4DLRA

H-ras peg 400/ca(oac)2, ordered off
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlrA00
3CH4B 3RRNA 5HKKD 3S1AA 1SVMA 1Z28A 5FL3A 4FMCF 1CJUC 2CCGA 2QT0A 3VKWA 3ZQ6A 4C7OB 3LLMA 3IO3A 4BZXA 1ZINA 4RD3A 4RD2A 4EPXA 4IDHA 3LFUA 2NPIA 5KPJA 4V0KA 4QGGA 4RKFA 3RRZA 1M2OB 4C0JA 2GXQA 2RGCA 1VG9B 2W2VA 2CEAA 2EYUA 4ZCMA 2VHUA 1KDOA 2NG1A 3ZZ0A 4BFSA 2J0QA 4V0MA 1T9HA 4M8NE 5FBVB 3LX5A 4JVMA 3UK6A 4FCVA 1YR9A 1EXMA 2C8VA 2BJVA 2OHFA 3HR7A 4A15A 2P3SA 5J47A 2VP2A 1E0JA 1E2KA 2D3WA 4NP6A 3BWDD 2XOKD 1EFRD 4RZ3A 4QM6A 3FMPB 1II9A 2JLQA 4FWIB 4W9MC 1Z2AA 4EIWA 4LK2A 4J0QA 2WBLC 1OW3B 4AKIA 4ITRC 4A2PA 2F7SA 1TU4A 2O8EA 1DAMA 3KKMA 3WNCA 5LBIA 2JJ1D 1DO2A 4CW7A 4Y0AA 1LS6A 4ZDJA 1W4AA 3KJIA 2GJAA 3MWLA 3GPLA 2WJIA 1Q3HA 4NYIQ 1R5NA 4Z8XA 4QHYA 4O3MA 1AIPA 3PCRB 1JAIA 4Q4JB 4DSNA 2REBA 2P0EA 2V7QA 4EQ6A 2E1RA 3GLHB 1ZCAA 4DDWA 4DEXA 4HUTA 5BWMA 1SVWA 5KUTA 1CJVC 2OFWA 2VPPA 5JS7A 2CLDX 4N0DA 2F9MA 4PC6A 1XBTA 3EASA 2W83A 5EE9A 3L43A 1UBCA 4LY6A 1MO3A 4D80A 4EKDA 1G3RA 5GJBA 1FP6A 4YXWD 3ND8A 3IUYA 1Z83A 2YWHA 1W5TA 5IK2D 3KQLA 2BMJA 3M4YA 4LOAA 3DMNA 3CWQA 2ZRNA 4Q1CA 3NH9A 1NI3A 2BEKA 1BKDR 1MKYA 2VHQA 2WOOA 2XXAB 1JQJC 4FCTA 2FNAA 3CNNA 1G5TA 2QP4A 3ND9A 4P3YA 2YYZA 1HEIA 3T1QA 2QMEA 3D8BA 4QBGB 5FPKA 1N0WA 1XPUA 1NIPA 1HUQA 1KDTA 5HPYB 4HLQB 3VR6A 1KGDA 1XDBA 2DBYA 5DYIA 4D0LB 1F48A 3MSXA 4WZAE 4KAXA 1P73A 4DZZA 3KXLA 4HLCA 3GLIA 3TQCA 1W7AA 2ONKA 4KFUA 1XP8A 2NIPA 1GKIA 1L8QA 3LW8A 3OE7D 1CS4C 2IYZA 2QBYB 2CE2X 4ASUD 3TRFA 4YDHB 3PUXA 2ZS7A 1DE0A 3SFVA 4PQYA 2R62A 3CKLA 1RRGA 4NH0A 5FBLB 2IWHA 4C2TA 2V54A 3BC1A 3U44B 3IIMA 4EFLA 1KI7A 4L9WA 5C4GB 4ZKEA 5FUWA 3U3RA 4B73A 1IOZA 4JL5A 4E5UA 1BS1A 1D5CA 2G6BA 3QPUA 1JI0A 4V0OA 4JYBA 1KHTA 1P5ZB 2OLJA 4A9AA 3KJEA 4Z1MA 4KSCA 1X8KA 2PCLA 1VYUA 2YKGA 2FG5A 1R0WA 2JGNA 4Q19A 5HE9A 4TMKA 5JJKA 2QQEA 1AN0A 5EJEA 3EARA 3TUIC 4B6FA 1DAHA 3BH6A 4WXRA 3E2IA 4D26A 4X8HA 1Z29A 3TNFA 2HEIA 4ZV4A 4TZ6A 3LAWA 5JI3E 5G41A 2RAPA 3CNOA 3OFNA 3OAAD 3LXRA 3KB2A 4A6PA 1WA5A 1G8GA 3BH0A 4NHOA 5JECA 1KK1A 1KI2A 1KKMA 3NH6A 2VF7A 2NZ8A 2CNWD 1NKSA 3B60A 1KSJA 1S4QA 1ZM4A 3MJHA 1E79A 1XJCA 4HEJA 4PANA 3NBFA 2RHDA 4QC2A 3L2OB 4DLUA 1TPZA 2V7QD 3ZIAA 5J4KA 5GVRA 4XD7D 2IW3A 3VX4A 3ZLJA 1YE8A 4NCKA 5K8TA 3L0OA 2CJWA 2ZSEA 2ZJAA 3MLEA 3NEYA 1IXZA 2PEYA 4IXNA 3I5YA 4BPBA 4LYJA 1KO1A 1NSTA 2PH1A 3PEUA 4A8JB 1W0KD 1PZNA 1I2DA 1G7CA 4IOJA 2D7DA 1XMIA 1AJEA 2HDNB 2IHYA 3ICQB 3PIRA 2XJ9A 4P4UA 3H4MA 4QNRA 4V0LA 5EXTA 3RVBA 1N6PA 3ETLA 2FFBA 1G64A 3AVTA 2G88A 3I5XA 4M21A 1XJQA 1H65A 5BW8A 2A5FA 4MRNA 4C4PA 4BFWA 1XJ0A 4KJZA 3AP2A 5GJWC 3SR0A 3WHKA 4Q02A 2AK3A 2JLXA 1GNPA 1PV4A 1XEXA 3SYNA 4QBIA 1NY5A 1KO5A 4MA4A 1GNQA 5LB4A 5C18A 3ADBA 1E2GA 4JL6A 5A5GA 3ASYA 2OCYC 4NDZA 1N6LA 2EFHB 1ZIPA 1J8YF 4RFVA 1XTRA 3SE0A 4JKIA 1J2JA 3A4NA 3AH8A 3Q5EA 4Q4AB 2W2XA 3GFPA 4B32A 5JLJA 1NMXA 1US8B 3BJIC 1F6BA 1Q22A 2ZRDA 4GNKA 4M9QA 5BYKA 1N5KA 4OQMA 4JVLA 3WXMA 3BIFA 3FKSD 3LX8A 1YZGA 1KI9A 3LBHA 4IOMA 1NLZA 4GP7A 4P31A 5E3HA 3AEZA 4B47A 3I73A 2G0NA 5BQ5A 3U2QA 4FW9A 1WBDA 1OH6A 1AS2A 1R5OA 1XD8A 2HCJB 1F5NA 1XEFA 4HAZA 3BK7A 4FWTA 1ZNXA 2EFDB 1U81A 3PUYA 4IVRA 1S96A 4Q21A 1RRPA 1CBUA 1U8ZA 3OZXA 3FHTA 3RLFA 4GZMA 2QY9A 5DNYB 3X1YA 4GT1A 2BDTA 2ZS8A 2QAGA 5DYGA 2WKPA 1MO5A 5G3ZA 5DGXA 3Q3JB 1FX0A 1Q20A 4P33A 2WPDD 2GXUA 4I99A 4A0RA 4JBWA 2QUZA 5TMPA 2WTUA 2GCNA 5CM8B 4PXAA 4BFXA 3QOFA 2PMKA 2ZU0C 3O8BA 1KMQA 1ZUHA 2JASA 5GJVC 3LQRA 4AG6A 2HUPA 4B34A 5IF9A 1Q57A 1MRNA 3LXXA 2IXFA 4DIEA 3D7MA 2CMKA 2OXRA 2WHXA 3EC1A 1DO0A 1N25A 2J7KA 3NXSA 4LRWA 4P4SB 5J4YA 1Z2CA 1Z6AA 4JLBA 1FOEB 1JPJA 4MDEA 3T1VA 2JCSA 5DLQC 4MGKR 1E99A 4EFNA 5JFGA 4ABYA 4BUJA 1CR2A 2QAGC 1G19A 1DOAA 2WIBA 3QIAA 5SZJA 2VBCA 3C15C 4HATA 1XU4A 2HXSA 4X8OA 1VYTA 3K09C 4I4LA 2P2LA 1NG1A 4Q4LA 4PC1A 3SBEA 5A4JA 2FGJA 3R20A 1LF0A 1G3IA 5LD2B 4LI0A 3T06B 1W0JD 3VR3A 2F1IA 3QBVA 1KI6B 3A1WA 3VU9B 5BN5A 4C3ZA 1E9AA 2VHTA 1PVOA 1RW4A 4U00A 3QF4B 5FTJA 4PSAA 5BN4A 5KNCA 5FTKA 4JBYA 3NKVA 1RFLA 3BE4A 1SXJA 4JMPA 1KKLA 2VF8A 4AURA 3P1JA 4MRSA 3NBYC 1ESMA 2OILA 3DKPA 4FMDF 1FMJA 1P9WA 4IKEA 5E7MA 2IX3A 2GCOA 3REFA 3C16C 4LJ6A 3CWZA 3AM1A 1ZVQA 3DPUA 1VYVA 1TEVA 2BVNA 2OE2A 4OK5A 4Q7KA 3I61A 1NG9A 2QSZA 1A1VA 5H8WA 4HZUB 2VSFA 5FUVA 1W36C 2EQBA 4RD0A 4MRPA 4FCWA 2WSMA 4MQBA 2FOLA 2QP9X 1D6JA 1JR3A 1NVXQ 3WBKA 4W5HA 4AYTA 2ERYA 2Z4RA 1NVVR 1T8UA 3FWYA 1M74A 1OPXA 1F2TA 4CF7A 2MSDB 2H8KA 1M34E 3BXZA 3K53A 5CYOA 4DCNA 1EX7A 4GRAA 1JEEA 3W6NA 4LV8B 3U5ZB 2W2TA 3I3SR 3TMKA 1NBMA 5J4HA 2WWGA 1IAQA 3HDTA 4LC1A 4TT3D 3SDZA 4PZYA 3X1XA 4B2IA 4MKFA 2CVFA 4URVR 2R6GA 4C0KA 3LDAA 4F91B 2PBRA 4I1OA 1H8ED 5P21A 4QL3A 3N70A 1E0SA 3ZVNA 1ODFA 1U0LA 3QXXA 2A7QA 3WYFA 4PQRA 4OQFA 5H70A 5AR1A 4EJSB 2ZYUX 2FX3A 1MABA 4S2EA 4XTCS 2IF2A 2ZRCA 5TB5A 2QGNA 3RS5A 1W46A 2WWHA 1SQ5A 2J45A 1XTQA 2C2HA 1DELA 1G3QA 4URYR 2GXAA 2AKAB 2IL1A 1VIYA 3WRXC 2XNDA 1VHLA 2Q3HA 1X1RA 2NZJA 4S35A 3K0AA 3GLFB 3WHLA 421PA 5B58C 1VMAA 1OT3A 2GCPA 4Q1EA 4C0HA 4BZPA 4IHQA 1WQ1R 1PUIA 5EP3A 1SULA 2UZ3A 3QXCA 4DHEA 1QHHB 3A4MA 1A82A 2C98A 1M1YE 3DDCA 1OIXA 1S1MA 4XIGS 5FOWA 4ERNA 1ZJ6A 1XTIA 3GJ4A 3QVUA 3AF3A 2HYDA 1EFCA 2YOFA 3T12A 4LJ9A 1X86B 2FPMA 1OFUX 1FUKA 5C46F 3B1WA 3B82A 4QBFA 4TN1A 3GJXC 3ADDA 3VMFA 3TE6A 1WE2A 2VH5R 2PZEA 4GMDA 4DUGA 2I1QA 4TL9A 1XXHA 3PUVA 4QGHA 4KO8A 4EUNA 4F93B 2J0UB 3KB1A 4EPRA 1F2UA 4E22A 4H1VA 4M9ZA 5FPSA 1FNMA 5FR2A 4B6EA 4R9UC 3V4RA 2GWHA 1Y63A 3IIJA 1E3MA 2TMKA 2YHSA 2QROA 3U3JA 3EAQA 1NN1A 2AN9A 1JJVA 5TV2A 2GETA 2OO7A 1OXUA 3GLGA 3BAFA 4EJSC 1GL9B 1W1WA 1YJ5A 2GRJA 5KNBA 1BYIA 3FHCB 5EP2A 3NDPA 3TAUA 2WJVA 3TBKA 4QRHA 1XFAA 5DH9A 4R2IA 2QP3A 2OG2A 2XZPA 1TQ6A 4ZIRA 4HUQA 1EX6A 1R10A 2CL6X 3RC8A 1DG1G 1Z0AA 1UEJA 1DADA 3ZZTA 4M0LA 2N42A 3A58B 1ZD9A 1GOTA 5KDOA 4RD4A 2P6RA 1QHGA 3AF4A 4LYAA 3A1VA 4Q7JB 5HE8A 1OH8A 3W6PA 2EWVA 3MRSA 4LC0A 5IT5A 4RD1A 5EE1A 1XWIA 4CEHB 1JJ7A 1ONBA 3SZRA 2GHIA 3G82C 1QG4A 4BFYA 4TZ0A 1NVVQ 1JR3D 5JHHB 1XZPA 1LB1B 3MAAC 3UMRA 1Z06A 3ADCA 3CNLA 4DXAA 2ZSAA 2JEOA 1ESNA 2OM2A 2R44A 1OJLA 2KBEA 4Q4HA 2R6AA 2J7PA 4JLDA 2YWGA 1Y3AA 2FMXA 1YU9A 4IRUB 1RJ9A 1G8YA 2FDCA 3LO5A 4UNPA 1QHSA 4PC3A 3RYTC 1NL3A 4OI2A 1KO4A 3AVQA 3MD0A 4M2LA 4Z54A 1N3BA 2NO0A 1E1RD 2B7CA 2QN6A 3HU2A 3QKRA 1TQ4A 4NCIA 3CUEF 4O0MA 1UBEA 3QNUA 4OQLA 5E95A 2AR7A 3QKSB 1KK2A 2V55B 4YONB 1C1YA 1E9EA 5B30A 5DHFA 3PR1A 2FZ4A 2MMGA 2REOA 1XD9A 3CW2A 2O8BA 1SVSA 2F43A 1WMSA 1XZQA 5D3MB 1RYHA 4EAQA 3KJHA 4W5WA 2IYQA 2DCUA 4DIDA 1NLYA 1EGAA 3OIYA 1RPZA 2FEMA 3EG5A 1WF3A 2AD1A 1YRAA 3UKDA 1GAJA 1B23P 1BH2A 1G7RA 1YZNA 1GIAA 2ZI7A 4URXR 5JWOA 2PJZA 2ZS9A 4LCBA 4TYYA 1XX6A 1AZSC 4ZI3A 2DPXA 1TF7A 3RAPR 4KLZA 3HU1A 1UEIA 2W0SA 1Q21A 5DIFA 4OL0A 3TUJC 1J8MF 2J9RA 4TQUS 3CZQA 4YQFA 3G0HA 5K8UA 4NYIR 4Q1AA 3CPEA 1PLJA 4KCGA 3R9IA 3U3OA 2C99A 2ZI9A 2QG6A 3QXHA 3V4FA 4DLRA 4CEIB 3CH5A 3K0CA 4DUGD 3CRRA 1LY1A 4HDCA 3T35A 4DSTA 2O52A 3H1TA 3WNDA 5D3QA 1E4YA 5EXSA 4Q18A 3V00A 5SZHB 1XB2A 3I72A 4RCYA 3PEYA 2GJ8A 3U7GA 5KSZA 3THXA 2WKQA 4YMWA 1RKBA 3AF1A 2GK7A 5G40A 2CDNA 4CEJA 1FMLA 3LVQE 4A82A 1N0VC 1IY0A 3K9NA 3UG6A 2XITA 1AM4D 2HYIC 2ORWA 4OI0A 4GP6A 2CL0X 3BS4A 3CONA 3CPHA 3NC1C 2GEVA 4L15A 3A6PC 1CU1A 1KJYA 2ZRMA 2ZRKA 1ANKA 4LPSA 4DEYA 4JVSB 3GQBA 2WWXA 5AK0A 4EPVA 1JXMA 3DKVA 2CLSA 4O2RA 5DI3B 1E69A 2GF0A 5TARA 2G9NA 3TH5A 2FSHA 3RS7A 6Q21A 1OE0A 5LDDC 1SHZA 5JZVA 3ZDQA 2O8DA 4M53A 5F3WB 3B9PA 3JVVA 2G1JA 4MUAA 221PA 1NF3A 3S1AB 1N0UA 1E9SA 3PUWA 5ANRB 4N1AA 4UNQA 1XCPA 4C0BA 3BFVA 1NJGA 1Q1BA 3D31A 2CE7A 4JSTA 4Z51A 2W6ID 1F60A 5EP4A 1HT2E 2J5XA 3EZ9A 4DCSA 3SQWA 3SJBA 3BOSA 4BRWA 3AGQA 2RGBA 4NMMA 2FF7A 4G5RA 1FTNA 5FOSA 3F5FA 4LSGA 5SZIA 2QNRA 3IDQA 3FTQA 4BFVA 4HSEA 2QENA 2G77B 1ZM7A 1VG0B 2WWIA 2ZR7A 1E1QA 4PPGA 3WMEA 2X77A 1II8B 1TL7C 1OXXK 2OCBA 4XWAA 1YZTA 4JJZA 4BZQA 4B43A 2O8EB 1Z0JA 4DLYA 1GKUB 1CTQA 3GEHA 2BEJA 4M1OA 3FFAA 1U9IC 5DN6D 4KYUA 1E2NA 2BM1A 3SJAA 1QRAA 4MUBA 3PJRA 2O8CA 5KHOC 2XTMA 4EQ6B 4OHWA 2WWFA 1TTTA 1LF5A 1R5BA 4DBLC 3W90A 4WW0A 2EWWA 2JAQA 2N46A 3KXKA 4Q5IA 1DAKA 1UKEA 3FE2A 3AKEA 2DWPA 3THYA 4DC9A 3HWSA 1Z0DA 1P9RA 1VKJA 2RGDA 2JIZA 5CM9C 1FFHA 3ADKA 2HCBA 3B9QA 1NNEA 3TUZC 4OHVA 5L3QA 2OLKA 1H8HA 5F9HA 2ANBA 4FIDA 1CP2A 3P27A 1WP9A 5CIWA 4M1SA 3PFIA 4DCUA 1X3SA 1EFUA 2PLRA 3ZD6A 1AGPA 3PVSA 4PC7A 1S3SA 3BD9A 4HAVA 4OYHA 1IY1A 621PA 1OFHA 1Z22A 2YZ2A 4U5XA 3MCAA 4C2UA 1Z0IA 3TK1A 4TMWA 1KK3A 2D62A 2B8WA 4OJQA 4WZ6A 3EC2A 4BEBA 5L8VA 3FOZA 1O3YA 1E2PA 1ZMXA 1IY2A 2P6UA 3BERA 1GL7A 1G291 4ZI2A 2Q21A 1S0UA 3CM0A 3CO5A 2WJYA 1NJFA 1DARA 1MOZA 1SGWA 2XJ4A 4AI6A 2OBNA 4TMZA 3R8CA 1N6HA 4KBGA 4EDHA 1IN4A 1LTQA 2IYUA 2OAP1 3GLIB 4HI0E 1QHXA 2HJVA 3I4LA 2ZI6A 3WMGA 4BEJA 2PLFA 4IDQA 1YR8A 2LKDA 2ZRGA 3OIUA 3KDSE 3ICEA 2VLIA 2AD5A 2AL7A 3I92A 1GITA 3PQCA 4XJXA 2HXYA 4LYFA 4LJ5A 1YZQA 4C30A 5CJPA 2ZYTX 4C9BA 3EA0A 4QG7A 3ZD7A 1TUEA 2QZ4A 1DTSA 1COWA 4KSBA 1SHKA 1ZNYA 4L16A 4LV5B 3UMFA 4RJLA 3OESA 1G8PA 4MH0R 2BBWA 3CLVA 4BQSA 4TSFD 1S8FA 2OEPA 2CCKA 1HV8A 2IYXA 1E2QA 3KL4A 5FL7A 5L3SB 1DPFA 3TSZA 2XTZA 4B75A 4IDPA 2EVWX 1E32A 3IQWA 1FQKA 5BYJA 3OEED 1IN5A 3W9YA 1FNNA 1CRPA 3SU8A 1XF9A 2UVQA 5J4VA 2P5SA 2ZPTX 3LWNA 3U60B 5KU1A 4RZXA 1E1QD 2C95A 4M1KA 4B76A 3MMPA 1HE1C 2ODEA 1LV7A 3MGCA 4AD8A 1QHYA 1NIJA 4Q7MB 3RRYA 2O8FB 2A5DA 4GPTA 3EZ2A 5KSPA 2AXNA 1HYQA 2B8TA 1CJTC 4GI7A 3EIHA 4G5OA 5G3YA 5FR1A 4UXJA 2A3RA 4PO8A 1KSFX 5DE3A 1KJZA 2BV3A 5IDVA 5CLQA 5KOYA 2A30A 3M1IA 2ECKA 3LW7A 4B74A 4DVGA 4B71A 1Z07A 1UBFA 2H7VA 2ZVPX 3K8YA 1IBRA 1OHHA 2CJWB 3VKGA 1JB1A 5AJWA 4QGFA 1CF4A 1YR7A 2ZRFA 3BB4A 1E9CA 2F55A 1GWNA 1II0A 2DFKB 1IN7A 4B48A 1TAGA 1XTSA 4PHTA 3B1XA 3EPKA 1ZYUA 4ZKDA 3U6BA 4PAMA 4O2LA 2ZUBA 2IYVA 3MWJA 5E7IA 2HLDA 4A2WA 2FZLA 1EK0A 1KSGA 4RZUA 2W58A 3EZ7A 5GADl 2F9LA 4IEIA 5KNDA 4PC2A 4Q48A 2IA5A 1N6KA 4OHXA 3T1OA 1HTWA 4RY2A 4AKEA 4RCZA 5GVSA 1G4AE 2GBLA 2VYFA 1XEXB 2WSSA 4IVPA 4RSGA 4NPHA 1ZM2A 5B57C 2G0TA 1XEWY 1W4RA 2WAYA 5JJLA 1AS3A 5JEEA 2AK2A 4ACBA 2OFXA 3H84A 3MWYW 4JLPA 3TGPA 1E2DA 1G41A 2JA1A 1CR0A 5DSZA 3VAAA 3UWOA 5AJZA 5FUXA 3ZVRA 2XZOA 5KSOA 1AGRA 1E0AA 2BBSA 1GNRA 3KJGA 3C41J 1CIPA 1Q3TA 2DWQA 4LBVA 3U7FB 1Z6XA 2BM0A 5FBQB 2GBLC 3AVPA 4FMDB 4ZDIA 3IKJA 1E2IA 3W5JA 3EXAA 4JS0A 2QAGB 4R7ZA 3EIQA 4HLUA 2BHRA 4KFRA 2O0HA 4K46A 1FX0B 2ZU6A 1FUUA 1Q1QA 4TLCA 1JR3E 2JATA 1Z5ZA 1UDXA 1GSIA 2L0XA 2XEXA 2GESA 1GILA 2KSQA 2PMDA 2Z0MA 1E2HA 3QEOA 3QSYA 1ZC3A 4PZZA 4OK3A 4OHYA 1XRJA 2WZQA 3B5JA 4N3NA 1NBME 4JBXA 4L9SA 4B3XA 1D9ZA 5FI0B 1JAHA 5EQTA 1NMZA 1P9NA 4XWKA 5DISB 3L82B 1QVAA 2IC5A 1KNQA 2AKYA 2IUUA 5JHGB 4Z1MD 1ZC4A 4D0GA 1P75A 2QM7A 2RHMA 1KAGA 4JZKA 2JLYA 2FFQA 3BFXA 3GEEA 2VIIA 4AYXA 4HLUC 8OHMA 2F1JA 5C1BA 3ZYCA 3CF0A 2VSXA 2ZE7A 3QXJA 4RFSB 4NTZA 5AUOB 3OFND 2RGNA 3K1JA 3BB1A 3K70C 1W36B 4M9XA 1NN0A 3ZS9A 2AFHE 4IW3B 2ZJYA 4MKIA 3MUFA 3WNBA 2LKCA 4XWOA 2ZIAA 3L8ZA 1E79D 3E70C 4F38A 2HT6A 3C8UA 3WP0A 5KDDA 4MDFA 4LUCA 3ZIAD 1OF1A 1F3OA 1LFDB 4QNMA 4DLSA 3OEHA 2XAUA 1TQDA 1XXHE 1GL6A 3C5CA 4TMXA 1HE8B 1U0JA 2GCOB 1R0ZA 4H9GA 2WSSD 1OXTA 2OT3B 4B35A 1XEWX 3GLFE 2JJ2A 1V43A 4YC7A 5B64A 2HT1A 3VNUA 4MYUA 1Q44A 4POAA 4JLMA 2DFTA 2J46A 4TYPA 4PTLA 1A2BA 3QG1A 3H86A 1M7GA 2ZRBA 2QT1A 2RGNC 4NYMQ 4LBWA 3UPUA 2FWRA 2WWYA 2VHCA 1QHNA 1KSHA 2BMDA 2IYYA 2ODWA 3TSWA 1N6IA 1V5WA 3C7KA 3GLGE 2R8RA 1FW6A 1F2TB 2DB3A 4GL2A 1ZP6A 2ZJ2A 2IEYA 4KHZA 1CRQA 1ZD8A 3O8CA 4M1MA 3IIKA 1D8TA 2R6CA 4GDFA 4BLPA 4D6PA 2G1KA 2VHJA 1OYWA 2YVUA 3K0FA 4PAOA 4C0QC 1IJFA 3IGFA 4RD6A 3ZGXA 2FEOA 2XGJA 4XTRA 1T5IA 1G18A 3EPJA 3WYAA 3Q72A 3TSOA 4E09A 3RWMB 1MABB 4KU4A 4Z8YA 1TF5A 2ZJBA 3B6EA 3UATA 1YKSA 5CB6A 3RSLA 3WMFA 1KMHB 1T0JB 2QPTA 3IILA 2ZJZA 3O47A 4PPNA 2QMOA 3R7WA 4TTPA 2YV5A 1WXQA 3A8TA 4MRVA 1JBKA 4NCHA 4D4MA 4JT2A 1NP6A 3N2EA 4WOPA 1SXJC 5DHAA 2NGRA 4YDSA 1Z6GA 2GVZC 3K0AB 1QDEA 3RS3A 3TJZA 1E9DA 4IFBA 5LPNA 3AF0A 2A5JA 1P60A 1TQ2A 2QTHA 3IPYA 1HQYE 3LRPA 3P4YA 1VG8A 5H1YA 2IS2A 3PENA 5FI1B 1U0HC 4QJ4A 1GTVA 2H92A 1U2RA 1SVKA 1T3HA 4FD2A 4C0AC 1ELOA 1G7TA 2D2FA 4MYTA 4PPFA 3I1FA 4RKEA 4YMTA 1OB2A 4EPYA 3VR2A 2IEZA 1A4RA 4F4JA 2DHRA 2ZREA 3NDBB 3LV8A 1P2TA 2VL7A 4X8LA 4DDUA 3A1SA 1XXHB 2ZSFA 1BMFA 4ARZA 4JL8A 2ZETA 2FPKA 3QVVA 2H5EA 5JEDA 2ZE6A 1GDDA 2QEQA 1E2LA 4MKGA 4WA7A 5E4FA 2OSBA 4R98A 2I3BA 3U3KA 2WVJA 1R0XA 5EE5B 2FA9A 4Q66C 1T3LA 3Q7PA 3GJ0A 1IN6A 1CR1A 3FMOB 3J81k 1WB9A 3AVOA 3LD9A 3LVRE 2EFEB 3NBZC 2A78A 4BECA 3TAHA 1A2KC 3GLGB 2GNOA 2J0VA 3B1ZA 3THWB 3RNLA 1QBKC 1GG2A 4CZ2A 2R9VA 2ZJOA 3UXMA 2FSGA 5F9FA 2ZI4A 4ZIRB 4HUQB 3A36A 1J90A 2WAXA 3CR7A 3SJZA 5JWRA 1G6HA 3W3ZB 2ZXUA 2W00A 1LNZA 2JJ2D 1W36D 3RS2A 4NL4H 1VIAA 3IPXA 1ZU4A 2JDIA 2GJ9A 3PG5A 4W7SA 2FFHA 3AV0B 1N5LA 1NMYA 2FH5B 4KBFA 1J7KA 3SS8A 1OYYA 2OAQ1 3HU3A 5JSZB 3VHLB 1D9XA 4R71A 4MKHA 3U7HB 1MR3F 1SXJD 2QI9C 2UZIR 3QJYA 1KOFA 4LBZA 4MGIR 1U90A 2C77A 4LBYA 4OQNA 4Q4HB 2FGKA 1KI8A 2IUTA 1JPNA 4GMXA 4XOIA 2V4ZA 5J4LA 3U61B 2D4HA 2QU8A 2YNMA 3PEVA 3EWSA 1D2NA 1M8PA 1ZRHA 3QPWA 1RJ9B 3KQKA 2P67A 2RGGA 4G5QA 4GFDA 4CT5A 2IHBA 1AQYA 2ZRJA 1XCMA 2H57A 3RS0A 3QKRB 4B3CA 1L7VC 3H2YA 5AUNB 3EZFA 2ZQ5A 3B85A 1B0UA 4QXAA 2I4IA 1YHNA 2NOAA 1YVDA 2NMVA 2IF0A 1EFTA 2F43B 3PEWA 5JMTA 1JNYA 5FOVA 5LB2A 2NPFA 1Z0FA 1UPTA 3RRMA 1ZW6A 1MH1A 4Q9KA 1NBMD 3QQ5A 1U98A 1CXZA 3I8XA 1VCMA 4US0R 5FBWB 2MSEB 3QENA 4ESVA 4PR0A 5EXXA 4M1TA 1T5LA 4UXIA 3VR4A 4GOKA 4EPWA 3EPHA 3EZ6A 1KAOA 1MO4A 3NVAA 3W6OA 2QE7A 1OKKA 2P6NA 3TIFA 4HLDA 1T8TA 2GVDC 2PZGA 1P2UA 2F3TA 3KQNA 5HTKA 121PA 3UG7A 3BB3A 1S2MA 1UADA 3AKYA 1N2CE 3DM9B 2V9PA 4KV9A 1YZUA 4V0ME 1R6BX 4P4TA 1BIFA 5J40A 4Q9LA 2XNDD 2XZLA 1BMFD 4OKSA 1P62B 2V6IA 4HB4A 3WYGA 1L2TA 1Q0UA 3W34A 1Q1EA 2NO9A 4LHWA 2VP0A 3R9XA 3EIEA 4GSYA 2F1HA 3K9GA 3IQXA 1G3MA 1G5RA 4CIDA 2BKEA 3THXB 2PCJA 4CEJB 4JYCA 1XD2A 1D2MA 2X19A 4JLNA 4B3BA 4XSHA 4HDOB 4LJ8A 1O87A 2X2EA 3OF5A 1MRSA 3DOEA 3TVTA 5B2ZA 4DT1A 1KO8A 1TADA 3AF2A 3UMSA 3AUXA 1CEEA 2XOKA 821PA 1EFRA 4AY2A 4DB4A 3QG5A 3A1TA 5HZKA 2H16A 3DOFA 2GZHA 4UNRA 4KODA 5EP1A 1VG1A 3LQQA 1KY3A 2QRNA 3LH5A 2DYKA 2WMNB 4D81A 2O8DB 3T15A 3L0SA 1LS1A 4MITA 4DSOA 1UKYA 2JJ1A 2GILA 3AQ4A 1SVOA 4PHHA 1G21E 1G4UR 4D4LA 4WAUA 3BH7A 5JRZA 5TXGA 4II7A 3HYRA 4TMVA 1E2FA 4Q00A 3TKLA 3VKHA 1K6MA 1CLUA 1QZXA 2OV2A 3OIVA 5F2EA 2V3CC 2IYTA 4I81A 3T61A 1W49A 5CK5A 1J70A 4LZZA 4D82A 4D2IA 4XSGA 4URZR 2X8AA 1XCGB 1ZNWA 2J59A 1AKEA 4FI3C 1DAFA 4M4SA 1NY6A 3K0CC 3AP3A 5KPDA 3NG1A 1G20E 5A0FA 1VHTA 1WCV1 4LHVA 4YXWA 1MT0A 2IS1A 2WKRA 5IK2A 1NRJB 3IHLA 2QPOA 2QA5A 3KX2A 4PO9A 1PLKA 1XTKA 4M22A 5FOTA 3VTKA 1DAGA 1UF9A 2H17A 2IXGA 4I1UA 4DWJA 3DM5A 4EPTA 3CF2A 3GLIE 4KXFB 3CRVA 2CHQA 2ZITA 5IHPA 4V03A 3GP8A 2OUKA 1G3UA 3GCGA 5DO9A 3I8SA 2O8CB 4FXPA 3FMIA 4G5GA 5EXPA 4LJYA 2F6RA 4DDVA 2J7PD 4IDNA 3HPRA 1BOFA 3THYB 3AGPA 1ZD1A 1XMSA 3SNHA 2N1BA 3IO5A 5G53C 4Q7LA 3OE7A 3AP1A 4A0HA 3TQFA 3UANA 4PSKA 3SYKA 3ZZUA 3LBNA 4ASUA 4WIAA 5BN3A 2C04A 5L3QB 1A7JA 2BC9A 3VR5A 3KTAA 3VNVA 3LLUA 2QMUA 4U02A 3B13B 2RCNA 1I2MA 3W5IA 2X1VA 3Q7QA 5C4MA 1WDTA 3NEJA 2ONJA 4B2PA 2ZANA 4KLNA 2O0JA 3U4QA 4E07A 1CKEA 1UFQA 4M9SA 3LA6A 3IBGA 4ZDKA 3NHBA 4D25A 5EE3A 3QE0A 4TWZA 3VX3A 1VDZA 4Q1BA 3Q5DA 2WMOB 1CJKC 3ZS8A 1IXSB 1X6VA 2ZYWX 2G3YA 4JLKA 3UWKA 4A0GA 1ETUA 1GKYA 2Q9BA 4GZLA 4DSUA 4B2LA 1N5IA 1W47A 3K0EA 4JSYA 4BLSA 3WBJA 2C9YA 3HYTA 1Z3IX 4DKXA 1BYUA 4QKQA 1N6NA 2DY1A 3X1ZA 1T0HB 4W5JA 3GFOA 3PV0A 1E2EA 1II8A 2D2EA 2P65A 3F3YA 4V02A 4AKGA 1PUJA 3OAAA 4IOKA 4C7OA 1P2VA 4R2HA 2ZUDA 2KJQA 2R65A 1GUAA 4BLOA 1J99A 2RGEA 3FMFA 5CDFA 1OH5A 1NN3A 1I4DD 2XSZA 2CNWA 3DMDA 4PSVA 1AA9A 1UDWA 1W44A 3HP1A 4HAUA 4TL8A 2P5TB 2GTPA 4IJMA 3BRWD 4K81B 3I32A 2Q6TA 2FJUA 3MFYA 1OFIA 4BFZA 2R2AA 4IXMA 4ZCLA 2ZYVX 4XD7A 2GJSA 3I62A 4I1SA 4B3GA 3K9HA 1MV5A 2BIFA 3KKPA 3R9WA 4HYYA 2Q0HA 3AVVA 1Q1ZA 1R0YA 1KI4A 2MSCB 1KIMA 2GAAA 2RKOA 3BORA 3FFBA 4FMBB 4DDTA 3N5CA 1W0KA 1XMJA 4CDGA 4F4CA 4DRZA 1D2EA 3W3AA 3BGWA 3DZ8A 3CR8A 3NIBA 2H18A 5AJYA 2NO6A 4TLEA 2DFLA 2EW1A 2ZEJA 2GJKA 4B3DA 2ANCA 4Q4JA 2AFIE 4DCVA 5CITA 2JJ8A 2ZVQX 5AJXA 5FTLA 3AVUA 3GLHA 2IS6A 2VEDA 3FDIA 3CPJB 1DBSA 5JS8A 3B78A 3KFVA 1OSNA 4KITB 3NBXX 3IEVA 2Q3FA 3TR5A 3T34A 1TUIA 3TW8B 3QKTA 4F4IA 2NTYC 4MGYR 4A4DA 3QY0A 3D3QA 4KFTA 4I1VA 1W48A 4A92A 1DEKA 5FPTA 1UKZA 4B3FX 4C0LA 1TF2A 2PZFA 4XH9B 1RC8A 2UKDA 2XB4A 4LJ4A 1Z63A 4BASA 1GRQA 4YMUA 3FHOA 3PXGA 1P2SA 4L8GA 1BO6A 2PX3A 4EFMA 1GRNA 4TYQA 2XXAA 3WY9A 3FKSA 4KFSA 5ELXA 4BGDA 3OIWA 4NYJQ 1E9FA 1UBGA 1XTJA 3QEJA 4HDQB 4US2R 4A36A 2J41A 1DG3A 4CVNA 2QMHA 1CULC 2VP6A 2FPLA 2GA8A 3KXIA 3NC0C 3O8DA 3C5HA 2ZE8A 1TMKA 3N2IA 2JLWA 1KZ7B 3JZMA 1TX4B 2ZJ8A 2GEUA 2HF8A 4LGMA 5HZHA 1IQPA 3LY5A 2QORA 3QPVA 1OXVA 4Q9JA 3AKDA 4FINA 1X8JA 2JIZD 1W4BA 5L3SA 2VSOA 1PJRA 5JBQA 2QBYA 4C0SA 4ILEA 1S9HA 2WPDA 5HR5A 1H8HD 1VCIA 3Q9LA 4WBSA 2B6HA 4F92B 2CHVA 3KUCA 1HQCA 4QHTA 3FGNA 4A2QA 1KI1A 3PITA 3AKCA 3CRMA 3U44A 5EZ6B 2FV8A 1IJEA 4JKYA 2J0SA 3FB4A 4QFMA 1GVNB 3SC3A 4HAYA 5TVKA 1E0KA 4ON9A 1E2JA 2O8FA 4OHZA 4UXHA 2QSYA 2KWIA 1ZCBA 4G5SA 2GAOA 5EUQB 4BRUA 3SQXA 1S3GA 1YQTA 2YWFA 5K8LA 4BWYA 1KO7A 1KDRA 1S1CA 2XSZD 1KY2A 1DAEA 1M7BA 4HAXA 5FPYA 1KK0A 4UJ5A 4LV6A 4KVGA 3H0KA 4NYMR 4LJAA 1ZBDA 4WZBE 3ZJYA 2BMFA 1KTVA 2YOGA 1NKTA 4NCNA 1E2MA 2E87A 1EFHA 2Z4SA 2ZTSA 3X1WA 2FFAA 4UNNA 3NTUA 2ZRLA 3AVYA 1LW7A 1CR4A 4WXPA 1SXJE 2W0MA 1EWQA 2QGZA 5M04A 2C03A 2YC4C 4AKHA 2GZDA 3K70B 4WVFA 1DAIA 4PO1A 2A2ZA 3GJ5A 3ECCA 1W0JA 5FFMA 2C96A 1G7SA 4Q1FA 5SZKB 2JLSA 1FZQA 3L0IB 3T5DA 4XVUA 1COWD 2KE5A 4IVQA 5GJCA 4QJ3A 2Q9AA 1Q12A 2IWRA 4DLWA 3U6KA 1VCOA 4MGZR 1RRFA 2CK3A 2IYRA 2V8OA 3ZH9B 4D4JA 3R8FA 5FL7D 1IM2A 4BLRA 2J87A 2EU8A 3TR0A 1JXOA 4Q03A 4DLZA 5AJVB 3LNCA 2REXB 3D6TB 4LYHA 3B2EA 4A8JA 3SBDA 4PQFA 1OIWA 2V1UA 3L0PA 4XVQA 4JJKA 1M7HA 3C14C 1C9KA 2IYLD 3T5GA 1ZU5A 2GZAA 3T1TA 4JLAA 2ZROA 1AZTA 1OIVA 2DFNA 2SHKA 1FTSA 2BCJQ 3CZPA 4GOXA 4OBEA 2OFOA 2A5YB 2Q3MA 3KKQA 2XX3A 1T91A 3EW9A 2AWNA 3W8RA 5L3VA 4D4KA 1N6OA 2W6JA 3NHAA 1P6XA 5FTNA 1S9DA 2ATVA 3KUDA 3C4JA 4E03A 3SI7A 4TT3A 5JI2E 5JWHA 2BBOA 1OHHD 1HH4A 1R7RA 2RH5A 5IRCD 4PX9A 5BXQC 2VQSA 1H8EA 1TU3A 3L8YA 3FPAA 1G8FA 1CJMA 2CL7X 4A8JC 2O5VA 1I4TD 4HB0A 3MJRA 4Q4AA 1IXRC 1K5DA 1US8A 2IUSA 4LHYA 3EWAA 5KO2A 2VP9A 2HLDD 4BE7B 2KI5A 2DR3A 3K09A 2YOHA 2PJRA 4TTRA 5FH9A 2NO7A 3RANA 2CCJA 1XPOA 1TEXA 3DVLA 1HY3A 1SXJB 3EA5A 1G16A 4UQOA 3GJ7A 1EESA 2F1RA 1SVLA 3QKUA 1NN5A 4M1WA 2PT7A 5TY0A 1XNJA 3GFTA 1GFIA 3SYLA 3SJCA 4D0NA 2FN4A 3AUYA 1YZKA 2ZM5A 4L4UA 3K0FB 1VTKA 2XNSA 2ZRHA 4IEEA 3ASZA 4TYWA 5AUQA 2BCGY 2RGAA 5CJ2A 1U8AA 1EWRA 3REGA 4BFUA 2ZAMA 4OK6A 3CF6R 4GBMA 3DHWC 1ZUNB 4F7WA 1E98A 3QUSA 2HF9A 4AWXA 1P3JA 4U7DA 2CHGA 1OB5A 1R8SA 2Z5FA 2ZJ5A 4Q47A 2WJJA 1L4YA 1A5TA 3NWJA 4PAQA 1P7CA 3R7WB 3GMTA 4RFSA 2ASEA 2IBMA 2O0KA 1NLFA 3SN6A 1VECA 4HAWA 1Z6YA 1W4CA 4P4SA 1HA3A 3X2SA 1R2QA 2A5GA 2QM8A 2ORIA 3CBQA 4G1UC 4MRRA 4QGAA 1E9RA 2D7CA 2PEZA 3TW4A 1ZNZA 3GD7A 2B92A 1T6NA 2CK3D 4DLTA 2WJGA 1Z08A 2AX4A 1T4GA 3ZVLA 2ZE5A 3JVUA 3VR1A 1AKYA 1HURA 1P4SA 4TQAA 4TLBA 2LWIA 1W5SA 1M6NA 3VFDA 2Q9CA 5E7JA 1FL9A 1RIFA 3P4XA 2PX0A 4G01B 2KBFA 4ARZB 3K70D 1MO6A 2VA8A 4NKRA 1T3SA 1KI6A 3VU9A 1XMVA 4K8OA 5FOUA 4NBSA 2RGXA 2CBZA 3QF4A 1P72A 4PPQA 1JECA 1YRBA 3DL0A 4AIIA 1ZM3A 4JLJA 4Q1DA 2HJGA 4LWZA 3A4LA 2GKSA 3DO6A 4N0EA 4DLXA 2CLCX 4TTQA 3SHFA 1JEDA 2W6JD 1FP7A 3F0TA 5H68A 5JRJA 1UKVY 2YINC 1TNDA 3GEIA 4H1UA 3B8HA 2RB4A 2OCAA 2HV8A 1G9XA 4LHXA 3ZQJA 4A0FA 3WP1B 1E1RA 2FSFA 2IXEA 1OV4A 1RE0A 2ZI3A 1F2UB 1FQJA 4HZUA 4TMTA 2GEDA 3P20A 5AWFC 5CYPA 1VCNA 3THOA 1SKQA 3W8NA 5LD2C 2BOVA 4PHFA 1QG2A 2ZR9A 5J5CA 5EE0A 3B1VA 3RDPA 1W2HA 1KMHA 1SZPA 3LBIA 2NO1A 4PHGA 4OI1A 3PUZA 2CXXA 4NZYA 1ZAKA 2LCFA 2OESA 721PA 5HCNA 1GP2A 2VO1A 4HB2A 3HJNA 1Z0KA 1U99A 1R8QA 3OEHD 4NU0A 4QHSA 1E6CA 1IHUA 4TLDA 2VTKA 2ZI5A 1U8YA 1W2GA 3M6AA 5EUMA 4EJSA 1G5PA 4QOSA 2VP5A 2ERXA 4PZLA 4BFTA 1AS0A 5HCIA 2ZR0A 1UJ2A 1GRRA 2BBTA 4JVNA 1RZ3A 4RZ2A 4DCTA 2DWOA 4HB3A 1JALA 1R4AA 1LVGA 3AVXA 2QTVB 4NE2A 2FU5C 5KDLA 1KJWA 2ZUCA 3SEAA 1E94E 3GLFA 4CGZA 3A1UA 4G0NA 1ZIOA 4Y0VA 2FSIA 2QAJA 1G6OA 1WRBA 2OBLA 4URUR 2MMCA 1QHHA 4MYHA 4PFSA 4IFEA 1Z8FA 3DEFA 1DVRA 4GOJA 2J1LA 3DZDA 2EFGA 1YZLA 1DS6A 4UJ3A 3SFZA 4AG5A 4V0NA 4TLAA 2A9KA 1G8HA 3OHMA 4ZDWA 3TVDA 2BKUA 3THWA 3CIOA 1OFTA 2VP4A 3TLXA 3RSOA 1SKYE 1Z47A 3CX8A 3RWOA 2B21A 1EG7A 2GK6A 4LDJA 2VRWA 1GM5A 3GJ3A 2D74A 2V6JA 3Q85A 4Q9IA 2O8BB 1QHIA 2C5LA 3KZ1E 4QJ5A 2C78A 2J0UA 4BLQA 4MYCA 2ZSDA 1X1SA 4KYIB 2ODBA 3CX6A 3E5HA 3QF7A 4DB2A 2QRZA 2ODNA 5EZ5A 3K0SA 3AB3A 2QQ0A 2PL3A 1KYIA 1N5JA 1AK2A 4OQXA 1FPMA 1GZSA 2QL6A 2W6IA 4IOLA 4L5BA 4UNSA 2BJWA 4JLVA 3CRQA 5AUPB 2WICA 4KVAA 1I4LD 5JSZA 1RYFA 1IONA 3X1DA 1XD2B 3HR8A 2ATXA 4URWR 1G17A 4X8MA 2Z83A 2G83A 3MWKA 3BBPA 2ZRPA 4TL7A 2WM9B 5FUYA 3EX7C 4DT1B 1IN8A 4A1FA 4YMSA 4HZIA 1OLOA 3P32A 1L4UA 2K5UA 4P0TA 1HT1E 4YLGA 3RC3A 4CYMA 3RS4A 4YMVA 5HKKA 3P26A 4XVRA 1P61B 1ZUIA 3VQTA 4LPKA 4NCJA 3SHWA 2C9OA 4G3XA 5UKDA 1KNXA 3CX7A 2NQ2C 3GJ8A 4LHZA 2KB0A 1C4OA 4CEHA 2IS4A 1SVIA 3GJ6A 5DN6A 3IEUA 3FKQA 2V1XA 3QBTA 1E4VA 1G1MA 4FMCB 4UKDA 4ZCIA 1AQUA 2AWOA 1ZM9A 4AC9A 4CT4B 5K8IA 3E1SA 3CB4A 2IYSA 3B7GA 5KTYA 1NVWQ 5C2JB 2R6DA 1VPLA 1NSFA 3RABA 3WRYC 4TQ9A 5CB8A 2OCPA 3QXSA 5CLLA 4JLOA 2BWJA 5CIQA 2QTFA 2RMKA 2ZRAA 5FOXA 4CRWB 2WV9A 4A6XA 2WIAA 2GF9A 1PLLA 1WBBA 1Z6TA 2JLUA 2GXSA 2ORVA 5JCPA 3K9LA 3QKSA 2IT1A 2B7BA 3VHXA 2Z6VA 5DI9A 5TDHA 2H1LA 2R6FA 5CDFE 5KYKA 3UIEA 2JDID 1RVDA 1SKYB 3U3MA 3EPLA 2OXCA 2X2FA 5D3MA 4RVCA 5F98A 2OBMA 3B1YA 2ZAOA 3F8TA 2AXPA 2C9CA 2OZEA 4BLTA 2YWEA 1KZGB 2ZRIA 3V9PA 4M1YA 1OXSC 1U94A 1UM8A 1K8RA 2YC2C 4ZO4A 5FPHA 4DJTA 4TYNA 4KI0A 1YR6A 2AHOA 4JT4A 4Q9HA 1E9BA 2JLRA 3KKOA 3M0EA 4DLVA 3MG9A 4ESHA 3O8RA 1NVUQ 2QPAA 5CK4A 3SOPA 2IK8A 5JCZA 4IDOA 4FN5A 5JJIA 4CEIA 1X8LA 3RHFA 4QM7A 2FE4A 2GDJA 4OI4A 1KI3A 3IBYA 1K5GA 3KTAB 2YJTD 3ZVMA 3KQHA 4P32A 1UAAA 2ZSBA 3KQUA 1N6RA 3GLHE 2CVHA 3IHWA 4JIMA 2BMEA 4NONA 2WOJA 2Z43A 2D06A 4AK9A 3FYHA 4ACAA 3A37A 3KKNA 3QI2A 4LJ7A 5L3RA 4O25A 3U7EB 2JLVA 3BFKA 3U4QB 3AVWA 3Q8XB 1JR6A 2EYQA 4LX0A 1U9IA 1JQLB 2J3EA 4TSFA 521PA 4B33A 2IYWA 4AYWA 1XPRA 3FVQA 2JLZA 2E9SA 3G5UA 2XB2A 1RRCA 5FTMA 2QE7D 1OKKD 2EFCB 2PT5A 1KDPA 3CRW1 5FBRB 1OH7A 4B44A 1QF9A 5KSYA 3OEEA 4OJKA 5DI3A 1E96A 1QVRA 3KFXA 3ONWA 4QBHA 2WWWA 4Q01A 2WJHA 4US1R 4TL6A 2XTNA 2I1VB 3JZAA 2Y8EA 4NYJR 2F3RA 4ZPXA 3HPQA
chains in the Genus database with same CATH superfamily
3CH4B 5DBFA 5HKKD 3H1BA 2Q5JA 1KVUA 3S1AA 5ALTA 5BSFA 3IIIA 1JIKA 3IAM1 1AH2A 1C7ZA 4R9SA 5GM2A 3JRNA 4I6GA 4RD2A 3UJNA 3LFUA 1A8QA 1CEXA 1QGZA 5ENDA 5F5XA 3CCBA 4QGGA 4RKFA 4C0JA 4OV6B 5KPJA 2W2VA 3WWCA 2A9VA 3SVTA 2EYUA 5CX4A 1BXZA 4ZCMA 2J0QA 3ZZ0A 1ZGBA 1DWUA 4M8NE 4QNNA 4UVHA 2YXBA 2W37A 3PLRA 1YR9A 3HR7A 5AK6A 1ZHHA 4P7GA 1SR8A 5B7PA 2O2XA 5HF6A 4YRBA 1E2KA 2D3WA 1CK4A 2J3KA 2HJSA 2W6ZA 4FNAA 3Q88A 4RZ3A 3ROKA 3WGOA 1QIGA 1AY0A 4REQA 1XYVA 1C0EA 1PKEA 3UZUA 1Z2AA 4KOAA 4EIWA 2BSXA 4ZHQB 1TTHA 1P2BA 1HT3A 1GZ7A 1DJPA 3K15A 3OJLA 4ITRC 3TOVA 2IVZA 4ZN6A 2O8EA 3D7LA 3I04M 4I08A 3VC2A 1CR6A 1DAMA 2Q0QA 3NXKA 3VPXA 4BFCA 4E94A 2UZ4A 2I66A 3JZFA 2EKZA 1LS6A 1PV1A 1W4AA 4HO1X 3PC8A 5FFFA 2AYZA 3Q0EA 1D0IA 1I3LA 2QLTA 1Q3HA 2WJIA 1R5NA 3AONB 3PDWA 3DQQA 5JNRA 3OOHA 4QFDA 4E11A 4DSNA 4Q4JB 1W85A 1TAQA 2O3JA 2NQ8A 2P0EA 2V7QA 3V7UA 1WOYA 3M4ZA 2N47A 3A2NA 2DZDA 3L4SO 1RM3A 1XQXA 1F17A 1RHUA 3ICPA 3OZEA 1SVWA 1LRLA 1W5FA 4BMPB 5BWMA 1WPGA 3BXFA 2OFWA 1V11A 2VPPA 3BF7A 5DLEA 4ZK6A 1XNQB 1P1RA 2F9MA 2D3TA 2PKWA 3FGOA 3EASA 3C2QA 1WLSA 4XQ9A 2D1FA 2GTHA 2EKLA 3SIXA 1MO3A 3CLSD 4D80A 4NICA 3D6FA 3AETB 5GJBA 3CT4A 3V7NA 2CDBA 3ND8A 4S1OA 1THMA 2YWHA 5IK2D 1TM4E 3L8GA 2FVYA 2HFKA 3BCUA 3HYSA 4IHKA 1AKVA 2BMJA 3T3MB 3SLRA 3N8DA 4HYEA 4GPZA 3PC8C 2BEKA 1LEHA 4KO2S 1BKDR 4E15A 1K0FA 1MKYA 1IOVA 1JQJC 3ZY6A 2FNAA 3ND9A 5GZ6A 9ATCA 1O96B 1G20A 1NYTA 2QMEA 3EEIA 3D8BA 4LSMA 2ZZMA 1PR5A 3VO9A 4DA7A 1JJBA 4IQFA 1NIPA 5BUCA 3TOZA 3HHEA 1P4GA 4K6KA 3DQPA 1E9VA 5DYIA 3S2IA 4TTIA 3RVDA 1QG0A 2MR6A 3CKMA 3IQDB 1J2EA 3H9CA 4E4RA 1PG5A 3TQCA 2VK4A 4FPXA 1E1KA 2JFYA 2NIPA 1GKIA 4WMLA 3AOGA 2QV0A 3TSAA 5AW7A 3EF0A 3AM3A 3ZR4B 2IYZA 4TKUB 5HZGA 4K7JA 5GGYA 4ASUD 3PEFA 1V47A 4GKVA 1R4NB 3K6SB 1UR5A 4Z4IA 2IHZA 2OM6A 2WYUA 3PWZA 4PQYA 5ALGA 5EWMA 3C6YA 4MIYA 2RI6A 1RM0A 1TI7A 4QX6A 2QE6A 1JKXA 2JI9A 1QRUA 4TKZA 2V54A 3BC1A 3U44B 2X0NA 4L9WA 3L0ZA 1GTMA 4S1TA 3Q2OA 4YCBA 3C8HA 4CQMD 1RIIA 1QIMA 4E5UA 4RF3A 4GUAA 2ZT7A 3DHVA 5G4LA 2ZT6A 3UB4A 3K73O 5B3KA 4FW8A 5GV7A 1WUTA 1MQ9A 2H5JA 2P77A 1JQAA 1P5ZB 3HJAA 4YREA 4J91A 3E3MA 5J9FA 1P8AA 4OMCA 4JOSA 4KLRA 3BKWA 2G6TA 1WY5A 1FSGA 3ZNPA 3ZWYA 1VYUA 4DLLA 2YKGA 5ICGA 4NABA 1M76A 4Q19A 3HVRA 5JJKA 4MP3A 4NZMA 1AN0A 5EJEA 1GUZA 3EARA 4O4HA 1RPAA 1T8YA 2GPBA 2Y1CA 3K5HA 4B6FA 5AVUA 1C8KA 2YHBA 4X8HA 1Z29A 1Z75A 2HRRA 3TNFA 1T24A 2EG5A 2HEIA 4ZQBA 1ZH4A 3LAWA 4TZ6A 2O59A 3W05A 2COEA 5FRDA 2IXTA 4AN4A 4NR0A 4C4RA 2QQGA 4L5YA 2A0UA 1I94B 5IXJA 1O54A 5CR9A 4NHOA 4L7QA 1KK1A 5JECA 1QPZA 3SQLA 1HTTA 3DNFA 3NANA 3WLNA 1ZOOA 2NZ8A 3OHPA 2CNWD 4CFSA 1KSJA 4IQ4A 5IVIA 3MJHA 4R40A 1XJCA 5E3JA 4BWFB 3NBFA 2I8AA 1LNSA 1W5AA 1PJTA 1SKUA 2QX9A 2RHDA 3A1CA 3L2OB 1UZAA 3ESYA 1TPZA 2V7QD 5KKAA 3ZIAA 1ZK2A 2HZBA 4FSHA 4R8VA 4XD7D 1H6DA 4XUGB 4P81A 1YE8A 3K71B 3ZLJA 2WFAA 2XUDA 4KQMA 3L0OA 5AI9A 4W5TA 4HX9A 2HIAA 1FU8A 1SUAA 2I6QA 2PEYA 2FW8A 3GLSA 3I5YA 4DR5B 3V6MA 3V1YA 5IN5A 4EI7A 4CETA 1HOTA 4BU0A 3R0ZA 2VDPB 2QM3A 1OYVA 1W0KD 4J3JA 4J1SA 3GIDA 2PUAA 5E4TA 2D7DA 4I4IA 3H5AA 4OX9Y 1CUBA 1NONA 1FQOA 1UWLA 4MO9A 3GU3A 2CFRA 3W3AD 1D07A 1N2XA 5TR9A 3WQSB 2IGBA 4G41A 4EB3A 1T13A 5TGZA 4ZT6A 1XQVA 1TT5A 5K0CA 5SY9A 1E20A 3UAYA 3QYAA 1XJQA 1H65A 3QVXA 4K28A 2NM0A 4OLAA 1GPH1 3K94A 3AT1A 3TO5A 1PK8A 4TUYA 2DT8A 5GJWC 3FHJA 1SD2A 3WHKA 2GKGA 2H4WA 4B6QA 5C1PA 5JXIA 2XMBA 3AUUA 3A6DA 2AK3A 3H2SA 4GRIA 4Q3LA 2ATEA 3I58A 4RIIA 1GNPA 1V7CA 1W87A 1KZHA 3PDIB 4JHXA 5DYYA 4B82A 3MLBA 3DOHA 1K4YA 2XD9A 4ZQCB 5AW1A 3ELWA 1SHUX 3IBSA 3IQIX 4S05A 5LB4A 4CF5A 1NFQA 1R3DA 1DUSA 1QM5A 3L7NA 4FS3A 3ZDDA 2LVBA 1WCWA 3SHTA 2V03A 3N07A 2AI3A 3MVEA 1ORVA 4RSRA 1RAHA 3M8KA 4XSVA 3WA7A 2ZB2A 4U4AA 1DWQA 3DF7A 4NMWA 1TVKB 2JFWA 1Y8CA 5HNKA 1C29B 2WYWA 1QZUA 2W2XA 1HLPA 3GFPA 1TDJA 5EOVA 1E5TA 4AT1A 4F21A 4RHTA 4GNKA 5DBHX 3H2JA 2OV1A 1SZDA 2QUKA 1LBQA 3ZCQA 1K9VF 1NUPA 4OQMA 4IVNA 3PSHA 4RVHA 2WD7B 1B43A 2E7ZA 4BGUA 1YZGA 2R4UA 5AXBA 3CUTA 5L6LB 4H7HA 5EUCA 3UFBA 4M6WB 3EGEA 5E3HA 5T8KA 1P7PA 1H93A 1NR7A 3AEZA 3EVFA 3VH4A 3WJ2A 4MVJH 1JH9A 1VSVA 3OQJA 2NU6B 1AA6A 2GMWA 1R5OA 1ZVVA 4OA5A 4TXMA 2KX7A 3R09A 1M5RA 3CO0S 1U2GA 5HUJA 3HDVA 5DM70 3PUYA 1P4HA 4G23A 2Z3WA 5IARA 1CIVA 3R3UA 4Q21A 4PLWA 1CBUA 4JMLA 5MGBA 2QY9A 3CWCA 3JWIA 4XYLA 8AT1A 1RZVA 3WK5A 2FRVA 2RE8A 1DLIA 5G3ZA 4B3TB 2WU8A 1FX0A 3P0RA 1Q20A 2PKEA 4P33A 4P98A 4UBLA 5DWVA 1VPTA 4I99A 1RWBA 4B3HA 1YMQA 5AW3A 5E8JA 4OJMX 2WTUA 1CVLA 3PYMA 1U3TA 1DB3A 3QOFA 4RVUA 3AHDA 4OEHA 3EBLA 5LQKA 2NVUB 4KO3S 3IQHX 3NOVA 1LI7A 5IF9A 1Q57A 5KOJA 3S6JA 1YO6A 2Q5QA 3K4PA 5T8KC 3AVWA 3D7MA 2MYPA 1MUUA 3CUUA 2ISSD 3E4CA 4O0LA 5DGXA 5DM0A 4BNDB 4FE7A 5D85A 2FK8A 2ZLBA 1WZCA 3IR6A 3BILA 5C8DA 2JIBA 4ILKA 1H3EA 3CLTC 3KE8A 3NT2A 1U2GC 4OSOA 1BQ4A 4K2AA 3CZ5A 3EDYA 4Q3NA 4R1SA 3LK7A 4H6XA 4FNOA 4ND1A 3BWBA 4FIZA 3I2IA 4ZT4A 1BCRA 3TLBA 5HTOA 4E14A 2BFNA 1NBIA 3DCIA 2ZDHA 2EZ8A 5A3JA 2BR3A 4QODA 4EUSA 1AQIA 3RI3A 3BD7A 1DOAA 3LY7A 4EKIA 3C15C 1UJNA 1TVCA 3DTVA 2CF5A 3D6MA 1UFOA 1W0CA 2P2LA 4Q4LA 5DTEA 1GDTA 1REQA 4PC1A 1MIHA 3CMMA 1G3IA 3ZI0A 3H5TA 1L5YA 3LK6A 2F1IA 3MYRA 4P58A 3VR3A 4LOJA 1KI6B 2A5LA 3H8WA 3A1WA 3L0YA 2ZUSA 4F2GA 5BN5A 2G09A 1E9AA 1Q92A 5CAEA 1PVOA 4U00A 5BN4A 1SIOA 3C1UA 1EBFA 1PRYA 1AOXA 1AUXA 4FZ3A 5FTKA 3UXYA 2WHEA 3WLJA 5KNCA 4WLVA 3HJUA 4G4JA 5A1JA 3SYTA 1KKLA 1NATA 1ZK3A 3VJLA 1AN9A 2VF8A 4BP1A 3NBYC 1S7GA 5EWJA 4FHFA 3LGXA 5EKXA 2P1ZA 2YH2A 4TTSA 4C4YA 3RR2A 2CLHB 3JD1A 2PU7A 1CB7A 1K86A 1E89A 1ECCA 1XTUA 4BNXA 5CG2A 1FDTA 1QP8A 3DD1A 4JBNA 2ZJ3A 1L4MA 4Y30A 5EMMA 3REFA 3CWZA 4ODIA 3EOAI 4WINA 5KWEA 5LLTA 3AM1A 1LDYA 1VJ0A 1ZVQA 2XUGA 3DPUA 3JD2A 3TW0A 4NJEB 2PH5A 1VYVA 2OE2A 3C7CB 4OK5A 1NG9A 1QQ6A 1QP7A 4U0KA 5EVCA 3WJAA 5JSQA 3JQ8B 4G5HA 2Z9BA 3L40A 4RD0A 3E7DA 2QLLA 3QBEA 2QRMA 1D6JA 4OM7A 1NVXQ 4MHTA 1EXNA 2FRXA 2VUTA 1YSCA 3LECA 1T8UA 3FWYA 4MX8A 4F84A 4CQNA 4A5OA 3K53A 2XCLA 2G9RA 2CVOA 4FYWA 4J0GA 4DCNA 1XN1A 1EGVB 2QVZX 1R8XA 1XEAA 1LQTA 3E05A 3GARA 3TMKA 5CCDA 2WWGA 4LC1A 1QZZA 1V1RB 2XLCA 3HDTA 3X1XA 1YZFA 2Y6UA 4MKFA 4AJLA 5JYEA 2R6GA 2I2FA 3CLTD 4V0RA 1DDOA 4FJ2A 3TD2A 5ER6A 4K6OA 5P21A 3UWMA 4AX8A 1Y80A 4JU9A 1GTJ1 3QXXA 4PQRA 4D3SA 4EJSB 1BRTA 5AR1A 4G0VA 2HADA 3PUIA 4Z9AA 3VSCA 3WKCA 4XTCS 2G7MC 2ZRCA 3U4CA 4DQXA 2CEKA 2R8XA 1W46A 3ELBA 4JFAA 2POCA 4M3NA 3SR4A 1SQ5A 3EXEB 2J45A 4MVJP 4YUYA 1ISRA 4IV8A 1DELA 4EHIA 3I2YX 1QPBA 2IL1A 5JUWA 1U3GA 1YC2A 4L57A 2Q3HA 4Z53A 5BV1A 1GLVA 1BWRA 3JWHA 3UMBA 1WU7A 5C1IA 3UBTA 2PMCA 2RG7A 4FFLA 4BZPA 4IHQA 4Y2GA 2WAOA 2ZTLA 1PUIA 2DHEA 1SULA 2HK9A 2UZ3A 2YW2A 4ZQGA 2YICA 4ARIA 3Q9UA 4MS4A 1P33A 2BP7A 2OWEA 2Q6LA 5H3CA 1A82A 1VMEA 1M1YE 5FOWA 1M8FA 1S1MA 4GWLA 4N3CA 1QGDA 1CUUA 4MB0A 1NT2A 4HLNA 4NOLA 1EFCA 3DWGA 4H7KA 5HIIA 5K5EA 1TEZA 1L6IA 1X86B 4LJ9A 2BGGA 1A76A 2P4QA 3NIWA 1JILA 3GJXC 3OKFA 3S2UA 4B2YA 4Z4EA 3QLUC 3ADDA 2PSDA 2VH5R 4GMDA 3G2IA 1UAYA 1OZ0A 3R7DA 4KHPB 1VA5A 1H0HA 3MUNA 3LC7O 2EDCA 4R5MA 5BSUA 4U3JA 4LS3A 5LVAA 2ONZA 3NWOA 1JWAB 1I7LA 1NW8A 1BXGB 2HRBA 4AUNA 3TG2A 4AQ7A 2XECA 4EPRA 1F2UA 3DJYA 3EYWA 1EIZA 4H1VA 3UCFA 2FZ5A 3N8KA 4AF8A 1D03A 2YY7A 4ARSA 5B3AA 3EDMA 3TZLA 3VPFA 2GWHA 4E12A 1ZEMA 2TMKA 5CX1B 4EK9A 3EAQA 2AN9A 1XIVA 1KQOA 1OXUA 4Z6KA 4G8DA 4KIGA 3DMTC 1EUDB 4M0DA 1AMNA 1M34B 1PS0A 3IDZA 5BOSB 1SA0B 5IJWA 2C4VA 5AW0A 4LXIA 5KB3A 5EP2A 4YJ2A 1K7CA 3COPA 1E5VA 4NENB 3CMCO 1M8KA 1XFAA 5DH9A 4GX0A 5CTJA 4L5IA 4TWBA 5CXQA 2OG2A 1GPDG 3EEFA 5AI4A 4HH4A 1R10A 4HUQA 3WWDA 3ZWXA 3LUBA 1H4TA 1UIMA 2Q07A 4JJ6A 4QJBA 4BBPA 4BNGA 1DADA 2H9AA 4KMMA 4R2MA 4PE5B 4OJYA 1I51A 3U4AA 3VYVA 3JYPA 4I7EA 1P0MA 3BWVA 1Y9ZA 3KWJA 4A7PA 2PZMA 3KAQA 3LBAA 4DL9A 4E2WA 3AF4A 3PQ2A 3HY3A 3OJEA 3H2GA 4NC9A 3F1KA 3LDFA 2B78A 2CHFA 3LYHA 1I3MA 1W88B 4PR3A 5EE1A 5GY7A 4MCHA 1Z9BA 4CEHB 2GHIA 3G82C 7REQA 3RBXA 2YZKA 1LTHR 1RBMA 4RX1A 5DFAA 4BFYA 1FIUA 1J8FA 1LB1B 3SM3A 1WDMA 3UMRA 1JEQA 1Z06A 3JYOA 4DXAA 2OM2A 3D8HA 4E33A 1A5ZA 3PVZA 2KBEA 5KQRA 1G2IA 2Q50A 5H3LA 4PS1A 4EGAA 5BWOA 2HBYA 5HIAA 3RV3A 1YE3A 2R97A 3KTOA 4YPOA 1ZG3A 4JLDA 3RUEA 1Q7CA 2YWGA 4QULA 3JZIA 1YU9A 2M1ZA 3LCVB 2K7ZA 3L7AA 4HDNA 3ZE1B 1I5EA 4AZVA 1V45E 4UNPA 3OCWA 4PC3A 3RYTC 2P2ZA 4C2BA 2XXBA 2PUDA 3ZDEA 1LU9A 3FDZA 3MQ2A 3MD0A 1N3BA 2AZ4A 2QN6A 2B7CA 3HU2A 3QKRA 5FWXA 3DXFA 4WEQA 1T6XA 3PCTA 4DE5A 3QNUA 2JFZA 5E95A 4W9NA 3NT5A 3QKSB 1DC5A 4AP5A 1XG5A 2PYZA 2V55B 1QNFA 5F5LA 1AQ6A 1Q17A 2PLWA 3DLBA 2DR0A 3I9LA 1B00A 2BGNA 2BEWA 5TMBA 4X6YA 5I51A 4WOBA 3S40A 1JHQA 3KJHA 4BGIA 3GD5A 3OC0A 4DIDA 1NLYA 1EGAA 2K4MA 2FJ0A 1B3BA 3ZN2A 3EG5A 4JOCA 1C3VA 3EDOA 4D74A 4BVHA 1YRAA 3L9WA 1ZH6A 2VH1A 2WA1A 4WOCA 3WJ1A 1GAJA 1EP9A 1G7RA 1B23P 2CXHA 1YZNA 4CKZA 2EX0A 1GIAA 3Q3EA 2DUJA 3GFGA 3KFLA 5EESA 4URXR 1B6RA 2ZS9A 3DUFA 4JBGA 1AZSC 3RAPR 5ELMA 2VAPA 4KLZA 1I13A 4RW0A 1OI3A 3TUJC 1EFLA 1DCMA 2O0LA 1J8MF 4PXSA 1Q1NA 2WLTA 1R8YA 1OY1A 3QE2A 4MLPA 3WYEA 3CZQA 4A73A 4YJDA 3AYZB 5K8UA 3OQIB 4Q1AA 1JAZA 3MT9A 3CPEA 4KCGA 3R9IA 1NW3A 4W9NC 6CHYA 1HDRA 2DJIA 5JYCA 2B4YA 1QCCA 2RG1A 3EDRA 4WH0A 2OD7A 5D3QA 1BVRA 4DCGA 1YOVB 5I3CA 4G36A 2ZJ1A 3V00A 4LXHA 4NAVA 2H85A 1A50B 2P8SA 4KRXA 4RCYA 4ER6A 3PEYA 4CTMA 2QX8A 3EK2A 1JPUA 2CDNA 3P2EA 4LXYA 4CEJA 2PY6A 1MPXA 2Z58A 1HE4A 3LVQE 5REQA 1N0VC 4OTZA 1IY0A 3WB0A 4P0PB 3FYUA 3IJ5A 2W6OA 2C82A 1KAQA 4WNIA 2P3QA 2C0CA 1K89A 1WG8A 3LC0A 1NNLA 1U7OA 2JIOA 5ABPA 4OI0A 2WSBA 1L4NA 4UTVA 1FNBA 5BSTA 4DEYA 3I05A 4JVSB 4XX0B 1E3SA 4EPVA 3T9DA 1GT91 1DWPA 2CLSA 1ULZA 4RV9A 3RJ5A 2D59A 3UY4A 4X95A 5DI3B 1L8XA 3TTUA 3C6QA 2GF0A 3SP1A 3ZV3A 2G9NA 1U6JA 3NYIA 4BWGA 5LDDC 3ZE6A 4M8IA 3AXTA 3CVOA 4U9IS 1J9EA 3B52X 4RH3A 5JZVA 3ZDQA 4JSRA 2JGDB 1CP3A 4W5QA 1MEJA 1Z62A 5F3WB 4E7OA 3L3BA 3UFXB 2O8DA 3L06A 3LHDA 5I9IA 3PE6A 1NF3A 4XDZA 4ZRDA 3S1AB 3DZGA 1N0UA 5ILGA 2I7DA 5CVUA 3C7AA 3OD5A 1Z5WA 1MENA 5F7JA 1XCPA 2H5IA 3UFXA 3BFVA 2W90A 3OEWA 3JVDA 2Q6OA 2YBEA 1IDOA 5SY4A 3VBEA 3N3BC 3TKYA 2NNLD 1OA1A 1F60A 5EP4A 2J5XA 3AW9A 3BOSA 5BYAA 3SQDA 2GAIA 1Z35A 1SBCA 4NMMA 2TYSB 1SCDA 2VDWB 4WGGA 3W2EA 5LP6A 3AJ9A 3DEHA 2C2MA 1K6IA 3SYRA 2R1VB 4CCYA 1KMNA 3IDQA 4MV3A 4AN1A 2C2OA 3ENQA 1JDSA 4BFVA 2AEMA 1G5FA 3VU0A 1E3WA 1VG0B 3R5JA 3MJEA 4PPGA 3ITKA 3GA5A 1Y7PA 2QPLA 4OHFA 2C97A 1V5FA 3CF4G 1YZTA 3IVXA 2X5OA 2O8EB 3PXEA 1B16A 4EUHA 5SICE 3C87A 5FEUA 3C3BA 4FC6A 4CKCA 4BX3A 2VZEA 1C0IA 5KQLA 4H1TA 5TPWB 5DCYA 2FRDA 4OHKA 4ABTA 2AVNA 5DN6D 2IY7A 2M98A 3B3AA 1PSWA 3RASA 1JE1A 1QRAA 4B6JA 2O8CA 2X5NA 5FI5A 1W85B 1WVMA 2XTMA 4FFMA 3D2CA 3U39A 4QQFA 3E1GA 4HXGA 3SHOA 1R5BA 4HGYA 5LP6C 4DBLC 3W90A 3WYCA 1ZXBA 4ITVA 5M34A 1H94A 1V11B 1TYDE 3HWX1 1XP5A 2H2DA 3RG8A 4DC9A 2A0KA 4Y9RA 4XX1A 1QH0A 1ORIA 5K6AA 1FS6A 1WAMA 4EO9A 3RVJA 1VKJA 1N77A 2RGDA 4TMFA 2ZQYA 5CM9C 1F8XA 4YCAA 1FFHA 1AKRA 3ADKA 2HZ7A 5K0SA 1TXGA 1W30A 3EXG2 5C5DA 1FYVA 4OHVA 4G0UA 2OLKA 1H8HA 2RC6A 2ANBA 4X6LA 5TQ2A 3MWEA 1N9GA 5CIWA 1YJQA 1X3SA 1V5GA 2JL1A 1JFLA 2YHAA 2Z5LA 3GH3A 3RW9A 1Q95A 2HB6A 2O2IA 2QNIA 1L1FA 3ZD6A 1QKKA 3UN1A 1ISMA 1YS2X 3BD9A 5IBRA 4E5DA 6GPBA 2NU8B 4F5YA 1WX1A 2I1LA 3MCAA 4C2UA 4TMWA 2DOKA 1PHPA 4WZ6A 3VC7A 5DGTA 3ZGOA 4DM3A 1M6WA 1DXHA 2FCRA 3FOAA 4GYJA 1YUNA 1E2PA 5AHWA 1PZMA 1GPKA 2VHZA 3BERA 3HVJA 3O4VA 3UOGA 4WESA 3V48A 5HEKA 1S0UA 2OA0A 3Q8KA 3EIOA 2FCAA 2HBQA 4DQUA 1V4VA 1XKLA 4GOND 1DARA 2XJ4A 1UOEA 1E62A 2X7XA 3P0FA 1P5FA 1EWTA 4JX8A 1N4AA 4TMZA 1R4MA 1IN4A 1LTQA 1WEHA 2J6BA 2O7SA 4G26A 1Z5NA 2O9JA 2F3QA 2DPLA 4OYLA 1DEXA 4ZZ1A 2XLBA 5ILQA 1Q2XA 3KDSE 3DEKA 1DBQA 3GRUA 4K26A 2WW8A 5EWMB 3AB8A 2O23A 1KY4A 4RC9A 1N33B 3P52A 1ICIA 5LYJA 1XQ9A 2EX4A 1NQUA 1Z4PX 4NVRA 3NOXA 4BNJA 5KVSA 2HJ9A 3WIDA 4C1BA 4RXTA 2WWVD 3ZHOA 3JASA 4LV5B 2QLNA 1V6CA 4KE9A 3VDXA 3CLVA 3DKKA 4TSFD 4EVIA 4EHJA 1BHJA 2WFLB 1A5AB 1O57A 5BUQA 3Q12A 4J90A 4N7JA 1KP3A 3KL4A 3T7RA 3RVSA 1TZKA 3N86A 4XCQA 1JMYA 4GX1A 4PICA 1RLTA 3ANNA 5BYJA 1HQDA 3OEED 5I7FA 1FDOA 1G2PA 2DPYA 2OHOA 4M0FA 5CVEA 2YXNA 3FPBA 4O4HB 3CVVA 4DSAA 2UVQA 4QVKA 5J4VA 5GIPE 2R7NA 4IILA 1BFKA 4X97A 3CIFA 1G8MA 2ACKA 2C95A 4M1KA 1ZBQA 5LUAA 4Z2YA 3DV0A 5EJ4A 1GV0A 3MGCA 1NW7A 1TW2A 2XMPA 4AD8A 3REQA 4CL2A 2O8FB 5ADWA 5KSPA 4EKNB 1U7HA 2AEEA 1N0IA 1PK9A 2H59A 2J9GA 3HLKA 1G0OA 2B8TA 3B20A 3BN3A 1IBKB 2GEBA 2VSQA 3E3NA 4WASA 5AXAA 4UXJA 5DF1A 3SMQA 1PX2A 1L5VA 2YY5A 3K9CA 4YK7A 3HP7A 3KR2A 1KJZA 2BV3A 5TC4A 3LLSA 4XQCA 3TSYA 1IG0A 1TOAA 1HDCA 2A30A 4B74A 4DVGA 5KOYA 1IM8A 1ES9A 3PC7A 4MVJG 1HLGA 3QVJA 4YT2A 2ZVPX 1G1AA 5BURA 1EQUA 1IBRA 2XTAA 4D98A 4GI5A 4YT8A 1BVUA 2VQ6A 1FFCA 4PYKA 4DHEA 1KQGA 4DW8A 3M70A 4ZMBA 2UYQA 3BXXA 1RLUA 4E5SA 3FOCA 3NNNA 3ZLBA 3TRJA 1E9CA 2VTVA 4QDKA 1RWNA 1TM2A 3WGMA 2FG6C 1LWNA 4K9NA 4PHTA 2D1QA 5HKLA 4ZKDA 1JYEA 3DHEA 1P44A 3MWJA 4AF7A 5E7IA 2HLDA 1UK9A 4A2WA 4X92A 3PKIA 2DFDA 3TFOA 1KSGA 3H6HA 1V4NA 4RFLA 4UUQA 2I9KA 3SMVA 1PJCA 4NNPA 5GADl 1U2EA 5DGIA 4Q48A 2PJDA 2IA5A 4OHXA 2X8BA 5AW4A 4TUYB 1HTWA 4RY2A 3OQOA 1NW5A 1T2CA 2FWIA 2B1QA 2LDXA 2RHBA 3CN7A 2GBFA 4BO1A 2Q6KA 4RK7A 1LXCA 2HWXA 2IP1A 3JQDA 3TYXA 2FWAA 5KJCA 3TZBA 5GZ3A 4NESA 3LTNC 4JT8A 4UUPA 3V3TA 1CX9B 3E7WA 4DV6B 2JI8A 4NPHA 4MW6A 4LTDA 3R5SA 2AC4A 2BGIA 3OLVA 3O1IC 5IDQA 1XEWY 1EHYA 4FHDA 2XMGA 4JJAA 2WAYA 3UHAA 3Q7RA 4R2JA 1QE5A 1AUOA 4IIUA 3T5CA 1CY6A 2AOXA 4PVDA 2OFXA 2HWKA 3G1WA 4JLPA 3I76A 3N7AA 4X41A 3HP4A 3RIHA 1CR0A 1IVNA 5DSZA 5JD6A 3EGIA 1CNMA 2P8JA 3IMGA 3HB1A 2LD4A 5AJZA 5CCXA 1R9GA 5FUXA 2XZOA 3SXJA 4ZZIA 2XKKA 1E0AA 3EQ2A 4EYKA 4FK8A 2QVLA 4EHLA 1DG9A 4F3RA 4B5LA 3RYCA 3INGA 4BB5A 4DMFA 5JH7F 4AKTA 2AQKA 2QN8A 3R9KA 2NQTA 5DW0A 3VR6D 3OG9A 1JYFA 4BNUA 2G4LA 3AVPA 3C97A 2XCUA 4ZGWA 4JR2A 1A8IA 4HNSA 2YASA 4EY4A 4J0HA 1E2IA 3GCZA 1HT0A 3W5JA 2RHWA 4JS0A 4RU1A 1MQ8B 4V1CI 4AM8A 3GDOA 3L7KA 2ICAA 4K46A 4ND6A 1FX0B 3AFNA 1A8SA 2QR2A 5TJ9A 1X0VA 4IX9A 3AF6A 1COZA 2JATA 1Z5ZA 3CU5A 1UDXA 1GSIA 1ODIA 3ZGZA 2PMDA 2NNWB 5CUQA 3ZWCA 5JRJA 4EATA 3K6KA 1UBMS 3E15A 1DIRA 2NYAA 2XE6A 1QIIA 1ZC3A 4CHTA 1WHTA 3H65A 4OHYA 4J94A 1NVMB 4IYRA 2A9FA 4KRYA 2Y05A 5KOJB 2HK8A 1JAHA 3DCJA 5EQTA 1P9NA 5CH5A 3VRHA 1HO3A 1ZOIA 5DISB 4XWKA 3L82B 2IC5A 1G9TA 5BWCA 2IUUA 3KDAA 5GM1A 4Z1MD 2JGRA 3B89A 5HOQA 5CFQA 3OZTA 5CTAA 1GSAA 1BCRB 1NV9A 1THZA 2FFQA 3WSWA 2JC3A 3V8EA 4N8EA 1ENPA 1T25A 3GEEA 2VIIA 3BF8A 2EJVA 3UHOA 2C20A 1EB9A 2V98A 3H9BA 3AVVA 3A0UA 1RWMA 2EGUA 2F8LA 1M73E 4Z9BA 5G1PA 3ED5A 3ZYCA 3W06A 1LJUA 1QXSA 4DNPA 2UUAB 3DHNA 1LBHA 1T4MA 3DTVB 3ME5A 2IIBA 3N28A 2CV1A 1DXQA 3DYBA 4EFKA 3R4CA 1YRLA 5ECGC 3OFND 3K1JA 1REQB 5EJFA 4JB8A 2NYUA 2NZVG 1NN0A 2YQ5A 4QPCA 5EG5A 3ZS9A 3V5NA 2AFHE 1F4PA 3NORA 4JC8A 2XT9A 5BN5B 4EHNA 4EHKA 1WW8A 2LKCA 4KUHA 4XWOA 5C7OO 3EZXA 3KJFA 1ZCFA 2ID4A 2D8AA 3C3YA 3L8ZA 3NT4A 5DGHA 2HT6A 3SBOA 1M10A 1EZ4A 2QN1A 1KZ4A 5EXEA 2RKBA 3WVNA 5LUBA 6AT1A 3WP0A 3QVMA 5IDXA 4MDFA 4W63A 2QR5A 3H9GA 1J0EA 1ZD4A 3TFQA 1OF1A 3G8CA 1F3OA 1PKXA 5K1ZA 3NZEA 5EWJB 3UJ7A 3GZNA 2WTXA 4U8HA 4V1CA 1TQDA 2WDZA 1GL6A 1DBWA 1E3TA 3C5CA 1H0RA 3C7TA 4QFCA 5CEEA 2OT3B 3ZI7A 3GLFE 1OWLA 1T10A 1P77A 1V43A 2FDRA 1OUMA 5IAEA 2VDQB 1DC8A 2WU3A 2HT1A 2HDOA 3CZRA 4MYUA 4POAA 2J46A 5EQDA 4XVHA 3FR8A 3H86A 5LU8A 1Y33E 2QT1A 3IURA 3M33A 3TFWA 3GGGA 4X94A 2BDEA 4OFWA 4Z99A 2B3DA 1RWWA 5CEJA 1P1FA 3OFKA 4BGEA 4K9QA 1VB5A 1V5WA 5BWLA 3FFWA 4I5EA 3JTEA 4RH1A 2QRQA 4U7FA 2O2ZA 4GL2A 1ZP6A 2ZJ2A 1J39A 1ZD8A 2CUTA 1EFDN 1C9NA 3MXOA 4M1MA 3VPHA 4CIYA 1D8TA 1NRIA 2GYYA 3O8CA 4GDFA 5SYMA 4BLPA 1ESZA 1P1KA 3IKMB 5IUNC 2A6PA 2YVUA 5KNCH 5H9VA 3MJ4A 2ZW9A 4C4AA 3IGFA 1H5NA 3TTSA 1AF4A 1M54A 4UEKA 1X7HA 4XTRA 5K2OA 1KMMA 1X9IA 1PJLA 1HETA 2BFPA 4Y2VA 3L8DA 3WYAA 4J2HA 4FZRA 1UOOA 2B4KA 3RWMB 2AOUA 2YWCA 2NADA 1TF5A 4Z8YA 5J2TF 3UICA 4KR3A 3B6EA 5AKHA 5KQSA 4F5WA 3UATA 2X1LA 3Q15C 3WYNA 1KMHB 1T0JB 1YFZA 2QPTA 5CLIA 3O47A 4JNCA 1L4FA 2OGUA 4Q3OA 3WGNA 4TTPA 1FVOA 5EPEA 4DDMA 1WXHA 2YJ3A 4JT2A 3TIXB 1OU0A 5DHAA 2VF2A 5EL0A 1QDEA 1Z88A 2EAUA 1LJ8A 1Z2EA 5LPNA 3AF0A 1TQ2A 1HQYE 3P4YA 2IS2A 1NJ1A 5BVHA 3ZHBA 5AM0A 3PENA 3KT8A 3A3OA 3LBFA 2JIPA 5FLKA 1JPVA 4MS4B 4M88A 2BP7B 4NNJA 1GTVA 3T7CA 2DUMA 2H92A 4JI0B 1U2RA 1P18A 4BX2A 3HXQA 1GPNA 1NF2A 4OLFA 3QVGB 5CM2Z 5DBGA 4C21A 3PI7A 3CW8X 3I1FA 2ZSIA 2MYUA 3G9UA 3DBLB 1UIRA 3LY9A 2XDYA 4GMHA 2IEZA 4RKEA 4EPYA 5CDHA 2FEAA 4F4JA 4DV0B 2B4TO 2BHLA 2OZLB 1UP4A 3BE6A 3LV8A 3OBBA 3ESQA 2EZTA 1V95A 4QU8A 2RHGB 2Y1DA 3DYIA 2IY9A 1BMFA 3FNBA 4QUIA 1RYYA 2O8NA 2YV2A 4KQGA 4KR7A 1FP4A 2HM7A 2V7VA 2FPKA 3A25A 3CH6A 3H42B 3H9UA 1B1CA 2QEQA 1N2BA 4IINA 4U2FA 4N41A 1HFWA 5EE5B 5JCXA 1C1XA 3I01M 3U19A 3Q7PA 3GL9A 1IN6A 3QW4B 1CR1A 3J81k 3LD9A 4M0KA 3OX2A 1J06A 3GVXA 4OOEA 1EUQA 2JAWA 1MB4A 5KAPA 4BECA 1P1JA 2O14A 1JKFA 4G63A 4GEKA 4M36A 4PCAA 4WUVA 1RWXA 2BJHA 1YZYA 5AKIA 3B1ZA 3JXEA 3SSOA 3LPDA 4YJ2B 4BX9A 2R9VA 2PUJA 5TEVA 3ZW7A 1T3ZA 2CVZA 2BN4A 4KPGA 4EA6A 2ZI4A 1AVTA 4HUQB 3TM4A 4DA9A 1X7XA 1GLNA 4GC9A 5JWRA 3W3ZB 2PFSA 5M29A 4RK4A 2W00A 4AMBA 4LKRA 3C98A 4BEWA 4F6RA 4CIVA 3WK8A 3JS5A 1W36D 3QX9A 3A4VA 2MSKA 2AZMA 2Z3ZA 4LJRA 4AJKA 2A0YA 4GR9A 3PT5A 1YS4A 2YQ4A 3QA9A 1AU9A 2GJ9A 4HVCA 1RLJA 4ZTUB 1U2QA 1OT5A 3SS8A 2Y1GA 9LDTA 3HU3A 3SZUA 7REQB 1R6VA 3QHPA 4I5IA 3VHLB 2PGXA 3T41A 5DW3A 4CM3A 1ACLA 5EN4A 1MQAA 1JEQB 2DJ5A 4MKHA 1KOFA 1KPGA 1XZCA 1U90A 3TMAA 1CFJA 2FGKA 2IUTA 4KDCA 3ZC3A 5C53B 2PVSA 2V4UA 3CJTA 4CXMA 1OX6A 4W7HA 1J20A 1GUBA 4C0WA 2DM6A 1CS0A 4IEFB 2TSYB 3MELA 3OMWA 3V8BA 2Q29A 3CJQA 5EFZA 4KPFC 3KQKA 4G5QA 2YUIA 5JASA 5J2UF 3UPDA 1W34A 2HTEA 1ZHOA 3FOFC 4LF5B 9ABPA 3FDZB 1G42A 2FW1A 3I53A 3MOGA 3X1JA 2OD9A 4Z7OB 3QKRB 1RPJA 1KYZA 1E6MA 5D51S 2PAFA 1ID8A 3HCFA 6LDHA 2J6CA 3M6MD 2ZQ5A 1J1UA 4P22A 1E6LA 1IU9A 2EBHX 3MJTA 5F23A 4DMCA 1UAGA 2DHCA 4FZ5A 3PF8A 3IDOA 4MRMA 3UMJA 4BP8A 5T4BA 4ENVA 1DTWA 5ITWA 2HK6A 2YJ4A 2BEWB 2B4AA 3PEWA 3L46A 1EFKA 3N6XA 3OFSA 5LB2A