A 2O2EA 4GP7A 1OFVA 1IOZA 3RAJA 1OA0A 1CEEA 2BH9A 2ZKIA 4RVHA 4EA7A 2ZJ5A 2UDPA 1QP7A 1PR4A 1M74A 1LK7A 2WD7B 3A3KA 3H9BA 1ZLXA 2VN8A 3E8MA 4RDXA 1VHJA 2A9OA 2F3SA 4N3CA 3OTHA 3I62A 4WEQA 4KO4S 1V6AA 4LOKA 3WLHA 4B2LA 3U7QA 3DEIA 3EW9A 4LF9B 2JF0A 3B1KA 3H1PA 3K05A 3M4ZA 3QM1A 2X0DA 3HG7A 1R0SA 5KOHA 4GKVA 3FX2A 1NBMA 1T9KA 5DM4A 1QYVA 2HX1A 4JP3A 2R7MA 4XPZA 2TSYB 3EAQA 5FUBA 5IP5A 4E08A 3PTLA 3DD5A 3WMRA 1U1EA 2BKEA 4TXJA 5JRDS 3T5CA 4MHTA 4UTXA 3WGVA 2QPAA 3EA5A 1OA1A 1UMBA 4H1VA 4KMOA 4PQGA 2JAUA 1K92A 2WD8A 3GLSA 5JSUA 5L3VA 2R3SA 1P0QA 1LJLA 1XROA 3AL3A 1OTHA 2QTNA 2BFFA 3EW7A 3H8JA 1PL8A 3LPAA 5G0UA 3QNUA 2VJLA 2XWSA 3FNFA 3KE8A 1VPEA 2F9LA 5EUQB 3R7LA 3SQNA 5JJBA 1NOKA 4TM8A 1QLHA 2VSXA 3WTCA 4Q0MA 1U11A 1ZH0A 1ECCA 4NQZA 4F11A 4YUAA 1NJ5A 4ZALA 1T35A 4Z6KA 3WYDA 1BCRA 4C0XA 5HJEA 1Z7GA 1WSAA 4X24A 1D7OA 1QIMA 9MHTA 4MINA 3DZDA 2CZQA 3DHWC 3LQ1A 1L5HB 2NTEA 3L0BA 2HDNB 1RVDA 1OYYA 1T9GS 2ZSAA 3Q9SA 3E03A 1ZD4A 3IB3A 3FWKA 1J5XA 2QD4A 4MP6A 1UOQA 3LMKA 2OVBA 1JILA 2Z2IA 2PGIA 1W76A 2Z98A 1Q20A 3WP1B 1P4HA 1R3UA 4MB6A 3O84A 2G06A 1YK0A 1LV8A 2PUVA 1QO0A 2PKQO 2QX9A 3JQAB 4HGOA 3TSWA 3NT5A 5JAHA 1HL7A 5DP2A 5KTTA 4FYPA 4U7GA 3T8YA 1SUFA 3GUUA 3LX5A 2DWQA 4K05A 5AXCA 3WLFA 4WXYB 2WF9A 4TWRA 1I01A 5ADVA 2ZATA 1FFAA 2WC1A 1KZ7B 1PZXA 1SEPA 3GAMA 4G2TA 1D8TA 1JBQA 1WNFA 1WPQA 1C7ZA 3OIWA 4QTXA 2IYAA 1SQFA 2YHIA 3CLSD 2JJ2A 1PR1A 1U4NA 1UBUS 2IC5A 4KAJA 1AE1A 2LZ0A 4MKIA 1E89A 3SXJA 1Q16A 3UAYA 3PGA1 3OEYA 4X97A 4DR1B 1PHPA 4Y6SA 5TF4A 3USCS 3U1BA 3BEDA 1CJSA 1SUEA 4KHZA 1XKTA 1QO9A 4K9QA 4BFYA 4Y67A 4BNZA 4BPRA 3LRPA 3U19A 2V03A 4V0LA 4DLNA 3ABZA 4L5YA 3KAKA 2O8EA 1I30A 1M6WA 1S2IA 2Q4EA 4YASA 3U7JA 1TCUA 4F2PA 3PB3A 1L7VC 2O3UA 3GT3A 3HJHA 2DFPA 3E5HA 4IVQA 2VHVA 4ENWA 5A9RA 2HMVA 1KAMA 3Q0TA 2CBXA 1Y89A 3FCOA 3I1YA 4NMWA 3LI2A 3CE6A 4PBTA 3UMRA 2ZRJA 2RH8A 3ZK7A 3O8RA 4PR3A 2P6PA 1USIA 4IDGA 2C95A 2C54A 5LNK1 3NTLA 4I1OA 2XUGA 3IMCA 1Z5WA 3L82B 5DSZA 5KU7A 1U7WA 2IEBA 2PLWA 1O89A 3P96A 4QYWA 3U4HA 3DZKA 4Y9SA 1Y4UA 3REQB 3MWFA 5AD1A 3UN1A 4CLRA 4N9QA 1H05A 4J0DA 1AV6A 4MVJP 1WVMA 1KFKB 2J4DA 4TKUB 2D5LA 4DIOA 2JGRA 1E2FA 2K4MA 1QB8A 5BP7A 1RC8A 2Z1MA 2AOXA 5FYQA 2C07A 1QOZA 4JQSA 7MHTA 3UWOA 2FPUA 5ANRB 1UP4A 3QTTA 2NNLD 4MQFA 4UU8A 3CUKA 2WD9A 2EGHA 1J90A 4Q7LA 1AGNA 3W6OA 4BNVA 1T1RA 1T9CA 3D4LA 2ZIGA 4FFVA 5KQRA 3L4EA 3E2MA 5J40A 3EZ7A 4D6YA 1GPH1 1K4KA 4OAOA 3C8HA 4RHCA 1T5IA 2CDRA 1A4XA 3P0FA 4GRIA 5LZ8A 4DV4B 4DR2B 4UXJA 2J45A 1KO1A 4JDUA 5BSEA 1TEVA 2BFEA 2WWRA 1V71A 3F6RA 4BX0A 4O08A 3NS7A 5DX8A 1GY8A 3HNPA 1EWKA 4RZXA 4C87A 4F1WA 1GTRA 1Z5NA 3V2GA 5P8WA 1PZEA 5ALPA 1Q1AA 4GXQA 1WDKA 3R1IA 1NUPA 1DEXA 1LVHA 1W4CA 5ALGA 2YC2C 5DW3A 3NP9A 3V8NA 2AFIB 4YRDA 4Q19A 1ZJWA 1NSYA 2HO5A 3K16A 4F4HA 2C59A 1Z62A 5EGNA 4B8YA 2XKJE 2Q5QA 2FW7A 3CIOA 2P69A 3H2KA 2J9XB 1SXGA 1D2NA 1F1BA 1FDTA 1SCKA 2H48A 3FDZA 2CMKA 2NU8B 1DTSA 1PJCA 3HU3A 5C51B 1AMNA 3VYVA 2MSCB 4C0BA 2W0MA 1GTMA 4MXDA 1U5BB 4QD3A 2XF8A 3UWSA 1LDYA 3DMFA 2I3GA 4YROA 5FPQA 3ZDXB 4C7MA 3ZD7A 3R6LA 1BS2A 3BXGA 3PLRA 4F04A 2N9UA 4PHFA 3MLAA 4BNMA 4JQOA 4MQ4A 4QJIA 2UUOA 1DO0A 5IJAA 1XTSA 5M34A 1UJ6A 4JY7A 1N4AA 2QQGA 4TTQA 3KDPA 2PUWA 2ZE5A 3D8HA 4PSVA 4AUNA 2VC2B 1F0YA 5LQUA 1NIJA 3CUUA 3Q5GA 1EP2B 5G2OA 2TMYA 4MCAA 5J59A 2HCBA 2YHAA 5FB3A 3T7IA 1DUVG 1PSDA 1Z6XA 3AHEA 4LC0A 3EEFA 3DTVA 3FUVA 3OSUA 5T3YA 2ONKA 1RR6A 4NEHB 2NADA 3LUAA 3K0BA 3NM5A 2GBFA 3ROPA 2QMHA 4FD3A 4W7IA 1OT3A 3UJCA 3I61A 2I7DA 1Z56C 3SMQA 3KSDO 3NWPA 4FFLA 3QXHA 2FA9A 1PR5A 3NBAA 4MA4A 3SSAA 3NASA 3AUUA 1MT0A 1PR9A 1Z2CA 2P4HX 4EFMA 2XOKA 4KDRA 4H08A 4WY8A 1QM5A 4H60A 4KP7A 1ZPDA 1SKAA 2ODAA 5F64A 5JPDA 1NQXA 3WXMA 2CXRA 1WZ2A 2C7RA 3VPSA 1CRZA 1KKMA 4FFOA 3VZQA 1T1GA 2JJ1D 5FI3A 3ROEA 4BVAA 2C4MA 5JRZA 3CB2A 3L1JA 1FPMA 4FVTA 4E2ZA 4I6JA 2J4FA 3H97A 3NAZA 1OHHD 1DTWA 2YMQA 3A1UA 1W4LA 2R11A 1Z29A 4HFNA 5FNZA 4YPFA 1NUHA 3FHCB 3IAFA 4CIXA 5FL7D 1XR3A 2B83A 4IWNA 5KYYA 3FNEA 4BNGA 1KMNA 1OBHA 1QHHB 1NE2A 2JPDA 3NHPA 4GYWA 3T7JA 4D9NA 4BP1A 4KBGA 4TUYA 1ZU4A 4MQ6A 1Q7TA 3DXZA 2D54A 4GVPA 1Z34A 3ABSB 1KEWA 3MJDA 3KS9A 2YIDA 1JUDA 4AMGA 4GR9A 1O5OA 2VCYA 2ZIEA 4OQZA 1PDVA 3M9XA 3NORA 3DL0A 2ZR0A 2WU8A 3HZRA 4YREA 3AY7A 3LGXA 4EK9A 3UGJA 4WXHA 2I7CA 1PLKA 4ETNA 1UPCA 1FSSA 4JXJA 1FLVA 5LCXA 3FYDA 1NLFA 3T06B 2AR0A 4ZQCB 1Z25A 4U2FA 3TGWA 1OZHA 5JRJA 3GAZA 2GPAA 5CEJA 3BMOA 1V25A 2A1UB 4O5OA 3EZGA 4KTVE 1UH5A 3H6HA 4F6RB 5HM6A 3BTOA 1P9RA 4P7GA 1N0UA 2HF8A 1UJMA 1I1OA 2YNMA 1Y0BA 3JX9A 3ADDA 4URZR 1N5KA 4IDOA 4CEJB 1SUWA 2F3TA 4HN9A 3A1DA 3H9JA 4WNYA 4KG7A 2XZLA 3ZHOA 4ZVLA 1XZLA 3U37A 3CG4A 4J7UA 1SBYA 2AH5A 2ATXA 2PXXA 1TT5A 3CA8A 4EELA 5I7SA 5JT1A 1SKBA 1G8HA 2AYYA 2P78A 2HFJA 4Q1CA 3A36A 3TBKA 4YMHA 5KOJB 5KBYA 3H86A 1PT8A 1KAHA 4PLTA 521PA 2C0QA 1DIGA 4OQPA 1H4SA 2D8AA 4ZAGA 4N03A 1YQEA 1J8FA 4D92A 4EHNA 1G8JA 2W2PA 4OUDA 3AESB 1WHTB 1WLSA 4U6QA 1KVSA 3O82A 3M1LA 4LE1A 5DNEA 1L5OA 3ZPXA 1IB6A 4R31A 1RWPA 3ELYA 4JJIA 4GGMX 1CK4A 3ROTA 4UC0A 1H5QA 5KVVA 1Z2NX 5EZYA 4UTVA 4H18A 2RJNA 2O52A 2ZSFA 4LFAB 1G17A 2ZS8A 3ORHA 2DR3A 3PFBA 5IZ4A 1YR2A 1UDWA 4QUGA 1V5WA 1SKQA 3GEGA 4ZAWA 2JA2A 5K03A 1OI2A 2R6ZA 1X7XB 5K6AC 4DA0A 2F3UA 1RM4A 1IHUA 2GJ4A 1GSHA 4ZV9A 4AB1A 4DOMA 2NLOA 4BNLA 3SHVA 1PHRA 3AG6A 2VSNA 2PZAA 1UJ4A 4AUKA 3PD1A 4Y1GA 4WFJA 3WA7A 2CLHB 2C42A 1N2IA 1E9EA 3L6EA 2D3TA 3H1BA 1HV8A 1QK5A 1V2GA 2IIBA 3A9WA 4GI5A 5F33A 1UBSB 4BMPB 4XGKA 2C5SA 3ISTA 1CLUA 3LP6A 4XDZA 3VOAA 1F48A 3BJRA 4BO8A 1JKJA 3K35A 4R7GA 3L8MA 4AULA 3FPFA 5COAA 3OZIA 4GLOA 3X44A 3ECSA 2ZBPA 3M5CA 3LT0A 1JQLB 3QYJA 1L1FA 3UAWA 4RJTA 4UXIA 1KHTA 3KYDB 4AWAA 1Z4KA 1GRNA 2E4UA 4NBNA 1YI0A 2XRYA 4EVRA 3RQSA 3A6HA 2Q50A 1J09A 3HDQA 3GMDA 3K6SB 1G3UA 3ENZA 4ALNA 3ND7A 1XVVA 3QLJA 2F3RA 4WBNB 3ZLJA 3SJAA 3FTDA 4UUMA 5LMNB 3PEUA 3HWRA 4EHIA 4YMGA 5LYYA 4EUSA 3FBGA 3H0KA 1JG6A 1KDRA 4XAQA 4E07A 4EHHA 2FETA 3JPYA 2D62A 3K20A 3R44A 3NHAA 3KOWA 4O02B 3V4VB 4ZGWA 3EOBI 5FA6A 1ACMA 5BXQC 3UFXA 4O4LA 1KRHA 3GZNA 3R5XA 4MI6A 4FYKA 3RRMA 1PJBA 1U0LA 4KXFB 2WNIA 3K1ZA 2YJGA 3F74A 1U8TA 3NP7A 4GR4A 8MHTA 3O2QB 1YQGA 2JCBA 5DN9A 1ZUNA 3WWCA 4S1VA 5I7EA 5AIBA 1GUFA 4KQKA 2ZE6A 3SY8A 1FDUA 1KARA 4BX9A 5LFAA 1FTQA 1RS0A 1ODFA 2TMDA 4JOBA 4JR1A 3OA0A 4ZWNA 1MLDA 1M83A 4X20A 3BTSA 1UXKA 3ENNA 4A36A 1P3DA 2LW7A 1O97C 4FN4A 2QMZA 2QN6A 1QHEA 2ID8A 4YUYA 1U63A 1PS9A 1SN7A 2DQYA 1SXJD 3FBWA 3F2VA 3OLCX 4FOOA 2EKLA 3K0FB 2R4TA 3I5YA 3BL5A 4EEXA 1Q1ZA 2HCJB 1RPTA 3AIMA 3DV2A 2Q3MA 1NAHA 1YHNA 3HKBA 3TZCA 1R18A 3NBQA 4Z5XA 4UDYX 2JG3A 4AJLA 3FXAA 1RYFA 2C0CA 3HCEA 3M8KA 4GF5A 4J7AA 4IJWA 4QJBA 3STHA 4P3YA 3WLAA 1HGXA 3O47A 3HYNA 4A03A 4P7KA 4FZJA 4HAIA 1GD1O 4TTIA 4Z2AA 3I09A 3HB9A 4X92A 3P2YA 3TIVA 1QH0A 3NHJA 5HUHA 5JCXA 3G9UA 2NO6A 3HYLA 3KJZA 3QHPA 4NV1A 3JQPA 4WACA 3KKKA 2W6OA 3SDZA 4RANA 1FXWA 1NYLA 2GRJA 2F8LA 1XMSA 4DLTA 1SMKA 4Y2HA 3UHAA 3U61B 5TDHA 3ZXXA 1I94B 4QUEA 3ZVMA 1R9JA 4ZU3A 1QVVA 4UMEA 2BFEB 1AXRA 2Q6IA 2HA2A 3DCIA 4HYQA 4RS3A 5EINA 3MUEA 1W44A 4P5EA 4D7AA 4P3KA 3RFFA 3SQLA 4GLFA 3ZHZA 3WLMA 3KWLA 3NTOA 1P29A 4ND5A 1BS1A 4DIMA 5ARBA 3D6FA 3ZOKA 4RK1A 5EQFA 3NHKA 1GZ7A 1NW9B 1ND6A 1RXIA 5TQ0A 4WQMA 3ZG6A 3A4NA 1HLGA 2EGUA 2M32A 3N1UA 4YP1A 5KINB 3JU3A 3WBKA 2B30A 4JL5A 4FSHA 4MI1A 3UXMA 2YRFA 4AT1A 4HL6A 2C5EA 4W8GA 4EBBA 1ZVQA 1CU1A 3EVEA 5ITVA 3GELA 3L07A 1R4NA 3ACCA 3F78A 4H6PA 3GJXC 4CIWA 3UAZA 3IJRA 3CO0S 3GPIA 1HKUA 1JKXA 1QWOA 3A9CA 4ID9A 4JGGA 4UHCA 3TVTA 4ZI5A 5EUBA 3EMKA 4W1PA 3V5NA 3RCBA 2V6FA 3VV2A 3C1AA 4EQZA 1UCFA 3W77A 5F12A 4I4CA 1V5IA 1MX1A 3D3NA 2WJ6A 3PICA 1CZNA 4ILEA 3ZXUB 3LC1O 4G8BA 4I2NA 4L22A 4LE2A 4OV6B 2ZIXA 2VFAA 3N2KA 2PKEA 2YWHA 1WW2A 3LUBA 3X0DA 3IMKA 2FF5A 5AW3A 2D1SA 5FFFA 3ZE0B 1Z33A 2OHIA 3KB1A 1K06A 1AGYA 1GQQA 3NPMA 4RQBA 2CLDX 4UBLA 2FW8A 5K0EA 5K8CA 5DIZA 1R5OA 1SM4A 2HBQA 4OHUA 3WL8A 1CR4A 4KRGA 1XT6A 1CQPA 2NSJA 3BAZA 2XMDA 3JWPA 4R3UC 4BNXA 4KR6A 4ZVKA 1W4RA 2Q5FA 2QN8A 5AYVA 2N42A 3GFTA 2E6KA 3WQRA 1J25A 3E2PA 3VHXA 3CRRA 3HN7A 2AX4A 1O8BA 1V8OA 3NOXA 4E2XA 3UWMA 1VHTA 4DB2A 1TU3A 3LRXA 3BRWA 3JZAA 4X1KB 1JJ7A 1A69A 2AOTA 4CI0B 1TZCA 3ADOA 1M2JA 1WBBA 4ZHQB 4LDZA 3N74A 2R87A 1O94C 2XXBA 5HMLA 3W90A 4JOQA 4JI5B 1Y3AA 4IIGA 1DZIA 4BBPA 1XCBA 4AP9A 1MXFA 4NCIA 1QRTA 4POAA 3DV0A 3OJEA 1OBCA 1UWKA 1CDDA 2ZBDA 1CY7A 1V1MB 3CZ5A 4MYTA 4D9FA 4PVDA 5BSGA 3GA0A 4WWHA 1EBUA 1CY0A 3VR2D 5DCUA 2DECA 3ZBPA 3S1SA 2ZXFA 1ZVMA 4TUYB 1K2VN 3BMNB 4U6NA 4NJEB 3NHRA 3SU8A 4Z49A 3YASA 1JN0A 2VF7A 3RT9A 4WZ6A 1G7RA 2WU0A 2IEYA 5AHWA 1ENPA 1TCVA 1NOIA 1P4SA 2HMSA 2VRBA 2X4GA 3HCBA 5A03A 1EK2A 3SHQA 3LXUX 4E5YA 4S05A 2QU8A 2H2AA 1L8LA 3OMWA 1GTVA 2JFWA 3ZWBA 3EZLA 2I2BA 4E4TA 4WH0A 3RG8A 4W63A 1C3JA 1HDGO 1WLYA 3AEQB 3DBLB 3OQOA 1OC4A 3O4VA 1T6XA 1YB7A 1Q1BA 5EMLA 1HQYE 3CB4A 3UXEA 3GLIB 1MT3A 1EVIA 4RGYA 1IUNA 2CLIB 5JZOA 4CEJA 3UFBA 3LP5A 1ML3A 2BMVA 2DPYA 4YRLA 3R3ZA 4Q7MB 1YO6A 4NQRA 1MJNA 2L69A 3PHCA 2R8ZA 3PIIA 2H0RA 3G9XA 1FFDA 1T0PA 3DO8A 4RD0A 5KNDH 2GRUA 4UUBA 3PENA 2V6JA 4PTYA 1FTYA 4C0HA 4QSMA 5JS6A 2GMWA 2Q1TA 5GINE 4E51A 5EXXA 4JOCA 1B15A 3EFEA 3NEYA 4CMCA 1T36B 2R68A 3HUDA 3UC5A 4BP3A 1Z22A 5BW4A 4D96A 5CDFE 4UJ3A 4LMPA 1JQKA 2D1YA 3LSTA 2BKUA 4G3XA 5C1IA 1OR8A 2FSGA 3K0EA 1T6YA 1PIWA 5D86A 4TROA 4IIDA 3PJFA 5DYTA 4B2IA 2DERA 3OE7A 1WO8A 1NVVQ 3HBMA 3KUUA 3LU1A 3O7MA 4GBGA 3RYCA 2WOJA 1Y6GA 3GLGE 3S81A 2JBAB 2FSIA 1MNAA 3ZJYA 1KNXA 1N6OA 1Z8DA 3P2IA 2UZ1A 3ITKA 3HXKA 5I9SA 3UH0A 2CZCA 4IRUB 5B1IA 3ZU2A 3PKIA 3QLVA 1L5FA 2PHZA 3K5HA 3KVOA 4Z7NB 1BFUA 4ND6A 3UAOA 4WINA 1H4QA 4ZEVA 1K5HA 1QRUA 2JVKA 3BZUA 4RF4A 4BFTA 5LU9A 1XAHA 1X38A 2W93A 1N5IA 1SC6A 1LLUA 1W85A 4PAQA 3TI9A 1LI4A 1SURA 3FNIA 3PPXA 4CETA 5JCJA 4HVCA 4LF4B 1M2VB 4LJ8A 1NLUA 5JSYA 3RC3A 3EXG1 3QUBA 3W8NA 4E2FA 3CE9A 1DFHA 4F6RA 4JENA 3AK4A 3EC7A 1YDWA 4FNGA 4LHYA 3K0CC 4JU8A 4PXAA 1RWMA 3R74A 5C1OA 3SHFA 2PUFA 1G5IA 2X15A 1CYDA 3FZQA 1ZGCA 3SF8B 1SUAA 1P7VA 2LCFA 4PNHA 4ZQHA 4Z3DA 4J3JA 1J7KA 4G8CA 5GTDA 2GEJA 1A9TA 1W4AA 3F8TA 3NHFA 4YP7A 1RXEA 5AXDA 3ZOZA 1ILEA 5FWYB 3C4JA 1FDVA 1EFRA 3DOEA 5TJHA 3PC8A 4Q4HB 3V3KA 2IA5A 5DYIA 2BJWA 5I47A 3L6BA 3UYKA 3E05A 4CLHA 5A5VA 1JAYA 2CDAA 3T4PA 1PSZA 5TVGA 3DG9A 1YZKA 1ULBA 3TXXA 2BSQA 1INLA 4KX5A 3M6AA 1XRPA 2IBMA 3I05A 2PAFA 4GO1A 5GQSA 2ZJ3A 3FDFA 1NZFA 5HF9A 3JQEA 3VSCA 2RJOA 3IJEB 3R09A 4KX3A 2D1TA 3SFVA 2XTMA 3EBPA 1IXRC 3G7SA 2QJFA 4P3PA 4D1YA 1Q14A 1ZIPA 4YLEA 5EYPA 3HGTA 4RM3A 5ES4B 3WISA 4LHEA 5FBLB 1JTEA 1KOLA 5JJIA 1B8NA 1EDOA 2D5AA 1W47A 3DZIA 4O2AB 1ESCA 3LJKA 3LZCA 4HHEA 4US0R 2IP2A 1RE1A 3QVWA 4QQRA 3NEPX 3E9DA 2I80A 4U8HA 1ISMA 2PQ6A 2QZ9A 1NN3A 1E6LA 1Q2XA 4KTTE 1D2GA 1S2NA 2C99A 2HRRA 3MF4A 4OBBA 5FBKA 1J9ZA 2EFCB 4FU0A 4AJOA 3LUCA 2HQRA 1I7LA 1JHRA 4ME6A 3B6KA 4LXGA 3JYQA 1YA4A 2NT3A 3K0FA 5JAIA 1C9NA 5AVOA 4OHBA 4MRNA 4E1BA 5AWFC 1I1HA 3R0VA 4A16A 4CL0A 1NBME 1EFUA 2CEKA 3Q11A 4FEAA 2NU6A 3ETEA 4GWLA 4QX6A 5LQSA 5LIRA 2DY0A 1EFDN 3KEOA 2J3MA 3QUSA 3QITA 1UMDB 1L4FA 2BRUA 4TL9A 3QX8A 1A5TA 1VE3A 4PBRA 5AOAA 4R9VA 5H1YA 3FCSB 5H70A 1RE0A 3U4IA 4M83A 5FAKA 1DUSA 3I3SR 4G5GA 4KGXA 4XKJA 1FX0A 2RI6A 2XX3A 3Q3JB 1LRKA 1GNPA 1TW2A 3GW8A 4AG6A 3HCFA 5ERXA 4D9MA 1ZVKA 3DTTA 4F71A 3TQIA 1JGTA 4DWOA 5LOVF 3B6JA 3BWMA 4H3SA 1MX9A 1XKQA 3BE8A 3DAYA 4J03A 5TARA 4PPFA 5KSZA 2YKGA 4K6OA 3X1XA 1RVV1 1DQPA 2BGMA 2EKZA 2Q0QA 4X63A 2NP7A 3ETDA 2RBKA 4I1YA 1ZJYA 2B8WA 3GG9A 1K68A 3L40A 5ESXA 5IXJA 2E4WA 1YU9A 1JKFA 3VV3A 1R6VA 1OZFA 2FQWA 4HLUA 1TAQA 3QVGA 2CL0X 2I1LA 1QTRA 3MB5A 4L8LA 1WRBA 7ADHA 4L50A 3SZRA 1P2FA 2P67A 4ZD6A 5E3IA 1RWXA 1X1QA 4IDQA 3RRFA 1QCYA 1ZH8A 2EJBA 3DGFC 3T9CA 1G21E 2YJNA 4LJRA 3ZW7A 2KYRA 2ZTLA 3DHVA 3LGAA 3LOPA 4B33A 4L9AA 1W1UA 2O7QA 5E6UB 5HQ3B 2SKEA 3IEXA 2IWHA 5LD2C 1ZMRA 4G0QA 3UK2A 2QM0A 3Q3CA 4XR4A 1E7RA 2P9YA 4XSHA 4J7CA 1QUFA 3V1LA 1ZISA 4EMSA 3ZXSA 4JCOA 2RC6A 1GUYA 1YMUA 4RH3A 4XA8A 4XARA 1R0BA 5TPZD 1BD3A 3G2NA 4G65A 3NX4A 3O8CA 1GUZA 1P4AA 5ER6A 1OB5A 1F3OA 1N6NA 2YUTA 2ZVJA 1R27A 2C3YA 1FP4B 1UMCB 4UHEA 1IEQA 7GPBA 5FYDA 1DBVO 1V3QE 2I3BA 4QRDA 1N2SA 5HEKA 4LMAA 2REOA 3E1SA 2H3EA 3EF3A 2G17A 1PJQA 4TPKA 3CLRC 2F55A 1Q1QA 4XCQA 4ZFNA 4Z0TA 2O7NA 4B4OA 3RFCA 2LKDA 2ZUEA 1DRKA 4QPJC 1DC3A 1MA3A 2HWUA 7AT1A 1HWYA 3PGXA 4MUMA 5B58T 4FFPA 4CF3A 3ZVNA 1XZJA 3DDNA 5I4BA 1P45A 1PT9A 2LD4A 3LHIA 4WESB 3TLAA 1PNOA 3P20A 3C6QA 4Q9DA 1CJCA 1ZVJA 2B34A 5ARDA 1CJUC 2ZRGA 1JPUA 3WFJA 4IDHA 2CFRA 1X1SA 3K8OE 1IAQA 3IDZA 3WB0A 4LBYA 4DREA 2XWJI 4UOEA 3FNRA 2D0OB 4A82A 4UM9B 4X66B 3RYIA 2RHWA 2R85A 3PWSA 1BROA 3I8XA 4F45A 5FX2A 3SOPA 2EJWA 2OP1A 1GGHA 1IY0A 2D8MA 3BWVA 1Q0SA 2IJGX 2W00A 3P2JA 3PQ7A 3WV5A 1A7JA 1ULSA 3AR3A 3KPJA 4HGZA 5JH7A 3Q7PA 4K9KA 5CM8B 5I7VA 5GV7A 2JFYA 4MV9A 1IAVA 2F90A 5AO9A 4FHEA 3JZIA 3TAHA 1FPQA 5BWNA 3L4JA 1H9CA 1MV5A 2YJ6A 5T6MA 2I67A 4BV9A 3RGWS 2PKXA 4FYWA 1Q57A 4MIOA 2ZTUA 5CVJA 1IQUA 3SYRA 2FWNA 3UY4A 4JI8B 3PX7A 4KJZA 2AZDA 5GGYA 4HAZA 3ZJ5A 2FZCA 5YASA 1WIWA 1E9AA 1VC2A 1ONOA 1XX6A 1Q0RA 4MW9A 4WXPA 3THWA 3Q9LA 2WFZA 1AKUA 1F2VA 2EDAA 4RZQA 2MJLA 3LD9A 3QLVC 4D3DA 1EWRA 1NWCA 4LJAA 3UTCA 2AW3A 1T5BA 4DMGA 1QDLB 3S40A 3DPUA 1N9KA 2HJGA 1EESA 5DN6A 2X8LA 5CXXA 2R00C 5NLLA 1C7QA 4INZA 4MMZB 3EULA 5CA1B 4JVNA 3A10A 1W36B 3HO8A 4QYIA 1AU9A 1XD2B 2JW5A 3EZXA 2JLAA 3HU1A 3ODGA 4ARBA 5AJZA 1SG0A 1U9YA 2WJJA 2RKOA 2LP4Y 2G3YA 1XNGA 2A9FA 4AJIA 1OFGA 1QS0A 1Z6AA 1ZW6A 2ZBQA 4PBSA 4U5XA 4DW8A 1PNRA 4TN1A 5HF5A 4I4LA 4JUAA 4HAVA 3KOUA 4CCWA 4CEHA 2GQ0A 3HKDA 3L7NA 1FLAA 1FLDA 2QTWB 1O0CA 1DZ3A 2V96A 2YQZA 1N78A 1EWVA 3ABRB 2P8JA 1HC7A 3ZDQA 2I78A 1ZJJA 4Q37A 5JNLA 3R9XA 3TIXB 2C7GA 3CUTA 4OP1A 4FMBB 3OPMA 2C00A 5FTNA 5T3UA 5AMXA 2EP5A 3HBLA 2W6IA 1NRWA 3W6NA 3NAMA 1AOXA 3GJ4A 4JP2A 1QHNA 1EQ2A 3N7AA 2WTNA 1R0ZA 2J1LA 4V0KA 5H5JA 5BV8A 3CJTA 3EVBA 3AVVA 3IH5A 1RNLA 1L1EA 3C1TA 3PITA 3BCRA 4L02A 1VB5A 2WKPA 3WNBA 1RDFA 2RGNC 3WYNA 2PA0A 5SY6A 4D56A 2PS0A 1M7HA 2X8JA 1NN1A 1EIZA 1FQKA 2D6FA 3N3AC 4FK8A 2QTCA 3HM2A 5C4MA 1ZIYA 3UMBA 3QH4A 1ONNA 1BVUA 1Z37A 1YDEA 4C88A 1A9SA 3UHPA 1SCUA 3EUFA 1E62A 4ZVRA 2H31A 3KM0A 1QQ6A 3BG5A 1SQGA 3LQFA 4DNOA 5FFNA 2XR1A 3GU3A 3DEFA 4YAJA 4EUHA 4Q1VA 1NXSA 2PUEA 4FDTA 1GFZA 3GHYA 2JD0A 1JDVA 1E5QA 5F9MA 1TX4B 5ETJA 4RH1A 1L4HA 1M75A 2MT9A 4ZI3A 2B92A 2OV3A 2PTHA 2IRWA 5GAJA 4RIGA 2R5FA 2QP4A 1PG2A 3ASUA 5AI0A 2AGVA 1H4VB 1G42A 2YYSA 2ZSBA 1YU6A 1ISRA 4YRIA 3G9ZA 4JI2B 2WIDA 4Y2RA 3B13B 1DBRA 1NT4A 3OZUA 3STVA 4J6EA 4OQMA 3WKDA 3RC1A 1OH8A 2CY0A 3S44A 1YR6A 1V48A 3ROXA 3QTLA 4JJKA 2RAFA 3V00A 1EVQA 3E9RA 4ZCRA 2VZ9A 5A4IS 3IP3A 1LFAA 4B3FX 1TMYA 1UKVY 2R0QC 5AJHA 3N5KA 4KSBA 4W6ZA 1JKMA 3E27A 1HE1C 4GZLA 4M8NE 3IEIA 2JI7A 1Y37A 2IEGA 3V8EA 1VM6A 3DEZA 4TMXA 4FHDA 3FOWA 3PHIA 1N2HA 4R41A 3RYHB 1NJ2A 3DYBA 3G0CA 4YJDA 5JQGF 1Y8QA 1JSLA 1NXWA 2GCEA 3DBOB 5AIAA 5FV4A 1XVLA 5JI2E 3EIHA 2I0FA 2OHHA 3I1IA 4CR7A 5L4NA 2RGUA 5ALYA 5MDHA 5A3VA 1NTRA 1WQ1R 1W5BA 1TJNA 2W2LA 4GU5A 3ZU3A 4CV3A 2OB2A 3AKDA 2G09A 4QTUB 4RDIA 3KEGA 4CUKA 1LQTA 2OUIA 3BICA 2B99A 1RXYA 1S2LA 1G2IA 4US1R 3EXAA 3IXMA 4FFNA 4MRPA 1U31A 2BTQA 4TV8A 3U7IA 3QEAZ 4D57A 5E6SB 4ZU1X 4LWZA 4EG4A 2CKMA 1ZU5A 1JQAA 2JCYA 5I45A 5E1MA 2PVCA 1RQXA 2VDLB 1H9BA 2YZKA 3JWJA 2JANA 3DBHA 2FUNB 4PC1A 2WTAA 2NXEA 4IFEA 1UJ5A 2IHNA 4NR0A 2B37A 1XL0A 1A1VA 1ZUWA 4MRMA 2RGGA 2R00A 3QLUA 2O1SA 1PQ4A 4GUDA 3GA5A 3O2JA 5FPYA 4UAJA 2FX3A 4OA8A 2QM3A 2FCAA 2IYTA 2DF8A 2ZUWA 5CB4F 4QXQA 3VJLA 4C0JA 2W7TA 1G3MA 3DONA 3AEUB 4WZBB 1PJRA 3KPYA 2V5VA 4FOTA 3ZCTA 5A7FA 1EQUA 3UJ3X 2EGGA 3JQAA 5EZSA 3SLKA 3RWMB 4HDSB 4JVMA 3W34A 3PNSA 4WL0A 3AHDA 1I3MA 3FJOA 3B6MA 4U7DA 2UUBB 2IWRA 4K0KB 1UFVA 1C7IA 1JVBA 1CY2A 4RKQA 4BRUA 4R8LA 1JQBA 1Z39A 3ONWA 4GOKA 4KNYA 1A9XB 5ED0A 2B8TA 1JZSA 3ZBUA 2CHQA 2O0HA 3NM6B 3LQ2A 4UEOA 4ZHSA 2FFRA 1OVGA 4XUEA 1Y9JA 3O2NA 5AK4A 4BUJA 4K6HA 3EPHA 1XD9A 4KIGA 5D01A 4UUNA 1S8AA 4LDPA 4U9IS 1NP6A 5ALZA 4NY1A 4G36A 5HQ3A 3F7NA 2X40A 4LE0A 1I4OA 4D8UA 1N92A 3B1VA 4D44A 1X1RA 2QN9A 4N5NA 2PWYA 4UCWA 5GADl 3C6XA 2NU6B 1R5NA 5AM3A 4UEKA 2ATIA 4O4JA 3EC1A 1UBRS 2I5PO 2YXDA 3R41A 4JA2A 4QFDA 4QPPA 3ZW8A 1K8XB 4B79A 1F5SA 3QFSA 4HDNB 4H77A 3WGUA 3VDXA 3FYHA 2YHBA 3TB6A 1UPFA 1T2FA 2PY6A 3KQKA 1B74A 1VIMA 4NK5A 5AW5A 2CVFA 4ARAA 3WRYA 4NESA 4L5AA 3FRHA 5T6BA 1XB2A 4DMUB 2O57A 4A0GA 4EJ0A 1DXQA 4H16A 2WE8A 2R9VA 3PP8A 5JV5A 2YWFA 3BMCB 2OM2A 3FLEA 4M9SA 2ZT8A 4MGEA 3AVQA 4AECA 3PQ6A 1SUPA 3JQ6A 5JSZB 5HP4A 3ZQ4A 4BB5A 1BG6A 4GMDA 3CLSC 2H5IA 5F1OA 1JYSA 4K2AA 1NAIA 4OCZA 5CIWA 4CFSA 1H2BA 4QASA 5KC9A 2DWPA 2WSSA 1E9BA 2OLEA 2ZU0C 2J5XA 2XDWA 5KWEA 3QBJA 1E99A 2R7LA 3M0EA 4ENSA 5A3SA 1QLJA 3MCWA 2PMWB 3PC4A 3HS3A 4Q9JA 1NBIA 1ZD3A 4FI3F 4V3CA 5ALKA 1JH8A 2Y76A 2NU9B 1S0UA 1CQIA 3WWOA 4I8XA 4F9EA 2PTGA 3IPYA 1ZOPA 4R1MA 2PO5A 4MWCA 3TIFA 3T4XA 4A8JC 4F85A 5TMDA 4B1FA 4XSGA 5BOSA 1Z08A 2WHQA 3JYOA 5LQDA 3PFNA 5IVHA 2PGOA 2PWPA 4D0SA 3UPTA 3MOGA 4G8DA 5C5DA 4HBZA 3VOSA 1W34A 3EMDA 4LX0A 2JLXA 4C29A 3HO6A 3H65A 3PSHA 2Y2VA 2FPIA 3N75A 5DWDA 4LQCA 3BILA 4ZRDA 5GZ6A 5TJ9A 3A3YA 3C3DA 2X9QA 3SC6A 1QKJA 3QKUA 4IV0A 2IEIA 1NPDA 1IZ9A 3EUEA 2B8NA 3A8TA 1NJ8A 2VDPB 4OYYA 5CPBA 1DT5A 3ICWA 2CK3A 1WW3A 2VXBA 1TEZA 1D0SA 1KK3A 1L7BA 4D46A 1CZKA 3E6AA 5KKCA 2ZCUA 5JQWA 4N3BA 3AF5A 4BLRA 4G2NA 4N4AA 4CG2A 2VUHB 3UJ7A 4FZRA 4TVSA 2IBSA 1ZNWA 1KIFA 1X1EA 1YAHA 3TS1A 4BMXA 2OD9A 2B6NA 4LSZA 1KXZA 5CUQA 1Q7GA 2OENG 5AI6A 5TS3A 2GXAA 5KYXB 4WESA 1PT5A 2GYUA 1NNEA 2NU9A 4BVHA 1T5LA 1LS1A 5DH9A 3QWBA 4D4GA 5HRCA 1PD1A 3IS3A 2R84A 2X3FA 4CUZA 2V6MA 4IKPA 4K6MA 4B3BA 2XCTB 3BGVA 4BB0A 4OHCA 1M10A 3UUFA 2VAXA 1QCZA 3F49S 4TV9B 1L7XA 2PUTA 5THQA 3WWPA 5JBNA 1RYNA 4MSUA 1U81A 5JSQA 3E15A 1PTKA 5K4AA 2KSQA 4M8LA 1LC3A 3L05A 3LBNA 2MSKA 4X7BA 1X1CA 4DLUA 5D51S 1MAHA 2CF5A 3FPHA 3D2BA 3T6KA 4LRXA 4HAYA 4MCJA 4QLAA 2W8BB 4NEQA 4DIUA 2ZB7A 3EF0A 4AW9A 5CLQA 4HNRA 4KI7A 1AK9A 5EJ2A 1WY7A 3GD7A 3O94A 5FWDA 1N6IA 4QUBA 2HH9A 3TDNA 5ULLA 1TL7C 1P5JA 1RI3A 3A9RA 3ZWDA 1H42A 3KQHA 1RTKA 3ILXA 2HSZA 1O54A 3JQFC 4FR2A 1J1UA 1KKLA 1LDBA 4B82A 4MKHA 3VNQA 4FLEA 3BERA 3C3KA 2MMGA 4IGFA 1FNCA 2Q3EA 2OAP1 1OZAA 1DP4A 8ATCA 1JSRA 3AVTA 4Y0NA 1RIFA 1J2EA 3OPYB 4EAAA 1JYEA 4BMSA 2OESA 3HMKA 3N07A 4CBVA 4F1KA 2GTIA 4R0MA 4DMCA 4PX3A 1EDBA 3JQBC 2QLLA 4C78A 5GJBA 1J24A 2IEDA 3T38A 2NSDA 2FMIA 5D1NA 2BCEA 2CFCA 1IC6A 2QX7A 3IHTA 4I1IA 1PJZA 2FPRA 1HY3A 4UD6A 3N6VA 5CD1A 1K63A 4PRKA 1VL1A 1EGVB 1E3SA 4YQZA 3QKRA 1K3UB 1LPBB 1RPAA 4R9UC 4L9RA 3S2YA 3GFVA 1KYZA 1KQNA 3GH3A 4EHKA 3BMQB 5KHLB 1CNFA 2CYBA 1U8UA 3R76A 1B4DA 2GNPA 3V48A 1BKSB 3PXGA 4EAQA 2EF1A 1HUQA 1HSOA 1XEWX 1F7UA 1MO4A 1UBNA 3O90A 2WJIA 1YCFA 4BMVA 5JADA 1MORA 3ZDBA 5E9QA 3FPBA 5CDTA 2ES4A 4BQEA 2C29D 2NW6A 3JTMA 3N2EA 4RKRA 4HJRA 3WK9A 4JXXA 3P71T 1LDGA 1JE1A 2I2FA 3CWCA 5CCEA 1GARA 1UAGA 4MVJH 3H17A 4AUEA 2WV7A 4OFXA 1T0UA 1V2HE 1ML4A 4IIXA 1CUHA 3QFRA 5DX1A 1M2FA 3ESRA 5KOJA 2PZBA 4WSOA 4RJJA 5AQ1A 5HKKA 2R8YA 2IYRA 3RU9A 3BFVA 4UE2A 3VU0A 1E2MA 4DBLC 2VP0A 1KEKA 4B3GA 4A92A 1SC9A 4UEQA 3ZDCA 3RYFB 2FDCA 3L43A 5IZCC 1DIHA 3N39C 3I9KA 3LLVA 1ZG3A 1F6DA 1TF7A 1F2UB 1E5DA 4QYTA 3V8RA 1PT6A 2OGTA 2ILVA 3G5UA 2DBYA 1FRVA 3Q98A 4OJMX 5C0OE 3R6TA 4TL6A 5DTEA 1JNXX 1QG6A 1XWFA 4ZC1A 4AN4A 3RSSA 5I7AA 4EF5A 3DDOA 5G1PA 3DXYA 2YV3A 1HFKA 1RLIA 3AQIA 2AD5A 2IW3A 3M3PA 1U9IC 4UTOA 3KQYA 3T0IA 4LOIA 3W0LB 1SCDA 4B45A 4ZYLA 4EB6A 2AN3A 2HK7A 2EV9A 1X7GA 1XZGA 2PJZA 2TMGA 3BFXA 3OE5A 3T5DA 1KL7A 4RIHA 1GZSA 3WMFA 3IR5A 4LQ4A 3GT4A 4NYIR 4HCJA 1KO7A 3MWLA 5KKNB 3JARB 4IXNA 4B73A 1VTKA 1ZW1A 1G60A 1ADGA 2IDMA 5B1DA 3HXTA 4ROTA 2YIVX 4LYAA 3W2IA 5CLFA 1XP5A 2CYCA 1TKRA 2JIZA 4U63A 3WSVA 3FSGA 4I3FA 1GA1A 4NCHA 3U17A 2IS6A 2PUHA 2GLUA 1YWGO 3I5MA 2B5OA 5BW5A 5FV7A 5KOYA 1GPJA 2C2WA 1PFUA 2CFTA 4P3NA 5ILGA 3TTYA 2EYUA 3OX2A 5B7NA 1P3Y1 3JYHA 3FDIA 3M1AA 1N2BA 2BI4A 1S5PA 2OP0A 2QOEA 2YH2A 3FOCA 1YA8A 1E60A 4RCYA 4QC2A 1L5GB 2Y1LA 1LH0A 1U3FA 1SRRA 1DCKA 2F7SA 3GRCA 1TFUA 4IHJF 3ZNNA 3KVYA 5GONB 3OKAA 1LBTA 4YN3A 2CXOA 5HOEA 4CT0A 3U6KA 1QYCA 1CJKC 1JHVA 3E9NA 4AJNA 3AI3A 3JWHA 1URPA 4W5NA 3ONFA 3G89A 4DJTA 4O4LB 4IW3B 1RXVA 3ZHTA 3N3BC 1XEXB 2V7TA 1QRRA 3VX3A 4AKTA 2PCJA 4J76A 4FEYA 4PAMA 2WVGA 3AJRA 2JNWA 3I32A 1LPMA 2HU7A 2Q2NA 4EA6A 5CVEA 3GX1A 1I0IA 1NZDA 3V55A 3BF7A 3P9QA 3TFQA 4H59A 2JKVA 4M1TA 4MO9A 4ZVQA 4A8JA 2J9ZB 3P5BA 1ZUIA 4F9TA 3VJRA 1N9ZA 5LQJA 3W1VA 4XIGS 5HM8A 1E2PA 2ONCA 3CZMA 1OXMA 3CVWA 2OBBA 1MC5A 2XVZA 4J2OA 1U3WA 2PBZA 3K70C 2PL9A 4XGRA 1QANA 4TXHA 1KO4A 4RFVA 1NW3A 3SDSA 3T35A 2BLLA 1T2DA 1V6SA 2OBXA 4WMLA 4NS1A 1OFUX 4HLDA 5DGHA 4P83A 3MAJA 4X1IA 5D84A 3TRDA 2GI4A 5KTMA 4ALKA 4BQPA 1OE0A 2JA1A 1FFXB 3LPLA 2X1HA 4EHLA 5CGQB 1ZICA 3ZUPA 5B55A 2RCNA 1YJCA 3RROA 2DQKA 3L06A 5FWYA 1N7IA 2Q4RA 2JGFA 1HF3A 2UXDB 1FSFA 2IHKA 3C7AA 3IKTA 1T2NA 1VL0A 5E4TA 4IXWA 3C43A 1YZNA 3V3TA 1ZIDA 3AW8A 3T4UA 3DP9A 3RAGA 4URVR 3KYJB 1AA6A 4R05A 2C8JA 1U6JA 2Z5GA 3TK1A 3L02A 4YRKA 1JT9A 1U8AA 3TG2A 3RKSA 3KSZO 4GSKA 4YFYA 2JFFA 5K51A 1USGA 2YWCA 3C3CA 4MS3B 3LX6A 3IE0A 4Z2YA 5AVVA 1RBYA 4U2CA 2MU1A 1WR8A 1O6FA 3A2MA 3DQZA 3PXUA 2HXSA 2RSLA 3IEUA 4PU0A 5CX1B 4EI7A 1B1CA 1KIMA 1M2HA 1OJLA 2ETXA 1BWQA 3DE5X 3LCCA 4HYTA 4BKMA 4M38A 1Q1NA 4DBZA 3U4QA 4M7WA 2AC4A 5AM1A 2BFWA 4QWMA 4DR6B 2DCMA 5AXBA 1CUFA 3OVMA 4JMLA 4AYWA 4G0UA 4HAXA 1PK8A 2X1MA 4EW2A 4P54A 2P75A 2WF8A 3F5MA 1EIWA 2XDAA 4K1LA 1UBGA 4NPAA 4KE6A 4HH4A 3TIGA 1GR0A 4RVCA 3NATA 1AB5A 2J7PD 3BH0A 4TQAA 2FX2A 1H3EA 2AC2A 3QA9A 2IYVA 3ANLA 1VHLA 2PD6A 2V3VA 3H4TA 4RPKA 3UG7A 1VJDA 5DNUA 4RD3A 4A2PA 5KCZA 2WPDD 1EAMA 3ANTA 3OECA 4JLKA 5EEGA 5EP3A 1E2HA 2HPAA 5DRTA 2CNWD 1FQWA 5LQKA 5DYGA 1QZ3A 2P4EA 2CC2A 4JBLA 2PT7A 3VVLA 1RWOA 1WBJB 1FP1D 1WZNA 2WHEA 1IWBB 2O7VA 3I0MA 4WE3A 5IDQA 2Q7XA 1A71A 2AUMA 1EM6A 4ER3A 3GFBA 1L1RA 3B9BA 1G4AE 3QBVA 4OP2A 4N8DA 1THZA 2HSEA 4M6WB 2F3QA 3RTDA 3ZZNA 1EFLA 4UUOA 2WIBA 2OCLA 3QLUC 1Q1GA 2F1IA 2LR0A 2IOHA 5A4JA 5IAAA 3OLXA 2H2IA 2ZANA 3IAUA 2CSXA 4IFIA 5ENVA 1O4VA 1U0GA 4K88A 5GONF 4BVFA 1P0CA 2QUKA 4PPGA 2NGRA 1SB9A 3H2SA 1JEYA 5B3AA 3FTEA 3NHMA 4P7JA 3OE1A 4RHTA 3SXPA 1NF8A 4RXTA 5ESWA 2O7SA 2ZYUX 2MINB 3GQBA 4O4LF 3LW8A 3RFVA 4KO2S 5IWAB 3CCBA 3D6HA 3NHZA 4PSCA 1A2BA 2X5KO 2BHRA 3OJCA 3EBLA 4H7IA 4EVQA 3OEED 5JAMA 2F43A 2FWBA 3UH1A 4EG8A 4RSGA 1SBIA 1HG1A 1R9GA 3IXQA 3OIUA 3ZIDA 1OPXA 3H19A 3M6IA 4EGSA 2R7NA 2O1EA 4TLAA 1Z0FA 2FRDA 1M2KA 4YV7A 1BGXT 2V9ZA 5IM5A 3STWA 4XYBA 1YFJA 3TPZA 5I7FA 4A0SA 3A2NA 2CNDA 5IKOA 3KEQA 2OV1A 5EKXA 1MJ5A 2DAPA 1CBUA 2H4ZA 3TJZA 5E1BA 1ENYA 3RUDA 1QZUA 2QR5A 4LZNA 3FYUC 4M36A 1KYYA 4CMIA 4MUKA 3ICVA 1QP4A 1TZBA 1U8FO 1LD3A 2VDRB 2J0UA 3ORFA 3EZ6A 2E21A 5F1PA 2B0JA 2XQVA 3SVLA 3EWIA 3KKMA 2NT4A 2P9QA 1FBNA 5FPSA 3DE2X 4JBNA 4NAUA 4XPIB 1FZQA 5FUYA 5HA5A 1EVLA 3BC1A 3VR6D 3EQZA 3EVTA 4I4NA 4JLDA 2QZJA 1UKYA 2WQ7A 3I0NA 4DLLA 2BFAA 3OPYA 4UU1A 2G71A 3GQBB 4ZN6A 1GU0A 3Q8KA 4F5DA 1B6RA 1Z26A 2P2NA 3LAWA 1YOVB 1XNHA 2CVQA 3MWEB 3L18A 4AXXA 1VKNA 1IBRA 2HCRA 5IARA 2P9HA 3WYGA 4RABA 3V7NA 3O0TA 4C7JA 2AL7A 1MOZA 4KQCA 3DOOA 1XCLA 2VUIB 3CMMA 2BGLA 5JSKA 1BFKA 2VDOB 3BIJA 5EZ5A 3IP9A 4C4RA 2H51A 4M60A 4PZLA 5JH7F 3ZKWA 1M6NA 2WMYA 1C4WA 3I9V1 1E4VA 1WABA 4JEHA 1EFPB 2WJZB 3PEEA 1BYIA 4CT5A 4BEVA 1KQGA 1C80A 1KSHA 4HUQB 2R62A 1I4LD 2AMVA 1GFSA 1TCCA 3BHJA 3ND9A 1MQSA 3AHIA 3PDWA 5LPNA 2CL5A 5G0SA 4UVEA 3PEYA 4ZI7B 2QD3A 2EG5A 3CEJA 3R5KA 1D1PA 3GDFA 1UBHS 5JPIA 1C50A 3VR6H 1YACA 3PJDA 5EZYB 5SZIA 4LWPA 4V0SA 2W0SA 5KPDA 2ZCJA 3CSDA 1G98A 1GRVA 4JUIA 5LR6A 3LBHA 3ER9A 5FUWA 3RRBA 1A50B 3OP4A 2RFLA 4RMIA 4DCOA 3F6BX 4X7RA 4W7SA 1JEEA 2ZS7A 4IQ4A 4L27A 3WRXA 5BY2A 1W4BA 5H9VA 4JK3A 4L6CA 4LRWA 1AKEA 2ECPA 4BLSA 2NQ2C 4F3NA 1KR2A 2OCKA 3K09A 4EVSA 4M0FA 4V02A 3OZFA 2Z6UA 4E5SA 3H5AA 5CVUA 1A9OA 3AFNA 2HM7A 4PG8A 2FZEA 4B74A 2OLKA 3CNNA 2HEGA 1DKPA 1P5FA 1NG1A 2OZVA 1Q0PA 2Q3HA 1BGVA 1Y63A 2XGOA 5JCOA 4L0DA 2EFHB 1Q15A 1ELOA 2Y6UA 4CF6A 3EMBA 4BAUA 1IVNA 2BGRA 3A0RB 4A2QA 5KMGA 1EWYA 1SOVA 2IZZA 1EG2A 3K2IA 1THTA 1BE0A 1ZOIA 2EZ4A 3BMQA 5KNBD 3L93A 2IHYA 4B7UA 3Q6NA 1ADFA 3QKRB 5COQA 5L4SA 2CJPA 1M34E 4M7PA 1IONA 1PFYA 1PZFA 2MDTA 3CF4A 3IILA 4CM1A 2BDEA 1UKBA 3WMXA 5FNVB 5IDWA 2C4TA 3CT4A 3NFYA 4L0QA 3L5KA 1M2GA 1ND5A 4LN1A 3PJEA 4TL8A 4X9XA 3EDCA 4DNQA 1QXSA 1QAOA 2AEMA 4GVLA 2VBCA 5DGXA 5J2UA 1W0KA 1U7TA 3TNDA 1CRWG 1SA0A 1GVNB 1WSDA 2WJAA 1QG0A 3F7OA 3C5EA 4IV8A 1A3CA 3ZV7A 1L7OA 3V2HA 3GA7A 4W9NA 2L19A 3CRW1 2ZFUA 1KJQA 5AM0A 1VLZA 3UMJA 4LY9A 3L6RA 4OHPA 4TLBA 2Q9AA 5HJ2A 1HNXB 3K8YA 1QGOA 2ZRPA 4UBOA 3W3AH 2Y9MB 3ZTTA 2AOVA 4OMCA 4DHWA 3SXUA 5L6MB 4C2UA 1CUEA 2VS1A 3KZMA 2CLSA 3FH0A 3OPXA 3TZKA 2OILA 2X4LA 1C2TA 4XX0A 2LCIA 3DEAA 4ZHQF 4B35A 3VH1A 3I53A 3R6GA 2WABA 3A6EA 3N0WA 3S2FA 1SHUX 2O14A 2VHEA 1HLDA 3JALA 3N8DA 2EEPA 1J0EA 4O4IF 3KVNA 4EYEA 4GOMD 3MTBA 1E2JA 3IVRA 2RHGB 4OGLA 3QBTA 1YZTA 3IKVA 1JFFB 3JAWB 4RA9A 1WF3A 4R5HA 3GIDA 4TWAA 1ACLA 1DQSA 2FV8A 3DOCA 3FUCA 3Q5EA 2AXNA 1EMDA 3ZWOA 1PG5A 4Y6RA 4YFVA 5A5FA 3EWNA 1SOUA 3BWBA 3FOBA 4PO3X 4TTAA 1QBKC 5FTKA 3A2KA 3ZGOA 1BWRA 2IPXA 4EHFA 8LDHA 4D8VA 3FW1A 4LECA 4L5BA 3GFSA 3L8HA 2Y66A 4CHGA 2PANA 1JIUA 4N5DA 3TEMA 1Y98A 1DQYA 2I2WA 1LJUA 2BP7A 3SQMA 3FHTA 4CCSA 1BHJA 5K3OA 2QN3A 1GRCA 4QOEA 2QN1A 5IT0A 1IPHA 5EE1A 1PBNA 1WMEA 3CN7A 4G67A 4RETA 1GZDA 1I0LA 2BM8A 2GO7A 2LXNA 4DUGD 3CVVA 1G38A 3KHUA 4I08A 1UK6A 3KE9A 2WT8A 3DF7A 3EUAA 2EKPA 3EE6A 4GM0A 5JXGA 1VRWA 1ISSA 2EU8A 3EWAA 1OVMA 1Y9EA 1FVFA 3ORYA 4XH9B 4FCTA 2Z1NA 3LRTA 5TC4A 1HBJA 2OSBA 2BPOA 2P62A 4KE9A 1AZTA 1NE7A 4OLHA 2WMDA 5EJ5A 4ZARA 3I2FA 1I14A 2JCGA 3PRYA 2HF2A 1FVXA 4FNMA 2Q8QA 5THXA 1OI7A 3BA1A 5HGXA 1RXWA 1DKOA 3ZLTA 4B43A 1P0MA 2JCVA 1DHRA 4HR7A 3WWZA 1SCBA 2WWHA 3O4IA 2JC3A 1R0KA 1IQPA 2AB0A 3ESCA 3HH8A 4IIEA 4Q3EA 3KZOA 1PK9A 4AN0A 2WT9A 3BPSA 2IYQA 4UTRA 5KNDD 1VA5A 2O8DA 2VBIA 3PX2A 2I8LA 3JVUA 4NONA 3R8FA 3AYXB 3ZE7A 1NBEA 4XJXA 1APBA 2ISCA 3EF1A 1N8TA 3OTGA 3A32A 4RKFA 2BGKA 2SECE 2IP4A 4G1CA 1KH3A 2QWXA 3GRPA 4TSFA 4AZ0A 3KOYA 1UKCA 1E1QA 2V7GA 4L2IA 1HE5A 3WYFA 3WYCA 5AW7A 4AKIA 1LLCA 4QBKA 2PLAA 4PYJA 1ESMA 2ZWOA 3DJYA 1AT1A 3CPEA 1YJXA 5K1ZA 2AVNA 3HB1A 3AM5A 1O7JA 1W7AA 2I6SA 2O8BB 3BIFA 2EWVA 1RLOA 4TWIA 5EJ7A 3QWIA 1BEZA 4OI1A 4NZNA 4DV0B 4KQXA 4FHGA 1KJNA 2CE2X 3I1FA 5TRTA 4UNSA 3IV7A 1LDEA 1SEVA 1OH5A 5AKJA 1MABB 3VISA 4KWIA 3CINA 4CJXA 4X1KA 4EG5A 2CXUA 1SG6A 2RBGA 3R8XA 2J5BA 3ROMA 4ARZB 4HMPA 3DAGA 4AO8A 5I3ZA 2CLMB 3UA3A 1DX6A 2ASVA 3PHLA 2DT5A 1IK4A 1M2WA 5H8WA 4X65B 4JNCA 5BMVF 1V7PC 1F38A 3VAAA 3HA7A 1X8XA 1HQKA 1NBOA 2VNJA 3RS0A 1CQJB 1XZNA 4D80A 4J3NA 4M0MA 2XNJA 2BFNA 5A6SB 1NGSA 2G70A 1SO8A 1L5YA 1HLFA 2ZRKA 4DCMA 5BR8B 2JI8A 4IF6A 4M8IA 1XTKA 3EA4A 2AKAB 4PCLA 4KIWA 1XKXA 4MQBA 3GK3A 3UC9A 5F9FA 4MQ5A 5HQJA 1RW4A 5DKFA 5TSDA 3S2UA 3U09A 1JHXA 1MUUA 2OGWA 4OY3A 4B47A 5GVRA 2R8EA 4L3VA 4JYZA 1RQGA 5EHQA 1L7RA 2BEJA 5ELXA 2LGJA 3AVUA 1BJKA 2YINC 1E96A 3CRMA 3N58A 2BMJA 3PPWA 2BYTA 1N6HA 1WX1A 3PUKA 5FJIA 2H08A 2H1HA 3ETCA 5IJZA 3JPWA 2C2BA 3OOHA 3AG5A 2ZQZA 3UV6A 4P22A 3KLNA 4PZYA 1Z4MA 1WP4A 4WIAA 1RACA 3ZWWA 3GD5A 1DEHA 1TPZA 4KXVA 1LQUA 4P4SA 4DRXB 4PC7A 1QLWA 3IPAA 2VQDA 3H9CA 4OH7A 3UHJA 1RZRD 3AR6A 4MDEA 1TRKA 2FX5A 2ZVQX 2DP4E 3UB2A 3U13A 3B9PA 1Q7EA 2Y93A 1X77A 4LK3A 1SXJC 3GJ6A 4DN6A 4PICA 3AETB 4PV7A 4FOLA 4JLAA 3M4YA 3U3ZA 3UVEA 3NW9A 3JR3A 3KYDA 2NUAB 1W36D 3VPAA 5BR4A 4C7OB 3QX7A 3ZDZB 1EVEA 3RVOA 2Q5IA 4J1TA 5BV1A 1K66A 4HSGA 1X2BA 2YYAA 4QXPA 4AN1A 2COKA 3D1VA 1TZJA 2BUCA 2BFBA 1O95C 3K96A 4N9WA 2PZJA 5AJUA 4J43A 2HUNA 3Q72A 1TQ2A 2FFBA 1M1XB 4LZWA 3WE7A 1RZVA 2PH7A 1MKYA 2VKTA 2R8BA 4MV7A 1T5OA 4RZSA 3QV1A 2YDYA 1OLSA 4OQYA 5TLSA 1HX7A 1FDIA 2H8KA 2IIQA 5KB3A 1CC1S 2FUCA 2V1UA 1CVIA 2YWXA 4F93B 1DKMA 1HT0A 3FMFA 1AKWA 1DAFA 3PX3A 1AN9A 1ODJA 2FG7C 2YFHA 3PKJA 4G0MA 3OF3A 4OI4A 3EY9A 2QV0A 1M6YA 3H2BA 1II8A 1PFKA 1M54A 1YR7A 4L7QA 3MT7A 4NYMQ 5ALMA 2XQKA 2Y0PA 3TRFA 2RIPA 1ZNXA 3WX0A 4XCVA 1QWSA 4Q7EA 2GXUA 4OJNA 4C1BA 3UPUA 1JLLB 3KYCA 2XVMA 3IV9A 3LDGA 4OQLA 4O3MA 1E3MA 3AU8A 2J8ZA 4JODA 1RI1A 4WA8A 4BJ3A 1Q0ZA 1P5HA 3C3EA 1V26A 1XRRA 1EK1A 1TKBA 3PVCA 4XB6B 4B7CA 2I7TA 4XDYA 4ZT6A 5E7QA 3SOZA 1K8RA 2FG6C 4EENA 3DE1X 5I48A 1X7WB 4IHKA 1QVZA 4JL8A 1BN6A 1P1IA 1TMKA 3GL9A 4EBFA 5DO9A 4EHJA 3PFHA 4XFJA 3QYPA 4D25A 1N1MA 1QGZA 2QMQA 2RGBA 1CEXA 4MAFA 3IESA 1Y8ZA 4ITRC 1VJGA 4MRRA 4RFLA 4D43A 3M49A 4DLPA 2AI3A 2VJDA 1EEHA 3IIIA 3IV6A 1JBEA 4AMUA 3T5PA 1RFGE 2GN1A 3QWAA 2WHYA 4TWZA 1TO1E 1WB5A 2PEYA 5JQGB 2P5UA 4FTWA 4RFSA 4Y6LA 4QAJA 2ZITA 3GJSA 1XN1A 4KE8A 1DGQA 1J8VA 4M0PA 2Q46A 1Z0AA 3URMA 1KI7A 1V8DA 4D9BA 1TGVA 2OAEA 3U44B 3NOOA 2PO7A 4HX5A 4KXXA 3N5CA 3RU3A 4ZICA 3CWZA 5JO9A 1TO6A 3B1ZA 3VDRA 2E4YA 2F67A 3I9FA 3N0RA 1W2WB 3IIKA 3KOZA 3K1TA 2X2EA 3PIDA 4HMOA 4PWYA