4DLRA

H-ras peg 400/ca(oac)2, ordered off
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase HRas
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlrA00
1Q12A 1HUQA 1W47A 4CT5A 4ZDJA 4NMMA 2FOLA 3EWSA 5JFGA 1E0SA 1BIFA 1NLFA 1WCV1 2JJ8A 1DO0A 5JJLA 1N6HA 2F7SA 4DLUA 1Q22A 1HE1C 4Q1AA 2N46A 1WB9A 1Z8FA 3W3AA 2V4ZA 1U9IC 4O2LA 3KKNA 3EA0A 2AKYA 3W8NA 1NJFA 4PHHA 3O47A 3L0OA 4W9MC 2R6AA 4ZPXA 4S2EA 3RS7A 3WP1B 5CB6A 2EYQA 1KSGA 4XWOA 3LQRA 2NGRA 2L0XA 4TTPA 4Q47A 3MWLA 4MKHA 1T8UA 4IFEA 1NG9A 1IXRC 2GXUA 3WRXC 4C0HA 4FINA 4XTCS 4URUR 3AM1A 1TEXA 2GJAA 3ZJYA 1FNMA 1ZUNB 5JWRA 2JA1A 3C8UA 3W5JA 3BC1A 1EFCA 5EE1A 3THXA 1Z07A 3PXGA 1E1QA 2PX0A 3AKCA 3KKMA 5CITA 2TMKA 2DWPA 1W36D 4I1VA 4LJ9A 1VG1A 3BOSA 5JEDA 2IL1A 4DLRA 2IYLD 4DLVA 4HB2A 4E22A 1NSFA 1JR3A 3CPHA 3ADKA 4FW9A 4HLUA 4K8OA 4PAMA 3WBJA 2J0QA 4P4SB 1MO6A 2CCJA 3DZDA 2WSMA 2ERYA 2J7PA 3GJ3A 2O8BB 3THYB 2CNWA 1ZM2A 4HLCA 1R8SA 4B32A 4QRHA 2QMEA 1VIAA 2AHOA 2YJTD 2ZSDA 4G5GA 3L43A 3M1IA 2VSXA 2WWXA 2AK3A 4MRRA 1O87A 3VU9B 2WWFA 3GLFE 3KQLA 4JJKA 1F48A 2D2EA 4FMBB 4BZPA 3LV8A 2FF7A 2QG6A 1T5IA 3CW2A 4NBSA 4PHFA 3RRYA 4C0KA 3LFUA 4AG6A 1D9ZA 2VHUA 3GLIE 1NF3A 1WXQA 2WWHA 2NMVA 4LSGA 4M53A 1E79A 2VF8A 3MFYA 4KFUA 4LDJA 4AG5A 3SC3A 3EPJA 1XEXA 2BBSA 4MDEA 2ZR0A 3K0AB 4NYIR 1ZNYA 1AS2A 3DL0A 5SZIA 2IC5A 5B64A 4TSFA 3KL4A 1AKEA 3ONWA 5FTMA 1XTIA 1XMSA 4KYIB 3QI2A 1GRNA 2OM2A 2OCYC 3FGNA 2QU8A 4EJSA 2V7QA 2CK3D 2BCJQ 2LCFA 4HDQB 2BOVA 4HB0A 4UNPA 4RVCA 3C15C 1W44A 2FPLA 3NDBB 4Q9HA 2GZHA 4IOKA 2RB4A 3OEHD 1MR3F 5AJWA 2V6JA 5EUQB 2OBNA 5EP4A 2ODEA 3QBTA 4BLOA 1GL9B 3LRPA 3A1WA 1D2NA 5J4LA 1TF7A 4QL3A 1UKYA 4B44A 4PR0A 1DBSA 1OXTA 1UM8A 3K0CA 2IHYA 1CR0A 2QN6A 4BUJA 5FUYA 1NVWQ 3LH5A 1G291 4LV6A 3U61B 1MABB 5FOWA 2KE5A 1COWD 4JVNA 4HATA 3SFZA 2PZGA 3A1VA 4D25A 2QBYB 2ZR7A 2XJ9A 1E6CA 5JECA 4C4PA 4OK6A 2BKUA 4KCGA 1UKVY 3KFVA 2WWWA 5L3SB 5DO9A 1E9AA 3MRSA 2PT5A 1GDDA 4Q00A 3CX8A 4UXJA 4X8MA 3T15A 3WNCA 2GA8A 4F92B 4QM6A 2YOHA 1VHLA 1Z22A 1JEDA 1UADA 2K5UA 2MMGA 2HCJB 4WXPA 3UIEA 5D3MB 1AM4D 1KDTA 1LVGA 1QHNA 1Q44A 3PEUA 2ZUDA 3CWZA 3ZD7A 4QBGB 2AL7A 3CRRA 1LTQA 4KSCA 1Q1BA 1JQLB 3NC0C 4WXRA 2C03A 4PC6A 4LJAA 3UK6A 4FXPA 4JS0A 4PO9A 4DZZA 2A5DA 2ZE6A 4EUNA 1KSFX 5BN4A 4C2TA 3DM9B 2P5TB 4HZUB 1UPTA 4BEBA 2UZIR 3QF4B 2RGCA 3CF6R 1KI8A 3TSOA 1XJ0A 1KYIA 1XD2A 3TR0A 3AVQA 2ANCA 2QY9A 4DB2A 2F9LA 2QPTA 1NMXA 2VO1A 5DLQC 2ZI5A 3SBDA 3GLGB 2BDTA 2BJVA 1ZD8A 4QBFA 1RJ9A 5TDHA 4OHYA 3W6PA 2G1JA 2CHQA 1RW4A 4ILEA 1SKYE 2H16A 1ZM3A 2ZRMA 3AEZA 3EAQA 5FBQB 4GMDA 4Q1DA 1DTSA 4EPXA 3Q85A 1L7VC 5GVRA 4US2R 5FBRB 3OE7A 5FOTA 2QAJA 2OAP1 4B76A 1Z28A 1AZSC 1J8MF 2RGBA 3GD7A 3W6OA 3FMOB 4GFDA 1ZP6A 4ON9A 3VHXA 1KDRA 3AP1A 4XVUA 2GZDA 1FPMA 2IS6A 4HB3A 5L3QB 3MSXA 3SNHA 1XXHE 4Z51A 3FKQA 4RD2A 4ZCIA 3VNUA 1SXJE 4PPQA 3A58B 1I2MA 1UEJA 2ATXA 1K8RA 1ZUIA 5AUOB 3Q5EA 1KZGB 3BFVA 4ZCMA 4A1FA 1XPRA 2JJ1A 2ONKA 1DAEA 2RKOA 3GJ6A 4C0JA 4CDGA 721PA 4F4CA 3ICQB 3OAAA 1GAJA 1VDZA 3RSLA 2QENA 2I1QA 1R10A 2W83A 3GFTA 5K8LA 5HCNA 3G82C 4WZ6A 5KTYA 1PLLA 5CIQA 1PJRA 4JYCA 2AWNA 1PLJA 4EPRA 2KBFA 4NYIQ 1X8KA 2LKDA 4LX0A 2XTMA 1EX6A 3U3JA 3QY0A 2ZSFA 4JT2A 2FWRA 3MD0A 1IJEA 2WKQA 4TT3D 3ZZ0A 4HAVA 1H8HA 4DWJA 2GZAA 3CO5A 2CL6X 3SEAA 3ECCA 4LUCA 2XTZA 4PO8A 2GKSA 2QRZA 1AIPA 3AVXA 3C4JA 5CDFA 1IJFA 3AGQA 2B6HA 2WTUA 4HB4A 5DYGA 4GOJA 2OFXA 3TW8B 4ZV4A 3IEUA 1NL3A 4XSGA 1A5TA 3B1YA 5CIWA 3QKSB 2YINC 4MGZR 2CE2X 1OFTA 1J8YF 3X1DA 3IQXA 2BBOA 3H4MA 3QXHA 1P6XA 1W36C 4FD2A 2P6UA 1UDWA 4URWR 1W49A 3OFND 4OQMA 1ZINA 4G5RA 3AF2A 3IIKA 3IGFA 3WRYC 2EYUA 3ZQJA 4BFUA 1IHUA 3UG6A 4H9GA 3EC1A 3ADBA 3LA6A 4EKDA 4Q1BA 4BFSA 4M9XA 1IN6A 3WMFA 3P26A 5FTKA 5JWOA 1II0A 4ACBA 1NVUQ 3K70B 2ERXA 2OT3B 1E98A 1LB1B 2CLSA 3N70A 2IYUA 4EPYA 5C1BA 3A36A 1NLYA 4V0OA 1CBUA 2NZ8A 4XTRA 2AR7A 4OL0A 2Q21A 3HYRA 4I1OA 1NI3A 4TZ0A 1YJ5A 1KIMA 3KDSE 2FSIA 3QIAA 2C9CA 1YZKA 2PCJA 5JJIA 1AKYA 2EVWX 2WMOB 1YR8A 4H1VA 2AD1A 3NHAA 2REOA 4HSEA 5HKKA 4OI0A 2H5EA 1QRAA 1W2HA 2YC4C 1VECA 3HPRA 4D0NA 4B6EA 2GXQA 1U8ZA 1VKJA 1R5BA 4C30A 4DUGA 3TH5A 4AC9A 2GEDA 3PEWA 1OW3B 2A30A 1G9XA 5JRZA 5JI3E 3UPUA 2WICA 521PA 1W0JD 4Q4JB 3SYNA 1TQDA 3KJEA 4ZI3A 1T0HB 3X2SA 5JI2E 1N6OA 5IHPA 3KTAA 4NONA 4XSHA 5JHGB 1UKZA 3CONA 1GITA 2J0UA 1DARA 2Q6TA 3O8CA 3IHLA 2QT1A 2WOOA 2BMDA 4UNRA 4ZIRB 3CKLA 3LBIA 1P2TA 1ZMXA 2CLDX 2E1RA 4G5OA 1X3SA 3EIQA 1KJZA 2W2TA 1H65A 1RIFA 1Z63A 1W2GA 2LWIA 2G1KA 3GJ5A 4LBVA 1OKKA 1DEKA 4PC3A 3ICEA 3AH8A 3EX7C 1WDTA 2OV2A 5DYIA 1ZW6A 3QG5A 3VQTA 3B1WA 3AB3A 1T4GA 3KKOA 5BN3A 5F9HA 1VYUA 4D26A 1NVXQ 2PEZA 3VR6A 2CCGA 3NWJA 4G01B 1VCOA 2HYDA 3VR5A 3PCRB 3AF0A 1TMKA 2WJIA 4TMXA 3T1QA 1IN7A 1TL7C 3U4QB 3RNLA 1M7HA 1P9RA 2Y8EA 4JL5A 3Q8XB 2GESA 4A15A 1NIJA 4KFRA 1F5NA 1Y3AA 2GJ9A 2GVDC 4XOIA 3SJZA 1OH7A 1OXVA 4AWXA 1G3IA 4R2IA 4WOPA 3NBYC 4B48A 1RZ3A 5E3HA 1NKSA 2P0EA 4UNSA 4MQBA 2OFWA 4CEIA 4BQSA 4KAXA 4TMWA 1ZD1A 4JSYA 4UXIA 1TF2A 2F43A 2GRJA 5JWHA 4JLMA 3AVYA 3QEOA 4HDOB 1T91A 4Z1MD 5EE9A 3CRQA 1SVSA 3I72A 3IBGA 3TBKA 2IA5A 1G18A 2XNDD 3WNBA 2CEAA 4V0KA 5K8TA 2WWIA 2JJ2A 2XZLA 2VTKA 1XU4A 5A4JA 3A4LA 3AP3A 1G8HA 1D8TA 3RC3A 2IWHA 3I1FA 3I8SA 1AGPA 1WP9A 4IVPA 5JS7A 4QGGA 2AFHE 2ZU0C 2F3TA 3PG5A 3U3OA 2NZJA 2Q9AA 3LX8A 2QPOA 4M9SA 4D4MA 3GLGE 4WAUA 2QAGA 3THXB 1CU1A 4CEJA 2ZJBA 1E1RA 4BFXA 2G3YA 1ANKA 3RC8A 3I4LA 1OSNA 1W4AA 5EQTA 3X1ZA 5BXQC 1ZM7A 4N1AA 1NVVQ 4Y0AA 4ZI2A 2KSQA 4LJ7A 2O0HA 4LHYA 3E5HA 3NXSA 2DYKA 2VPPA 4JLNA 2JLVA 1PV4A 4JT4A 1YZGA 1KO8A 3R8CA 5BYJA 1JJ7A 5IRCD 1W0KD 5HR5A 2V1XA 5F9FA 4TMVA 1VTKA 4F91B 2OCPA 5UKDA 3BAFA 2JLZA 3IBYA 1D2MA 3DMDA 4RD0A 3LAWA 1CJKC 1R0WA 2WIAA 4EPWA 2P2LA 1ELOA 1NKTA 2IYZA 4M9ZA 4F93B 1FNNA 2ZXUA 4TLBA 1TADA 4IFBA 1XEXB 1N25A 3C14C 3CB4A 1X1RA 1DG3A 3B1VA 4KODA 3CR8A 3HR8A 2W58A 4DCSA 4TN1A 1WMSA 1MRSA 1N0UA 4U02A 1OF1A 4EJSB 4F38A 5JHHB 4JBWA 4Q48A 1NN1A 2AXPA 1RRFA 2C9OA 3IPXA 1D6JA 1HY3A 1KGDA 5DNYB 2ECKA 3FB4A 4QJ3A 3MWJA 4Q9LA 2AWOA 4XVRA 3HU1A 5FTLA 4M22A 2FZ4A 3TAUA 2Z6VA 1S9HA 1V43A 2JDID 1XTQA 1R2QA 5EE5B 4YMWA 1SKYB 3NKVA 3BE4A 1JBKA 1R5OA 1KK3A 1TQ4A 1T9HA 2XSZA 2PJRA 1LF0A 1P72A 1SXJD 5FFMA 1DAIA 1XZQA 2EFGA 5JCPA 2QSYA 4MKGA 1II9A 4KLZA 4Q4HB 1SVWA 1DG1G 1MRNA 1S3SA 1WBDA 3KX2A 1EFTA 4TQAA 4RKFA 5GADl 3UMFA 3S1AA 4ZDWA 4R98A 2KB0A 2YOFA 4DIDA 1I4TD 2FE4A 4M1TA 1G3RA 1DELA 2FFQA 3HWSA 2ODBA 5DI3A 5FPSA 1E0JA 2WHXA 4B35A 2HXSA 1Q1EA 3WBKA 4V0LA 4LBYA 2X8AA 4TLDA 4MUAA 1W1WA 4PZZA 3ZIAA 3EXAA 1YZTA 3T61A 5DIFA 4Q1CA 1B0UA 3DM5A 3OEEA 1KK2A 4M0LA 1N5KA 2ZUCA 1N6NA 3IO5A 1ZM9A 2IXEA 3ADCA 1E2NA 4JVMA 2PT7A 1ZYUA 2A9KA 2O5VA 2RGAA 2VHJA 2D7CA 2GEVA 3C7KA 1HT1E 1OHHD 1FP7A 1XBTA 2HDNB 2X1VA 1LFDB 1R0YA 4FCVA 2GHIA 2GVZC 4D4JA 1JALA 1I4DD 1KTVA 1WF3A 2G0NA 3IDQA 5CLQA 3EPHA 5JSZB 3R8FA 4KI0A 3VFDA 2HEIA 4PC1A 1SVMA 1C9KA 3HR7A 3BK7A 3EZ7A 1A7JA 1RVDA 2QM8A 1Z0IA 3AGPA 3QOFA 5BQ5A 2NOAA 1TX4B 1SVLA 3ASYA 4TTQA 3T06B 4BECA 1H8EA 1RJ9B 4I1SA 4W5WA 1PZNA 3ZYCA 1J90A 3AKEA 3ZH9B 3C16C 3RS4A 4A6PA 3LD9A 5D3QA 4AURA 4DEYA 3W5IA 2ZS8A 4LJ8A 3B13B 3VNVA 3KJGA 5B2ZA 4PSAA 3BWDD 3B9PA 1Z0JA 3B6EA 3MJRA 5B30A 4V02A 5KNDA 4C7OA 2FSFA 2IF0A 3U2QA 3ZDQA 1XMJA 2UZ3A 4HAWA 8OHMA 2QMOA 2C8VA 2G88A 2YWFA 1T3LA 2IT1A 2ZANA 5FI1B 2ODWA 2AN9A 2AXNA 2ZYTX 4L15A 5LDDC 3OESA 3I32A 2BBTA 1U99A 5FTJA 1U9IA 3DOFA 3SJBA 3UWOA 3EPLA 1G8PA 1NBMA 3K09C 4P32A 4RD4A 3AVWA 2ZRBA 4C0QC 3PJRA 2PL3A 4B34A 3X1YA 5KDLA 1P62B 4TQUS 3N2EA 4RD3A 3ZQ6A 4M1KA 3JVVA 2W6JD 2QPAA 1MT0A 1HURA 1M7BA 4P31A 2C5LA 4C2UA 2N42A 2ORVA 1MO3A 3A1UA 5JZVA 1YVDA 1F2TA 5FR1A 4L4UA 4FN5A 3ASZA 2QQ0A 3CRW1 3ZVLA 1XTKA 2MMCA 2BM1A 2J41A 4OBEA 2ZIAA 2XB4A 3CPEA 4LC1A 3DKVA 1UBCA 1XJQA 3RLFA 2WAXA 3JVUA 2ZE8A 4AK9A 1IBRA 1CR4A 2FPMA 3W6NA 3L0SA 1G16A 4JLOA 1M6NA 3K9LA 3QKRA 4M4SA 4P0TA 5FOVA 3CNOA 4F7WA 3B8HA 3D8BA 1CTQA 4A2QA 4A8JC 5E7MA 2GWHA 4LYFA 1GG2A 3FOZA 1IXSB 4U5XA 2YNMA 3NG1A 1E9BA 1EX7A 3FTQA 2BMJA 1S96A 4JSTA 5LBIA 2V6IA 4HAXA 4MH0R 4URYR 3UKDA 4BRUA 1QBKC 4PQFA 1OB2A 2XZPA 1XPOA 4AYXA 4Q9KA 4PZLA 3NC1C 4IXMA 4UNQA 1DE0A 2V9PA 3NIBA 1DO2A 221PA 2XOKA 4LHWA 3TW4A 3TUZC 2FV8A 4PPNA 1BMFD 1XF9A 2HUPA 4R2HA 4YMVA 3CUEF 1QG2A 4PX9A 2F3RA 3A8TA 3TQFA 2EW1A 4DDUA 1BOFA 4MRNA 4C0SA 4O2RA 4HZIA 4B3GA 3U3MA 4M9QA 1AQUA 2GCNA 1JPJA 1YKSA 2EWWA 3PEVA 4KYUA 3ZS8A 4ZDIA 4IDOA 3OIVA 2J5XA 2JGNA 3LW8A 1O3YA 4YXWA 3V9PA 4DCTA 2QT0A 3R7WB 5CM9C 5DN6D 1J99A 3GJ4A 4DSUA 3LLMA 2FFAA 2Q9CA 2F55A 3BH0A 1A4RA 2A3RA 1Z06A 4HLDA 3ZZTA 2ZRNA 3RYTC 4U7DA 3CX7A 2WMNB 3AUXA 3B9QA 3IQWA 4FWIB 5CK4A 1ESNA 1G7TA 4Q01A 3TAHA 1PVOA 1VPLA 3GQBA 2RHMA 1QZXA 3UXMA 1W5SA 1N3BA 1JR3E 5EP3A 2EWVA 5EXXA 4ASUA 2WJGA 3GJXC 2IXFA 4BPBA 2IYYA 3CNNA 3OZXA 5EZ6B 3A6PC 1D2EA 2JAQA 1HV8A 1FX0A 1N2CE 2QRNA 2D4HA 4G3XA 5FUVA 4JBXA 3RVBA 2CCKA 1FOEB 1Q20A 4NCJA 3W34A 2WJJA 2H92A 1RYHA 3E2IA 2ATVA 3GMTA 4PHTA 2CXXA 5KDOA 2HV8A 5BN5A 1Q1ZA 5J4HA 3W90A 1HH4A 1IAQA 4URVR 3A1TA 4NZYA 4DSTA 3NH9A 4B3CA 1KI6A 3PUXA 2D74A 1Z29A 5JBQA 1N6KA 4BZQA 3B78A 4GPTA 3VHLB 2ZRPA 3KTAB 2CDNA 1NY5A 1RKBA 2OBMA 3QNUA 4Q7KA 2J0UB 1OB5A 3OIWA 3HU2A 4L9SA 3KFXA 3EIHA 5SZHB 1XCMA 3PUVA 4A9AA 4RZUA 1US8A 1JECA 3M4YA 3SHWA 1UFQA 1GL6A 1SXJC 2CVFA 3DVLA 3O8DA 1E2HA 1Q1QA 4RZXA 3E1SA 3VR3A 4LV8B 2CE7A 2OESA 3PITA 1UBFA 5C18A 4A4DA 1KAOA 1Z6GA 1E2QA 2IBMA 1G17A 1P73A 2MSEB 3SU8A 1OFHA 3ETLA 1LY1A 1R7RA 2A5YB 1YRBA 3NEYA 2QI9C 3QVUA 3KKQA 4BLTA 3ZVMA 3DDCA 2ZSAA 4L5BA 2JIZA 4POAA 1BYIA 3L2OB 3FHTA 1VCNA 1GKUB 2ZJYA 3QXCA 4IVRA 3EG5A 2R65A 2DHRA 4G0NA 2OCBA 1E4YA 2HJVA 4MYTA 1TF5A 3BJIC 4Q02A 1U8AA 1QHHA 4NDZA 1KY3A 1Z08A 5JMTA 1W5TA 4A0RA 4BGDA 4XD7A 2FPKA 1RRGA 1E2KA 3QXXA 2DBYA 2ZI4A 4HAZA 4ZO4A 2OSBA 1G3QA 2ZJ8A 1XTSA 4DLYA 1AJEA 4TYPA 4CEIB 3LVQE 1U98A 3G0HA 5KDDA 3EZ9A 1KMHA 3TR5A 2F43B 4TLAA 3TVDA 1OH6A 5IT5A 2H17A 2VP6A 1KSHA 4KJZA 3PUZA 1HA3A 5EXTA 3AVUA 2ZAMA 3G5UA 5KU1A 2RCNA 1P9NA 1SVIA 4IEEA 4OI1A 2WSSD 3SI7A 1E94E 1KO7A 4B33A 2CL0X 4YMUA 3AVPA 2XXAA 4YDSA 1XEFA 4NHOA 2IYXA 4RY2A 5E7JA 1Y63A 2ZVQX 3REFA 3V4RA 2ZSBA 1XWIA 3OIUA 2HXYA 1QDEA 1MKYA 2W00A 2FDCA 5DSZA 5CJPA 1CP2A 3LLUA 1T6NA 4B75A 2RAPA 2WBLC 4X8HA 1U90A 2QA5A 4KFSA 1BH2A 5EXSA 2WPDD 4TZ6A 3BRWD 2F1IA 4KV9A 4MRPA 1I4LD 4I99A 1XEWY 5KNCA 3CLVA 4IXNA 1KI2A 1IN5A 2Z5FA 5KSYA 3IIMA 3P27A 1XTRA 1DS6A 2CVHA 4PTLA 3LBHA 4HEJA 4WVFA 1XB2A 4Q18A 1XCGB 1WE2A 4DXAA 4TYQA 2Q3HA 2WIBA 4NYMR 5HTKA 3D6TB 3QXSA 4HAYA 3BERA 4IW3B 1GKYA 5L8VA 1W48A 2OXRA 3PVSA 1QG4A 5AWFC 1NN0A 3FKSD 3IHWA 2ODNA 4FWTA 1CXZA 3PQCA 4QGHA 5AJZA 3DEFA 2GAAA 4EFNA 3ZVNA 4L8GA 1FP6A 1XNJA 2V54A 3K0FA 4GNKA 3THYA 1NP6A 4HAUA 3K70D 2YKGA 2VSOA 1U2RA 3P20A 3KXKA 3MAAC 4DB4A 1JJVA 1IQPA 3AVOA 3VU9A 2OBLA 1S1MA 5DISB 2R2AA 4YLGA 2FFHA 1KZ7B 4F4IA 1KO5A 3MWYW 4PSKA 3MMPA 1AK2A 4BE7B 4AKGA 4G5QA 5E95A 1LS1A 2ZRHA 4GMXA 3FDIA 3FHOA 4D2IA 2WWYA 2HLDD 1E2MA 2WV9A 2V1UA 4CZ2A 3LVRE 5H8WA 3SHFA 1ZNZA 4NP6A 1CLUA 3DPUA 4IDHA 5ANRB 3T1TA 2CJWB 2HF8A 2D06A 2H18A 3T34A 1J70A 4E07A 1P9WA 1E2LA 1ETUA 3LNCA 1TUIA 4Q9JA 4MA4A 4V0MA 2BEKA 4PO1A 2RGXA 3EZ6A 2E87A 3I3SR 1Z3IX 4W7SA 2QGNA 4PPGA 3N2IA 4BLQA 4NU0A 2QQEA 2IYQA 3Q72A 2B92A 1GL7A 2G6BA 4GL2A 2QP9X 2OE2A 4LYAA 3IKJA 2IXGA 3BBPA 5AK0A 2FJUA 3KQKA 1K5GA 1FTNA 2F9MA 1M7GA 2GCPA 3U3RA 3FFBA 2QGZA 3SJAA 4UKDA 4ZKDA 3QUSA 1GUAA 4PANA 1DADA 2XITA 1ZAKA 4RCYA 1OXUA 2ZI9A 1Z6YA 2BBWA 5CDFE 2W6ID 3TRFA 3B5JA 1F2UA 3IILA 1N6PA 2CK3A 1AA9A 1EFRD 2MSDB 3RS3A 4PFSA 2QE7D 4TWZA 3TNFA 3U5ZB 3OEHA 4NE2A 4UXHA 1CKEA 4OK3A 1TU4A 3SOPA 3S1AB 3LY5A 5C4MA 2VP5A 2ZRIA 3FE2A 3GEHA 3P4XA 2XX3A 3PUYA 4ARZA 3AUYA 5DI3B 1DAGA 4GI7A 1FL9A 3VR1A 4DLTA 3U6BA 5L3SA 2O8DA 3K53A 4IOJA 2JEOA 3SFVA 3REGA 1U81A 2REBA 5FUWA 4JLBA 2ZRCA 4MYHA 4TMZA 4C0BA 1E9FA 2OZEA 1K6MA 2R6FA 4DBLC 4DJTA 4CEHA 1EWRA 1COWA 1TEVA 1N5JA 2HF9A 2NO7A 2QEQA 5FL7D 1CRPA 4MRVA 1CF4A 1KK0A 3PFIA 1DAHA 2I1VB 3TK1A 1KDPA 2DFLA 4A36A 4TL9A 3M6AA 2ZETA 4GOKA 3ZGXA 4R9UC 4CGZA 3BB3A 1YZLA 1E0AA 5IDVA 5L3RA 4TLCA 2F1HA 5M04A 2GBLC 3AP2A 2QMUA 2NG1A 1AQYA 4KU4A 4LZZA 1GM5A 2KWIA 2CLCX 5J4VA 2W2VA 4Q1FA 5G41A 3I92A 2VHQA 1E2FA 2ZROA 4RSGA 3TJZA 2ZUBA 3EW9A 3H2YA 3Q9LA 3TQCA 1Z0FA 2G77B 4GP6A 4L9WA 4EPTA 4EPVA 1V5WA 4AKEA 3EPKA 4QJ4A 3LWNA 1YU9A 3H86A 2Q3FA 1DPFA 3AQ4A 2GDJA 4HYYA 2GCOA 4C7OB 1ZC4A 1VG8A 1OIVA 2FEMA 5G3YA 2FN4A 1JAIA 2Q3MA 4DCVA 2ZI6A 1IN4A 3K8YA 4JIMA 4KITB 1HEIA 3ZZUA 1E1QD 4QHYA 3AV0B 4MKIA 1GSIA 1J7KA 3ND8A 4NYMQ 1KMQA 1JQJC 1CRQA 5LD2B 3W9YA 2ZRKA 1A82A 4HI0E 1SGWA 1KDOA 4FCTA 4KVGA 4LJ4A 1JR3D 2GF0A 2RGDA 3DZ8A 4KFTA 1Z47A 5B58C 4R7ZA 4RZ3A 3NTUA 3BB1A 2J0VA 5FBWB 4DKXA 1HT2E 3CRVA 2AKAB 2J7PD 3SJCA 1Z83A 1F2TB 2CNWD 2FU5C 4QGFA 1KNXA 1XFAA 2R62A 1IY0A 4XJXA 2GTPA 4MRSA 2FFBA 2XNSA 4HDCA 2O8CA 1OJLA 4MYUA 1ZU5A 2PH1A 1IOZA 5F2EA 4CYMA 3X1XA 1OYYA 4JL6A 4DLWA 2EQBA 2XEXA 2ZI3A 5F3WB 1VCMA 1N0VC 3TGPA 2YYZA 4EFMA 1GNQA 3PENA 1S0UA 3QKRB 1UAAA 1TTTA 5BWMA 1EESA 2NO1A 1E79D 2ZS7A 4RKEA 1TNDA 4M1YA 3WHKA 4JLVA 4M1WA 1YE8A 3CBQA 3UWKA 1XD9A 4TSFD 2GETA 4QNRA 4XH9B 2QL6A 3T5GA 4DHEA 3PIRA 2UVQA 4JL8A 4LCBA 4MKFA 5GJCA 2O0JA 3SZRA 5EZ5A 2V7QD 4Q1EA 1Z6AA 1XMVA 3TUJC 5TVKA 4IDNA 2D62A 2IUUA 4ERNA 4AIIA 2RGNC 4P4UA 4ZDKA 3FVQA 3LO5A 1AS0A 5J5CA 3NBXX 2OEPA 5FPTA 1KO1A 3WNDA 121PA 2C9YA 5GJBA 1AS3A 3F0TA 5FBVB 2ZEJA 3U7HB 1RE0A 2AX4A 1AGRA 2F1JA 2IS1A 4IVQA 1GWNA 4OQLA 4TT3A 5EP1A 3VKWA 2P3SA 2YVUA 4NL4H 1XZPA 1CR1A 1TQ2A 4QKQA 1K5DA 4JKIA 3UMSA 2GAOA 3MWKA 3RS5A 4NCHA 4URXR 2ZJAA 3DMNA 2WVJA 3BXZA 2A78A 5G53C 3W3ZB 2R6GA 1AZTA 2ONJA 4OK5A 4IEIA 1SULA 4S35A 4KSBA 2QP3A 4A6XA 3K70C 4BASA 2JLRA 4TMTA 3KJHA 2IWRA 2RGEA 2X77A 4HLQB 4HUTA 3SS8A 1NMYA 5FPYA 2ZYUX 6Q21A 1EFHA 3OFNA 4P33A 2JLYA 2WJYA 2IF2A 5IK2A 2CMKA 4OQNA 2IYWA 4N0EA 5CYPA 5FOXA 1FX0B 4LWZA 3GP8A 1DOAA 3T12A 4AKIA 2ORWA 2BCGY 5K8UA 2W2XA 2FA9A 1FUUA 2VBCA 4RFSA 3DOEA 5AR1A 4JLJA 3T1OA 2LKCA 1T8TA 2G0TA 3FMFA 4A0FA 5JRJA 1P75A 4Q21A 3WMEA 4NCKA 4BFVA 1CJMA 2ZRAA 3VKGA 2X2FA 5EE0A 1JI0A 1L2TA 1CJUC 2QORA 4GSYA 1WA5A 4K46A 4Q7LA 1U0JA 3U6KA 4EQ6A 3ZLJA 2ZI7A 3F3YA 4IHQA 2ZM5A 4IKEA 5KPJA 1E3MA 5C46F 5TXGA 1UF9A 5KPDA 1FQJA 2J1LA 3BIFA 3MG9A 4AYTA 1YZQA 5KSOA 3KB2A 4RD1A 1KO4A 3QVVA 4EIWA 2GF9A 2KJQA 4ABYA 1G6OA 1N6LA 2J3EA 3AF3A 4TQ9A 1G64A 1LW7A 4TTRA 1VYTA 4Q4AA 1E9RA 1AN0A 1ZRHA 3N5CA 4L16A 3WMGA 3OE7D 3R20A 4IDQA 1G1MA 1VHTA 1VG9B 3CM0A 1XD2B 4YONB 2O52A 3MJHA 2VRWA 2ZU6A 1G6HA 4OQXA 4GBMA 3BFXA 3TVTA 1N0WA 1W0JA 5TMPA 1XD8A 2I3BA 2FMXA 1Q0UA 1EFUA 2QNRA 5AUNB 5KOYA 4PSVA 2GK6A 1ZNWA 1YQTA 1G7RA 4ZKEA 1UEIA 4OYHA 5LB4A 4B71A 1GRQA 4XWAA 3U60B 2ZTSA 3NHBA 1KI7A 4LPKA 4NTZA 5GJVC 5GJWC 3T1VA 2ZSEA 3TSZA 1JB1A 1HQYE 1M8PA 4IDPA 4ESHA 4K81B 3RS0A 1E2DA 1S2MA 1FTSA 1XEWX 2ZJ2A 4I4LA 5CK5A 2QP4A 3B1ZA 1OYWA 2A2ZA 3RAPR 4LK2A 4DDWA 3VX4A 2IS4A 2JJ1D 2ZAOA 4YDHB 1UBEA 3U44B 5FL3A 1QHHB 3OAAD 5A0FA 1DAKA 1E2JA 2ZRFA 3HP1A 5LB2A 1CR2A 5JJKA 1QHGA 2DPXA 3KZ1E 3LDAA 2ZRJA 1IN8A 3GLHA 4HUQA 1SZPA 2V55B 3GLFA 1YR7A 1OXSC 4FMCF 4I1UA 2DR3A 1NLZA 1R6BX 1KMHB 3K09A 4PZYA 1Q57A 3DHWC 2DFKB 4A0GA 4LI0A 1XCPA 1NN5A 4FCWA 1OFIA 5FTNA 1LS6A 3DO6A 1TUEA 4LY6A 3NDPA 3GLIA 1OPXA 4OI4A 4QJ5A 5EE3A 1KI1A 4BFYA 2XXAB 2FEOA 2VHTA 2YWGA 3GFPA 3I5YA 4B74A 3RABA 1H8HD 2IUTA 4RJLA 5LD2C 3KJIA 5CB8A 2QTVB 1F3OA 5E7IA 4GOXA 3JZAA 4LJ5A 1IONA 2BC9A 1M1YE 1P2SA 3MGCA 3NEJA 3QJYA 2I4IA 4G5SA 4JLKA 4LPSA 4M2LA 5FL7A 3PEYA 4QBHA 1P5ZB 2WZQA 5EUMA 3CIOA 2FG5A 3QG1A 4TL7A 4DRZA 2IHBA 3JZMA 4GZMA 1SKQA 1UKEA 1ZUHA 1ODFA 2VL7A 3D31A 1N6RA 1ZNXA 3EA5A 3GCGA 1E96A 2GK7A 5CJ2A 5FH9A 2C77A 5LPNA 1BO6A 2VEDA 3KKPA 2C96A 2GEUA 2PLRA 4D6PA 3UANA 4Z8XA 4Z1MA 4BWYA 4A8JA 2IS2A 3RRMA 3THWA 1Q3TA 4A2WA 1R0ZA 2D3WA 1M34E 2XNDA 1Q3HA 1JXMA 2EFCB 3BFKA 4QG7A 3VR2A 3A4MA 1E32A 4FI3C 4NCIA 5F98A 4EDHA 4LHZA 4HLUC 3THOA 3SR0A 1UBGA 3T35A 5HZKA 2UKDA 2JLSA 1PLKA 3O8RA 2EFDB 1G7SA 4LHVA 2IYRA 2YOGA 1WRBA 4CIDA 3QE0A 4FMDF 1S9DA 4XIGS 3I8XA 3Q7QA 2DB3A 3K0FB 2Z83A 5P21A 4UJ5A 3EZFA 3H1TA 4QNMA 3CNLA 1R8QA 5FBLB 4G1UC 3GLHE 1NBME 4C0AC 2WM9B 1CULC 4BEJA 1QF9A 5JLJA 4U00A 1ONBA 1W36B 1SQ5A 2BMEA 5DI9A 2VH5R 5FR2A 2J87A 1G20E 2BVNA 4RD6A 2Z43A 1NNEA 1G5TA 4WZAE 5CM8B 2Q9BA 2W0SA 4B6FA 1CS4C 1Z5ZA 2BEJA 2G83A 3SYKA 4QOSA 5HKKD 1S8FA 4V03A 1OH5A 2YZ2A 2ZRLA 1ZM4A 5KNBA 3AVTA 1YZNA 3KUDA 2REXB 1BS1A 4DUGD 1P2UA 3NBFA 1W0KA 3QXJA 5DHFA 4OHWA 4EJSC 4DSOA 2ZRGA 2P67A 3A1SA 3HU3A 1DAFA 3HDTA 4QM7A 1M2OB 1XDBA 4BFWA 5E4FA 3PV0A 4DIEA 4M21A 2BIFA 2O8EA 1PUJA 1W7AA 1C4OA 4IRUB 1IM2A 3QKTA 5KUTA 1P60A 1GFIA 5J40A 4CF7A 2VYFA 2WKRA 3CWQA 4MYCA 2FGKA 4W5HA 4WW0A 2JASA 1FFHA 5JEEA 5KSZA 3TMKA 4WZBE 3K0CC 1G4AE 3WHLA 4KLNA 2DCUA 3AKDA 4NH0A 1II8A 2ZITA 2HYIC 2NIPA 4EAQA 1U0HC 1F2UB 1KI9A 4V0NA 1T3HA 3HYTA 4DCUA 3R9XA 1OKKD 3LBNA 2XGJA 4Q4HA 3VAAA 1G8FA 2JATA 5B57C 1P3JA 4KO8A 3SE0A 1YZUA 5FI0B 2GNOA 4LJYA 4PPFA 1CIPA 4ARZB 4B47A 2JDIA 3Q3JB 2RHDA 1NMZA 1UDXA 3UG7A 3L82B 1TPZA 2B7CA 1XXHA 2W0MA 3K1JA 5EXPA 1U0LA 3TKLA 3FFAA 1IY1A 2ZJZA 2O8DB 3I73A 3MUFA 2V8OA 1Z0AA 1SXJA 5J4YA 4LYJA 4Y0VA 2FNAA 5H68A 1L4UA 2NO0A 5BYKA 4DDTA 2PEYA 5TV2A 2OILA 2C04A 2BM0A 3VTKA 4E03A 4CEHB 5C2JB 5TY0A 4LBZA 3B82A 5KYKA 3A4NA 1F60A 2IYVA 3FPAA 2IYSA 2C78A 1T5LA 2NPFA 1R5NA 4QGAA 2ZVPX 1IY2A 2OAQ1 3QBVA 3K9NA 2YHSA 2NTYC 3C41J 1Z6TA 2X2EA 5JSZA 1E9DA 1A1VA 3SYLA 2O8FA 5HZHA 3FMPB 4M1MA 1WBBA 3AF1A 4JLAA 1OIWA 1XP8A 1N5IA 1N6IA 4C3ZA 3BGWA 1VMAA 2ZJOA 4Q5IA 1OHHA 1NG1A 3CH5A 4DT1A 5DGXA 4LHXA 4XWKA 4BLSA 2JJ2D 1ZIOA 2IEYA 421PA 1RRCA 1OXXK 4Q9IA 3I62A 2Z0MA 4JBYA 4PAOA 4JJZA 4M8NE 3GPLA 5AJVB 2WAYA 1F6BA 1KKLA 5FOUA 3FHCB 2GCOB 4JLPA 5KO2A 5KSPA 1ZBDA 2QM7A 5CYOA 2NPIA 1T0JB 5DHAA 3GJ7A 2EFHB 2D2FA 1EWQA 1E2EA 5FOSA 2PLFA 2O0KA 1BKDR 4IJMA 4A92A 2YWEA 2FH5B 3F5FA 1E1RD 2J7KA 2VIIA 4LOAA 4DEXA 4OI2A 2RMKA 3P4YA 1SHZA 3RDPA 2IEZA 2IYTA 2OO7A 2FSGA 1KY2A 1RC8A 1CJTC 2QZ4A 2IX3A 1OV4A 3RSOA 1PUIA 4IOMA 3BH6A 5HE9A 2CL7X 4Q66C 3QF7A 2JLXA 2WJHA 2A5GA 2C98A 2QAGB 4CEJB 3RRZA 1YRAA 2O8CB 4PQRA 1OT3A 2HCBA 4D82A 1X8LA 1NSTA 3O8BA 3GEEA 2VP4A 4DLSA 4BLRA 1E0KA 3D3QA 4WIAA 3OIYA 1G3UA 3FYHA 4AY2A 1VYVA 3I61A 1RRPA 3CPJB 2SHKA 1Z0KA 1KNQA 2AD5A 2XJ4A 1G8GA 2ZRDA 4BLPA 3EWAA 1FMLA 1OE0A 4P4SA 1KOFA 2A5JA 3Q7PA 2W6JA 4OJKA 3RANA 2B8TA 3I5XA 5H1YA 3SQXA 1J2JA 1M74A 2OHFA 2VP9A 4YMSA 5SZKB 3J81k 1G5RA 1GILA 1GIAA 1KJYA 3CX6A 2O8BA 3KXLA 1W46A 2ZYWX 4DC9A 1FZQA 3UATA 3LXRA 2FZLA 2OG2A 4Q7JB 1E99A 1P2VA 4Z54A 3CF2A 2D7DA 1NRJB 3L0IB 3AVVA 1YR6A 2PZFA 1KSJA 2OLKA 5G40A 1W4RA 4B2PA 2PZEA 3P32A 4RZ2A 5K8IA 4C0LA 2NQ2C 4MGIR 3BH7A 4OHZA 4X8OA 4EFLA 3K0AA 2XSZD 3IO3A 3A37A 2BWJA 4FMCB 2EU8A 1FW6A 4BFTA 4CT4B 1G8YA 4NYJR 2R44A 4F4JA 5FUXA 5IK2D 1S3GA 5DE3A 4B3DA 3PR1A 3R7WA 1E9CA 3CR7A 1TAGA 2WKPA 4GRAA 4URZR 2VP2A 2ZYVX 3QEJA 4RCZA 4CW7A 5BW8A 2ZREA 1SHKA 2G9NA 5DH9A 1BMFA 1S4QA 2P6NA 1NVVR 1JPNA 3MCAA 1R4AA 3V4FA 1E9EA 5AJYA 1D5CA 2GJKA 3R9IA 4OHXA 1KI4A 3U3KA 2VP0A 1MV5A 3QPUA 3B60A 3GFOA 4QC2A 2QMHA 4JKYA 3IEVA 3W8RA 1S1CA 3ZIAD 4LV5B 2HT1A 3EIEA 2X19A 3OEED 1EK0A 1ZC3A 2QTFA 4B2IA 3IUYA 5DN6A 4DLZA 4IOLA 4RFSB 4D0LB 3U7FB 2XB2A 4W5JA 3TE6A 1MABA 2V3CC 2WOJA 2JLUA 3K9GA 1U8YA 1I2DA 1KHTA 2R9VA 3WY9A 3EARA 621PA 5ELXA 2QBYA 1GOTA 4PHGA 4ESVA 2GXAA 4OKSA 2BMFA 3P1JA 1G7CA 4N3NA 4DVGA 1EXMA 4EQ6B 2KBEA 2R8RA 3BORA 4A82A 2ASEA 1YR9A 1E4VA 4FMDB 1B23P 5HPYB 2FX3A 2H1LA 1H8ED 3E70C 5D3MA 4B3XA 4D0GA 2F1RA 2R6DA 4UQOA 4JLDA 4Q4LA 3U44A 3TUIC 1OIXA 4Q4AB 3KQHA 4PC7A 4UNNA 2J59A 4V0ME 4JVSB 4Q03A 3F8TA 3T5DA 1TU3A 2XTNA 4DLXA 1L8QA 1RYFA 2ZJ5A 4HZUA 2CHGA 1HYQA 1DVRA 3ADDA 1GTVA 1ZIPA 1NIPA 3QF4A 2OFOA 3B2EA 1SVOA 4LGMA 4BFZA 4RFVA 3GJ8A 3TLXA 1NJGA 2VQSA 3BB4A 5AUQA 5IF9A 1XRJA 2GBLA 1NY6A 1QVAA 1MO5A 1E2IA 4C9BA 3GLGA 1HTWA 4MGYR 3WXMA 3Q5DA 4P3YA 1NBMD 2MSCB 4YMTA 4TYYA 3RWOA 1GNRA 4OJQA 2P5SA 4MGKR 2VSFA 1FQKA 2HT6A 4US0R 3GJ0A 3WYGA 3V00A 5J47A 1N5LA 2AFIE 1JR6A 4J0QA 1GZSA 2JLWA 4KHZA 5SZJA 2DY1A 4OHVA 5AJXA 3L8ZA 4B43A 4H1UA 3B7GA 4QHSA 1QHYA 3BS4A 4DCNA 1X1SA 4JMPA 4II7A 3GLHB 3SBEA 5L3QA 4N0DA 4HUQB 3GLFB 1OLOA 3LW7A 4O25A 1JEEA 4QXAA 1RFLA 1EG7A 3IIJA 1BYUA 2ZS9A 2GXSA 2J46A 2GJ8A 1XMIA 2WJVA 3KQNA 4JYBA 3BD9A 3L8YA 3SQWA 3EC2A 3D7MA 3HPQA 1G19A 2YWHA 4MUBA 3ZVRA 4YQFA 3GLIB 1WQ1R 3VR4A 5KHOC 2CBZA 2P6RA 5FPKA 3CF0A 2CHVA 2DFTA 2J0SA 3RRNA 3DKPA 3QQ5A 3FWYA 4Q19A 4AKHA 1ZCBA 3K9HA 4MITA 2ZR9A 1P7CA 4AD8A 2GILA 4AYWA 1OFUX 4B73A 3B85A 1CJVC 4QHTA 4TYWA 1Z2CA 2C99A 3VMFA 1YHNA 5EP2A 3KUCA 4XVQA 2P65A 1KAGA 2WWGA 1MO4A 2XOKD 1C1YA 1GKIA 1KJWA 2B21A 2BJWA 4JZKA 2Z4SA 3ZD6A 4ITRC 5TB5A 5L3VA 1JNYA 3U7GA 2C95A 2QAGC 1QHIA 1IXZA 1VCIA 4NCNA 3OF5A 4LJ6A 4A8JB 5J4KA 2WSSA 3THWB 1X86B 4NYJQ 4P4TA 1P4SA 2AK2A 5FPHA 4D4KA 2VLIA 4A2PA 2H7VA 3R9WA 1P61B 3ND9A 3L0PA 3M0EA 5HCIA 5JCZA 4YXWD 3EASA 2KI5A 2VHCA 4LC0A 3KB1A 1XJCA 3UMRA 2ZE7A 4GZLA 4M1SA 4TMKA 2PCLA 2R6CA 2DWQA 3PUWA 1X8JA 4E09A 4OQFA 2OUKA 1XPUA 2RGNA 2WPDA 4D81A 1E2PA 4TL8A 4DSNA 2VA8A 3CZPA 2PX3A 1EGAA 3FMIA 1XTJA 3CH4B 4KBFA 1FUKA 2JLQA 5TARA 3QKSA 3QKUA 1ZJ6A 1KK1A 1Z6XA 2PMKA 4FIDA 4PAQA 2FSHA 2VF7A 1QHSA 3LQQA 3LX5A 1Z0DA 3EZ2A 1W4CA 2RH5A 4E5UA 4ASUD 3QPVA 1E69A 3ZS9A 3AKYA 4TLEA 2N1BA 1LNZA 2A5FA 1Z2AA 1R0XA 3LXXA 2OCAA 2NO6A 2DFNA 2OXCA 1FMJA 1ZVQA 1HE8B 2QUZA 2RGGA 2ZQ5A 4UJ3A 4X8LA 1A2BA 1GP2A 1L4YA 3FKSA 2H8KA 1E9SA 2J45A 1ZCAA 1ESMA 2C2HA 4KBGA 4US1R 4R71A 3AF4A 2QSZA 4CRWB 4GT1A 1U94A 3SDZA 4WBSA 2Q0HA 2CJWA 4BZXA 4LYHA 1DAMA 2A7QA 5G3ZA 4DDVA 4A0HA 2B7BA 2B8WA 3TIFA 1KI3A 2IK8A 4LBWA 3H0KA 2O8EB 2GJSA 821PA 4D4LA 3QSYA 2ANBA 2XAUA 1MOZA 1Q21A 2PMDA 1T3SA 2HLDA 3KQUA 3MLEA 4MDFA 1G21E 1G3MA 4Q7MB 3CRMA 4B2LA 1QVRA 2PJZA 1II8B 2H57A 4B3BA 4D80A 3C5CA 3H84A 4AI6A 1JAHA 1JXOA 2ZPTX 1KI6B 4QBIA 3QPWA 4NPHA 1E2GA 3WYFA 4I81A 1D9XA 1RPZA 2Z4RA 3QENA 1GNPA 3C5HA 4QFMA 3SN6A 3RHFA 4Q4JA 2ZE5A 1G4UR 4BRWA 3WYAA 4PXAA 2ORIA 5AUPB 1ZU4A 2QTHA 1TQ6A 4PC2A 5HE8A 4JVLA 2JIZD 1CEEA 1US8B 4GDFA 2F6RA 1W4BA 1XXHB 4O3MA 4ACAA 2BV3A 3X1WA 3NVAA 4TL6A 1XX6A 1SXJB 4ZIRA 5A5GA 5C4GB 1GRRA 4GP7A 5H70A 3WP0A 4KVAA 1ZD9A 2W6IA 2E9SA 4M1OA 5EJEA 2BHRA 5GVSA 2XZOA 3K0SA 4CVNA 2DWOA 4YC7A 3HJNA 3VKHA 4XD7D 1EFRA 1X6VA 3NBZC 2HJGA 1GVNB 1MH1A 1QHXA 2FGJA 2QE7A 2QROA 5CLLA 1VG0B 1A2KC 4Z8YA 1OH8A 1SVKA 2JCSA 3RS2A 1G5PA 1HQCA 1UJ2A 4NKRA 3U7EB 3RWMB 1LV7A 2BKEA 1NN3A 3K0EA 1VIYA 1LF5A 2OLJA 5JS8A 1KKMA 1G41A 2YV5A 2O8FB 3OHMA 4B3FX 3NH6A 3B1XA 2EFEB 4PQYA 3VX3A 3CZQA 3TSWA 3U4QA 4WA7A 2J9RA 2IW3A 2PBRA 3IPYA 2NO9A 4KXFB 4ZCLA 4O0MA 4LRWA 3GEIA 2IUSA 3KXIA 4DT1B 4TYNA 2YC2C
chains in the Genus database with same CATH superfamily
4OYYA 1Q12A 1P6QA 1SHUX 1Y7LA 1HUQA 4AB1A 4X90A 2OZKA 3Q7EA 3OZGA 1IPEA 4X5OA 1CY2A 3EGCA 1SRQA 3ZI7A 1E0SA 2WZDA 3O4HA 5TRTA 1WCV1 1NW5A 2GNAA 4ETMA 2O7NA 2F7SA 3JQPA 3PKZA 1GLNA 3A4IA 4D4HA 2W7TA 3QMMA 1JLLA 4L3OA 1HE1C 4OG2A 4Q1AA 4DMCA 4RPLA 1UR5A 4CKZA 1Z8FA 4K40A 1OGIA 2AEEA 4LDPA 2XRMA 3P0EA 1T5DX 3KKNA 3EA0A 4XQCA 3VJKA 3WWCA 3PT5A 3TR6A 3W8NA 5ERYA 3C39A 3O47A 1PT8A 2JGMA 3Q6IA 4HNQA 2QXUA 5I7EA 3CLSC 2Y76A 2PZMA 4ZPXA 3MT7A 3DAFA 3TTYA 3ZDCA 5D7BA 5F4ZA 1XLUA 4MDHA 3JCZA 3THSA 3SIRA 2GAFA 1EMDA 3LQRA 4Q47A 1C3OA 4IFEA 3IBSA 3KOYA 4LOJA 2HOQA 3ED5A 3AU9A 1BEEA 5CT9A 3L8HA 3DE0X 5BSFA 5K9ZA 1TJ3A 5KYYB 3C3XA 1EFCA 1ICEA 5EE1A 1E1QA 3DHNA 5SYNA 5DHQA 2FSUA 1HM5A 4M9RA 2VPQA 4P08A 1XCBA 4WXEA 1VG1A 4MW9A 2AUTA 1LTKA 2NU7A 3LDGA 2IYLD 3PNSA 2NQ8A 3L1HA 4E22A 4G1VA 2XNCA 3LQ2A 2RHGB 1P8JA 2LRHA 3CPHA 5TPWB 4C2AA 4DA0A 2VQDA 2RARA 4NH4A 2PG3A 4K6OA 2VPZA 1R9GA 2MSNA 4YI5A 1Y3CE 4X60A 1U3CA 2UAGA 3D54D 4D9BA 1EA7A 1NDQA 3M70A 3NGLA 2NZWA 3I2IA 3THYB 3D8TA 5ITSA 3QUQA 3I5AA 1VIAA 5FHQA 4JJ8A 1HE3A 3NANA 4HAIA 5EUBA 3NIWA 3A6FA 2AOXA 1LLDA 3HXLA 1T6XA 2D2EA 4BZPA 3MQ4A 4CHTA 5CGZA 1RYNA 5MN6A 2H4FA 1QRTA 2RDMA 2FF7A 4Z7QB 2PT6A 4C5CA 3HJTA 2QD5A 1DCKA 4KXLA 1T5IA 1ULUA 4C0KA 3LFUA 4WMLA 3CLTD 4J3JA 2C5HA 2X1MA 3L92A 5CHYA 3TOSA 3GLIE 1E79A 4LDJA 1Y1TA 1BXKA 4WXYB 1G59A 2BBSA 3ICPA 1WCXA 1KA9H 5GOTA 5B64A 1AS2A 4AN1A 3T7IA 1UOPA 3GJSA 3IJ5A 4Z86A 4GOMD 4EYKA 4AJJA 5I7SA 3K0HA 4X7BA 1UBUS 3PFBA 4F5ZA 2RK6A 3OPYI 2JRCA 5CDHA 1GR0A 3S2IA 2NP6A 1G8AA 2YJ5A 2ID4A 3OJWA 1T5HX 3CZMA 2C0QA 4WLFA 5AKXA 3TRIA 2R6ZA 5JY1A 5KKCA 2LCFA 3OLYA 2BOVA 1WUYA 4RVCA 3E9NA 2Y1XA 1CEYA 1W44A 1TQ8A 2FPLA 1EEXB 1N2ZA 2P79A 1U0EA 3NDBB 4FFWA 2CDCA 3DFIA 3B5EA 4RKWA 1DSSG 3ONVA 1L5KA 2XE6A 5AJWA 1D7AA 5ULLA 4TVKA 4IHJB 1LX6A 2LD4A 1L4NA 1T1EA 3EB9A 3QBTA 4YFYA 5JAIA 3KQTA 1V5FA 1L3CA 1P5HA 3ID6C 3S8YA 3ZQUA 5F78A 3TIXB 1UKYA 4MZDA 4HN2A 4U4AA 3WGLA 1IJBA 1DBWA 1H2WA 1J0AA 3AEKA 3WB9A 3LPMA 1A50B 1F8XA 2Z2JA 3NAMA 3ZTTA 1JBEA 1PJAA 4BUJA 4LV6A 3U61B 1YB5A 1A5BB 3A9CA 3OPXA 2QD2A 1ID1A 2W6PA 4JVNA 3S7TA 2PA0A 5F4BA 4MS1B 1U9JA 4GI2A 4ZVRA 3RW9A 4F9GA 2OC9A 1N33B 3IAXA 4DA6A 2N1MA 2ZR7A 1E6CA 5JECA 1LBSA 2Q5LA 2WIKA 4C3VA 5DO9A 1E9AA 2VAVA 5CFZA 1AKVA 5KDOA 2DWUA 4X8MA 2AF3C 5C1OA 5B2EA 4PM4A 4F92B 1DDOA 1WNTA 4NOLA 5FOQA 3I9LA 4FR2A 1WUHS 2H4HA 4QYIA 3PXXA 1Z22A 2MMGA 1JHUA 1UADA 1EFDN 2HCJB 3BTOA 3NHUA 2SBTA 2WTEA 1VLVA 3EBLA 4PAGA 1B7GO 1RM0A 2QD1A 2ZUDA 1CDOA 1JIIA 2PMWB 3CWZA 1LTQA 3EFOA 4C05A 3NC0C 4LFAB 5H81A 3UK6A 1WETA 3IOCA 4FXPA 3KZCA 1R4NB 2FZEA 4IXDA 2YW2A 1TZKA 2ZE6A 1KSFX 1TIKA 2ZAGA 5FFMA 1VKZA 1HPLA 3ESZA 3T99A 3TOZA 3BMCB 4BEBA 3DGFC 2RGCA 3GRZA 3JR7A 4RVNA 2L18A 3ONNA 4J7CA 1FDSA 2Q4RA 3RREA 3SF8A 2EDAA 1FNSA 2CMHA 5K0BA 2ANCA 1P80A 1TJ4A 1KDZA 5KVAA 2F9LA 2QPTA 2AFHB 1H05A 3I04A 2XVXA 4MPTA 2ZI5A 4Y18A 5TS2A 3IFSA 4E32A 5KVVA 5TDHA 1CIJA 2ZWAA 2JIRA 3W8EA 3ELYA 2G1JA 4ILEA 5IAOA 2OOSA 2OLEA 1H5NA 3TQIA 3N28A 5HQ3A 3KAPA 4OAOA 1PWYE 1TC1A 3FZGA 4IUYA 1WKCA 4JJ4A 4US2R 2TMYA 4EPXA 3IBCA 3R7BA 2R68A 3OE7A 1I6MA 5FOTA 2AJ8A 1W9MA 2WSBA 3E82A 4B76A 3FVWA 2XOEA 3QFTA 3K9WA 2XCLA 3D6NB 1THMA 2H3EA 2Q5HA 5C81A 3U48A 3HA3A 5K4HA 4ZAGA 5CCDA 1PNTA 3MQFA 4LNUA 4ON9A 1ZP6A 2H4YA 2HHHB 2O2HA 1XZFA 4UARA 3UB3A 1KAMA 2GZDA 3USZA 1KOGA 5IJ9B 3EIOA 1MORA 3HFJA 3GV0A 4KN6A 4QOIA 3MSXA 1R64A 5EGNA 4K87A 5HIKA 2QRKA 3NHYA 5BVHA 2WUEA 3VNUA 1SXJE 2OENG 3A58B 4PPQA 5ALYA 1UEJA 2ATXA 2XHZA 4FKMA 1ZUIA 1WNFA 3GH3A 5AUOB 4L4ZA 4F6RA 5HM6A 2DY0A 2P9EA 3ICOA 4ZCMA 5FYQA 4P4NA 4A1FA 1XPRA 3G7SA 3GJ6A 1HDIA 2GTHA 2FPOA 3G9QA 2F64A 4U2EA 5K0CA 3IAAA 5AVXA 1JTEA 4F5WA 5ALVA 1NXPA 1T4CB 2I1QA 3IB6A 4LRQA 4YJFB 1Q7BA 1MJGA 3CWCA 3SVTA 3OJFA 4TV8F 4IO0A 1HORA 2OXEA 4C5BA 1WJGA 5I5EA 2QTGA 5LOVB 3GUHA 1PJRA 5DP2A 1JFFB 3QFRA 2OBFA 4FSHA 1AURA 3CKKA 3S68A 3PUIA 3C85A 2DR0A 3KT6A 5C51B 3MRVA 2JZNA 4OMUA 3PNMA 4KVFA 3SSAA 2XD9A 3U7QA 3QU7A 1BZYA 2CYAA 2LKDA 4C4ZA 4J07A 2XTMA 1DRJA 1H2EA 4AZSA 1U2DC 2A4MA 4JT2A 3JWJA 1SA0A 2LR0A 2WKQA 3GN2A 1IDN1 1UBTS 1W85A 1ZJJA 2WT8A 3M49A 5AHRA 3SS7X 1H8HA 5IX8A 1QDLB 1T9BA 1RRVA 2GZAA 3CO5A 1O7JA 2J5RA 4PO8A 1YKGA 5IEBA 3SDSA 5KYWA 3WLQA 4B6RA 3JS5A 1AIPA 2FX2A 4ZEOA 4E5MA 2COKA 3U0VA 1QUFA 4ZO9A 2DUMA 1DWQA 1NMSA 4KR6A 2WTUA 2OTCA 4ZVSA 2H0AA 1FFWA 5DYGA 2YWBA 1OU0A 2C4NA 2V0NA 5E1OA 3SLRA 4CR6A 4BATA 3IEUA 1NL3A 1Q17A 5DXAA 1I3NA 4HOYA 2CLLB 4BO4A 1XMQB 3L6EA 4N4AA 3ROEA 3FFXA 4BRZA 2PKCA 2QS9A 3ZCSA 2PSEA 1PX0A 4EHNA 4DDKA 2BBOA 3QXHA 4ZO7A 1W36C 1Z17A 1J9ZA 2GN2A 4JASB 5JYEA 3QUAA 4MPJA 1A8UA 1EB8A 5TSDA 2VZ0A 1R3DA 3HCRA 4G5RA 4YJ3A 4YP7A 5JH7A 1NJ2A 2ENWA 2ABWA 2VXCA 4UU0A 4NQZA 2R1VA 4FQ7A 1Q0LA 3HV0A 4L95C 4MTCA 3UG6A 2XTJA 3ADBA 4BBZA 1B15A 1CJCA 2NAFA 2ODAA 2VVTA 1BMQA 4PFKA 3HMQA 4Q1BA 3RB8A 3V7NA 4BFSA 3WMFA 1BCSA 4K1XA 2C7OA 2OT3B 3ILHA 3JU3A 1SG0A 3NXKA 4JHLA 2HU5A 3T7EA 1MZVA 1Z73A 2DF8A 1ECGA 2YR0A 1FPQA 2AR7A 3KAKA 1ULSA 1XZMA 1KIMA 3R6GA 1X7GA 4UUPA 1QU2A 3KCNA 3QIAA 2ZAIA 2C9CA 3CQ9A 3WLPA 4ER6A 1C8LA 1AKYA 2WMOB 1YR8A 2RH4A 1P17A 5JVDF 1ZA2A 3AR2A 2H7YA 2H5EA 1DO8A 4MO9A 4OHKA 1OBFO 2NACA 4RHUA 1VECA 2PFSA 3FD8A 3S2EA 3T95A 2GXQA 1T5TA 1VKJA 4D9MA 2O3UA 4ZHQB 3OX2A 3TH5A 2GEDA 3URKA 1OW3B 1NUQA 1E66A 5J59A 3D6UA 1TFUA 521PA 1W0JD 4Q4JB 1P6UA 2Z9DA 4UBKA 4XYMA 5K8VA 4B3RB 5FNVB 3X2SA 3DTTA 2VDLB 1V71A 4X93A 1N6OA 5JG7A 2HBRA 3FYDA 3ETJA 4NRDA 3HYNA 5KNDH 2CV1A 3AIIA 3OM8A 1RZRD 1GITA 1NOJA 1PSZA 5HJ5A 3Q7RA 5JAHA 4R05A 4BC1A 3EAFA 2Q6TA 4R1OA 2ZBDA 3UBMA 3O8CA 2WOOA 2QVGA 2BMDA 3FNFA 3IELA 3WK7A 1FUYB 2J4DA 3IIIA 3DDHA 5I9SA 5CVTA 1CX9B 2OG1A 2X4DA 2MOKA 3ITKA 1Z36A 3LBIA 4WV3A 2P6OA 1X1QA 5HRUA 4FM9A 4I66A 3I76A 1ZMXA 3GRVA 3SAJA 1JHRA 4C1NA 1L7RA 1UMCB 4MA5A 2Y66A 2W2TA 3DXXA 1H65A 4RIFA 1RIFA 3PNKA 2VDUE 4L08A 3EY4A 4MRMB 4DCPA 3LT1A 1A9YA 1I3LA 4MP6A 1WL8A 4PC3A 4DNFA 4CG2A 3JVEA 1J42A 3EX7C 2DEUA 3MN1A 2K7ZA 2C4WA 4H7EA 4OPMA 2UZ1A 5JD5A 3QG5A 1KJ8A 2IEDA 3DEYX 4MMYB 4TS9A 4KGZA 1SU4A 5KOIA 5BN3A 5REQA 2BRUC 2CXHA 2RH8A 1T0IA 4AFNA 3QELA 3VR6A 2CCGA 5MHTA 1DKPA 4MB2A 2NU6B 1TVEA 1U65A 1VCOA 4QX6A 4G5XA 4F8JA 2IDZA 1BG6A 1ATIA 2WJIA 3GFGA 1EM8A 2HRRA 4TMXA 4Z0HO 3T1QA 1IN7A 5A62A 5K0TA 4RKQA 5JASA 3BIWA 2E18A 4JL5A 2A8YA 3IVXA 5F1PA 1ZD3A 1BA2A 3DMTA 2I4MA 5DX8A 1TMOA 1CIVA 1ZGHA 5KYUA 3I2FA 5SV2A 4A15A 1XVLA 2PYIA 4AJOA 5LMCA 2GVDC 5HFNA 3ZWCA 3R9KA 4GX2A 4X92A 1KC1A 3WGQA 1G3IA 3HNRA 4AWXA 2FB9A 3MS2A 2NUBA 4JUIA 3NBYC 4A23A 4B48A 1NYTA 4UNSA 4BQSA 2IYAA 4KAXA 4WFJA 2G7MC 1JE0A 3UK7A 1QBGA 1WOMA 1TF2A 2F43A 4D56A 4BGVA 5JWHA 3DBHA 4JLMA 1LJLA 4ENQA 5JXGA 5DT2A 1JLLB 1JDJA 4BYMA 1GDHA 3V6MA 1T91A 3SKXA 2RFLA 2ACWA 5IC5A 4DBLE 1T1SA 3HKBA 2VUTA 3IBGA 2Q3CA 5E4YA 4YRMA 4BU0A 2IA5A 4KVZA 1G18A 1P1BA 1O94A 1P0IA 2CEAA 1NBWB 1RNLA 2XNDD 3NM5A 4IJQA 2ZYAA 2BFPA 3H65A 4YAKA 1AE1A 2V0GA 1W8DA 1HL3A 4RF2A 3C43A 1UIMA 2IRWA 5F3DA 2A4KA 1YA6A 4UEKA 4A10A 5A4JA 5A7FA 1O8BA 4K86A 3SP1A 1L4LA 2DULA 2RC6A 1NSYA 1WP9A 2P41A 1GLGA 1KH3A 4QGGA 3MMSA 3OHPA 3PG5A 1MAHA 3P2EA 2FUNB 5ETJA 1GSOA 2QPOA 3I9V1 3P0IA 4UHEA 5FXMA 2V74B 4R0MA 3GLGE 4FLMA 3KWFA 1S2DA 1SUSA 5JAZA 1Y98A 3DZHA 3CZAA 1LDYA 4LQCA 4F12A 4CEJA 2O2IA 3SXPA 1E1RA 4BFXA 1K2VN 1EVYA 2I3ZA 3PC8C 4QLBA 3PEEA 2G3YA 1ANKA 4UM9B 2NU7B 5FLYA 1W4AA 3R3SA 5SY9A 1UC4B 1EYZA 3C5EA 2EHDA 4PW0A 5EESA 1RBMA 5EQTA 2VDOB 2WM2A 3TBHA 2CD7A 4RADA 1FQWA 4LYEA 4N1AA 5BXQC 3O3CA 4Y0AA 2KSQA 2YX1A 4LJ7A 1JZQA 4PO3X 4D5EA 1G55A 3C0KA 2DYKA 4FDAA 3L6DA 1FP4A 3P94A 2GZMA 4U63A 3WYCA 5KNBD 2H1HA 3IKMB 3WX0A 2P4SA 5KTKA 3JQQA 1GZUA 1KO8A 1GKLA 3GGJA 2HD4A 5T8KC 3VHRA 1O95A 4G24A 4ND8A 2OHHA 5FUQA 1GQOA 4FPXA 1B0AA 1FS4A 3NVMB 1L1QA 2P30A 2WAOA 1R37A 5EI5A 3KT0A 4GX5A 4DYVA 2PJUA 3IBYA 1J25A 4RD0A 1T43A 4N8EA 2VNIA 2B36A 2Q5JA 1NKTA 1KAQA 1MENA 3WGTA 4M83A 1DZ3A 4UZFA 4TLBA 1QG6A 4K1LA 4HDAA 3RC1A 1ADGA 2WT9A 2VHYA 2WI8A 4B3IA 2VYNA 1AKMA 4IFBA 5DZSA 4ZT3A 4BVEA 4JX9A 3C48A 3B1VA 1Z5UA 1CP3A 3LKZA 4GYJA 2YV3A 2PSJA 3F5QA 4PGHA 3WGZA 4NEGA 2G1UA 3FUWA 4TN1A 3S81A 1YF3A 1N0UA 4C4XA 1SCBA 3EEYA 3FZEA 2WMYA 1V8FA 2AQKA 1Q0TA 4UE2A 4L22A 1JU4A 3OFVA 4Q48A 3C8HA 3LUAA 4O59O 4IZOA 5L7TA 4BMYA 3FB4A 4UULA 2GZSA 3AFNA 3BL8A 2ZCVA 4DQ0A 5JU6A 4M22A 4EUFA 2FZ4A 3GFQA 4OFZA 3AX6A 4FHZA 4D9NA 4E12A 4OL9A 1G38A 2PGXA 1R2QA 2FRVA 2W98A 3G2PA 4O4JF 1M5UA 3T3DA 1TVCA 2HA5A 5E1MA 3SS9X 3TL2A 3TRKA 4BQIA 1P1RA 1R5OA 1XCJA 1RAHA 1Y9JA 4KR9A 1EE9A 2J9ZB 2XCQA 1LF0A 3C97A 4FGUA 1R6XA 1YC2A 2UUPA 3D0QA 3PQ2A 3Q9SA 4LRXA 3AEKB 3GUVA 4NC9A 1XZQA 2I1WA 1S4MA 2EFGA 3FWHA 4FNAA 2AGVA 3WWOA 4B7AA 4KE8A 4WEOA 1GZ6A 3P52A 5EY5B 1DG1G 1X2EA 1VKNA 2QLTA 4ALMA 1RMYA 2NT3A 1DQNA 1BAPA 2FKNA 4RFLA 1WBDA 1C8KA 4BX8A 3HVIA 1THGA 3C3CA 2YQ4A 3VYVA 3AUSA 3HSKA 2JARA 5GADl 1QV9A 4MVYA 2FWJA 1SAYA 1EXWA 2ZCJA 1MZPA 2GUGA 3G1TA 4DIDA 5AD1A 5F7OA 4KHPB 2FE4A 3FRIA 4XGNA 5FPSA 3BGDA 5DI3A 1YZVA 2ADMA 4NZMA 4DHWA 1YWGO 1Q1EA 1KJ9A 3ETCA 7AT1A 2XUKA 3L4JA 1Z5GA 2EFJA 4NZNA 4QYIB 4PZZA 5T64A 3SHVA 4IDFA 1YZTA 1CQIA 1OWLA 2FP4A 2WHYA 5DIFA 4AXXA 1N4DA 1UBRS 3DM5A 3RS9A 1RQGA 1DFIA 2D1QA 2QRVA 3IO5A 1DX9A 2IXEA 1JMVA 3QE9Y 3EFOB 4JVMA 2PT7A 6LDHA 1VGVA 2WF7A 2RGAA 4YJDA 3L46A 4WKPA 1XBTA 3MUOA 1DEHA 3MJDA 1R0YA 2OM6A 4RPGA 4GKJB 2I2CA 3N07A 1R0KA 2FQYA 4KQIA 1JALA 2JLBA 4E7PA 1E6MA 1PYDA 1RAGA 3B1KA 3UUFA 5CLQA 3BWBA 3VYTB 4ZN6A 3R8FA 3EPHA 5JLAA 2BKXA 3EIFA 3OE4A 1SVMA 3TX6A 3BXFA 3BK7A 1AHNA 2IW1A 3SF8B 1RVDA 2TECE 3QOFA 3AGPA 5ALUA 1JYEA 1DAPA 5GIPE 4F84A 5BQ3A 3PK0A 1Z7EA 1TX4B 4EJFA 3LC7O 4HXYA 3ZYCA 4BQQA 3AKEA 4J8PA 3WB2A 3ZGVA 4C6RA 3C16C 3CLRD 1E5TA 2Z2YA 1TTQB 4CTOA 4Q4CA 2RB5A 1BVRA 5HQ3B 5K99A 5D3QA 5KNCH 3IULA 3FMGA 2YBEA 3DO5A 2AR9A 3B13B 1S3IA 1SCKA 4II3A 1MTZA 3MOIA 4CIVA 1VSQA 5JW6A 3QEKA 3B6EA 3H6HA 4GH5A 1LLFA 2YBDA 3KR1A 4OKIA 2VPTA 4LQ4A 3UENA 1YMQA 4PRKA 4LNUB 3PGMA 4OHRA 1PDVA 1EAMA 1WUKS 2EL9A 4NV1A 1ENYA 1HNWB 5BSEA 2G88A 2QJWA 2ZANA 4N82A 2ODWA 3D8SA 3HJUA 4YLEA 1Y3BE 5CLJA 5GTDA 5GWXA 1EP3B 1SOVA 4UTOA 5LDDC 4F4JA 3CW8X 2BBTA 3BIXA 3KDPA 4K9QA 3DOFA 2HU7A 5BVHB 1XMXA 1G8PA 1NBMA 3K09C 1U3VA 2JGIA 1KS2A 3H4VA 2ZRBA 3A9WA 3P2JA 1TLTA 3PZBA 4M0KA 2PNJA 1HQKA 3UTDA 4C0QC 5LA6F 4DMMA 4YT2A 5CDFA 1XDGA 5DLDA 1JB9A 3PDJA 4BNYA 4TQUS 5IXJA 1G20A 1R4MA 4X7MA 4M1KA 2MCFA 4GC5A 3JVVA 4AP9A 4WZAA 7ADHA 1VPTA 1SD2A 4KAFA 2I8LA 1GPH1 1MT0A 1HURA 2F17A 1Q6YA 1EEHA 3VISA 4N6NA 1WM1A 3A1UA 1YVDA 3AOGA 4ROTA 3ZR4B 4BYGA 5JZVA 1NC3A 4FN5A 3ASZA 1U5AA 2QQ0A 3ZVLA 5DEIA 5TMBA 1XTKA 2GH1A 3RKRA 1S8OA 4G8DA 3CPEA 1W25A 2ZYIA 3I64A 4OHPA 1WU8A 4IX1A 4U9IS 3DKVA 4MW6A 4X1OA 5KS2A 1UBCA 1XJQA 2QTZA 4OAPA 3RLFA 5I9IA 4U9UA 1DOZA 3RYFA 1CR4A 2FPMA 2Q07A 3K2IA 3BCSA 4R69A 3U7QB 4M9CA 1M6NA 1EP9A 1IEQA 1WS6A 4M4SA 5FOVA 3NW9A 4F7WA 4QWMA 3B5IA 1CTQA 4C6TB 3CB2A 3SYRA 5LU8A 1YUMA 4B6JA 1N8KA 3DE6X 3RRXA 4R4JA 3PRHA 4AMVA 2BFOA 3A4VA 1A98A 4U5XA 1JWLA 1K63A 1M6WA 2YNMA 3NG1A 5IKMA 1E9BA 1EX7A 1K8YB 3ZH2A 5FF9A 5A3QA 2NTEA 1IY9A 2PSFA 4WZBA 4MH0R 1Z7GA 4DV4B 3A2LA 4K88A 1MH9A 1OB2A 5LKRA 2LIVA 4CFSA 4QOHA 4AYXA 4BO9A 5LQKA 1W5EA 1M54A 3TPFA 2BSXA 4PZLA 1TD1A 3ASUA 4DUPA 4KTTE 4PX5A 1ODCA 4AJHA 2JK1A 3TW4A 3K96A 5TGZA 2EEZA 1QH8A 1DC4A 2FV8A 3EVAA 3O82A 4J75A 4P8RA 2V6GA 4PPNA 1ZCFA 5AHWA 4BTVA 3LDFA 4CMAA 2HUPA 3PUJA 4FILA 1AF7A 3KTFA 4YMVA 3CUEF 1SXQA 3TQFA 2PQMA 3KPWA 2YY5A 3CC8A 3EAGA 4PIPA 4MRNA 2YTZA 4O2RA 1T1JA 1ORHA 1RP1A 3CNBA 1KARA 1KL7A 4C0SA 3MAJA 2OBBA 4WBNF 1Q7CA 2QX8A 3VU1A 1C3VA 2P4EA 3P8ZA 3RIYA 3AFGA 4YJ3B 5JH7B 2JGNA 3V9PA 5AVYA 5CXXA 1P19A 1KYZA 3H2ZA 3HM9A 2R1VB 1J99A 4DSUA 5JANA 3RTCA 5J63A 4DZTA 4JJFA 4OBWA 3IRUA 4IPTA 2FFAA 3T4XA 2F55A 4LCEA 2Y2UA 3EVGA 3U31A 3E53A 4HLDA 1PQPA 1SVUA 1OTHA 2O48X 4HBZA 3ZZTA 1BCSB 4DIOA 4TV9A 3WSVA 1QLHA 4OJYA 2EX0A 5CK4A 1CUWA 2INGX 2CV0A 4UNIA 2X0DA 4H0NA 3NI2A 4BJHB 2PE5A 3W06A 2XYVA 3JASA 4ZU6X 2YWDA 3OA0A 3N39C 5ALHA 2EWVA 2NO5A 3ET5A 3FPHA 3ROPA 5E8JA 2I7TA 1Z7WA 3SZMA 1IL0A 3VR6H 3IPLA 3LMKA 3WVNA 5IYZB 4NFSA 5A4MS 3I4CA 2FAXA 3M6WA 3OZXA 2B69A 1D2EA 2WWVD 1FX0A 4AJKA 2WINI 2B8NA 4OQQA 3KKZA 1Y6JA 2Z95A 4G3XA 4ZU3A 3L1KA 2CCKA 3R3VA 4NPAA 5AH0A 3WLRA 2I6TA 2ATVA 5I9TA 2XY4A 1JG6A 1U9CA 4DA4A 3IXLA 1HH4A 3A28A 2PH5A 2R7LA 1M33A 4S24A 4URVR 5HK9A 3NETA 1EBUA 1CUFA 5FDFA 4B3CA 1CF9A 1UODA 2Q46A 3PUXA 2Z8XA 4MVCA 1L4FA 1Z29A 1EJ0A 4FCCA 1N6KA 4PGAA 5E38A 5DRYA 1LD3A 3KVNA 4LY0A 4BZQA 4G0VA 4OU4A 4UUOA 4QREA 4LWPA 4TOIA 2XGSA 2A6PA 2ACEA 1QZZA 3R0JA 2CDNA 1RKBA 1XK6A 5DHTA 1SOUA 3QNUA 1RR6A 4QUJA 1RXUA 3NASA 2OYRA 4BXOB 1E1CA 4FX2A 5SZHB 3UGJA 1Q0HA 3PUVA 1US8A 3GJQA 3M4YA 3IXMA 1QYRA 3LP5A 5ESDA 1OX5A 4W9NA 5AQ1A 3IDZA 1SUEA 2EKDA 2ROQA 1HE5A 3NOQA 3HKDA 5ILGA 4LV8B 4P34A 1Z39A 1PWEA 3GARA 1KAOA 2HWXA 1Y9AA 2HA6A 2ST1A 3OQ6A 4QSMA 4F0JA 1P73A 3W5AA 1OFHA 3V1KA 4KUGA 1CZHA 2JKZA 3E6AA 4L5JA 2J5KA 2UZ1B 2QLMA 5GV8A 1V4VA 1TVMA 1YRBA 2QI9C 3QVUA 5CPFA 4FP9A 3KKQA 5T3YA 3H2HA 5C8VA 5BN3B 1ZJ5A 4J7XA 3DDCA 4UBOA 5REQB 4RNCA 3VA7A 3H83A 2JIZA 3SVLA 3QELB 4UVDA 1FDVA 1VCNA 3HQ4O 2RC5A 1WX1A 1X14A 4EEKA 1EM8B 2FPPB 2PN1A 3FJ1A 1GKUB 2ZJYA 3QXCA 1MG5A 2H7XA 2GERA 2PKQP 5HKBA 3WMWA 1MFPA 4QPJC 5ALOA 1Z4JA 3ZQKA 2QM3A 4Q02A 4LN1A 5BNWA 4I1PA 4NDZA 5JMTA 3ANTA 1GTJ1 3OA2A 1W5TA 4NBRA 4YCJA 3KCQA 4A0RA 1YXMA 2FPKA 5KYUB 1E2KA 2PGJA 3M5PA 4Z4CA 1NRWA 4G07A 5L7YA 2DBYA 3NTQA 3OMLA 2C00A 4HAZA 3RRFA 1G3QA 2A88A 4P5DA 1Q0ZA 5HF9A 2H1OA 4RVHA 3LVQE 4HWOA 1LUAA 1U98A 2KM1A 3GLTA 1CY8A 1GU0A 3HJFA 3LL4A 3RF6A 5KDDA 1ZVVA 1F20A 4OSEA 3IOYA 2F43B 2QRHA 1SHTX 2WU3A 3DBHB 3GAZA 4L76A 8ATCA 1KSHA 2BL4A 4KJZA 3M6UA 2O2DA 4TXJA 5EXTA 1O0CA 4AS1A 1M3SA 2DQSA 2GAIA 1IWPB 2IZ6A 3AVUA 4L6IA 5EJ7A 1SVIA 4IEEA 2WSSD 1GPAA 5C34B 2BM9A 3JQ9A 1XTTA 4S1OA 4Y1RA 3UAXA 3W9UA 1XEFA 4EG4A 1I4EB 4QFBA 3EZYA 4WPGA 2QTTA 4FFBA 3NRCA 1CQZA 2HZBA 3REFA 1TM5E 3DB1A 4QPPA 2QTVA 2QUJA 1IVNA 2V6MA 2W00A 1ZH8A 5CJPA 4LMRA 1HF3A 1Y37A 3PNVA 2DTXA 4B75A 3HH8A 2QA5A 1BH2A 2FW7A 5KREA 3KWLA 4GF5A 1I2ZA 4TZ6A 3BRWD 1QB7A 3VPXA 3ROGA 4D9GA 1NVBA 1Z35A 1GGKA 1K8XB 1XEWY 1NPTO 4YRGA 3OIFA 2PUDA 1XHEA 1O0SA 3T52A 3JWEA 3JYNA 3UXEA 4XAQA 1XTRA 4UOQA 2PK3A 4QTTB 2C2YA 5LYYA 3WKCA 1XZNA 3U17A 4JNCA 3H2IA 2RHRA 4ND2A 3AU8A 3FSJX 4JJGA 5AHXA 5SY4A 3I1IA 3QU4A 5K6RA 9LDTA 2A0XA 4XVHA 5HTKA 1VP9A 3D6TB 3QXSA 1J22A 4H59A 4AX8A 2AYYA 4IW3B 3QLJA 2QN7A 4MJ7A 4UPDA 4AZ0A 2QGFA 3E5MA 1QOZA 1QG4A 1DUVG 1NN0A 2O7VA 1FP4B 3FKSD 4CF3A 3IHWA 2ODNA 4ZYLA 1NJ5A 1CXZA 4RVSA 3DD5A 3RBZA 2G80A 2PBLA 3DEFA 4PZCA 3G1WA 3AOEA 1MQSA 4ND8B 4EZEA 1ZUWA 1ML4A 3K0FA 5CCEA 2YKGA 3K70D 2PH7A 4Q3CA 1KH2A 1U2RA 2D5IA 5DCWA 2E48A 1N2SA 4PSUA 1OC4A 4R2MA 3R7LA 5BY2A 4ZD6A 1JJVA 3RGGA 1IQPA 3AVOA 5D01A 1S1MA 3RM3A 3PHBE 4RK5A 2R2AA 4YLGA 3ZX5A 3PIDA 3MWYW 4PSKA 4KG7A 3MMPA 1AK2A 5WRFA 1NXSA 3EGIA 4GM1A 5JNSA 3A0UA 2O07A 1CZNA 4NEQA 2OQVA 5C32A 5HX7A 4JV5B 3ZHQA 1PT5A 3QWIA 2M6KA 3VJRA 3UT6A 4FLFA 2I66A 3W5VA 3D6VA 3NNDA 2KLBA 5BQPA 3G49A 3T34A 1QFMA 1G8SA 1J70A 3LKDA 4RTMA 3MMZA 4YQZA 2I91A 2BEKA 2EKZA 1KAHA 2W93A 4RY8A 2E87A 5TMEA 3OZBA 3B89A 3LOUA 3Q0IA 1RLUA 3BRSA 3C1UA 4PPGA 5C37A 3IEMA 4NU0A 2BFBA 3KOWA 2ZZMA 1CY1A 2P9QA 1GL7A 2G6BA 1FTGA 2WZBA 4EBBA 2ZZNA 4M99A 2V03A 1XVVA 2IXGA 3IKJA 4KLAA 3INGA 1XHLA 2FJUA 5T4BA 1TMYA 2F9MA 3GZ4A 4I4TF 1DP4A 3DOIA 3U3RA 1LNQA 4DDHA 2JGJA 2PT9A 1QX4A 2QGZA 1JA1A 1U2GC 2VPWA 3G9ZA 4HKTA 4XQ0A 3SJAA 1NXVA 3QUSA 5C5EA 3JWHA 5MDHA 1MT3A 2W48A 3F7OA 5D1HA 1OXUA 1ZOSA 2XA1A 1Z6YA 4RZHA 4WBXC 1HO3A 4OBXA 3SCZA 3VVMA 4M1ZA 3WLOA 5DNUA 2PS0A 4GGMX 1XQWA 3TLGA 2X8WA 1XWWA 3VNRA 1TZCA 4TS4A 1YNSA 3RS3A 1YFZA 2E4AA 5DN9A 3ZDRA 2VPYA 3AY3A 1V41E 4UXHA 2OOKA 2VBGA 4OK3A 5TT0A 3OOWA 4EI9A 3IJRA 5CFRA 3OUZA 3K9FC 3FE2A 2XX3A 4ARZA 4OLBA 5HFJA 4NECA 1IEWA 4P86A 5DI3B 1C9DB 5BSKA 5IW8A 3H9UA 1FQOA 2JAXA 4GI7A 4GDMA 1FL9A 4FYHA 3VR1A 3U6BA 5CR9A 3K53A 4IOJA 1QB8A 2JEOA 2FP4B 1CQIB 2ZTLA 5DTEA 4OQEA 3GHYA 1EUDB 1ZK2A 4D9IA 3Q9UA 1DC8A 3U4CA 1QFZA 4J0GA 1Q2UA 4KXQA 4KQFA 5FJIA 2QRVB 3K9BA 4N0MA 3EVNA 3M83A 2OZEA 3BHMA 3BXEA 2N9UA 5KJEA 3W8FA 2QU7A 3DS8A 3KE8A 4IGEA 1OLUA 1WPXA 5GY7A 2CYCA 4BPRA 4LF8B 1DBPA 2PGOA 3HUTA 4HT3B 2ZWVA 1N5JA 1LW6E 1Q50A 2NO7A 2QLFA 4UUAA 1CF4A 3FWNA 1KK0A 1WMBA 3PFIA 2I1VB 1W29A 2H29A 4RHTA 2IH5A 1PTKA 3F6EX 4QU8A 1ESCA 1N92A 2V3VA 3QVTA 4KO4S 2AG0A 5IC6A 3ZGXA 2ZETA 4ZRDA 5EVCA 4CGZA 5K3DA 3UA4A 4C4SA 1JVNA 4EGSA 5IFLA 5L3RA 3TB6A 3OI7A 2F1HA 3AXSA 3QV2A 5A9SA 3D7LA 5D87A 4BP1A 1LI7A 2QMUA 2NG1A 1AQYA 2ON6A 1V8DA 5F1KA 3BSYA 3R76A 2N47A 2W2VA 3VC1A 3ZV3A 5J4VA 4FGSA 4Q1FA 4P0PB 4I08A 2CVPA 5G41A 1C2TA 5A5VA 3T9DA 3I92A 1VE6A 4FFSA 3E8MA 1WPQA 1E2FA 1GY8A 1Y7PA 2EW8A 2JHPA 2ZROA 3EEQA 4I36A 4RSGA 3WYBA 2QX6A 2YRFA 2R7NA 3L4BC 3OTWA 1Y33E 4FOSA 5ICMA 3TQCA 1PQUA 2G77B 2XRFA 1V5WA 5A1TA 4ZQBA 4AU1A 4KIUA 4G4SO 5L9AA 1AKWA 2ZYHA 2YXBA 4BVGA 3EPKA 1WVGA 2E85A 2Q3FA 3ONDA 3CLSD 4JELA 2OZPA 3HC7A 4C76A 5KYXB 1Z4OA 3GROA 4G0PA 4LRYA 1V9LA 4OM8A 3T5TA 1I8TA 1F9EA 2YN2A 1PNRA 1U7OA 1UT8A 3DWFA 2DQKA 4FHFA 4GOND 1ORWA 4H6XA 4BGEA 4BB9A 2Q3MA 2D7JA 5LDHA 2WUFA 1IN4A 1DWPA 4I6JA 4MICA 1VJRA 5JDIA 4GPAA 1TZMA 2GO1A 4QHYA 5KOHA 4MKIA 4MLPA 1GSIA 1SEVA 4KRXA 4YP1A 5FQNA 1JQJC 1CRQA 3HXQA 5LD2B 2PUVA 2DVMA 3TTWA 4P3OA 4QU5A 1SHJA 5DGDA 1KDOA 1GZ3A 4G6ZA 4LJ4A 1JR3D 2GF0A 1G20B 1R4MB 3OZVA 5AOCA 5AM3A 2PUAA 4J6FA 3GD5A 1E1LA 3MJTA 1Z47A 4KFTA 4N0PA 4RZ3A 1P2GA 3JSAA 4WZAB 5EMMA 5B58C 3BB1A 1K8ZB 1QKKA 2HWKA 4KXMA 4DADA 5HJ7A 2J7PD 1H2YA 3OBIA 3OTOB 1GRVA 1Z83A 1JAXA 4BBAA 1Z13A 2X6RA 1XFAA 3PF9A 4NFLA 3UVEA 3E8SA 4ZGWA 1A71A 1F3LA 3C4VA 3S99A 3CXUA 1ZIXA 3TTSA 4I19A 1R8YA 1IK4A 4MYUA 1IOZA 2YV2A 1N7JA 3PFNA 5KOHB 4UHHA 1OYYA 5T57A 3MIIA 3H5WA 4NNJA 1JDPA 2XEXA 2ZI3A 3TZCA 2X0KA 1VCMA 3KG2A 1JKIA 5CFLA 1CV2A 2NXEA 1F8UA 3SIPA 4TWRA 2YASA 3C7AA 1S0UA 1SPBS 4C07A 1UAAA