4DLRA

H-ras peg 400/ca(oac)2, ordered off
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlrA00
1NP6A 4HAZA 3NC1C 1P62B 2IEYA 3VR5A 3A6PC 2V9PA 4HUQA 1T0JB 2OBMA 2QG6A 2WHXA 1XTIA 3K9NA 3RRYA 4OHZA 3PUXA 3QF4B 3AM1A 1E2DA 2WWIA 1N5LA 5EXXA 1E9EA 2XZLA 1DAMA 1TADA 5CITA 4G5SA 1G8HA 2GDJA 4L5BA 2FSGA 3BC1A 2BDTA 1Q20A 1IOZA 3GLGA 1AM4D 1D2EA 4M22A 4OQFA 3VR3A 2DWPA 2NPIA 4R98A 1E9BA 2B8TA 2OLJA 2D4HA 5E7IA 2ZUBA 2FA9A 2DCUA 2QMOA 3AP3A 621PA 1QVRA 1SKQA 2IC5A 2REOA 4EFMA 2PJZA 2WMOB 1XPRA 2C9YA 4MKFA 2ZRNA 4DBLC 3EPLA 5DIFA 4AURA 3BORA 2YNMA 1KK2A 5HPYB 4ASUA 3HR7A 1NSTA 3BH7A 4DB2A 2ZRDA 4BLSA 1G7RA 3IKJA 4MITA 3CNNA 3FHOA 2BMFA 1XZQA 1HT2E 2C03A 4OK5A 4RKEA 2FPLA 4OHVA 1W4RA 1E1RD 2A5GA 3C14C 1W36D 1P2VA 2ZVPX 2V8OA 4MRNA 5C2JB 1X3SA 3KL4A 5JSZB 4FMCB 1EWRA 2QORA 3KTAB 3GLGE 3EC2A 3M1IA 1YVDA 3AVYA 2C2HA 4FMDB 4JJKA 2FFQA 4TL8A 1IAQA 2Q6TA 2O0JA 3MUFA 1XCGB 4AI6A 4BGDA 2RGAA 4RFVA 2P6UA 2OV2A 2VBCA 1BS1A 3Q7QA 3QF4A 2WTUA 2F43A 1G5TA 2HDNB 1Q1BA 1YR8A 2VP9A 1OIXA 4MGYR 3WYGA 1AGPA 4A0HA 2REXB 3AVXA 2B7CA 4M1SA 4C7OB 2GXAA 2YWFA 4CF7A 4Q03A 2IYYA 5IK2A 2ZRGA 2G0NA 3UMFA 4EPYA 3NKVA 3W6PA 4O2LA 2XJ4A 1VKJA 1U9IC 1TPZA 3T1TA 4IEEA 4DSNA 3AVVA 2CMKA 3K0CA 1MO6A 5TY0A 2N42A 3GJ0A 5B30A 5FUXA 4BPBA 4TLDA 1KAGA 5ELXA 5CK4A 1S9HA 5FOXA 2ZJ2A 4OHXA 4UXIA 1K5DA 3WMEA 4ZI3A 1MO4A 4KFTA 4HAXA 1RRPA 1VCNA 2Q9BA 2ZS9A 1ELOA 3T15A 1SHZA 1KDOA 2G77B 1KO5A 4RZ2A 3T61A 1KI6B 1QG4A 4BRUA 5J4YA 2HYIC 3X2SA 3DOFA 2ATVA 3BAFA 3BWDD 1FFHA 1YKSA 2RCNA 4DB4A 4WZAE 3B1VA 3IIMA 3T06B 1LB1B 5JSZA 2MSEB 1JAIA 1II0A 4QBFA 4PFSA 3D3QA 1JJVA 1G21E 3IUYA 4LHVA 3B7GA 1UJ2A 3ZVMA 4HLQB 4X8OA 4R71A 3OIVA 4C0KA 1XEWX 4I1UA 5TDHA 1FTSA 1RE0A 4JSYA 2QSZA 5KYKA 1W44A 4MKIA 4C0LA 2IUTA 4QBGB 5J5CA 1I4DD 2Q9CA 821PA 1GNRA 2ZU0C 1OW3B 2EWVA 3RRNA 2PJRA 2UZ3A 2YC4C 4BFVA 1SVIA 2JLQA 4XOIA 5FBWB 3W5JA 1AZSC 1G20E 4UNNA 1Z6TA 2JIZA 1XD8A 2ORWA 4EPVA 1S8FA 3UKDA 4C3ZA 1E1QA 4AK9A 4D4JA 1M8PA 2BMJA 2CXXA 1R0YA 2OZEA 4UNPA 4NPHA 2XZPA 1X8KA 2ZTSA 3ASYA 2OXRA 1S1MA 3P4XA 2D3WA 3LXXA 4F7WA 4G01B 1GRRA 2QTHA 2ZRIA 4OI1A 5JZVA 4A8JB 1OXXK 5IT5A 3U7FB 2ODNA 1UFQA 1T6NA 3FDIA 4LJ7A 4LPSA 721PA 4G0NA 1HV8A 5K8LA 2Z6VA 4OQXA 1A1VA 4TL7A 2FJUA 4GBMA 1KAOA 4F93B 1R0WA 4KSBA 2PH1A 3AVQA 1E0AA 2AKAB 1KMQA 5AJXA 4BFSA 3WMFA 3K9GA 1BKDR 3SBDA 1CR1A 3LWNA 4HDOB 4A9AA 2IX3A 1OV4A 4B3CA 1UKYA 1OXVA 1E0JA 4IKEA 3H2YA 2QMHA 3NTUA 4BFUA 1NN1A 2O8BB 2QMEA 4IOLA 3TW4A 4V0NA 1DBSA 4AG6A 4D0NA 1T3SA 3TLXA 2ONKA 2ZQ5A 2FV8A 2XSZA 4TTQA 5G3ZA 3MWYW 3IHLA 2VP6A 2HJVA 2ZJ5A 2ZETA 3MG9A 1KO7A 1ZRHA 3A1SA 5JI3E 2NO6A 5KOYA 3DMDA 2ZRHA 1LW7A 1JQLB 4GZLA 4QM7A 4AY2A 1II8B 3KKQA 1E98A 1VG8A 1OH5A 1S0UA 2WWXA 2CL7X 3B5JA 3CO5A 1RZ3A 1FP7A 5JWOA 1N6IA 1QBKC 2I1VB 3TSWA 1F6BA 5JI2E 2CHQA 5IK2D 1GG2A 2BWJA 1II9A 4B76A 4URVR 2D62A 1CBUA 2H8KA 3A1UA 3RABA 4PC1A 2V55B 3LBHA 4RKFA 1BOFA 4A8JA 1ZM4A 2FF7A 3SYNA 4BQSA 3FMOB 1ZAKA 2C9CA 4B3DA 4JS0A 1G9XA 521PA 3ZS9A 1FMJA 4ZKDA 1SXJC 4L9SA 1RW4A 1QF9A 2R2AA 4YDHB 1GWNA 2V6IA 4US0R 3FE2A 2FH5B 3ZZUA 1W4CA 4OHYA 3QBVA 5LB2A 1IQPA 1IJFA 4AD8A 3NEJA 3KUCA 1G18A 1VYVA 2HF8A 2Q3FA 4NONA 5KNCA 4ZCMA 2EQBA 3Q7PA 4OL0A 3WRYC 4KITB 1T4GA 1FNMA 1R5OA 1T5LA 2OG2A 4JT2A 2F6RA 5HR5A 3NBFA 4WA7A 4A82A 3ZZ0A 2O8BA 3LX5A 3AKDA 2VL7A 1VHLA 1KI3A 2ANCA 1NIJA 4LY6A 3K0AB 3CRMA 4IDPA 1LNZA 4DIDA 1MO5A 2ZREA 2MSDB 1X1RA 2N1BA 1AKYA 3WNDA 3A1VA 2X8AA 1E9RA 5EXTA 4A92A 3U3KA 1E9DA 4WZ6A 2FZ4A 4LHYA 1I4TD 1II8A 2V7QA 4IDQA 4C0JA 4HZIA 4DIEA 4MRSA 4TL6A 2C8VA 2QRZA 1CTQA 4FMCF 2IXFA 1EWQA 2IYZA 3VMFA 5CLLA 1HY3A 5EJEA 1WE2A 1YZKA 3JVUA 2W2TA 4KLNA 4CVNA 2ZSBA 1ZINA 4FCTA 4FMDF 2RAPA 3REFA 2JIZD 1U98A 3A37A 3CRVA 4MUBA 4A6PA 3CX8A 2XEXA 1PVOA 2IYSA 1NG1A 4HB2A 2AN9A 4ZO4A 1XTKA 3ICQB 1E1QD 2GHIA 2ZRKA 3U61B 4AKHA 1GVNB 2ZE6A 4C0QC 3IEUA 3LW7A 3TNFA 1IXSB 1N6LA 3G82C 1P9WA 3SS8A 4PAOA 4NU0A 1S96A 1T8TA 2GK7A 5JFGA 1FX0B 2Q21A 1UBCA 1T3HA 2B6HA 4Q9IA 3UATA 4Z1MA 1NNEA 2B7BA 4US2R 2GJSA 1OE0A 4NCHA 4J0QA 4OK3A 2HLDD 1P73A 4E22A 1NSFA 6Q21A 2QZ4A 4NYMR 2FSHA 2WKPA 2I4IA 3KUDA 3H0KA 4MYHA 1ZCAA 5KPJA 5FPTA 3AP2A 1W47A 4LBYA 4DSOA 1TQ2A 1UM8A 4FD2A 2CE2X 4KV9A 4JVMA 5JHGB 2QAGA 4KYIB 2DFTA 3AV0B 4YMWA 4Q66C 3IGFA 4PSVA 5H70A 1MRSA 2GCPA 3K0AA 1KJWA 1OHHA 4Q19A 1Q44A 2H57A 2OAP1 2W6JA 4CT5A 5CJPA 2BMDA 3ND9A 2VA8A 1NG9A 1KNQA 3H1TA 2CVFA 2P65A 1KZGB 3OFNA 221PA 2ZAMA 2WBLC 4KFRA 4TMVA 1J8MF 2X77A 2GA8A 2XSZD 3CWQA 3RS4A 1KK3A 1M74A 1ZM3A 4IFEA 1FQJA 2NTYC 1CJVC 2ZVQX 4QJ5A 2Z43A 4JIMA 4AKIA 1OH8A 3FB4A 2OEPA 2DR3A 3SEAA 2W0SA 2ZS7A 3IBYA 4S2EA 1Q1ZA 1S3GA 4Q48A 4TN1A 3I8SA 5DNYB 1ZD1A 3O8RA 2O0HA 1T91A 1NIPA 2XOKA 5DISB 4NP6A 3IIKA 1Z07A 3LA6A 4IXNA 4BLOA 2F1HA 4MH0R 3AKCA 4A0GA 2GCOB 1FX0A 1DAKA 1GIAA 1X8JA 1RYFA 4Q18A 1L4YA 5DN6A 3KXKA 1Q12A 5J4VA 2GVZC 2J1LA 3SI7A 3FPAA 5CDFE 1DAHA 1IHUA 3I3SR 1DG1G 2R6FA 2XTNA 1ZC3A 4QHSA 4BECA 4NHOA 5GJWC 2CLCX 3Q5EA 2XNDA 2J0QA 4CDGA 3HJNA 2JDIA 4AYXA 3OE7A 2C9OA 4JLDA 4PQRA 5JBQA 1W5SA 1VHTA 1R2QA 4DJTA 2W00A 1OH6A 3HR8A 1W2GA 4EUNA 2J0SA 3MJHA 2H16A 1CJKC 1OKKA 5AJVB 1ETUA 2CBZA 4XJXA 1P4SA 3KKMA 3QF7A 1QHHB 1N6RA 1OXTA 4RD6A 4Q7MB 1V43A 3AUXA 3Q9LA 4B74A 1JXOA 3LV8A 5J4LA 2A9KA 1OXUA 3I72A 4NKRA 1W48A 1N0WA 3CW2A 4PZYA 4HSEA 1DVRA 1KJYA 1KY2A 4LJ6A 4RZUA 4F4JA 3A4NA 5KTYA 2LWIA 2V7QD 4OBEA 4POAA 2IYWA 3ETLA 4KFUA 4B32A 2HCJB 3CX6A 3RVBA 3TBKA 4E5UA 3GLHA 2RH5A 1JJ7A 3TR5A 1N5JA 4ZDJA 1YHNA 2FSFA 5JJIA 1ESMA 4M21A 3A4LA 5FL7A 2MMGA 2GCOA 4IDOA 4KBGA 2PX3A 1ZUIA 3KKPA 3L82B 2VF7A 1XJ0A 2EYUA 2HCBA 2W2VA 2XB4A 1JB1A 2E1RA 4LWZA 3DKVA 4BLQA 1FOEB 1WRBA 1TUEA 5LB4A 4Z1MD 5EZ5A 3SC3A 1HT1E 2GESA 3Q5DA 1D2NA 1IN5A 4TL9A 4MYUA 3PQCA 2V1UA 1O87A 2OUKA 1GSIA 2ASEA 4JKIA 2YC2C 3C15C 4NCNA 4OHWA 1DELA 4X8LA 1Y63A 4U00A 2J5XA 1LS1A 3U3JA 3VFDA 3GLHE 1G4AE 3I8XA 3L2OB 3L43A 1S1CA 2JLYA 1Z2AA 5DGXA 2ODEA 1OHHD 1GZSA 4TMZA 1NF3A 4KLZA 3ZQJA 1NJFA 1G5RA 4LV8B 2W6JD 4JLAA 2OFWA 2RB4A 1DS6A 3LO5A 4IXMA 3KFVA 3KXIA 2QGZA 2PX0A 4TT3A 3OFND 2AXNA 3L0OA 2F7SA 3EX7C 3WNBA 4YC7A 4ESVA 1CRQA 1KZ7B 1ZD8A 4PANA 1G7TA 5C18A 3UMRA 1OFTA 3N5CA 4LPKA 1IM2A 4W5JA 5AJWA 4BE7B 1IN6A 3ZYCA 5FBRB 2G6BA 4ZDKA 1M7GA 3OEHA 4Q7KA 4JSTA 1TUIA 4ESHA 2QTVB 2RHDA 3OHMA 1G8PA 2QM8A 2VSFA 2MMCA 4NYIQ 2QPAA 2NG1A 3VX4A 2VIIA 5AUPB 3CNOA 2XOKD 1XB2A 2PCLA 4MYCA 2XTMA 1KO4A 1Z0DA 1DTSA 4Q1FA 5C1BA 5SZIA 1W1WA 1A82A 4HUTA 2FWRA 1SVWA 1Z6XA 3GFOA 5DHFA 3BFVA 1DG3A 1Z0IA 3QBTA 3L8ZA 4ACAA 3I5YA 3C5CA 1PUJA 3T1VA 3DOEA 3BGWA 1ZP6A 4NCJA 3SYLA 1VDZA 4PAMA 1XJCA 3AGPA 1SVOA 2VTKA 4DRZA 2C04A 4PR0A 3LD9A 2IWHA 2XNDD 1S9DA 3R8FA 4HUQB 1DAEA 1E4YA 2JDID 3GFPA 3MCAA 2VYFA 3OE7D 3Q3JB 4MRRA 4D4LA 5FOVA 3RDPA 2O8FA 3WMGA 1PUIA 3TQCA 4DEXA 5F9HA 3THYB 4Q4HB 4XTRA 5CJ2A 1Z06A 2CL6X 2BVNA 3AKEA 1OKKD 5HE9A 3FYHA 3AVWA 5FTMA 3GD7A 4XSGA 4X8MA 2YINC 4A1FA 3L0PA 1B23P 1YR9A 1HUQA 4H1UA 3BH6A 4I4LA 4JBWA 4LYAA 3GP8A 1NBMA 3MMPA 2A7QA 2JLSA 4QNRA 2CVHA 2EFEB 3AF1A 1I4LD 1OB2A 1E4VA 4BFZA 1AA9A 3AQ4A 3SJZA 4DDUA 3K0CC 2ZXUA 3VKWA 3WYAA 3QKRA 2EFCB 1GKUB 1TF5A 3BK7A 4HAUA 5TARA 1KSFX 1GRNA 3K09C 4MKHA 4G5QA 5GJCA 1DAGA 4B73A 2IS1A 4LYJA 3KQUA 4BZXA 3FKQA 3VKHA 2RGDA 3B9PA 1U8AA 5HCNA 2VPPA 1FPMA 4YLGA 1JXMA 3U3RA 4R2HA 5J40A 5KO2A 5FL7D 3SFZA 4NBSA 3LH5A 1JECA 2GF0A 1YQTA 2GJ9A 2IYLD 2VP2A 4IOJA 4MDEA 4Q9HA 4C0BA 3AVTA 3QXXA 1Z6AA 3IDQA 3B1XA 3C4JA 5HZKA 5CK5A 4JLNA 1OF1A 2IF0A 1GDDA 4WW0A 5DYGA 2WJHA 4UJ3A 1NBME 4LGMA 1BYIA 1SVLA 2GZDA 2O0KA 2YWGA 3GLIB 2JAQA 2HUPA 4G5RA 1OYWA 4OK6A 4Q4LA 3VHXA 2GEVA 4RD4A 3ZQ6A 3MWLA 1JPJA 3R8CA 3CF2A 1MV5A 1E2NA 1GNQA 1TQDA 1QHNA 1TNDA 2F43B 4NCIA 3VR6A 1N25A 3THYA 2F9LA 4Q4HA 2XB2A 2EW1A 2R44A 3I61A 4IRUB 4GFDA 1E2FA 1AJEA 3B85A 2HJGA 5EUQB 3GJ3A 4CEIB 2QI9C 1JALA 1HYQA 4JLJA 1G16A 2JA1A 1RRGA 3CZPA 5L3QB 4Y0AA 1Z47A 1OXSC 3MJRA 2BBOA 1JEDA 2BBSA 4TT3D 4O3MA 3U7GA 2R6AA 3CM0A 4FWTA 3EPHA 4LYFA 3TKLA 2C95A 3REGA 2FEOA 4MKGA 5JCPA 2QU8A 3VTKA 2JJ1A 4NYJQ 1JR3A 3HP1A 1IN7A 4TQAA 3BOSA 5AJYA 3QKUA 3WP0A 1E69A 1CXZA 3OEHD 5E95A 2RGXA 4IDHA 4KBFA 4BEJA 2AFIE 1P72A 4QGGA 1KI9A 1W5TA 3TUZC 3EA0A 2R62A 3NIBA 1W0JA 1DPFA 1R5BA 1TMKA 3CX7A 2XGJA 3GJ5A 4DUGA 3A8TA 3B1WA 4LJ9A 3RSOA 3U7HB 1Q21A 3SQXA 2HT1A 1E0SA 1XPUA 2NZ8A 3M0EA 3GLIA 1OFUX 1AQUA 1VIAA 1G41A 2BMEA 2AD5A 2DFKB 4URZR 1XF9A 4LHZA 3M4YA 4EFLA 3O47A 2WWGA 5FTNA 3T5DA 2ZRBA 2GCNA 3K0SA 4GNKA 3ZD7A 2AKYA 4TLAA 5SZKB 4XVQA 2AHOA 4C0AC 3A1TA 2KBEA 2ZSDA 3ADKA 1JR3E 2FOLA 4BZQA 4MDFA 1XBTA 4WVFA 1G8GA 3KB2A 5FR1A 3T12A 1AK2A 4DXAA 4CEIA 3KZ1E 1VYUA 5KHOC 4NL4H 4ZCLA 4DLSA 1WQ1R 2FFBA 4RD0A 4ACBA 4O0MA 5L3QA 3U5ZB 1XDBA 4AWXA 4MA4A 3K09A 3X1XA 3TW8B 3SN6A 3WBKA 2IHBA 3LDAA 5DSZA 4A6XA 1AN0A 4OI0A 4M1TA 1E6CA 3GLIE 4A0FA 2EFHB 2NMVA 1YZTA 1NBMD 3BERA 4GOXA 4URWR 5FTLA 1BO6A 4M53A 3DDCA 3UG6A 3GJ4A 2FPMA 4A8JC 1VCOA 1WBBA 2WWYA 5JHHB 3PUWA 3U3OA 2W0MA 2V54A 1E2IA 4A2WA 1R5NA 1Q22A 3ZIAA 1P61B 3I1FA 4YMUA 3BFKA 1CRPA 1P2SA 1Q1QA 3Q8XB 1QG2A 1VYTA 4A0RA 5KSOA 2A5FA 2WWFA 5KSZA 1G3QA 2OSBA 3NHAA 4MGIR 3T35A 3O8CA 4DLXA 5A5GA 3B1YA 4MGZR 2ZYWX 4BLRA 2E87A 4EAQA 5EE3A 2I3BA 3QPUA 2FGKA 3UWKA 1OFHA 4LV5B 4MYTA 3N2IA 4RSGA 3W9YA 2FX3A 4HB4A 2IEZA 3LBIA 3MWKA 2QA5A 1X6VA 2BEJA 1HQYE 2QNRA 2QRNA 3B78A 4HZUB 3EIQA 4HLUA 4FWIB 2IK8A 4NCKA 4RVCA 3Q72A 2F3TA 4TQ9A 4XSHA 5EE5B 3LY5A 1NMYA 2FEMA 5ANRB 3QXHA 3RYTC 2YKGA 2Q3MA 4WAUA 2ERYA 1NN3A 2ZR7A 2FPKA 1LVGA 3FHTA 1G8YA 3LQQA 3ZZTA 4ZIRA 4Z51A 3GPLA 2JLVA 2QTFA 1KTVA 1Z63A 1CR0A 4YMVA 2VO1A 1XTSA 3TGPA 2NZJA 1N5KA 4HATA 1KJZA 1G291 1UBFA 1GTVA 4DCTA 4EPWA 4NH0A 1TF2A 1RFLA 1U0HC 5D3MA 1N6HA 3QPWA 4F4CA 1DAFA 2OM2A 4EPRA 1YZNA 4ASUD 4QOSA 2A30A 1KI1A 1SZPA 2JJ1D 1GRQA 1YZUA 1JR3D 4ZCIA 1P9RA 2QQEA 3GJXC 1QHYA 5E4FA 3AKYA 4Q5IA 1RYHA 2LKDA 2R9VA 4XWOA 3OEEA 1M7BA 1VCIA 4EQ6A 1EFRA 1ANKA 2G0TA 2GBLA 2ANBA 3B1ZA 5B2ZA 4Q21A 1E2GA 2O8CA 4XTCS 1Q3HA 1JEEA 2YV5A 1NVUQ 2QE7A 2ZJOA 1W0JD 4JJZA 5BYJA 4ZKEA 3CKLA 1GUAA 1J90A 5JMTA 5EUMA 3T1OA 2QMUA 4DUGD 3A36A 3SHFA 1P9NA 1RKBA 2X1VA 1YJ5A 5SZJA 4DCVA 4PC6A 5C4MA 3H84A 3CPJB 2ZSFA 2QAGC 2GVDC 3BJIC 4HZUA 4RD3A 1DARA 5FH9A 1XNJA 5FPKA 2FFHA 4ZPXA 2QM7A 1XMVA 2G1JA 3EC1A 5HCIA 2PZGA 3RS5A 3C41J 3P4YA 3U7EB 1E9FA 1R10A 1G6HA 4LBVA 3EPJA 3NWJA 3TJZA 1NVWQ 1DO2A 1MKYA 3W8RA 2D2EA 3BB3A 2GK6A 2JJ2A 1OYYA 2VEDA 3IQXA 2WZQA 3AF0A 4F91B 3ICEA 3GJ6A 2ZJAA 3MWJA 3FWYA 5JJKA 2BBTA 4U5XA 1F60A 2BM0A 1KI2A 4XD7A 3EA5A 3KJEA 4FI3C 1H8EA 3RRZA 3X1WA 1XZPA 2WSSA 1UAAA 3ZLJA 3PENA 3QXSA 5JEEA 3ND8A 1KI4A 2IXGA 1XMJA 1U0JA 1HA3A 2ZSEA 2WWWA 1Z08A 2P3SA 5L8VA 4JYCA 1E2MA 2IUSA 3W90A 2IYQA 5LDDC 4Q1AA 2CDNA 2A2ZA 1RVDA 2QAGB 3V4RA 2AD1A 2FGJA 3IPXA 4W5WA 4DSUA 3B9QA 2PBRA 5KNBA 1Z0JA 1Z22A 2AFHE 4O25A 4R7ZA 1LF5A 1NL3A 3CB4A 4XVUA 3W3ZB 4RY2A 2NQ2C 2ZE7A 4JL8A 1E94E 2O52A 1RRCA 3QVVA 2Z5FA 1W0KA 1F2TB 1G4UR 1SVSA 3GFTA 4M2LA 1KO8A 2WVJA 3D7MA 1TAGA 5BN3A 2OILA 3ZGXA 1G17A 2DYKA 2REBA 2G83A 5EP3A 4CGZA 4I1SA 2CLDX 4PSAA 3K70B 3AVOA 3T34A 1HEIA 3QVUA 3LLMA 4Q4JB 1GKIA 1TL7C 1SVKA 3RS7A 4V03A 3EPKA 3TAUA 1US8B 1PLKA 5JCZA 1TF7A 3CR8A 1AGRA 2RGGA 5KDLA 4DLTA 4DWJA 1EESA 2YZ2A 1XCPA 3U3MA 2ERXA 2GZAA 3GJ7A 2GXQA 2XNSA 1E79A 4Q02A 5FOWA 2WKQA 1CEEA 1E99A 2CEAA 4QHYA 3NBXX 2V6JA 5AUNB 1QHSA 4UJ5A 3SHWA 3AGQA 5TMPA 2BBWA 2G3YA 5TB5A 1Q0UA 3A58B 2J46A 3CH4B 4XWAA 3THWB 2ZAOA 4I81A 1XRJA 1TEVA 1V5WA 4JLBA 2C98A 4ON9A 3EZ7A 4IVQA 1YU9A 4E09A 2TMKA 3RS0A 1E32A 2W58A 5EP4A 1L4UA 5AK0A 4B44A 3SOPA 3NBZC 4FCVA 5KSYA 1KOFA 2ORIA 2VP5A 2AWNA 2Z4RA 3KKNA 1N6NA 1YR6A 4C0SA 4XIGS 3SE0A 3VR1A 2KSQA 5KUTA 4JL5A 4DC9A 4Q4AB 1NI3A 2J7PA 4C4PA 2P2LA 3B82A 3IBGA 3OEED 5P21A 2JASA 1EFRD 3ZVLA 1UDWA 4PC7A 4JLPA 5D3QA 2ZRJA 4B2IA 1AQYA 1F2TA 1F3OA 1RIFA 3MAAC 5JLJA 1DADA 4CIDA 1VG1A 1BMFA 5HE8A 4URUR 1UKVY 2OCBA 4PX9A 4IVRA 3HDTA 4HAYA 5CDFA 1CJUC 4Q1EA 1Z29A 1J8YF 2IUUA 2DFNA 5FOSA 4ITRC 1VG0B 4KODA 4OI4A 4Q4JA 3FTQA 4LZZA 4DHEA 4EPXA 2Y8EA 3HU1A 4LI0A 1US8A 3JZAA 2PEYA 3H86A 4RD1A 2AL7A 1HH4A 1IN4A 3EZ6A 2AK2A 4L16A 2P5SA 2DWOA 4ZDWA 4M1WA 1LS6A 2WSMA 1KMHB 4JKYA 3DM5A 4R9UC 4QC2A 2QT1A 4UNSA 1A4RA 3CWZA 3WRXC 3GLHB 1Z0FA 2VHUA 2AWOA 3VNVA 1IBRA 2O5VA 2YWEA 1DAIA 2EWWA 1F48A 4LHXA 4LYHA 2JJ2D 1QRAA 421PA 3KFXA 1CR4A 4Z54A 2BM1A 3CIOA 3KQHA 3THWA 2D06A 3TK1A 2ZS8A 4FN5A 2YOGA 2WJIA 3O8DA 5JRJA 4KYUA 5JWHA 3SQWA 1P2UA 2H5EA 4M1KA 5C4GB 1OT3A 4W9MC 2CCJA 3MGCA 3EZFA 3QUSA 4Q7LA 1H8ED 2IS2A 3EARA 4LK2A 5EZ6B 2GILA 1W4AA 2O8EB 1R8QA 5CM9C 1E2LA 2ZRPA 2ZRFA 1BIFA 3FMFA 4Q4AA 2DWQA 4Q1DA 4TTPA 5G3YA 5FR2A 4YDSA 2NOAA 4D80A 2QROA 3FHCB 3HYRA 1ZC4A 2BCJQ 3NDBB 3LLUA 5KSPA 4LDJA 1XWIA 4TMWA 4AG5A 4B33A 1TU3A 4KAXA 1XD2B 1I2MA 2ZJZA 4KXFB 1W0KD 4DCNA 4GMXA 1EGAA 1EXMA 2ZITA 4M9XA 4TLBA 5L3SB 4V0LA 4C9BA 4HLCA 1MO3A 1YZLA 4KVGA 4Z8XA 5GVSA 1NJGA 1T3LA 2Z4SA 3FOZA 3RC8A 4LJAA 4MRVA 4NYIR 4V02A 1KMHA 5F9FA 1G6OA 1E2HA 3ECCA 1KDTA 2I1QA 2QAJA 3TSOA 1ZW6A 1R0XA 2JATA 2W83A 4Q9JA 1LV7A 1EFUA 1NVXQ 1G3MA 5CYPA 1KDPA 2RGNA 3P1JA 2OO7A 4RZ3A 1OLOA 1N0UA 1ZNZA 4B75A 5E3HA 1E79D 2QUZA 1GAJA 3E70C 2ONJA 2GEUA 2AK3A 1U0LA 2RGEA 3AB3A 2GJAA 1KIMA 2CL0X 1X86B 2D7CA 1L2TA 1G3UA 4XVRA 3TH5A 1G19A 3JVVA 3LFUA 2ZRLA 3MRSA 5AUQA 4B3FX 3HYTA 5TXGA 5DI3B 3K9LA 5HZHA 4BFWA 1SQ5A 2RHMA 5DLQC 4TYYA 2O8EA 1CF4A 3F0TA 1P7CA 4TZ6A 1ZMXA 2HEIA 4LSGA 3GEEA 1ZM2A 3CLVA 2BOVA 1XTRA 4PXAA 1E2EA 5DHAA 3PEYA 3HPQA 5FPSA 1K6MA 1E3MA 1TX4B 1N5IA 5BN4A 2GETA 4NZYA 4M0LA 4MQBA 1T5IA 2O8FB 2J7PD 5BN5A 3ZVNA 1XD2A 4KCGA 4FCWA 2NO7A 4W5HA 2XJ9A 1G8FA 4OI2A 1QDEA 2IF2A 3CRQA 4IW3B 4OYHA 3PIRA 4UXJA 5L3SA 1XX6A 2KB0A 4P0TA 3QSYA 1BMFD 1MRNA 3AVPA 1VG9B 1YR7A 4PO8A 1Z3IX 3K70D 2DY1A 4B2LA 2VF8A 1KK1A 3QY0A 3CRRA 1WA5A 1U90A 1ZCBA 2R6GA 4OJQA 4TWZA 1YRAA 1NMXA 4JLOA 1HTWA 1COWA 3IQWA 4QRHA 3NVAA 2HT6A 2FSIA 1KSHA 3DZ8A 4F4IA 2ZYUX 1Z6YA 3QKRB 2FNAA 5LPNA 2WWHA 3RHFA 1KDRA 1CP2A 4ZDIA 1VCMA 2PEZA 4GDFA 3GLFB 2GAOA 4U02A 5A0FA 1RPZA 1GKYA 1W4BA 3ASZA 3IHWA 3UWOA 4DLYA 2HYDA 2WJYA 3E5HA 2OBNA 5DN6D 4G3XA 5IDVA 3X1YA 3WXMA 4DEYA 1SHKA 2PCJA 2PZEA 4QBHA 5DI3A 2IS6A 2CLSA 4IDNA 2QY9A 4YQFA 4RCYA 4B48A 2QSYA 4X8HA 4P4SA 2DFLA 2ZU6A 3CH5A 4C0HA 1KK0A 1UEIA 1J7KA 2GZHA 4E03A 3WHKA 1ODFA 1MOZA 4A4DA 2RMKA 1UF9A 2ODBA 1Z8FA 4O2RA 3AUYA 1E0KA 2FE4A 3MFYA 3AF2A 3DEFA 2QPTA 1KKLA 4M1OA 1XU4A 1IY1A 1MABB 1MH1A 3DZDA 3IO5A 3UXMA 2CK3A 2VP4A 1M1YE 1KGDA 4KU4A 4PAQA 3C7KA 5AR1A 3LX8A 2PLFA 4NYJR 4JLVA 1ONBA 2J3EA 2A5JA 2ZI6A 3RANA 1FUKA 4GP7A 3N2EA 4MUAA 1PZNA 3QOFA 2R6DA 4NTZA 3EIEA 2MSCB 2KWIA 3VHLB 3EASA 3HU2A 1S3SA 4RFSB 2AXPA 1OPXA 3AH8A 2UZIR 3W34A 3EW9A 1XMSA 3D6TB 4FMBB 3HPRA 1JNYA 3PV0A 5FPHA 4RJLA 3GLFA 1NY5A 1G1MA 2QBYB 1YZQA 2IWRA 1VIYA 3QE0A 3WBJA 2WOOA 3HWSA 1YE8A 2FU5C 3OESA 4OKSA 1CJTC 2L0XA 1FP6A 2F1JA 2KBFA 3K0EA 4TMXA 3TIFA 1WB9A 2GRJA 3GEIA 3A1WA 1ZJ6A 2CJWB 4UNRA 1L8QA 3ZD6A 2NO0A 1IJEA 3BB4A 1S4QA 2ZYTX 3SJCA 2IYRA 3F8TA 2UVQA 4D0LB 2O8DB 5IHPA 3LBNA 2KI5A 4IOKA 1WMSA 1X8LA 2G1KA 4UXHA 3LAWA 1ZM7A 4M9ZA 1A5TA 2OCPA 4PO1A 5KDDA 1ZVQA 3V9PA 2BV3A 5EE1A 3B8HA 1KY3A 3L0IB 2EFDB 1MABA 4GI7A 2IA5A 3S1AB 1Y3AA 4RD2A 4Q00A 1A2KC 4WBSA 3ZVRA 3GLFE 4D82A 1SGWA 3TUJC 1GL7A 4PC2A 4TYPA 4D4KA 4YMSA 1NLYA 3WNCA 2P5TB 1A2BA 2VHTA 2J0UB 4HLUC 2B92A 4GL2A 1N2CE 4AIIA 5FUWA 1SKYB 3I32A 2GAAA 1CULC 4RFSA 2ZI5A 1Z0KA 1D5CA 1XMIA 3QG1A 1XPOA 2LKCA 2VSOA 2WOJA 4B6FA 3RS3A 4URXR 5JRZA 3RC3A 3ADDA 5J47A 1COWD 4QBIA 1P6XA 3SBEA 1MT0A 1B0UA 1D8TA 3KB1A 3CF0A 1Z2CA 2GWHA 2QBYA 1GNPA 4OQLA 4L4UA 4Q47A 5BW8A 3U6KA 1JPNA 4B43A 3EZ9A 2V1XA 3QKSB 2PT7A 4IHQA 2GEDA 1U8ZA 2YJTD 1CLUA 1HE1C 3PEUA 4PPQA 5BQ5A 4B3GA 1GITA 4ILEA 1EFCA 2CJWA 1U99A 1ZBDA 5E7MA 1F2UB 4GRAA 2G88A 4MRPA 3WY9A 2X19A 3IPYA 2OLKA 5AWFC 4B35A 2O8DA 2A78A 2NPFA 3FMIA 3K8YA 3CPEA 4V0OA 2PL3A 1R0ZA 1KSGA 2GBLC 2IYTA 3B13B 4HLDA 4EJSA 2BIFA 1H65A 2CCGA 3BIFA 2A3RA 2OT3B 4P31A 2D7DA 1XTQA 3OAAA 4D4MA 5KNDA 4FIDA 3VQTA 1UBGA 3PR1A 3S1AA 2QGNA 3UK6A 3MLEA 3LVRE 1E2JA 1UKEA 3FVQA 4NMMA 5HTKA 2VLIA 4CZ2A 1CKEA 3WP1B 2HV8A 2J0UA 2JLRA 4ZIRB 5F2EA 2JLZA 2CK3D 1TQ6A 3R20A 5BYKA 1Q3TA 5K8UA 1TEXA 2R6CA 3LRPA 2JLXA 1CIPA 1KYIA 4KSCA 3G0HA 4D25A 2GJ8A 1ZUNB 2HXSA 2IYVA 8OHMA 1VTKA 3P20A 3EAQA 1IY2A 2IBMA 2BHRA 3NC0C 3C8UA 1WCV1 5D3MB 1Z28A 4CRWB 1OH7A 2Z83A 4PPNA 4OQMA 1EX7A 2NGRA 1ZNYA 5KPDA 1P2TA 5HKKA 3V00A 3UPUA 1G64A 3KJGA 4KI0A 3TMKA 3C16C 4Y0VA 3E2IA 4M9SA 3QKSA 4TMKA 2FDCA 1CJMA 2GXSA 3AF4A 3K9HA 2YHSA 2RGBA 1KHTA 3CONA 4QL3A 5EQTA 4EQ6B 1EFTA 1S2MA 3EWSA 3LNCA 4TTRA 3PJRA 4N1AA 1MR3F 1O3YA 3BH0A 1F2UA 2O8CB 1IXRC 2H18A 2E9SA 2UKDA 4Q9KA 4P33A 2FZLA 1SKYE 2EVWX 1FW6A 3B60A 2P6RA 1VECA 2FMXA 3ZJYA 4QKQA 4DVGA 5B64A 1EG7A 3T1QA 3QXCA 2F1RA 4P4TA 4TLEA 1T8UA 3RNLA 4Z8YA 2OBLA 2IYUA 1YRBA 3EWAA 3I92A 3RWOA 3KTAA 3A4MA 2JGNA 3TVTA 3KQKA 1FTNA 1NVVR 4QJ4A 4PZZA 4U7DA 3W5IA 3RRMA 3OIWA 4M9QA 1C1YA 4A2PA 1DO0A 4DDVA 2DBYA 1QVAA 2Q3HA 1T0HB 3IIJA 2VH5R 4PHTA 3I62A 1FL9A 1ZIPA 1C4OA 4JBXA 4D26A 1JR6A 5JJLA 2KJQA 4TSFA 2FFAA 4EPTA 3NH9A 2YWHA 4JVSB 2W6IA 4TQUS 3TQFA 4CW7A 3BRWD 4DCSA 4DLVA 3CBQA 1QHIA 3QI2A 3BS4A 4C7OA 4EIWA 1AS2A 2F55A 4GOJA 3ZDQA 4DLZA 4KVAA 4S35A 2H92A 4DCUA 4WZBE 5FTKA 2QQ0A 2OHFA 2JLUA 5G53C 1CS4C 3U6BA 4BWYA 4BFTA 2CNWA 3PG5A 4C30A 2C77A 1TQ4A 4DLUA 3FGNA 3TR0A 4AKGA 2H7VA 1ZU5A 4DSTA 1L7VC 1FZQA 4TYWA 2OCAA 2OXCA 5CIWA 4OJKA 3RWMB 4KJZA 2GJKA 4CT4B 1KKMA 3W3AA 4JVNA 2RGCA 5FPYA 3CF6R 4IEIA 4LX0A 1OSNA 1KO1A 3KQNA 1KI6A 3SJAA 4QXAA 3OZXA 3VKGA 2HLDA 1LF0A 1NY6A 5E7JA 1UEJA 2F9MA 2ZE5A 3CR7A 1PLJA 4EFNA 3BD9A 3RAPR 2DB3A 1AS0A 3SU8A 4FXPA 4GOKA 2EU8A 2LCFA 3KX2A 1OIWA 3QNUA 3UMSA 2ZI4A 3SDZA 2WPDA 1KI8A 4NE2A 5FBVB 5M04A 1W7AA 3K1JA 2C99A 3QJYA 3X1DA 3LXRA 3KQLA 1Z83A 3OAAD 1Z0AA 2F3RA 5KU1A 1LY1A 2OESA 2ZE8A 1WXQA 4G5GA 5FFMA 5CYOA 2J87A 1U9IA 2XX3A 3K70C 4L15A 4LCBA 4EDHA 3KDSE 4ZV4A 4QG7A 3N70A 2C96A 2C78A 1HE8B 2FN4A 1NVVQ 1NKTA 3NDPA 1W49A 1G7CA 1G3IA 2J59A 2QP3A 4D2IA 2XTZA 3D8BA 2QENA 3TRFA 3H4MA 3CUEF 1TTTA 3G5UA 4A2QA 2EYQA 2VQSA 5FOTA 5DO9A 5EXSA 4BEBA 2QL6A 1W2HA 2CCKA 4RCZA 2GXUA 2EFGA 2ECKA 3BXZA 4GT1A 4ERNA 1F5NA 3NH6A 2NIPA 5HKKD 1QHXA 1WP9A 2BCGY 4HAVA 3ZIAD 3QG5A 1EX6A 4Q7JB 3IEVA 4LBWA 2Q0HA 3VX3A 4BLPA 3W6NA 3KXLA 1J70A 2PLRA 2JEOA 4G5OA 5BXQC 3U60B 2J0VA 2HF9A 1H8HA 1ZD9A 4BUJA 1A7JA 3DKPA 1IXZA 3O8BA 1TU4A 1NLZA 2AX4A 4LC1A 4CEHB 4B3BA 4V0MA 1OB5A 4DLRA 1E2QA 5IRCD 3DL0A 4I1OA 3PUVA 4G1UC 3MSXA 4KHZA 2ZEJA 4PHFA 3V4FA 3B2EA 4K81B 3AVUA 2SHKA 2ZYVX 2ZJBA 3VNUA 4QHTA 1NMZA 1KSJA 5H8WA 3DVLA 4M4SA 2IXEA 2WJJA 3DMNA 2ZPTX 4UNQA 1D9XA 4BFYA 3SR0A 2IS4A 3HU3A 4EKDA 3BB1A 4TSFD 1PJRA 4H9GA 4WIAA 2VHJA 2WAXA 2V3CC 1E2PA 1U81A 4C2TA 2XXAB 1FUUA 2W6ID 4K8OA 3ZS8A 3ADCA 1AKEA 5GVRA 4DLWA 2KE5A 1LTQA 1M6NA 4CEJB 3EG5A 3PEVA 2V4ZA 4LJYA 4V0ME 1DE0A 3UIEA 4HYYA 3I73A 3JZMA 4P3YA 1SXJB 1QHGA 2CNWD 1ESNA 2IW3A 2RGNC 4UKDA 4URYR 3U44B 2BJVA 3DHWC 3E1SA 1IY0A 4B2PA 1P3JA 4JBYA 2K5UA 1YZGA 3GCGA 3R9XA 2YVUA 4LC0A 4C2UA 1UDXA 2FG5A 2J45A 4ZI2A 5G41A 2ZUCA 4GZMA 1NKSA 3RSLA 1E9SA 1UPTA 1XCMA 2WAYA 1D9ZA 2VHCA 2WMNB 3NBYC 3D31A 2PMDA 1R4AA 2IT1A 2WM9B 5J4KA 5F3WB 2QE7D 2QN6A 3GMTA 3NHBA 2OE2A 5K8TA 3IILA 4IJMA 2CE7A 1XD9A 5EP2A 3PXGA 1XFAA 4CEHA 3U44A 1D6JA 3U4QA 1GL9B 2HXYA 4PQYA 2ZRAA 3L0SA 3M6AA 4GPTA 1JI0A 1I2DA 4D6PA 1ZYUA 1XEXB 3OF5A 5SZHB 2G9NA 1UKZA 2QPOA 4JLKA 2IL1A 1XTJA 2WPDD 4FW9A 5FI1B 4II7A 4JYBA 3EZ2A 3F3YA 3VR4A 5JWRA 1JBKA 3TVDA 3NG1A 1N6KA 3PVSA 4AYWA 4P32A 4TYQA 4L9WA 5FTJA 1G7SA 2R8RA 2XXAA 1AZTA 4LOAA 3SZRA 3VAAA 2ZSAA 5DI9A 4FINA 4M8NE 5B57C 4CEJA 4BRWA 4IVPA 2BEKA 2WIBA 1GILA 5CM8B 1SXJA 3OIUA 2ZR9A 3BBPA 4KO8A 4LBZA 4AC9A 2F1IA 4XD7D 5DE3A 5LBIA 3B6EA 4IOMA 3J81k 4M1MA 3FFBA 3I5XA 2D74A 2WSSD 3F5FA 3LVQE 4Q01A 3U4QB 2PMKA 3R9IA 4A15A 2VP0A 4Q1CA 3THOA 1ZNWA 2QT0A 1E9CA 3GJ8A 3GQBA 1KI7A 1G5PA 4GP6A 4LV6A 2ZROA 4B47A 3QEOA 5IF9A 4I99A 4B71A 3AF3A 2OFOA 4QNMA 1HURA 1OIVA 5FUYA 1JQJC 2BKEA 2H17A 1BYUA 1Z5ZA 1W36C 2NO1A 1H8HD 4OQNA 1ZM9A 4ABYA 4BZPA 1XEXA 1R7RA 3FMPB 5EXPA 1GP2A 1SXJE 4F92B 3QPVA 1GM5A 1E2KA 1EFHA 1M7HA 2GF9A 2WJGA 1XXHB 1Q57A 5A4JA 1U94A 4E07A 4NYMQ 3CPHA 1PLLA 3DM9B 4QFMA 4P4UA 2ZJ8A 2CHGA 4AKEA 1CR2A 5AUOB 4QGAA 2J7KA 4HAWA 2OAQ1 2WJVA 2YOFA 3NXSA 4PC3A 1E96A 2J9RA 4IFBA 3P26A 4D81A 5K8IA 3RLFA 4YXWA 1E9AA 3ZH9B 4DDWA 2IYXA 4BASA 4HDQB 4WXRA 4F38A 5GJVC 4L8GA 2PT5A 3QENA 1FNNA 4N0DA 4PHHA 5FBQB 3TAHA 5CIQA 3R9WA 3SFVA 1U2RA 3PEWA 1ZNXA 2WV9A 3CZQA 1K8RA 1J99A 1T9HA 4TMTA 3PFIA 2ZI9A 3W6OA 4TZ0A 1XEWY 1M2OB 4LJ4A 2B21A 5JEDA 4P4SB 1ZU4A 5H1YA 1W36B 2P6NA 2ZJYA 4JLMA 4UQOA 5JS7A 4LHWA 2QP4A 5FBLB 3VR2A 3PUZA 1RRFA 3FKSA 3R7WB 1AIPA 3Q85A 4B6EA 2GNOA 2N46A 4LJ5A 3U2QA 2NO9A 5JECA 3SJBA 2ZR0A 1WF3A 2BC9A 4B3XA 3QQ5A 4R2IA 5F98A 1VMAA 1N3BA 4US1R 1LFDB 2Z0MA 4DKXA 5EP1A 2ODWA 2Q9AA 2ZANA 4TLCA 1W46A 4V0KA 3PITA 3AEZA 3CNLA 2OFXA 3UG7A 5CB6A 5GJBA 1JAHA 1XXHA 1GFIA 3MD0A 4PHGA 4M1YA 4PPGA 2QP9X 1GL6A 2GTPA 3NEYA 2P67A 4H1VA 2DPXA 3BFXA 3K0FB 4Q9LA 2ZUDA 3SYKA 5B58C 5LD2C 5BWMA 4QJ3A 1HQCA 1QHHA 4DT1B 3BE4A 2X2FA 1QZXA 2OCYC 1P60A 4JT4A 1GOTA 1J2JA 4PSKA 2YOHA 2ZIAA 4BFXA 1D2MA 1AS3A 3PUYA 2YYZA 5TV2A 3VU9B 1OFIA 1UBEA 5J4HA 1SULA 2H1LA 3KJHA 1RC8A 2CHVA 1XJQA 3X1ZA 2ZI7A 4WXPA 4CYMA 1BH2A 5DYIA 4Q1BA 2P0EA 4PTLA 4ARZB 1EK0A 1R6BX 3DO6A 4HDCA 5CB8A 4N3NA 3QKTA 4XWKA 3IO3A 1XXHE 1SXJD 2ZRCA 4MGKR 1E1RA 1WDTA 3FFAA 4LJ8A 5FOUA 1P75A 3AP1A 3TUIC 3WYFA 5KDOA 3QIAA 3I4LA 3CRW1 2WKRA 3LQRA 3OIYA 1NLFA 5JS8A 3R7WA 3LW8A 4BLTA 4DZZA 2RKOA 4GMDA 4HI0E 4JL6A 5FUVA 4A36A 3THXB 2B8WA 3EIHA 1NN5A 1RJ9B 2C5LA 3TSZA 3PCRB 5LD2B 1IN8A 4GSYA 4PPFA 5EE0A 1PV4A 1DEKA 5FI0B 2WICA 1M34E 4PQFA 3GEHA 4YONB 4EJSC 5EE9A 1Z6GA 2WIAA 3W8NA 2ZRMA 2JJ8A 1N0VC 121PA 1Q1EA 4B34A 5H68A 1P5ZB 4YMTA 4D0GA 3K0FA 2ZM5A 4DDTA 4TYNA 2R65A 4WOPA 1R8SA 1UADA 4JVLA 1K5GA 5L3RA 2X2EA 2ZI3A 4DT1A 1XP8A 2W2XA 5L3VA 2VHQA 4I1VA 5UKDA 2ORVA 4W7SA 2ATXA 1WBDA 1FQKA 3T5GA 2JLWA 5DH9A 3L8YA 4XH9B 4KFSA 3GLGB 5GADl 3KKOA 1KNXA 3VU9A 3ADBA 1NN0A 1ZIOA 4AYTA 2PZFA 1NRJB 1X1SA 5G40A 2BKUA 2A5YB 1FMLA 4ARZA 4JZKA 4YXWD 4QGFA 3QXJA 1ZUHA 5C46F 2VRWA 2D2FA 3KJIA 2XITA 4RZXA 5FL3A 1CU1A 4NDZA 3SNHA 4PZLA 1N6OA 4HB0A 1XEFA 5TVKA 2GKSA 4HB3A 2QEQA 2JCSA 2J41A 4HEJA 2VSXA 1IONA 4K46A 4QGHA 1U8YA 1SVMA 3P27A 1DOAA 4QM6A 5AJZA 2BJWA 4JMPA 1N6PA 3WHLA 5CLQA 4EJSB 1VPLA 4LUCA 3UANA 3THXA 1G3RA 3K53A 2AR7A 3QEJA 1C9KA 3ONWA 1RJ9A 2XAUA 4LRWA 1OJLA 3EXAA 3FKSD 4PO9A 2A5DA 2IHYA 4N0EA 2DHRA 2XZOA 3P32A 3DPUA 3C5HA 3RS2A 3TE6A
chains in the Genus database with same CATH superfamily
3IP8A 4DTIA 2JBAB 3PDIA 2ONZA 2QU7A 2G5CA 1AGNA 1ZD5A 4L1KA 4RETA 1ODKA 1MW9X 2NT3A 2C2MA 1JX6A 3FGPA 3FHJA 3K9NA 4GWKA 3HFJA 3OWOA 4WQMA 1PFGA 3RRYA 5I9BA 3QF4B 3ZCUA 2JANA 4QO8A 2ZDQA 3RAGA 1L4LA 1T24A 2QRKA 2WIDA 5K3FA 1N5DA 1E9EA 2EERA 1TK9A 1XTPA 2XZLA 2D0IA 1RYEA 4FS8A 4WZAB 1TADA 4ES6A 3HACA 5CITA 3WK6A 4D96A 1G8HA 5HEKA 1TK2A 3H8VA 1GZ5A 2FSGA 2PA0A 4Y9UA 1NLUA 3BC1A 2W5UA 1JHXA 1T4CA 4PHCA 4LTMA 3SZUA 1IOZA 1FC0A 1AM4D 1JE0A 1ICIA 2I99A 4LSWA 3L05A 3DW3X 5GGYA 4CI0B 2DWPA 2UUCB 4R98A 3SZ3A 5D6NA 3H11A 4IZIA 3RG8A 3U1TA 1EI9A 1SQGA 3VZQA 5ENVA 3ZY4A 2QMOA 3F67A 3WLFA 1LSOA 5IJWA 1XPRA 1RXWA 3TZQA 5CA1B 5J2UF 1UC8A 2ZRNA 1E1KA 4IY1A 1NNI1 2D8AA 1FDUA 1I5RA 3BORA 4R51A 2P35A 5HPYB 1K6XA 3NI2A 3V4ZA 1FFSA 5EPEA 3HR7A 5CVDA 3BH7A 2YXEA 4BQFA 2ZRDA 3FYUB 3KVOA 1G7RA 4OLHA 2ZBQA 1BVUA 3CNNA 3FHOA 3VYRB 3QW2A 1P7YA 4Y2GA 1K9SA 2AQIA 1NF8A 3TMAA 1E6EA 1G20B 4RKEA 2FPLA 4KQ1A 1W4RA 4OHVA 3RSSA 2WVAA 4DGSA 5KJCA 1W36D 1R15A 5KBYA 2R8YA 2P9TA 1GCOA 1TJ5A 1GNVA 1V11A 2DHCA 3OETA 3LSYA 3C6YA 1KJQA 2EL9A 1GV0A 1ORWA 1MNQA 1I2CA 3GLGE 2QW0X 3DE5X 3F7TA 3B6ZA 4ZT7A 5IH3A 3DXZA 2H31A 4BGEA 4B3JA 2GUGA 4WKGA 3FWHA 4G2TA 3QWHA 5COAA 1DRWA 3IERA 4L22A 4Y6RA 1FYXA 3UHJA 2O0JA 1Y6FA 1HETA 4RIHA 1L4GA 1T5BA 2WJ4A 4LRSB 1V2GA 4BGDA 4M0PA 3FPLA 5BR8B 1PS9A 1KR5A 3LOQA 2HMTA 5TT1A 3EEIA 1J0BA 2F43A 1F4LA 3WYGA 1OIXA 3AUAA 1AGPA 2HMAA 3AVXA 2B7CA 4KWCA 3N2KB 2YWFA 2K87A 4XQGA 3OWHA 2GXAA 2IYYA 1I6MA 3GA7A 4XIJA 1GQYA 2FEPA 3W6PA 3LUBA 4OA8A 4Y1RA 1VKJA 3TVYA 1U9IC 3T1TA 1EDEA 4O63O 1R4MA 1G21A 4RA9B 4PGFA 4OM8A 3ZXXA 3LUHA 2EBWA 4BPBA 1KAGA 2FSVA 4EGJA 1XVIA 1SHJA 2I9PA 3RJZA 4PYRA 3VUEA 2P2CA 2X22A 3AY3A 4HS4A 1DBIA 2RONA 3I2HA 4ZI3A 3VHQA 3C6XA 2Q9BA 2VYND 2L18A 4WGFA 1ELOA 2GZ3A 4KOAA 1I1OA 3KLPX 1CF9A 1WXHA 1KA9H 1KO5A 1MB2A 1PCXA 1U7UA 2C9MA 2G77B 2GPYA 3IDFA 4KQHA 1Z4LA 5EKUA 3MMXA 2WIFA 3SQLA 4RV4A 4C4TA 2GTIA 1OTYA 4EK9A 2BSXA 1JJFA 3BWDD 1YKSA 4HJRA 3GCDA 4QYSA 2B8JA 4WZAE 3ORHA 3B1VA 2XCTB 1DXQA 2IZ0A 2Q4TA 1QP0A 2VATA 1DX6A 2CFCA 4C6SA 1LB1B 1RHKA 2HIAA 2XNHA 4QDTA 2MSEB 5K4GA 3ER8A 4QBFA 3QFRA 3FCUB 3JYHA 5DTQA 2HSGA 1H3FA 4XLTA 4UEOA 1SMKA 5HS6A 2DETA 1FFDA 2HJHA 3U7QA 3D1VA 2R6HA 3TLMA 3NUGA 5E2IA 4OLJA 4UCQA 3ZZMA 3TZ6A 2R6JA 1HL3A 2PXAA 3TI9A 3VO9A 5TDHA 1JG7A 1AF4A 1FTSA 1UZLA 1RE0A 4JSYA 2QSZA 3DT9A 1XT6A 4FOPA 3UY4A 1I6WA 1IZ9A 2C7OA 4QBGB 1XCOA 5DOZA 1VOTA 1S01A 1I4DD 3T7AA 3C7CB 5CA1A 2Q9CA 2GERA 1GN9A 3OQMA 4NBLA 4P54A 821PA 5FYDA 1GNRA 1A4XA 3BKWA 4QQ8A 2UZ3A 1G8MA 2ZR8A 4RYLA 1YVUA 1SVIA 2WHRA 3PWZA 1ZRMA 5HFAA 3V1NA 5ISMA 1G20E 3O9MA 5D84A 3INYA 1M33A 4P3PA 2XE7A 3IS3A 3VNAA 4I50B 5K9ZA 1P0IA 1J0XO 1P18A 4EPVA 2PTGA 2JCGA 3R6WA 1M8PA 3EOBI 1KP3A 4UNPA 4BY9E 1U0EA 1S1MA 4LJKA 5LIRA 3I6IA 5AI4A 3LXXA 1GRRA 2D1YA 4EKNB 4UUAA 4OYRA 3TINA 3VR3D 2ZIFA 3OFVA 2V6GA 2FK8A 2ODNA 3QPAA 4HWGA 4HTFA 3S2SA 4BNJA 3BTVA 721PA 5I7EA 5FF9A 3UBTA 4HH4A 4FB4A 4ZRMA 1FFYA 5BORA 3L93A 1UANA 2PZJA 3CEJA 1QTRA 1F0KA 3JQ9A 1R0WA 3F5DA 3D64A 4KSBA 4F93B 4W7HA 3Q7EA 2G8LA 3FMVA 5CGZA 5DZSA 1SC4A 1VL8A 4BFSA 1ABEA 1WUTA 4N7BA 3WMFA 3VM6A 2DR0A 1W5AA 3D3WA 5B36A 1XZJA 3S0JA 4W8GA 4BMSA 2RK4A 2DY0A 2GYVA 1NA5A 4U7GA 1UKYA 1GSOA 3MJCA 4P6VF 1OXVA 4UU1A 1E0JA 1C3VA 4A8HA 1OBFO 1RQPA 4BC1A 4EA9A 4LA4A 2QMHA 5LZ9A 3QEMB 4Q6WA 4ND7A 2CEKA 4PQEA 2O8BB 4WUTA 3HJUA 1EAYA 4V0NA 3SNKA 4B8YA 4L02A 1P1JA 3WLIA 1T3SA 1C7JA 3ZNQA 1Y6JA 4QUBA 1VPWA 5BVHA 1IPEA 2ZQ5A 4MHOA 1Z15A 5G3ZA 1G5HA 1GUZA 3BIWA 3IHLA 3ZK7A 3K6JA 3LIIA 3U61B 2B2NA 5GM1A 3K9BA 3O5AA 2DVMA 2IOHA 3A1SA 3HYLA 2NO6A 3EJWA 1DHRA 1FVHA 3G2MA 3IQZA 4XPIA 4BBAA 5JC1A 2ZRHA 4AY2A 1AKNA 1JQLB 4QM7A 4PFKA 1UZNA 3COZA 3V80A 1E98A 4RHXA 1OH5A 1YVRA 1UOQA 4Q05A 5JSKA 4CR6A 5JWOA 4D56A 1FF9A 2UDPA 4RA6A 2CHQA 5IK2D 2GGSA 1GG2A 3HXLA 4ZANA 3GARA 4B76A 3UXHA 4MW9A 4URVR 1U2PA 2FW9A 3UT0A 1H4QA 1T8YA 1KH1A 2MHCA 3FSGD 3NPAA 4B5LA 2W4QA 3E18A 1C4WA 4H27A 2V55B 4RKFA 4TM7A 3OP4A 1BOFA 1E5LA 4PLZA 2D1SA 2VDWB 1UJCA 3H5OA 1K8QA 4N4AA 4OM7A 1D2HA 4TS1A 5H59A 3M83A 4CKBB 5K0TA 4B3DA 1C8KA 1HE2A 1NJ5A 2WINI 4GPZA 4L3VA 1NUHA 1Z7BA 3EFHA 4P35A 3IUBA 3NHSA 4U2DA 4YK7A 4RTOA 5M7EA 2IGBA 4YDHB 2R8XA 2W4MA 3LQ2A 4US0R 1QOQB 3ZZUA 1NGSA 3I39X 1V16B 3EIWA 2DHEA 1Y9ZA 3NEJA 2MCFA 3VU0A 1C9DB 2BW0A 3H2ZA 4RV9A 5DHRA 5JC8A 1CB7A 4YAOA 4HFRA 2F6RA 4A82A 3AKDA 3OF2A 1MB3A 3MF4A 5F1OA 2ANCA 5IS2A 2Z9DA 3K0AB 4XB6B 5ALGA 2DRIA 3P2YA 1UBUS 2ASVA 2ZREA 1C0PA 3FNHA 5KCZA 1XNQB 2N1BA 3USCS 1IATA 1CK4A 1HFKA 3O1LA 1C2TA 3SZOA 3CXUA 4J76A 2BYTA 5BNZA 1Z0ZA 2OAEA 1II8A 4N01A 2V7QA 1L7MA 4DIEA 4MRSA 3FF1A 5J2TA 2QRZA 3CTPA 3DQPA 4FMCF 2IXFA 3ANYB 1NXPA 4WLNA 4ALLA 3KWMA 1EWQA 3DBLB 3PF8A 3DKKA 3AUJB 2W6CX 4E4YA 1ZINA 3P9YA 4BGIA 4FE7A 1YQ9A 2RAPA 2CUKA 3REFA 5DFAA 2WNIA 3S8MA 2AE1A 1U98A 2HU8A 2X8WA 4IH1A 8ATCA 3CX8A 2XEXA 1PVOA 2Q8QA 3M7IA 3RYHA 3OT1B 3PHHA 4GKAA 3AJRA 4QQKA 4WXEA 3DZCA 3IP3A 1M2VA 3B2NA 1WQ3A 4C0QC 1IN1A 3LW7A 4M60A 1IXSB 2A1UA 4OO3A 4QPZA 1RWPA 5DTEA 3X1JA 1U0OC 4CCYA 1K8XB 3G8DA 3NTLA 3B36A 5BSRA 5AVVA 1T8TA 3W3AD 5FT9A 4GXRA 1WCIB 4OCZA 1WX1A 5HOQA 1TKAA 1MG5A 2GJSA 1KMMA 4UFNA 1KOLA 4OK3A 3WIOA 6Q21A 2J3QA 2QQGA 4JC5A 4RKYA 3WL4A 3BSSA 1FBTA 1I9GA 2QVLA 2OYRA 2REQA 5CDYA 1K7XB 3P9CA 5AICA 3JASA 3AP2A 5AVXA 1WVGA 2VDLB 1BHO1 4LBYA 4DSOA 2ZBEA 4FD2A 4HFNA 2DFTA 5DP2A 4JYPA 3BTOA 4Q66C 4E94A 1V8DA 2PX5A 5H70A 2VK1A 1Z5GA 2O2DA 1E3SA 5EESA 4Q19A 5LZ2A 4PAWA 4E30A 4MVCA 4C6TA 4JEHA 3C0KA 3C3EA 4Z1OA 5K01A 1KNQA 2P65A 4DY4A 2F3QA 2LNDA 5BXYA 1KZGB 4WFQA 4ZO7A 2H7YA 3RT7A 4L08A 2HIHA 4JH0A 2TMDA 3RS4A 1PT7A 3DF9A 1QDUA 4OSEA 1N75A 5KX5F 1T10A 4B5KA 2FQYA 1VPTA 2PFKA 1NW8A 3ITEA 1TLTA 1E5VA 4AKIA 1J06A 4AS2A 1S8OA 1TM3E 4B8WA 3RVOA 2DR3A 5BT8A 2W0SA 4BTVA 4UBJA 5G4LA 2OHOA 4TN1A 3I8SA 2A9RA 1RYBA 1ZD1A 3MTAA 1PQ4A 2GRUA 2PD3A 3O8RA 4GEKA 1EGQA 3QOYA 1QRRA 4HL6A 1T91A 3A3PA 2ZIWB 5LLTA 5COQA 3CEMA 1B26A 4MV7A 3P97A 2DJ5A 4IIBA 4BLOA 5ARBA 2F1HA 3MBKA 4G0OA 2B2CA 2GCOB 1RYFA 1Y4UA 2AZTA 1L4YA 5DN6A 3JARB 2XMPA 5FUQA 2AUNA 2C5BA 3EGIA 1OA0A 3AEUA 4LFAB 1IHUA 1HYEA 3FNGA 1PT9A 4J2HA 2G28A 1NHWA 1FS5A 1ZC3A 2ONCA 4J07A 1J1UA 4LOKA 4N0PA 3Q40A 2TRSB 4QSMA 2E4XA 3BDIA 4KTTE 1ISRA 1ZK0A 2DCMA 4ZT4A 1LLDA 5BYAA 4M9UA 4G5YA 5AQEA 1R2QA 4O4HB 1L7XA 1YQDA 3MHTA 1U2GC 1MB9A 1MIHA 4EMUA 3DMPA 2OMKA 3HR8A 5JS2A 5B6IA 2I03A 5JPDA 1BXRA 1W2GA 5CAEA 1XNGA 2PD4A 3MPUA 4PTZA 2V0GA 2J0SA 2LP4Y 2H16A 1GQ2A 1OKKA 1A5SB 2CBZA 4NC9A 4YJFA 1P4SA 2EG9A 3GT7A 3KKMA 1Q7CA 3VR4H 2WLSA 4HVLA 4JOBA 5E6UB 2Q3DA 3AUXA 1OA1A 2G9ZA 5G02A 3O26A 4DZTA 1LKZA 2GB4A 4R1PA 1JXOA 4JI4B 1SOWA 1OXUA 2BGIA 3A05A 2PJUA 2ILTA 5HS4A 2BTEA 1M6HA 4S1WA 2OGWA 4LJ6A 1RQNA 4RZUA 2VJBA 3A4NA 3TTUA 2CJFA 4LJSA 4POAA 4RQTA 5LMZA 4XIFA 3FFWA 4ZVUA 3CX6A 3TBKA 5LR6A 1YDWA 3P71T 5M2QA 5K2MA 2QXTA 3MJ4A 3HA2A 4ZT2A 3T7SA 3QE2A 3NM5A 3TQIA 1I3NA 1X87A 1UBRS 3OJOA 1XHEA 2OWDA 5K99A 2WJPA 2AIRA 4LXIA 2FSFA 3SXPA 3A4LA 4CM7A 1I3LA 1TIKA 1ZUIA 4F9EA 2Y1WA 5KS2A 2C00A 2WILA 4MQEA 4INPA 2EYUA 2HCBA 3UC9A 1TJPB 4ZXPA 2Q2VA 2E1RA 4R8SA 3WZLA 1V4BA 3HUTA 2WD9A 2R00C 3CZ5A 3EXEA 3E9RA 4QATA 3AHIA 5JSYA 3ZU5A 1FOEB 1EDDA 1K9VF 1TUEA 2BFDB 3E3AA 3ZNOA 5AW8A 4RIEA 1ST3A 1VSQA 2AN3A 2GESA 4FUTA 2WB2A 1YTUA 3QVJA 3A3OA 4PYKA 5ER9A 1RWVA 3WNVA 3PTZA 1THMA 3G9UA 1LS1A 4BVFA 3F5SA 3VYTB 1DKMA 1G4AE 1OYVA 4YR9A 5BUCA 1NXVA 3UQYS 1ZI8A 3TD9A 1V1RB 4HVCA 2JLYA 4OIMA 3EH1A 2C54A 1LLCA 1Z2AA 5DGXA 4CL0A 1NF3A 2Q0XA 5A5FA 2HIMA 5CEEA 3WGIA 2EP7A 3QVKA 1H2RS 1FFEA 3ZZNA 1IZ0A 3HCWA 3ZCXA 4H15A 4HYQA 4TT3A 2P9BA 3DE2X 3OFND 1FLVA 2LCIA 1JDPA 2Q27A 3L0OA 2I4OA 2JGMA 4OQZA 4BNYA 4DS3A 3BFJA 3GUCA 2Z8YA 3OX2A 1ND5A 2B7LA 2GS9A 3EX7C 2XT0A 1CRQA 2B78A 1YK0A 4EY7A 3UMRA 3HKCA 2GAJA 2C42A 1OFTA 2X9NA 5I9LA 3N5CA 3VPSA 1IM2A 3F90A 4W5JA 4BE7B 4DA8A 2VTBA 2Q62A 4PLTA 5FBRB 3M3DA 5TQ0B 3TQRA 4F7DA 4ZDKA 3MJDA 5DX8A 1ODSA 2YWBA 4ZGWA 5I4IA 3G49A 3WHIA 1G8PA 1TGYA 1QH1A 2EG5A 3COVA 2FX2A 2WTMA 4KZKA 2QPAA 4N5MA 3AM4A 4NYIQ 4C2AA 3D81A 2P4QA 5EIBC 2VIIA 1FLAA 3OF3A 4FFPA 4EF5A 2XOKD 5AUPB 2YNMC 1YRHA 1D7OA 1DTSA 2Q3CA 4ZYXA 5C1BA 1TDJA 1ZHHA 3KK0A 2C07A 1XA4A 1JKIA 4LECA 1NRIA 1P0QA 5DHFA 1OU4A 3T5AA 1N5OX 3TYXA 3E82A 4TRNA 3JAKB 3F96A 1T5OA 3L8ZA 4RXTA 5JDCC 4K6FA 4HPXB 3BGWA 1LFAA 1ZP6A 3DCIA 4A16A 4A2CA 4KW7A 1G60A 1PR4A 3MCTA 4PAMA 3TWOA 4DRZA 1ZHFA 1L5SA 3FJOA 4KAFA 4PR0A 4UHBA 3D5TA 3M9LA 3PDIB 1S9DA 1NW4A 3WGZA 1DAEA 2JDID 3JWHA 3Q3JB 4MRRA 2VYFA 4D4LA 1BDBA 1K86A 1YS1X 4RDHA 2O8FA 2QIOA 3TQCA 1KQGA 1IWOA 4RU1A 1DBRA 2CLFB 3THYB 3BL5A 2PXHA 5LZ7A 3KR9A 1WDLA 1C29B 2BZSA 4YWHA 2CL6X 3P0JA 1B6GA 3ZJ4A 4B4UA 4BJ6A 1JW9B 3AKEA 2AB0A 1MX1A 2BE7A 2CMDA 4YAEA 4FYMA 4DQKA 3FYHA 3AVWA 4R6WA 3QLEA 5K0JA 2OOKA 3DTNA 3GD7A 4X8MA 2ZDGA 3WIBA 1CUEA 1FY2A 1YS2X 4FOOA 3CLUC 1L4KA 1CJSA 3FDZB 4B45A 5FWNA 2O3TA 1GLVA 1HUQA 1SPXA 5JH7A 4PICA 4I4LA 1V1MB 3D7KA 5A6SA 2QRUA 1I1HA 2EAUA 3W1WA 1NBMA 3A9UA 5EJ8A 3KVYA 1K5PA 4EMBA 1OB2A 3E22A 4KVZA 2EFEB 2ODAA 1I4LD 2WLTA 2XT6A 3AF1A 4XQCA 3DYIA 1U5AA 3AQ4A 2EDAA 1CF2O 3K15A 1AKQA 1P2BA 3AFOA 4Q82A 4DDUA 1O08A 2QOEA 2EFCB 2V5VA 3QKRA 1GKUB 1TF5A 1ZCFA 4NFLA 1Z4JA 2AYZA 3BK7A 4HAUA 4QRDA 3JALA 1JSLA 3KAJA 3OTIA 5TARA 2OQ2A 3RM3A 3VDMA 3G89A 2I7XA 1LRJA 3B70A 5FNZA 2WAMA 1S89A 3KQUA 4BZXA 3FKQA 3HCCA 3GD5A 2XB6A 5I47A 1U8AA 1D2AA 1QFSA 2ZUTA 2VPPA 4Y2SA 1H1LA 1JXMA 3L01A 3BE6A 4HP8A 1H1DA 1XU7A 3DTYA 1CQJA 3G9ZA 2GF0A 3N3AC 3WJ1A 4FGUA 1XRPA 2ZULA 3P4UA 1JL3A 3EK2A 3EB9A 4YRPA 2LW7A 2X42A 4BNZA 3EEOA 3EHDA 1FA9A 2GNPA 5C4IA 1LV8A 1SU7A 5FP0A 3R7DA 2V59A 1OF1A 3GAAA 1GDDA 5DYGA 4JIGA 3PI7A 4UJ3A 4LGMA 2GZDA 4E5PA 4JJAA 2XBMA 1EP9A 1ULUA 2Z3ZA 1UK6A 1JPJA 1OGYA 4HNGA 1E2NA 3O3OB 2F43B 1QQBA 1TVCA 1YC2A 1W88B 3DZFA 2VNSA 2F9LA 3DFIA 2VJDA 3QYFA 3SZMA 2R44A 1L5WA 3L18A 4XWTA 5CA0A 2AFIA 3VHRA 2W6OA 4DV2B 1UQRA 4GFDA 1E2FA 1UMCA 4Q93A 4G23A 1AJEA 1U3TA 3ANXA 5KOHA 1KZ1A 3V34A 2G0AA 3KYDB 2QI9C 4FIZA 1JKFA 3TPZA 1UKBA 4DM7A 1RRGA 4IHJF 4DRXB 1KOGA 2TYSB 4KXYA 4Y0AA 4F6CA 4V2UA 5IASA 5EHNA 1HSOA 4N7JA 1VFPA 1DPGA 4LK3A 5B4TA 4O3MA 2H52A 1RWXA 1VJRA 1C3LA 3KOMA 1NVDA 1SCNE 3EGCA 5FLKA 4BMPB 1GTZA 4YLYA 2J6BA 3TXXA 4BO4A 3IE2A 3M1LA 5JISA 4UDXX 2JJ1A 1JQ3A 3ZN2A 2B98A 4G0YA 4MI9A 1BTOA 1ZK3A 1IN7A 3HP1A 3PCXA 5H0IA 3E81A 1HE5A 1K92A 1LU9A 3HL0A 4JY7A 5AJYA 5HIAA 4BTEA 3WP0A 3OEHD 3WJAA 3FLBA 4IDHA 4HWPA 3TUZC 2YMQA 4CG1A 3TS1A 2I6SA 3WGUA 2P79A 3E9NA 1R5BA 3OCVA 3Q6IA 3IEXA 5DNCA 2AX3A 3HCBA 5KTSA 3B3QA 4F56A 2ZBGA 4RHYA 1UXIA 3U7HB 3U7QB 5ITVA 1DQSA 4IZ6A 3ZTYA 3IVGA 2HT1A 3G2KA 3IT0A 5D5QA 1QKIA 1AQUA 4D9MA 1G41A 5IU6A 2AD5A 2QG4A 5K0FA 1QRUA 1UBJS 2FPGB 3PD7A 5ALNA 3RGGA 4EFLA 3O47A 2WWGA 3SVLA 4L4XA 3RW9A 2CNKA 3K0SA 1H05A 2NO4A 2EFJA 1I3KA 4TKVB 4TLAA 2DQ4A 1E1CB 1P5JA 5ES4B 1M9NA 2DPMA 3D4NA 3DJYA 4X54A 2GYYA 3GL9A 4C0AC 2YX1A 3G3EA 3ADKA 3QE4A 4FNMA 4YDRA 4ZTZB 3KEFA 5AI8A 4J9UE 3VSDA 4F5WA 4MDFA 1XBTA 3RROA 3RTBA 2HGZA 1N33B 5FR1A 3L8EA 3SBXA 4CM1A 2POQX 5ETJA 2YFYA 3KZ1E 1ODTC 2W8ZA 1YHYA 2E85A 2JFQA 3ROKA 3PD1A 1ECCA 2C3PA 4NL4H 3VA7A 1PZGA 4ACBA 5L3QA 4I36A 1NR7A 4L4SA 3WKBA 4Z7QB 2NP6A 1U8TA 4MA4A 2Q9UA 5DN9A 4RIIA 1TCCA 3L0ZA 1BVHA 5DSZA 4A6XA 4OI0A 2JGAA 5IKOA 4NF2A 5EQDA 2BGJA 5TGDA 2ECOA 4A0FA 2IU6A 4C88A 1F5SA 3EVBA 4EEZA 5LLDA 3RYCB 3SDSA 2PRIA 3NBQA 2JLBA 1R6VA 3NTRA 4UTXA 3TXYA 1T25A 5FTLA 2A4KA 4M53A 1NXOA 3OLVA 3GJ4A 3QFTA 2PS1A 3IAS1 4AJIA 1S6YA 4R05A 4E21A 4UTNA 2OD9A 3ULKA 3U3OA 7ABPA 1CY8A 2NSJA 4RF3A 1BHQ1 5CG1A 3D6FA 1R5NA 3D3WB 2CY0A 3MYYA 3JQ7A 4R7GA 4MGHA 2Y1KA 1CRPA 3OWXA 5GINE 5DLPA 1MEEA 2AC4A 3Q8XB 1QG2A 4YAUA 3BZUA 3LY8A 4GQAA 5KSOA 3CGGA 4FILA 1LPOA 2WWFA 1G3QA 5KSZA 3NHAA 4C2BA 2LV8A 2ZYWX 3PD0A 3PXBA 5EE3A 2SKEA 1BFDA 5DHQA 1VP3A 2Y1LA 4BMZA 3A1CA 3UWKA 4YCCA 3TW0A 1XTZA 3L02A 3G7UA 4MYTA 5CX1A 5BVHB 3G5LA 1JXQA 3NBUA 3T95A 4MQ4A 3GYGA 2HJSA 3HN6A 2QM0A 2PWZA 3RC9A 1UBSB 4YA6A 2HHCA 4EY5A 1HQDA 3UV3A 4EJ0A 3QUAA 1HQYE 2CXNA 2QRNA 3B78A 4RVCA 1VLZA 4ETIA 2IK8A 1QO0A 1SM4A 1YQWA 2F3TA 2H48A 1Q15A 2P9EA 3DMTC 3N0XA 4UCFA 3LY5A 4RANA 4DYDA 1JWBB 1QORA 3HDQA 3VZRA 4JJIA 3QXHA 1QANA 2C2OA 2MYPA 1R6UA 1IHPA 3REQB 1D1QA 3SZLA 1NN3A 3TJRA 4KMOA 2HSEA 3B5EA 3MMZA 4RA6B 2P27A 1T5HX 2YY7A 4Z51A 5L95A 2CV2A 3BWXA 1UFVA 1NVAA 2JI6A 3A04A 3TW8A 1PZHA 1PTJC 1I01A 3ZH2A 2P78A 1CIVA 3ZGVA 4F6RA 4QYMA 1XTSA 3I5AA 4MWTA 1DTWA 2NZJA 4MWSA 5HA5A 3G0DA 4R3NA 3HXTA 1GTVA 3TZHA 2X13A 2Y92A 1TF2A 3V4OA 2O2YA 3BA1A 1GFZA 2WNSA 4XM2A 1UWVA 3HFGA 4J1QA 3OE5A 1GKKA 1TD9A 3JW8A 1A27A 5B7QA 2WYUA 2IP4A 1MW8X 3UOGA 3DMYA 5CIYA 2X9QA 2YNMD 5BV8A 1VDMA 2BGMA 3DBRB 4ASUD 1JJIA 5AHRA 1DC5A 1KI1A 3F7OA 4MGEA 1YJBA 1GRQA 4CM4A 3LP6A 1TJ4A 5G0WA 1YZUA 1JR3D 2Q50A 5JTTA 3QHPA 1QHYA 2FCRA 2R86A 2JFPA 3TFQA 4TVOA 4BKPA 2DERA 3SSOA 1NXTA 1XZEA 1P5RA 2FY8A 2G0TA 1P8AA 3E9DA 1V9CA 4J8PA 2BT4A 5FJJA 1BDHA 3NHZA 1UAGA 1W29A 2VT6A 4K3VA 1NVUQ 2O2EA 2ZJOA 3AL2A 4ROSA 1EJ0A 2JI7A 3B6IA 3KJFA 3PA8A 1D0VA 4FKMA 4G1EB 1QUEA 2ET6A 3B6KA 3MM4A 5EUMA 3T1OA 2VZ8A 4AZVA 3A36A 4IQGA 4UAUA 3W5SA 3CLRD 4KGZA 2QRQA 3CPJB 3PT9A 3HZOA 1P19A 4LZJA 5I8ZA 4AL4A 1LPAB 2B9EA 4LVCA 1XNJA 3PFFA 3BSWA 2JRLA 9MHTA 5F73A 1YZFA 5CGQB 4RL4A 5AH0A 2BFFB 2G76A 3CLUD 4CTMA 3RS5A 3MSCA 4MQMA 4C4OA 3P4YA 1ODIA 5KYWA 1E9FA 2WUEA 1G6HA 1MZVA 1T0IA 4HDSA 4HR7A 3R1IA 2ZYSA 3CRZA 3PTLA 3FCYA 2Z9CA 3GRYA 1L1FA 4GBGA 1MKYA 2VH1A 2PMEA 3U4GA 3ZWWA 4WLVA 1W25A 4Y6GB 2VEDA 3QUCA 1LJLA 3IQXA 1VM6A 2WZQA 3AF0A 4JROA 4MTCA 1ZIXA 4NV3A 5U1PA 3ZOZA 5KI6A 2ZBVA 1AKWA 2HAEA 3CJTA 2FVXA 1M2VB 2ZJAA 2ZYHA 1U28A 2W22A 3GJ6A 3FWYA 3IP9A 3MWJA 3TQOA 3V9AA 5JJKA 1H5NA 2HRBA 1M5UA 2Y6VA 2ZSIA 2PYDA 3LDUA 3NHLA 2PSJA 4U5XA 4LF8B 2CHEA 1ADJA 1ID1A 3OPYI 3PGVA 4XD7A 2ADMA 1I5OA 2G5TA 4DANA 1H8EA 2AMYA 4ZVSA 1XMXA 1PNRA 2Y0CA 4JT9A 1A0OA 1C1DA 3FGOA 5JEEA 1MX3A 3ND8A 3ZLJA 2IXGA 3QFFA 1U0JA 4BNLA 4J16C 1Z08A 2H08A 3VSAA 1FVFA 2EEZA 2H29A 4FZVA 5LA6B 2FUG6 3MTJA 4FXOA 3SF8A 4YCAA 4AS1A 3K0HA 5EXEA 1PN3A 3ROEA 4AMBA 1YV9A 1GZDA 3SWWA 3LQKA 2P9QA 3A6EA 2D59A 3RKUA 1CETA 3ZQKA 4D0SA 4W5WA 4DSUA 3MWDB 4URFA 1W94A 1Z0JA 2G5PA 2X1MA 3L6EA 3M9XA 4BU1A 5FXMA 4JGBA 3OTGA 3W3ZB 4BRSA 2ZE7A 3BWVA 1RXCA 1E94E 4NZZA 5FNVA 3T9EA 1RM5A 2Z5FA 5K45A 1F2TB 4M37A 2DKFA 1FRFS 1KO8A 1HNWB 5LZ4A 1E1DA 3ZHVA 4MWBA 5BN3A 5FULA 1ES9A 2REBA 2PAFA 2WF5A 5EP3A 3MLAA 3QLVC 3R6GA 4FHFA 4IDEA 3ZPXA 1YBAA 2VQ3A 4HD8A 2AYYA 3T34A 1HEIA 3ERCA 1T5SA 2WV7A 4Q4JB 4BWVA 3O82A 1VIMA 1SVKA 4BJ3A 3EPKA 5K09A 3TAUA 3DYBA 1US8B 5HILA 4B4WA 2IVFA 3WWDA 5CXQA 2HK7A 2HRQA 4EG6A 4CETA 1TF7A 3AUFA 1Y6RA 1UJ5A 3WQBA 2YZ2A 1VPEA 4HQRA 4CMIA 5JSHA 3U3MA 2CYAA 4TN5A 1HDGO 2NYAA 1RAEA 2XNSA 4Q02A 2WKQA 3O6VA 5EQJB 1E99A 2BF4A 2CEAA 2FLWA 2YV4A 5AUNB 5ALKA 4UJ5A 3SHWA 2HL6A 5B1SA 4YXWD 5DNUA 1BG6A 2WR8A 5HM8A 5KZMB 5JNLA 4LXQA 2J46A 4L9AA 2ZIUB 3THWB 5K4HA 3HM9A 1O94C 3E35A 1Z74A 5A6VA 4PCAA 4H6WA 4R9NA 1V5WA 4XB2A 4NZMA 3FOEC 3H1EA 1I7PA 1X2BA 3EZ7A 1KFCB 4QVKA 1YS6A 4IS2A 4E09A 3G7SA 1YCDA 2QDXA 2X3FA 5DX1A 3EEFA 1FLNA 1QG6A 1NQWA 2W58A 3RS0A 4EOGA 4CQNA 1CQZA 4GYKA 5AKHA 5AK0A 3U9LA 2A0WA 3B38A 4B9AA 3VNRA 2Z4RA 2ORIA 2RGUA 2VP5A 1F2DA 3IAHA 3RS8A 1YR6A 4C0SA 1QPGA 3CIFA 2BEWB 3MJSA 1EHCA 1QBGA 4NBUA 4D8WA 2WABA 4C4PA 3IBGA 5P21A 2GPBA 1YI0A 3OZFA 1EZZA 2JASA 3FI0A 1BXRB 1UDWA 3GRPA 4JLPA 5CAEB 3WL7A 1L7EA 5BSWA 4E5MA 3EXIA 3FZYA 4EGCB 1TAUA 3MAAC 3K1YA 1DADA 2VDRB 1X80B 1VKOA 3EDOA 1E6MA 2WJ6A 5HE8A 3UFXB 4FHEA 5MDHA 1WUYA 1U7WA 3OZCA 5TVGA 3UOWA 2Y0EA 3SM3A 1CJUC 2NX2A 4KIJA 4UM5A 1BW9A 4GC9A 1SB8A 2VUIB 4HQOA 4YP6A 2Q4EA 3THSA 5C8XA 3O8QA 1HZZA 1VG0B 4ZAXA 5AVRA 3FI9A 3CN9A 5EAIA 4PVCA 3HU1A 3RYIA 4L5JA 4PAGA 3JZAA 1QYXA 2AL7A 1HH4A 1IN4A 3C1UA 4KO2S 2AK2A 1KDZA 4R54A 1VLQA 3M49A 1DEOA 2YFQA 3JQAD 4JKYA 5E9JA 4GPAA 1JVBA 3G0BA 2JFOA 4QC2A 4ZO9A 4UNSA 5FLEX 5TSDA 3WG9A 3JQCA 2VHUA 4CPDA 2EJWA 3I0MA 2AWOA 1X0VA 1IBRA 2O5VA 2YWEA 1DAIA 2WD8A 2B25A 4YJ2A 1EJBA 3KSZO 5ALLA 3TLYA 1EEXB 1N8NA 4KDEA 2YZKA 3QHQA 3YASA 4EHFA 2JJ2D 1QRAA 3IJPA 4C43A 4OFZA 1CR4A 1FFAA 3JY6A 2PNJA 2BM1A 4RNDB 1UOPA 3KB6A 3TK1A 1WO8A 2VEOA 3K6KA 2ZS8A 3Q12A 4RVNA 1EZ1A 1SG6A 3BK1A 4Q3CA 2YOGA 4K9PA 1TYZA 1QQAA 3FPEA 3WGQA 1NVBA 1G6KA 1P2UA 1IOVA 1OT3A 1ZVMA 2CCJA 4W9MC 3EZFA 3FJYA 4Q7LA 3DR5A 1HBJA 3AETA 4WESB 4DR2B 4IJKA 5EZ6B 4FYPA 4KPGA 1D04A 2GILA 4TMFA 3MK31 3FN4A 3VISA 5G3YA 5EJ9A 4Y2QA 2DWQA 4Q1DA 2YYYA 1MAAA 3H5IA 1QCDA 2H0QA 4LE0A 3ROFA 2XIQA 4B6RA 4JENA 1V9LA 3GCWA 3CUSA 1SCIA 3MLBA 1Q7EA 2ECQA 3CXRA 3FHCB 3KWJA 4CDMA 4D80A 1T29A 2QRVB 4EGAA 3ESAA 4MVJI 1TO1E 5I7SA 3GGJA 3LLUA 3NDBB 3ENKA 4HQLA 3UW3A 3ZWAA 4ZHQF 3GBVA 4AG5A 1QH0A 1X15A 1ECJA 1E4EA 1DCFA 1JUDA 1XWIA 1TU3A 4KAXA 4CNBA 1M67A 1XD2B 1ZKDA 1V5EA 3N39C 1DCTA 2JGDB 4M1EA 4DCNA 4EY4A 4GMXA 1SIUA 1EXMA 4TLBA 1UK9A 3B7WA 5FTWA 4V0LA 1QQ7A 2WZDA 3TJMA 4C9BA 3OSUA 1ZD4A 4JB0A 1VLJA 1EKXA 1JFLA 1YZLA 3Q1LA 1LBHA 1JZTA 5EJGA 2Z4SA 3RC8A 1B2RA 2KX7A 4LJAA 4MRVA 2AVDA 4NYIR 3OLZA 2AQ8A 5JD5A 4BFCA 3S2IA 3N0VA 1T43A 1KMHA 3HUUA 3R5SA 1Q50A 4GVLA 4J4HA 1G6OA 3HN7A 1E2HA 3BMXA 4JN6B 1E5XA 4HXGA 4JXKA 4I55F 4CF4A 2ODTX 4XFJA 4D8YA 3TSOA 5ALUA 1I13A 5LSAA 2VTBB 2CLKB 2WIKA 4WWHA 1GZUA 2HMSA 2WC1A 5ICEA 3A9VA 1GUYA 2XVZA 1DFGA 3L0BA 1NVXQ 2WVGA 3I9FA 2RGNA 1WY7A 4FYWA 2TMGA 3X43A 1VKRA 4II3A 2P1ZA 4RF5A 3V7WA 2X3YA 4ARBA 4I19A 3DDHA 3WO0A 1EDZA 2BM8A 3OPQA 4CIWA 3EVFA 4GR4A 2IQ5A 1KIMA 1C30B 2CL0X 5ENZA 7REQA 3UJHA 2D7CA 1MBZA 5DHPA 5TNXA 4YJGB 4NRDA 3RJ5A 1SU8A 1G19A 1VSUA 3JVVA 4NZNA 3LFUA 2Q46A 3EIOA 1NDUA 4RXUA 5FI5A 5AUQA 5J9FA 1EFPB 4B3FX 1KAQA 2CV0A 3EOAI 2J9GA 4OY3A 2FEXA 1WB6A 1W2WB 3F0TA 4FSXA 1V8BA 2JL1A 4LSGA 3HVUA 4TVBA 1C8VB 3CLVA 1SUSA 1PL8A 1XTRA 2BGRA 2CMHA 2I29A 4PXAA 5MN6A 3X1MA 1U3UA 5HF5A 1K6MA 3H18A 1TX4B 1J1ZA 4MKXA 4MPRA 1VXRA 5ALRA 5BN4A 4M0LA 4MQBA 2O8FB 3EAGA 5F1PA 3ZVNA 2IY8A