4DLRA

H-ras peg 400/ca(oac)2, ordered off
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlrA00
4L15A 1W0KD 2JLZA 2DFKB 2GCOB 4W5HA 2RCNA 3ONWA 4ACBA 2FSHA 1CU1A 1S2MA 2ODBA 4KI0A 3FMOB 2YJTD 4AG5A 1PUIA 5CYPA 2CEAA 4I1UA 3GD7A 4NU0A 4R9UC 2X8AA 2ZROA 5FR2A 1W4CA 3IQWA 4C2UA 3IO5A 4RD3A 3WMGA 3ZIAA 3AF0A 5SZKB 1NMXA 3DL0A 1A1VA 4IXNA 3I8SA 3HJNA 4A0GA 2C9YA 5EJEA 4LJ9A 1NNEA 4ZKDA 1XMVA 2OZEA 3CIOA 3KB2A 4JLDA 4HDCA 1J90A 2B7BA 4PO1A 4IEIA 3C4JA 1W4BA 4JLAA 3SFVA 2NOAA 1SXJA 3LAWA 1W7AA 2QZ4A 2XB4A 5CJPA 1G8YA 3FMIA 1T91A 4GFDA 1XXHA 3GLGE 1D2NA 3RNLA 4PXAA 3FWYA 1UDWA 5EP2A 3CKLA 5TARA 4BLSA 3F0TA 1IN6A 3QPVA 4U02A 4WAUA 2NPIA 3K53A 4KBGA 1US8A 4DCTA 1X8LA 2PL3A 4A4DA 2GZHA 4ARZA 3PENA 4TQAA 1Z6GA 5CIQA 1CR2A 4CVNA 1JR3A 1Z0JA 2IUUA 4HDQB 2WAYA 5H8WA 2GA8A 2J7PA 3MUFA 1RE0A 3CR8A 4B2LA 1YZLA 4IOLA 1EG7A 3C16C 4P4SA 2ZUBA 5H70A 1Z83A 4W5WA 4C9BA 1E2HA 2FGJA 1ZUIA 1ETUA 3CZPA 3Q85A 3A1VA 3W3AA 5A0FA 2EYQA 5CB6A 3K70C 3GQBA 1XU4A 4NCHA 1SQ5A 1KYIA 4MKGA 3BFVA 2WWYA 4OI2A 4EUNA 2FMXA 5K8IA 4BLPA 4LV5B 3PEYA 1BH2A 1Z6AA 2ASEA 1AGPA 2WZQA 2Z6VA 3QQ5A 4OYHA 1Z6YA 4O2RA 2RGNA 1R8QA 2NQ2C 2C77A 4DLWA 1A2KC 4E5UA 1NSFA 4RKEA 1O87A 3P1JA 2CLDX 5H1YA 5FPHA 3BFKA 1IOZA 1YZTA 4YMWA 4L4UA 3TSOA 1W0KA 2YHSA 1M7BA 2IC5A 4US2R 4C0HA 2JDIA 1N6KA 1BKDR 4M2LA 1D2EA 3B1XA 2VHQA 2ORWA 4DLTA 1G4AE 5E7IA 2ZRJA 2WWIA 2ZI5A 5KDDA 3K09A 3SN6A 2NZJA 4Q4HB 1D8TA 2F1HA 3U61B 3EWSA 1Z22A 2PMKA 3K0CA 2W6JA 3K0FB 4KFTA 3IDQA 4IDOA 3AGPA 2QA5A 1B0UA 2ZAOA 4EFMA 4Q18A 4URWR 3RSOA 3X1ZA 5IRCD 4FW9A 3NDPA 2FZLA 5KPDA 4AD8A 2QGZA 1I4LD 4I1SA 4PPNA 4UXJA 1Q1ZA 2BDTA 4RFSB 1ZBDA 3VR6A 2O8FA 1TF2A 2Z5FA 1II9A 4PR0A 1TQ6A 1UBEA 3U3MA 1CJMA 2ZJ5A 4KLZA 4ZDKA 1LS1A 1KI1A 4BFXA 2JLYA 4C7OB 3LO5A 1ESMA 4PAMA 3B9QA 4JLNA 1NY6A 2PCLA 4P4TA 1ZM3A 3K0FA 4TL7A 5TB5A 3SFZA 2MSDB 4S35A 1LB1B 3U4QB 1OKKD 2X77A 4R71A 5SZIA 4OQLA 1E79D 1E4VA 5EXXA 1YR8A 3REFA 4BPBA 1CR1A 1LW7A 1U0LA 1EFRA 4KFUA 2VF7A 3R9WA 4B3GA 1DAFA 1Z28A 2WKQA 4HZUB 1P9NA 2IUTA 4WW0A 5G53C 5A4JA 3HPQA 3VX4A 2QRNA 1NBME 4JSYA 2SHKA 4LBWA 4EQ6B 1UKZA 2QSZA 3WP0A 4P4UA 4US1R 2O8BA 3LQQA 4S2EA 3LBNA 5FFMA 3FMPB 1XD9A 3JVVA 1W47A 2BVNA 2CHVA 5CIWA 3BXZA 3AVTA 3EIHA 4PC3A 5C4MA 2P6RA 4V03A 1P2VA 2EU8A 2EYUA 3FGNA 4PC1A 3RVBA 4CT4B 4L9WA 2ZI6A 3IIMA 5DGXA 2PX3A 3B2EA 3MRSA 2NO0A 3HWSA 1E2QA 2AHOA 1KAGA 4JJZA 5C18A 3KKQA 4G5SA 1QG2A 5BQ5A 3RHFA 4G1UC 2QAJA 3U6KA 5UKDA 3K70B 1VCOA 5HZHA 1II8A 3FVQA 3NHBA 5E7JA 1XX6A 4LWZA 3U7EB 5FOWA 1HE8B 4I81A 3ZVMA 4Q47A 1OSNA 3WHKA 3T34A 4K81B 1T3LA 1XXHE 3GLGA 2GTPA 3HYTA 1FP7A 5FBVB 3PIRA 1E2NA 3QJYA 4HLUA 4KV9A 2AFHE 1MRSA 3AKCA 1EESA 1R5BA 1CEEA 2BWJA 3BB1A 5C4GB 3BE4A 3EZ9A 2NIPA 3GP8A 3CB4A 3SI7A 4DCVA 2HXSA 3V4RA 4IHQA 2JASA 2GDJA 5EXTA 5CB8A 2B8TA 1EFUA 1N6IA 3CONA 3QSYA 4QXAA 1XJQA 2YV5A 4FMCB 2ZSBA 2REOA 1SVWA 2F43A 4C0JA 1AQUA 3NKVA 4B48A 3EZFA 1KO1A 1E9FA 2GJSA 4W5JA 1JXOA 4RD2A 2O0JA 4NL4H 5JBQA 3NH6A 2WMOB 4C7OA 4A2PA 2B6HA 4K46A 4H9GA 4YC7A 2J0QA 4RZ3A 3K9HA 2FX3A 3PUVA 3WXMA 3LY5A 3U2QA 1N6PA 3N5CA 5JS8A 3FKSD 4GZMA 2RHDA 2ZAMA 3A37A 2Q9AA 1G4UR 2ZETA 2R9VA 5CM8B 1W36B 3QVVA 1LF5A 4MKHA 1XTJA 1MKYA 3OIYA 1KY3A 1T4GA 2P2LA 1NBMA 3F5FA 3W34A 2L0XA 3RABA 1E9AA 3SQWA 1X3SA 2JAQA 4PSVA 4LJ4A 1ZM4A 3J81k 3NHAA 2G6BA 2QG6A 5E7MA 3TQFA 1ZD1A 2GAOA 2CMKA 4CEJA 4V0KA 2OAQ1 1QHHA 2GK7A 2QT0A 4RSGA 3TAHA 1VDZA 3VHXA 1U90A 2V55B 2ZUDA 5FUVA 1NVVQ 1T8UA 3Q5EA 2QT1A 3F8TA 1R6BX 3B82A 3OF5A 4CW7A 1SULA 4B71A 4OK6A 4PFSA 2OM2A 4EQ6A 4NYJR 2AD5A 5BN4A 3LW8A 2ZVPX 1N6HA 1JJ7A 2UVQA 4WZAE 4TWZA 1VHLA 1WCV1 4YMTA 4AYWA 3BIFA 5FBRB 3BD9A 3RS0A 2G77B 5GJCA 1V5WA 5AR1A 4LOAA 2VP2A 1G41A 1KMHA 1U99A 1XXHB 2FEMA 2ZE8A 3QIAA 4UQOA 3QEOA 1N6RA 1E0AA 2D74A 1EX7A 1DELA 1FNMA 3TW4A 2D7CA 4WVFA 4W9MC 3VNUA 4TYYA 2WWWA 4RZXA 3EWAA 5DI3A 2CCGA 2FWRA 5C2JB 1ZCAA 4OK3A 5JMTA 3UG7A 4Q4AB 3KTAA 4KFSA 4Q9JA 3VR2A 3SYLA 4MDFA 1GKIA 1MOZA 4LSGA 1VCNA 5B58C 1P9RA 5B30A 4FWTA 2WAXA 3PCRB 3GCGA 2EWVA 1UBFA 1D9XA 4PZZA 2DCUA 4BLRA 2IS6A 3UIEA 2KJQA 1S3GA 2P5SA 1Q0UA 4XVUA 2F3RA 3L43A 3RS4A 4D4LA 3HYRA 3QOFA 5G3YA 1E94E 3VTKA 4C3ZA 2MSCB 3H2YA 1Z0FA 2WMNB 3AP2A 1G5PA 5DISB 3ZIAD 3QXSA 4DLZA 1QRAA 3WP1B 1RYHA 4LPKA 2HCBA 1N6LA 2DB3A 3RSLA 2VSOA 3QBTA 4TMVA 3ECCA 3IHLA 1SXJB 3P20A 2FFQA 4OI4A 5KNCA 3TVDA 1JR6A 2XSZD 1OFIA 3B8HA 4ILEA 4P32A 4X8HA 3NTUA 4HYYA 1N2CE 3T1VA 1G8FA 1MV5A 4RD4A 1N25A 4HB4A 4TL6A 1XWIA 1S4QA 3R9XA 3EPHA 3QEJA 1ZYUA 4P31A 1SKYE 4IFBA 1WQ1R 1E69A 2IS4A 4OJQA 1KSGA 4ZDJA 4RKFA 1HT2E 1JR3E 2KB0A 4C0QC 5BYKA 4FI3C 2VP9A 5TDHA 4NYIQ 1GDDA 3LX5A 4TLBA 3DPUA 1XEWX 3OAAA 3P26A 4AYTA 4TTQA 4JL8A 4JZKA 2K5UA 2ZRCA 1U9IC 4GMDA 4GMXA 5CK5A 2ZR7A 1ZD9A 2O0KA 1E9CA 3NWJA 4QGHA 2GESA 3PITA 4JLMA 2ANBA 621PA 2FNAA 3IGFA 4YMVA 2OILA 2VF8A 1E0SA 5AJWA 1WF3A 2EFGA 2X1VA 2AD1A 3GJ3A 3I92A 1H65A 2O8EA 3X1XA 2VH5R 4Q9LA 3RS3A 5FI1B 2Z4RA 1W4RA 2HLDA 3RANA 4MDEA 2R62A 2IF0A 4TN1A 3GJ4A 4TLAA 1JPJA 5EQTA 1J2JA 5IT5A 1KKMA 5CK4A 1AM4D 4HAWA 2GBLC 2PZGA 2GK6A 2FJUA 3RS7A 1MH1A 4OHWA 1YR7A 2WJGA 2ZRIA 4BRWA 4F38A 2A30A 3KQNA 3ZQ6A 4JLJA 4G5QA 2VP0A 1OKKA 1ZIOA 3LVRE 4B76A 4UNNA 1DAMA 4FIDA 4Q19A 4TT3D 5EE3A 2V9PA 1NLZA 2QGNA 1ZU4A 2ZSFA 3A36A 3EG5A 4UJ3A 2IWRA 3RS2A 4YQFA 5JJLA 1G17A 1CP2A 1P7CA 4GSYA 5TXGA 2G0NA 1VG0B 1U98A 3NC0C 4DEYA 3UKDA 4V0MA 3MJHA 1OXXK 1T6NA 3B6EA 1E2EA 3GFPA 4M1TA 2OBLA 2IF2A 2EWWA 2ZI3A 2IEZA 2J0UA 1OFTA 1B23P 1HTWA 1I4TD 2H7VA 3IQXA 3WRYC 3E2IA 3B13B 2DPXA 3ETLA 1VCIA 4L9SA 1KJYA 4AG6A 3HR8A 3VKGA 1L7VC 3PVSA 2RAPA 1ZAKA 3H0KA 1ZM2A 4URUR 3QNUA 1HUQA 4W7SA 2Q21A 4Z54A 4LY6A 4A6XA 2NO1A 2MSEB 2BC9A 2JCSA 3SS8A 1OIVA 1UF9A 2R6AA 3UANA 1R0WA 3E70C 4IOJA 1P4SA 2FA9A 4TQUS 2OXCA 1K8RA 2WSSD 1KSFX 1F2UB 2ZRPA 1NKSA 1NVVR 1XD8A 2ZJYA 3CZQA 4WXPA 4CDGA 2V1UA 4FXPA 2C03A 4BGDA 2FG5A 4DUGD 2J0VA 1UBGA 2Q3HA 1FUUA 3KFXA 3GLIA 2PT5A 4JKYA 4CYMA 1U8AA 2GWHA 1L8QA 2P6NA 5GVSA 1QHSA 4URXR 1G7CA 1PV4A 4AI6A 1DOAA 4N3NA 3OEEA 2AXPA 1JEDA 2Q9BA 3EZ2A 3L0OA 1TNDA 1CLUA 1OHHD 2RH5A 2GXAA 1FX0A 4HZUA 1GKUB 2ZYVX 3QXHA 4TMWA 2WOJA 2ERXA 4A8JC 3CX7A 1W36D 2WBLC 3CF6R 2QP9X 4KFRA 4JBWA 1YR9A 3GLHB 1G291 2PH1A 4KHZA 4EPTA 5B64A 1IXZA 2BKEA 2KBEA 4HUTA 3TUIC 1E2KA 5FPKA 4DB2A 3A8TA 3GMTA 1JI0A 3BH0A 2F9MA 4IVPA 3CWQA 2J3EA 4PQYA 1LFDB 1MO4A 3I73A 4JVMA 4LHVA 1VIYA 1S1CA 5CLLA 2J7PD 2BM1A 5AK0A 4UNRA 5GJBA 3I1FA 3HU2A 1E9SA 2BEJA 5EXPA 1M2OB 1NY5A 1L4UA 5DE3A 1DBSA 1ZMXA 2IYQA 1UDXA 3TR0A 4NCIA 3FDIA 4XD7A 4A36A 3WYFA 4Z1MA 2ZANA 3R7WB 1QHGA 1NMYA 4NMMA 4R2HA 2ZEJA 4RFSA 1QZXA 4R2IA 1QHHB 1W0JA 3BB4A 2VHJA 1HE1C 1Y63A 2GF0A 5TV2A 5JECA 3EPKA 4PHGA 1ZM9A 2IYTA 1GZSA 1CULC 3KJGA 1G3MA 1FMJA 3KDSE 4ON9A 3GLFB 3SJZA 1TF7A 3C7KA 2R8RA 4E03A 2GNOA 3TBKA 2IYUA 1SVSA 2BMDA 1G9XA 1W49A 2VRWA 2NG1A 1VHTA 2VQSA 1TAGA 5B2ZA 3CWZA 1MABA 3MJRA 1FMLA 4LRWA 5FUXA 2QTHA 3OEHD 4M8NE 2P0EA 4LDJA 3L0IB 1E4YA 2GBLA 3MLEA 1ZCBA 3B1ZA 1CKEA 4XVRA 1LY1A 3MAAC 1JPNA 2PZFA 3B7GA 5L3QB 1UEJA 1OB2A 4WZBE 2OAP1 4B3BA 1FTNA 4TZ0A 1UKVY 3U3OA 5F3WB 2WWFA 2IYYA 1LV7A 2H17A 2ZIAA 2IHBA 4C2TA 2XEXA 2O8CB 5FBWB 4MUBA 3DKPA 1CJKC 1NN1A 4BRUA 2KSQA 2IK8A 1GL7A 2G3YA 3LXRA 4M9ZA 1GM5A 4MGZR 4PHFA 4D0GA 4ZKEA 1T9HA 3TLXA 4U00A 3RWOA 1KO8A 4EPWA 3G82C 1TQDA 1E2MA 521PA 3SYKA 2D7DA 1XMJA 1VG1A 2ZJBA 1Q3TA 4HUQB 3GLHA 2H5EA 3SBEA 3V00A 4QC2A 3VR4A 5J4VA 3H84A 4G3XA 1AKEA 2GXSA 4EPXA 4M1SA 2PBRA 4P4SB 1FX0B 2CVFA 4CEIA 3AP3A 4PSKA 1FP6A 3RRZA 4BWYA 3IBYA 1X6VA 1XNJA 4F92B 4IVRA 1KNQA 2IWHA 2I1VB 2DFTA 1W46A 2PX0A 2XSZA 1U0JA 3UMFA 2IL1A 2QEQA 3VMFA 1TU4A 3EARA 4HB2A 2YNMA 1N0WA 3FFAA 4P33A 5FUYA 3TAUA 3L82B 5CYOA 4ABYA 3T35A 3QKTA 5JRJA 2DWQA 1GG2A 5KDLA 3VU9A 1RYFA 4XSGA 4URVR 1H8HD 4MUAA 1P2TA 2ZE7A 3CR7A 4Q1AA 1Z5ZA 3KKNA 1OYYA 3Q72A 4QL3A 3KXIA 3CX8A 4O2LA 4CGZA 2YWGA 2WJJA 5E95A 2ZRLA 1SXJD 4Q1CA 4IOKA 4NYMQ 1W4AA 1S96A 4BZQA 1OH7A 2R6CA 3NG1A 1ZU5A 4PQRA 3CNNA 2W2XA 4I1VA 2WWXA 1J70A 4WBSA 2V6JA 3HDTA 4HI0E 3NBFA 2QI9C 2REXB 5G40A 5LB2A 4EJSC 2XOKD 1AS2A 2A5GA 4Q01A 1UADA 3I3SR 4N0DA 4MYTA 3BGWA 4MKFA 3NIBA 4BZPA 2CCKA 2JJ1A 1C9KA 1DO2A 1R2QA 3AB3A 4FMDB 4LC1A 1GNRA 1YR6A 2IX3A 3BAFA 1XEWY 1Z3IX 4XSHA 4Z8XA 2BBTA 2AWOA 4D80A 3GLFE 3VKHA 1A5TA 2NZ8A 2WOOA 3U44B 5J40A 2DHRA 1IN8A 1LNZA 1U0HC 3I5YA 2ZR0A 3A58B 4GT1A 2P3SA 1K5DA 2FEOA 5JHGB 1OH8A 1GUAA 3DVLA 2H16A 2GZAA 4RY2A 1HT1E 1VCMA 2C98A 2GJ9A 4EFLA 4B6FA 1H8HA 4ZDWA 4AY2A 2YOHA 2AFIE 3BWDD 2A5DA 1G19A 821PA 1DAKA 4ITRC 5AUQA 1KZ7B 3Q3JB 1OT3A 2HJGA 1XMIA 3CPJB 1NVWQ 4LGMA 1N5JA 2NPFA 3GJ8A 5IHPA 4US0R 4KVAA 1GOTA 2FPKA 2V54A 4B2PA 4Q4AA 5KU1A 1F60A 1Z2CA 1KI8A 4V0LA 4F4IA 3KQUA 1CIPA 4MYUA 3SJAA 1HV8A 3U3JA 4DEXA 2ZRGA 3TUJC 1V43A 4F7WA 3KQLA 1K5GA 2RGEA 1GTVA 2ZI7A 1P72A 1FZQA 1RFLA 3EX7C 3NXSA 2VEDA 2BBOA 4DSNA 4BLOA 4B3DA 4ZO4A 1VMAA 5FTJA 3KXKA 2C04A 3GLIB 1XF9A 3C41J 2PEYA 3RC8A 1W5SA 4HB0A 1AGRA 1XDBA 5KDOA 4B44A 5JEDA 2WV9A 2XZLA 4TYPA 1QHYA 4XTCS 1Q1BA 1EFHA 2GKSA 2F1JA 3FOZA 4XH9B 2KWIA 4E07A 5AJZA 4DBLC 2A7QA 5HPYB 1T0JB 4QJ3A 3X2SA 3EIEA 2CLSA 4BFYA 4NP6A 1W2HA 3SC3A 4JYBA 4M21A 1XTKA 2OCBA 2QORA 1H8ED 2GETA 2IUSA 2QAGC 2V1XA 4KVGA 4CIDA 3U5ZB 2XB2A 2I3BA 1ZC4A 4KAXA 3OHMA 3HU1A 5KSYA 4V0OA 3OE7D 1MO3A 3IPYA 5AUOB 2JJ1D 5AWFC 2ZE6A 4MH0R 2V4ZA 1COWA 4CEHA 1R7RA 1T0HB 2IEYA 3W8RA 4EDHA 4A0HA 2ERYA 4LZZA 1ZP6A 4OK5A 2G1KA 4AK9A 1SGWA 5LDDC 1EGAA 4DLYA 4OHXA 1HY3A 2F1IA 2YVUA 5IDVA 2QTFA 4RD0A 1Q12A 4C30A 2A2ZA 2YC2C 3P27A 2H57A 5M04A 5L3SB 3C15C 1DG3A 4DHEA 1DADA 3L0SA 2ODNA 3TQCA 4BFTA 2BMEA 4AC9A 4A8JB 3PFIA 4PC6A 5DSZA 2WSMA 2NGRA 4JLOA 3W9YA 3W6PA 2J7KA 1EFTA 4GP7A 3BOSA 1E9DA 3IIKA 3DHWC 3QUSA 1T5IA 4RZUA 1G64A 1OIXA 5GJVC 2ORVA 3SHFA 3X1DA 1C4OA 4AYXA 1FW6A 1N0VC 3I62A 1RRPA 1E9EA 1G3UA 4Q1EA 1EWQA 2PZEA 3LXXA 1NBMD 4L8GA 2O8CA 4M1KA 4GOXA 3CNOA 2CK3D 3R9IA 2UKDA 2CBZA 4YONB 221PA 3PXGA 4LJ8A 5L3QA 3U6BA 4OBEA 3FKSA 1T8TA 4CZ2A 4M22A 5KTYA 2OSBA 3QXJA 4DLRA 1DAGA 2FFBA 4NYMR 1KDRA 3RS5A 4URYR 4Q5IA 1G1MA 2J41A 4B3CA 1XTIA 1RRGA 1XBTA 4GNKA 2ATXA 1EX6A 3BH6A 3H1TA 3L8ZA 4PTLA 3EA0A 4M1WA 5EUQB 2GVZC 1PJRA 4DCUA 4QJ5A 1XD2B 4IVQA 4AKIA 1CXZA 1AS3A 4TLCA 1RPZA 1NLFA 1MO6A 1KI9A 2WKPA 4F4CA 3WMEA 2CL0X 2G83A 2PLRA 1P62B 1R4AA 3I4LA 4D0LB 2CDNA 1A82A 3TMKA 2EFDB 1MABB 1TEXA 1XEXB 1DPFA 1KTVA 2DYKA 3KXLA 4LJ5A 2AXNA 4H1VA 1OXSC 4FD2A 4PPGA 2HXYA 5P21A 5JEEA 2XTNA 2BHRA 4URZR 4HSEA 4XJXA 5KNDA 4Q4JB 5FBLB 5FTKA 1ZUHA 2QM7A 3QY0A 3DZ8A 1P75A 3LLUA 1ZNWA 4I1OA 3M6AA 4QG7A 4QNRA 4CT5A 3FFBA 4TMKA 1YRBA 2XITA 3EASA 3TJZA 5LD2C 1TTTA 2PLFA 2QAGB 4DSUA 1KJZA 2R6DA 1Q21A 4MRPA 2JLWA 2ZRKA 1C1YA 3FYHA 2JJ2D 3MMPA 3N70A 3AVXA 1T5LA 4Q21A 1U8YA 3D3QA 4Q9KA 2B7CA 4A8JA 1OLOA 2NO9A 3LX8A 5FTNA 2J45A 3MD0A 1KSJA 3ICEA 1NVUQ 4BUJA 1YKSA 4MRSA 4XTRA 3ICQB 1FTSA 4OQFA 1BOFA 1TU3A 2G88A 2ZRMA 3GLHE 3PUXA 3TGPA 2NMVA 4FCTA 1F5NA 3UPUA 4XD7D 3MWLA 2RGBA 4CEIB 4HLCA 1M8PA 3QKRA 3FHCB 3QXXA 4IDHA 3WY9A 1DTSA 1UFQA 2WICA 4JKIA 3OEHA 2QMOA 2IBMA 3TKLA 3ZVLA 1F48A 1XCMA 5AJXA 3V9PA 1Z0DA 4QM7A 3LH5A 2JLSA 1OXTA 4BZXA 2GCNA 1DAEA 1XTSA 3SZRA 3ZQJA 2ZJOA 1P61B 2ODWA 4ZI2A 1IONA 4DDWA 1IXSB 1SVKA 3MGCA 4JBYA 1G18A 1TEVA 3QF7A 3ZS9A 3BK7A 1D2MA 4BFWA 3B1YA 3TW8B 2XXAA 2AK2A 1ZD8A 3GLFA 3A1WA 1JB1A 1GILA 3T15A 3NH9A 1RZ3A 2IXFA 4JS0A 1LS6A 1IQPA 1CJUC 3B5JA 4QHSA 4XVQA 5GJWC 1YZGA 4M9XA 3TRFA 4GL2A 1W44A 3ADCA 3W5JA 5FUWA 1KI4A 4UNPA 2FZ4A 2C2HA 2F1RA 2V8OA 2QQEA 5JZVA 1E1RA 2OO7A 2D3WA 2ZYUX 3CRQA 3WHLA 4F93B 2FSGA 4OHVA 4EPRA 1KNXA 2IW3A 1LVGA 3D6TB 3FMFA 5JCPA 2HT6A 3TE6A 2RMKA 3AF2A 3V4FA 3C5CA 2OEPA 3QG1A 4Q00A 5FL7A 2N42A 4Q9HA 3T5GA 3CF0A 2VTKA 4IOMA 3BORA 1XP8A 3EC2A 3CBQA 3MWYW 3GFOA 2OCPA 4C0BA 2QSYA 1IAQA 1U94A 4B34A 4K8OA 4FMDF 2QPAA 3AH8A 3ZZTA 1XRJA 4BFVA 3O8CA 1XZQA 1X8KA 4OL0A 4QGGA 4DIDA 1VG8A 4I4LA 3KQHA 5JJKA 2WJHA 2ZUCA 2A5FA 4MQBA 3EZ6A 4YXWA 4Q66C 3S1AB 1U81A 2GCOA 5HKKD 4Q4JA 3DOEA 1Z07A 2BIFA 4BFZA 2ZRAA 3IBGA 1HH4A 3K0CC 4HDOB 4Q03A 2FPMA 3QENA 5DYGA 5TMPA 2O8EB 4D4KA 5EXSA 1PLLA 2X2FA 4DIEA 4FWIB 2QROA 4DKXA 5KPJA 3T1QA 4MGIR 3D7MA 3NBXX 4B43A 4HAUA 4LBVA 5BWMA 3CLVA 4OI0A 4M9QA 1ZM7A 4ZCLA 2ZRDA 3EPJA 3REGA 3VR5A 2OG2A 2GEVA 3I32A 4F91B 2GAAA 3U60B 1VTKA 3OIUA 4RZ2A 3B78A 2W6JD 5FOVA 1NJGA 1E1RD 3DM5A 1Z6TA 4UNSA 2AKAB 5EZ5A 1P73A 5G41A 1EXMA 3FTQA 3GLGB 3L8YA 5DN6A 5JHHB 1BYUA 3CUEF 4IRUB 2C8VA 1XPOA 1E2IA 2WPDD 2HYDA 2OCAA 4EJSA 1KAOA 4A9AA 1P3JA 3FE2A 2OLKA 1J8MF 2J5XA 2NTYC 4DDUA 3SEAA 4KLNA 1WBDA 1JQLB 4PHHA 2O8DA 2HLDD 2VHUA 2ZI9A 4FMCF 4R7ZA 4QFMA 2FH5B 2BEKA 5KSPA 4M0LA 2QPTA 2VP5A 1G5TA 4ZIRB 1MO5A 1Z06A 2GVDC 4OQNA 3CRRA 3WMFA 4OHZA 2X19A 1DAIA 3FPAA 1ANKA 1HA3A 1GL6A 2TMKA 4NTZA 2Q9CA 2Q0HA 3PEVA 3LD9A 5DI3B 4AIIA 1XTQA 4NKRA 3CW2A 3OE7A 2F3TA 4A82A 2ZU0C 1DE0A 2C99A 3PQCA 3OIVA 3R20A 2QN6A 1EWRA 4HATA 2CCJA 2BBSA 3NBZC 4HUQA 4NYJQ 1N0UA 4C0KA 4Z51A 2ORIA 4ZCMA 4MRVA 4UXHA 4ACAA 1Q57A 2J46A 4QJ4A 1W1WA 2OCYC 3SBDA 3ND8A 4Q02A 3WNBA 1XCGB 3K9NA 4Q4HA 4HAVA 2DBYA 2QQ0A 1OYWA 2XJ4A 4QBIA 1JNYA 4YDHB 4FN5A 1VYUA 1CBUA 4D82A 3A1TA 3AVQA 1WP9A 2I4IA 1DG1G 5JI2E 2QMEA 2QUZA 2ZSAA 4WOPA 2F55A 4DSOA 1P60A 4Q48A 4QGAA 2GEUA 2ZYTX 4NBSA 2OXRA 1TQ4A 1XTRA 4TMXA 4WA7A 3Q7QA 4Q1FA 3TSWA 1RIFA 4E22A 2PMDA 3T06B 3DM9B 4B73A 4MITA 1TPZA 4A2WA 5G3ZA 4D4JA 4QKQA 2RGXA 1NKTA 1BMFA 3KJIA 1KJWA 2RKOA 2Z0MA 2RGDA 4LYJA 1YVDA 2ZJ2A 3LFUA 1GITA 1RW4A 5FPSA 1E32A 3TH5A 4KO8A 421PA 4IJMA 4LI0A 2PJRA 1RJ9B 2P6UA 1W48A 3LA6A 1F2TA 2J1LA 2AN9A 2CHGA 2ZPTX 4PZLA 3U7HB 4QM6A 2REBA 3BBPA 4M4SA 3MFYA 3LW7A 1ZVQA 3OEED 3NEJA 4CF7A 4RVCA 3GPLA 1R0YA 1R0ZA 3TSZA 5DN6D 2V3CC 5EE0A 1N6OA 4JVNA 4DT1B 2QMUA 3RWMB 4A0RA 1YE8A 1TUEA 2GF9A 3BB3A 5CDFA 3NBYC 1VG9B 2EW1A 1FQJA 1XJ0A 3DMDA 5FOUA 3GLIE 1OB5A 1X8JA 3DKVA 2ECKA 5K8TA 2HCJB 1WDTA 5J5CA 4HAYA 4PZYA 1KGDA 4C0SA 5FTLA 4TMZA 3VAAA 3SNHA 1CR4A 2FSIA 3SR0A 1CS4C 2VP6A 2RGCA 2A3RA 3SOPA 3R8CA 3QVUA 3THXB 3B9PA 4MA4A 3CRVA 1Z63A 1QHXA 1IN5A 4G0NA 2N1BA 1PZNA 3GJXC 4D4MA 1BMFD 2Q6TA 4KODA 3TR5A 2GEDA 4C0AC 3L2OB 3TNFA 3EXAA 4JLPA 8OHMA 3GEHA 2VSFA 4B75A 1E2LA 2V7QD 3PJRA 4OQXA 1VIAA 2QBYB 1FL9A 1FUKA 2W0SA 1E1QD 3P4YA 4WXRA 5BYJA 4Q4LA 3UATA 1H8EA 4HEJA 3S1AA 2Z4SA 4HAZA 5DIFA 3PUYA 2H18A 1NMZA 3T61A 5AUPB 3B85A 4DB4A 1ZIPA 3PEWA 4V0ME 1U2RA 5J4KA 5ELXA 1OH5A 1IN4A 4HLUC 2FGKA 2OESA 2B92A 1E9BA 1SVLA 1GSIA 2R6FA 1G7RA 1ZUNB 2XJ9A 2I1QA 2YINC 2X2EA 1BS1A 3IKJA 4KYIB 4TTRA 2FDCA 4I99A 1WMSA 1Q44A 1ZINA 5FH9A 4JLVA 4QRHA 5DO9A 5C1BA 2YWHA 1NIJA 2XNDA 5HE9A 1NN5A 2VP4A 2XZPA 3QG5A 2VHTA 3CNLA 1KIMA 2UZIR 2O8BB 1NP6A 2Z83A 4G5OA 2ZS7A 2FU5C 3MSXA 3JZMA 3AVVA 1CRPA 1ESNA 1S9HA 3AGQA 3QI2A 1UKEA 3ZVNA 4R98A 4RCYA 4NCNA 4O3MA 4IW3B 2AX4A 3AKDA 3P32A 2B21A 4NZYA 2KBFA 3GJ5A 2EVWX 4M9SA 5EE1A 1P2SA 1AKYA 4OKSA 4EJSB 1DAHA 1HQCA 3O8DA 4DCSA 1SVOA 5FPTA 1X86B 1W0JD 5FOXA 2RGGA 1G21E 2QENA 1JQJC 5BN3A 2H92A 1CF4A 1G6HA 3THOA 3ND9A 4H1UA 2WTUA 1HURA 3AKEA 2H8KA 1F6BA 3A4MA 2FV8A 1JECA 2NO6A 3CM0A 4DCNA 4DLUA 1AIPA 2O5VA 4AKHA 4TL9A 2VBCA 2J9RA 121PA 3AM1A 1FNNA 4M1OA 1VPLA 4ARZB 3VHLB 4JVSB 1G3IA 3AKYA 2JLQA 1L4YA 2JA1A 4A92A 1A2BA 1GFIA 1P9WA 3PG5A 3ZZ0A 3THYA 4PAQA 4JMPA 5H68A 4PO9A 4QBGB 2WVJA 1YJ5A 4JVLA 3VX3A 1KMHB 2QPOA 2W6IA 4Y0VA 2BKUA 3K0AA 4LYHA 4PPQA 1KK2A 4HLDA 3VFDA 1WXQA 2HEIA 5CDFE 5IF9A 2HF9A 5JWRA 1PLKA 2GHIA 3K09C 4MYCA 3MCAA 5EP1A 5HCNA 4DXAA 1IJFA 5JI3E 2WHXA 2W83A 4BE7B 1XEFA 3Q7PA 3TK1A 3IEVA 1AQYA 5JFGA 4TQ9A 5LBIA 4TZ6A 2ZU6A 2JIZD 2ZREA 4BLTA 2W2TA 4KITB 4JBXA 3VR1A 3N2IA 1SXJE 1YRAA 3QPWA 3KZ1E 1KY2A 5FPYA 2GRJA 2W0MA 1G3QA 1N6NA 3K0EA 3QKSA 3WYGA 1MT0A 2CL7X 4HLQB 1I2MA 2G9NA 4Q7LA 2ATVA 2GZDA 2ZJZA 3SDZA 3A6PC 3CO5A 1P6XA 4IFEA 3RRYA 5L3RA 1M6NA 4LHZA 5FTMA 1X1RA 4ASUD 1S3SA 5EP4A 3LLMA 1KOFA 3ADKA 2OE2A 3TVTA 3QE0A 1E98A 3I8XA 4YMUA 1U9IA 2VSXA 5EE5B 3OESA 1ZJ6A 3AF1A 2ZYWX 5EZ6B 1D5CA 2A5JA 2WWGA 1US8B 4Z8YA 1I4DD 5K8LA 1LF0A 4IKEA 3VNVA 2C78A 1G16A 4JIMA 2QP3A 4WIAA 5SZHB 3IUYA 2BOVA 3A4NA 1OPXA 4G5GA 4DLXA 5JS7A 1WA5A 4TYWA 3W6OA 4N0EA 3WNDA 2IYRA 1XJCA 5GADl 4U5XA 4JT2A 1GRRA 3THWB 3L0PA 2JIZA 1TF5A 4LJ6A 2FPLA 2P65A 4B32A 4EKDA 1T3SA 2ODEA 4LJAA 1OJLA 3KTAB 1COWD 3JVUA 3AVPA 2Y8EA 2BJVA 1YHNA 4GI7A 4O25A 1NG9A 2IA5A 1KI3A 4LPSA 4PSAA 2JLRA 4EPVA 4YMSA 5L3VA 4BFUA 2IYVA 2QAGA 3CH4B 4Q7KA 3HR7A 1QBKC 2QBYA 4V02A 1M1YE 2GJKA 1NSTA 4P0TA 2LKDA 4M1YA 4A1FA 1S8FA 1JJVA 3BFXA 3ZYCA 1XPUA 3NC1C 3A1UA 3OIWA 3GJ7A 3SE0A 2O8DB 3PUWA 4KSBA 4X8LA 2OFWA 5HR5A 4MYHA 4CEHB 3GJ6A 2WIAA 4U7DA 1W5TA 1WBBA 1QG4A 3HP1A 1NLYA 2J59A 4V0NA 3U7GA 4ZIRA 2QRZA 4PQFA 1PUJA 3K1JA 1DO0A 4JLKA 3GJ0A 5JWOA 1EFRD 3QKSB 2Q3MA 2EQBA 4KCGA 3THXA 1OXVA 2CJWB 3QBVA 2A9KA 4GP6A 3ZGXA 1Z2AA 3F3YA 3KJHA 1KK1A 1S1MA 2C95A 3OFND 3QF4A 1RRCA 1RKBA 4RCZA 2J0UB 4B35A 2GXQA 3UMSA 4BQSA 2JATA 2YOFA 2YWFA 2AR7A 1GRNA 3KUCA 5J4LA 5KO2A 2O52A 3RDPA 1YZKA 3GFTA 4Z1MD 1N5LA 5KHOC 1IM2A 2CXXA 1NN0A 3AP1A 4JJKA 3ASZA 1GRQA 5AJYA 4Q7JB 2WPDA 2GILA 4XWAA 2AK3A 3AVUA 1JEEA 4GOKA 3IIJA 1OE0A 1GL9B 3QF4B 1AN0A 3AF4A 1GNQA 2XNDD 1KMQA 1IXRC 1ZNYA 5D3MA 5JSZB 2N46A 3LWNA 2QY9A 1ELOA 5FL3A 1E0KA 3NVAA 3Q8XB 3DO6A 4POAA 1UEIA 1VKJA 1YZQA 1JBKA 2R2AA 1BIFA 3FHTA 5LB4A 2XTZA 3ZLJA 5EP3A 3AEZA 3BH7A 3KX2A 4DVGA 5F98A 4Q7MB 3I72A 4XWKA 3VR3A 4DC9A 1IY1A 2ZJ8A 3ZH9B 3ADDA 3W3ZB 4RD1A 1VYVA 1DEKA 1TQ2A 4MKIA 4C4PA 1Y3AA 1NF3A 2RGNC 2D06A 2IYXA 4D25A 5A5GA 4NH0A 2RB4A 1G8GA 1M34E 2ONJA 4DZZA 4QBFA 3EC1A 1II8B 1Z0AA 4NYIR 4ERNA 1NL3A 4PC2A 1GNPA 3IEUA 4QOSA 1KK3A 3B60A 3TIFA 1OH6A 4B47A 1XPRA 2F43B 5DHFA 1E3MA 1BYIA 1AJEA 5E4FA 5B57C 721PA 1D6JA 2QM8A 2PCJA 1RVDA 3E5HA 4LV6A 2GJAA 6Q21A 1L2TA 2ZITA 1FPMA 3EA5A 1UM8A 3CH5A 1QDEA 4G01B 2VO1A 1O3YA 3T5DA 4UXIA 2PEZA 1R8SA 1UKYA 4IXMA 1A4RA 4LUCA 1IY2A 4C0LA 1OHHA 4A2QA 2PT7A 2YC4C 3HPRA 1M74A 2E9SA 1IY0A 2ONKA 3DEFA 4MGKR 1E2DA 1OF1A 2F7SA 2QL6A 4LHYA 3ZVRA 1CJVC 3WNCA 1G8PA 4J0QA 2ZQ5A 2ZVQX 2WWHA 4HB3A 1K6MA 3T1OA 1XZPA 1E79A 2JGNA 2JDID 3P4XA 3RYTC 2JEOA 2WM9B 3LVQE 5DH9A 2C9OA 4DUGA 3LQRA 3Q9LA 4AKEA 2ZXUA 2ZM5A 2H1LA 3NEYA 4PX9A 3BC1A 4BEBA 1JALA 1OFUX 4NPHA 4QBHA 4AKGA 4KU4A 4BLQA 2VYFA 4GPTA 2WJIA 4BASA 4OJKA 1AA9A 3QKUA 5JLJA 2ZTSA 2E1RA 1Z8FA 5TY0A 3R8FA 2O0HA 4LYAA 1KDOA 3DMNA 1LTQA 1U8ZA 3ZJYA 1NRJB 3KUDA 4N1AA 3CX6A 4BECA 1FQKA 1R5NA 1W36C 3AF3A 1ZW6A 3M4YA 1G3RA 1FFHA 4LHXA 2QP4A 1GKYA 4D2IA 4QHYA 2O8FB 2P67A 2GXUA 4D0NA 3GEIA 1JAHA 2C9CA 5D3MB 5JSZA 5CLQA 3W8NA 4TLDA 4PANA 1J99A 1PVOA 4D6PA 4KJZA 2VL7A 1EFCA 2G0TA 4DDVA 5J47A 1OXUA 2IXGA 2JJ2A 1KHTA 4ZV4A 2Q3FA 1QVAA 3MWKA 4PC7A 2MMCA 4PHTA 2GJ8A 4QGFA 3SJBA 4HAXA 3DDCA 4RD6A 2ZRBA 1GIAA 3B1VA 3THYB 4B6EA 1KKLA 3VQTA 1E1QA 1IHUA 1AK2A 3UK6A 4Q1DA 4OQMA 2LCFA 3H4MA 2JLUA 1KI6A 3HU3A 4LJ7A 3TUZC 1HQYE 2CNWD 2BMFA 2VA8A 3LBIA 1XCPA 1FOEB 4PPFA 2XAUA 3KKMA 4FCWA 4DRZA 2LKCA 3CF2A 2W6ID 4ESHA 3BERA 4IEEA 3SYNA 1XFAA 2CJWA 1KK0A 2D2FA 5L8VA 2P5TB 3UWOA 1A7JA 3C14C 3MG9A 1F2TB 4UJ5A 4L16A 1OV4A 3CRW1 3SQXA 3VU9B 1JR3D 1F2UA 1CR0A 4Y0AA 2FFHA 1ZC3A 5KSOA 2FF7A 3QKRB 3QPUA 1CRQA 3K0AB 4LC0A 4ASUA 5ANRB 1NVXQ 5F9HA 3KFVA 5D3QA 1R10A 3LV8A 3AVYA 1SVMA 4BFSA 2XTMA 4P3YA 1GWNA 1NI3A 5E3HA 1G6OA 1BO6A 3OAAD 2XGJA 1MR3F 2OLJA 1DVRA 3SJCA 4G5RA 3W5IA 4DDTA 3O8BA 2FE4A 2OHFA 1OFHA 1E96A 5DI9A 4RJLA 1IJEA 1TL7C 4GZLA 4II7A 4LV8B 4A6PA 3ADBA 3IILA 1NJFA 1E99A 5LD2B 1UPTA 3ZZUA 1NG1A 1Q3HA 4OHYA 1Z29A 2CNWA 1YZUA 2PJZA 1DS6A 1RRFA 2C5LA 2D4HA 2ZRNA 4NCJA 4WZ6A 4DJTA 4DLSA 2HF8A 2ZJAA 2IS2A 2DFLA 5FBQB 2ZE5A 1TMKA 2QMHA 2XNSA 4B3XA 3W90A 2DFNA 2WIBA 2BMJA 2BM0A 1VYTA 2DR3A 5HKKA 1UAAA 2W58A 3FB4A 4XWOA 3BRWD 3T12A 2OV2A 2HT1A 2J0SA 4GBMA 3PV0A 4GOJA 2IYLD 3WBJA 3THWA 3RLFA 3T1TA 2KI5A 2ZRFA 4ESVA 1KO4A 5J4YA 1Z0IA 4B33A 3K9LA 4B74A 1Q1EA 1KZGB 1T3HA 3UWKA 2AL7A 3PEUA 3IPXA 3AUXA 5FOTA 5BN5A 2HV8A 1Z47A 2JLXA 1P5ZB 1SXJC 3G5UA 4Q9IA 2AWNA 1S9DA 1I2DA 2VHCA 1J7KA 2W00A 3PR1A 2BV3A 1G7SA 3H86A 2D62A 2HUPA 2IHYA 4L5BA 4LBZA 3U3KA 2BJWA 5F9FA 1KSHA 4LK2A 4A0FA 3E1SA 3OFNA 4ZPXA 1AZTA 2FSFA 2YYZA 5KNBA 3X1WA 2B8WA 2ZI4A 4LX0A 2QTVB 4A15A 3EW9A 3O47A 2IS1A 5CITA 3K0SA 3CPEA 4JSTA 4XOIA 4EIWA 2WJYA 1RC8A 3ZD6A 4CEJB 4NDZA 4EPYA 3G0HA 4MRNA 4TYNA 2W2VA 1E2GA 1XEXA 4IDQA 4DSTA 2OBNA 1XD2A 4OI1A 1SZPA 4O0MA 1WE2A 3AVWA 5K8UA 2HYIC 4LCBA 3W6NA 3EZ7A 2D2EA 5BW8A 2FN4A 4FCVA 4ZCIA 4F4JA 2CLCX 4XIGS 1YQTA 1Z6XA 2BCGY 3JZAA 4MGYR 2R65A 4RFVA 5CJ2A 2FFAA 3CPHA 4TYQA 5IK2D 3SHWA 4M53A 1IBRA 3R7WA 5EE9A 2EFHB 1G5RA 1MRNA 1TUIA 4QHTA 2ZR9A 1SHKA 2R44A 5DLQC 4TSFA 3RC3A 2C96A 5KUTA 3WRXC 1E2FA 1D9ZA 1N5KA 5IK2A 1Q20A 3EIQA 1HEIA 2WKRA 5TVKA 4PO8A 1VECA 2BCJQ 4LJYA 4HZIA 2FOLA 3ZS8A 4X8OA 2R6GA 5SZJA 1AS0A 3I5XA 1NN3A 3AV0B 3UMRA 4JT4A 1M7GA 3EPLA 3WYAA 1IN7A 4KXFB 2EFCB 4NCKA 2QE7A 2G1JA 2DWOA 1CJTC 4X8MA 4DT1A 2QU8A 5JCZA 5HE8A 1ONBA 2CE2X 2IYSA 1N3BA 2LWIA 2V7QA 3UXMA 2GCPA 2ZSDA 2CL6X 3RAPR 4EAQA 3O8RA 1G20E 1GP2A 3SU8A 2XOKA 4ZDIA 2J87A 1Q22A 1RJ9A 4YXWD 1PLJA 3LNCA 1KO5A 4YLGA 3LBHA 4FINA 3FHOA 2CHQA 2RHMA 3GEEA 4TTPA 1X1SA 1TX4B 4TMTA 3N2EA 4PAOA 4DWJA 1QHNA 1W2GA 1J8YF 1EK0A 2MMGA 3IO3A 3U7FB 4GDFA 2IYZA 3ASYA 2HDNB 2WSSA 1WRBA 1S0UA 2VPPA 1ZNXA 1JAIA 1HYQA 2KE5A 4QNMA 4E09A 4EFNA 1G7TA 5HZKA 3K70D 1KDPA 2OBMA 1E6CA 2F9LA 2YOGA 3UG6A 3I61A 4TSFD 3RRNA 3KKPA 1XB2A 1WB9A 5JJIA 1ZNZA 1OW3B 2XXAB 5DHAA 5JRZA 3EAQA 5AUNB 4UKDA 5KOYA 1KI7A 1R5OA 1CTQA 1R0XA 1TADA 4LBYA 2QE7D 1N5IA 1UBCA 2A78A 1SKQA 4TLEA 1E2PA 3B1WA 3A1SA 3DZDA 5BXQC 4D26A 3M0EA 4AURA 1SKYB 3QXCA 2EFEB 2VIIA 5F2EA 2E87A 4D81A 1NIPA 3IHWA 4B2IA 3C8UA 1JXMA 3NDBB 3FKQA 4KSCA 4KYUA 5HCIA 1KDTA 2YKGA 3D31A 2OUKA 4B3FX 3KB1A 1QF9A 2CK3A 2OT3B 4TT3A 2IXEA 3D8BA 4JYCA 3MWJA 1GVNB 1ODFA 5FI0B 1G8HA 1Q1QA 3AQ4A 4JLBA 3C5HA 2AKYA 4NONA 5FR1A 2IT1A 2YZ2A 2DY1A 5C46F 3M1IA 4BEJA 3U3RA 2ZSEA 5KSZA 2JLVA 5L3SA 1ZRHA 2XX3A 2RGAA 5LPNA 3A4LA 3K9GA 1KI2A 5DNYB 4NHOA 2QNRA 3OZXA 2ZS9A 2ZRHA 2CVHA 5HTKA 1M7HA 1AZSC 1XMSA 1YZNA 4ZI3A 2CE7A 2DWPA 3AUYA 5CM9C 1P2UA 3U4QA 1QHIA 2HJVA 2Z43A 2F6RA 5GVRA 4DLVA 4LYFA 3BS4A 1YU9A 3KKOA 4FMBB 1SVIA 5DYIA 2JJ8A 3KL4A 3ZDQA 3AVOA 1OIWA 4JL5A 1II0A 2VLIA 4GRAA 4JL6A 3ZD7A 1DARA 1Z08A 4TL8A 1F3OA 4IDPA 4M1MA 4UNQA 1UJ2A 2ZS8A 1GAJA 1QVRA 3RRMA 3U44A 1E9RA 3DOFA 4LHWA 2ANCA 5J4HA 3PUZA 1E2JA 2WJVA 3WBKA 2YWEA 4YDSA 2BBWA 3KJEA 3CRMA 4IDNA 5EUMA 3BJIC 5AJVB 2UZ3A 2OFXA 3VKWA 4Q1BA 2NO7A 4AWXA 1Z0KA 5KYKA 1E0JA 1SHZA 4MRRA 3LRPA 4KBFA 3KQKA 3Q5DA 2V6IA 2XZOA 3X1YA 1KO7A 3LDAA 4NE2A 5FL7D 1KI6B 3K8YA 5JWHA 4CRWB 2A5YB 2IYWA 5FOSA 2OFOA
chains in the Genus database with same CATH superfamily
4L15A 1TKAA 1NU6A 3H4TA 4RIEA 3LF1A 2DFKB 4JV5B 1CUFA 3C3BA 2GRUA 3ONWA 4FSXA 1NU8A 1LPSA 2P27A 2QL9A 1I14A 2VJYA 2RBGA 3E9EA 1C3LA 1RWBA 3RVNA 3FMOB 1Q7CA 1CNFA 4KI7A 4LYGA 3VC2A 3G2JA 2CT8A 1PUIA 4CKBA 4MQEA 5H02A 2PX4A 3CG4A 2QX6A 3GD7A 3LT2A 2YQ5A 4IGKA 2ZROA 4S12A 3ZZNA 4AMBA 4CV2A 5AT1A 3AI1A 4DMMA 4DG9A 2X0NA 2ZDQA 4OHMA 3BXHA 3GZNB 4LTDA 5FJJA 3WMGA 6LDHA 3ZIAA 5A71A 5SZKB 1XYGA 1GV0A 5D51S 4YWJA 1CB7A 1QTIA 3I8SA 1JVBA 2NUPA 3FB1A 3PQ6A 1PTKA 2BGMA 4HGRA 2X0EA 3GUVA 3S8MA 1XMVA 3CX4A 3N5KA 5LQCA 3CIOA 2BKLA 4HDCA 1U28C 3CZ5A 4RK5A 3AEKA 1N2CA 2VHZA 2I03A 2YTZA 3CE9A 1EFPA 1LV8A 4PO1A 4G4SP 5JAUA 3C4JA 1AD2A 1V11B 3SFVA 1U6KA 2GPAA 4H7IA 3KLNA 4KXNA 4BMPB 2IH2A 1L5HB 1YR2A 4XCVA 2I91A 2NYVA 2P3OA 1T91A 1WP4A 1D2NA 2A0FA 1RWWA 2B30A 3O9ZA 3RNLA 3JR3A 3TD6A 3V55A 2XNJA 3CKLA 5TARA 4BN5A 4OMCA 2VVTA 4RS3A 4WAUA 2NPIA 1J5PA 3B3FA 3OWOA 1E5LA 3B1KA 1YB4A 1X8LA 3H9CA 2EBUA 4MUMA 4R1LA 3UCXA 4DCTA 1KY4A 4KPUA 4CVNA 2HU8A 1I6WA 4Z4HA 5EVCA 1Z0JA 4ZT2A 2ZZKA 5L4LA 4HDQB 3D6JA 4N8SA 2GA8A 2C7OA 2BL4A 2J7PA 2OBFA 3C85A 3T9EA 5IMBA 4BTLA 3TPCA 1PWXA 4P4SA 1RHUA 3KSRA 1L5WA 1SC3A 1Z83A 3LWBA 3OIFA 4MS4A 4R1OA 1HE3A 2O3QA 1HLPA 4MJXA 3ESCA 1Y7IA 3QUBA 3OLQA 4ZVMA 1OLSB 3GQBA 4NCHA 2O2GA 1GTMA 2GZ3A 2WT4A 5KX5F 2PFKA 1E63A 1GGFA 1RHKA 1SHLA 1QCZA 4BJ5A 1X7XB 4X71A 1NWHA 1YBFA 1Q17A 5K8IA 2YVKA 3RK1A 2IYNA 5IDWA 2XRMA 4EUFA 3ILHA 3UOGA 4J3NA 1Z6AA 4C07A 1P81A 2WZQA 4HDRB 4RPGA 1XVVA 4EYEA 1Z6YA 1R8QA 3IVGA 1PL7A 1C1XB 2C77A 4DLWA 1ESEA 3DOHA 2F00A 4FGKA 3AXTA 2GZ1A 2CLDX 5J1SB 1J8DA 1ZXBA 4ZRNA 4D9GA 2A9RA 3DE5X 1GA4A 1DIAA 1TQHA 2H5IA 1LK5A 2OD9A 5DMXA 4YMWA 1M5TA 2OBBA 2ADOA 2ZWPA 4MWCA 3TSOA 2YHSA 3OFKA 3PC3A 5IT0A 2TSYB 2JDIA 1ZMTA 4M2LA 4Z9FA 3B1XA 2FMUA 5C8VA 4G0VA 4DLTA 4QWWA 4UBLA 2ZI5A 3KYBA 1NXOA 2Q1XA 1YFLA 4ZXPA 2SCUA 3I2FA 3KD3A 4FD3A 2VT3A 4Q4HB 3WADA 2G36A 4FBMA 4G0XA 4GE3A 3EWSA 4M89A 5BQOA 4UD6A 2O2YA 4LHEA 1BGVA 1E5DA 2NV2B 1SKUA 3K0CA 4DRYA 4KFTA 1RKQA 2YJ3A 3GJRA 1RLTA 3IDQA 4MAAA 3E58A 2I7DA 2Z2XA 4H59A 3FUUA 2QJFA 4O63O 5LXTF 5FF9A 2F64A 2HA7A 3RSOA 3UWSA 1MQ9A 4K05A 4TKVA 2QK4A 1Z12A 3AETB 2M6KA 3KPYA 1X3LA 2DUUA 3PWSA 3VDXA 4HDKB 3ZC3A 5B4VA 5KPDA 2E1PA 1I4LD 3AHJA 5F4ZA 2BR5A 3QA9A 4L0QA 5BSUA 3IVMA 1GZDA 4KLZA 4CMEA 1ZSNA 1P0IA 1Q19A 3DTVB 1DUVG 1RJWA 1EBUA 3LO5A 4G5HA 3RKRA 3P5BA 10MHA 4H1TA 4K9NA 1NY6A 2E2WA 2Z9BA 1ZM3A 5AM1A 1YS2X 4ZTUB 2HH9A 5MFPA 4JENA 4S35A 4R9SA 5MN5A 3AERB 3AEYA 2O1SA 1OKKD 4PLTA 1LKZA 3C24A 4J7UA 4OQLA 4F4JA 4R71A 1GTRA 3REFA 2VF5X 4YTEA 1NQAO 4MJLA 4AMZA 2Z98A 1RKVA 3FCXA 4GZ5A 5HGJA 5KQPA 1VSTA 3JQAD 1U8XX 4AZ3B 2HHHB 4BJ6A 1NXTA 2HPZA 2JRCA 2D8AA 4D9FA 1P9NA 2BKAA 1BXGB 2PY6A 4RTPA 1NBME 4QYSA 4JSYA 4EQZA 3LU1A 4ZQIA 1UKZA 5FLXA 3EAGA 3AUFA 3WP0A 3OBBA 1B93A 3LQQA 2OP0A 5CA1F 5C5EA 1VKRA 3SBXA 4KZKA 2IY8A 3TS1A 1W47A 3GFVA 4I4CA 1HC7A 1OFVA 2P5UA 4WXEA 3EIHA 3AVTA 1EDBA 3H5LA 2EU8A 1DTWB 2EYUA 1GPBA 3O4GA 4EG7A 4OHRA 1U7ZA 3TL2A 1PS0A 1IY8A 2ZI6A 1F9EA 2JEZA 3CJTA 3FA2A 5TQJA 3B2EA 3N2YA 3MRSA 3A3PA 2H54A 4A5OA 1TA0A 1N0IA 3HWSA 1VRCA 1E2QA 2LTAA 2I6QA 1QE0A 3IP7A 2ZYHA 4CG1A 4RMGA 2FRDC 4G5SA 3T41A 3QMVA 2BZSA 3LUGA 3SZ3A 2QJOA 3ZG6A 5HKAA 2PH7A 3U9LA 4GGMX 4YRAA 2VQ3A 4INJA 4FZ5A 4OA8A 5JDIA 1H1LA 2QAJA 3K70B 5IJ9B 2O3TA 1A9ZA 2CXQA 1A8IA 1X7XA 2PX5A 1XX6A 3FDXA 1QNFA 1XCLA 1DKUA 2IPLA 2W6OA 4LWZA 4UMDA 3U7EB 2WJWA 3W5HA 1N8TA 3T34A 1AKTA 4K81B 3WHKA 3ICWA 2ZIUB 3HYTA 1FP7A 5E6SA 5FBVB 1R74A 1A9QA 3K9QO 4ALMA 4KV9A 2AFHE 3AKCA 1C7IA 1TJ5A 4C6RA 4O4JA 1ODIA 3BB1A 1VJDA 2QUBA 3L0BA 1M0TA 4B17A 5AK3A 3CB4A 5JIBA 3SI7A 3TNJA 4DCVA 2HXSA 3K8QA 4IHQA 2X9LA 2MT9A 4YNBA 3HNOA 4YECA 3TZKA 1Y1QA 1D1SA 1ZICA 2AC2A 5CFMA 2B20A 3T4UA 3T7AA 1N2CB 2IHJA 5KHLB 2TMYA 4BLWA 3EG9B 4ZHQB 1NR5A 1A5ZA 1TD1A 2YV5A 3ESXA 3KBOA 4QXAA 2JH9A 2MYTA 1AQUA 1A95A 1XL0A 3FYCA 1YZHA 3KHKA 5B7PA 4YCAA 1JXOA 1S7CA 2YIVX 1T2DA 3N86A 5AI9A 4MQMA 4UDNA 2EW2A 5JSQA 2AOWA 1KEWA 4NL4H 3TIVA 3FPJA 1ZH6A 3DBLA 1JA1A 2PD3A 3PUHA 1R0KA 1XZ8A 4XGRA 2PTGA 3OQ1A 4WZAA 2B6HA 2W2KA 4H9GA 2J0QA 1PJZA 3K9HA 2FX3A 4DIMA 3OQ6A 2GUGA 5KVVA 2WHPB 2AQ8A 4QDJA 1Z36A 1N6PA 3N5CA 3U2QA 1YT5A 4IXDA 4HBZA 3FKSD 4UU1A 3RHSA 3ZY3A 3RJMA 1EHCA 4N49A 3VR2D 5EVJA 2RHDA 1GSAA 3IBSA 1WXWA 3LKDA 3CLSC 2Q3BA 4XM1A 5KJ1A 5KTPA 4MKHA 1XTJA 3DEHA 4KH1A 4KQHA 3R3HA 4MO2A 4I9NA 3NIWA 3OIYA 5CM2Z 5HW0A 2GHRA 1O57A 3HR4A 4UE3S 2C3YA 1NC1A 3ND5A 2P5YA 4AICA 1E9AA 2P11A 4KAJA 4AMYA 3CGGA 2RK4A 4G0ZA 2O6LA 4PSVA 4RQAA 3OP4A 3ILVA 1R64A 3I42A 5B5SA 3LY9A 2G09A 3JD3A 3NHAA 2G6BA 2DECA 3PIIA 4FJ2A 3WKBA 1SHJA 2CLMB 2HBYA 4MS1B 5E7MA 1ZD1A 2CBGA 3NNNA 3C6YA 3D4OA 1B2RA 1P3Y1 3ER8A 4V0KA 2MR5A 4TWIA 3OOSA 4RELA 1DMSA 3TAHA 4RTLA 1VDZA 4QQRA 1U90A 2ZUDA 3Q2KA 3S2YA 3WQBA 2P2GA 3TQTA 3D7SA 3F8TA 3OF5A 3OLXA 1Z8NA 5EIEA 5IM4F 2A4KA 1L7OA 2DH5A 4OK6A 4PFSA 4UHBA 1X70A 1JDSA 2BFNA 1K63A 4ZRDA 3HWWA 1P5FA 3P9YA 4IDAA 1GHTA 4K6FA 2JFHA 1Y8RB 2G07A 2BONA 3F1LA 3HXTA 4GQAA 4LXIA 4Y1EA 5DVZA 8LDHA 2YWBA 2NU6B 5JH7F 1SXPA 3BD9A 3SYTA 4HP8A 1Q7RA 1EFAA 4LOAA 2VP2A 4NK5A 3YASA 2D74A 3G5TA 1DELA 1FNMA 4J1TA 4U2EA 4WCFC 2GO1A 2EBWA 2B1RA 4RZXA 2Q27A 1GPMA 3EWAA 5CURA 3ZHBA 2FWRA 3ZGVA 4CMGA 5BNIA 3UG7A 3KTAA 3PC8C 4KFSA 4Q9JA 3SYLA 4MCJA 4RTKA 5B7NA 1GKIA 1MOZA 3EY9A 2V59A 1VCNA 4H3SA 3SC2B 5B30A 3CH7A 2EWVA 3Q3EA 1D9XA 1SBYA 3QFCA 5ICEA 5JZSA 2KJQA 4GYWA 1S3GA 3OQMA 3T7RA 3VXKA 1F8FA 4XVUA 2AN3A 2F3RA 1T4BA 3E8MA 3RS4A 1CV2A 2MTBA 5G3YA 1EWKA 3F7NA 3QWIA 4HH4A 3VTKA 3JYNA 1U7PA 1JG3A 1RKXA 2FKAA 2WMNB 3JSAA 3DH0A 4LDRA 4BV8A 5IX8A 4XQCA 2P1ZA 1DLJA 3ZCVA 4DLZA 1QRAA 1ISJA 3KOMA 3WP1B 1OXBB 2YHIA 1Z82A 4M1EA 3K2EA 1N6LA 5AKIA 3RSLA 2D1SA 4MV6A 3QFRA 3ECCA 1T8PA 3LVFO 1I0ZA 3T9BA 2FG6C 2ZT6A 2G71A 4OI4A 1UBMS 1GRVA 4EJ0A 3TTYA 5BOVA 4QUKA 1DQSA 2XSZD 1X7YB 4Y67A 1R88A 4ILEA 4BNKA 3NTUA 2EZ4A 2D2VA 1O5TA 1ST3A 1MV5A 4NBTA 2VRNA 1TCBA 4ENTA 2CHUA 2NTEA 3NHUA 1LRLA 1XWIA 4QDUA 1VLVA 1SD1A 1YAHA 2B8NA 2KS6A 2PR2A 3O84A 1T5TA 1SKYE 1CZNA 3FMVA 5K3SA 1QAMA 3WKAA 1E69A 1T13A 3ENWA 4OJQA 3S29A 1D4FA 2PZ8A 2R11A 3K3PA 1JR3E 4OUDB 1ZS9A 5IANA 1N92A 1O4VA 1FLDA 3BJRA 1P45A 3EGXB 4Z2AA 5BYKA 5FUMA 3D7KA 4FX2A 3LPLA 4NYIQ 1VJTA 2XMRA 1GAEO 1O96B 3OAAA 1C29B 3AZPA 3NPMA 4P3NA 1JRLA 2VJNA 5IUJC 5AD1A 2IOYA 4TTQA 1KMCA 4JZKA 3D6AA 4GMDA 5CK5A 4GMXA 4MW2A 3UWKA 3O91A 2O0KA 3VHXB 1PQYA 4QGHA 4YT5A 1NW6A 4MR8A 2FNAA 1NVEA 2WAOA 3G5AA 3HXKA 4HFJA 3QVGA 3ZWDA 1F6DA 1PD0A 4EABA 2G7MC 1IBLB 3QW4B 1N2GA 2QVGA 2GEFA 3I92A 2AD1A 3GJ3A 4HX5A 4TS4A 3FXAA 5JDCC 4EYQA 1MOSA 2O8EA 3P2IA 3B3GA 3LUPA 3X1XA 2VZLA 3OE1A 4D42A 1U5BA 2Z4RA 3RANA 1G8AA 2O2IA 3NM5A 3SLGA 3X43A 5A4MS 1ATIA 4AF7A 1USWA 4J0HA 1OVMA 1OGYA 3K8OE 3FPGA 1V37A 2XCTB 2IU6A 1QWSA 3IUQA 4YJHA 3LXUX 5EIWA 3WQRA 3ZYZA 5EQTA 1Y5RA 4CLDA 3IQGX 2JKZA 3ZQ4A 2F1OA 3IYLW 3MWDA 4HAWA 4XX0B 5IBQA 3L7MA 1EUYA 1VZ3A 4KWHA 1BQ3A 1G8SA 3TFWA 5KSWB 1DDGA 2ZJFA 4RV9A 2GK6A 4Z0NA 1ULSA 1C80A 1Z4QA 2XE6A 1Q11A 1SXGA 4O2BF 3ZU6A 2CZQA 1G9SA 1E60A 4O2AB 1CQIB 1YR7A 3KQNA 4ALKA 3OCWA 4I1RA 3QUTA 1P4RA 2VP0A 4DYHA 2CZGA 4B76A 1QO0A 2W6CX 1CUWA 1DAMA 1GQYA 3NLLA 4FIDA 1GPYA 1PT7A 2PL5A 3EG5A 1X7WB 4KWTA 2ZM6B 5JJLA 1U2TA 1UPUA 3WTBA 2AC4A 1GCIA 1YBHA 3LOPA 5TXGA 2G0NA 4BNXA 4MEJA 5CW2A 3NC0C 2ZWVA 5B55A 1EVEA 1S8NA 2P4SA 4NE7A 3IQFA 4DEYA 1KFEB 3JD1A 5JW6A 4YI3A 5IARA 1N0HA 4CN8A 4YCSA 1E3QA 2Y6UA 1ZEMA 2OBLA 5FBZA 1GPWB 2IEZA 4UTVA 3BHMA 3ZX4A 1I4TD 2H7VA 3GT3A 3M4XA 4REQB 3QQPA 5M3BA 5E1DA 1I2CA 1WLSA 2PA0A 3C98A 4CMKA 3DQQA 4R9VA 3ETLA 1DWQA 4L9SA 1MH9A 3MTJA 4Y2UA 5TQ2A 2WW8A 3EXIA 1XKLA 3R3UA 2B4RO 1YA8A 3HR8A 1VIDA 1FLVA 3VKGA 3ITNA 3DLIA 4LI3X 4URUR 4F2DA 3PA6A 4IUDS 4P5DA 4UUNA 3SC4A 4E7PA 1RXWA 1YK0A 2Q21A 4Z54A 1MW8X 3OFJA 1DX6A 5IVIA 5IVKA 1H1DA 3ZWVA 3VSEA 4ATNA 4LFAB 1NGSA 1JQ5A 1OIVA 1NRWA 1A8SA 4WLEA 1P1KA 2H5JA 4U2GA 2NXNA 4TQUS 2OXCA 2D5LA 1FYWA 4Y7DA 2ZRPA 3F6SA 4UHHA 4WXPA 3ZCQA 2V1UA 4EY5A 2C03A 3UJ8A 4DUGD 4P38A 2F3PA 1FSFA 2BISA 3KCNA 4I8IA 1L5QA 4QULA 1V25A 2FP4A 4FKBA 3HKCB 1JHAA 1EU1A 2QTZA 5DB4A 5HILA 2ONJA 2IZ7A 4P3XA 3LFHA 3M2TA 1VHDA 4QQKA 1JN0A 5FTWA 1L8QA 4NBLA 1XT6A 3V8PA 5JS2A 1QKKA 3TFQA 2C5BA 1DOAA 1JJIA 2H9IA 2Y1CA 3OEEA 2PS3A 3Q3CA 4FBGA 4Y6RA 1JEDA 4FSDA 4PZ9A 1TNDA 5K3FA 1JGTA 1IHOA 3UW3A 4EITA 3LP6A 1UWCA 3WLSA 1RQNA 4HZUA 5DHPA 3KETA 3FTFA 2ZYVX 4IIVA 4IS2A 5DTQA 5K6TA 3N0RA 4A8JC 1N5DA 4OH1A 5G0VA 1W36D 3LK6A 1USVA 4YRKA 4JBWA 3GLHB 1ECLA 1GU1A 2MSLA 3TIIA 5B64A 4OQEA 1IXZA 3EFEA 5FPKA 4HQ0A 1E2KA 3A8TA 4DC1A 1H9BA 2F9MA 1Q0TA 3TYXA 2J3EA 5CLLA 2PXAA 4JVMA 3EFHA 1TLFA 2FOIA 5THXA 1MJNA 2J7PD 1Y9DA 1KMNA 4UHFA 5B1DA 4UNRA 5GJBA 5HCUA 1E9SA 1SM4A 3R0JA 3DFFA 1RRMA 4CMBA 2XWQA 5DX0A 5IDXA 1U3CA 1SCDA 3O8QB 4YWHA 1M2JA 2V3VA 1DBSA 3HDQA 5B3JA 4LXYA 3UCFA 2FQYA 4ND5A 3VKVA 2YV4A 3C39A 3DWGA 4NCIA 4XD7A 2CLHB 4A36A 1I7DA 4OBXA 2H1WA 3SC6A 1CD5A 3U7FB 3R7WB 3WV5A 4R2HA 1B1AA 4JJ8A 5E6SB 3CF4G 4RFSA 3NBQA 2PGNA 3KIPA 3BB4A 1LQUA 4CUKA 2X8JA 1Z2OX 1M83A 2ZWMA 1MB0A 1EQ2A 2AYYA 1V9CA 1CNEA 3G0OA 3HJTA 5DTIA 1CULC 1KYTA 3ZK7A 1Y6ZA 2FN7A 1XRQA 4MYSA 3ZVKA 3GUUA 3SJZA 5ED4A 1FQOA 3C7KA 3L92A 4E03A 3K1AB 2GNOA 2VTBB 4M36A 4ZVVA 3BIWA 4A16A 1ADJA 1G9XA 2E4XA 3OLYA 1SD5A 3D3EA 1WKBA 1RWPA 1Y8RA 1JLKA 5IYZB 1TAGA 3OCYA 3HLKA 4M7RA 4PSUA 3ZWKA 3D0OA 1AY0A 3Q3GE 4NX2A 1RRKA 1Y8QB 2Q3EA 4G9EA 4DS3A 1TZBA 3FNBA 1WEHA 3HB5X 3ORYA 4IHJA 1PZFA 5JYEA 4WN9A 2ZLBA 3SXUB 3MAAC 1UFRA 4CV1A 1IZ7A 4RK7A 2PZFA 4CL3A 2AN4A 2QWXA 4UTRA 3OSZA 4P5PA 4CQMD 1C30B 1RCFA 3B7GA 2P9QA 1UEJA 2ZUSA 3LA8A 4OHFA 3W7AA 1XCJA 1Q0PA 3KQMA 5IP5A 3ROEA 4B3BA 3T1HB 1FTNA 3N6VA 3K0BA 2PKQP 4TVKA 4X3PA 3U3OA 4EBBA 4TZ0A 3CLTC 2H17A 1QIDA 2EBFX 5IKOA 4EG4A 4C2TA 2QZPA 1Z8DA 2VPIA 4JCCA 2H0AA 4WZZA 1XAJA 1KRHA 2B3DA 2AC7A 2GERA 2I2FA 2W8BB 1NBAA 1RP7A 1R0RE 3KOZA 4X84A 3JYPA 4JR2A 4MP6A 3RODA 2KSQA 3WQHA 4B87A 3U7QA 1IQUA 4U7GA 3KJZA 3LXRA 4Y6SA 4MGZR 4PHFA 1SKBA 3VBCA 3TQQA 4BNZA 4XDYA 4D0GA 3TLXA 1XZGA 3HZZA 2PSDA 3R41A 4GXRA 2HRRA 4ENUA 1EVZA 3ROTA 5LMZA 4Q05A 4D57A 5G4KB 1CUZA 3SY8A 5EIBD 5T5QA 4HUQB 2H5EA 1KJNA 5HKLA 4CM8B 3JATB 1EWTA 4KQFA 4EF6A 4G3XA 2VJMA 1AKEA 3NTXA 4BCCA 2GXSA 4EPXA 1RNLA 3WLMA 1ZJZA 2K87A 1XVUA 3IKMB 1SQGA 2CF6A 4KIJA 4PSKA 4QGBA 1FP6A 4Y6LA 3UMBA 4C3VA 2IXDA 1K06A 1XNJA 1F7UA 2HM7A 5A02A 1V2HE 2H06A 3NHRA 2DFTA 2AI3A 1TEHA 3KALA 2PX0A 2XSZA 4UD2A 3UV7A 2QEQA 5BVHA 3ANLA 3LMKA 3AF6A 1KEVA 2YNMA 3B9RA 3K6RA 3EWIA 1B6SA 3OLVA 5C8YB 4RDIA 3PNLA 4ALNA 2E18A 3T35A 2DWQA 4FW8A 1X2BA 5L7YA 3FPCA 4KGVA 1H8HD 1VP3A 3M7IA 2ZE7A 4R2LA 1BMDA 2PLNA 3KKNA 2NVBA 3ZJ5A 3HFGA 2V58A 1UODA 3E53A 3T5MA 1NV9A 4CGZA 4NOJA 3K7EA 5IBRA 2YWGA 3O9MA 4N40A 5LLTA 5D00A 2C5GA 4R8LA 4S24A 5DWDA 1X87A 2ARKA 1Y4ZA 2HEGA 3OLZA 4BZQA 2Q5OA 3HZOA 4AMVA 1YRWA 4O0LA 3NG1A 2RJ3A 3V5NA 3F5SA 4CHTA 2BFCA 5LQKA 1VFNA 3GLRA 3PEFA 3AZOA 2H1SA 3ZGNA 4I1VA 4ZP1A 3DVAA 2WWXA 3LUHA 4JJ7A 3R7SA 1P33A 2V6JA 1Z5WA 3ZNQA 3E22A 2ZT5A 1RYEA 2X4IA 3EVZA 3TLAA 3WK8A 2AMJA 2XOKD 3M49A 1VB3A 3MCWA 2LE0A 3I3SR 3LUAA 3NT4A 2XCIA 1DEXA 1P2BA 1PBTA 4WT7A 1DEOA 2J9GA 1B0PA 3KTDA 2ZULA 3C6MA 2BEUB 1A8QA 2VH1A 5FEMA 3BAFA 4YJFA 1XEWY 4W82A 1Z3IX 2F9FA 3Q98A 3AK4A 3DT6A 1YNOA 4D80A 3GLFE 3VKHA 3K92A 1P5HA 2DTEA 2NZ8A 5CNMA 4FDUA 2JJMA 4M46A 4HQOA 3LHKA 2V7PA 4X66B 2FVXA 2JIRA 1VA4A 4DQDA 3I5YA 2AFHA 6NULA 1T34A 2P3SA 2VATA 1LSJA 3F6YA 3TR6A 1OH8A 4EYGA 2H16A 3JQGA 4M87A 2G6TA 3GQVA 4KNWA 5ALKA 1HT1E 1VCMA 2DH6A 2JAPA 2JD2A 2NVOA 2P3LA 3CYFA 4JI1B 3ZQKA 2W2MA 4AY2A 2YOHA 3OPVA 3LPCA 4OLAA 4E5NA 2C5SA 2PUGA 2YWJA 3EFOB 3H5WA 2W8BA 2CFOA 4XAQA 1DIOB 2XUDA 3I53A 3MN1A 1JP7A 1N5JA 1RMTA 2GM9A 3RC9A 4R8VA 3HZHA 2BTOA 1D8AA 3FLMA 4HTAA 4EWLA 3AY3A 3EXEB 3OU2A 5C3UA 3H11B 5DEOA 3VSBA 2EJTA 3AF5A 5IHPA 4ZI7F 1GOTA 2GD1O 4GC5A 5C3MA 4Q16A 4Q4AA 1F60A 1Z2CA 1KI8A 3AFNA 4F4IA 3KQUA 1CIPA 2C7QA 3U3JA 4DEXA 3L1HA 4MW0A 3E3LA 2B5WA 1V43A 3GNQA 2OZVA 3TUJC 4RVOA 3ZCUA 4D3ZA 4F7WA 2X7XA 2EQAA 1RR6A 3V1UA 2IZ5A 1KP2A 2C2GA 3OUTA 5CCBA 1FZQA 1K75A 2FSUA 2FWBA 3HA3A 2IUEA 1M75A 5T3YA 3MGAA 2DTDA 4EMSA 4XD2A 3IAAA 4ZO4A 3KXKA 2JAXA 5D87A 1KVTA 3QEAZ 3GLIB 3K2QA 3R5KA 1EMDA 2PEYA 1W5SA 2AHRA 4HB0A 1N1MA 3BE5A 1M1NA 2PT6A 1J0XO 4XPIA 5A7HA 4LMAA 1BXZA 4C5CA 1O0BA 1UC9A 3D6VA 3FCEA 3D43A 2WV9A 2XZLA 4TYPA 4ZVRA 2XIQA 5A4JA 1Q1BA 1CEQA 1E7YA 2GKSA 2Z6UA 3NHSA 2HJWA 3C45A 4FOTA 2VDNB 1UBLS 2CN1A 1YASA 4LXUA 4TSKA 4MA5A 2EEZA 3HVJA 1DX9A 3PPWA 5HPYB 1XZNA 1R6TA 2DFDA 2RH4A 3T7CA 4QJ3A 1CQXA 2G72A 4EYOA 2I5PO 5G0SA 3DUFB 1QUFA 1JUDA 2Y0PA 3EIEA 4MVWA 4EW1A 2W42A 5K0ZA 3SC3A 1XTKA 2OCBA 2QORA 2V1XA 4KQ2A 4U2KA 4XGQA 4YAFA 4CIDA 4JBHA 2XB2A 4ZICA 1TZMA 1VP9A 2I3BA 4JVOA 1ZC4A 3PCXA 3ZBUA 4NNPA 4BX3A 1BXRA 5AUOB 5FO0A 4HGOA 4KAFA 1N3IA 4LGCA 3V34A 3AX6A 1R7RA 1YAJA 2FPIA 1EQAA 2CKMA 2IEYA 2BH9A 2QVXX 2VSNA 3LHSA 3MUEA 1DJPA 1SUWA 3DZHA 4NULA 2X6TA 4AJ9A 3C5VA 4OK5A 2G1KA 1GXSB 3K4QA 5FCDA 1UJBA 1SGWA 5F7XA 5FPSA 3CNQS 1HO3A 5G4KA 4OHXA 1HY3A 3AJ8A 4N3GA 4A2CA 4B83A 4ZYLA 4CL2A 1K5HA 2YVUA 2Q5FA 5JC8A 5ADUS 1WMFA 3ABRB 4TTVA 3S2EA 2A2ZA 3P27A 1V6CA 4OM7A 5EQJB 4RXTA 2W2QA 3C15C 3FIJA 5JI3E 4DHEA 3L0SA 3D8NA 1UWLA 3MJSA 1L6IA 3D2AA 3W1WA 1SG9A 2RI6A 3SIWA 1XELA 4A8JB 2VRBA 1HDYA 4EO4A 4EG8A 2WSMA 3R3XA 2QZ9A 3SX4A 2NGRA 4JLOA 1H5UA 1SCUB 3HKCA 3QHPA 3KPUA 2J7KA 4GP7A 4PO3X 5F12A 1E9DA 2XB6A 2VUUA 3DHWC 3RU9A 4B80A 5ER6A 2R8YA 5GJVC 3SHFA 4AS2A 3X1DA 1C4OA 1M66A 3U3ZA 1RRPA 1G3UA 4MO9A 1XF1A 1DJNA 4TLMB 2O8CA 1I3LA 3ZE2B 1XN1A 2RC6A 5A05A 2CK3D 4DE5A 3WAGA 4OAQA 2UKDA 3SICE 4N5NA 1JH8A 1SCJA 1XQVA 4INZA 4R1SA 4W8GA 1PRYA 2ZXFA 4F5EA 1LQTA 1IBCA 4NG5A 3ZV7A 5L3QA 4WUVA 1J1UA 2YXBA 3K5IA 3OPNA 4FDTA 4TUYA 4INAA 2NU8B 3M8KA 5FWDA 3K32A 4M22A 1X80A 2MOKA 1NPYA 2JIDA 2HSDA 3CN9A 4U0KA 1ADYA 5CVCA 4WDRA 4C4OA 4FKZA 4NC9A 4CV0A 3OQJA 5AVOA 1WVIA 1QF6A 3K16A 4Q5IA 3AR9A 3NTLA 1VBKA 5ERGB 1RRGA 1KXZA 4GNKA 4IIBA 1IHPA 1ORTA 2ATXA 4PS1A 1EX6A 4ZN6A 4HYTA 3VSAA 1QIFA 1JG1A 1HX7A 4AKIA 4NLLA 3IMCA 1FB5A 3P96A 4U39A 4BO7A 2WKPA 4HDNA 4K9SA 4MW5A 5EJ4A 2C4WA 3WMEA 2VXOA 3I9V1 5F4BA 4KTVE 4PSDA 1AU9A 1ZH0A 2XUFA 5KINB 1R4AA 2XUGA 3E03A 2GS9A 4F3YA 2O57A 4PFKA 3WSWA 3AB8A 2I54A 1RQ2A 1AZWA 1A82A 1MU0A 5A3RA 1D7AA 3IEIA 4Y6OA 1MT3A 1PJSA 3INTA 4U7WA 1ZK3A 1QJCA 1WPXA 3A6LA 3VR0A 4MLPA 2J6BA 4H1VA 1OX4A 5JPDA 2XF8A 4PU0A 3WI7A 4L78A 2BHRA 2NSDA 3KQYA 4R16A 2QM7A 3LXMA 2WKWA 4KN9S 4RKRA 4LOJA 1XRMA 1AC5A 2PRYA 3JQ7A 1C9NA 3MEQA 4I1OA 4QG7A 4K26A 3RGWS 1V7QA 3HY6A 1KYWA 5B6PA 4UUAA 3W2FA 2HA6A 2X22A 5LD2C 1IZ9A 1WY5A 2JLCA 1FUYB 2G25A 2PWBA 2QTLA 1W75A 1U7DA 3D64A 3GY0A 3K9WA 2D2IA 1ZGJA 3MGGA 1KJZA 4MRPA 3GXBA 4L9RA 2ZRKA 3OX3A 1RLMA 1ECFA 4L3OA 2JJ2D 2E89A 4PRLA 3AVXA 1T5LA 3HB9A 4Q9KA 1L7DA 4K0KB 3NBMA 3FTDA 4LZNA 1UZAA 3SIXA 3LX8A 5CH3A 3H1GA 4Y2RA 2J3MA 5FXMA 1KSJA 2X58A 1YDHA 3H17A 4DMCA 2VLBA 2ZBDA 3HYNA 5KVSA 1UDBA 2ZUTA 1X15A 4OQFA 1NI5A 2P1RA 3MJEA 2C59A 5IAAA 3TGPA 3FSGD 1PQ4A 3UPUA 1SIWA 4YJ3A 5ADHA 1PHRA 1XYVA 3IAFA 5DHRA 4MMYB 3IOYA 2PUAA 3DVAB 3PX7A 3QKRA 4CEIB 4EH1A 3CVOA 4JXJA 4LZOA 4D6XA 1SQSA 1UFQA 2NUPB 5BO5A 4D5GA 3QWAA 4F4HA 3TKLA 3LUBA 3ZW9A 1VGVA 4QM7A 1QO7A 5LQAA 3HWRA 3GELA 1ONNA 4KUHA 2FQQA 5TQ0B 3T9FA 3OBIA 7REQA 4Q4CA 2ZB3A 3A4YA 1ZLYA 3SZRA 4ZEOA 3PD7A 5IUKC 1P61B 4L2IB 1IHXA 1IXSB 1SVKA 2ZYSA 2YFYA 1VSQA 3L0YA 1G18A 3QPCA 3LBYA 1VRWA 4HRXA 4B7AA 3H4VA 3MT9A 1RIIA 4GRIA 4BFWA 1D2MA 1A9XA 1O5IA 1N1EA 2VRCD 3G17A 3D6NB 2AK2A 3RVSA 1KJ9A 3EB9A 1JB1A 2ZOSA 5A9SB 3KPVA 1QO0D 2HU7A 4U2CA 3WFJA 4OATA 5EZYF 4N5DA 3ROQA 3PTAA 3B5JA 1PR4A 3OVMA 4TV9F 1FNDA 1K2VN 4M9XA 4ZCPA 1O94D 2QMYA 3ADCA 3DLHA 1A4XA 1KXJA 4JIGA 4TZTA 5BUQA 3PC4A 5KYTA 4ZT6A 2HKIA 1OWLA 1KI4A 3VPSA 1TM4E 3CCFA 2C2HA 2F1RA 4XB6B 5ALXA 3UV6A 1FXUA 1IUNA 2RJOA 4HGPA 4EDFA 3UUGA 2B69A 1GPJA 4KIUA 3DOUA 2OO7A 2D3WA 2ZYUX 2BZ1A 3BMNB 3N8GA 1AUVA 3JS5A 4OHVA 5GM2A 1KNXA 2DG2A 4BGVA 2BFEB 4KOEC 5JCPA 3T6KA 1VDMA 2HT6A 1E3LA 2OVBA 3AF2A 3STVA 5A9RA 1JEYA 5FL7A 4Q00A 2N42A 4Q9HA 3ELBA 1X13A 3GJSA 1ZGCA 3UT5A 1LPOA 1R50A 2IIQA 2C92A 2Q3CA 2QSYA 2R7AA 5ALJA 3TMAA 3P2OA 4B7CA 4N41A 1GYRA 1DKRA 2C0QA 4YALA 2JCBA 5FBHA 3WRXA 3H6HA 1HFJA 1NBOA 1SUFA 1XZQA 3BE6A 1YA6A 3H2SA 4ZO9A 2O0MA 3ENQA 1TI7A 4G8BA 5AOBA 1VG8A 4I4LA 3RLIA 3ZHSA 2A5FA 1AMNA 3PDIB 1NRIA 5LWHA 1L4MA 1OZAA 2GCOA 3GCDA 1M54A 3WWDA 4BFLA 4X0EA 2BGJA 3L6OO 3CRNA 1Z07A 4K9MA 1BCSB 4EHLA 2BGWA 4ZEMA 3PFFA 1FLNA 1YUMA 2HCRA 2I8AA 3L79A 4GVXA 5JY1A 1VLHA 5H82A 4HDOB 4MIKA 5TMPA 1BN6A 3QENA 2VKTA 3N2KB 5EFZA 4D4KA 2VQFB 1PLLA 2PZBA 2WU1A 1DV2A 2X2FA 1CSEE 1UQTA 3BMOB 3I4FA 4RVFA 1J1IA 5DX8A 4DKXA 2XMGA 2IYPA 2PSEA 3D7MA 4ALJA 2CJFA 3HKDB 1NFQA 1RM4A 1ODSA 3LOQA 5BWMA 1AZLA 2ZBFA 4UPDA 2FP3A 3CGWA 3C3EA 5HIJA 3ZE1B 3RYHA 4D8XA 1U31A 4JP3A 5JD3A 3EOAI 4XSVA 2G9RA 4F91B 3V4PB 5HA5A 1QIMA 2QGFA 5FOVA 1U8UA 4CIVA 2FPWA 2R4TA 2AKAB 2HDHA 5G41A 3F3KA 3OJXA 3OQOA 2I2BA 4EEKA 1JHUA 1LK0A 2OWDA 3U4IA 5DNCA 5I8ZA 3NQ41 4IRUB 5REQB 3ABZA 3RBXA 4LFBB 1E2IA 3KPJA 5JSHA 3PICA 4HDNB 4UVHA 3DMFA 2H07A 5DOZA 1QS0B 3P0EA 2CHFA 2GEJA 5CHEA 3ZCPA 5C35A 2FHPA 3LG2A 1BGXT 2CJXA 5IKEA 1R6AA 1BA3A 5CB4B 2V7GA 4RYDA 4DGSA 4BO4A 3O82A 1T2FA 5T6MA 2O8DA 1C8VB 5LKAA 2CNKA 2VHUA 1CUXA 3CEJA 3TG2A 2BMVA 4RK4A 1Q7GA 4B1FA 1U2PA 1VSUA 4P9NA 4LF9B 4QFDA 1XDDA 5DULA 1TM1E 4M0LA 5CT6A 5CXQA 1U8EA 5CA1A 1G5TA 1MO5A 4RWEA 5M7EA 2WUFA 5LP6F 3WMFA 1NV8A 3INNA 1FXWF 2X19A 4OHZA 1F8UA 1WO8A 1FBTA 4EVRA 4F3KA 3IALA 4XVQA 2H29A 1RFGE 5DI3B 3BRCA 3GPBA 3CW2A 3WLNA 1AUQA 1VJRA 3R20A 4JOCA 2DWCA 2QN6A 1YS4A 3Q11A 4GKAA 2DP4E 4HATA 2BBSA 1S8AA 4FOLA 1JKMA 2Y1EA 2IDZA 1MC5A 4FONA 3DHNA 4C0KA 1A98A 1JR2A 2ISCA 3SIRA 1QTNA 3GMSA 5EUCA 1Q57A 1B15A 3OTGA 3SBDA 3ND8A 1GPUA 4Q02A 1P7VA 1U4NA 1XCGB 1CIJA 3K9NA 4Q4HA 4WI1A 3THRA 1N36B 1OYWA 1YWGO 4HDSA 4XW2A 1HDXA 1DIBA 1MMFB 3F4LA 4KQIA 4YDHB 3UA4A