5FYQA

Sirt2 in complex with a 13-mer trifluoroacetylated ran peptide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
282
Chain Sequence
ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Lysine-Deacetylation of Natively Folded Substrate Proteins by Sirtuins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-2
total genus 89
structure length 282
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 5fyqA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5fyqA01
4GM4A 2VK8A 1S5PA 2NXWA 4RJJA 2B4YA 4BVGA 4IAOA 1O96B 3PKJA 1Q14A 4TWIA 2IHVA 4K9NA 5BWOA 2VBFA 2JI9A 3U3DA 2VJYA 3PDHA 5EJ4A 5BWNA 1U2DC 2AG1A 3EA4A 3GLSA 4BV2A 4MPRA 2H2HA 2H2GA 4GPEA 1S7GA 4J16C 1ICIA 5EJ5A 2BRUC 3D81A 2Q5OA 2UZ1A 4V1CB 1UPCA 3F6BX 4FEEA 2OD9A 4BN5A 1EFVA 1O97D 4GG1A 5IMSA 2VBIA 4KXQA 4BN4A 4BVFA 1M2KA 2H4JA 3LQ1A 2H2DA 3JWPA 4V1CI 1NM5C 2JLCA 1UPBA 2EZUA 4BVEA 5DEIA 4I5IA 1YI1A 2FSVC 1PT9A 4TWJA 4X3PA 4GM1A 2OD7A 3FSJX 5D7NA 4K9OA 4K9KA 5DGTA 2PGOA 4MZXA 3K35A 4BUZA 2EZ8A 1PVDA 3CF4G 4MPJA 2OD2A 1YI0A 3CLTD 2NYRA 1YTLA 4JD5A 3JR3A 2WVGA 4RJKA 1N0HA 1XLTC 3HWX1 4JU8A 4JUFA 4RMJA 2Q5QA 3F6EX 4GM0A 2EZ4A 1M2NA 4JUDX 4RJIA 5AHKA 3PKIA 4RMHA 5K2OA 3D4BA 2C31A 2Q5LA 3GLTA 4K9MA 1T9DA 4L2IA 1YC2A 4MPPA 5EJ8A 1Q17A 3E9YA 1D4OA 1U31A 1YBHA 1OZHA 4HDAA 1PYDA 5K3SA 3RIGA 4Y6OA 2JLAA 4KGDA 4JT9A 2A1TR 4UTXA 2IHTA 2IHUA 1PNOA 3ZGVA 2JIBA 4V1CA 1YC5A 1T9AA 4JSRA 1PNQA 1YNOA 2AG0A 1SZDA 2EZ9A 4FZ3A 3EY9A 5EJ7A 2FRDC 2PANA 4X3OA 2FWNA 4QPZA 2Q27A 4F56A 4FEGA 5DGDA 3HWWA 1Q1AA 5EJMA 4O8ZA 2H4HA 4UTNA 2PGNA 4Y6QA 1V5FA 2V3WA 1V5GA 4UUAA 1T9BA 2HJHA 4C7BA 3D7KA 2QQFA 1DJLA 3FZNA 4UTZA 3GLUA 5EJ9A 4UTRA 1U2GC 2Q28A 4IF6A 1PTJC 3CLRD 4K9PA 5FEMA 1SZCA 1OVMA 1OZGA 3IAFA 4QQ8A 1PI3A 2VK4A 4MQ5A 4KPUA 2JI6A 1Y9DA 1POXA 1M2JA 2VBGA 4L3OA 2JI8A 5MF6A 3RIYA 1POWA 2FR8C 2OORC 3IAEA 5EJAA 3ZG6A 3EYAA 3U31A 4C78A 4GP9A 4ZZIA 1BFDA 5K6RA 2Q5JA 4UU8A 4ZP1A 5EJ6A 1QPBA 4F4UA 2UZ1B 2QQGA 2WVHA 3OE1A 2WVAA 4BVBA 1OZFA 4Y6LA 5FYQA 4IG9A 4BVHA 5K6TA 4JUBA 2Q29A 1M2HA 5BWLA 3CLUD 1V5EA 4K9LA 4BV3A 5MFZA 2EZTA 5MFPA 3CLSD 2VK1A 4K9QA 4HD8A 1HZZC 3FLMA 4Q9DA 1JSCA 4RMIA 2W93A 1YHYA 1EFPA 1MA3A 4D5GA 2X7JA 1PO7A 4UU7A 2H2FA 1U28C 4COKA 4D5EA 4J1TC 3GLRA 1YHZA 2H4FA 1MCZA 1Z8NA 4UUBA 2H59A 4JT8A 1M2GA 1E3TA 5MGNA 4G1CA 4RMGA 2A1UA 4JUAA 2DJIA 2JI7A 4JU9A 1T9CA 2OO5C 4R8MA 1Q6ZA 1J8FA 4UTVA 1UPAA 3ZGOA 4JUCA 1ZPDA 4QELA 2FN3A 4FVTA 2H2IA
chains in the Genus database with same CATH superfamily
4RCYA 4N7RA 4CCYB 5CB6A 2B4YA 2PFKA 2WWGA 2AN3A 2YW9A 4AKSA 4OH1A 3LGSA 4P86A 4WD3A 4YRGA 3UMVA 1MDFA 4JV5B 2GTHA 3J81k 1GKLA 4QPJC 1S01A 2JGDA 4A6PA 4AMYA 4CJXA 4A73A 3TEFA 5BQOA 5JVDB 4RY8A 3QE9Y 1P7VA 2IVZA 1S2GA 3CKYA 1DRVA 1O6BA 2PMEA 1Z5WA 2OYSA 2QAGB 4CT4B 1NULA 4HNHA 2QMOA 3Q10A 5HUJA 1PQWA 4XUGB 2ZSJA 1RM3A 5ELLA 3EPKA 3OT4A 3OX2A 4Z9AA 1A69A 3WB0A 4E5NA 1Y7IA 1YHNA 2ZRDA 4ZHQF 3FOAA 1XIVA 4ZZ1A 1QYIA 1LVUA 2HFJA 3DG9A 4AJNA 4ASUD 3ENZA 3GT0A 3U7IA 3GH1A 3E03A 1R8QA 1U3WA 1KZ1A 1QIJA 1ULTA 4DNXA 4EQ6B 1QBKC 1LX6A 5F2NA 4RIHA 5HOEA 1UIRA 1A0OA 1DP4A 3C39A 3PSHA 1RCTE 1XWFA 3IODA 3LX4A 4PX5A 4CV1A 2AFHE 2N9UA 3EF0A 3A10A 2BZGA 2W6JA 2AKAB 5TIIA 3UW3A 2R1UA 4HYQA 1WW3A 4IDDA 3NYWA 5EJ8A 1Q20A 1U3UA 4EYOA 2FMKA 4MLCA 1G17A 1AKEA 3O3NB 3ILXA 4KGDA 3HQ4O 1FRQA 5HE8A 2I6XA 3UF0A 1WCYA 1RRFA 3R23A 1RMYA 1Y98A 5C9ZA 3HRKA 3C5VA 3VU1A 5B58T 1D07A 2C5AA 3KB2A 1QBGA 4YBRA 4JGIA 3P9PA 4Z51A 2PQ2A 4TVKA 1DBWA 2CNBA 3G2MA 4LHYA 1DLIA 3L6BA 1WBJB 1GTJ1 5H0IA 4WCVA 4WKPA 2P3QA 1DXOA 1F12A 2VUHB 4Q7EA 1THMA 3MT7A 3T99A 4BLPA 2GYYA 2J9GA 3IAAA 4LSMA 3PITA 1R6BX 2YR0A 3OM8A 4L3OA 2FUKA 3QXCA 1ECLA 4MVJF 3INNA 4RK7A 2JATA 2R86A 3WLOA 3HCPA 5U1PA 4KFUA 5HKAA 2Q8PA 1MEJA 4NU6A 1QFMA 4RA9B 3UMGA 2IPXA 4NAVA 1ABEA 4U0KA 4RABA 4C76A 3KELA 1QIHA 2R1TB 5GVRA 5A9RA 1HRDA 1VRWA 1SUPA 2OHXA 5KZMB 1JVSA 1KVRA 3I23A 4MVJM 2JZOA 2O8FA 3C7CB 5KTSA 5D5PA 1NQXA 1ZONA 4LYHA 3SJ7A 1YA6A 3OWOA 2VP6A 2Z5FA 1IC6A 3GDGA 3AI2A 5AW2A 3SVTA 3IIIA 4HVTA 4B3XA 4S12A 1XNQB 2R47A 3K30A 3FTQA 1ICEA 4J1NA 4FB4A 5IBQA 1AN0A 1DAOA 3SP1A 1PDWA 2XUDA 4ZAYA 5EINA 3X1JA 1N6HA 2D8MA 5K6AA 3DXXA 3N8HA 3PQFA 4I4NA 4KVFA 4R8MA 1OLUA 3ZBQA 5AW1A 2Q45A 2IFTA 5TF0A 3RHFA 3DYVA 3IFSA 3S44A 1MAUA 1ZIOA 2ISQA 4KQ1A 5F1YA 2A94A 5FHRA 4EUKA 4S05A 3LTEA 3AG5A 2XQFA 4FIZA 2FZ4A 4ODIA 3E3MA 3PU6A 4D46A 3UFXA 3MJVA 3KJEA 4MV0A 4OHCA 4ZI2A 1ZH2A 4L57A 1OC4A 2QUBA 4MUJA 3HKCB 5EJ4A 4A5OA 4QRIA 1VHDA 2DKOA 5L6LB 3HYNA 1P4AA 3V2GA 3EFEA 5LLTA 1MOSA 1ZRMA 3P7MA 4EZBA 4F1JA 4CIAA 4E03A 3O26A 1JBEA 3PQ4A 3EOBI 4G23A 3PC8A 2J0EA 4J3FA 5AKJA 4LPKA 3DMGA 1H2BA 3PUKA 4LG1A 1NYLA 1EJ2A 1ULHA 3KR2A 3NT5A 1TL7C 3T7KA 1IWPB 1TM1E 3OZSA 3TQHA 5LLDA 3Q98A 4L3WA 1FX1A 4BZWA 2RGAA 5C18A 3IQDB 3EQ6A 3LP8A 3K09C 4J1TA 4C2UA 4LYDA 4O5AA 1HF3A 1Y6FA 4UCWA 1RAGA 3RNOA 4X3PA 1DB3A 3ESCA 4P4GA 4BV8A 1FC0A 3O1IC 3EXAA 4EPWA 3BF7A 1C9EA 1IBCA 3CEMA 3COPA 2DBRA 2IYQA 3S27A 5CA0F 2R8BA 2I1WA 2YJ4A 2KS6A 4JT4A 1FS4A 5A7FA 5CB4B 1A27A 1L5KA 1DIRA 4ED9A 1PR4A 4WK6A 1YB2A 1SOWA 3G5UA 2MHCA 2QAIA 4PGFA 5J5AA 3UYLA 3V8PA 1GCGA 3TGPA 2Q4DA 5D3MA 4WY2A 5DX0A 3DA8A 5G3ZA 5JCXA 1W4AA 2AJLI 4IXWA 3QEMA 4MWGA 1W19A 3ESQA 3UUFA 1KZ4A 2LE0A 2QORA 2XTMA 1RP7A 3R3HA 1E6WA 2EZ9A 1U2ZA 1B8NA 3C4QA 3BKWA 3GPCA 4QGGA 4A7PA 1D2CA 1K3UB 1PZMA 4R7GA 5B6JA 3H7IA 1FFCA 2C7BA 3CJTA 4JLAA 3ZIUA 5TGDA 4U7DA 2ZULA 4CKEB 4G0VA 1FP2A 3NTOA 2O8EB 2IH2A 1Y9EA 4L8VA 4EGFA 3SF8A 3D2LA 5KU1A 3RFUA 4WY8A 3KUDA 3R7SA 2POCA 4L74A 2XRFA 1JAXA 3F5DA 3TTTA 5JY6A 4HZGA 4NE2A 1B26A 1C50A 4Q16A 4ZT5A 4BLWA 5B55A 1EBUA 1XELA 4W1QA 3TNDA 3RSHA 1V1MB 4ZQCB 2B8NA 4TXLA 4Z9BA 5J2UB 3TL3A 3OCXA 2VWPA 2Z2JA 5KYVA 2I2XB 4KN9S 4OB6A 1UMDB 3LQQA 3BMQB 3BH0A 7ABPA 1RIFA 4H1HA 1M0WA 4LRXA 1VZ2A 3RVBA 3SQLA 2YJ5A 2ILTA 4DILA 1BIFA 1OCEA 4L2IB 2A9FA 4Q3NA 3QX3A 4LC1A 5D3QA 3BN3A 5GINE 5KAMA 1BMTA 5D86A 3UXEA 1A77A 2AV6A 3ZQKA 4P3OA 2BBTA 1TB4A 3R1IA 4IDHA 3OKPA 2XTZA 4RGBA 2QR2A 3UWDA 3QX7A 1JYFA 3HU5A 3AM1A 2Q2VA 1PJ3A 1AKMA 4B3CA 4EMSA 2F43A 2CEKA 2DQSA 2I54A 3UTDA 1IM2A 3ZDZB 2AR9A 2HRRA 5B3LA 5IYZF 2A92A 5B7PA 4QJIA 4IDQA 2F64A 3IP3A 2ODAA 3KUXA 3CIFA 1MJGM 3Q85A 3AESB 2BBOA 2C83A 3OBBA 4JNCA 5CEFA 4RTJA 2XCTB 1KNQA 3EBLA 4YVFA 3IEVA 3HL0A 1S9DA 1MO3A 3FA2A 4F2DA 1M8PA 3D6TB 1GCOA 1KAGA 1LRJA 3AFHA 3EZ2A 3P19A 5DXJA 3RU9A 3KDAA 2G5PA 4OEHA 1XHFA 2QTCA 1GRNA 1HE8B 3G0DA 821PA 2H1WA 3DDNA 2DPMA 2P69A 5TR9A 3ZOKA 1YU6A 3JSAA 1V35A 2WU4A 1GQ2A 1FB5A 1K2VN 2O2GA 4DIEA 4Z2YA 4BNIA 2BRUA 4P9NA 4MA5A 1QE5A 2WP8J 1I14A 1Z2OX 1IY8A 1JJBA 1WPRA 1Y3CE 2WE8A 2YFQA 4M1TA 2VTBA 3TQQA 3AVYA 5KJFA 2Q2QA 4MULA 4D8XA 4IUCS 1LNSA 3QGMA 4G01B 1PFKA 4GKBA 1GGNA 2YCBA 4OHUA 5J59A 5CDYA 4QICA 3LBAA 1AKTA 4WKCA 3GP8A 4G9BA 3PEYA 4GW3A 1P73A 3P5BA 4RTOA 3ICEA 2ZUCA 3HVHA 1R6DA 1T2CA 3UHAA 4DZTA 1NW5A 3PUZA 3V5NA 4O2AB 2AWNA 4Q82A 3V8NA 4EKEA 3L5KA 2FQQA 2HF2A 3Q3VA 5LBTA 4A16A 5ESXA 1N0HA 4JQYA 1ZD9A 5EE3A 2XZLA 4FJ2A 2CF5A 2EYUA 1F3LA 2Y1FA 4J9VA 4X9XA 3AQ4A 1XEXB 2EZ4A 3RPEA 3TW8A 4URUR 2PYZA 1Q3TA 2JVJA 4POOA 3N74A 1NQAO 5BQFA 4D9CA 2M6SA 1G2OA 4UKDA 1VSBA 3TPFA 1QH0A 1E4OA 1S8FA 3HNOA 1P18A 2CKDA 3EXFB 4G0YA 4ILEA 4RH0A 4BWVA 3IVAA 5I8WA 2WSLA 4ZO4A 1OWPA 3LBIA 3RARA 16PKA 3M6IA 1E3WB 2I8AA 2IYFA 3MXOA 1MKYA 4RV5A 2PMDA 5K3SA 3ZHRA 3B9PA 4BQFA 3AGPA 4YX9A 2REOA 3PHLA 4V1CA 5C80A 2VRWA 2MR5A 4X3OA 5HS6A 3MNFA 4FEGA 4AQDA 3ZHQA 1LLFA 3HV2A 4BX8A 2BKAA 4LDAA 3RBVA 1F2TB 3TKYA 5GADl 5KTTA 2VQDA 3GLHE 3ZV6A 4EG4A 4Y8VA 4DB2A 4YJDA 2D5AA 1YAJA 3KJFA 2FVXA 4LGYA 4Q9HA 1RKQA 4FGWA 4GLFA 4YPVA 2VBGA 1I51A 4F4FA 3CLKA 3KEOA 1MAVA 1G2PA 4GGOA 3UJPA 5LQAA 1L8QA 3EPHA 1ILWA 4QUDA 1HMPA 2R00A 2X9NA 5IK2A 2PVSA 1VPVA 8ATCA 1HDZA 1YCFA 4ZP1A 4GKKB 2JVIA 4FFBA 4H59A 1E5XA 1TK9A 4IRUB 3AR7A 3UMJA 3H11A 4AP6A 2BHRA 4PG5A 4YJ3A 4HR7A 2IEDA 3G85A 4LZAA 4OJTA 2DETA 4OQXA 5GGXA 5MFPA 5A71A 1NXWA 4BLSA 3VU3A 4ZN6A 1BVYF 2YS6A 3SFVA 1F9EA 2YVAA 3AEQA 4EZIA 2Y1KA 4F6RB 5T67A 1N2BA 3MA0A 4UNPA 1HE4A 1LDYA 4EHIA 1NE2A 2HBYA 3DWGA 1Y3HA 3BD8A 2ZCUA 4D6YA 1JKIA 1I3LA 1O54A 1SCUB 1U81A 4N5MA 4U3JA 3LQYA 1H2AS 2C8KA 2F8LA 4WN9A 4GR5A 2QX8A 3COVA 4REQB 1QPZA 1TX4B 3MGBA 1UMBA 4RLQA 2EARA 3ND9A 5FLKA 3AF0A 4ICIA 5TB5A 2G9NA 1LLQA 3K53A 1SVKA 4B32A 3HDGA 1Z25A 4B31A 4EKDA 2AL7A 3CLTC 3WNVA 2REXB 4QXMA 3PC3A 4CQMA 2ZPTX 1NJFA 1YZUA 3QNWA 3D3WB 4M49A 1QC5A 4ZVRA 2CK3A 3KE9A 3OQHA 5B3KA 4WW0A 4UDXX 5IEBA 4HATA 3SXUA 1SFRA 4MVJA 2BDUA 2X5NA 5EKSA 4KE7A 1F4PA 2HPZA 4HLDA 5EI5A 4EABA 4G2NA 2EBUA 3JZMA 3IDAA 1A98A 1WL8A 2FLVA 3KHKA 4NOJA 1OBHA 2ID8A 2AQKA 4AULA 3LJKA 4WWHA 2V0GA 2A7QA 4OQEA 1FUEA 3C4JA 2WICA 5AOAA 4MA0A 4D25A 2QGNA 4CM3A 5A6VA 3OJOA 1CZLA 2EV9A 2PSSA 3V1KA 3LKVA 1F5NA 3SC2B 5K3FA 3UK6A 1PUIA 5AI9A 4GR9A 3ZS8A 4KAFA 4NVRA 1KO5A 1U9IA 2QTVB 4DBZA 4M9CA 3HJNA 4MUHA 1YXMA 3LHIA 4Z9YA 3IEXA 3LA8A 4G0MA 4RGQA 4CDRA 1XTSA 1NY5A 4MNTA 4NBSA 5BRJA 3PEEA 4RMJA 1E9CA 1XVTA 4JC4A 1M2NA 4ALMA 2XNSA 1WUHS 4K6OA 5C4GB 2JKYA 5DM1A 3QKRB 2PX5A 3C8HA 3W5IA 3EEOA 3GT3A 3DOHA 4KHZA 3GVCA 3I6BA 4S3MA 3B2EA 2FZKA 4AMBA 1IB0A 3DC7A 4AJKA 3LLVA 3CRW1 3I72A 5ICMA 5AQEA 1DJOA 2C9MA 4HQFA 3HBMA 4B3BA 4PNHA 3OCCA 1DQSA 1FFXB 1XTVA 1CPYA 3JAWA 2C2ZA 5T4EA 1L6RA 2OXFA 1TCAA 1GQFA 1EU1A 3LQ4A 9MHTA 1V5FA 3W5VA 3IJPA 5FBZA 4TGLA 1ULZA 2ONKA 4NCJA 4JB3A 5FOWA 4G67A 5JMOA 2CB9A 4L4SA 4EF4A 1O5IA 4W5JA 3VGPA 4EG3A 2I55A 4QFCA 4AAYA 3O31A 2CN1A 5JD4A 1YB5A 3BTVA 4Q6WA 2HNAA 1DC3A 1HYEA 1YASA 2EFDB 1NKSA 3B6MA 4HUJA 1W36D 5AHWA 4IIEA 1N9GB 2ECFA 4IBOA 3STXA 1ADYA 1CS0A 3RK0A 2Q29A 4FWIB 2F17A 2BLLA 5SY6A 3QVSA 3R24A 2W6QA 1QP8A 4FHEA 3X2FA 2P6UA 5K8CA 5LU8A 3M6AA 3ENWA 4Q7JB 4TUYB 4ROSA 2YXPX 4RGYA 1GN8A 3KT3A 4J76A 4BIMA 1XMXA 5I7FA 5JD5A 2IY9A 3DTNA 1FDUA 2KQUA 4TMTA 2VPPA 4YBZA 3OIUA 2ZROA 2LKDA 1MCZA 2RHOA 3F5SA 3HY3A 2NAPA 2MJLA 1S9HA 2X1LA 4Q1EA 4IP0A 3TTWA 1TTQB 4BJ5A 2ZXFA 4C0JA 2O8CB 1CJCA 1GZDA 3OLXA 1XNGA 2I80A 4U7HA 3KOMA 2XLBA 4UHDA 2A1IA 4NDNE 1T4CB 1P0CA 2X1MA 1KO4A 4OHRA 1OGYA 4O59O 4CMBA 1ZIXA 2H2IA 2ZT8A 1ETUA 5J1SB 4IS3A 4CIVA 4CDNA 4CQLA 1FLAA 1N36B 4BMDA 1C9NA 5HE9A 3TAUA 1GTSA 1NFQA 3PFIA 4WBXC 1G5PA 4BNWA 3LK7A 1YIAA 1KH1A 2FI1A 3BXOA 2GCOB 4D81A 3K9FC 2CHQA 2Q0QA 5DM70 1N0IA 1YUNA 3EZLA 5E2BA 2QUIA 4LVOA 1GLNA 3I4LA 1BOFA 3IGFA 4G5SA 3O84A 2ZB4A 3HDVA 3ZGLA 2AOTA 3V00A 3GG9A 4Q7KA 1S2IA 2GFQA 4NQZA 1QXSA 2ZR9A 4GMFA 5FQNA 4MQFB 2A2ZA 5HFJA 4GBGA 5D3ZA 3TH5A 1WB6A 2XDYA 3AEXA 4Z8YA 1TO1E 1HURA 1OX6A 1OVGA 4A0QA 1MH1A 5CLQA 5I6DA 2LVBA 4WSOA 3G13A 4B33A 4JR1A 1GYRA 4ER7A 1WKVA 1GL9B 4L9WA 5FXMA 4ZKDA 5HIIA 4NMXB 4V02A 3BGOS 3QEBZ 2YC4C 4GPTA 3BDVA 2CGEA 2WHXA 3E27A 1WF6A 3EXEA 2EIHA 3KZ1E 4X91A 4XFJA 1GZUA 2WJ3A 5JPDA 1PV4A 3N1UA 2BW0A 1RYYA 3S5JA 5JMTA 1V47A 4FXOA 1XPJA 1RJGA 2F6RA 5AI4A 4YI5A 3TQFA 3AIIA 3E9NA 4GP6A 1H0KA 1UK6A 5ALXA 2Q4RA 2ZRHA 1RABA 1LSOA 3Q7SA 2VYNA 1FCJA 1KRHA 1O4WA 3HXKA 2IHYA 4YALA 4NJOA 4LC0A 2VQ6A 3LX5A 4TS1A 3V8EA 4D4GA 1LPAB 1LF5A 2HDWA 1AGRA 1YDHA 3HG7A 5DIZA 1FDOA 4IUYA 3UT5B 3KKMA 4N6GA 5DXFA 1Z6QA 1X1RA 2CLEB 4BNFA 2ES4A 4E15A 3DS8A 4EL0A 1DIGA 2LUOA 3WYNA 4EKNB 3MJCA 1XCLA 1N1MA 1X8XA 4H18A 4A4DA 4EZEA 2QNRA 4M4SA 5JS6A 3EASA 2NXJA 4LSGA 4PCLA 4CL8A 4LMRA 3LOQA 5GV7A 2XKAA 4IJ5A 1PT6A 4MV3A 5E0OA 4WADA 2UUPA 3N2GA 4FBLA 2CFOA 5T6BA 3M1LA 4JVMA 3B1XA 4JLBA 3ZNNA 3KKKA 3FBWA 3TQOA 4NCAA 4M55A 4GP9A 1ZJWA 4F3TA 4JLKA 2DUNA 4R2LA 1L5HA 1RZ3A 2B82A 2FN7A 2GXAA 4M1ZA 3JZAA 4P58A 2GZRA 1FTGA 1GU7A 1VSQA 1I0IA 2E37A 3IUNA 4HUQA 1ISSA 2BKUA 4YMUA 5ICGA 2FQWA 5AVRA 1F2UB 2PUCA 3O8CA 3T3EA 2Y71A 4R9NA 2DQ4A 4RM3A 4R7ZA 4TVOA 5CVEA 3QOWA 1Q0SA 2C07A 1DIHA 5BVHB 1J24A 1Y7HA 3T7AA 5M7EA 1ZIDA 1AV6A 5I4KA 1E2NA 1DSSG 4Z1OA 1V41E 3VZPA 1A8PA 4QLAA 1R6XA 1R5OA 2FFRA 2MSKA 1M6VA 3GNSA 5K8VA 3HVKA 1OIVA 4GVLA 1P7CA 1VMKA 5HZKA 5AW8A 1UEIA 2GDZA 1QVAA 1G63A 1T3ZA 2D06A 2I4LA 3LW8A 5ICCA 1GTG1 3QEJA 3DTTA 4KJXA 2OUIA 2BPOA 2YV5A 3JYNA 4MGKR 3VJLA 3VOSA 5LWQA 4BZQA 3KQMA 4Q0MA 2VBCA 4A0RA 2JAUA 2JIMA 4JY7A 4PC7A 2VG8A 4AX4A 3NYQA 4EJ0A 4TLDA 4F38A 3I1YA 4KUHA 1U8ZA 2FPGA 1QUFA 1X86B 3M1IA 5H4HA 3TMYA 3C8ZA 6REQA 2B8EA 1V6SA 3OIFA 1X13A 3SN6A 1ZVKA 3EMDA 3WIDA 4HK4A 1Z63A 1UH5A 1MDBA 1C3VA 1D2RA 3CH5A 2GEFA 3K5IA 1KGSA 3MWKA 3F3KA 4GOND 3RC9A 3C48A 5DO9A 3WQBA 2GPSA 1RRKA 3TRJA 1QHGA 1B93A 4IHJB 1TQ4A 3PA8A 2X4GA 4MDHA 4QPPA 4AZWA 4O4LA 3COYA 2JIQA 4H35A 4ZHQB 3KXPA 4KIGA 3DKKA 4RZUA 4MW1A 3MMPA 1Q1QA 1PZGA 4CMHA 3U60B 1VFPA 1XZCA 3L8DA 3MINB 3K2BA 3FZGA 2AC4A 1V8ZA 1KMHB 2REBA 3DUWA 2WAOA 2NIPA 2VK2A 2SBTA 4JN6B 2WTAA 4D4LA 1CS4C 4MX8A 3V7WA 1I4WA 4QU9A 2B98A 3U0VA 4EECA 5BR1A 1EGHA 4JP5A 4U39A 4J4TA 2GN4A 2DSNA 2HK7A 3M4JA 4ZAVA 3DZJA 2AVDA 4I4TA 1ZCAA 4M9UA 4BJ1A 5MHTA 2PFSA 5FRDA 4TLEA 3SZMA 3RFCA 4EUFA 5LIRA 2IH5A 1LK0A 2GPAA 2QRQA 5TMEA 4IJWA 4IHQA 1U8FO 3V32A 4BE4A 3ZVMA 2ZDGA 1NU8A 4D6PA 2JLVA 2VHVA 3WK4A 4I5DA 2B69A 1IXSB 3HB1A 4TKLA 4WK0B 4GUDA 1P19A 4HAUA 1FJXA 3EXIA 4LHSA 1WB5A 3L79A 3PRJA 1SXJB 2PZEA 2A4MA 1HT1E 2QEQA 3D4OA 3I3OA 3K6KA 3WICA 2XB9A 2CXHA 3EDMA 1Q21A 2QM8A 5HTOA 4X24A 3LUAA 4M76B 3A32A 4JVOA 1UT5A 3DP7A 3UENA 3ZHCA 1DZ3A 4QBHA 3H42B 4OD0A 1RQLA 2QRKA 3U09A 3L7KA 3E7DA 3GPBA 4AUNA 3FNHA 1TC2A 5GONB 1C2YA 1EFKA 1OI2A 2WPNA 3D6MA 1SXIA 2P2YA 5DULA 3MTGA 5J43A 3DPSA 5CNKA 4HSEA 3HY4A 4NABA 3ISTA 4EG6A 4INJA 3EGEA 3D7MA 1KXJA 1U11A 3CSUA 1MFPA 3E9ZA 3EMKA 2QP9X 2VDOB 3K9WA 3PF8A 3FDXA 4OQLA 2OZVA 4ZU1X 3RTDA 3ABZA 3UMSA 1NJ2A 3LYAA 1L8AA 2AMLA 4LXYA 3ONWA 2AS0A 3KU4A 5ER6A 2X3UA 1OXMA 3D2BA 3MTDA 1XKQA 3QBEA 3V9AA 3TAXA 2PHZA 3I9OA 4L4XA 5AOBA 4LRSB 2LCQA 5KJ6A 2FZGA 2VPXA 3WYAA 4B6JA 3UOWA 3NBAA 1P7WA 2ZSDA 4QODA 5JWHA 3GLQA 4UBNA 3KVRA 5CBPB 3V2UA 1W29A 5B3JA 1BQ4A 2X5OA 4WZAA 5ECWA 2X4LA 1AZTA 4PFJA 3WL6A 4JK3A 4H31A 4LNHA 4Q5IA 4BGDA 3HO1A 1ZA2A 1VHTA 2WJAA 3ZHVA 1IBRA 1IHUA 1TQHA 4PQGA 1X14A 3IJRA 3WRWA 3OF5A 1HLPA 1Q1NA 3PC8C 4R1PA 2H63A 2HIGA 2VDKB 3WE7A 2XMCA 3OJXA 3WGIA 1V8FA 3UGQA 3C43A 3L7JA 1Z4JA 1STOA 3UWKA 5LYJF 5E2IA 3TE7A 5IXSA 5AP9A 5DEOA 4X6YA 1BMQA 1VBKA 4L5CA 1ZGCA 3CB4A 1T1GA 1KI1A 4MMXB 3WXMA 3BMQA 5F2OA 3U39A 2UU9B 1G21A 1W5TA 3M0EA 4DJEC 1EGAA 4HNVA 5KOHA 3LP5A 5JE8A 4A1OA 1O6ZA 4AURA 1NM5C 3MVEA 1LSUA 5FR1A 3JPYA 2JB9A 3RROA 3NBQA 3IPXA 1FQKA 1KYQA 2AMVA 3BE4A 4AB1A 5I01A 5IULC 4QL3A 1BD3A 2Y1XA 5DHFA 5ABPA 2PWYA 3EQ2A 1YZ3A 3EA0A 3B6IA 2P0AA 4GI5A 3PBKA 2QE7D 2ZREA 4Y1GA 3FY4A 3S1AA 3BHJA 5CDSA 5BSVA 3ZU6A 2XMRA 1EX9A 4GF5A 3WQHA 3KFVA 4YYZA 2F9LA 1BGWA 4WOKA 4MPDA 4W99A 4QOHA 2V7TA 3BXEA 4B09A 1H3FA 2CEAA 3IHTA 4XYBA 1GPYA 1J1UA 1RWBA 2AN1A 1W30A 5P21A 3ZGYA 2WHYA 4E21A 3CURA 2V9CA 5C53B 1ZJZA 3HACA 3O83A 5GAJA 4E5DA 4KQCA 5KVQA 1MRNA 5E7JA 1ESEA 2DHCA 5EJFA 5TQVA 4NARA 1KMNA 1P39A 4B76A 1A9XA 3H1EA 4Y9UA 2AJDA 2N42A 4QBKA 1M1YE 2IZ1A 3GLHA 1Z74A 2ZR8A 4QVGA 4XEHA 1PK9A 3K9BA 3QZUA 3RNLA 2J5KA 4K2AA 2BEUB 4GNRA 4UUAA 5AK5A 1YE5A 5IHXA 2F67A 4FU0A 3ROFA 1SEVA 2NV0A 5T4BA 3O0DA 2HA6A 3UKDA 4KPEC 2D5CA 3LWNA 3A2MA 4PNZA 3KAPA 1ULSA 3ZUGA 4ASUA 3LY7A 5LXTA 1KY3A 2JIPA 1VOTA 2PLFA 4M9SA 4M0DA 3ASYA 5KYUB 3F3MA 4IIVA 3LT1A 2IF2A 1F48A 1GRCA 1O9BA 3JWGA 2YYSA 1JLLB 1I1QB 2ZATA 5JRDS 2J0SA 3C6XA 4ADSG 5IUNC 3I61A 1RI5A 1KU6A 1YQUA 2C29D 2P67A 3NEPX 2W2LA 1MQ9A 1DKRA 4W8OA 4YJGA 3K1AA 1TQ8A 1IQ0A 4HFMA 1E3WA 1QOZA 1O89A 2FQXA 4UTOA 2VEOA 2FRVA 1XBTA 2AYZA 2HLNA 3PNVA 4IQ0A 2FUG6 1L5FA 1AM4D 3DAFA 3QA9A 4Q4LA 2H59A 4MCAA 3GJ7A 4D3FA 1M9NA 1MVOA 4JUAA 5AIAA 5AXAA 4LWPA 3DLIA 1J0XO 3DMNA 4IXMA 1XEWX 5AKXA 5DN6A 2AUMA 4FE7A 3UBMA 5BMVA 4JCCA 3UPDA 4AWBA 1K89A 2PLRA 4LECA 1TYBE 2RKBA 2ZSEA 3RYTC 4HEJA 3W9BA 1AHNA 3ZOZA 1NVMB 2G5GX 1WTAA 1XTPA 2WM8A 5B7QA 3HBJA 1EB8A 4W5TA 3NHFA 3B52X 3G17A 4ZTZB 4TL6A 1R50A 2C2XA 4GZ3A 4Q9LA 1K08A 1E2GA 3D5TA 3EEQA 3SC3A 3ZNQA 3PNYA 1NW8A 2D7CA 2LDBA 4E4RA 4EHJA 4TVBA 4ENRA 1K6JA 2PSEA 3HCFA 2Q7XA 3EHDA 4O25A 5YASA 3D81A 1WHSB 3H9CA 4FMPA 2ONCA 2WYUA 4PSAA 4BB9A 2BBWA 1LPPA 1FP4B 2DGDA 3MMNA 4KP7A 2C3MA 3GO4A 5HIKA 1JMVA 1WEHA 3AF3A 4GXTA 5CYFA 3SDSA 1A1VA 1OA0A 1M2KA 4L8YA 4YRAA 2PPVA 5LKAA 1HZJA 1W47A 3CV3A 1J0CA 3UOAB 1MW8X 4FCTA 5AVQA 4B8YA 4ZYXA 4F21A 5B2EA 1IQPA 1M6EX 3EFHA 4EYEA 4FYIA 5DP2A 3AUAA 3EISA 3R7WB 3E7FA 3IT3A 3RT9A 2C54A 5JISA 4FOSA 3LWDA 5IAEA 5JZOA 4FDLA 3ILSA 4RDIA 1IHPA 4KXWA 2D59A 1BKDR 1T5TA 1XFDA 4RANA 3WIBA 4BNTA 2HHCA 1F4LA 1NWCA 1EK5A 1CLUA 1R6UA 2HMAA 4KLCA 2ATVA 4CTJA 1JIVA 2QKYA 3BTUA 8OHMA 4TXJA 3VKFA 4DCTA 4NYMQ 2D6FA 2E4XA 4JXXA 3PQ3A 2BUBA 4BEWA 2RJ3A 4ZOEA 2RAVA 4AG3A 5AD1A 4E2XA 1KPIA 2ZIFA 2HI0A 1PHPA 1PJQA 1QC5B 2OFXA 3BSFA 3OEEA 4BRUA 2IPLA 2Q50A 3DQPA 3VSAA 1DG1G 3F7OA 1GY8A 4R2KA 4RJTA 3DEKA 4I1VA 4JT9A 3ZIAD 2EL9A 2YUIA 2P9BA 1SHUX 4K6MA 1P8JA 5DM2A 1BRMA 1P1RA 4HC4A 4MMYB 1NVGA 3CLRC 1JIQA 3FTPA 3ORFA 2ZKLA 4GWLA 4DIOA 4HZUB 3I9LA 2DC1A 1ZN2A 2NVUB 5KNCA 2JW5A 3ECSA 2I6QA 3EY4A 5IKMA 4DR4B 3G02A 3LV8A 3R9IA 5EHZA 2YOHA 2ZZNA 2BFOA 3AHEA 1K8QA 4WK4B 1RWKA 3BYZA 3KQKA 1O08A 1ZVVA 2CDBA 2RHLA 3HL4A 3DEFA 2O50A 2QTVA 2I1LA 5EQTA 2HH9A 4E4TA 2ZK7A 1QGUB 2Y1GA 1GUAA 3FDFA 3GZTB 1NLFA 3A1TA 4N03A 1XZLA 3RUHA 1TTTA 4TTVA 1A4IA 5A3RA 2R7LA 1PGJA 1U0OC 3SZUA 4H7HA 4WN3A 1ZISA 4QAJA 3PCRB 1RIIA 1Z0DA 2EZTA 3DLPX 1QNLA 4P7GA 4YASA 2A0YA 4O0LA 3RS3A 3FLMA 1B8UA 2RHDA 1A97A 5DYGA 1PUJA 4QPNA 3WWCA 3FPCA 2GAFA 4B75A 5M29A 5DNCA 4WNYA 1ZRSA 2VP2A 3F67A 1LWNA 5EE0A 1K68A 2LP4Y 4DYHA 2XSZA 4J9UE 4W6QA 3LW7A 1FK8A 3R3XA 2WWIA 3WGTA 1PD1A 3L82B 5AW3A 4C29A 4F0JA 3LL7A 3MJSA 3KT8A 3OU2A 4PCUA 1SRRA 2Q3BA 1AKQA 2X2OA 3QPWA 4NG4A 4W1RA 4YDRA 3KDPA 3BIXA 3WK5A 3WB9A 1CETA 1GSOA 1JHUA 1RI1A 3G9TA 1SCQA 2YWBA 4LI0A 4A0FA 2A3RA 4MR8A 1QYWA 1N5KA 1HKHA 1PR9A 3THRA 1GCIA 3RI3A 4GXNA 5BSKA 5C4IA 2JCSA 3F49S 3QVLA 4FR0A 2GZMA 1R3DA 2B9VA 2PU5A 3EZGA 3KALA 4KRXA 2JZNA 4QE3A 5AOCA 1WV0A 3JX9A 1KI3A 1YL6A 2BRUC 4CZ2A 2HEGA 1UPCA 1X7ZA 2AA3A 4C87A 4P53A 4N7JA 1JF8A 3RAGA 4BFTA 3P20A 1KARA 4AZ0B 5G1NA 4BN4A 2K2QB 2MMGA 1CY0A 4LY0A 2WWHA 4LY6A 4B4DA 1YDMA 4C03A 2QF7A 2FSHA 4LRUA 1DHRA 3OT5A 4O5OA 4TUYA 3DOJA 5ALSA 4D96A 3ITNA 1MVLA 1P31A 1B0AA 2O23A 2W48A 3MS2A 4HCJA 3HB9A 5DK6A 4PZAA 3A70A 3FKSA 5K6AC 4PNEA 3EIOA 2BYTA 1LPNA 5EIXA 4OXRA 1XK7A 3DDZX 2JKZA 4DA7A 1OI7A 4TQGA 3QU5A 1Z08A 4JQZA 1BE6A 4M2LA 5ES3A 4PLFA 2M6KA 3S2ZA 3E6AA 4GECA 3A37A 3A4MA 4C6RA 5DHUA 5BNWA 1OFTA 3ECCA 4H77A 1VFNA 1DEXA 1NW6A 3WADA 1OFGA 3ZDFA 3ZV3A 3V97A 2WUEA 1DBRA 2OXIA 3FDJA 1TAHA 3H5RA 3LDHA 4NYMR 1YBHA 1HNZB 2NXEA 3HFJA 4FKZA 1WLYA 2IPOA 2V7XA 2BKEA 1Y6GA 4TRNA 2PRJA 5E2AA 1EUCA 4QLOA 1L7PA 3U4DA 1LPOA 1Q74A 1V7ZA 2H1CA 3L46A 4BP9A 2PANA 4DCOA 1PNVA 4YV0A 2LRHA 2H1RA 2XAUA 3OQ6A 2FMHA 2H52A 3LZDA 1Q1ZA 3MPOA 4YUZA 3JYLA 4EJ2A 1QRTA 1C29B 3NC1C 3AR4A 1NW9B 1Y9ZA 2QE6A 3DLAA 1SVSA 2VUTA 3M81A 1DBPA 3VDRA 1DAKA 3KRTA 5CVJA 4FHFA 5BQ5A 5ESRA 3PUYA 3WWOA 1GA1A 1VKOA 1L0BA 2YRFA 4LGMA 1L1FA 4DCGA 4U1RA 2GWHA 3AEZA 3B7GA 3COWA 4X3CA 1RWMA 3TRKA 5ALVA 1OYYA 1NMEA 3AM4A 1IATA 2WFMA 1VCHA 4UEKA 3H5WA 4OUDB 5DGHA 2UUBB 4QJBA 3IP5A 3G2LA 1E6EA 2AFHA 2J48A 4GLJA 5BN5B 2EKZA 1E9BA 3O82A 4LK3A 2B6HA 2ZTMA 3NALA 3Q3HA 3QI2A 3W5SA 1L9KA 1ZD4A 3W6OA 4BP8A 3WFZA 3CTMA 1VL1A 1UL1X 1VC2A 1VPDA 2P62A 3K0AB 2D5IA 5JQGF 1VIAA 2B35A 3H19A 2HXSA 4W4TA 1ADFA 2YKGA 3OCYA 4ZRNA 3RS4A 2GN2A 4YEDA 3AGQA 2H7YA 3QBDA 4P3NA 1Z8NA 3A1NA 4ZEVA 1DOZA 2XWBF 3JQ8A 3N9IA 2ZU0C 4N6NA 1SIBE 3D7LA 2OECA 4I66A 3ET4A 3VR3D 1XTBA 3WYBA 4EY5A 2FZLA 4DZZA 4P4SB 2JFHA 8AT1A 2Q4TA 5G0WA 3G0GA 1PFVA 5LOVF 1U0EA 2POQX 2YMPA 1XQYA 3BS4A 3QJGA 2PFGA 4E5VA 4QDJA 4ER5A 3CCFA 5SZJA 4J7AA 2ARKA 1E99A 1I6LA 4MZDA 3ROKA 1YS4A 4Q19A 4PXSA 3G2IA 1JTEA 1F8FA 4TKMA 4BFVA 3A9UA 4MCIA 3GJ0A 2W6JD 3F6CA 4RVCA 4ZCIA 1UJ2A 1U5CA 1IN5A 2RK6A 1KYVA 5FB3A 1Y48E 1QRUA 3PNSA 4ND4A 2O1WA 3GEPA 5H4GA 5AW4A 1NV9A 3O1HB 3O8QB 2IGBA 3ZLVA 3KSMA 2PZ8A 1MPTA 3HBAA 2YWGA 3MYYA 4J2HA 4AJ1A 4N9WA 2F4NA 2WP0A 4NMLA 1S2OA 5JCJA 1O4VA 3W5JA 3IB6A 2JJQA 4PC6A 3VO9A 2R4QA 3D1JA 3IL2A 4WXMA 1QF6A 2KJQA 4NJEA 4OU5A 2HCJB 3QXHA 2PN1A 2E55A 4QSHA 3RJZA 4IQ8A 3KZNA 1BXGB 1C7EA 4GDFA 3OPYB 2BDEA 4J4BA 4OYLA 3ONDA 4C0QC 1CNMA 2FWAA 5ADVA 2AC2A 1RDFA 1QKJA 2G4LA 4E11A 1H2RS 1JSRA 5H9WA 4N3BA 4FFNA 3KO8A 4I4IA 3G0HA 4B6RA 4H4CA 4L16A 4R1QA 4TTPA 3ISJA 3KVOA 1U90A 2PV7A 2J9FB 1CFJA 3IP7A 1VE1A 2W6OA 2WTXA 4P0QB 3DKPA 2PTGA 1SC4A 2YWDA 4A10A 3SEAA 5JQGA 4TV8F 2WB4A 1ENOA 2ISSD 3RIGA 2GA9A 3KJNA 1Y7LA 2GHIA 1EDZA 4C3OB 2G9VA 2AG0A 2O52A 3U44A 2FXIA 2PT7A 1X7GA 4HOYA 2V7QA 4MARA 3R7FA 1GRVA 3B1FA 3DB1A 1N0WA 3G68A 1FE8A 4RYLA 5TJHA 5KYNA 1DTSA 1XQWA 2BP7B 2YASA 1R0LA 3I1JA 3OMWA 2EFJA 1CVLA 1ZOLA 4UBKA 4Q9KA 5DI3A 5DGDA 3T5PA 3URKA 1PK8A 2VKQA 4LNUA 1AKNA 2HWKA 1AK2A 3DMPA 3LX8A 4RD6A 4RVSA 4G4SO 4ZK2A 4EL5A 2CMFA 4OX9B 3HE3A 4KE9A 4AF6A 2FR0A 2FP4A 2PRIA 1ZH6A 3E0QA 1U7HA 2BHTA 3HJBA 1MAHA 2QJTA 5CTJA 2F3QA 3R75A 1V4VA 4B2IA 3RYCA 1CDZA 1Z6TA 1A5SB 1FTNA 1T5HX 2PTHA 3LHSA 4NQRA 2JFWA 1K8ZB 1AS0A 1FTQA 3NO4A 2CY0A 2QD1A 5TMDA 1Q1BA 4Y0AA 4FGJA 1HETA 2PUWA 4AY5A 3DBRA 2W2KA 4BNGA 2AOVA 2HPAA 2NZXA 4HAIA 1PKXA 1CUBA 3OZVA 3K7EA 3J81A 2ZUFA 3GFQA 4K7JA 3WBKA 4XD7D 1NLMA 2C9DA 2HQBA 5I5GA 2QTGA 3RBAA 3SI7A 3PQ5A 4ZCMA 5LU9A 3CONA 2GA8A 3T5BA 1UT8A 1TD1A 1Z62A 2F1KA 2IBTA 3ZD6A 4PIMA 4G1CA 3GT7A 1W49A 2B4RO 3VZRA 4V0QA 5CCEA 3QF4B 3QELA 3KT6A 3ZWAA 4DBLC 4X1YB 1PIWA 1ESNA 2VATA 2GF0A 2J33A 2WI8A 1JH9A 1AG9A 3H2IA 4BZPA 1Y8RB 1BDMA 2H16A 2QTBA 4IKOA 2EWWA 1GPKA 4ZQFA 3ET5A 3DVAA 1Z39A 1V6AA 4XVRA 1B00A 1V1RB 1WD7A 3WL8A 2J4FA 5JNWA 3ES9A 1B8OA 1EDOA 1JG4A 2PH1A 2XD4A 2Q4BA 1K2WA 4KJZA 4FNGA 3GVHA 2W8ZA 1GADO 1VTKA 1I36A 4IO0A 1DG3A 3MWEA 1QHHA 3E2IA 3VJKA 3OJEA 3DBLB 2ZDQA 3A4LA 5G53C 4GX0A 4MUIA 3ZCQA 3NRBA 4G84A 2G70A 1FNDA 2IXGA 2QL6A 3AY7A 1K4YA 1U8XX 1V8BA 3QWAA 4AP5A 2CCJA 3KQOA 1NLYA 2PUFA 2IK8A 3JQ9C 3HUFA 1WJGA 1WWKA 1PL7A 2FPWA 2Q5HA 4RETA 1F8UA 1P2TA 2J3KA 3QOYA 5FFFA 5LBIA 3V3KA 3ZCRA 1LVHA 2AXEA 3Q7PA 4DV5B 1VGRA 4MDYA 5FQOA 1QTQA 2WJZB 3N8DA 4US0R 4LIPD 1EBBA 1YTLA 1P0MA 5TNXA 3CMCO 4A3SA 2V7PA 4ARSA 3DM5A 1XZHA 2WJJA 4NF2A 4W7SA 4M8NE 4IR7A 2OCDA 4MS1B 3VR3A 2IXEA 3QE2A 5KWIA 3AO0B 3FPKA 2YRXA 3BREA 1USUA 1EFRD 3AIOA 3OKAA 1P7ZA 4BC0A 3QVGB 1I0LA 3IA2A 3ICOA 4L9RA 2AF3C 1K8XB 1PVVA 1TVMA 2ZVDA 4UVHA 1AQIA 2GNPA 3TZ6A 2CJPA 1A8IA 3VYVA 4JP8A 3IBYA 1WAMA 3HGTA 3FFAA 4YA6A 2Q27A 3E3NA 1T91A 2JEOA 4E5KA 1G21B 1HKUA 1C3LA 3ZWXA 2PUAA 3F6PA 4BMSA 1S8AA 2BELA 4Y2UA 1C5KA 2VP9A 2B7LA 2GN9A 3B38A 1HO3A 3KEQA 3O5AA 1BD4A 4C0SA 2YWJA 1WVIA 1AIPA 3KZXA 4QPCA 2BGGA 1TAUA 1YAHA 2XD9A 3SS8A 4R1OA 4BTLA 1NOKA 2XDAA 2G4CA 1GNTA 3F7NA 3R6TA 4ZI7A 3HXQA 2GD0A 3NBMA 1S3GA 1MOPA 3AFNA 3FCAA 5F2KA 4UJ3A 4E33A 1GTVA 4RL4A 4AIIA 3H8WA 5TMPA 3N8KA 3E58A 4UU1A 1CUAA 3Q6NA 2IVFA 4YXFA 1V9CA 4B34A 3HKEA 4RTMA 3VYWA 4UNNA 2D2XA 1Z2PX 1GOTA 1Z68A 2Q2WA 2ZJ8A 1F5SA 1AQJA 2BMVA 3RAPR 1TUBB 1B0ZA 4J43A 3GLIB 2HSGA 3OF3A 4CNQA 3L77A 2DTEA 3A0RB 2GPYA 3O0TA 1JXOA 3FVQA 1ABBA 4QBTA 3H2SA 1L4KA 1WX1A 5JNRA 3SC4A 4O3MA 3GLHB 3VR5D 2BCGY 4D3DA 1FRZA 2P8SA 2ZS7A 3TO5A 2HV9A 5ALNA 4Z54A 5IKOA 3KOXA 4MJXA 3LYLA 2G67A 2VQSA 3OX3A 3R5SA 4MWTA 3RE1A 4MV7A 2AOUA 3CLVA 4YRIA 2Z4TA 5LB4A 3TBHA 3JAKB 5NLLA 4NK5A 5AJUA 3ZHUA 4OGLA 1QIFA 1M1ZA 2GCIA 4TOIA 1JPUA 3LUCA 2VT3A 2HHJA 2FJ0A 5DLQC 1TM7E 3FSEA 2H07A 4J4HA 4JOSA 2WVJA 1Q84A 3MW8A 3QE0A 1FX0B 4OAQA 2ZZMA 4RPIA 5FUXA 2OGTA 1Y9JA 4ISCA 5GIPE 2H06A 3H1FA 2MSWA 1ZICA 3GJTA 3PRKE 4F5DA 4A8HA 1C7RA 3JV7A 5LYYA 2XNKA 1RYNA 1H2FA 1HPLA 1R4NB 1WHTA 2FSPA 3D0QA 3MWDA 3CCBA 5BMOA 4Z4QA 3PLAE 4X8LA 3VC2A 3ZJ4A 1DC6A 3INGA 1PQ4A 1XEFA 3PNBA 4XI9A 4BRZA 4M7PA 2Z95A 3U1TA 3EAQA 3TTSA 3GLFE 3CNEA 1KYYA 1NY6A 2WYWA 2XBLA 1WXWA 2A88A 2XGMA 5HKOA 3KCNA 5EMLA 4JWTA 1X7XA 3LDUA 1N5IA 4Z4GA 4F06A 1ZM7A 3K16A 2Z83A 2FSIA 1K7SN 4B85A 2G9UA 3QPDA 5FI1B 1K9SA 5EHNA 3TPCA 2H6EA 3PKIA 4OBWA 3MJTA 5AKHA 4BLTA 3TIXB 3NDBB 4B40A 4ZGBA 4M8KA 4NTZA 1P9LA 4QATA 3BXPA 4QTZA 1RFGE 2AFIA 2VWQA 1G64A 3NJ8A 1IN4A 1WCXA 2GPNA 4AO6A 5JIBA 1LCIA 1PG5A 1LXCA 1WHSA 3HM2A 3MAGA 3ETEA 4Y1RB 3K31A 1PNTA 3SQNA 1YBFA 3D5QA 4XIIA 1JAZA 4Z7NB 3T1YB 2JGIA 2WT8A 1P29A 3BG5A 2ZZKA 3TR5A 4BMCA 2OORA 2Y1EA 3IMCA 1USGA 1XTUA 2I7TA 4Q4JA 4B8WA 1L4GA 1YFJA 1E61A 1DIAA 2Q28A 2ZUSA 4RY9A 1I3MA 3UB3A 4OHMA 1QDLB 1SPBS 3AW9A 3D6HA 3Q7EA 2ZP1A 1POWA 1GAWA 2FY8A 3V8VA 5C8YB 2V1UA 2XNDA 3CPSA 2OBYA 3GA7A 3VAZA 4OSOA 1RKBA 1RP1A 5CB0A 3O4HA 3L7YA 5BXYA 1QAMA 2AXQA 3A3NA 3IOBA 1B6TA 1C4KA 2KE5A 4ZJYA 1M2VA 2ZRJA 5I3ZA 3F9IA 1G2IA 3NM5A 5C5IA 1RRPA 5CDTA 4ABTA 5K51A 4QYIB 3WQRA 621PA 3I34X 2ZYIA 4A82A 4JBNA 4FX2A 1JIUA 2J46A 5HF6A 5CUQA 2B7BA 2JIDA 4PLHA 3PENA 3P4XA 3Q41A 4Q9IA 2ZYDA 4E88A 1PWHA 3QEMB 4RIGA 1SCDA 3BD9A 4LS3A 4CNBA 2WYVA 3ZLJA 1QYRA 3IAS6 1NTRA 2FEMA 4HEQA 4D9NA 4P08A 5HX7A 5GWXA 3N5KA 2WC1A 4H7KA 1K8YB 1VMDA 4OLAA 3ACBA 5AI6A 2VL7A 1A88A 1T36A 3ZE0B 4DXAA 1RE0A 4HUTA 5HXAA 1UPAA 2CDCA 4GOJA 3RTBA 3VPGA 1UJ6A 3O91A 1U63A 2K6GA 3X1WA 4MWBA 4R40A 4P5EA 1DPGA 2AE1A 2PR7A 1QG4A 4QQRA 4FWTA 2NXWA 1LTQA 3HCEA 2VXOA 4RVNA 3PVCA 3OZBA 2E82A 3R3UA 4XRGA 3QE4A 2IHVA 2B2XA 4LYJA 4X65B 3BE5A 2GNOA 2WOOA 3SZLA 4RVDA 3AM5A 3ISVA 3UAWA 4JELA 5HPYB 2GHQA 3IRUA 4E4YA 4U2BA 6ABPA 1NN5A 5LQNA 1UBUS 1JGTA 1TZJA 4CEHA 2B4KA 4AY4A 3KB1A 4AK9A 5H1YA 3A14A 2AZTA 3P2IA 1BXRB 4PZ0A 1RZRD 1OLOA 3B1JA 1G20A 1ZMXA 4TWRA 1IUNA 4M8LA 1XDUA 3NI2A 1VE3A 4L73A 3JAMA 3EIXA 5CNIA 2C82A 3M83A 2YQ5A 3COJA 3QLVA 4ZIRB 3ZXXA 5IVPA 3G8CA 1KPGA 2GAJA 2QS9A 2WJHA 1DXQA 2ZAGA 1T4MA 2FSVC 2CFCA 3A6EA 3LUFA 1BEZA 5DSTA 3UW1A 2PYDA 5IHPA 4GX1A 1QYXA 2DTDA 2W37A 5KTNA 1G4UR 5KQMA 3IUYA 4JB0A 1Z7YA 1UBOS 1VSTA 5KOIA 1LZKA 2WA1A 4I0WB 3G2KA 1GQYA 1P2FA 4R2XA 3ZPXA 4PFSA 3P27A 1BCRB 2A5LA 1ZZEA 3K8YA 3UPTA 3TMAA 2P4EA 3PD1A 4ER0A 1MR3F 3ZS9A 4OJYA 5JSZB 4XA8A 4BU0A 1QFXA 4QG7A 3CUTA 4RTNA 4GYWA 3MXTA 7REQB 4P22A 5KNBH 4Z4EA 3DMDA 3BJMA 4JB8A 1GNLA 3JW8A 3U7QA 3OE5A 4CQJA 1N2ZA 10MHA 1RQRA 1IZ8A 3FMGA 1EFPB 1YOVB 3OTWA 3II6X 1SR8A 3IAM1 3PF9A 4EVSA 1E2KA 1NW4A 2AMFA 2ID4A 4DLNA 2C7RA 2G82A 2FFBA 3EXHB 2YXEA 2BEVB 4GMGA 1KSGA 3RGGA 2QVZX 1SBCA 2PMCA 3A9WA 5EWJA 5KJ1A 4AKHA 5B7NA 5C7YA 3TLZA 1DX4A 2E4UA 2WJ4A 5I4BA 2J30A 3I52A 1OKKD 1P2UA 4WINA 2ZT5A 1T5IA 4O8CA 4CL0A 5JNVA 5L95A 2QDKA 2HJWA 3CRVA 4JSYA 4KWTA 2XNJA 1D0SA 1KIMA 3GLUA 2YH2A 4LMAA 2WAAA 3WOHA 4W7IA 5KSPA 3BOSA 4LGCA 4BQIA 1PFGA 3E4DA 1KHTA 1E59A 3G9QA 1E4YA 2ZUEA 4E51A 3ZW7A 1C81A 4N3AA 3HFRA 3QV2A 2CYCA 5EJAA 3TSCA 2JLUA 3QW4B 4RJLA 5TT0A 4NHEA 2ZJ7A 5K8IA 5KNCH 1ODJA 3A9RA 4TKVB 2ZPAA 3BERA 3O4JA 1IB6A 3IOYA 4V0RA 1KEPA 3KX2A 1P7PA 4JYCA 5IPFA 1GDDA 4YAWA 3DZKA 3ZZ1A 4U2CA 3KK0A 2YHUA 3KUKA 4S2UA 4BKQA 221PA 4RENA 5EIHA 4PSVA 1GDHA 2RK4A 2QOEA 3A6KA 4B1FA 5KYYB 1Z8DA 3NCHA 3OOSA 2Y77A 4KWCA 3OIDA 3P94A 4BBPA 1G4AE 5F2EA 4EG7A 4YR7A 5CVDA 2Y0BA 3AIMA 2ATEA 3K0CC 1OPRA 2IPMA 4UBJA 5JATA 2D1YA 1FFEA 4MEJA 1NMSA 2RHRA 1QF7A 2BI8A 2IWRA 5F23A 3ANMA 2JGMA 1IN7A 3MAJA 1IDOA 4AXXA 4EFNA 2HF9A 3IDFA 3ITDA 5CD9A 1N2OA 2JAWA 2LD4A 2XUHA 3I01A 3OPNA 4HP8A 4TV9A 2QK4A 1MORA 1N8NA 2CVQA 3CF0A 3CX3A 3PWSA 4HGZA 4YCAA 2A3NA 5HG0A 5LP6C 1TEXA 4RTPA 3DVRX 3A0UA 1BE1A 1BN7A 3NPAA 1JDBB 4MR7B 3DV0B 3QNUA 2OUKA 4NENB 4OJQA 4QUBA 3FPAA 9LDBA 5JJKA 3CKMA 2A9PA 4CM9D 4BJ6A 4E13A 3KS9A 3D4PA 3KYIB 5A2QA 2RGEA 4Q34A 4YJ3B 4I6JA 5D5QA 3KB6A 1LBEA 4O3FA 4X1KA 4WFJA 4XOUA 4R8SA 2EVWX 2WW8A 3HVJA 3QU2A 3ZV7A 2XGJA 1O58A 1XOIA 3I09A 4WMLA 2W2VA 3QWIA 4M7RA 4EHHA 1IJBA 3LVFO 1L8OA 4BNDA 3BL5A 2A84A 3R2JA 4IIFA 2B99A 5IVKA 2FDXA 3DH0A 1W93A 1N5JA 2QZPA 3DZDA 5JHGB 4CTOA 2JJ2A 2PGOA 3EEIA 2C0PA 3AINA 3GJXC 3L9WA 4PG6A 3LWZA 5LQUA 1VG1A 4BO1A 1N25A 2RI1A 3IJ5A 3SDBA 1UMBB 2BFNA 4BVAA 2GD2A 3G2HA 3W34A 2GZAA 4HDCA 4X1IA 2RCNA 4OI2A 4L6IA 2NTJA 3I73A 2HRBA 3TTUA 1A4RA 1FDIA 2O1SA 3WDLA 2DXIA 2NZJA 4PYIA 4V0NA 2Z8YM 5AXCA 3KQWA 3O7MA 1N6NA 5A06A 1CR6A 1V8PA 3R9WA 3GMIA 1KGDA 3E9YA 2H8GA 4ZXFA 3D8TA 2QV7A 1XCBA 2HSZA 5BPHA 1G8MA 1UFKA 1YQ9A 2ECQA 5ALYA 2W6MA 2ENWA 3E9QA 3CPHA 1E9SA 1TE2A 1KZYC 3EZYA 3I9MA 1GYQA 2VP5A 4D74A 3E22B 2XMSA 4BNUA 3IUEA 1B43A 3FZYA 3EMVA 3G9XA 4FYXA 2XUOA 4GQAA 4NH4A 3NTUA 3IAUA 3VHXA 2H5IA 4JR0A 1EEXB 4U0JA 2HCTA 3HU1A 1SXHA 3L1IA 4WNAB 4FCCA 2BC9A 5F4BA 1GAEO 3JQEA 3OIWA 3AR2A 3GW8A 5B1SA 3ZLUA 3G8AA 3JS5A 4ETMA 2CXXA 3CISA 2OSVA 3CJQA 3U26A 3V1TC 3SICE 5IVHA 2FXVA 2ZYTX 3GGSA 1ZOIA 4G5HA 1QWOA 1MEOA 2BFCB 3ZE7A 3CGGA 2IC5A 2C20A 4RO0A 1QR6A 1VBFA 1R18A 4F71A 4ANFA 3FR8A 3TQCA 2QRZA 1M0EA 1DJQA 1N5DA 2AD1A 5F5NA 1QYCA 2PGXA 3LOPA 1NUHA 3BDAA 2BMAA 1HNNA 2Z5GA 4UFNA 4PYQA 4RZHA 2JAOA 3CLSD 3DBHA 3FMPB 3IVCA 3JTMA 5HIJA 4C0LA 4DLZA 4IIDA 4RHFA 1JQKA 4MVXA 5JQGB 1PZFA 3A4YA 1KJZA 4RMIA 1BYIA 5CYOA 2WWXA 4EITA 3V1LA 3V9PA 4GBJA 4FYMA 3UB4A 1PF7E 4CMKA 1KZ9A 4RBNA 5CA1A 1NG9A 1QO9A 4C1NA 4FEYA 1HRKA 1FFXA 1GNQA 1RKUA 2OZEA 3MERA 3P2YA 5H82A 2XCUA 1RRMA 4FD2A 4YREA 4MV5A 4ZAZA 1E5QA 3ADCA 3F78A 1N7IA 3VOAA 5DYIA 5J5VA 2FVYA 3ME5A 2PV0A 1QP7A 4KRYA 3RO7A 2WJPA 2Q3MA 1B6RA 1DHTA 1L7XA 3AXSA 4GVPA 1ADJA 4S1VA 4WAUA 3L6UA 1XZPA 4Y7DA 2A57A 5ILGA 2ZM6B 1WU8A 2GWRA 4QOGA 1XMJA 2AZDA 4MVJE 4COOA 1AA9A 2QZSA 1OOEA 1TXGA 2P30A 5BWNA 3PC6A 4ONEA 4OQYA 4LE2A 4R7TA 2PQ6A 3BE8A 4V2IA 3T8YA 3VNAA 4EF5A 4EF6A 5I5EA 4J16C 1NBAA 1K5HA 1NQOA 1VDZA 2PKXA 1SPXA 5CJPA 3IO3A 1I2DA 1O94C 3U4QA 4L27A 1TRKA 4N76A 5GGYA 4JI0B 3PLNA 2DFDA 1D03A 1IE3A 1S8NA 3CG0A 5EEHA 4OLFA 1VPEA 1Z6AA 4DLSA 3QBVA 4OFBA 5ALIA 4I9UA 3W9YA 1F4VA 4KMMA 4QNRA 1PR0A 2V5UA 1Y1KE 1YA4A 5DM0A 4F4IA 2B1IA 2Q3FA 3BDIA 3FLEA 3EAGA 1KQNA 4ZYLA 1CUXA 4DT1B 1LFDB 1ETHA 3IQWA 4ZJUA 4RXTA 1VRCA 5A03A 3RVQA 3ZHSA 2WPDD 5FFMA 4V24A 5GM2A 2BD0A 2FTKE 2ZEJA 5LMCA 2DRIA 2CCKA 2R62A 1UC4B 4MUEA 3I76A 4PN3A 4Z6KA 1NHWA 2BSXA 4B5LA 4K40A 3PJRA 4L51A 2IU3A 3CX8A 1IZ7A 3ANYB 4GBMA 3MLBA 4M83A 4HVCA 3SSNA 1H0HA 1ONPA 5J9FA 2RKWA 4GLBA 4MPPA 4UHKA 3SEFA 3BJRA 1HORA 2O2HA 3JVDA 1XN4A 2KM1A 1ND5A 3DQZA 1R0RE 4PPNA 1RW4A 2DFNA 3OZDA 4LJAA 2QL9A 1QIGA 3E3AA 1NRWA 4EW3A 4R0MA 1TJ3A 3GFPA 3QKSB 3A9SA 2PWAA 1IEQA 4UATA 5IARA 2P5TB 3DBLA 3KYDB 4IUDS 4PONA 4WOJA 5DBEX 3NTQA 3UT6A 4UTNA 4EYQA 1MF7A 5FPYA 3S2FA 5IM4A 5DCLA 2IPAB 4RVGA 4D9MA 1U2GC 4YMTA 5JAUA 2YXBA 4Z0PA 3IAFA 3BL6A 3C5HA 2IYVA 4WEOA 4IZ6A 3FWNA 5CFOA 1E2QA 1ZNZA 2QW0X 4FZRA 1FZTA 2NV2B 5AW7A 4EUSA 1T9HA 5FCDA 3FE2A 2V4MA 4M0KA 1R9NA 3U31A 2GESA 1XZDA 3P52A 5K6RA 4RFSA 3GHHA 2HPVA 4LMBA 1X0XA 3EXEB 1WSDA 3R4VA 1QOPB 1TLTA 3BEDA 1MOQA 2CXRA 3V4SA 3PXBA 4MS1A 5D6OA 3BX1A 5EPOA 3TQIA 1WNTA 2V97A 1Q77A 1NBMD 1RXEA 1FFDA 3DDHA 4JLWA 5EJIA 2WSMA 3WIEA 2R5NA 1ZN7A 1E1QD 2PL9A 4IWNA 3PPVA 5F1PA 2EX4A 2CV2A 3GAZA 1T9GS 2QT0A 1MC4A 1MA3A 1XDGA 3BF8A 4IJVA 2EKDA 4OK6A 1IPEA 1U0SY 4OP2A 5KDLA 5LA6F 4UHBA 5CFZA 1RPZA 4LV5B 4EOGA 3T7EA 2OBFA 3I62A 5J2UF 4AT1A 2RHTA 2CD7A 4OFXA 3FMIA 3I9JA 4Z1MA 4JJIA 1HA3A 1LW7A 3JATB 1BGVA 3F47A 4EEKA 4Q05A 2VWGA 5D8DA 4GX5A 3PCTA 3G8YA 3TR0A 5HSGA 3FFXA 1U2RA 1TQDA 4D44A 2Q62A 3PGKA 3EXHC 4H7DA 1GR0A 3VR5H 2PBLA 3LUKA 2AI3A 3L4JA 5KYXB 1FEZA 2H8KA 3LCMA 3IVGA 4MWOA 5EXEA 5FLYA 3FOZA 1TCBA 2OHGA 3RHZA 3Q7TA 4P7BA 5ADHA 4YAJA 1VYUA 2SNIE 1MEEA 2ZWMA 5JO0A 1PG0A 2IYRA 3PKZA 5FWYA 5JY1A 3U2QA 1O8CA 2IYAA 4JLDA 1PJZA 2IOFK 4BO7A 4JWKA 1UJCA 1V4BA 4MKXA 4ROTA 3RQSA 4DJDC 4DRXA 5EKUA 2J31A 3OJLA 3EDRA 1R5JA 3O2JA 2DWPA 3EG9A 4A2WA 5CNJA 2XYQA 5BVHA 3ND8A 1GGKA 2J8ZA 3J7TA 3KKLA 4ARZB 4MGZR 1Q2UA 4OQNA 3L4SO 6LDHA 3M5PA 4B3HA 2GFHA 2QM7A 1SKQA 4FILA 4OI4A 1L5YA 3X1XA 5IF9A 3D43A 2O1XA 4BDSA 4ZJZA 1AK9A 1TRHA 5LD2B 4CTMA 1EFDN 1FYFA 1MHPA 4QD3A 2XUQA 3CLUC 5SV2A 4F2WA 4JD5A 3DPUA 3BK7A 3M3HA 1Y33E 4MS3A 4O0MA 3RIMA 5DHAA 4K2HA 4TWAA 1AA6A 2B34A 2P9ZA 3DAOA 3OEWA 4LDRA 2AOUB 3OJWA 4LXQA 3PV0A 2FPPA 4JBYA 4EI9A 1F6WA 1KI2A 1TT5A 4N3NA 1QCDA 3ROXA 4E3ZA 3FTDA 3F71A 1BHQ1 3B82A 4L2IA 4ZU3A 7GPBA 5T41A 5E3HA 4D4IA 2K7FA 1CE8A 1RMTA 3NLLA 1ZA1A 4NE7A 4J8PA 3RK4A 2HEIA 3ZE1B 5KSYA 1DELA 2JK1A 3SNKA 1AZLA 4FZVA 4UMVA 2VH1A 3UK7A 5FAXA 1F8GA 2C5LA 1FP6A 3IT2A 1BKSB 2NQ8A 1DWPA 5LIPA 3VKHA 2I03A 5DW3A 2PPLA 1ZOPA 1DFIA 2Y6UA 3GUYA 1ND6A 4N0MA 4ZVMA 3VH2A 2H31A 4AZ3B 3MCTA 1Z12A 1R4NA 1WHTB 2HK8A 2N75A 1NG1A 3PFWO 4GC5A 4BX3A 3IR7A 2HYIC 1SZCA 3H1TA 3VZSA 2QJWA 4XDZA 5DXAA 4C9BA 3BB3A 3K1YA 1XRLA 3H5NA 2PQMA 1JKXA 2IQ5A 4NG5A 3S3TA 4J3JA 3MINA 5HNKA 5BVGA 3H2HA 5DGCA 1C9KA 1D6MA 1XE3A 2D00A 3PQ6A 4GYKA 3W8FA 2P2GA 2JRCA 4TMXA 5LB2A 2R65A 1L4NA 1JKJB 2HKIA 5IH3A 5E9JA 2BONA 2ZOSA 3PHIA 2J09A 2PZMA 3T6KA 2FUG1 2JAPA 4MUGA 5LZ8A 1V5EA 2C2GA 3DE7X 3G88A 3H0KA 2C57A 3ENNA 2CSUA 1GU1A 1JAHA 5FTNA 3LYUA 1ZHOA 4HKTA 3VH1A 4IZIA 5GP1A 1GAXA 1Y5LA 2XZDA 3HLKA 1XNHA 3K0FB 1EE2A 3A1CA 1ORWA 3HLTA 3VSEA 1QRDA 2CLMB 4H3KB 5LMUB 2L82A 1VLHA 2V6GA 2VNIA 1PJAA 2XYGA 2PUVA 4F04A 1RMQA 1CIJA 1U4OA 1VIYA 2HK9A 4NZZA 2O3SA 1CEYA 3K09A 4UUQA 1XJCA 1VKZA 1KQPA 4XZ3A 1XZ8A 1I4DD 2VF5X 5CAEA 2CVHA 2P9TA 4LCBA 2KLHA 3AKEA 1XAIA 2IXDA 4XCVA 1MNAA 1T9KA 3VX4A 4F85A 4ZIRA 4ID3A 4YHBA 1FNBA 2R0QC 4KN8A 1B41A 1R37A 3B70A 4NICA 3WGZA 2PZAA 1ITZA 2I7XA 3DBIA 4Y3UA 2ST1A 4G0UA 4V1CB 4EJSA 3WJ1A 4UQLA 3IAXA 3L9XA 3ZGXA 1JZSA 1A96A 1F1JA 1P6QA 2OG1A 3PEUA 3DLCA 2XJ9A 1GILA 2DLNA 2EJWA 2YFHA 3CRZA 4LV8B 3VC1A 3AUSA 3R5HA 4JYBA 1L5QA 2EJTA 2GLUA 3NBZC 1YDWA 3H9GA 3U62A 3ZKAA 5M34A 3DJYA 4BX2A 4Y1EA 4BASA 2FGJA 4MEAA 2WMNB 3NWJA 3OZCA 4PLCA 1N8KA 5L3VA 5DN9A 2HUNA 5FPHA 4IJQA 3E9CA 4FZJA 5L3ZA 4RS4A 3H0EA 4JYZA 4C7MA 2GYUA 1NXXA 2AFVA 2C1EA 2I4MA 2P6OA 3T9EA 4AYWA 4L8LA 2C3UA 2AVNA 1MV8A 2GK3A 3C98A 4M8IA 2C9ZA 3EDYA 1Q5PA 4AF8A 4IFIA 4K9RA 4KSYA 1SQFA 3BK1A 4QGSA 3DXZA 4IMRA 5B57C 2OBBA 1KEKA 2J7PA 3FYUC 2I2DA 3ICPA 3C70A 3JYQA 5L3RA 3TB6A 1EAYA 2BMDA 1FUKA 1GT6A 2QLJA 2V4ZA 4HMPA 5EJGA 4DBLE 4F6RA 3L43A 4ZV4A 3OC6A 1Q22A 5AR1A 3PNLA 3I37X 1FXWF 1KMIY 2HRCA 4X20B 4XXHA 1B15A 3STTA 1RQ7A 4CLEA 5FA5A 5B6IA 5KINB 1RCFA 1NVTA 4FMBB 1ZJ5A 2RH5A 1CP3A 4MP6A 4QXRA 3T12A 5J23A 3DCNA 1ZD1A 3OKCA 4TT3A 1P0IA 1KK2A 1W44A 4H27A 5AHKA 3T4UA 5FA8A 1X38A 3PR3A 1ULAA 3TBFA 3ZN2A 2QVBA 2GZHA 2RSLA 1WETA 3FHTA 4OI1A 4DQ0A 3GD7A 1IL0A 3B7WA 4YWJA 3TNLA 5JHHB 3QNMA 1P81A 2RGGA 2NUTA 2HADA 3UK0A 1SXQA 1XA0A 3QA3E 4RZ3A 3MELA 5EJ2A 4HQKA 1LC3A 1YDGA 2AEEA 4KFRA 3PDUA 4BE9A 1UJNA 3IUJA 3FPGA 1PX2A 2Q9AA 4TYQA 2F8MA 2PXXA 4M7OA 3GRVA 5BSFA 2ZJ3A 3HA7A 4Z1MD 3C16C 3H5LA 1KAMA 3OX1A 5JXGA 4HWKA 3PEVA 3UAOA 1AJEA 3CKLA 2ACKA 3E61A 1M7BA 3BKXA 3Q1KA 2AUTA 3T9CA 4AP9A 4D82A 2ZB3A 4PICA 3B78A 2Y27A 1R8JA 2W93A 1EFPA 3JWHA 3OTQA 4UU7A 1W5EA 3OPVA 5JH7A 3TNYA 4IGEA 1E7RA 1SUBA 3SC6A 3HJRA 1I3OA 1GNSA 3LXUX 4KVAA 3VC7A 3HB7A 4X61A 1ISGA 5KWVA 2VS1A 3QXJA 3VMFA 3A3YA 3EAFA 5CA1F 2OTCA 1KJYA 3QYPA 3ZLBA 1NLZA 3OLVA 2ZJ0A 3SYRA 2Q5FA 1PVOA 5JSYA 1CIVA 2Q46A 1EI9A 1JX6A 3KLPX 2FQ1A 4MRPA 3D3KA 4FE3A 3OUUA 4BLVA 2Q3LA 3RS7A 2QJRA 3PNMA 3LS2A 5C37A 4HN2A 4KO4S 4GL4A 3ZTYA 4CF4A 2KB0A 2FSVA 1ZCJA 5JZBA 4G9GA 4FNMA 5TRTA 5KSZA 3LLSA 3M89A 2FW8A 3V1YA 4D92A 5COBA 1ZKDA 1I4LD 5ITVA 4CU2A 1Y4AE 3GAFA 1EUQA 2PD4A 4P3KA 1O0SA 2WPDA 3VU9B 3GLVA 3AV3A 1JDZA 2H2DA 5DWQA 3BFJA 3NHLA 2QLBA 5L51A 3AQIA 1YULA 4AM8A 4WJLA 4H7IA 2VJBA 1DAGA 5BV8A 3A05A 2DX7A 2CNNA 1D7AA 4OL9A 2JCBA 2BVNA 4CT5A 5BN1A 5BNIA 2O7RA 2DBYA 2HLPA 4YYEA 4W9NA 3HZRA 4FCWA 3RS9A 3IAM6 3I8SA 4Z2AA 4GM0A 2B4AA 2Z08A 1I7LA 3ER9A 3F9RA 1GZHB 1MN6A 1DWOA 1GKYA 1SXJD 2QTWB 5TVKA 1FTYA 4K9DA 3A6ZA 4PZPA 2WIGA 4OBEA 2ZWVA 4WVLA 3X1YA 4BMVA 3O7WA 3IA7A 4LQLA 3HV0A 5JSKA 3GLFB 1VGVA 3BORA 4M89A 3HMKA 4WOPA 2AR0A 3JWEA 3E5HA 5DB4A 5FADA 4WBNB 3MWLA 3QXSA 5IJZA 3BRWA 4ZYTA 1KWGA 2D0PB 2PGLA 4R05A 1GTZA 9ATCA 3BT7A 4G0XA 3DEIA 1C7JA 2L2QA 1TK3A 3ABOB 3QLUC 3EQZA 1XRSB 1JXQA 3BXGA 1SCBA 1EUDB 4CPDA 1B73A 1LJLA 1SZJG 2BFEB 2WTMA 3GK3A 1WO8A 2Z57A 3I5UA 1FZQA 4KPYA 1QX3A 1T1JA 1Z2EA 2HU2A 2R2GA 4UTZA 4PNPA 4XQEA 1L5LA 1YSCA 2DWOA 2HIAA 3E9DA 1QS0B 5AKKA 3DV9A 3THYA 1LQUA 2Q6OA 4YQYA 2CNKA 5TSDA 2AEFA 2GBIA 4WESA 5I7WA 3KJGA 3OMXA 2GS9A 4LXTA 3GYGA 4RDCA 2JCGA 4EY7A 4C88A 5K0SA 1MZPA 3P9QA 2G6TA 2HA2A 3M4NA 3UAZA 3EUAA 4RY2A 1VLVA 3I12A 3KTOA 2B20A 2QVYX 4PTYA 1O77A 1E9DA 1JXAA 4FMCB 1C9YA 3EWSA 1K27A 4FYPA 2VSFA 3HWRA 3I9V1 2BZ0A 2HAEA 4GZLA 1ORIA 3ABSB 1NUPA 1Z0SA 5JI3E 4WKGA 4C08A 3LNCA 3HZZA 4EAAA 2QMZA 3C1UA 4H6XA 4NBUA 4DF3A 4F4DA 1EXDA 2BFFB 3SIWA 2YC2C 4KIWA 1ZNQO 3SD7A 4DM4A 2QMUA 1MIOA 5A6SB 3LRXA 5FWXA 1KDPA 1INLA 2B1GA 4J1QA 4UEOA 5BP7A 1P3DA 2V0NA 2N46A 1NR1A 2RGXA 1EQUA 3NETA 4WXPA 3MCAA 4QDZA 5AKYA 4NHOA 2WKWA 1ZIYA 2C2MA 4EG1A 3L2OB 4Y0NA 1GO2A 1Y63A 3P9RA 4MWDA 3IS3A 1P5HA 4DMGA 2Q3DA 1AQNA 1DV1A 2ZXUA 5G3YA 4II3A 3UCFA 1V2HE 5A9SA 4HRVA 4PYLA 3O3CA 4Q6BA 3USZA 4EEZA 2AK2A 1W9MA 3DL7A 1YK1A 1J0BA 2WUGA 4LPSA 4N18A 3MBKA 3ZU2A 1Y3AA 5F1OA 4FDMA 1QGUA 1CUGA 1E20A 2Q5OA 3ANTA 4XSHA 3I39X 4WJZA 4NBWA 2XZPA 1QX4A 5BUZA 1MG0A 5H80A 3T7DA 2JD2A 3U7GA 1LDBA 1GPDG 3EN0A 1TQ6A 3SSOA 3UXMA 4JC5A 3L05A 5DNDA 4O4JF 4U8GA 5FI5A 3T1HB 4QGHA 1US8A 1G7TA 2YY6A 4U5XA 3CUSA 4B35A 4HB3A 3SYKA 4M0CA 3PGVA 3N2GB 3SFTA 4DADA 5AVZA 1IVNA 1E2DA 1VHJA 1FS5A 1WXQA 5KOYA 5B64A 3QVXA 3OURA 4RXMA 2CLIB 2G17A 1ZIPA 1MPXA 1JQ3A 2XQKA 3ZCVA 2KX7A 3PK0A 1XQ6A 2X6RA 5ESWA 2PA3A 2DHEA 4J16A 4FOPA 5TQ0B 3SHOA 3DFFA 4C6TB 1A4XA 2FPMA 1KDZA 4Q7QA 1NVKA 4DDTA 3EPLA 4FXPA 2OQRA 1Z82A 3B3AA 3I5AA 3QWFA 4H0CA 4MK4A 5LQSA 4YCNA 1DO8A 1BHSA 1XPRA 4DUYB 1CRZA 1F6BA 3EC1A 3FTNA 4BDTA 3NGLA 2CL6X 3SHTA 1MX3A 1Z4OA 4NZPA 3FRHA 2QR3A 4WZBB 3RAJA 2E4VA 1AY0A 2BR4A 5GONF 2RHJA 4ESHA 1L4YA 4A8TA 1PV2A 5FO1A 4KXFB 3CXRA 4ZZ3A 1KMQA 1M2WA 1VJGA 3L0CA 4NDAA 1RPTA 2J9XB 3NOOA 5E38A 5M3BA 3NNNA 4MGEA 5AOVA 1RAFA 3TZEA 1M33A 2FRDC 2IV7A 2Q9UA 3NIBA 2UUCB 2XQJA 1IH8A 4JJKA 4F5EA 4XWKA 3TTYA 3FZNA 2UVQA 3HABA 4UOEA 2PX2A 2ZLBA 2RGNA 4WIAA 4B44A 2FHPA 3KAQA 5ITZA 1OAKA 2P6RA 1OHHA 2XCOA 3OA0A 5TLSA 4KACA 1KP3A 1DC8A 2FPGB 1ZD2P 1QQTA 3GJSA 3JQAB 4XUEA 1AKYA 2ASEA 3UWOA 3WVNA 3GJQA 3A1DA 3OHSX 4OB7A 1ZK2A 4QTYA 2PUEA 2FLWA 3K9LA 3PP8A 1W6UA 2FEKA 2ODBA 2OLKA 3GU3A 1I6KA 3PLRA 3LXXA 3SBDA 3LHDA 5IH7A 4I55B 3C0KA 3HN6A 4LMPA 4NCNA 5C4MA 3L0PA 1Y8AA 5ICSA 1JB9A 4FYYA 5K3BA 2CXQA 3WDSA 1JVNA 3C24A 4NAHA 2XKKA 2NV6A 1T2FA 3GD5A 4LJYA 1OQAA 3TD6A 4AXBA 4IY1A 4NLLA 4PBRA 3H0CA 3E35A 4Z99A 1JSCA 3ZWWA 1SY7A 3MB8A 3WG9A 1GSHA 2DB3A 3NEYA 3B36A 5FUYA 2H3EA 2Z3ZA 4RD3A 4IRXA 4PEVA 4UQPA 3TG8A 3CR3C 1PSZA 4HNGA 4W7HA 5BYKA 1YHZA 3AT1A 3WFJA 5DHSA 4FW9A 4N12A 1ZHFA 4N65A 3HMQA 2WSBA 4GXRA 4PZCA 4S1OA 4Z9XA 3STHA 3R5JA 3C3BA 2DJIA 4WPGA 1ZI6A 1SXGA 2FA9A 4P1ZA 3UAVA 1LA2A 3C1OA 1SXJC 3ZQJA 1XVAA 1CZNA 3SPXA 3UV7A 1VG8A 1R12A 4MUFA 3NTLA 5SYAA 3W5DA 2ZYSA 1NQ5A 4DR6B 4ZT4A 3PKJA 1C7IA 3MWFA 4R98A 2BM8A 5BORA 5IT0A 4V0OA 2A35A 2IY8A 2Y0PA 4MB2A 2PKQO 4KSCA 4BV2A 4OH7A 1OGIA 2DPYA 1E8MA 3OZIA 4NBLA 4DCNA 1DL5A 1B2LA 2GBGA 3L8MA 4FKMA 2C7VA 3JARB 3T1NA 5HWSA 1T5DX 4WE3A 2QROA 1N1EA 5BW5A 1V6CA 1EE1A 1RPJA 1XA3A 2F1RA 4IM7A 2GJKA 4CE6A 4ECEA 1UIMA 1SBZA 3R3ZA 1R4ZA 5DX1A 3R0IA 5I48A 4MR9B 1BXKA 2NP7A 1SXJA 3FJOA 3LRTA 4H7EA 1FYDA 2VDVE 1E9FA 4XCXA 2IYWA 3A1FA 3MJDA 3QITA 3W06A 3QXGA 1G5HA 1QQ6A 2MINA 2O0MA 1PT9A 3SR0A 2OAQ1 4YV7A 1XDDA 1I7QB 4CLHA 1MRZA 3C7DB 4PHTA 1YS7A 4U8HA 4Q4AB 1E3QA 4KITB 1AX9A 2YWXA 3GJZA 1SBHA 4ZVSA 4Y1FA 3USCS 2LCFA 3MRVA 4ZAGA 4G97A 5GTDA 2O2XA 2AZXA 2ZM5A 1XCOA 3NXKA 4MJLA 5GOTA 1G19A 2QHXA 3NNDA 3PFHA 3ZR4B 3RVJA 4GT1A 2A1TS 5B3AA 2B5VA 3TOSA 5CMLA 3T4XA 3QUQA 3W7VA 4CR8A 4OHFA 1U98A 4XWYA 5HBRA 2IUFA 4R3UC 1GARA 1YBMA 1VIDA 2JEYA 2OP1A 2P5SA 1L7MA 2QLFA 3P2KA 1S89A 4M53A 5B1DA 4HV4A 1GRQA 1QIEA 4EB6A 1HG0A 3R6GA 3ZE6A 4O1HA 3VKGA 4IDPA 2YVUA 3WK8A 5FWDA 5ALDA 4BS9A 1IEVA 3DGFC 1CUDA 3ZVNA 1JU4A 3M1YA 2XRZA 2GCNA 1JHAA 3KYCA 2VXYA 5BNFA 3GX1A 4Y2RA 2UYOA 1KC3A 1PGNA 1Y8ZA 2A5GA 3D6VA 3I04M 2QQFA 2AE2A 4HN4B 4WCFA 2Q8QA 3M5DA 3GAAA 2Y92A 4P84A 1IOZA 4B4KA 2C04A 4N6OA 4MW0A 5F35A 5F76A 2VYCA 5HK8A 4B2PA 1CQIA 2M9MA 3IH5A 2EHJA 3WIVA 5DISB 3HXMA 1JHVA 3DTVA 4W8HA 5EZ5A 2AEJA 3B8EA 3UJHA 1F06A 1ZNWA 1AT1A 1F17A 2V65A 1GU0A 4DEYA 3TVTA 4EHKA 4EFLA 1XCGB 3ZJUA 2F3RA 3UWPA 2FR8A 3SJUA 1KI6A 2R6DA 4JR2A 1P5JA 2HD4A 4PFQA 4O4HF 5CM8B 5IVIA 4IFBA 2XTNA 3KXLA 5CH5A 3KPUA 4DTIA 3PFGA 1FU4A 3EVEA 1N5OX 1HK7A 3NGMA 4ALNA 4PYRA 5J2TB 2P40A 1L4BA 1V7QA 2YBEA 4YMHA 4IFEA 5EIOA 1C0LA 1ZBDA 4I55F 3T3NA 4RD0A 3H5TA 1CNFA 4NWIA 1WM1A 4YCJA 3CVXA 3HEBA 2AXPA 3WL4A 2PO5A 1WXEA 2QVXX 1M83A 1WXIA 3MHPA 3QU7A 1U94A 4X00A 5JBQA 1J8DA 1MT3A 3PIIA 3THXB 3VNRA 1JMKC 1KYWA 2JFBA 4KXUA 4CMIB 4GZ6A 3TS1A 1QH9A 1N7GA 5BVGB 4R0VA 1O94A 3A2KA 2F9MA 2Z5LA 3AHCA 1GA6A 1K3FA 2FOXA 4QSMA 1C8KA 4ZPXA 4DMFA 1QGZA 1U7DA 3VM6A 1EFVA 5F3RA 3ACDA 1HC7A 4HN9A 1ZQ1A 5JTUA 1PBTA 5IZCA 1OWNA 4LRTB 3P9XA 4WFQA 2RKOA 4RVOA 2IKQA 3R44A 2WRZA 2B6NA 3M9WA 5EFZA 1FJHA 2ZTLA 1U5BA