1WSWA

Low temperature (100k) crystal structure of flavodoxin mutant s64c, dimer, semiquinone state
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDCIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Redox properties and crystal structures of a Desulfovibrio vulgaris flavodoxin mutant in the monomeric and homodimeric forms.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
total genus 53
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2004-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wswA00
3B6JA 2D5IA 1AKQA 1RCFA 5EMNA 4YAFA 4Y9UA 4YAUA 1C7FA 5LJIA 3KEGA 4H6PA 1B1CA 3L9XA 1AZLA 6NULA 1KBQA 1TLLA 5ULLA 3NHPA 1T5BA 1AKTA 3F90A 3FVWA 5F51A 4YQEA 4M0CA 1XYYA 1XT6A 5FX2A 3NHJA 2V5UA 1DXQA 3KLBA 4GR9A 4FGKA 4N65A 2Z98A 5F4BA 4YALA 2BMVA 2B3DA 3P0RA 4CF6A 2KLBA 1E5DA 3EDOA 3NHYA 2FVXA 2F1OA 2BPOA 2V5VA 4QOHA 3OWHA 2XOEA 1ZWLA 3NHFA 4R81A 2BF4A 3GAMA 3HA2A 3O73A 4ESEA 2FZVA 4QOGA 1YOBA 3UXEA 2MTBA 4F8YA 2WC1A 2RG1A 4QOEA 3JSXA 4BMOB 1H69A 3W79A 1J8QA 3HR4A 1AKWA 4BMPB 2W5UA 2QR2A 3F6SA 1ZX1A 5LBUA 2Z9CA 1CZKA 3B6MA 1RLIA 1FVXA 1FLNA 4PU0A 1ZWKA 2QMYA 2ZKIA 4LTMA 4LTNA 1FLDA 1NNI1 4QOJA 1AKVA 2GSWA 1C7EA 1FLVA 3HLYA 2MWMA 2OHJA 3NHUA 4QOIA 4NLLA 3RPEA 1BVYF 4H2DA 4PTZA 4XDGA 3OX3A 4YAOA 5FUQA 2KQUA 2BZSA 1AKRA 2FOXA 2Z9DA 3NHSA 1CZOA 3TEMA 3NHWA 3TE7A 1DXOA 4LAFA 3O2NA 4C0XA 3NLLA 1YCHA 1YDGA 1CZUA 1X77A 3OWXA 5FA6A 1KBOA 4J8PA 2OYSA 5B3KA 1H66A 4DIKA 3QE2A 3R6WA 3W78A 1OBVA 2R97A 3GFQA 3LCMA 3OVMA 1YCGA 2HPVA 3EYWA 3NHRA 2N1MA 4HS4A 1JA1A 3LT5A 4FX2A 2MOKA 3L9WA 1AHNA 1CZRA 2FZ5A 3F2VA 2QMZA 1J9EA 2QX4A 1D4AA 1XI2A 5A4KA 3UXHA 3K20A 2QWXA 5BUCA 1OBOA 4Y9RA 4DILA 3G5MA 2QX9A 2QX6A 4NULA 2HNAA 4PTYA 3NHLA 1RLJA 1SQSA 5EAIA 2OHHA 3S2YA 5LVAA 1YKGA 4ZVLA 1D04A 4C0WA 1FTGA 1YCFA 1QBGA 1J9ZA 3ESXA 3FNIA 4U7FA 2FCRA 2Q9UA 4CETA 3N39C 4N9QA 5LLDA 3GFSA 4ZVKA 5LJLA 3QFRA 3D7NA 2A5LA 3B6IA 1WSWA 2Z9BA 3K1YA 2FX2A 4GI5A 4GQIA 5F12A 1RTTA 4D02A 4U7GA 1V4BA 1QRDA 1AMOA 4ZVNA 2MT9A 3U7IA 4S24A 3N3AC 1AG9A 1J9GA 4Y7CA 2FLVA 2BN4A 3GFRA 2M6RA 3NHKA 3OJWA 3N3BC 1FX1A 1AKUA 5B3LA 3ESYA 3W77A 1D03A 2X2OA 3ESZA 2FAXA 5NLLA 4OXXA 1JA0A 1VMEA 5JROA 4C76A 3ES9A 5LMCA 4QOFA 2V9CA 3FX2A 1CZLA 2M6SA 1QHEA 2OHIA 1FUEA 4N82A 5NULA 3OJXA 1WSBA 1FLAA 1F4PA 3KAPA 2QX8A 1CZHA 3U7RA 3OX1A 1SG0A 1TIKA 2FDXA 3SVLA 3F6RA 2Q62A 5EA2A 4YAWA 2XODA 2R96A 4LTDA 3B6KA 1CZNA 2AMJA 1BU5A 3W7AA 1T0IA 5LBTA 3QFCA 1I1OA 3TZBA 2HNBA 1YRHA 1QR2A 4FGLA 4HEQA 4DY4A 3NFRA 4ZVMA 3FW1A 4XDHA 3KAQA 3ZHOA 1XYVA 5TGZA 3OX2A 4QODA 4C14A 1GG5A 1OFVA 2ARKA 1DX9A 4LA4A 3FJOA 4U7HA 2X2PA 4FGJA 4ICIA
chains in the Genus database with same CATH superfamily
1WMSA 1XCJA 3YASA 2CXRA 5FTMA 5JZMA 2UVPA 1ZOLA 1UUFA 3C14C 3E2MA 2AW5A 1NVUQ 4IIJA 1M8JA 1YJBA 5HTKA 3K0FB 4GQAA 1V11B 3LGXA 4JT2A 1FXWA 3JWPA 1SBHA 1N34B 4FLEA 3EVZA 3GBSA 2R7NA 2WHYA 3ONDA 5FXMA 2IP4A 2ORWA 1RRGA 3BE8A 1T3SA 2R8YA 5KNCH 2F3PA 4MEBA 1P8JA 5IH7A 1CUVA 4D3XA 4B1FA 1IU9A 4UNQA 3NHPA 2VAMA 4UC0A 2BI7A 3GAAA 4JVSB 4Q9IA 3ZE9A 5BWMA 3TVDA 1EDBA 2GYYA 3C1TA 4C04A 2QM7A 3GFPA 3WBFA 1EZZA 4YQEA 1QVZA 4JJFA 2JHPA 1Y8ZA 2PZ8A 2IHBA 1AX9A 3DPIA 3ENKA 1YRQA 3Q0EA 3QTLA 3L5OA 4IZ6A 5TF0A 1PV4A 2DVMA 4DQVA 4EI9A 1TM5E 5TNXA 4OB8A 1RBYA 1V1MA 1PFWA 4HNAB 4K9MA 1FX0B 4I55A 2FR0A 4XIIA 3RS4A 4AULA 4J7AA 3EH2A 1QP4A 4AG5A 4W7SA 4EPVA 2OXFA 2DUUA 2Y0CA 4LRUA 2ID4A 1P6UA 4K88A 2IITA 4ZVPA 5LQRA 3P0RA 5JZSA 2I34A 2BFCB 2HPAA 3KYDA 4RZHA 6CHYA 3M4JA 1X1SA 1OLSB 1WP4A 1JQAA 1XTKA 2JDIA 3N8HA 1GADO 4M7OA 3ZJYA 4NL4H 4OTZA 5AOAA 3H18A 3A31A 3HSKA 4ZGBA 2Q2VA 2EBUA 3MHTA 2P2CA 4B83A 4P82A 5JWHA 5LP6C 2A86A 2YQZA 5DYNA 3S7TA 4C2TA 3UK0A 4RH3A 4B0PA 4EF6A 2ID7A 2PMCA 5K3BA 1GWNA 3BMNB 4I14A 5HCNA 3T5MA 1KQFA 5JO9A 4QVGA 1KZYC 1B7GO 3OJOA 4J3FA 1HR0B 3DL0A 4MROA 3M7IA 3EVTA 4N5HX 1AA6A 1U5BA 1B6GA 3H2BA 1R3UA 1L7RA 1SBYA 1NV8A 1QJCA 4DMHA 4ESEA 1EBBA 2I67A 2F55A 1R6VA 3ZDDA 2PH7A 5A5VA 2DFVA 2Q5CA 2YXDA 2AOXA 4LQDA 1T1JA 3NTVA 4QYIA 3S40A 5EMJA 5KWJA 3C3KA 4PGAA 2HHLA 1YFZA 5SY4A 1E79D 1AH2A 2YYYA 2L2QA 2FPSA 4NEHB 4Z9XA 3R5JA 1JWAB 5KUTA 3VJRA 3FA2A 3ZIDA 3D8SA 2QI9F 3DE7X 1W85B 3USZA 3PUWA 2ORIA 1N25A 2WNIA 2ZTLA 2DTEA 1I1NA 4J7UA 1CTQA 3W9YA 5MFPA 3FBGA 3IKJA 3IULA 4PQFA 5EWJA 3IIIA 3O03A 5CDFA 3NVKI 3WICA 1U2TA 1YVDA 2RH9B 3PNKA 5ALEA 4JFRA 2UXDB 2WUDA 3E5MA 1D1TA 4X1IB 4P53A 5H4HA 2OD7A 4F6RA 4RD6A 2H5LA 1TM7E 1RC8A 1YJCA 5LPNA 3A1DA 1HLGA 1KDOA 4ZYYA 2RHMA 5AVQA 4NZNA 4NDNE 3HA5A 2YC4C 2R4TA 5FTKA 4JBGA 3VR1A 1V9SA 5ALMA 2RSLA 3LTEA 3G9UA 1C1XB 3LY9A 3R6TA 2QMYA 4S1OA 3GLHA 4LFBB 1N75A 4BJ1A 3T6KA 4H3VA 4EFDA 4HV4A 1NJSA 2J87A 3BRQA 3DMPA 3PC6A 2H57A 4TSFD 4TV9B 1NMEA 1V8ZA 4GDMA 5AO9A 2AYXA 5I7VA 2XCLA 1P5RA 2WTUA 2I9KA 3NNSA 2DP4E 4CDRA 1GAEO 1NVBA 2OHJA 3W5CA 2B1GA 4Z3OA 3GNTA 2H9IA 4MV9A 1A8PA 4RFSA 5A1TA 4Z8YA 3DBOB 3EG9B 3N2KB 3N5CA 3ZU6A 2ZUWA 3ZI0A 4KDRA 1O5OA 1W9HA 1Y5LA 4E08A 5A5EA 4WESA 2GO1A 1Q57A 3OLVA 2GWHA 3QRWA 3TFQA 4J0DA 3BEOA 3AIOA 3NDPA 1LBEA 2RJ3A 4TMVA 3ZG6A 1DWQA 4P93A 3SIWA 2JC3A 4B34A 4M3NA 1UWLA 3RODA 2WYVA 4EKIA 3NHSA 2IVZA 4NEGA 2NOAA 1SCAA 2QP3A 4G0VA 4LZLA 1P1CA 2VQFB 4KQGA 4ENTA 4TLBA 3ONFA 3PT9A 1XMJA 2X8BA 4H3HB 1NU6A 5EIAA 5FB3A 1Z29A 3MPOA 4BFUA 4N48A 1H42A 4BMDA 1HDRA 1YDGA 2RGNC 2A0FA 3FYHA 3PFCA 1NVVQ 2D2IA 4D8WA 5KSZA 3FTNA 1MORA 4J6FA 3HCRA 3SYLA 4JL8A 1WJGA 1KJIA 4URFA 3I6MA 4E5DA 2YVQA 4ALMA 4ALIA 5JI3E 3WX0A 2QLFA 4Y6RA 4DCNA 3G68A 5BQ5A 3L0IB 3QGMA 1LI5A 1OI3A 4G8CA 5A9SA 3LQQA 8ATCA 5J5CA 4J8PA 1U31A 4RZXA 1FMLA 1SVKA 1H1LB 1W94A 2IUSA 2WUFA 2ZU0C 3OM1A 4M87A 1GTL1 1VYUA 4EPYA 1OH7A 4HNTA 3AVXA 4JSRA 1AUQA 3OOHA 1PNTA 2XXBA 4IGEA 3ZGLA 2ZGVA 4WZAB 3L6RA 3ADDA 1ELOA 4UUOA 1FNDA 4DA0A 3W1EA 2C2XA 2Z2JA 3UAOA 3ORRA 4MRAA 1FP6A 3WIVA 3ZWBA 4YUVA 4IZHA 1P2FA 1A82A 3G1TA 1ULAA 5HRUA 3ZVNA 4AMGA 4HWSA 4C6TB 2C9BA 2PWYA 1H6BA 5I7SA 1D9ZA 4RF5A 3SP1A 1YA8A 2WILA 3K2EA 3RLFA 2FWRA 3NVAA 3ILXA 3O9MA 5JNUA 3SDSA 1VI5A 1V47A 1OA0A 3ERCA 3TOXA 3K6KA 1XZIA 3RVSA 4RZQA 2CSUA 1JU4A 2EF1A 4QE3A 4CV2A 3T3NA 4MKZA 1DMRA 1QDUA 4OK3A 1NBOA 3V8EA 4K9DA 1Y5IA 2OBMA 1RYBA 3ZZTA 4MLDA 4R84A 2Q5OA 2EYQA 2NTYC 2QRUA 4QQKA 5EP3A 2Q3CA 3PICA 3PC4A 4MAAA 1M34B 1PL8A 1W8DA 5JLJA 3U1BA 2IELA 4DADA 3S1AB 5A4KA 1FDRA 3T52A 1U98A 5HR5A 3X1YA 3IA7A 1XHEA 3Q7PA 1N6LA 3OA0A 5B4TA 2JCVA 3LWBA 1NG1A 1XHLA 3IP1A 1F14A 3LPNA 3MMNA 3P0FA 4MVCA 1WE2A 4FNMA 2D06A 5KB3A 3JU3A 1T5TA 4RKWA 2GCIA 1E7YA 5BR4A 4RNCA 3UJPA 1HE3A 1TYDE 2ATIA 3G9QA 1GGHA 2PTHA 3LSYA 1T36A 1Z0DA 1OQAA 5B4VA 5IFLA 2ZUEA 1X80B 4MV6A 3ZDXB 3MT9A 4A8JA 5C4MA 5FUWA 2G8NA 5AK3A 3ROFA 1C1YA 1UPCA 1Z8DA 2DBVO 2ACVA 3OZUA 3ZNOA 2ACWA 2FFRA 2NO1A 4BJHB 5TJ9A 3ZX5A 4JIGA 1E61A 4FHCA 5LKRA 2O1EA 5J3JA 2XRZA 3PQ2A 3IP9A 1IN6A 2FOLA 4UM5A 1JFTA 5HQJA 3OKAA 4QYWA 5DHSA 1JHUA 3GXBA 3NPAA 2I6QA 2A3NA 1EBUA 1E6EA 3DJFA 3ZEAA 1HRKA 4D42A 1M1YE 2GAFA 4EHKA 1CEQA 2DH5A 1IG0A 2K2WA 3PSAA 5EWMB 5MGBA 3GCXA 1SN7A 3IT0A 5E4YA 2BIFA 2ZJ1A 3BX1A 1E8NA 3X2FA 3BMOB 3CCBA 4H1WA 4LYGA 5ALNA 4GMFA 4HO1X 2YN4A 4PAMA 1EXVA 1ZAYA 2RAPA 3FVVA 3RSSA 1ORWA 1OHHA 3OEED 5EHNA 4J0CA 1KMMA 1Z62A 2G4CA 3CKKA 5FWNA 1M8KA 5DZSA 2NSDA 3BBPA 3HV2A 1W6UA 4F8JA 2XHEA 2I2CA 3VYVA 2FEWB 2BGGA 4XDZA 1DQZA 3HY3A 3CLKA 1E3IA 4I81A 1OVGA 3SIRA 1G8KA 2TMDA 3O7WA 2JI8A 3Q12A 2XYGA 1V4BA 3N53A 2FMKA 3QJGA 5AM5A 3D3KA 2VK8A 3KZMA 2WUGA 2Q8QA 3GR6A 4BO4A 5IULC 4RJIA 5E0OA 1E59A 1H2AS 4EB8A 2PLRA 2PMWB 4JNKA 3G1UA 4YJDA 1QH8A 2SCUA 3HMKA 4I4LA 4FOTA 1PUXA 1E7QA 1AG9A 1QZ3A 5K3DA 5HOQA 2IHTA 1TFRA 3P0IA 2A1TS 2ID9A 4IG4A 4YGYA 2PRYA 1WSAA 3GFVA 4RKRA 4X0EA 1M2KA 2P78A 3V97A 2A9KA 1OFUA 2PGNA 3PYXA 1PJCA 1R9JA 4C5AA 5KSOA 2GEVA 2HPHA 5FNVA 4LC1A 1J2JA 3CX8A 3GJ3A 4EJ0A 2CLSA 5E4TA 4L2IB 4PNEA 4D4GA 1STOA 4D74A 2DHDA 3E5NA 1YR9A 5BYJA 1DX6A 4J16A 2LP4Y 1H4TA 4NQRA 3L6EA 5A06A 4RIGA 1RACA 2BUBA 4FOOA 2KS6A 4UJ3A 2GXAA 3OOJA 4M9SA 1N0VC 2P2DA 4YP1A 5LWQA 1QH1B 3QEMA 2ECOA 4AJ2A 3OURA 2X0IA 1OIVA 5BVGA 2BAGA 4TZ6A 1FCJA 2Z56A 3PFFA 3TJRA 5HGJA 5IU6A 1T5LA 5AK5A 9LDBA 2JRCA 3INNA 1DLJA 3QVTA 4G63A 4JOSA 3ONEA 5K9ZA 3ZKWA 3A3NA 2QENA 3RVJA 4CQMD 3Q15C 1U7OA 2MYPA 3D6HA 4LF8B 1OREA 1E9CA 5DI3A 2CK3A 1NW6A 3TNDA 3H9JA 3SVTA 4FNGA 5FTJA 2VUTA 2ZB4A 2JLZA 4QQNA 3VJLA 1Y48E 1Q1GA 3VA7A 2DU8A 1ZMXA 3AH8A 4IVRA 1P31A 4PR3A 1JE1A 2JEZA 3ECAA 1RCUA 2AG8A 5FOTA 5HS6A 5J2TA 1A9OA 1IM2A 2AN9A 3O4IA 4PZCA 1EM6A 3BC1A 3M5DA 3OA2A 1P1HA 5CURA 4E4YA 3DMDA 3TSOA 3SJ7A 3HCNA 2Y1DA 5CM8B 5T64A 4GM0A 3I2GA 2J9FA 3K4HA 2DPHA 4UEKA 4MR7A 3WYNA 1JT9A 2P9FA 1DIAA 1BX3A 4HD8A 2HBRA 2I4LA 4M55A 2PRJA 1B2LA 4XIGS 5EINA 4UQOA 3ZK8A 1KMIY 3HUDA 3IDQA 3LHDA 4RZUA 1SC1A 1G5TA 3O82A 2CB9A 3OQJA 3LYLA 3SHOA 2BFDB 4AYWA 2NYVA 3G1WA 2GGSA 2PK3A 3JS5A 2A2ZA 2X7HA 1BJTA 1VIVA 4C1NA 5L4NA 4Q7QA 1JEEA 3AETB 3ICVA 3IBGA 1X7GA 1YTUA 2Q99A 2XVZA 4RNDB 5AIAA 1RC0A 2QVCA 4B45A 4O2BA 1ZQ1A 2WLTA 3QF4A 1X7ZB 1Z0SA 2RGGA 4UOQA 5KEIA 4N4AA 3TVYA 3A4IA 4C0JA 2B21A 4X6YA 1SD1A 2R6AA 2B7CA 3SLGA 1T2DA 5DK4A 5KYUA 1DIGA 1SU4A 2XGJA 4UBIA 5ARCA 2IYFA 1NFRA 4NMWA 1TUBA 2ECQA 4NXMB 1W1WA 3HYLA 4JQZA 1MVNA 1EVJA 2ZVQX 1CPYA 3NTLA 4B35A 1PWXA 3USCS 3R1IA 2J3IA 3EGDB 4D43A 2E5LB 3FFBA 3FPFA 1VL2A 1RKVA 3JAWB 1MZVA 2BCGY 3TIGA 3DVQX 1HC7A 5TEVA 5ADUS 2MSKA 4FZ3A 3EVNA 4JI3B 1XZDA 1XDWA 4I3HA 3DA8A 3BT7A 2NV2B 1SGWA 2Y8EA 1VG8A 4EVSA 3S5UA 4HRAA 3GU3A 1PCXA 1SXJA 2DTXA 3AEKA 2VHZA 5ECYA 4CU2A 3EFOB 1T6ZA 2PRZA 3I1FA 1QH0A 1XRLA 2R4QA 3G2KA 1OPXA 2QTHA 4L8FA 3NDIA 3WA6A 5LBTA 2EKBA 2J6IA 1P9LA 1QE0A 1YV9A 4FBGA 4ZQGA 3WWPA 4YRSA 3Q8WA 3GP5A 3V80A 3BA1A 1JXAA 1SQ0A 2J4FA 1UJMA 4IHJF 1E2DA 1FW8A 1V11A 2A0WA 4UAUA 1A9RA 4R8MA 3W9UA 4TWRA 4B82A 1FFEA 5IVHA 4RK0A 1X9HA 3QTTA 2O2SA 1CVRA 1LTHR 5DO9A 5EEHA 4CMGA 1Y82A 4L8VA 4MCIA 4CQJA 2UZIR 2QGZA 2HC9A 1AU9A 4QECA 4TL9A 1H3EA 2Q9CA 4AU1A 1LBTA 3NP9A 1NTOA 1JDSA 2G09A 1Z2NX 4FFVA 4W7IA 1L3BA 1JQEA 1SXIA 2AFHB 2B4YA 3ZU2A 4XVUA 4AQ7A 3GUYA 4D8XA 1JHZA 2Q49A 2P8JA 1SHZA 1LLQA 1DSSG 1G7CA 3LZDA 3ICPA 4Q03A 4PS0A 4D8UA 3OX4A 3GX1A 4YASA 4E15A 4MR9A 5CHYA 3OOEA 3CGWA 5A6SB 1V5IA 3L40A 3RCBA 1DUIA 4AMVA 3I30X 3FCOA 3LP6A 1BCRB 2C0QA 5EC8A 4C4TA 4EHDA 4E09A 1NQAO 4Q1CA 5K6AA 2X2PA 3HABA 4WKNA 3U31A 3IDZA 4HNAA 1VLMA 4G5FA 4JLSA 4AN4A 1FX0A 1L4HA 5HVNA 2IS6A 2ZJAA 4MIKA 2Z6AA 2AR0A 5JDIC 1CR2A 1CQXA 1M7HA 1XCPA 1WM1A 1VZ2A 2V7UA 4PSAA 4A10A 4KR0A 1J2EA 2V9PA 1R00A 3BJMA 5LIRA 1FUIA 4BPBA 3QUTA 4M9CA 2C95A 4QJ5A 4G6ZA 2GZMA 3J7TA 3TJZA 3CNHA 3LSTA 3KT3A 2RI0A 1ZK1A 3DAGA 4QG7A 4YXWA 1L5NA 4ZI7A 5C5EA 2WP0A 2I76A 1AZLA 5EQTA 1QOPB 6NULA 2FJ0A 3F96A 1ZGGA 1DEKA 4ND6A 1TLLA 1HURA 1S6YA 3KAKA 1EX6A 4M0KA 1ZUWA 1AKTA 1T0BA 3FKQA 4PFSA 3TZKA 5CJPA 5KX5F 2Q6VA 4KXVA 2XD9A 4BE4A 2FV8A 2HCRA 4A0HA 4FWIB 4F4IA 4DYVA 5KTYA 4IUYA 4LYAA 3A28A 3CSSA 3EBLA 1EDDA 1Y8AA 5F7JA 2B35A 2EWVA 2GYUA 4D45A 2G40A 2HZ7A 1J7KA 3CZRA 4R3WA 3PVZA 4TTJA 1KOLA 3V55A 4URVR 5KDDA 5IKEA 3IEUA 1R0BA 1QLJA 2TMGA 3NATA 1N0IA 4G09A 5HILA 4JI5B 5HBRA 1Z13A 1S8NA 2NTVA 3MMXA 4OU4A 5ELXA 1NVAA 4WEOA 3UANA 4W5RA 1VIYA 5JS8A 4NH4A 3VVMA 1XSEA 4JI7B 1NBIA 2XMZA 3ASUA 4W1RA 1KJYA 3OUTA 2FWAA 3E4DA 4HAUA 4QL3A 1V2HE 2NU8B 4EJSB 4DYHA 1V8FA 2VJBA 3CF4A 1SY7A 3CRRA 3BK7A 3FUUA 3BMXA 3ELWA 1NQUA 4I8XA 3UJHA 1NZFA 2PU7A 1G60A 4AUEA 3ZJUA 3K5PA 3LPLA 3IIEA 2XOEA 3FZYA 4IMPA 4EL0A 4GE3A 4BC1A 3JXEA 3GAMA 4OAQA 4AJLA 3H9EO 2PZFA 4O29A 3B89A 4GR4A 3G82C 2D1QA 1BFKA 1VM6A 4WVFA 3CMCO 1XRMA 2UZ3A 3ETHA 4M60A 1E63A 3OUUA 4TMWA 2JLQA 3MOIA 5DT2A 4TZKA 1Y7HA 1OZAA 1BVUA 3P2MA 4GRAA 4E11A 4F9FA 4OREX 4QGAA 1RPNA 3CZAA 3R3YA 2J33A 4LJ5A 1C80A 4DEYA 4QOEA 3C3WA 3QJYA 3P0HA 2XUQA 1EK6A 2IPXA 4FHDA 4L6IA 1UBJS 3A1WA 5LSAA 3CC8A 5CM9C 4OI4A 3K6JA 1H69A 4YGXB 3MOSA 4AJNA 1H2FA 1F2VA 1LJUA 3STUA 3M34A 3N2GA 2OBFA 4TL7A 2I4NA 2O3QA 3RSCA 2JFOA 3LDFA 4MRPA 1EIZA 1V1RB 2PX4A 1V5WA 2NSLA 5G4KB 5EXDA 4ID3A 2Y0PA 4BUJA 1VXOA 1H5QA 1N7JA 5KYXA 3AJDA 5FBKA 3RUAA 1FP2A 3G9XA 4DR3B 3OPYI 2ZTHA 1DIOB 2B3TA 1QQTA 1MV8A 2PR2A 3TK1A 3B85A 1MO3A 2OFPA 4ESHA 2O2XA 1IOVA 2NX2A 2QTTA 1V7ZA 2ZJOA 1R0KA 3GFGA 3ZDRA 2RGWA 3N2IA 1G63A 2E4XA 1L7PA 1OLXA 2GXSA 3LKVA 4K0RA 5I7RA 1AQJA 4QVIA 2FH5B 2K2QB 5I7WA 1WMDA 2FW1A 2O52A 3H6GA 4H1UA 3NWJA 1H4VB 1KQOA 1QJ4A 5KTNA 1VJTA 3RIEA 4JYAB 3PDWA 3VJKA 4A6EA 1D5CA 3C5HA 3THYA 1C7EA 2C31A 4E51A 5CVVA 2PUAA 2X7XA 5AIBA 2R0QC 4ZYLA 2ZBPA 2VAVA 5JJ5A 2IBTA 1QKIA 1Z7BA 1PJRA 3MQ4A 4IV0A 2BL4A 2EFCB 3DV0B 2H2AA 3HVIA 2FB9A 4FKBA 1R5NA 3Q3VA 4LQCA 3LCCA 3L41A 2QT0A 2FKAA 1G3QA 4O4HF 3ZQ4A 4MMZB 4WZAA 5D2CA 1NA5A 2BZSA 2Q6KA 3NGLA 2YIMA 3P0JA 2H51A 3U26A 5CLJA 3FOZA 2QVXX 2ERXA 2G08A 3ENVA 4I4TA 2VNSA 2CUTA 1YB1A 2HIAA 3UAZA 4WCFB 4AYTA 1G16A 5CLIA 4RTKA 2P5TB 5F5XA 1MENA 4BC0A 4IDAA 1G4AE 1HEIA 1EU1A 2YKGA 3N6RA 4WASA 2VS1A 4GPBA 4L6CA 5ECGC 3ZGZA 4R7GA 3OJLA 4BB0A 5DTJA 4YDQA 3BB4A 4Q1EA 1X7DA 2BD0A 3B3FA 1CRZA 1R6TA 2NU6A 5BPHA 2XRFA 2XUZA 1R1DA 4JL6A 4C3UA 4W5NA 2C07A 5EKXA 1HFKA 1VBKA 4D6PA 2XKAA 3B8EA 5AFSA 2GLTA 3KNZA 3TCKA 5T7BA 1FPQA 5DJ5A 4RVOA 4E0BA 1M34A 3OU6A 4ACBA 5P21A 2WQ6A 3LQ1A 1EXMA 1OBCA 3P5BA 4ZOLF 3S1AA 3UQYS 3ANSA 3GYGA 4PG4A 5EL0A 2JG3A 4KPEC 2JKVA 2DPLA 2O07A 4GC5A 1DEAA 4C6SA 5L40A 1XXLA 4CHTA 5H9VA 4D9FA 4YCLA 1LQTA 5JW6A 4RVHA 1JZQA 2Y4OA 1JSCA 3L0PA 5H8WA 2CJWB 2OC4A 3ROKA 4C0LA 1DAFA 5JSKA 3O95A 2WU1A 2O7VA 5AD1A 4J9VA 4ARVA 3CLTC 2W8ZA 1PV2A 3EXHC 3QYAA 2W00A 1G0NA 4OBEA 4WNYA 4G56A 3WV5A 4F12A 5KO2A 1U8ZA 1RWVA 5EFOA 3JQ7B 5LQAA 5DXFA 4EA8A 4KKVA 4AJIA 2VQEB 3SZOA 3EXFB 3KK0A 4BRZA 4DLWA 4FDVA 3LT5A 2V4MA 3KV1A 2GKSA 4EBFA 4F72A 1TMKA 1W4BA 2FHSA 1YMQA 2HWYA 2WI8A 5FA5A 1T6YA 5C8XA 1AHNA 2HA0A 3FMVA 1C2YA 1I7PA 2GBIA 2OOKA 3C7DB 3ZE7A 3JQBC 4IRUB 2IHKA 3ABZA 2QMZA 5IWCA 2QX4A 5LR6A 3GWGA 2BP7B 1E3WB 5BT9A 3RHFA 1E2IA 1XI2A 4L3VA 4AKHA 1EVLA 3RVDA 5FUMA 4INZA 3K20A 3LKBA 2YWRA 2ZYGA 3LV8A 4XLTA 1SVMA 3I34X 4DG9A 4BX3A 4KMRA 3SMVA 2N9UA 1Y8RA 2CMFA 5B30A 1JR4A 4MXDA 3AVTA 3WQQA 2QNIA 4PS1A 3ROEA 4AG3A 1ZGBA 2DWCA 1F9AA 4DABA 5LXTA 5B7NA 4HMOA 2QQ5A 3COYA 2H11A 2IU0A 3WJ7A 5HJ5A 5FT9A 1A96A 3EX7C 1S0UA 1QQBA 4MPRA 1W2GA 2D2VA 3WJAA 5KVAA 1TVMA 2PFGA 4R54A 2GF9A 3A3OA 3KUDA 3G0CA 4PLVA 5AI4A 4C4AA 5A62A 4BS9A 2WFLB 4D3DA 1E4EB 2DH6A 3OPQA 4H6XA 3ZCXA 4C0AC 1WHTB 3KDPA 1PZHA 2BELA 4K1XA 1DJOA 1IXSB 4ZODA 2FQYA 4WADA 1UT8A 1Y34E 2I22A 2E3JA 3LOQA 5EY5B 5CK4A 2Q5EA 1J9ZA 4GLOA 3V2GA 1U7ZA 3N5KA 4IX9A 3A6GA 5IC5A 2B5VA 3WYDA 2A0XA 2JFGA 3TOVA 3TSWA 1EFPB 3WR5A 5A03A 4NPHA 3DZJA 4YT5A 4AO8A 1NJ6A 5JS6A 2X4IA 4BGVA 4KQ9A 1V7PC 2VNAA 2HWKA 5EIHA 2IL1A 3ZIAD 4X8LA 1PUJA 3EZXA 2P11A 3ZZUA 4RCYA 1RP1A 3JQ9A 5KYWA 4FFRA 3BH6A 5LQDA 2W2VA 5DBHX 1T1GA 1YB5A 2YVAA 1C1DB 2ZWMA 5TPWA 3KX2A 2DULA 1MDBA 2BF7A 3AHJA 2ERCA 2Y0DA 4CFSA 3ZCTA 1O3YA 1R7RA 2BMAA 2I03A 4Q66C 1A7AA 5M5BA 3D43A 5EGSA 3DF7A 4R8VA 1XRSB 2KB0A 4CU5A 4EY3A 3OZCA 1EQUA 4XQEA 5JYDA 1XLTA 2HMYB 4FS3A 1UJNA 2KPOA 4DB2A 3E58A 2V4UA 3PP8A 5C31A 3PNSA 5CGQB 3RYFB 5H68A 4I5GA 2BHNA 4MGKR 5J1TB 3U1TA 2HV8A 3V4FA 1SIWA 1Z0KA 2F4NA 4DMRA 5E2IA 1K3FA 4M0DA 4YCCA 5LMUB 1KR5A 5CA1A 4MS1A 1J07A 1SCIA 3IVXA 3KPUA 5E6RB 3T9AA 2PSJA 3QBTA 4M36A 3NV9A 1L7DA 2GVNA 2CNBA 1U8EA 2PSEA 1WUJS 2HSDA 3I01A 2PJDA 2IRWA 2YXLA 2ZRGA 2YY6A 1P4RA 2D8MA 4YP5A 3HM2A 4ZCIA 1PL6A 3M70A 1XZBA 3L0CA 3L1JA 3R9IA 4C0BA 2VAXA 3NONA 4B3FX 1K5GA 1G8YA 1W87A 2VOJA 2AEJA 1FX1A 3LXXA 3OD1A 1DGQA 1IBSA 1FU8A 1OXTA 4EMTA 5LM3A 2WE7A 1EP9A 3SBOA 1G20B 1NE7A 4O2AF 2BFDA 4LJLA 4G5XA 1CLEA 2O3SA 4TXNA 4EEKA 4D41A 1J0BA 2JD0A 5E1BA 1YWGO 3QPWA 5KTMA 3AETA 3CGGA 2I3BA 2NO4A 1K9VF 2XWPA 2B2XA 3NBXX 3WGGA 4DM4A 5FPKA 1XXHE 4WNAB 2BV3A 3ASZA 3RIYA 3JTEA 1U9IA 2F7SA 1DEHA 3KR0A 2ZRQA 4OQNA 2QSUA 5IJ0B 5KZMB 4XVHA 2IV3A 2NYAA 1URPA 2HXGA 4RL4A 2DZDA 3TRJA 5AW5A 2RD2A 2WPNA 4KWIA 3VZBA 4ZT3A 3AWDA 5FULA 3KFVA 4LXUA 3I9FA 4RIFA 4WBNA 1Z26A 2XUPA 1SXGA 3IP6A 2OPHA 5KJCA 3WMXA 3S70A 4TROA 3DZFA 3IVGA 2R6JA 3GJZA 4O1HA 4YJHA 5COAA 3CVXA 1XQWA 3FMGA 3I62A 4WX2B 4BN5A 3F7OA 5J1SB 4BEWA 3FTDA 3JAWA 4G0YA 2B1JA 2OM6A 2H1OA 1A8UA 1X14A 4KQJA 3V2IA 1ZK0A 4LYDA 1NHGA 2EQ5A 2IH4A 2XH8A 2ONYA 4LSMA 3E61A 1VC2A 1XK6A 2ZREA 4Z9AA 2Q27A 4A23A 4DLBA 3L4BC 2C5FA 3E3MA 3COVA 3H5LA 3GNLA 3LLCA 5CH8A 5AJXA 2CL7X 4ZAYA 4Z1MD 2R00A 2VTBB 4V39A 1WB6A 1V6SA 4EG6A 4PIVA 4OP1A 4ES6A 2QTMA 2FWMX 2YV2A 3OBIA 1O0BA 1GRNA 2X8AA 1OI2A 1UXGA 1VE9A 2C5AA 1UKYA 1XZKA 5EWLB 5B5SA 5BV7A 3SFZA 4DQDA 5C1IA 3B6EA 4LHEA 3R0VA 1IN1A 1PSDA 2FPPB 3RAEC 3CVOA 2FDXA 4X3OA 5BN5A 2O8FA 3QOWA 1UC9A 2VHJA 4HRXA 1HDZA 3PX2A 5D84A 4ENPA 5HQ3B 3V00A 2OVBA 2HAEA 3W4JA 4KMOA 1K8YB 3DCIA 2Q0QA 3D4IA 3W5HA 1TZKA 1RRVA 4IWYA 4HF7A 4LTDA 3KYCB 2O8EA 3L0DA 1OJLA 4I66A 4DL9A 2ZCJA 1SC6A 1CZNA 4UARA 4YCBA 4Z7OB 3GA0A 1F5SA 2JIMA 4K2HA 4YMSA 3BH7A 2EV9A 2OPBA 4MV5A 1NV9A 4S1VA 5DEIA 5J5AA 3W7AA 4EHIA 4QREA 3GG9A 5K0BA 4HJXA 2WFAA 3GD5A 3RYCB 1ST2A 1M2EA 4D26A 1BFDA 3ENQA 4DQXA 4EJMA 3U19A 4QFDA 1FVFA 1I1HA 3KO8A 4PF1A 3N28A 4Q3KA 1ZBQA 1IWPB 1ZD8A 3UAGA 3U62A 2EKPA 2OVFA 3EIOA 2X8LA 4Q7JB 4RE5A 3GCGA 2C83A 1FFWA 2I1QA 1WXHA 1E9RA 1YRHA 4LECA 3H5OA 5CB0A 3ZDEA 1LZKA 4BO2A 1KAEA 4DXDA 4WZBE 4HCJA 2Z6UA 4OM7A 4JT4A 4J4HA 4YJ3B 1MB9A 1DBRA 2P1ZA 4COOA 3VNSA 2GETA 4TGLA 1QWSA 2JJQA 4ZK6A 2PUDA 2PUCA 3R7BA 3KCQA 4C2UA 3R3UA 3ADKA 3E9YA 3OX2A 4HTFB 4QODA 1U28A 1EIWA 2J59A 1NXWA 1U2DA 3G5TA 2V3WA 2VPXA 5HK9A 5JPDA 3LQRA 4FFWA 2VA8A 4KP7A 1I7LA 4CFYA 3HDYA 1YBFA 1BMFA 5P8WA 2C1EA 2WFZA 3MTJA 1LU9A 2JBAB 3CNBA 1Z5GA 2H2GA 4GQBA 5DGHA 4C0QC 1NL3A 1RWOA 1IHOA 1PKEA 4UUBA 1B8VA 1K6EA 3HCBA 1QIJA 3BJIC 2VCYA 3K94A 2PG3A 4CM5A 3HDHA 4PZEA 1YQGA 2C82A 3NBQA 3OZWA 3LA8A 4ICIA 4L57A 5AKHA 4AKTA 3ZVKA 2D5IA 1AKQA 2VF8A 3QVGA 3INGA 4H6VA 3W6NA 2VH2A 3WZ2A 2DY1A 1V9LA 2IHZA 1IB0A 2VQSA 4ISBA 3VTKA 2I91A 3F9RA 3KZCA 1MBZA 2IYOA 4U2EA 1MJGA 2XUFA 4WD3A 1RPTA 3VYWA 3MQFA 3INYA 3W3AA 1VSUA 5EZ5A 4EJSA 5IN4A 1WBDA 2ZZNA 3CPEA 3IUEA 5AI0A 3ZK7A 1GV1A 2NVOA 1GCAA 4JJ6A 2ANBA 4ZJYA 4TKVB 1LV7A 4Y2XA 3DXYA 1NIJA 3OQ1A 1SKUA 3OZXA 2ZK7A 4U2DA 4OYRA 3OT5A 4N5MA 2ZR9A 4XQ0A 2BBTA 5TEWA 2QA5A 1WB5A 1YR8A 1J97A 1LDNA 4OHBA 1LW6E 1NP7A 1ZUNB 2Z30A 4HYQA 3ZQKA 4BMNA 2O3UA 4MYRA 4HAYA 1WWKA 1WUTA 3WRXA 4EEXA 2NUPB 4J03A 2AJDA 5K20A 1RDFA 1OAAA 5C7YA 1EYZA 4M0CA 4M88A 4LC9A 4R68A 3HEAA 2UVQA 3UMVA 4ND3A 2D6FA 1VPWA 1N57A 4B3BA 4YYZA 1KJWA 3NHJA 1NN3A 4BQRA 1O54A 1ZCBA 3IQGX 2NZJA 3GUHA 4UU0A 4RVUA 5AI5A 1MW9X 1LS1A 4N65A 2I6FA 3LY5A 4PSVA 3VPHA 4LHYA 1M2GA 3KM0A 3I73A 2QRPA 1CERA 4WI1A 1KYWA 3FMOB 4ZVRA 2BBOA 2HQRA 1JG6A 2RHGB 4FJ2A 3TJMA 4YMIA 3OU7A 2QW1A 3S2FA 4UQLA 1XVUA 2F00A 3A4TA 5JSYA 3AJ9A 3BGIA 1GPBA 3V4VB 1V1RA 1GPKA 3IKVA 3GGPA 5G4KA 4UVEA 2CVPA 5K51A 5M2QA 2XJ9A 3PR3A 4BKPA 3LCJA 3OF2A 4M0MA 1OXXK 4P0PB 1MU0A 1Y0BA 1U0FA 4XQ9A 4CQNA 1YU6A 2EJVA 2GCEA 2V7XA 4I1YA 4E5PA 3JD4A 5HM8A 1TC1A 3V8BA 1HE2A 3E7PA 3NW9A 1F60A 1HA3A 3LMKA 2EEPA 4NP6A 2Q4BA 2EDCA 5IM5A 4EENA 4AQYB 2X15A 2GASA 2Z57A 2CFOA 3O4HA 2QPLA 1PWHA 4U2CA 1XKTA 3VR0A 3WLMA 3WIDA 4BFSA 1NG9A 5CTAA 3MJHA 2G71A 3MB8A 4V2IA 4PBTA 2XXAB 1CIPA 1L3CA 3K9HA 4L4UA 3E27A 3QWBA 4G24A 1FZQA 2FLKA 2CD7A 5E4JA 1U94A 3T3EA 4Q4CA 5KWVA 1E79A 2DQZA 2IUTA 1GGNA 3ZWKA 1Z4MA 4BMOB 3A0RB 1LVUA 3PJGA 4JEMA 1QSGA 3GGDA 3M9WA 4K05A 4EX7A 3RS9A 1D09A 3P9RA 4GP7A 4INAA 1RPZA 3EGXA 1EVZA 2NV6A 2R8OA 1JSRA 3LQKA 4R41A 3HR4A 5IK2D 2CVZA 4ZCTA 1E58A 2EXXA 4CMJA 4JR1A 1S2OA 3AKDA 5CT8A 1N3IA 1VMDA 2D0DA 3GEGA 4XSGA 1VE3A 2POQX 3AQIA 2C2GA 1RIFA 4MTCA 4IXMA 2BRUC 1FRZA 4X44A 1PQUA 4MKXA 5IAGA 1KWGA 1T34A 4Q9AA 4RD4A 1G5HA 1WVIA 1Z9BA 2VSFA 4I6JA 3P71T 4JJ7A 5BQPA 5ESXA 1FYEA 4D9JA 1OX4B 4PU0A 4J1NA 1JJBA 4DHEA 2NVBA 1SZJG 1NNUA 2PBRA 2A1IA 4AXBA 4EA9A 1YB4A 2PEZA 5SY9A 3ZDCA 2D54A 3UHOA 2P9GA 3ILHA 1FLDA 4DNPA 1WABA 3HXKA 4TQ9A 4QPDA 4OK5A 1N3YA 1L8XA 4KRGA 1FDIA 3EQ8A 4WCVA 1XA3A 1UBHS 2GSWA 3QUQA 4TSFA 4LWZA 1SKMA 2I3ZA 3CJQA 1HQYE 4PSCA 1QUFA 2I66A 2VDNB 2AK3A 3I23A 4EEZA 3Q6MA 1XKLA 5JSFA 5JC1A 5FH9A 4BO6A 4REQB 5D6NA 2NZUG 5AVKA 3Q0TA 1GZHB 1Y98A 5ECWA 1WB9A 1GG2A 1SK8A 4QOIA 5EUBA 3Q7IA 3QEKA 4IIJF 3B2NA 3AW8A 3BHMA 1IY9A 4PWZA 2GYVA 2ZJZA 4PTZA 1ZD3A 2Z4SA 3EVDA 2BSAA 2Y1GA 1FXWF 4DLTA 3HZZA 2VRWA 2F1HA 2G28A 1RI3A 3AFGA 3ROMA 3VSCA 2YW9A 2CJWA 3DFIA 5JD6A 1KYZA 1IVNA 1BE0A 3VR6D 3WXMA 3VX4A 1OY1A 1PS8A 3C4JA 3PNVA 3AUXA 2H5EA 4F5ZA 3HXOA 4L27A 4M9RA 4R71A 1N77A 3F7MA 1S2IA 4BFCA 3RSOA 5C8VA 3HBAA 4JKIA 5B3JA 4QFBA 5IF9A 4L5AA 1CU1A 3EYAA 3OP1A 1PJSA 3OEYA 4OLFA 4BO7A 1M1XB 3LIIA 3EXFA 3EXG1 4P4NA 1QGDA 2GPYA 5FD8A 4F0JA 1XAJA 4DEXA 1K75A 3Q41A 1IJFA 1QVRA 4F4FA 4I1VA 5JE8A 2FUG1 4AAYA 3TL6A 3AC0A 3ZCPA 5BV1A 5I7OA 5K8VA 2PS1A 3W0LB 3JARB 2CMGA 4BX9A 4MPTA 3A1EA 3AX6A 2FMHA 4I55F 4QTUB 4LNUB 4JLDA 4AF7A 3AR9A 2DQKA 3EZNA 3O94A 3JAKA 4OHRA 5CYOA 3RFTA 2JLYA 4UE2A 4P4TA 1TTQB 2OYSA 2H8GA 1HI9A 3DS8A 5D85A 1R0LA 3E9DA 2WJVA 5C8DA 3FRIA 2ZYAA 4S1PA 5BSRA 1PR2A 2JFUA 2DQYA 2EFHB 2ZYSA 3LUDA 1QYVA 4X54A 4BZWA 1A7KA 1RR6A 2LDXA 1Q1ZA 2LIVA 1OB2A 1M66A 3W78A 4IMIB 2JGNA 4D57A 1CY0A 2PSDA 3M1LA 1P7WA 3GFQA 2OFFA 1EFVB 4JS0A 5FTLA 1MABB 1E1RD 1ESCA 4DR7B 3CT4A 2QN7A 3QV1A 2X0DA 3Q7RA 4ZDJA 1TT7A 5H1YA 3ECSA 5CDHA 1GNRA 2I2BA 4B4VA 4CL3A 4M83A 3OZ7A 3GZNB 2A5GA 5ESRA 5KINB 1OH6A 2HPVA 4B3MB 3HBMA 1WZUA 2ZBUA 3DZIA 2FSGA 5DM4A 3QKTA 4BMZA 2VDMB 4UW9A 1PDWA 1PKXA 4MIYA 5D3MB 2FQWA 2PPLA 2WSIA 4V0MA 1KAGA 3LIPA 2AQHA 4WA8A 2R1VB 1CUSA 4JHLA 3KT0A 2GHRA 2HUPA 2R8BA 5H9WA 2REOA 2P7IA 3P4XA 1Y9DA 5K3FA 5AW8A 3CBGA 4P4SA 1ZD1A 4MULA 1ESNA 1NJ1A 2EZUA 2BFPA 4JJEA 4X94A 1L5KA 3CEHA 4MDHA 1YIDA 1GITA 1P44A 3DMGA 1KFBB 3GGOA 5ARDA 3RQIA 3R7SA 1OBOA 4WFKA 4IP0A 3R6GA 2AEFA 3MBKA 1PEAA 3WL8A 1E3EA 2DBRA 1PWZA 2WWTA 3OKCA 1HH4A 4NZ9A 3DEYX 4JZYA 5IDXA 1IIBA 1KK0A 4XJTA 1YI0A 4FZJA 1T2VA 1QYRA 2RGXA 4HFNA 4R51A 5FDFA 5AKZA 1U3TA 1U8AA 2QN6A 1TKAA 3G85A 4RXUA 2MYUA 2ZB8A 2XTZA 2Q2WA 3PK0A 5JISA 3FTQA 2IYVA 4TWAA 3MCWA 4WJLA 1MNQA 2ZSEA 3X1KA 4NS1A 4NCKA 3WTBA 3IPYA 3V32A 1I36A 1H23A 4DAOA 2HO4A 2OHHA 5DW3A 1PUIA 3NYWA 1IDOA 4DJAA 1ISJA 1MW8X 2Z1NA 2SHKA 1PBNA 1UBFA 2JJ1D 4C0WA 3BD7A 4KO3S 1LBIA 2VK1A 2J0EA 5A5FA 3IQFA 3REOA 1W93A 4JP3A 4EYQA 3ZE1B 3RYFA 1L4NA 4IF6A 1NW8A 4UNNA 4G0WA 4HLNA 4DV3B 1EQAA 4HATA 3H1AA 4TLAA 5HPYB 2P2LA 3G2PA 1A0OA 5JADA 3O4GA 5EJMA 3F7NA 3BWCA 3IBTA 5JR3A 1GPMA 5KREA 5HQTA 4UNIA 5E6RA 1RYFA 1C8VB 2YJ3A 3K05A 1B15A 4OQMA 3PGXA 2GPBA 1QMGA 4I1SA 3HYCA 1GGMA 1YZQA 2W58A 3K15A 3GI1A 3SGLA 5EHQA 4US1R 1WR8A 4B7ZA 4F6LA 4B5LA 2XE8A 3KJQA 1XJ5A 1B8UA 2R6DA 3OT1A 3LFTA 3SEQA 1Q15A 4MW1A 3FUCA 5DWQA 3JZDA 3MUEA 5KYKA 1T9DA 4Y1FA 2QK4A 2FX2A 2W90A 2XE7A 2GQ0A 1UT6A 3BTOA 3LDHA 4GQIA 4KXMA 3VHXB 1OLOA 2YFKA 4G5HA 4H31A 4DJEC 1KAHA 1NBHA 2W6IA 1WTCA 2O9JA 4KL8S 5EYPA 4C3ZA 5ERYA 1DAPA 2GBLA 3K9FC 3U81A 4BGIA 1MKYA 1OXKB 4G0OA 2LUOA 1E18A 4JA2A 4Y2PA 3WL4A 1OBHA 5C4GB 4FGSA 1W88A 4TYYA 1LI7A 5JYBA 4XOUA 4D0NA 3RVMA 4WKPA 5BN1A 2ATCA 3I2KA 3LHIA 2B0JA 4GMGA 4NIMA 4IDNA 2HW8A 3ZC3A 1R2QA 4FCVA 4HI0E 3DEJA 3IODA 4Y7CA 2HRQA 5CXQA 4QGSA 1JVSA 1GTZA 1JAYA 1O96B 1S3FA 3IQEA 3LVQE 4ERNA 2UXBB 2O59A 1WW8A 1QG6A 1E1KA 1PNVA 4RETA 2W6CX 4Y2UA 4CG1A 5K8UA 2HCTA 3AF2A 4H7IA 4BNJA 4OO3A 1I14A 4WPGA 4N3BA 4CG2A 1BG6A 3H1PA 3TX6A 3GNQA 1YS6A 2YNMC 2W98A 3HYSA 4ESVA 4AK9A 1AMNA 2ZUBA 4M1OA 5B3LA 3T95A 2FPGA 2OSVA 1P0PA 1LC3A 4D2IA 3IDOA 3OM9A 1MO6A 5DISB 1PJTA 3IQXA 1FNSA 2A9PA 2BKEA 1N3BA 1Z33A 1XJ0A 3DOOA 2FSVC 1BFUA 3UGJA 1Y7TA 4B32A 7GPBA 5AVZA 4LF5B 3FYUB 3LXRA 3IMFA 3RWBA 4X6UA 5AM1A 2H1RA 3K8QA 2BR5A 3QMVA 1IVSA 5K3SA 3IEKA 4UVIA 5AVRA 1AQIA 2FUCA 2EBFX 4CQMA 4G25A 1MC8A 4PNPA 1QYCA 1DFIA 2FPPA 1FP4A 3CIFA 1ZZGA 4FMDB 4LZJA 4ZWNA 3W04A 1SB9A 1Q1EA 4CI0B 1M6EX 1O1YA 4X60A 1I24A 4K8RB 1NFQA 3ORQA 4KXWA 4IY1A 3RFUA 1JDNA 1VBFA 2J4DA 3PVCA 2CDNA 4HSGA 4PZPA 2NTNA 3LCUA 5KVCA 3D3WA 3ZHXA 1I2MA 3D7SA 1QZTA 4RZIA 3HN6A 1R12A 1WXDA 1CLUA 2YFHA 1ZJJA 4RK7A 3GLFB 2GM4A 3MIZA 4CGYA 2NZWA 4WLOA 2OAGA 2VZLA 1FMCA 2QDXA 4L3WA 1SCDA 4ROSA 4WVLA 4XKJA 2FU5C 2P4SA 2OCGA 3CT6A 2INGX 1L7OA 4NOLA 2H2FA 4KXNA 1WO8A 2YHAA 3ZHBA 4DDUA 1OWLA 2ADOA 2GWRA 2HA5A 3EZ6A 4TT3A 5IJXA 4AJOA 1P0CA 3EAGA 2CUKA 3FYSA 5JSHA 2JHGA 2AZ4A 1CJVC 1O2DA 1XDUA 2WF9A 3TRHA 4MMYB 1H0KA 1HYQA 2H8KA 1L5SA 2VT3A 2P67A 3LNCA 5FNZA 3UOWA 4ZYWA 2WBLC 1TD1A 3SI7A 3ZHTA 3KBBA 4JLJA 2C4KA 1ZKDA 2V6FA 2D13A 4AWBA 4JCCA 5G3YA 4ZCRA 5SV2A 5DXAA 4GXNA 1Y7IA 3DBLB 3TF5A 1HDEA 3STVA 2WABA 1B0PA 4OHCA 4LBWA 1I7SB 3O92A 5CJ2A 1VTKA 2WAMA 1BZYA 2AB0A 2BLNA 2HRZA 2YS6A 3E9ZA 4Y3UA 1WDTA 3VAZA 4G9BA 1AC5A 5I4KA 1L4LA 2QAGA 1ZNYA 3L6CA 1DVRA 1ECFA 4EH1A 2I2WA 3KEOA 1U7DA 1WOMA 1ZONA 1Z73A 5GOZA 3DD5A 3CLHA 4C6RA 3O2SB 4NF2A 1Z4LA 1A1SA 1RCTE 2BFBB 3CA8A 4ZT5A 1G64A 3JQRA 3KOOA 1AS0A 3MTBA 1Y1LA 4U3JA 5ES4B 5B1EA 1SHLA 2IC5A 2WAYA 3HNPA 1JV2B 1X92A 1TVCA 1RABA 2WJ6A 4RMIA 2J5RA 4AZ0A 1UMDA 4D5EA 3A7DA 3RQSA 4HUTA 3FI0A 1N2BA 1KSJA 2AG6A 4IVNA 3NXKA 4NYMR 2HCJB 1K7SN 2XA2A 4KBYA 5G4LA 1H22A 3DR5A 2UDPA 5BQ3A 4D82A 1DKPA 2ODNA 3M6WA 1I7QB 1J56A 3U5ZB 3I04A 5DCYA 2BISA 3ISTA 4B6EA 1SOVA 4TKVA 1F4LA 1LSUA 2YHSA 2MSDB 4Q05A 2J9GA 2KBFA 3RUIA 2RAVA 3W7VA 5I7FA 3C6QA 1KYYA 1D7AA 3COSA 3AR8A 3GVXA 4MKFA 3CKLA 4N5LA 1PJBA 4TXLA 1DKOA 4R1LA 1QO0A 1AQUA 4IIXA 3RVQA 4HNRA 3FCCA 2MCFA 1TEZA 3E9CA 1AJEA 5FNVF 5BWLA 2GNOA 1OZFA 4MGZR 3WBBA 4DSNA 5CUQA 4WDQA 1TM3E 3DLAA 4ZO4A 1EZ1A 2DR2A 1K7EB 3CBQA 1K6MA 3I9V1 2WHRA 2YJZA 3HG7A 3L8YA 3JATA 1UMCB 2QPTA 2VTDA 3TO5A 3VYUB 1MQSA 2XUIA 2C4NA 4XR4A 4Y98A 3R9XB 5HS4A 3ZLJA 3A6PC 3U4MA 4O1IA 3V8PA 2D7DA 4JLUA 1Z6AA 1DPGA 3HPRA 1SZDA 4YAFA 4S12A 1LDGA 4YJ2B 3Q1KA 4YAUA 2XLBA 3UICA 4C0SA 1AF4A 1JFFA 2ZW9A 4CF3A 4M0FA 1Z0AA 4ZD6A 4HDSB 3UJDA 4ID9A 1CF9A 2O2EA 1U7WA 3KJGA 1FFSA 4OB6A 2DLDA 4MICA 1TM2A 3BDIA 1ODKA 2QZPA 4OJNA 1NF2A 1VE5A 5JS7A 4AROA 2ZUVA 3C3PA 5PGMA 5IT4A 1E9FA 4EQZA 2AA3A 2X40A 3B70A 3ED5A 3HCAA 3RF6A 5E9JA 2FFBA 2YVLA 4A36A 1CKEA 1U81A 2V98A 3HFSA 1O08A 3BORA 1TLFA 2JH9A 5J2TF 4CIAA 1HFEL 2C77A 1ZNQO 3CVWA 3J80A 2IS4A 1P7VA 2WWWA 4FU0A 3U16A 1M1YA 1MJHA 1TVEA 2QVYX 3H8VA 2NQTA 3OFND 1DIRA 2O8BB 1HX7A 3FWKA 1R8YA 1XL0A 3IELA 3ZBUA 3WYAA 3VR4D 4B4WA 4KYUA 3S1SA 3Q1LA 4Q15A 4KTVE 1JPNA 2WKWA 4W63A 1TIPA 1TYEB 2PFSA 4F3RA 1IRXA 5JATA 1GU1A 3GA7A 5TARA 2VXOA 2HMVA 3L04A 1U4OA 5AWFC 2UVDA 3V1YA 1Q12A 3PDUA 2FDRA 5FHQA 1IHDA 2ZYDA 4R7TA 3L1VA 4MWSA 3FUXA 3LWDA 3QBEA 4TL6A 3QBDA 2GDJA 4D9KA 4R9VA 2X5KO 2X2EA 4A0RA 1FTWA 2C2ZA 4Y9DA 2KLBA 4MVJF 1D3AA 5BWBA 5IZCA 4O2BF 5HK8A 1B93A 3NWBA 4BPRA 3OUZA 4CEJA 2FVXA 1VB5A 1UWKA 4QJ4A 3KVYA 2YMPA 2M32A 1U3VA 4MA0A 4NTZA 1YIAA 1YAHA 1HE8B 2A57A 2JGMA 3I37X 3IDSA 5COQA 4ALJA 1H1TA 5LZ4A 3WLOA 4D3YA 2PKQP 1RS0A 5DX0A 2FW0A 2ZCVA 1M67A 4TSRA 2FUG6 4HY3A 3MXTA 3I61A 2QL5A 4OL9A 2P5SA 3ICWA 3TIXB 3EPHA 4IYRA 3B51X 2YINC 3R74A 1BRTA 1NPDA 4BN0A 4IIVA 1E2GA 2RHHA 3ZCSA 4IHKA 4Z0PA 3H0KA 1T5DX 2IQ5A 3U44B 3AHFA 4O4IB 2OBLA 3B9RA 1UMBA 2ZJ8A 2LXNA 3NGMA 4L08A 4OBWA 5EJIA 1SD5A 2WC1A 3CRQA 2IEYA 3EQZA 3I8SA 4OJQA 3NCHA 4A2WA 3LX6A 1H6CA 3MN1A 3OFKA 4TX1A 1TO2E 4BDTA 2YMMA 3F6PA 2BLLA 4KLAA 3BJRA 4IIBA 2ZQZA 4REQA 2OYCA 4DV6B 2W8BB 1LW7A 1GNTA 3FPBA 3N6XA 5D01A 4XRGA 1LPMA 1JKXA 5DEOA 5HEKA 4NHEA 1GGFA 3UJAA 2XDWA 2ZUCA 2W6OA 3RTCA 4ECEA 2RC6A 2D3TA 1S2NA 3KQPA 1MRZA 2DUWA 3I2IA 4A6PA 3U56A 4LF6B 5CH5A 1VB3A 1YDWA 2BMJA 4G4IA 2FKNA 4L0MA 5EZYA 5JY1A 5E7JA 4W8HA 2VPYA 4H17A 1AXEA 4HB4A 2QM0A 3OFSA 1U0EA 3RC7A 1ZWKA 1U65A 5FI1B 1NBME 3IALA 4JR0A 1Q1AA 3TTSA 1ZR2A 1ZH4A 4EPTA 2EX1A 4YONB 3PC8C 4GOOD 4B6FA 3CJTA 1IBMB 1F9EA 1UZMA 4QOJA 1XF1A 5F1KA 3DDOA 3H1BA 2WYIA 1Y89A 4MVYA 4KQIA 2WTMA 4CEHA 1T3LA 3QLUA 3SCZA 2YZGA 1GZ4A 2PR7A 2WU4A 2RJOA 2DUJA 1QIHA 3AR7A 3DOIA 3PDIB 1YKSA 3Q5EA 4FYKA 1L8QA 1JXQA 3H0EA 4JKYA 4TKUA 4AMZA 2HHHB 1UBKS 3OC6A 4J0GA 2XW6A 5AMXA 1N0UA 4Y1RA 4DMMA 4ZT7A 1V6CA 5H3CA 4KPYA 2CLIB 3C3EA 3KQYA 3QELB 1IONA 4ZCMA 3V7YA 3L7JA 3F5FA 3MLEA 3OZAA 3OHSX 4XGIA 4X64B 1WW2A 5LQSA 4TT8A 1SEVA 2ZYHA 1RXSA 3PNLA 2CZQA 4EECA 4ZI7F 4LF4B 2Z9DA 1EFVA 1KBZA 4RZ3A 1MABA 1SUWA 1DT3A 2ZI4A 3CZCA 2BBSA 4K6KA 3NHWA 4HFRA 1EVEA 3LTNC 4D3FA 2QUIA 3PR1A 2GMWA 1MG5A 1RQXA 1XXHB 4JVLA 4C0XA 3HXQA 2QTGA 3PPIA 1OXVA 4R2KA 3AL2A 2PMBA 3R40A 2HLHA 1S8AA 3U3JA 1DTEA 3DGEC 1ZA1A 4OPMA 1TGYA 4HP8A 4U2KA 4KH1A 1JIIA 2QN1A 1NZJA 3MT7A 3UHPA 3KCNA 2ZR0A 2JI7A 1FDWA 2CXHA 2R1VA 1SHTX 4MV1A 3SX4A 4ARZA 1B43A 1FFHA 1YDMA 4F86A 3HCDA 1SQ6A 2UYCA 3KE8A 4EMUA 4KPUB 5B2FA 5HRCA 4Z6KA 5A2GA 1ECPA 3V9AA 2X9VA 4JB8A 3UMYA 2AUMA 1V8DA 4NBVA 1IATA 1CE8A 5DK6A 1XRRA 2IV2X 1YCDA 3HO8A 3M0EA 3OWXA 2PNJA 3VC1A 4C22A 3WYFA 4MV4A 1REQA 3GDWA 4KYVA 2EERA 3K9LA 5DWVA 2DCMA 5LD2B 5IS2A 1UPAA 4GVPA 2VP9A 1M2JA 4FYXA 1CC1S 1P0MA 1LBQA 5JARA 1Y1QA 3AF1A 4BZXA 3B12A 4NFYA 1OROA 4RJ2A 3ZS9A 1T4BA 3T1HB 4WJZA 5KYYA 1OBVA 1U0TA 3AU9A 4IZOA 3PKZA 4C29A 5AHRA 2ET6A 2WF8A 2W2MA 3C4VA 1YK1A 2QGFA 3HB9A 1VLQA 3LCMA 3O3NB 4UHBA 4DREA 2A7XA 5JCOA 2F8LA 4FYIA 1AB6A 3ID6C 4I1RA 4YAJA 5JDCC 3SQLA 2CUNA 4II7A 5C7IO 4N3NA 2GJAA 3PRHA 1LPSA 3R4VA 5TT1A 3WAJA 4NWIA 2I99A 2P62A 1A5AB 1GRQA 4FXPA 3R3JA 1JA1A 1X7WB 5F33A 3KSZO 1N6RA 3K8YA 1V1JA 2JCYA 4J0IA 2MOKA 4JGIA 3BFKA 4EMBA 3BWMA 4E94A 2EKDA 2C0CA 1A4RA 1WZCA 2OQIA 3EZYA 4E2YA 4DUPA 2OXCA 3O74A 3C6XA 2E82A 5F5NA 1R4MA 1G19A 3DKIA 5DTMA 4M76B 4XD7D 4Q3NA 1TCAA 4LE1A 3L07A 3G02A 4QLOA 1M2VB 5TT0A 4RTRA 2OGZA 2IXAA 2CWWA 2PRSA 4A82A 4ZV4A 1FDUA 4QRDA 1QCDA 2QX6A 3CHYA 1BN7A 2JIBA 4Q18A 4Y6OA 1OTXA 3ONNA 2OXTA 5F21A 1BE6A 1E98A 1NVFA 3FPEA 1KEUA 1SVNA 2PX8A 1DJQA 3KZKA 3SZRA 1JHYA 2JIOA 2AT1A 3TI9A 1YVEI 3WYBA 1WNTA 3H4MA 2H54A 2WD9A 2ONJA 3ZU4A 3K6RA 4JLOA 4YCAA 4WXPA 2MJLA 3DEAA 5CB6A 1Y4UA 2VJOA 3FNBA 2WOOA 1DDIA 5CW2A 5EN4A 1Q3HA 2E55A 4WZBB 3VHXA 5BUQA 5U9CA 1I9CA 1RSZA 2WTEA 3HZOA 2XYVA 1ZUHA 3NYQA 1C0LA 1PJZA 3B3GA 3P27A 1XQ1A 1B76A 4RHYA 3DKRA 4TTTS 1IHPA 1U0NA 2AF3C 4HTAA 5BUSA 9MHTA 2DFPA 4GPZA 3BZWA 3QKRA 2YZ2A 2XJ4A 5BQFA 3DFKA 4QO8A 2BJWA 3RKSA 3ZW9A 4BWGA 4RJJA 4NNPA 1NY6A 4RS3A 2DXIA 3E9EA 3IHTA 4RYLA 2F1RA 1QX4A 2C8KA 3MPUA 4LCEA 3VZQA 2ACKA 2EOAA 2ZAOA 3AHEA 4HYEA 4ERXA 2BFEA 3NIGB 4C7OB 3KG2A 3QBJA 1S9HA 4LN1A 3VH1A 3ROZA 1RKUA 4X62B 1QO9A 5CX1B 5E6SA 2PX5A 4CDNA 4KO4S 4HQFA 3LUFA 4FC7A 2BFFA 2B92A 1RQRA 2DLCX 5JNTA 3MJTA 4RA9A 2OYRA 4I4TF 3PX7A 5JHHB 3BM5A 3D6JA 1DWUA 1V3TA 4C88A 4R1PA 3QYFA 3EIEA 3MWKA 5DH9A 4D02A 2ISQA 4LWPA 1M6YA 2AXEA 4GZMA 1GUDA 3B1JA 1GPWB 2IY7A 5J63A 2O6HA 1N0WA 2AIRA 2JL1A 5DNDA 4UDNA 2E4AA 3KHSA 2PUHA 3T94A 3W5UA 1VHDA 3D6NB 3W3AH 1TF5A 4JGBA 4JX9A 3D7LA 4FZRA 3NAQA 2W37A 1P1KA 2BFAA 5IUKC 5C7LO 1W0KD 4JX8A 3H6KA 4L15A 4JLKA 3QEJA 4FYVA 5EIXA 1GAQA 1SCKA 5HGXA 1NUAA 4KO1S 1LLDA 2X0RA 2YICA 2ZBEA 5FORA 1Z25A 3CXRA 1N6NA 5CXSA 4IDCA 2ONCA 3ICOA 2Q4OA 3G0IA 2IXEA 4OHXA 1GNSA 5FOVA 4UKDA 4ED9A 2PL9A 3VZCA 2YWXA 2VPIA 3QPBA 3BS4A 4NBSA 4UDYX 5EKTA 3LXMA 2D1SA 3TDNA 3PHHA 3L46A 1HZZA 1N4DA 4O4JA 2O05A 5AW4A 1J2YA 1QQ7A 4E4RA 3B9BA 3QA9A 4P2GA 3GLUA 4KODA 1GPJA 2C29D 3R6LA 5TPZD 1XMPA 3V4SA 3UWOA 3WL3A 1A4UA 2ZIWB 3DAFA 3IUPA 3UFXA 3URMA 3VU8A 4DG5A 1CNEA 1D2NA 3JZAA 5JQGA 3NUGA 2IYEA 4HDKB 2YIDA 2Y92A 1QHHB 1V9CA 1GEGA 1YKFA 2W71A 4G2TA 1VPVA 4E5MA 4BAGA 3A36A 5IXJA 3I53A 1P61B 1JA0A 1C29B 1EVIA 4FONA 1X8LA 4IOMA 2WWYA 3MILA 2PH3A 3GCWA 5CW1A 4BQFA 2BKAA 4BO1A 4LZZA 4LHZA 4YHHB 1X7YB 1KKMA 1XCOA 1TC2A 3I9V6 3WE7A 4FEEA 3DFFA 3RD5A 3JYHA 3RSZA 5DCWA 2P9JA 1PQYA 2OMKA 2UYHA 3QU7A 2PBFA 2R86A 3E70C 3UK2A 2PSHA 3CINA 3G0BA 1CF4A 4C89A 1IN4A 4PQEA 1ORVA 1JKFA 1PI3A 1FUEA 4DB4A 2FE4A 2X3UA 3AM5A 5LXTF 3GG2A 2JIPA 2LRHA 4ME6A 3OETA 4KQWA 3W06A 3M6MD 2FX3A 3T7AA 3F74A 5F35A 1BXGB 1BWRA 2J85A 2FWNA 1E6UA 2W43A 2HRDA 5IBPA 4HAOA 3DH0A 2X1LA 3T0GA 3UT6A 3ZWDA 2WG1A 3W9SA 1L7MA 1OFHA 1E69A 4HEA1 1CQPA 4KZKA 2F1IA 3T5AA 4B84A 3WLNA 1BIFA 3M6FA 4D0LB 4I50A 1NI4B 4PZ0A 1OGJA 1B3BA 3R7WB 4RC9A 2BJHA 3ZS8A 3W6PA 2OUKA 3L8GA 4KSBA 5LLSA 3ZWNA 1FFBA 4JDUA 3L1IA 3ZJ4A 4A92A 3U7RA 4QTXA 3GLRA 4D9CA 4UCQA 2H1FA 2IHNA 4KMMA 4LXIA 5IAEA 2AKAB 4B48A 4IJMA 1KFKB 3KHKA 3SQMA 3KL4A 3R20A 3TBFA 3WDSA 2XODA 2OESA 1IWBB 1T4GA 3IBCA 1KP3A 2WUVA 1Z88A 3UM9A 5T67A 2ZG6A 1Y9EA 4F8EA 3HL0A 1AS2A 5AVJA 2PGAA 1EUDB 3B6KA 4KWTA 4Y2GA 1NM5C 2HBZA 2TRSB 2XB4A 2KSQA 2ZIXB 1IZ0A 3H2HA 3KJHA 4IM7A 4ZRNA 5ICFA 4K0KB 4MJLA 1POXA 1BU5A 1T1IA 5PNTA 3EQ6A 1CRWG 1NLFA 2PLAA 2VCHA 3LE8A 1JFSA 1JZSA 3UA3A 1KS9A 3FNFA 1PJAA 4N9WA 4U9IS 3JQGA 3Q8MA 2FI1A 1D2AA 3PYMA 5IMBA 1ODCA 3DD1A 3MUNA 4YJ2A 4UTXA 3RVOA 1MEEA 4IDQA 1PZXA 4Y2QA 5J4KA 1C9EA 4R83A 5IVPA 4HDSA 1GZ5A 5A71A 3CKMA 4XFKA 4JUCA 1GZVA 1TO6A 2GF2A 2V59A 3OM0A 3IAAA 1RZ3A 1TE2A 1FY2A 1P2BA 1TUEA 3C3YA 3L4EA 1S1CA 4TLMB 3VAYA 1DFGA 3KAQA 5FWDA 1TW2A 4PIPA 1FFDA 3VU9A 5DU2A 4Y8VA 1BWSA 3GEDA 3WRWA 2C78A 3DKPA 2XZOA 2COEA 1HO3A 4MVJM 3SF0A 10MHA 2DPGA 2IXDA 1AUPA 1YR1A 3CLTD 4WOCA 4WLUA 1U2GA 3TG2A 3TDKA 3TECE 1DJLA 5F9HA 3CURA 3GEBA 4Q9DA 4HUQB 3KQLA 1B23P 1G5FA 2CHUA 3AW9A 1O95C 3PEYA 2WJAA 4YCMA 2YRXA 4MW4A 2W83A 1VI6A 2JHAA 2OEPA 2P4EA 3FN4A 2P3LA 3LDGA 1E3MA 4XB2A 5KWIA 4XYMA 2C94A 5SYMA 4DUZB 2WFMA 1I6MA 1RCFA 3DHWC 4LZAA 4C4XA 2VYND 4TRMA 4FNOA 1U7PA 4PEVA 2P2SA 3VMFA 4HPWA 5C8ZA 1Z6GA 4RD1A 1NFFA 4JJZA 1SU8A 1FRNA 1ZIXA 3UMJA 1ONSA 4R05A 2ZVDA 4KN8A 3ANYB 3TOZA 3G0HA 3PEVA 2H92A 4CKWA 1YB7A 2YN0A 4EAQA 4ZKDA 1IQ0A 1GPNA 1XNHA 1VECA 4MQEB 1PE0A 4BLQA 1XYGA 3QZUA 1NNSA 2GLXA 3EB9A 3PITA 4HN2A 3OE5A 1RKXA 2PL1A 3FZGA 1NSFA 3VHRA 4BASA 2E4VA 2HWUA 3IOCA 2PX6A 1AK1A 1Y6JA 2YX1A 3K30A 3PIRA 3ZI7A 4EJ6A 4WBNF 2DC1A 4B85A 2IEIA 5AXAA 2H1SA 4NOKA 2FSSA 3T35A 4W5OA 1KMQA 3FVWA 1AKEA 1O89A 1OASA 4AJKA 1LDBA 8ADHA 1O94C 5CR9A 4GMXA 4IWXA 3CLSC 1OTYA 2QQGA 1FZTA 3HBLA 3F8WA 4QU5A 2WWVD 4QATA 4QBHA 3IE1A 1GLVA 3U44A 1EUYA 4O4IA 1V3UA 2MMCA 5AKGA 2RB4A 2QJOA 2P2GA 1U5CA 1YB6A 1T24A 4Z53A 3U7HB 2F4VB 3LKDA 4KR6A 5F4BA 2VN8A 3CS3A 2VUIB 3IV7A 1HZJA 1YAJA 3GLKA 3L7CA 1C0KA 3T7CA 2IEAA 1ESEA 3LFUA 4QXPA 2QBYB 3DMRA 4RLSA 2VVTA 2FRDC 3K32A 1V7CA 2W8BA 4C0HA 1SPXA 4AJEA 4DNOA 1QHXA 1UDCA 2A9VA 3QOYA 4J3NA 2PV7A 2GESA 1AHIA 5KAPA 3WWDA 4PGMA 3IR5A 3RANA 1RJGA 1G8GA 1SCUA 1J8DA 2CFCA 2CNDA 4IDEA 4QOHA 3T5TA 3V6LA 3EGEA 2YH2A 2ZP1A 3EEBA 2OCAA 1Y3CE 3N2NA 3RUHA 1KJ8A 3B1ZA 2PANA 5REQA 3JALB 3WWEA 2A8YA 1DQPA 2NGRA 1UJ6A 3IAXA 4P7GA 4F91B 3BZUA 3ZHSA 1W52X 4K1LA 4BO9A 1H0SA 1VHTA 3QI2A 5G3ZA 5HF6A 2HIHA 5JMPA 1ZKMA 3MD0A 1XD2B 3WIBA 1FE8A 4RMGA 1PS9A 2D2FA 3KZ1E 4HPJB 1W5EA 1T2EA 2VJDA 4YIHA 3DEHA 4PCLA 4WY5A 1WEKA 2GVZC 4GYKA 3T1NA 3SWWA 1A5ZA 1KAQA 4I8IA 3JSXA 4PV7A 3W8DA 2IZZA 3BK2A 2WA2A 1DTWA 1JHOA 1Z2DA 2Q07A 5TQ2A 2IXFA 3FMIA 1AN0A 1SWWA 2ZI5A 3EEIA 4HYYA 5CYPA 3AUYA 1JDVA 5JSZA 1U2RA 3QELA 2FUNB 2WM3A 3F47A 1KXZA 1W4ZA 4V03A 3RYIA 4DY6A 3B1XA 3AINA 4L7VA 4W5TA 1CJUC 3HACA 3PFBA 1TI7A 1VIMA 3SS9X 2VEDA 2F3RA 4NYMQ 1X0VA 4OHVA 1UK6A 3AQ4A 1E62A 4YAGA 3K8OE 3NBKA 2G07A 5E9QA 3QVJA 4YT4A 3N75A 1COWA 3B48A 4NC9A 1D9XA 1EFLA 4W8GA 1NUSA 2WIFA 4JUDX 4UULA 4PHCA 4OX9B 1R0WA 3FMFA 2GOYA 1YQXA 4ZREA 4ZV7A 3P4UA 1AB5A 1I2CA 2RGDA 3HVUA 3KZNA 3SS8A 1PO7A 3M4ZA 2M1ZA 4YLGA 2IWHA 1NKVA 3D2CA 1AGPA 4QDTA 2ZBQA 4MW5A 3UPDA 5FAKA 3PIDA 3H5RA 4HDQB 5A02A 1YI8A 2AWNA 4ND5A 1R5OA 1H2HA 1YB2A 1NOKA 1NVKA 2EC5A 4JHXA 4L85A 3UWKA 4P08A 2EFDB 3ELBA 4BX8A 3QU4A 4OLJA 2WZQA 2XAUA 3M6VA 4EW2A 1I3KA 3LLUA 3W5DA 5C34B 4PC6A 3HJCA 1L5QA 2Q2OA 2Z2YA 3GEEA 4TQUS 4F9EA 4PN7A 3RC3A 1AGYA 2BMEA 1BVYF 3N2LA 3K71B 4H2DA 3BFPA 4NBLA 1P74A 2A9OA 3AMVA 4JT9A 2DLNA 1Y6ZA 4MKRA 4CNQA 4J2HA 4EGFA 1VG1A 1XX6A 2YV4A 3KU1A 2KQUA 1EP1B 4NG5A 5GZ1A 2XADA 2I65A 3HJNA 5BW5A 5BT8A 5E8JA 3BRWA 4K9QA 1GARA 4JSYA 2ZUTA 2W2TA 4PAWA 1NVXQ 3LHSA 4Q9JA 3BJEA 4HFJA 1QPGA 4F4JA 3DB2A 3SY8A 1J1IA 2YRWA 1IL0A 3KKPA 3VR6A 4DMGA 4M1TA 3BHNA 1E1CB 3WLAA 1JDZA 5GOTA 2OORA 1UAAA 2I8AA 3O4JA 4P9NA 1EGQA 4QUHA 4RUKA 4YJGA 5IC6A 1WQ4A 1YU9A 1I6LA 3KQKA 1QP7A 5IYZA 2MR6A 2YW2A 3EFHA 1GPH1 2HCBA 1W34A 3CEPB 4RGVA 4JLMA 4OAOA 4XGNA 4AW9A 4CLDA 1VMAA 3OQ6A 4L6AA 4JLNA 1A95A 1UZNA 2XUGA 4MRSA 2CDCA 4KQCA 4XYEA 5CVUA 5ALXA 1AZSC 1WCV1 4Y6QA 1E77A 2DMRA 5EP1A 2J3LA 2XMBA 3I72A 4CZ2A 1VPEA 1Q17A 1POWA 2XQGA 4P83A 1Z6YA 3ZHRA 3EXIA 4AY2A 3UWDA 3FG9A 1SCJA 2OGUA 5E1OA 5KYTA 4KR7A 5B7GA 3A37A 5CDFE 4KFCA 5JS1A 1KC3A 1U9YA 3JV7A 3PXEA 3LUCA 1DG1G 4R5HA 2D0PB 4DDMA 1TK3A 2RH4A 4GX1A 4H1HA 1GQFA 4CW7A 3CSDA 5CFLA 4MHSA 1ETUA 1NGSA 3AWIA 3LCVB 1JDTA 1FC0A 3I9KA 4KHZA 1ZN9A 1EM8B 2ZAMA 4XUEA 4ZO9A 3EJWA 4H1VA 4IHJB 2CKMA 3PD0A 1BHQ1 4UE6A 4ZOQI 2YY7A 3U39A 1E1RA 2JI4A 2JA1A 3EYWA 1JIUA 1GPAA 1VG9B 3EISA 4DSUA 2ZWVA 2YXEA 5KTPA 2VDPB 5AJWA 4JB3A 1HT1E 1KNXA 4MQBA 1RT9A 3NOXA 2PWZA 3UB2A 1SCNE 1NURA 3L6DA 1QHSA 4OMFG 2VDKB 1L5OA 4HLUC 3VQTA 1OOEA 2N42A 1J06A 4G2NA 4KKXB 1JDBC 4A0FA 4NJEA 1OKKA 5JAZA 3MF4A 2ZIZA 1J7JA 3C6KA 2I7VA 3U2QA 3GEPA 4YACA 1ADGA 1HQKA 1ULUA 2C3UA 1MEOA 4ND1A 4ZTUB 1EUCA 1DAOA 1XZLA 4E2FA 3I4CA 3DEFA 4XFDA 2VYCA 3PHIA 4KUHA 5F98A 3FTCA 1XZMA 4O4LB 4BVJA 2J9RA 3DJYA 3GEMA 5K0EA 4LVOA 2OG1A 3LXUX 3ZXSA 5BXYA 3C0KA 1P0IA 1X86B 1ZYUA 4LJ7A 4ZANA 2RH5A 4OI1A 2O8DA 1L9KA 3CM0A 4NJOA 5FIUA 3LG2A 4Q4JB 5AYVA 3RJ5A 4HVTA 2AC4A 3AI2A 3NAZA 2I2FA 5KQPA 1XTQA 3QYJA 1ZOSA 5AOCA 3VPCA 1CG6A 1C14A 1MJNA 2LCFA 3UMBA 3JYOA 3K0EA 3WLTA 1UK9A 1Z5NA 4B3XA 5DLDA 5BWOA 2UUCB 3QKWA 1KI2A 5EAIA 3I5AA 4JLPA 4PO3X 2MINB 5J43A 3V8MA 4CMHA 3KLPX 3ZD7A 4L8LA 5DGXA 1WXXA 4OJTA 3SZLA 1JJVA 3UAVA 5KX5B 5JU6A 4N6GA 3W5JA 1F2TB 3UV7A 4DLLA 1KYIA 4AECA 1QDEA 3TLGA 2QN2A 4ZN6A 1DV2A 4MKIA 4OLBA 1XEAA 2CWDA 2FCRA 3ANMA 2QQ0A 3OCXA 1AURA 1L4UA 4JEUA 3ENWA 3IPAA 4BYGA 1VSQA 2IF0A 4E6PA 2O5RA 1MAWA 3ENNA 3TCXB 1IN5A 3FUTA 1J5EB 3VNBA 1QC5A 1KI4A 1SQGA 2XX3A 2NU9B 1I30A 5LJLA 3LC0A 4L5YA 3C24A 1RJ9A 2O2YA 4EAAA 1W9MA 1FTYA 2VJAA 5EZ6B 1VL5A 4BVBA 3I5YA 4HEA6 4M22A 1FJXA 2OXIA 4B74A 5CBPB 2X86A 3B2QA 4WLEA 4TLCA 1P9NA 3PNBA 5DLEA 3EGVA 6ADHA 5FA8A 3AESB 4EM6A 4ASUD 1ZRNA 4POAA 4MWBA 1BMTA 1NYLA 3GEHA 3T99A 2F3SA 3SOPA 3IUJA 1Z4JA 3ZXXA 3TD9A 2AXPA 2FFJA 1EX9A 1Y8CA 4UDXX 3ZCUA 1Q14A 2C3YA 2R5NA 1ZPDA 2DQSA 2H2IA 1MA0A 2PKYX 3AFIA 5KQMA 2P9YA 5LMZA 3HA7A 3T9DA 3VKVA 4ZMBA 2IU6A 2PXAA 2C7BA 3WLLA 1J9GA 2X4DA 2H00A 3WIEA 1JIKA 1JEYA 2CGEA 4QRHA 5EIOA 3HB1A 2IQIA 2Z08A 1C9DB 3OMWA 3EA0A 2GFQA 4RSGA 1X7YA 2BN4A 2BTQA 1C4WA 2N0SA 1ZA2A 4N3GA 1YS2X 2GKGA 1OWPA 2B83A 2Z04A 2XE4A 4RAOA 3OOSA 4ZOAA 1U0JA 4K26A 1Z0ZA 5KSPA 2ZE6A 4IJ6A 3W1WA 1SIOA 3M3PA 3ADCA 2Y6VA 3EGOA 2FZCA 1H65A 1A1VA 3LCRA 4KJXA 4G1EB 3WHPA 4TN5A 2Z95A 1G4HA 1D5WA 2F6RA 2LCIA 3G23A 2WSMA 1K7FB 1PGJA 3OSZA 4LK3A 1J33A 4ONEA 2GJ4A 5BR8B 1BVHA 3CUEF 2J48A 3U9TA 4OGLA 1JJAA 1PG2A 1G291 3LW8A 4DC1A 3U7FB 4OHYA 2FAXA 3P9IA 4ZYVA 2FPIB 5NLLA 4HH1A 4PLZA 3DMTC 1A77A 1VLLA 2NU7B 3O8QB 2HD4A 4G5QA 2AKYA 3GJXC 4G8JA 3T38A 1G8FA 2QORA 3DW1X 2HB6A 3PD1A 3U0VA 2XBLA 1KRHA 1VMEA 3PUJA 4BQIA 5M34A 2YQ5A 3ES9A 3R7WA 3EW9A 1NUQA 3THXA 5BSUA 1NMYA 1S7CA 1KH1A 2IIQA 2Y2VA 4DV5B 4YAEA 4J7XA 3C5VA 2XWSA 3V4LA 1ZCAA 4UASA 4EI8A 3TRFA 2EATA 3K0AB 1DBSA 4DG8A 3PHCA 1G8SA 4ON9A 1DEXA 4PSKA 4DLZA 1RC1A 2JI9A 1WVGA 3LQ4A 3ZEIA 2YJ5A 3IBSA 2B8TA 2CDBA 4Z3DA 5ADVA 1M5TA 4XTRA 3DMNA 3SG0A 4D7AA 4LGYA 4E5UA 2ENUA 9LDTA 4G23A 5IKXA 1VMKA 1NBWB 2FR1A 2ZIXA 3INRA 4AXXA 1B41A 2WMYA 4LJKA 4Q1FA 4O4HB 1MJFA 1FTSA 1G6HA 2RBKA 2ZUFA 5EZSA 3AEUB 4F56A 4BMCA 4B5KA 3OTGA 3KOZA 5I3ZA 4BNDA 1Z74A 3AP2A 2HO5A 1UCFA 3KBOA 3NBMA 4HAXA 4WMLA 4WY8A 3WFJA 4EKEA 3WBJA 1J8VA 1LPAB 1RQGA 1YS4A 4FLFA 1FP7A 3GGSA 3STTA 3E9RA 3OI7A 3OLQA 3RNOA 1F20A 4YXFA 2PJUA 4DV2B 4XM0A 1H2YA 2BGTA 2Y9PB 2IZ5A 1G5PA 3IP5A 1NRIA 3PXUA 4IGIA 1DV1A 4YJFA 3BXGA 4HXYA 1YJ5A 2QGNA 1LUAA 4EZBA 2WWHA 3G5UA 2B2CA 2EF0A 1RQNA 4DSTA 1CUCA 3PEFA 2NPOA 3UKOA 5ABPA 4KO8A 2QTNA 2P65A 4IXNA 4AF6A 5JC8A 4MYCA 4OQDA 2QYOA 2QXUA 1KY3A 4D4HA 4LHSA 4B3IA 3SVLA 4JGGA 3WY9A 3KELA 1PJLA 1CJTC 4LY6A 3OT4A 5ITVA 1L7BA 1IK6A 2FX5A 3VOTA 1WF6A 3PRJA 2VSXA 3HP1A 4DRYA 3HY4A 2C9ZA 5HFJA 2XTAA 5EE1A 1KMNA 1UZAA 2X4GA 1IH8A 1RXEA 4L78A 4ZOLB 4GFDA 1S8FA 2PZBA 4B6OA 3S0JA 1P1IA 2AMJA 3LECA 2LCQA 3ZDYB 2IEZA 3OIGA 1MV5A 1YMUA 3BILA 1GRCA 3DBIA 3Q3EA 1U8TA 1BWPA 2AE2A 4I7EA 4L8GA 3HJUA 3RC9A 3M5WA 1J5PA 2WPDA 2WRZA 4HJRA 2ZETA 3TSZA 3UAWA 2RGNA 2V6IA 4CEIB 2FP4B 1LZLA 3KLOA 3MWDB 5AQEA 3C3CA 5LU9A 3FHTA 4MNTA 1U8YA 4ITUA 3AP3A 4PZUA 1GTVA 1UP4A 1UFRA 3HJTA 4O1MA 2NG1A 3OPMA 2LPMA 3E05A 1YHYA 4I3FA 4TVOA 1W96A 5EFZA 4C08A 1V5GA 3L0BA 4AVYA 2OQ2A 5B12A 1QV9A 1A2KC 4Z4IA 2VF5X 5DN6D 4RHCA 2G5CA 4ZJZA 1JVNA 4HEQA 4MOWA 5HKKA 1XZPA 5K8JB 1FSSA 2XOXA 3E7WA 5BQOA 5EUMA 1M6VB 2G1AA 4NBKA 2CSXA 2JJMA 1Z0JA 3T7SA 2DT5A 1P9OA 2BGIA 1R88A 3U4DA 3ODPA 5LA6A 5B57C 3ZW7A 1WW3A 2P2YA 1XAGA 5DB4A 4LRTB 3REQB 4K6CA 1H8HA 1TYAE 2ZM6B 3DF9A 2VUUA 1KDYA 3FWZA 4LY9A 4X7MA 4B7UA 2A4MA 1XCBA 1C30B 1G8PA 2YHBA 2IU3A 3STXA 1S8OA 3DAYA 3D3EA 3KKNA 3MUOA 2HBYA 3OAAA