5FYQA

Sirt2 in complex with a 13-mer trifluoroacetylated ran peptide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
282
Chain Sequence
ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-2
publication title Insights Into Lysine-Deacetylation of Natively Folded Substrate Proteins by Sirtuins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 89
structure length 282
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 5fyqA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5fyqA01
4BVEA 3EA4A 1SZCA 4BN5A 1M2JA 1UPAA 4GM4A 2NXWA 1V5FA 4R8MA 3CLTD 4JSRA 2AG0A 1PO7A 4KXQA 3JWPA 5EJMA 4QQ8A 4FZ3A 4RJJA 2H4FA 1UPBA 2QQFA 5EJ8A 1Y9DA 1QPBA 4V1CA 4MPRA 1YC5A 5MF6A 3JR3A 3ZG6A 2Q27A 2VBFA 4KGDA 3GLSA 4JD5A 4JU9A 1PNQA 1M2KA 4UUBA 1EFVA 2IHTA 2FWNA 4MPJA 2Q29A 2H4HA 1DJLA 1BFDA 2JI7A 2BRUC 4BV2A 2VJYA 1YHZA 3HWX1 4MPPA 1Q1AA 5D7NA 4C78A 3FZNA 3CLUD 1OZGA 1O97D 3FSJX 4G1CA 2VK1A 4K9QA 1J8FA 1PNOA 5EJ6A 3D4BA 3K35A 4D5GA 5BWNA 2H59A 5EJ9A 3PDHA 4K9MA 1HZZC 2JI8A 5FEMA 4O8ZA 2EZTA 1NM5C 4IAOA 4I5IA 1Q17A 1ICIA 4BVGA 2QQGA 3EYAA 3IAEA 1T9CA 1POWA 4BV3A 2NYRA 2FR8C 2PANA 1V5GA 2A1UA 2OD2A 4TWJA 1T9DA 1U2DC 3U31A 2Q5JA 2OD7A 4JT9A 2JIBA 4GPEA 2DJIA 2IHUA 2Q5OA 1YTLA 2H4JA 4GP9A 2FSVC 3RIGA 2VBIA 4IG9A 4RMGA 2Q5QA 3GLTA 3ZGOA 1OVMA 4HD8A 5MFPA 4K9NA 4FEGA 5MGNA 4FVTA 5MFZA 2FN3A 3CLRD 2H2HA 1MCZA 2OORC 3LQ1A 4F56A 3FLMA 1YC2A 4K9PA 2X7JA 5EJ4A 4BVFA 4Q9DA 4GM1A 5EJ5A 1O96B 4RJKA 4F4UA 1PT9A 1ZPDA 4GM0A 1M2GA 2IHVA 3F6EX 2PGOA 1PTJC 5IMSA 2VK4A 2EZ4A 4TWIA 2FRDC 1SZDA 3U3DA 4ZZIA 1PI3A 5AHKA 4JUBA 1T9AA 1Q14A 1YHYA 1MA3A 4UUAA 4RMHA 2Q5LA 4C7BA 1Q6ZA 5EJAA 4Y6LA 4BUZA 2C31A 5BWLA 4JUDX 4GG1A 4BN4A 5DGTA 1M2HA 4BVBA 2H2DA 5K2OA 4K9OA 4Y6QA 1YI0A 4UU8A 1YNOA 1Z8NA 5EJ7A 1M2NA 1PVDA 4Y6OA 4K9LA 4UTVA 4RMJA 5DEIA 4UTXA 1U31A 2VBGA 2WVAA 1JSCA 5BWOA 4JUCA 3PKJA 4D5EA 4JU8A 2H2GA 4IF6A 1OZHA 2H2IA 4J16C 3D7KA 4MQ5A 1YBHA 3E9YA 4L2IA 2VK8A 2JLCA 3IAFA 4RJIA 4K9KA 2A1TR 4V1CI 4QPZA 2EZ9A 5K3SA 4KPUA 4V1CB 3CF4G 4X3OA 4UU7A 4HDAA 2PGNA 2H2FA 3GLUA 1YI1A 2HJHA 4L3OA 3CLSD 3GLRA 2W93A 4JT8A 1UPCA 2JI6A 1S7GA 4RMIA 2EZ8A 2UZ1B 2WVHA 5K6RA 2UZ1A 4UTRA 3ZGVA 1U2GC 1XLTC 2EZUA 4MZXA 2JI9A 1E3TA 1D4OA 1EFPA 2B4YA 4BVHA 2AG1A 4J1TC 4COKA 4X3PA 2Q28A 1T9BA 2OD9A 3D81A 3F6BX 2WVGA 5K6TA 2OO5C 1POXA 3OE1A 2V3WA 3PKIA 3RIYA 1N0HA 4FEEA 5DGDA 4ZP1A 1S5PA 3EY9A 4JUFA 2JLAA 4JUAA 4QELA 1U28C 1PYDA 4UTZA 3HWWA 4UTNA 1V5EA 5FYQA 1OZFA
chains in the Genus database with same CATH superfamily
2OCXA 3LUKA 4HF7A 1GCAA 1EFRD 3D8BA 1F6BA 3V1TC 4DRZA 2HREA 3R0XA 4OQDA 4TX1A 1N8NA 1YH3A 3C24A 4DC1A 1KAMA 4HYYA 2CNLA 2M9MA 4IIGA 4BGEA 1UPAA 2MIIA 1YBVA 3N7TA 4GOND 4RAQA 5TT0A 5DGIA 4LXXA 3UENA 5LOVB 3BRWD 3GGJA 1GN8A 1QIHA 2YRWA 5A9SB 1HQYE 1YB1A 1GGMA 1GLGA 1EFDN 4L28A 2Q3BA 1FSFA 4ZARA 3AF5A 1D1TA 4M9UA 4EY3A 5JROA 2PKQP 2C2YA 2YQ4A 3A1CA 1ARZA 3NHMA 3OJWA 1JF8A 4I4NA 5AHXA 1O5OA 5AT1A 1Z39A 2RGEA 5C46F 4UVEA 2B8TA 2O3JA 2BMEA 1OXUA 3CJTA 5CVJA 2PR7A 3WRXC 1ND5A 2OMEA 1SIUA 1GTVA 1PAUA 2YJ5A 1JEOA 3GRUA 4HFRA 4ZXPA 5A5FA 3GRZA 5I5EA 1LFDB 1OE0A 4JQYA 1JHRA 2GNOA 1HFEL 4ZQGA 2O2HA 5AW1A 3GH1A 2H9YA 1HE3A 2NZ2A 3RU9A 1ESCA 4XWWA 3LO8A 4IDHA 2NVWA 3H3XA 1C2YA 1JLRA 1ZK2A 3JZDA 4CF3A 3R40A 5DHFA 1UBFA 1ISMA 4BO0A 3CKLA 2QQFA 2BMFA 1Y9DA 4KQ9A 2ZUSA 2M6RA 2ON6A 2PWZA 3TRHA 4NJEA 4OQYA 4YUXA 5GONB 1YCGA 2AOTA 3A6HA 3K6KA 5FNZA 1IRXA 4F7WA 2G1PA 2P9HA 5FNVF 4E1VA 4DF3A 2J6CA 1X0VA 3N3AC 1TM3E 5EJEA 2DWOA 2FR0A 4ZZ3A 2IOFK 1M2KA 3WK9A 2G5GX 4E5MA 5BSKA 4OMUA 3ZGXA 3LRTA 1QBGA 2XODA 4AUMA 4EX6A 2KS6A 3O38A 1OU0A 3K9HA 1G1AA 5EP4A 3L8GA 1Y8RA 1M54A 4NBVA 1LBSA 2JLRA 4GXQA 4D8XA 2X9NA 5COAA 1F9EA 2C2XA 1BFDA 1QQ7A 5DULA 3ZVKA 1IXZA 5L7YA 5HRCA 4E5SA 3OZXA 2PEZA 1LDGA 1U9CA 2I22A 1PJRA 2HJWA 5C4GB 5BSVA 5I4IA 1Z4NA 2GILA 1OTYA 4J1TA 4RLHA 5ICCA 5BSTA 2PVPA 4H27A 5DBIA 4BV2A 2VBCA 3WNVA 3KCNA 4B4VA 5BR1A 4IUBS 2O7VA 1RI5A 2PZKA 3VPHA 2F1RA 2IBSA 4ZGWA 5B5SA 1Q1AA 3P9SA 1Z2OX 2WD7B 1GNVA 4UUOA 5EXEA 1CNEA 2X13A 5F2KA 3UB4A 2QENA 1BE0A 4G63A 5ALZA 1F60A 5JPIA 2UYHA 2YCBA 1U8AA 2E0IA 2V4ZA 3L02A 2GUWA 3LSYA 5JNVA 2FMHA 3A36A 5EPUA 4QE3A 5JLAA 3GAFA 2REQA 1XTBA 1RYBA 3IP7A 2FWBA 5I9TA 1SCIA 4TLAA 4LJAA 3MB8A 4M9ZA 1FTWA 2AI1A 4BMVA 1K1EA 2CXOA 2WPDD 1CC1S 2VNSA 3MD9A 4LVNA 4PW0A 5SY4A 4A9AA 4XGQA 2PPVA 4TXJA 4CCSA 5IDXA 5KYKA 1AX9A 2LNDA 1AKMA 4PLWA 5H3LA 1ZH4A 4C4ZA 4P33A 2WLSA 3ZPXA 1LZKA 1JDUA 1TRKA 3LCJA 3KQVA 1C9MA 1X7WA 3NPMA 5DNDA 5BV2P 3HUEA 1WMSA 1U3GA 1RACA 2X0KA 1MTOA 3QKUA 3ADCA 2ZUWA 3MTEA 5DCUA 1XVIA 1XMSA 4M37A 2HNAA 3EXAA 4QLOA 3TZHA 3IAUA 3KKLA 3N2GA 3ZWMA 3FHLA 4RQAA 2FPSA 1JKFA 5ALKA 5H3HA 2IS1A 5EP2A 3ROEA 1VBMA 2W6ID 4JI2B 1I36A 3WDMA 3F2VA 1R50A 3GQVA 3LUAA 1E1LA 3N0VA 4HI0E 2VO1A 3ZS9A 5L4LA 3KU4A 4N3CA 1C8LA 1Q17A 1Y4AE 1ICIA 2IEZA 5IXYA 1VRVA 4GYJA 3CRVA 3OQOA 3G2PA 1TPYA 1QYRA 1W1WA 3QPVA 2QQGA 1REQA 3ETDA 3AMVA 4L22A 4HYEA 3RBXA 1J5EB 1Y6RA 4B35A 3ENNA 3MTBA 1C3EA 2H92A 1MQAA 5LBTA 2V6IA 3TQFA 3W8NA 5I6DA 5HFJA 3NPAA 5JBQA 3WICA 1DQNA 3CLTC 4BKOA 4PSAA 3LCCA 3A4MA 3U4AA 4WBXC 3RYHB 2XXAB 1ZP6A 1MTZA 1EM6A 4PZDA 4WCVA 1Z7WA 3HTXA 4IJMA 5JMOA 3LY7A 3R6LA 4JVSB 4DBZA 4F9GA 4LBVA 4K3VA 3JD2A 4GBJA 5DN9A 4A92A 2IHNA 1IIBA 2GN1A 5HDQA 1IN7A 1AB5A 2PBZA 3I73A 4C2TA 4PR0A 3A1VA 3TG2A 4L27A 4UUPA 3RTDA 4F12A 1U11A 1VHDA 2QNRA 3CV3A 3I0NA 1PL7A 1TO1E 1TLFA 3HXMA 5K3BA 3R8FA 1WJGA 3ITDA 4D46A 3IQIX 5FNVB 3EWSA 1DINA 4OXXA 1L5HB 4BNLA 1CTQA 4MJXA 2G08A 3OPYI 3O0TA 4CZ2A 4QTYA 2A9FA 5C5DA 5U9CA 1KYYA 2DFTA 3A1WA 2ZUVA 1JALA 2QJWA 2R4QA 2WFMA 2VYVA 4YRCA 1FYDA 4C4YA 5K7SA 2WTXA 4JJAA 3MBIA 1BXGA 3P4XA 5KTNA 1A8HA 3C3MA 1VP9A 3LVFO 2Q8QA 2DR0A 3DZJA 5CB4F 1OT5A 1DAEA 2ERYA 2PZMA 1B3BA 2H2AA 3BFPA 4QC2A 1UBUS 1IMOA 3ELBA 1OKKD 3NMUF 3PQ4A 5EMJA 4PZCA 5HQJA 3DMFA 4BE9A 1TZKA 3TCNA 5IVIA 1E3EA 3QBEA 1RXSA 4BO6A 5K4AA 2QNBA 4ZU1X 4QUKA 2B92A 4HWPA 4QBHA 3ST7A 4LISA 3GT3A 3DVLA 3OHMA 1MCZA 5CXQA 3GMDA 3Q98A 1T4BA 4UJ5A 2PMKA 1A82A 3VYVA 5K5EA 4IXWA 2VT7A 3L4BA 4D8UA 1Y6FA 3S5UA 1PJ2A 3JQAA 2X8BA 2R85A 5KJCA 5DBHX 2IZ0A 4U7DA 5JSZA 1IQPA 2P2YA 2FSPA 2C5HA 4DJ5X 1GTRA 2NNLD 3AY0A 5KTKA 1Q0LA 5KHLB 1QGED 1M34A 4KBFA 1MJGM 5JVDB 3FVWA 3L4BC 3E9RA 3MSXA 2AXNA 2HO5A 4C6TA 3CSDA 3MUFA 4AC9A 1XRMA 2AJLI 1TK9A 3I2HA 2HKIA 1E3IA 1J0XO 2IOFA 3Q6NA 2I4TA 4MV9A 3F8SA 2FCAA 3UGKA 2KBFA 3RJZA 2QVLA 1UBGA 3SEFA 2PNJA 3H7IA 2OXRA 3S4YA 1NFQA 4ZAFA 2HMYB 4I9GA 2CYCA 2P6RA 1GPBA 4XVHA 2HD4A 4F2WA 2Z4RA 3OJEA 4Q6WA 4HTFB 2XEXA 3U81A 2JGEA 1Q74A 2HJRA 3D6HA 1BCSB 2WG0A 4IHJF 5JECA 4IDOA 5SZIA 3KETA 4II7A 1LDYA 1I2AA 2P68A 3R3ZA 1IZ0A 4IIDA 3HCDA 3SLKA 1T24A 3ES9A 4ALKA 2IUYA 4AJOA 2BKUA 2ORIA 3JSAA 3FYCA 4BDSA 4GXRA 3UMCA 4JP3A 1PZXA 1Y5RA 2JIZD 4GF5A 4TWIA 2C4VA 4PG4A 4REMA 5IYZF 4Z4QA 2N47A 5EXDA 3GH3A 1CUSA 1B6GA 4ZZIA 2P3LA 1PI3A 3H0EA 2NZUG 4L07A 5HIKA 4GYYA 3G5AA 4YAGA 2EAUA 4ZYXA 4E33A 3FCSB 5JCJD 2C4MA 3X1XA 1JGTA 2PMBA 4V3BA 4ZU3A 1NXSA 1SAYA 1U9YA 1IBLB 4LI3X 2X15A 4DXAA 1VHWA 2QTAA 1NW5A 1BHQ1 4M46A 3NHFA 1GPUA 1FBTA 4CQNA 1KTVA 5I7AA 2PX3A 1TK3A 2I80A 3ITKA 2F43A 3MS7A 4MRMA 2E5FA 3DE2X 3KT6A 2JAXA 3QXXA 4IF4A 3NASA 3AF6A 2DEUA 2HQRA 2YWBA 4DBLC 1ZDMA 3WNDA 2QTLA 4FLMA 5JC8A 4OQZA 5GY7A 4BBZA 3DAHA 3QG5A 2RBGA 3UJHA 3NUQA 2PL5A 1JNXX 3EC7A 4V2UA 3EEFA 1H2BA 5G40A 4BTVA 1P2FA 1PNVA 1VKRA 2PLFA 2Q0HA 1N2CA 4NFHA 3SEAA 2YIMA 3PUVA 1JU3A 3HMKA 3S29A 4KXYA 2Z95A 2AH5A 1QH0A 2JFNA 2H2DA 1XCLA 3GY0A 4MW0A 1WZUA 3QLVA 4ZVVA 1XQVA 3VPDA 3G1WA 3WMWA 4W8OA 5KU7A 1J99A 1RAAA 3SU8A 4UU8A 3A3NA 3E5RA 3AV0B 3FWNA 3K94A 5EZYA 2I3AA 4O2BF 2HHHB 4Z0PA 3OA2A 1HV8A 4NFSA 1KERA 2BUAA 3U3OA 4BJ5A 3B7PA 4BO4A 1EDZA 4OVKA 4Y6OA 1ZRSA 2PNFA 2HT6A 3ZKWB 1GYRA 5CB4B 2H29A 3TWOA 1U31A 1HNWB 2V7TA 1EFCA 2Z3WA 4S2EA 1VKZA 1JSCA 2FR1A 3IBFA 1YONA 3F1LA 3JD1A 5CXSA 3RC3A 1WKCA 3AKYA 2SKDA 4HATA 4MUGA 1E1YA 1UXIA 1V95A 5G0UA 2GDZA 3K9NA 3AR3A 3LLSA 4JLKA 4BO3A 1C30B 1VYTA 3CZAA 2HI0A 3A2MA 3D4LA 3ROPA 4ABYA 1QAOA 1T35A 3SZUA 4KMSA 1CCWA 3EQ6A 1HR0B 3HBAA 5TE9A 1O7JA 2XJ4A 3CR8A 2AKEA 2QTCA 3AHCA 3WL5A 5EC8A 1LSUA 1X7GA 2O8DA 5FWNA 4LYYA 4M1ZA 5JBIA 1N1EA 2ZITA 2IXDA 5HR5A 1GUAA 4MQ5A 3GXBA 4FFLA 1DT5A 2E49A 1MN6A 1Z12A 3KAJA 4ZOLB 1SEPA 2CL5A 2RHJA 5CNKA 2O19A 1U3TA 3WFZA 4L2IA 16PKA 2QM0A 3S40A 2IPOA 4D9KA 4G65A 4KNYA 1UJ2A 4EHKA 2PIAA 4RHUA 1WA5A 1JHDA 3FTCA 4NG5A 2QUJA 2VP5A 3FDZB 5JCOA 3ASUA 1G8SA 2ZRLA 5BQXA 2ZBDA 1KYWA 3ICPA 4MGYR 5C8YA 4MVYA 3WGMA 3VSDA 4FJ2A 2ZE6A 3DC7A 2X2OA 1H4QA 2P3SA 4HO1X 3T5DA 4DT1B 2FW8A 3MG9A 3P9PA 3LHKA 3KOZA 1E2FA 1JSZA 3NXKA 4FHGA 2RHMA 4Z7OB 4MQ6A 4JP2A 5P21A 5TPWA 3MLEA 4CTMA 4JBXA 3MJRA 3ROMA 3WL7A 2PKQO 5KQSA 1ZNWA 2PRSA 1J42A 4X3OA 5HM6A 2GK6A 5FWDA 1OAOA 1BDBA 3VVBA 4UPDA 2FUKA 2YFYA 3S44A 1TMKA 3OJCA 1OPRA 3Q6MA 1C1XA 2ZVQX 1X2BA 5IYZB 1OLXA 2VP3A 3AUXA 4RA6B 5LU9A 1Z0IA 2VN8A 4D8YA 1VE7A 2JCBA 3FTFA 3ORYA 4M53A 1WR8A 2QE7D 2W93A 1YZHA 3B3QA 5AW7A 3KK0A 3ZJTA 1DX4A 1U8XX 4QT4A 1UPCA 2I03A 2W6MA 1K75A 3ET5A 3FLBA 2J6HA 3FOAA 3P94A 1SG6A 3A3YA 4HJRA 4ZC1A 5DCLA 3PNPA 4IJ6A 4DLBA 4C7JA 4Y2XA 1ZWLA 1T9KA 1FF9A 1SHUX 3KVNA 2DWQA 4Z99A 1EA5A 4RVNA 5K3OA 3ZWAA 1Y5MA 5K0BA 5DX0A 1KU6A 1XLTC 1KSJA 1Q3KA 1Q15A 1K9SA 1TO6A 4LY6A 4RZUA 5ECWA 3CVYA 2E55A 2O3UA 3TFWA 4F9TA 3KJEA 3N53A 1WTCA 3W5IA 2C88A 3S7TA 3UPTA 1F0YA 1ONPA 1RJDA 2PSHA 3PIRA 4HK4A 5CDSA 5JMTA 1VA5A 1B74A 2XCOA 2LCQA 3CE6A 1W25A 4RZ3A 3A1UA 3CF0A 3ENKA 1OXTA 3OH8A 4ZREA 1N92A 1WO8A 1J5XA 4G1MB 4DCTA 4CCYA 1H9CA 3F97A 3C8MA 1HC7A 3KT3A 5KYUB 1C3XA 1V5IA 4MWGA 2HHLA 4U3JA 3GD7A 4QHYA 3AY6A 3HJGA 5KWEA 2Y1WA 3BIOA 1C14A 3A11A 3JARB 4B34A 1U0OC 1YKGA 1J70A 2A92A 1GG9A 4BRUA 1ZBDA 3AESA 4HX5A 1DDIA 2OAGA 1G17A 3LT0A 4I50A 4DWVA 4WL0A 1IN1A 3RLIA 4ZOQI 2F1OA 2I6TA 4GLFA 1RLTA 1YF3A 2FAXA 2IYYA 3Q7QA 4FLEA 4JL5A 4F4CA 2O5VA 3AI7A 3FGZA 1VB5A 2I1QA 3QZUA 1MRNA 4Q7KA 2XYVA 3U7QB 3WLEA 3F7TA 1W0KD 5JZMA 4CMIA 1DP4A 4Y8VA 4CL3A 1NXOA 4X85A 5ALSA 1E7QA 4R4JA 1P33A 4TYNA 4WEQA 1X7ZA 1K5PA 1RXUA 3C41J 3V1KA 1QHYA 2A30A 1M6HA 2HQBA 3OZ7A 5ARBA 2GB4A 4Q1AA 2V8OA 3AM3A 3C3WA 3JD4A 3PDIA 2AFHA 3O94A 1E3WB 5HTOA 4ZAYA 5FA8A 3WGNA 2DH5A 1C7IA 1KK0A 2P9YA 1YZKA 2PXAA 3SI7A 3IEPA 2HRCA 3MRSA 13PKA 4HQFA 3E0XA 3R6WA 4IO1A 4B74A 1W6RA 4YK7A 4QUGA 3AHGA 2A0WA 2Q4DA 4GBMA 1M1YB 2LR0A 3PHGA 1UDRA 4NYMQ 1CUZA 4G23A 4D1YA 1RBZA 4I5DA 5HF9A 3CLVA 3FB1A 5JXJA 2OHOA 5DJ5A 5C3MA 4L4UA 2DZDA 2C7OA 1LRKA 3AIIA 2XTZA 4ESHA 1FX1A 5ERGB 1RHUA 1TGYA 3CW9A 3G2HA 1HUQA 2QRGA 4C6HA 4TRMA 2UAGA 3IHLA 1UFVA 2V96A 4IRUB 4IX9A 4AW9A 3Q4GA 3SR0A 3GZNA 4TLMB 1OLUA 2BJHA 3OCXA 4ZO4A 4YBZA 4GGMX 2EJCA 4AJEA 5C81A 3DR5A 2VCYA 3HJTA 2PMFA 4QJ5A 3DV0A 1OCEA 1DIBA 5TQ0B 4ADSG 2ZJ1A 1Z0SA 1Y89A 2F59A 2WNIA 3T99A 4XJXA 1HEUA 1EVIA 1VJCA 4MMZB 1ZR2A 3EFBA 2CXPA 3TM5A 4DCOA 1MF7A 4JJIA 4LRQA 4U7WA 2V6GA 5A71A 2JGDB 3U1VA 1RXWA 1KRXA 3DE7X 3F5MA 1NUAA 5LIRA 4EY4A 1KWKA 4ARIA 3L41A 4I1IA 4LF5B 1PT5A 2QVZX 5EJMA 4FP9A 4D9GA 5LR6A 3VOAA 3WLKX 3HKDA 2FQYA 3NNNA 1NW7A 2IJGX 2I65A 2VPZA 3D1JA 2QS9A 3NTXA 1FDWA 2WIKA 1JHZA 4KACA 1WUYA 5DTJA 2GNPA 3JALB 4H17A 3JR3A 1JW9B 1PF7E 4EFMA 1XNRB 1UIMA 1EK0A 3OX3A 2X4GA 3K4QA 4EL5A 5CBPB 1GJRA 2Y99A 4K88A 2Q8PA 2VQ6A 2PZFA 2DE0X 1UFRA 5DRTA 1F7UA 4XJVA 1QKJA 1M74A 3FRHA 2X0RA 2EERA 3QV1A 2AQKA 1KBQA 5UKDA 5A9TA 4UUQA 4HAWA 1Z25A 2O07A 4ZI2A 3DAOA 3VU9A 3ZNOA 3FOFC 1M1YE 3QEOA 4ODIA 3M4XA 2J6IA 1RABA 4G2TA 1V1RB 4HLCA 2WQ6A 1NNI1 5IM5A 3HKEA 4PGFA 4PLYA 2P35A 3DNPA 4PO1A 5DHSA 5GZ6A 5CA1A 1X70A 2JFZA 2O1WA 1YRLA 4IDDA 3AZOA 2DQYA 2VEOA 3HBMA 3FBWA 4ZYYA 3BJEA 3HVIA 2G17A 3KQWA 3NJRA 4XPIA 2VA9A 2G88A 3BCRA 2GJ8A 3GIDA 4H1TA 1FP1D 1Z6GA 1L7NA 4QIHA 2BRUC 2O4CA 3OFNA 4YTEA 1H2HA 2I67A 3T4PA 4TMKA 5M34A 1D4FA 1EVJA 2WYVA 1H2RS 1LC3A 3BN3A 4IOLA 4BZPA 721PA 4G1FA 1ZVKA 4MRRA 4TYMA 1SUEA 1N5IA 3FR8A 2R79A 3GCWA 1K5HA 3K0FB 4EDHA 5A3SA 1GA4A 4GI7A 3N2LA 3W79A 2G71A 1JKJB 2QN1A 3EIWA 3C3BA 1IJFA 2DU8A 4QULA 2A9RA 4F5ZA 4LZJA 4AZSA 2GTPA 4FXPA 4NNJA 3RFXA 3TI9A 2CF6A 3I83A 4AI6A 2AX4A 2YUTA 4MUNA 1XZEA 1U0JA 4M87A 1BQEA 3GGPA 4D3FA 1O5TA 1JIUA 1W30A 3IP8A 2MCFA 1YFKA 2HFKA 2RH9B 1XZDA 2Q6LA 4HWKA 1LPNA 2CFOA 1J8FA 2QVBA 2ZT6A 5G0WA 5LXTF 4BX9A 4DPKA 2QQEA 2O0MA 2Z9BA 3UCXA 3LUFA 4F9EA 1WETA 2BY4A 5FWAA 4LC0A 2FV8A 1Q2UA 4NECA 2Q0QA 1NT2A 2ZE7A 2XQFA 3AONB 1DVRA 3K35A 1P3DA 3BHMA 4QTXA 3JD3A 1CWUA 4WNAB 2POQX 2HZ7A 3PFFA 1MH9A 1A97A 4YRAA 2BKXA 4N4AA 3U4HA 2VH2A 2G77B 1TZCA 2HWXA 2PD3A 3GLHB 3IVGA 5CEEA 1A98A 1I7DA 2PD4A 1T36B 4RTPA 1N5JA 4CI0B 1JXMA 5BYAA 1FXUA 3HRKA 4WFKA 1VCIA 1G2PA 2I1LA 5LA6F 4YLYA 5DT2A 4JQCA 5LIPA 2HC9A 3JAKA 3NALA 5BUCA 1SZPA 3KBOA 5B12A 1QPZA 5J2UF 5JDCA 2E4VA 2FX2A 4OXQA 2QHXA 3BL6A 3QIAA 2PDAA 5BQ3A 3DT8A 4BWYA 2GA9A 3WLHA 1ESDA 1SWVA 4Y98A 2E9SA 4DV5B 4OUDB 5GJBA 2NQ2C 3DHYA 3O26A 1QO0A 4Q12A 4J6EA 3T4XA 4FYHA 3WIVA 1HYBA 1PG2A 1ZUD1 3E48A 4M55A 1QP8A 1E9FA 5E2IA 4BQPA 1XQ1A 4X1YB 3RSZA 1WB6A 2GD2A 3K7EA 3M82A 5IAGA 3VPXA 4DIEA 1FYXA 4RSMA 1T2UA 3LHFA 3MMZA 1Z47A 5ELLA 1KK3A 4DMUB 3IAEA 2G76A 1RZUA 2BELA 4B5LA 2AC2A 2HRDA 1X8JA 2FKAA 3OIFA 3QVKA 4ER6A 3MCVA 3HM9A 3N7AA 3FB4A 3OT1A 4P7JA 1G7RA 1SXJC 2IIPA 1Z75A 4DQUA 3LO5A 5C1PA 2W2QA 2LPMA 2ZUBA 3Q15C 1RZVA 1TVMA 5FO1A 4GQIA 2IS6A 3FZYA 3DDNA 4L0DA 4YV1A 2BKVA 1L6RA 3T5MA 3L49A 5JPDA 2VHVA 1VI2A 5AKXA 3L4EA 1QO0D 2P78A 1WKVA 1HRKA 5BYBA 1JHMA 2QRHA 4J7CA 4A1OA 1H22A 1U7DA 1SBHA 2Q5JA 1MW9X 1PQPA 2X2FA 2C1ZA 1SXJD 3H2IA 4L15A 4L74A 4EF5A 1YQDA 2OILA 3WIUA 4I55A 3EZ6A 4Y6SA 1Q2XA 4YACA 3OTWA 3QVGA 5ALGA 5JSHA 1AUQA 1W4CA 1V4NA 3JQ7B 3U9SA 4MULA 1OWPA 1TQ6A 1VMKA 1A0OA 2OBBA 2IV3A 2VBIA 4IG9A 4S3MA 1Q84A 1VHTA 4O2AB 4PSDA 5ELXA 2ZYWX 4MAAA 4P6VF 4B32A 3GLHE 2OM2A 4ZI7B 3CH6A 1ZR4A 2H1VA 4JJZA 3U4DA 3RQSA 3HPQA 2VJMB 4G5FA 3RC1A 5A6SB 1I5EA 4YRGA 3VH1A 1E7WA 4RV4A 2X8JA 4LUCA 1WP9A 3CX6A 1BQ4A 1PX0A 2UZIR 5DHRA 3LTEA 4YCNA 1C9EA 3TLAA 4XCQA 3FCCA 3ZY5A 2Y92A 4HQNA 4M0UA 5D51S 5TF4A 3DMDA 3VZRA 4B7CA 4EO4A 3I0MA 3R9IA 6CHYA 3A4NA 4OGFA 4KPUB 5J43A 1M2OB 1B00A 1GGKA 2IW3A 3NEAA 1HMYA 5DX1A 2XMCA 1H8HA 4YQYA 2Q8NA 2AMYA 3PTZA 1ADBA 4LRUA 3L1VA 4Z54A 3OSUA 5EMKA 1I1HA 2O52A 3OP4A 2XT0A 3OTIA 2WFLB 3PC2A 1CIPA 1P0CA 2GS9A 2QAJA 2FP4A 1RM3A 1W29A 2IH2A 3DS8A 2Z09A 5LXTB 1OBHA 4MYUA 3DE3X 4X20B 2G8NA 1N4AA 1DARA 3AP2A 4B2LA 3RW9A 1V5WA 2ZTUA 2NWQA 3L0PA 1UDBA 4E2WA 1E20A 4WJZA 2HW8A 5LQAA 1LK5A 4AJHA 1BX3A 2NU9A 3MJVA 1WD5A 3L7JA 2ATIA 1FTSA 3BYZA 2PS1A 1VMIA 1U2ZA 1U8UA 2GN0A 3R23A 2AD1A 1F2DA 3H1EA 1RRGA 2E85A 5BSEA 5IMSA 2C77A 1W4RA 5LA6B 4JEIA 3VI4B 1P39A 1KYZA 3U40A 4YVFA 4EGQA 2I7TA 2R00C 4YROA 2XYGA 4TS9A 1L4KA 5CIWA 4JELA 2PXHA 3V1YA 3ZTTA 2BKAA 2VUHB 2C8LA 3E1SA 4CE6A 3UUFA 1HYEA 4V0RA 3W2FA 1A88A 5J58A 1I7SB 4MR9B 5GJCA 5IVHA 1E2HA 4YRFA 1P75A 4V0KA 5A3QA 3B12A 4P92A 4BFYA 4GWGA 2BGKA 3GDOA 1NNUA 5EKTA 3AX6A 1A9SA 5D87A 3MHTA 1UXOA 1CPYA 2IIVA 1IY8A 4LDPA 1X19A 4MV6A 3UMJA 2AFIB 2R6AA 5D2CA 1SA0B 4RDXA 1Q91A 2YVAA 3RRJA 3THRA 3IT0A 3KTAB 3R24A 2I2AA 4ID9A 4M0DA 1T6BY 2TMGA 1SU4A 3EGXA 3ORRA 5CLQA 3KELA 1NVMB 4CKBA 3D4OA 1YIDA 3A9RA 2RB5A 3HKBB 3CIFA 2DR3A 1QRAA 3GUUA 2R4UA 2VJNA 1FTYA 1GN9A 4PSVA 2E18A 2CZQA 1PL6A 1N6IA 2IW1A 3C6YA 2BEWA 4H7KA 2VF4X 3P71T 1P5JA 2OLKA 5AI4A 5E7IA 5H16A 2Y2UA 3FHJA 3NXSA 3AVWA 3CWZA 5F78A 2J46A 1OXBB 3KSUA 5BNFA 3KZVA 3TIFA 3TIXB 1ZHFA 3ZUPA 2F4VB 3T95A 2X0FA 3EVBA 2GZ1A 1QU2A 1M2NA 1HPLA 4HMQA 4KTTE 1L5ZA 4E14A 4IRMA 4L5BA 1NW3A 3G0OA 4AG3A 5BWCA 5KYXB 5DEIA 3WRYC 1OSNA 1JAHA 3SIRA 3BWVA 1HL3A 4WA7A 4BMYA 4MVJH 1S2OA 2WHPA 5A4AA 1GL7A 4HV4A 1GOTA 1HLGA 4R7GA 4JKYA 4LJ9A 1L5NA 3QKIA 3MYYA 1TQHA 3QYPA 1FRFS 1DX6A 4HPXB 4JP5A 4OHZA 2BD0A 3F6PA 3DFKA 3HJHA 1SC6A 4CM5A 2W8BA 1V8FA 2E82A 1ULUA 3WFJA 3S8YA 1FW6A 3AUTA 5AJHA 1K27A 1L7QA 2P11A 2C1XA 3IHKA 3LH5A 3N8KA 4O4HF 4D3SA 3F49S 3PK0A 3BCHA 4KNVA 4NU0A 3WO0A 1QIGA 4YRIA 4LA4A 3S0JA 2QR3A 3HBFA 5MN4A 5BV1A 3ABSB 3OPYA 2AFIE 4OXNA 3CKYA 3DKIA 1NHGA 4W9NA 1YBHA 5ALRA 3CUTA 5REQA 5ESDA 1AG9A 3V00A 1SHJA 1WULS 3OF3A 4U7PB 1DKLA 3HFSA 1NMYA 1CNMA 1KHTA 1YS2X 2O2GA 2ZSFA 5BR4A 4EPYA 4M22A 1RS0A 1G5TA 3KKPA 2P9EA 3OTHA 1B73A 1JN0A 1G19A 2B1GA 3O8CA 1DX9A 2VLBA 3ABOB 2CCGA 1GDDA 1G3IA 1OFUA 4UREA 4W9NC 2FUCA 2J9RA 4RPKA 4RJIA 4WLFA 2R7LA 4M9CA 4YT4A 3THWA 1GV0A 4MUBA 3QXJA 3PCRB 3LLUA 3BTSA 5CX1A 1RFGE 3CIOA 3SS8A 4KQIA 1GIAA 1VHJA 3WK4A 5CFZA 2O8EB 1V7CA 1SQ0A 1JEEA 3L7KA 1F4VA 4MLPA 5GWXA 5F7OA 1TZBA 5FULA 3VO9A 1DAPA 4ZEXA 1YU6A 2OT3B 3GQBA 4J7UA 5I7OA 4RD1A 2WIDA 4Y0VA 121PA 2OBYA 2K2QB 4XQCA 3DE4X 1QZ3A 1XAHA 4CMBA 2IYEA 1O96A 1YAJA 1T6ZA 3GNQA 3OEEA 1RRMA 4WCFB 3A25A 1E2NA 3MMSA 1I3OA 5E9QA 3T1QA 4A6DA 1FB5A 3A4IA 1Z5WA 1PR3A 4DLUA 1D2RA 3LBAA 1M9NA 4KQ6A 1JSLA 2ZT8A 1CULC 3EQ2A 4QEZA 3RF7A 2V0NA 4BNIA 4F45A 1D0VA 2VOEA 1KVQA 3CO5A 1R7RA 1CEYA 2Q0SA 3FPLA 2I99A 3VC7A 1USIA 1YRAA 1YD7A 3PGMA 3TQIA 3EX7C 4Q3LA 2I2XB 2ZRDA 3DPSA 3RVMA 4TKUB 1UXHA 2XIQA 3BH7A 3LY8A 3KRTA 4J0CA 1SK8A 2ZR9A 1WL8A 3C8ZA 4LF8B 3DKPA 2NXNA 4D3XA 1UAAA 3WWYA 4FJ0A 1GKYA 3CRW1 3HDQA 4J9UE 3X2FA 5KQGA 2UDPA 1JDZA 1QCDA 2AG1A 2V59A 2VNKA 2QI9F 2C20A 3A3KA 3H7AA 4ZAXA 1AN9A 1RYFA 4X3PA 2BBOA 1ABFA 3BXOA 4MTLA 1IC6A 4COKA 2H4ZA 1PGOA 3UYLA 1ILEA 5TQVA 4FGUA 2BFPA 4H2DA 4E11A 5IC4A 1LPPA 4CEHB 4BP3A 2OD9A 1DCFA 3Q6IA 4WXRA 3ZU4A 2GETA 1FC0A 2XWQA 1AUOA 1J0CA 1GFWA 3L07A 4HQ0A 4LYFA 4P3XA 3V42A 4D4MA 1GLNA 1Y3AA 3OE1A 3VNRA 3HGTA 5ERYA 1JG3A 1XP8A 3UQZA 1TL7C 4KTVE 1G5RA 1SU7A 4RESA 1JQDA 3RUEA 3LBYA 3CCBA 4NBWA 1PJQA 1WE2A 2O3SA 3B70A 3TNJA 4C89A 2C9CA 5EE0A 4DV3B 3SX4A 1JQ5A 4R1LA 3CLHA 4MS1B 2CHUA 4JYCA 4DUYB 3C74A 2EW2A 4FDLA 2PFGA 2QD4A 2RHLA 5EXPA 3AVVA 1RMYA 2HHAA 4NBSA 1J2EA 1K7SN 3HYRA 2H8KA 1G6KA 4NLLA 1LI5A 3B6KA 4H08A 4BO8A 4Z3KA 1GTSA 4UTZA 4O4JF 1SB8A 1X1CA 4BL5A 2J30A 2VJLA 2YWFA 2VUSA 3KZKA 4DGSA 5LQJA 3ESCA 4D4HA 4LFBB 3RASA 4D99A 3NUZA 2HMUA 4NYIQ 1VYHA 2H11A 3LWZA 3KLBA 1IFXA 3WIOA 3SNHA 4BO7A 3P2JA 1HYQA 1W6UA 5JUWA 5LD2B 2O05A 2QAGB 3GJXC 1J1IA 3EUAA 2P9TA 3GELA 4LDRA 5B6IA 5GVSA 4LBYA 1MAHA 1NE2A 1RI4A 2GRUA 2ZJ2A 5HGXA 1IJBA 2BZ0A 5FBLB 3FW1A 2A9JA 3T0FA 4AK9A 3BK1A 4MVWA 1BEUB 5IVPA 5AW8A 4TT3D 3AFHA 4RUKA 3OEWA 2ZI9A 3Q7SA 1L5SA 1V5FA 1TGVA 1IHOA 4V38A 3R3VA 2X8LA 3IOEA 3OFJA 1CXZA 2JFYA 2YN0A 3BHIA 3EARA 1A9ZA 3P1JA 4YAFA 4F5EA 5JSUA 3PWSA 5B3JA 3GNTA 4OIMA 3ZZ0A 3OTOB 4XIGS 1O6GA 4GL2A 4O2RA 1UC8A 3IODA 4PYOA 4I99A 2ZPUA 4GL4A 3AQ4A 2C92A 1P2DA 3D0KA 3UHAA 5GINE 1T3LA 4IUDS 1PO7A 5K8IA 4LPKA 1I2BA 3QWBA 4XE5A 2EP8A 2NZ8A 3O93A 3QXHA 4ARVA 4PNEA 5B3JC 3OIUA 3A9WA 3EPRA 3O3NB 5LP6F 1E9SA 3KPYA 2I7VA 1K86A 2VP6A 3IHWA 1KK1A 5KSYA 1WCWA 3ZE0B 1TCCA 3BGDA 3OM1A 1Q44A 3CJQA 3ODGA 4NMMA 4ZEWA 4GU5A 3RJMA 2IK8A 1JJBA 3SF8B 5KSZA 4LQ4A 1PWEA 5HWSA 2XKBA 2A1TS 4P4TA 3AFOA 2J3KA 3TTSA 5AYVA 5JCXA 2VBFA 3GEIA 4MVJP 1FFAA 1J5PA 1KO1A 3M2PA 1QC5A 2QY6A 5B53A 1EUCB 1E66A 4TKLA 1B23P 3M3PA 3K8QA 3RSFA 5PGMA 5KMGA 4JLUA 3JU3A 2NADA 3I2GA 1V47A 3TOXA 1PGNA 2QRVB 2CCKA 4DCGA 4BNHA 3EN0A 2R6FA 4HWSA 4Q1DA 5AUOB 5G1PA 5B55A 1SHKA 2ZRKA 2ZJYA 5B64A 2PZGA 1NOJA 2GFIA 4DB4A 1V26A 2OCLA 3IOMA 4A73A 1Z3IX 1ZZGA 3Q2IA 1XZBA 5CIQA 1C8KA 1ZMXA 3O90A 3AI3A 3H4IA 1CP3A 1K97A 2EF0A 3NHLA 3BL5A 5D3QA 3OD5A 4FJ1A 2TSYB 1FYFA 5C31A 1P74A 4C3UA 2J9GA 2ZM6B 3LT5A 1IG0A 2VQSA 4GVLA 4WZBB 3AVTA 2C5LA 1NDHA 4QU8A 1J0EA 3UHPA 3ZGLA 5KNBD 3CM0A 2XDAA 1P19A 2H3HA 2ZB8A 3DBIA 1TJYA 2QRQA 4YIKA 4A1FA 4AJJA 5LMZA 5JLJA 2I8AA 1L4FA 1O8CA 4ZI3A 2A0FA 1DFHA 1JHOA 5FJIA 1WHTA 3CLKA 3V46A 3CKKA 1M8GA 2WUVA 1OZGA 4J3JA 3TZCA 2BGNA 2ZQ5A 3MFQA 2O48X 4AP9A 4RKEA 4F84A 3HCPA 5LL6P 2XVZA 5BT9A 1P5FA 1BMDA 5CAEB 5HUHA 1NX6A 4KLCA 4PFQA 1WSDA 1PEDA 3B5JA 3ULKA 2QL7A 3ISJA 4AG6A 4EG1A 3C4VA 2B98A 5CNMA 3R7WA 4E03A 1RJ9A 1I3CA 2FZ4A 3NLLA 4O4JB 5DP2A 4ZVUA 4A26A 4M8KA 3S1LA 3STTA 2GZDA 3ND7A 1XYGA 4RYLA 1S7CA 1H3NA 5SZHB 5HYVA 4R51A 1JLKA 4MQ4A 5JATA 2H59A 3L92A 3K1AB 4L5AA 2I4IA 3CPEA 4QD3A 4ZTBA 1RJEA 5EZQA 1XMPA 5IBQA 4YCCA 3VR5D 5AVJA 5KOHB 2CDCA 1NBEA 2VHEA 4M1KA 4O8ZA 1FFGA 3D6MA 1W85B 2WTBA 2OV8A 1CJTC 4V0ME 4MVJD 1SOAA 4UU1A 1QHGA 5ALWA 2E3JA 5GGXA 1T2EA 2XUAA 2C5SA 3A31A 2RFLA 3JATA 3X1WA 1RKVA 3DL7A 2WJIA 3FTQA 1O95A 1CZNA 2DFLA 2ODQA 4XR4A 3VR3D 2X5OA 3QELB 4FD2A 2WR8A 2P40A 3QRWA 5JHGB 1K5DA 4OQMA 2CWDA 4MPDA 4YWJA 3G1UA 3A1FA 3KB8A 2WAXA 2OUIA 1WW3A 4LXIA 5LB4A 4WZBE 3TOZA 1VJRA 2VDLB 2W4QA 3L1KA 4B2PA 5CYOA 3I9MA 3K6JA 4NG4A 3K2EA 4X6YA 1NN1A 4RPLA 3ERCA 1O95C 2QE6A 3KQYA 2M32A 4DIMA 3C8UA 3H1TA 3NGMA 3G82C 3D6NB 1EXWA 4URZR 3UOAB 4PSUA 2H1FA 4DR4B 3DL4A 5J2TF 3A4VA 2OXIA 1WU8A 3LHDA 2YVKA 5AP9A 3NHKA 2WWYA 2J32A 1NLZA 2OKGA 3L6OO 3ASVA 1UBLS 2O1XA 2PA0A 2UYOA 3AY7A 3WHLA 1YR9A 4DWJA 3EIQA 4K8OA 1M76A 2WB4A 3HU3A 3LFHA 4JJ7A 5IZCA 1JLHA 4TTJA 5DW0A 4N3BA 1C2TA 1JNYA 2ZI4A 4YXWA 4X66B 3A7DA 1NMEA 3SQWA 3Q87B 1UK9A 3PEEA 5LKRA 1NLMA 2R8RA 1CS4C 2FWJA 2W4IA 3WIDA 1EFHA 4MIYA 4ON9A 1QWSA 3RIGA 3TIGA 4BLQA 3ZVLA 4E07A 5DNCA 3UH1A 3OQ6A 1IZ7A 1YRWA 3H9EO 1K7EB 2XA2A 3HB5X 3WK6A 1BGWA 4E2YA 3GLFA 2FPIB 1UZLA 1YL6A 4HDKA 4HDRB 2P5SA 3HLTA 4G1BA 5F5XA 3NVMB 2EGHA 4DDKA 4D9HA 1DAHA 2Y1OA 4BV9A 1A4RA 1N7GA 4Y2GA 1GYPA 1CRPA 1I8TA 3TTYA 2QK4A 2RAVA 4P86A 1S2NA 2QLJA 4L50A 3FKSA 5DNVA 1C3LA 4EGFA 3ISTA 5DASA 3JVIA 1EVLA 2VYND 2H2HA 3CW2A 1O0CA 1I5OA 5SYNA 5E3IA 1HSOA 1I6LA 4TKVB 2R8XA 4L9SA 1DC7A 3RVLA 1NKTA 2XEDA 3T0GA 1XZKA 5FH9A 2BUCA 1ZD1A 3QVOA 4FWTA 4RGQA 1NP6A 2F9LA 3FJYA 2C7QA 1G21A 3EH1A 4Z1OA 2X76A 1XMQB 3EMBA 2V74B 4IVPA 2A5YB 4BEWA 1L8LA 3R7FA 2ORED 2WJAA 3UK1A 3RVKA 3GCZA 3W8FA 2YIVX 4BVFA 3AHDA 4Z49A 4N8DA 3VUEA 4G67A 2GD6A 1QLJA 1V4BA 1ZINA 2JVKA 2PX5A 2FSUA 3DW3X 3IE2A 3M34A 3MS4A 4H4CA 4M99A 4NC9A 4QDKA 2NLOA 2W00A 4RJKA 5F3DA 2PZJA 3C4QA 3AR8A 2EKQA 3VNSA 3F5FA 5JYCA 4WLNA 2BGUA 2IYLD 2ODAA 1N1DA 2YWXA 3OHPA 4EI7A 4DY6A 1XTVA 1AS3A 3MW8A 2XBUA 3C1AA 4B3MB 2CUTA 1EE2A 1GYQA 2Z3ZA 3F6EX 4KK3A 4U5XA 5K8UA 4P7KA 4M0EA 2J0QA 4FUQA 4BLRA 2JVIA 2VPIA 1IIRA 2X19A 3OFKA 4GWKA 4DJAA 3T9DA 3EVNA 1GCOA 4ER3A 1DBVO 1XZMA 1LPSA 2W6CX 3LKVA 4R98A 3U7GA 2AV6A 3DOJA 4ZTUB 1TZJA 3U4QA 3N9IA 3O9VA 4PG7A 4DNFA 2HL6A 3K2QA 1IJKA 1CQJB 2ZYTX 3UK7A 2B8EA 2A9KA 4L8LA 2RCNA 4EUEA 2ZSEA 1F4PA 2ZIXA 1H4VB 3MNFA 1OLSB 4KWCA 4UTPA 2V5AA 5BMVA 4JHXA 3BTOA 2HK8A 1M6VB 2QLBA 4ZHSA 2B94A 5G0SA 1HMPA 4CR8A 1K8XB 3OF5A 1YHYA 2GXUA 3B1VA 1RSZA 4GEGA 3TB4A 3OP1A 3DTVB 3TQOA 4RMHA 4EMBA 4PN3A 1UJ5A 1C0EA 2R8ZA 3BSFA 4UBMA 4MMYB 3Q7PA 4KIWA 1NI4A 3R9XA 3WADA 5JJBA 1NLYA 1J8DA 2LD4A 4ZK2A 3DOIA 3PTLA 2OB2A 2K5UA 2B4KA 4CV1A 4H6XA 1ZICA 4U39A 1YS6A 4DY4A 2X3YA 4B6QA 3NTLA 1L4MA 1XB2A 5J2TB 2J3QA 3Q3HA 4MQFB 3SQDA 4EHAA 2Z2XA 1DBPA 2FQ1A 4ZOBA 3Q8WA 3MCTA 2PSEA 3A6EA 5CH8A 3B9BA 2A33A 3ADKA 3COJA 2JIDA 3EUFA 3IP6A 2PVSA 1O3YA 3OT4A 3V34A 4OGGA 1MJFA 1XZCA 4QFMA 4BBPA 1BDJA 4KXMA 2A4KA 1Z26A 3PQ5A 4BWVA 4BFLA 2B30A 1MOZA 5KPDA 2G72A 2UYCA 2XA1A 1U0SY 3TX2A 4P36A 2R65A 4YJ3F 1CZOA 4IHKA 2D13A 5K8JB 2XDYA 4WMLA 4L5IA 3IULA 2C7RA 3V1MA 3EA5A 3PDUA 5E0KB 4F1WA 3ZWBA 2UYYA 4OFBA 3CVJA 3L6RA 4V39A 1EG2A 2YCLA 1T5LA 1NF2A 3EW7A 3G8DA 3HLKA 2PGIA 1GNTA 3N0XA 4F38A 2I0FA 4MCJA 1DDGA 2G25A 4D4GA 4E7OA 5IUJC 2OZLB 3DWEX 5K01A 3MINB 1NN0A 3SYMA 3UNXA 1ULTA 1NASA 2JIRA 5CT4A 3PICA 4IKEA 4JVNA 1DAOA 2ZR7A 4JR2A 4BQRA 4GMKA 3FPBA 1NC3A 5AM5A 3R7NA 3HUUA 2DMRA 4FINA 1JDBB 1HH4A 1PZGA 4IF6A 3HHPA 3IESA 1CUVA 3PNOA 1AUPA 4ISBA 3T34A 4C4PA 1F0NA 2H2IA 1SC4A 4M0FA 5KQMA 3VNVA 2Q5IA 5EIHA 3EQ9A 4IDPA 4MR7B 1P7VA 4DVJA 5BP7A 2LZ0A 5DYNA 4EPWA 4IPTA 4HSGA 3RABA 1MC1A 1C5KA 3KP1A 1XCJA 1QKIA 3AL0C 3PBKA 1JYSA 2AE1A 3IR6A 3T9FA 3TTVA 2HWYA 3OE5A 4AWBA 2BMWA 2Q7DA 2VH1A 1CF4A 4B3CA 3UWMA 1U98A 1FL9A 4WSOA 3RU2A 2D2VA 2SICE 1RQNA 2IE8A 2VJPA 2A57A 3BCSA 4HRAA 2OEPA 2E4WA 3OZUA 2F1KA 3JQDA 4HH4A 1BCRA 4KIJA 3CUYA 1NC1A 2YJ4A 3EIXA 4XM0A 4YNBA 4X93A 4RK5A 5FV4A 1E79A 5KWJA 3HK2A 2AN9A 5ESXA 2JLCA 5JDIA 3V4VB 1DEXA 5GV8A 3KUKA 5J3JA 2QTBA 2CNBA 5IBCA 1K5GA 1U0NA 5EZSA 4B46A 3B82A 4ZYWA 1LBHA 2FFHA 3CTPA 4XUGB 1DJMA 1JFFB 1DHRA 1ODKA 2GCPA 2YZ7A 3G7NA 2H00A 3I5UA 2GFHA 2J09A 4KRXA 1YZFA 5CDYA 2L0XA 1KDYA 3CLSC 3TTTA 5JDIC 1G4UR 1C4XA 2NAFA 2ZYVX 3FJOA 4GXNA 4EPRA 1USWA 1HG0A 3A4LA 1NHWA 5PNTA 5H68A 1P2SA 1YI1A 1AKEA 4PN7A 1TPZA 2LCIA 4GVPA 1ZN7A 1HRDA 4L0QA 1P4GA 3A6GA 4GYWA 1YKSA 3RNOA 2D62A 1H4TA 2X6TA 1TUBB 4N5MA 2IH4A 4OBEA 3V4SA 3CLSD 5KX5B 4A0HA 4BE4A 1IZ8A 1EM8A 1Z6PA 4RJLA 3VSCA 2SHKA 3X1KA 4DG5A 4CIXA 4E3ZA 3THYB 1HE2A 2JCSA 4QXOA 1U9ZA 3HN7A 4XDZA 4ZVLA 3QMWA 4Z53A 1EX7A 4FS8A 4FMPA 3K0EA 3OCJA 1ZC4A 2O59A 3ZWDA 1VIDA 2IVFA 3GLGA 1GQRA 3DOHA 2Q1TA 2XYPA 5BVHB 3SHOA 3LUCA 4L3WA 5JHHB 3G89A 2HRBA 4MKRA 2R6DA 1I3NA 2EZUA 4MZXA 2WIJA 3EAGA 4XB2A 5C8YF 3LUDA 3DL2A 4DIBA 1XJWA 2A8YA 1E7RA 4UASA 4BXOA 1ETUA 1OYYA 3ANSA 3QPCA 1JKMA 2AJTA 2Q3HA 4MV3A 3RYFB 3FUCA 3JQRA 3LLVA 2FEXA 2XCLA 5BQPA 4K2HA 4NR0A 3ZS8A 4MUIA 5DXJA 3TVYA 3WBFA 5K0GA 1SC9A 4E88A 4RY8A 4L9AA 4GE3A 3S5JA 3HL0A 3EOAI 2MSKA 5LBUA 4G0YA 1AKNA 3P2IA 2Q28A 1U1FA 3LQYA 2FW9A 3VZDA 3EPKA 3LCRA 3AL3A 3KB6A 1A1VA 3KXIA 5CA0A 4C21A 3J81A 3QQPA 3VR2D 5CLLA 2OQVA 2EU8A 1P6QA 3KJQA 4GSKA 3BERA 1T29A 4YJ3B 1NVBA 3KQLA 1JEAA 2JK1A 3IMCA 1Y3FE 3V4ZA 4P35A 2GDJA 4P82A 1FRVA 2JHFA 1TT5B 1XDWA 1R0SA 2YWGA 3EZFA 3V8QA 1Z4KA 4W6QA 4YMTA 3NIBA 3GROA 4I1UA 4WBSA 4A03A 4B7XA 3QHAA 1VG0B 1G7CA 4ZYLA 1R64A 3AVPA 1ITZA 1OAKA 2ZROA 4NE7A 3PV0A 4KR7A 4GOOD 1KI7A 4F97A 1XU4A 2QNIA 5HZKA 3HUDA 1V9LA 4R31A 2AKYA 3L0ZA 9LDTA 1E2MA 2OM6A 4M0CA 3EIOA 1H1LB 1X9GA 2D00A 4IIJB 3MMNA 4MUEA 3PC4A 2QSUA 5IHPA 3QLUC 2BJVA 1PYGA 2GRAA 2PSFA 4FW8A 4IJ5A 3JVDA 2B2NA 2RHCA 4PHCA 5FPKA 2GN4A 1IE3A 2CLKB 2E5WA 1ZRNA 2WMNB 2WABA 3EVAA 1GG5A 3R76A 1YRBA 3GJYA 4ZJUA 4TZ6A 2EHJA 5LYJA 2QZSA 4HN4B 1OB2A 1CJVC 1U7OA 3T7EA 2HSWA 3M5DA 2A9OA 3E7PA 5AK5A 4EQ6A 3ILYA 3WSVA 3C6BA 2PZBA 4MAFA 1HI9A 1LSSA 1NW6A 3DPUA 2WJ3A 1UPTA 5BN4B 4XYEA 1DCMA 1EK5A 1W1UA 4ZT2A 5IK2A 1SUDA 2OUKA 5FPHA 4ND8B 3HA7A 4I4LA 4QRHA 5EWMB 1G6HA 2WI8A 5IU6A 3FKJA 3MCZA 1ZRHA 3I01A 1G4AE 4NXNB 1CDDA 4KO3S 3LUBA 1SZCA 3UZUA 1GRVA 5DBEX 1R0LA 5D7BA 2HLDA 2V65A 3PGLA 1QYXA 3QUCA 4IOJA 5KKAA 5ALEA 1BJKA 3DVAA 4PLCA 1GVHA 3EA0A 3UICA 1XI2A 3EWNA 1E2JA 3H3JA 2BR3A 1TYCA 4W5QA 4HG2A 1TLLA 3KR9A 2P67A 5DMXA 4QVIA 3RSSA 3GCXA 1G3RA 2H1IA 5HOQA 4FZ5A 5LQMA 3T61A 3FPKA 3SQNA 2XOKD 2XKKA 3NBFA 1I80A 2HSZA 3DT6A 4PYJA 3WISA 4K6CA 5DN6A 1VZ2A 1D9XA 4BRZA 3RVSA 3ITEA 4IWNA 4M0KA 1JR6A 2D1FA 4QQ8A 2PQ0A 5KNCA 1YT5A 5J5CA 1MABA 2Z56A 4D4IA 5I4BA 3T52A 4DR5B 4XH9B 5HS4A 2J4DA 3D6FA 4JP1A 2GEFA 1XZAA 4LJ6A 5T4FA 1QDLB 3D3EA 2W11A 2RC6A 1TU3A 3CNLA 1XVTA 2Z1NA 4G0XA 3BCUA 2ODNA 3EXEA 3ORFA 3PT5A 2IXFA 3VC1A 1Z63A 1SUCA 5BW4A 3TUIC 1BE8A 4YAKA 2Z6QA 4OQNA 2Y3IA 5COQA 2Q27A 2JIQA 3L0DA 1TQDA 2C5GA 2VZ9A 4MCAA 1T1RA 2BFEB 1J2YA 4OHRA 2XNDD 4W8HA 5CW2A 2LKDA 5T6BA 1QLWA 3RDPA 3GLSA 1TW2A 1QONA 1PNQA 1U7TA 2XKJE 5FL7A 4R3WA 3WNZA 4DA0A 1PJ8A 3U7JA 4M88A 1W9HA 3G9TA 4H7PA 3Q3VA 1GZUA 1RFLA 3UJCA 3Q0TA 2HYDA 3P52A 1R15A 5TMEA 4ZCMA 1WRBA 1PSWA 2CVQA 3DDZX 4C0BA 2BDUA 2Q29A 4TXLA 4RJTA 3DV9A 1SCNE 2QDXA 3LC0A 4DQXA 4R0MA 5CFQA 1IZYA 1YI8A 4NHOA 4F71A 2D74A 4NBKA 5JSFA 4KFSA 5K6AC 1YASA 3C6ZA 5JAOA 5M7EA 2WF8A 1N3BA 3R75A 3ZDAA 2AZTA 1LLUA 2WF6A 4DQVA 4FBLA 2H7CA 2BVNA 3E3AA 4RA9B 5LSAA 3BQMB 1MENA 1QS0A 2QF7A 2XZOA 1RCUA 1CQPA 4CQMD 1K6MA 3IMKA 4MDFA 1RMTA 4YP9A 5FUBA 3C1OA 1IQRA 2HEGA 1W52X 2ILVA 1TC1A 4EJSA 1J9GA 1WABA 2NQTA 4N0DA 2BFFB 1FYEA 5MDHA 4MRNA 3IO5A 2CE2X 3FZNA 4BRWA 3VTFA 1JLLB 1QVZA 2OO5A 3VTKA 2I9PA 3LZCA 2W2XA 3DUFB 1XZPA 2O20A 1QRTA 2FG7C 1O97D 3TTWA 2O7QA 2B7LA 1CUUA 2P0YA 2WSYB 4EJSC 2IUFA 1R5JA 4KN6A 5TS3A 2VQEB 3CRNA 2AGVA 1UODA 4CEIA 2OFWA 5HQ3A 1BVRA 3CVUA 5IC5A 3NJ8A 3BKWA 3VR6A 1VPDA 3KD3A 1DAKA 3C8DA 1RRFA 3JQGB 2KHZA 4LXHA 5A5EA 1UJNA 4RTLA 3RKRA 1T5OA 2B4AA 3TRKA 1UKZA 1DKRA 1K0FA 1MVNA 1X80A 4D2IA 3PF9A 4OOEA 4WXMA 4GLLA 4NSNA 1XPRA 3H65A 1E7YA 3HNPA 1X8LA 2FW7A 4MPTA 3GJSA 4RXMA 2OK8A 3LCMA 4LDQA 1PUIA 4Y1RB 4AROA 4LJKA 4RETA 4BNGA 4AY5A 3ECSA 3SY8A 3V8PA 4AZ0A 3ZD7A 4MI3A 4DV1B 2J08A 1DZIA 3LBNA 4O25A 3UXMA 2R1VB 1EBFA 1SVMA 2QP3A 4IMIB 4KWEA 1GDHA 2BGLA 3IEIA 4PWYA 2OGTA 5L3RA 4ZYTA 4IGEA 3NM5A 5K8TA 1RKXA 4R41A 1YQTA 4C14A 1FRNA 1S2GA 3K09A 1GPNA 2ADMA 2YICA 5K3EA 4NOMA 3UMRA 1BX0A 1FDOA 1RP7A 2P2GA 1Z2EA 3Q1KA 4XSVA 4ACBA 4KH0A 4GS5A 2OK7A 3KDPA 5DTMA 4RLQA 4DDVA 2XOEA 4N82A 3U1BA 2UYGA 2ODBA 1PGQA 3JPYA 3HVJA 3MGCA 3LQ4A 4UHFA 4QUIA 1V9CA 1D1SA 2W37A 4EHHA 2A1UA 2QGFA 3GUVA 5AJWA 1QORA 1Z13A 3DFUA 3MTJA 5TJ9A 5JFOA 3EBOA 4KH1A 5AICA 1V3TA 1OBCA 1RVV1 4GQAA 3FHTA 1X1TA 1UEIA 2ZBGA 3ZOZA 1YJBA 3F3SA 5B7PA 5AVKA 3RJ5A 3EPHA 1NV9A 2KM1A 2Z8YM 4RPHA 1GADO 4XI9A 4XVUA 3HYSA 3LK7A 1GRRA 1U0EA 4Z7NB 1R4AA 1J23A 4ZJPA 1R8JA 2DUUA 2DJIA 3E4CA 1IBCA 2JNWA 3FAKA 3KOYA 4L3VA 3C7DB 4B3RB 4FQ8A 3QVTA 3BHNA 4F2DA 1DZ3A 2IEYA 2QOEA 2XRFA 3LP8A 3OZWA 1USUA 3UWOA 8ATCA 4JYAB 3TOVA 3ELYA 3UCFA 4AY2A 2J0VA 1CBUA 1FXWA 1L1QA 3OQHA 1SELA 2AE2A 4UAUA 2IY8A 1MC5A 2VRWA 5BRAA 3EQZA 1OX6A 4Q9NA 1TC2A 3ZN2A 3TPZA 4Y0NA 4PXYA 3GNSA 1ST2A 1SQGA 3W8EA 3G8AA 3R2JA 2NV2B 4LSGA 1ADCA 3KUDA 3MF4A 3D7LA 3HCNA 2VP9A 2J5BA 1WCV1 4EB0A 3KLOA 5IBRA 4DFDA 3WGIA 3VU9B 4P3NA 4OBBA 3V2IA 1Z0ZA 3ZV6A 1UEXC 2FOXA 4REQB 4ZCTA 3EG5A 3KFVA 3WK7A 3SOZA 4W82A 3HCBA 3O4FA 3QTLA 4ILKA 4MJLA 4YMWA 2AXEA 5ALOA 3UWSA 5LQKA 2YZMA 1U9IA 4MEBA 1XCOA 4OB7A 4RSHA 1H9BA 1GKIA 3W8DA 1BWPA 3WSTA 1CUGA 5E8RA 3KYCB 4DILA 3CB4A 5KSOA 3ABQB 3QA3E 1QVRA 2W42A 3KEGA 5EHIA 1DLIA 4C20A 5F9MA 2N1BA 1SKYB 2CUKA 3DLIA 4A5SA 4EBFA 5K6RA 3L4KA 4JL6A 1VJTA 1QGOA 1DG9A 1RWPA 1U9IC 3Q9UA 2Q7OE 4E09A 3N6XA 5IJ0A 2ZIGA 1RIIA 2ZAOA 2PJDA 3HCEA 4CM6A 1IY1A 2JZCA 4DPLA 3U4CA 2DLCX 3DB1A 4MIKA 3U3KA 2AQHA 4I5FA 4NNOA 4D45A 3RI3A 4C1NA 1KE1A 3Q85A 2OESA 2YKGA 3S1AB 4AMGA 2QRPA 1IY9A 3LQFA 1VPTA 1R5OA 4AFNA 1XAJA 2Z4SA 4OSEA 5JV5A 4MGEA 2HLNA 3NWPA 1Z5OA 3SC2B 3GPCA 3K9BA 4MV0A 1FVOA 2XLCA 3N2KB 3OO0A 1WD7A 2XCUA 3AIKA 1EAMA 2ZYSA 3PFIA 4J91A 4X44A 3MWJA 5EUBA 2QZ9A 5HMLA 2HFJA 4OTZA 1UMDA 1NY6A 1ISGA 3L1UA 4OLBA 3QJYA 4P08A 1WTAA 1A4IA 4J49A 1AXGA 1BKDR 1NA5A 4HADA 3EJ6A 3TCKA 4AKEA 1FMFA 4OY3A 2O3QA 2AR9A 1IN8A 2DP4E 1MG5A 4EELA 4MKGA 3N07A 3SYRA 3BGOS 4KXXA 3KKKA 1YA4A 1B3RA 4IHQA 4U5QA 1XCBA 5G2OA 2G1JA 4EF6A 1B1AA 1FLVA 1OHHD 2GERA 3LGAA 4BY9E 2N0SA 3LCUA 1RLIA 2BHNA 4ZEVA 4ZN6A 1S9HA 3L8ZA 4BB6A 2F1IA 2D1QA 1HTBA 3TEJA 3VUFA 3M9WA 3UFBA 3L7IA 4JUDX 3NTQA 6NULA 1WXXA 2LTAA 1YL7A 1WZEA 2ETVA 4HB0A 3GMSA 2VQ3A 4N03A 4W6ZA 1LVHA 1B8OA 5EMLA 3X0DA 2XNHA 5C18A 1G2QA 2JDIA 4KVFA 4O8CA 3M5PA 3KXLA 4QNMA 5GQSA 2BFDA 4GC5A 2CVHA 4B44A 1YRHA 1SKYE 3BMNA 4FN4A 1KEZA 4BMXA 4QTTB 1EVEA 1R0KA 1M2HA 1UK7A 3H86A 1HDEA 4BVBA 1L7OA 4PS0A 2OFOA 3U37A 4BZWA 4P4SA 2VP4A 4BLUA 2IEIA 4J2TA 4E15A 2C9OA 4DA4A 3CW8X 4YHHB 1QO9A 3I3SR 3TM4A 2FFBA 5MN6A 3DMTA 3IEUA 5E0OA 2QL5A 4RTOA 1FQKA 3RJTA 3SBOA 4ZOCA 4N0MA 2JFOA 2CLMB 2VA8A 2AVDA 2GLTA 3L05A 3QVVA 2FZ5A 2BSQA 3EDOA 5EZ6B 3IUQA 2VTDA 3QWHA 3DMTC 3OM0A 3VU8A 1MB0A 4JUCA 2EJTA 2VH5R 4O5OA 1JTVA 3PQ3A 1KI9A 2G5TA 2Q2WA 3ICVA 4IJVA 3NT4A 3GC6A 5IH3A 3G5TA 3IQHX 3CX7A 4EG8A 1XEXB 1TAUA 1KKLA 2FPPA 2RKWA 2WSIA 3DEZA 2OC4A 4FGWA 4ACAA 1W2GA 4NDNE 5KWVA 1GKKA 1M72A 1O94A 3PL5A 3GJ8A 2VUIB 1YUMA 4H7FA 3T15A 5CEFA 3GJ0A 1BGVA 1KMHA 2RJNA 4ZVRA 2RG7A 1II8B 2NN3C 1XALA 3WYCA 4E2XA 1UOOA 3F1KA 2FGJA 4P4UA 4L5JA 1R9GA 2WIGA 1JLSA 4PRKA 1W96A 1J20A 2J9FB 4KQCA 3W9UA 2GYYA 1EDOA 3HWRA 4XRRA 1O94C 4YRTA 5BSWA 1MIHA 1UM9A 1KFBB 3F9IA 3JASB 3LXUX 2GZ2A 1APBA 4KQXA 2FRVA 2RBKA 2DHQA 1ZIXA 3C98A 3R5HA 1NP7A 4GKAA 4HVLA 2CSUA 3ACDA 2FSIA 5KVSA 4CVNA 3BA1A 1X7HA 4L0CA 1G0NA 2RAPA 1CJCA 4U63A 3RSHA 3SJBA 1T4MA 3I8SA 1Z6XA 1RWXA 1IPEA 4V1CB 6ADHA 1V35A 2IYRA 4RHYA 2NZJA 1KZHA 3T1TA 1YXMA 4KR0A 4HUQA 3NRBA 1T9GR 1W36C 3A32A 2OBFA 1A2BA 2C2MA 3NH9A 4KXNA 3W5DA 1A8IA 4RULA 2NSYA 1U1IA 3WQQA 2HU8A 3DQQA 4RW0A 3SD7A 2Q3EA 5CD1A 1Y42X 3H3FA 3E1KA 3LGXA 3VQTA 5BNTA 1R88A 1X39A 3ZW7A 3IVMA 4EF4A 2EEPA 4IW3B 1LTQA 1GEEA 1QFYA 4JIGA 5B1DA 3AF3A 2PZLA 3ZHBA 4JT8A 4I8IA 4YRLA 2IEDA 4D43A 3O1HB 2I71A 2ID9A 4XD7D 1KS2A 1OBFO 2Q3DA 4JENA 1WMEA 3NFRA 4PVCA 3MLBA 4DUGD 2BI4A 3K70D 1U5BA 2R62A 4YRDA 3PRYA 1W34A 3DVSX 1PK9A 5LMUB 2XTAA 3BX1A 5TQ0A 1Z0FA 2PQMA 2ZW9A 3TQSA 4G0VA 4BO2A 3ZGVA 1CUAA 2B37A 5COBA 2BFCA 3H87A 3MQ2A 1VCHA 3GCGA 3LSTA 4DREA 2DTXA 2ZUEA 3FNQA 2BYTA 1QK4A 1QSGA 2R6CA 2Q99A 3CUVA 3TQRA 4NOKA 1YHNA 1EFPA 1T8TA 4OYYA 1KPHA 1OI2A 1E4OA 4PSKA 2HA2A 2GBLA 4B2IA 1K66A 4BVHA 5BO5A 1YR7A 2VJCA 3RYIB 2DUJA 1LX7A 5H0IA 4AUEA 2O06A 2C4NA 2GAAA 2VAWA 4YP0A 3WGKA 2ZJOA 4N41A 1C8BA 1Q7EA 3TPCA 2QXUA 2YVQA 3UKOA 5FOVA 1T5IA 4U0KA 5IJXA 1QYCA 5CTAA 4CEJA 1ORRA 1EE1A 1EWQA 4MS3B 1GQYA 4YN3A 3M4ZA 2GBLC 1V7QA 2C9ZA 4ZHQB 3UA3A 5KYWA 4CN9A 1IBKB 2XXJA 2TECE 2BEVB 3IAHA 2W22A 3PGXA 4OEHA 4RAOA 3PKIA 3UFXA 1SOWA 1IQ0A 2QMYA 4HGNA 3ANNA 3BGIA 5FP0A 3EHDA 4AX8A 4JJ6A 4EGCB 5L3SB 2AB0A 1HLFA 1YE3A 1AK1A 5DKFA 1F2TB 4RDIA 4P0QB 4C7OB 1UEJA 4GFDA 3RFVA 3H11B 3TXXA 4D42A 3EUEA 4XYMA 2QRLA 3DW1X 5EYPB 3ZQJA 3CBQA 5CT5A 3T3IA 5IUNC 3WA7A 1CR1A 4JJGA 3S99A 1CU1A 1YIOA 2CBZA 4BIMA 4QQRA 1XD2B 3C3AA 4BIIA 2XV1A 2Q2NA 3NGLA 2QD5A 4M0PA 2FPMA 5HKAA 1O6BA 3RVQA 3KB2A 3G9UA 4FDUA 3HVRA 1GY8A 4UPEA 3WB0A 4LOJA 4UZEA 1MB2A 2CFCA 2ROQA 3I62A 4YRPA 3VZPA 4M60A 5FDFA 4CV0A 4KR2A 1QUFA 1C1HA 2BMJA 5FUYA 3U7EB 1RC1A 1JT9A 2QN8A 1OZFA 3AHFA 3GEDA 4OXIA 4ZKEA 1G7TA 4UBKA 5HEKA 3R8CA 2NUBA 3V1UA 3EA4A 5K3AA 4OM7A 3R5JA 2YV1A 1S1MA 3B6ZA 1LPMA 3UUEA 5JNSA 2HQ1A 5FFNA 3JWGA 2DPHA 4OA8A 4UD6A 1OT3A 3J7TA 2NXWA 1NXWA 3PD1A 3FCAA 3GK3A 4XYBA 3I9LA 2I5PO 4WLVA 3ESXA 2VHYA 1TYDE 4CG1A 4WFQA 3AR2A 6REQA 2DLNA 2BGJA 2R5NA 5BUQA 1EWTA 2Z3VA 2QP4A 4UNQA 4GPAA 4G37A 1UBTS 4UHJA 5B1IA 3Q5EA 1LA2A 2Q07A 1AMOA 1NNSA 3L6EA 3RAEC 1QE0A 4KXQA 1DJPA 3RIEA 1P0PA 1J97A 2XMGA 3VR0A 1PFKA 3B3AA 3AILA 4EKNB 4QRDA 4FZ3A 1TECE 2CK3A 2GBCA 1MRSA 3L1IA 4M9XA 4Z3DA 1RZRA 3KTDA 3M8KA 3ZIAA 1EK6A 2PRKA 3PXEA 4WKCA 4RZSA 3RYTC 1NVDA 3BH6A 3NBYC 1T2NA 1YC5A 2K87A 3SG0A 3ZGYA 2HOQA 4UXJA 3G5MA 1KAQA 2P6OA 2B4TO 2EGUA 1HDRA 3Q41A 4G5OA 2E1PA 1SBIA 2BFBA 5DYWA 3FYDA 2OCAA 2BE9A 1CQXA 1C9YA 4JLDA 1FNSA 4JGGA 1E9VA 3R77A 5LWQA 3TMYA 5CURA 5LQUA 5ED4A 2IL1A 1QFJA 2Q4BA 1KVSA 3EIFA 5KTPA 5ALXA 2JLUA 4GEKA 3CINA 3KJNA 5TPZA 1IBMB 1P1BA 1J6UA 3GT4A 4ZQCB 3SJUA 4BATA 5IAOA 3QOYA 4HEA1 1TD1A 1H8EA 3AC0A 2EGGA 4FC7A 4WGGA 5JNUA 4NCBA 3I4FA 1YMUA 3L8MA 4IQ0A 5I51A 3AEUA 2AZMA 1QHFA 3WYAA 2WJVA 4NDAA 1NOIA 1J39A 1V6CA 1IAVA 2GTHA 5FFFA 3ABRB 2Y4NA 3G0DA 5ICSA 1EX6A 4X65B 4G41A 4C78A 4M36A 3BICA 4N01A 4N12A 2ACEA 1KS9A 4FDVA 4UHKA 1GSOA 3IKMB 3FI0A 4FWIB 5KHOC 1TU0A 2WHQA 4Q03A 3FSJX 3DQZA 3BPSA 5GJWC 2B2CA 1R9MA 4B3IA 5INTA 4GX2A 4C0LA 4LE1A 1UBHS 1JQEA 1QJCA 1P72A 1TZ2A 2BL4A 2HDHA 2PFKA 4DN6A 3QF4A 1EP3B 1HQCA 2BSXA 3KEOA 1H05A 1W9MA 4K46A 4M9QA 5CXXA 1FFYA 2R4TA 4JI5B 2ZIWB 3O2JA 3CRZA 1NJ6A 3OKPA 3AH8A 3KQTA 5HX7A 1DRWA 2GM5A 4PIVA 4PGHA 4OL9A 2UUAB 4G4SP 1Z6YA 4PRZA 1O9HA 3P26A 4Q1CA 3A28A 3TKYA 5B2EA 4JXXA 4N5NA 4KKVA 2NVUA 1J09A 5CU7A 2CBGA 5JJCA 3P9KA 2ZG6A 4YDSA 3PDHA 2IX9A 2CMDA 3R7BA 2BGRA 4EG6A 3KUCA 4O02B 4PHFA 1FX0B 4EUKA 1T4CA 1ZM3A 4WJKB 5IKMA 3OLQA 5FFMA 1XVLA 1LLFA 3BGVA 2OYRA 1GT6A 3TLXA 3I37X 4PZYA 3GF4A 2L2QA 4Z1MD 3DWGA 1NKSA 5HDBB 2ZI5A 3VU1A 4GWLA 4FYYA 2GPJA 4YDQA 5LMNB 4PPQA 4TYWA 5DM0A 5IF9A 1AZLA 4GDMA 4QFDA 3MIZA 1AQJA 3W7BA 3IT1A 1IOVA 4RDHA 3HO6A 1A5SB 1ZH8A 5CT6A 4IDNA 5DI3B 5C5EA 4XWYA 1MJ5A 4O4LA 5E6SB 1Z73A 2LVBA 2DQZA 3ETJA 7REQA 2PQ6A 3GOQA 6PFKA 4ESOA 2GEBA 3O92A 1T9CA 2GRJA 1HDOA 3UGQA 4BV3A 4DCSA 3R74A 2AMVA 3C15C 2QTHA 4NJMB 3DM5A 3SNKA 3GRAA 3JVUA 3ZBPA 2VNJA 3EZGA 1VJDA 3MILA 3OOYA 2KI5A 3PEFA 4A8JB 1SR8A 4EA7A 3A9TA 2AZDA 2YZKA 3O75A 4MWCA 4HMPA 2VTBA 1I14A 2B5WA 5LOVA 3BFKA 2OSVA 2GK7A 3K0CA 3UMGA 4EMTA 3IV9A 2AJ8A 4R2JA 5A9SA 3OJXA 2NIPA 2B4QA 2DRIA 3I39X 3TPFA 3U31A 2GM9A 2O6HA 2Q3FA 1P9LA 4N3NA 3KAPA 4O1HA 2PUJA 2IHUA 2IYSA 4O2LA 1NN5A 1ZK1A 2Q5OA 3WHIA 1QLHA 1H1TA 3LPNA 1P6XA 1OWMA 4RZXA 5JZBA 3NVAA 3LX5A 4Q48A 1ZH6A 5C7YA 1RRPA 1Q0TA 3OE4A 5J4YA 3PNMA 1EBBA 1UJ6A 3AHEA 1NPTO 3MOGA 3AGQA 2IIBA 5AXBA 5BV8A 4NZZA 1A5TA 2YV4A 3M5CA 4IIVA 4MRPA 3FKQA 3PR1A 4WV3A 3V33A 4ASUA 4DNXA 3NBAA 3PUWA 1U2EA 4LYAA 5KX5F 2Z2ZA 2HA5A 5GONA 5KVQA 3N0TA 1Z17A 2IP1A 1P77A 3NG1A 4NCNA 4AXBA 5CG1A 5D1NA 5D6OA 1E3QA 1WVGA 4MGIR 1XZGA 1RM5A 1Z0JA 4N9WA 4NMHA 3COVA 3GARA 2AW5A 4P38A 1JI0A 3T3MB 4ZU6X 2IUUA 2FHSA 3GEHA 2JH8A 2W7TA 4R3NA 1L5WA 5EWLB 2WSMA 1O03A 3EH2A 2YHBA 1QGUB 4QKQA 1BC5A 3O4IA 4IH1A 4XKJA 3B1KA 3WQBA 1N8TA 2Q2QA 4ENUA 4ZANA 4YQZA 1G3QA 2EFEB 2FF5A 2VDJA 2ZDHA 1LEHA 4JH0A 4MYHA 4RD6A 5H59A 2PRIA 3L6BA 4ATNA 4BZQA 3T4UA 2WP8J 4PPGA 1Q22A 4TS4A 1SO8A 4OI2A 3Q3IA 4YRZA 5EJ4A 2V7QA 1IAQA 3ZWKA 3ESAA 4K6MA 3WNBA 5H4GA 1YZ3A 3IYLW 1DKPA 3HG7A 3N8NA 2W83A 1WZIA 3MAJA 5EMHA 1PT9A 1YUNA 4B0PA 2HBQA 3JD0A 4C9BA 5T57A 4I66A 1Y9EA 2C9MA 3R0IA 5D86A 2J41A 1QQ5A 3COYA 1PT8A 2WD7A 4PZ9A 3K72B 4ZQIA 4RCVA 1AUVA 4X91A 1XWWA 1QB8A 1BJTA 4FMBB 5DRYA 4NK5A 3W8RA 2V54A 2WDPA 4AKHA 3AJ8A 1CETA 2JD2A 3EXIB 3QHQA 3OX1A 5KSWB 5HILA 1K6XA 3AEQB 2VSNA 2ZYRA 4LWZA 4LTDA 5D5QA 1HK7A 1OXMA 1LRLA 3HYTA 1I2MA 4R01A 1SFRA 2F64A 4WXYB 2VDWA 4N5LA 1GR0A 1H6BA 3E5NA 3R0QA 3WXBA 4KUGA 4IV5A 4CM8B 1TTTA 1CUYA 2CMFA 3IVRA 3JRNA 2JFFA 2IS2A 4C87A 3RR2A 5AW6A 3AKEA 1NM5A 3FA2A 4HLDA 4KQ1A 4P3PA 1Y98A 5KVCA 3EMVA 5IRCD 5LDGA 1QQBA 5H9VA 2ANCA 1I7NA 4LOHA 1LY1A 4L95C 2P77A 3ELUA 5BWLA 5DWVA 1MOQA 1Z4OA 3S2GA 1QB7A 4BFXA 1YWGO 3C39A 3C97A 3DLAA 1FOEB 2FWMX 2M6SA 1R6TA 3OZEA 4QDUA 1UFKA 2YJNA 3SZMA 1E98A 3ZLJA 3DD5A 1W75A 4ARZB 1J22A 1V1MA 1VGQA 3ROXA 1RQPA 3VOSA 2P5UA 2Q46A 1WVIA 5AVVA 3WGOA 3UJ8A 1KEPA 1NNLA 4TTVA 2HCTA 1DAMA 1DQSA 1RJWA 1DEAA 3LX4A 5AW5A 3AVUA 1H2FA 4B47A 2V1UA 2VHZA 1U94A 2AI2A 4G25A 4FHCA 4A27A 4EYOA 1KEEA 5AK0A 5J1TB 4Y6QA 1BA2A 3ZH9B 1OWLA 4HMOA 4HGOA 1KDVA 1ZIOA 5IVKA 3FYSA 5D84A 3RYHA 3QITA 1M33A 2XXAA 3DWIA 1GM5A 1XAGA 4OX9B 4UTVA 5BMVF 4UTXA 5KAPA 1ZUNB 3MGBA 4AZ3B 4F11A 2IY9A 1QZXA 3IUMA 4JL8A 1VI6A 2NU7B 2WQZA 5BWOA 1IN4A 3MZ0A 1NYRA 2P30A 3D02A 3E27A 1Y5IA 3FWKA 4B82A 3IS3A 4KYVA 5ICFA 3MTGA 1OW3B 2DKNA 4AO6A 2WTEA 4HGZA 4OHMA 1SNYA 2B83A 1W0JD 2AYYA 2GF9A 4F1KA 1FS5A 3PPIA 4IXDA 5FNVA 1L5HA 4XZ3A 2VCEA 5KOJB 1VKNA 2QU7A 3WKDA 4WHMA 1GITA 1Z7BA 2VYFA 1V7PC 3ZZMA 4D9BA 1RYZA 1YDMA 4O5AA 3STHA 1N8SA 2X8WA 3FVRA 2PK3A 1G20B 2ZQZA 3NHAA 1Q5PA 4LDNA 3F8WA 4RTRA 3FNBA 3DXZA 4H3HB 5K0NA 2JGJA 1GL9B 1T9HA 4AP5A 4C08A 2PPLA 4Q6BA 5CMLA 4CLEA 2VK8A 2ZPTX 4CM3A 1TM1E 3F67A 3NAGA 5SY9A 3R3WA 1N9ZA 2FETA 2PE5A 1BN6A 3TFOA 4LHYA 4YRJA 1BD4A 3PTAA 4WIAA 3TJRA 4EECA 3TLZA 1N6KA 1E4YA 1GPAA 5ALQA 3AY3A 1WS6A 4NCKA 2D2EA 1YZVA 3IAFA 4L7QA 1A9OA 4BMZA 3H5TA 1IUKA 1P5ZB 1L5OA 3JZMA 5HW0A 5CK5A 1UZUA 3AJEA 3DNMA 1E89A 4DIOA 2X14A 1XA0A 3BF7A 2BFWA 4HEJA 2IIQA 3B6IA 4MV1A 2JAQA 3QFSA 3V7YA 3OIVA 3WC4A 1P0IA 2ZWMA 3BSYA 1KMQA 4GGPA 1F17A 3DDHA 4N7RA 4OFWA 3UO8B 3IALA 2FI1A 3GUCA 1JMKC 1WWKA 2FMKA 3W5CA 1U65A 2HJHA 3GFTA 4GPTA 3VYTB 3E2MA 5JVDA 2PH5A 4E22A 1KGSA 5D00A 1EUYA 3KM0A 2FOLA 4XSHA 4LHSA 4YS6A 2JZNA 3HDVA 3VGJA 2UU9B 2KMLA 3IBSA 2R1TB 4Y9RA 4FUTA 1NDQA 5FUWA 1YFLA 4X63A 3BB4A 3LT4A 4QUHA 1P3Y1 4R83A 2HDWA 4DJDC 1JA0A 1LPOA 1CDZA 1J9ZA 2O14A 2W58A 3PWKA 4H1HA 3KT8A 4HTFA 5AW2A 4NPCA 1RP1A 1BCSA 2OCPA 1ZMTA 5IKOA 1BJRE 3SYNA 2C2GA 4HN2A 4YV0A 4OGLA 1P0QA 4CEJB 2GEUA 1WIWA 4C7MA 3CS3A 4TRJA 3H2KA 3OQ1A 2H5IA 3CUEF 1K08A 2XITA 4QFCA 2IPMA 3N5CA 3ZWCA 1L5GB 2GTIA 3QVSA 4I4CA 4QYSA 2NTVA 1LNSA 1ZXLA 5DHPA 2YZGA 1JZSA 3TR5A 5KO2A 2D8AA 4HEQA 1F8YA 1X92A 4LC9A 4W5HA 4BBAA 1GRCA 2VCHA 4H7IA 3U4IA 1CY7A 3WLRA 4B7AA 4BZZA 1EZ4A 1T4DA 1RPNA 4GVXA 5HTKA 1R37A 4CL2A 1HE8B 1MJGA 2VSYA 2WQ7A 2PN1A 2JGIA 5ER9A 1FNBA 1J90A 1HEYA 1IXSB 4RZHA 2NX2A 3S2SA 2F7SA 1E1QD 3D81A 1EE9A 1P5RA 5CNJA 3F6BX 4G84A 3GP3A 2EFCB 2H52A 2IFTA 4NPHA 2IWRA 3BJRA 3L1HA 1FW8A 2CMGA 2H1LA 1Z5ZA 2PL9A 3I6YA 5KYVA 1TVKB 1K3FA 4GRIA 3V2HA 1QHEA 3DBHB 3T06B 1OROA 4X90A 1V3VA 4URUR 4Y6GB 3VKGA 2QLMA 2Y27A 3H5LA 3TLJA 4KITB 3BJZA 4QOJA 1LLCA 1FQWA 4F6RB 1H23A 1T1SA 4TSRA 1EWYA 3ZJ5A 1QF6A 4LYJA 3ZQKA 2O8FB 3LKBA 3IUJA 3P7MA 3DCJA 1ZGAA 2Q1XA 1T2CA 3B89A 3IR7A 1S6YA 4FDMA 4IL5A 4V0LA 1CHDA 4UZFA 2WA1A 1VBNA 1LB1B 1UC5B 2CHQA 4MA5A 4M1OA 1OX5A 3TE6A 1KFJB 1JJIA 1EGVB 3AF0A 1I2ZA 2VHTA 1NUPA 1YJCA 3ZKWA 3DFFA 5DTQA 3ZV5A 5CB4A 2IEAA 1EHCA 4CLHA 1SUSA 4HCJA 1RXEA 3H5AA 3DCIA 2MSNA 1XXLA 4QEKA 2JATA 2WM9B 5CA0F 3S2IA 3AVQA 3HACA 3L43A 4ENQA 3UK0A 5A4IS 1JJFA 2G40A 2XY4A 2YNMA 3JYQA 4IHAA 3CURA 4ZCIA 4FCVA 1U3FA 3MTDA 4KMRA 1RI3A 4OK5A 1PR4A 3HO8A 1EMDA 2FOIA 3F7OA 2GCGA 3LPLA 2VJOA 5AJUA 4AX4A 3FFWA 4IIYA 3ACBA 4IDFA