1WSWA

Low temperature (100k) crystal structure of flavodoxin mutant s64c, dimer, semiquinone state
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
b'AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDCIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
molecule tags Electron transport
source organism Desulfovibrio vulgaris
publication title Redox properties and crystal structures of a Desulfovibrio vulgaris flavodoxin mutant in the monomeric and homodimeric forms.
pubmed doi rcsb
total genus 53
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2004-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wswA00
3K20A 1I1OA 5LMCA 3B6JA 1ZWKA 3LCMA 4XDHA 1FUEA 1WSWA 3B6IA 3B6MA 1CZOA 1YCFA 3KAPA 1WSBA 3NHUA 4Y9RA 2FZ5A 4R81A 5B3KA 4HS4A 4D02A 5NULA 5F51A 3UXHA 1BVYF 1BU5A 1AKRA 2BN4A 1YDGA 2B3DA 3O73A 2FLVA 3HA2A 4GI5A 4XDGA 2R96A 1OBVA 4QOFA 1OBOA 3W77A 4F8YA 4LTNA 3K1YA 3NHFA 3N3BC 3UXEA 1RLJA 5FA6A 2X2OA 3FJOA 1QRDA 2QX4A 1J8QA 2BZSA 2QR2A 2X2PA 3FX2A 4U7FA 2QX9A 5LVAA 4ZVLA 1FLNA 2QWXA 2MOKA 3L9WA 3G5MA 2BPOA 3ES9A 3NHLA 4FGKA 4N9QA 4ZVMA 3ESYA 5LJLA 3HLYA 1AKUA 4QOEA 2ARKA 2OHJA 1T5BA 1AZLA 3FNIA 4FX2A 1OFVA 4PTZA 2FVXA 3QE2A 4QOIA 5EMNA 2ZKIA 2Z9DA 4S24A 5LBTA 1SG0A 1YKGA 2Z9CA 3OWHA 1E5DA 1ZWLA 3RPEA 1CZKA 4BMPB 6NULA 1CZUA 1X77A 3NHRA 5EAIA 4YALA 3GFRA 3F6RA 3OX1A 4H6PA 4J8PA 4DIKA 4YAUA 4C0WA 1FLAA 3W7AA 3GAMA 3GFQA 2A5LA 4GQIA 1RLIA 2GSWA 4LAFA 1GG5A 4PU0A 2QX8A 1FLVA 3ZHOA 4C0XA 4DY4A 1H69A 3W79A 2HNAA 2FCRA 2V5VA 2N1MA 3JSXA 3EDOA 4QOJA 4Y7CA 1B1CA 1XYYA 2Z98A 3O2NA 1D4AA 1D04A 2M6SA 1H66A 4LTDA 4BMOB 1J9EA 1FTGA 2MT9A 4ESEA 3NLLA 5JROA 3R6WA 3NHYA 2OYSA 2FAXA 2FOXA 1YCHA 1D03A 2QMZA 3FVWA 1J9GA 1DXOA 3GFSA 2OHIA 3LT5A 3NHJA 1XI2A 3QFRA 1VMEA 1DX9A 1TLLA 1CZLA 3NHPA 5B3LA 1XT6A 2HNBA 4FGLA 4FGJA 2Z9BA 1JA1A 2F1OA 1CZHA 4CF6A 3TEMA 4C76A 3OX2A 3NHSA 4PTYA 5F4BA 4ZVKA 1J9ZA 2KQUA 4NULA 4C14A 1AKWA 2M6RA 4LTMA 1XYVA 4YAOA 3W78A 1QBGA 3KAQA 1AHNA 3OJWA 4U7HA 1AKTA 4DILA 4YAFA 4NLLA 1C7FA 3NHWA 4QOHA 4ZVNA 2HPVA 3EYWA 5NLLA 4ICIA 1CZNA 1AMOA 2AMJA 3OWXA 4M0CA 1C7EA 2V5UA 3NHKA 2FDXA 4U7GA 5EA2A 5LJIA 1AG9A 5LLDA 3KLBA 3S2YA 5FX2A 3L9XA 2QX6A 3TZBA 3FW1A 1YOBA 1DXQA 1FVXA 2KLBA 3SVLA 2MWMA 3F2VA 1QR2A 1AKVA 2XOEA 1YCGA 2OHHA 3OVMA 2BF4A 2FZVA 1KBOA 4CETA 1RCFA 1FLDA 4HEQA 2R97A 5FUQA 2BMVA 3HR4A 1TIKA 2RG1A 2W5UA 1SQSA 3ESXA 3OJXA 4OXXA 2WC1A 3F6SA 2QMYA 3NFRA 3QFCA 4GR9A 3F90A 2Q9UA 2Q62A 3KEGA 4Y9UA 3U7RA 5BUCA 1V4BA 4N82A 1NNI1 1RTTA 1T0IA 1CZRA 3N39C 3P0RA 5ULLA 1F4PA 4H2DA 2D5IA 2V9CA 4QOGA 4QODA 5A4KA 2MTBA 1JA0A 1FX1A 5F12A 3TE7A 3B6KA 1YRHA 2FX2A 1KBQA 1QHEA 3D7NA 3OX3A 4LA4A 4N65A 4YAWA 5TGZA 1AKQA 3ESZA 3N3AC 5LBUA 1ZX1A 2XODA 4YQEA 3U7IA
chains in the Genus database with same CATH superfamily
3STWA 4UPEA 2BGKA 3Q72A 1X1SA 2V3WA 2NV6A 2XWBF 3QX8A 4A5OA 5KOYA 2J9RA 1Z8FA 4KIFA 4HNUA 5LYJB 1X2EA 3FKJA 2GXSA 1UKZA 2YL2A 4MAFA 4C4ZA 5K7SA 2OAGA 2KW5A 1VMKA 3GDGA 2B0CA 3PDJA 4YMGA 4J43A 2B3DA 1R6XA 1T0HB 2HHJA 2WBLC 4DJFC 5DI9A 5BXQC 1QYVA 5CHEA 1Z5GA 3W0LB 4WBNF 2BMEA 4H6VA 2D6FA 3CEHA 2EL7A 3R3UA 5BUSA 1A8IA 2DX7A 2BM9A 1Z6PA 4IUBS 1Z6QA 3SJUA 2J48A 3LU1A 4V0OA 3KVYA 3MBOA 4OHCA 4TYPA 1KVQA 1G8FA 2FCAA 3HDHA 3INTA 1PBNA 1V5GA 1JDBC 4KK4A 4L8YA 4OLFA 4B45A 5J9FA 1OX5A 2V74B 3WIDA 4CTOA 2NZJA 4Y1EA 5M7EA 4D44A 4TTJA 3ZCPA 2VJKA 4P4UA 4P0PB 1DV1A 3UCFA 3D4LA 4FGSA 2ZI6A 1YKGA 1QH1A 3HBMA 1E5DA 1X1CA 1NBAA 4P8RA 4D2IA 4L4XA 4QTYA 2B2NA 5DU2A 4ZYZA 3ZCQA 2OSBA 2TS1A 5FWYA 1T4CB 2Z57A 3IMFA 3KB8A 2B98A 2ZIXA 3KJZA 4DIKA 6AT1A 4PHTA 3GFQA 3WFJA 1DRJA 1VTKA 1FLVA 3R6DA 1NQOA 1LS6A 1XVVA 5ECYA 5JMWA 3TJMA 3IT3A 4IDFA 3RIGA 2A3RA 2KM1A 1NBHA 2WWFA 4L4UA 1JP7A 3M5PA 3CZPA 4R68A 1NMYA 4FFBA 1I8TA 2V58A 1KZHA 4MV8A 2P0YA 2I67A 1EVJA 4HZGA 2PGLA 2QRVB 3A1FA 3UV6A 3H8JA 4FFRA 2X4GA 3IA7A 3D7MA 1SUIA 1MENA 3GF4A 3H05A 4JJZA 5TQ2B 4UMDA 3L7LA 3G9ZA 1HWYA 4GLJA 1F12A 4I55A 2X76A 3JYQA 4U00A 3OIFA 3VQTA 4RENA 3UB2A 3VAYA 2XZDA 4A6DA 4HYTA 3RHFA 3X2EA 2Y67A 5AVOA 1ENYA 1SUFA 3TI7A 1OWOA 4TV8A 5EWMA 3R5TA 3W6PA 3DT9A 3PEEA 1N2EA 2HPVA 3GLRA 1DDIA 2XI4A 3OH8A 4GICA 5D84A 3GVXA 3M89A 3E8XA 2Y4OA 1WXIA 2I34A 3KLMX 4IQ8A 4QPPA 3STYA 3A70A 5KTSA 2NU8A 5EA2A 4HAIA 3DDZX 4CL2A 1IZYA 3NH9A 2BOVA 2JHFA 2NACA 4JBXA 3SLKA 4ETIA 5HIAA 5IM5A 1Z45A 5DSTA 1YR9A 3ETCA 4QPZA 5KVAA 3DMYA 2OR3A 1DBQA 2P9GA 1QCDA 1Z82A 4ILKA 2GNOA 3DKIA 4FX5A 1CUFA 5FBZA 1AOXA 2V6GA 2YWHA 2GN1A 4YX9A 5IFLA 2Y99A 2BFBA 2ZSKA 1HH4A 1SWWA 3NC0C 4CKBA 1IVNA 4B6PA 5AW1A 5JBQA 3MB5A 2HMVA 3VR4D 4AS3A 6ABPA 5DYYA 2O8EA 1RHUA 5JZMA 2RHHA 3PYMA 1JALA 2RAUA 2HKIA 4QUDA 4L15A 1Z4PX 5F5XA 4CM4A 2ZE6A 4QGSA 2EFYA 2PFSA 3U7IA 4MVCA 2G8NA 1JAIA 2RHOA 2R751 4IVNA 3QVUA 4L3WA 5EJGA 4EA9A 2ANBA 5JECA 4YJFA 5FPTA 2PLNA 4FMPA 2MR6A 1GWNA 4DIBA 1M6EX 3WQQA 4FCCA 1UMDB 1M8FA 3EUEA 3RI3A 3MSXA 4DYDA 1Z36A 1XEXA 4WEOA 4V24A 1GT91 1VIVA 4KXVA 2MYUA 2V9PA 3C6KA 3KPVA 4Z53A 4H35A 3K05A 2NUPA 3EG5A 3BK1A 1QRTA 2PS3A 5DLQC 1LKZA 4KQ6A 4BNDB 2QP3A 1U7OA 2VQ6A 3QM1A 2VL7A 4HGRA 3IDQA 3I04M 4G1FA 4Q12A 2BVNA 4EO9A 2R66A 5JXJA 4IILA 2KBEA 3TW0A 1AD2A 4LIPD 3L6RA 3KT8A 4NBTA 1E96A 3PJEA 3DFZA 4L4ZA 2W48A 3C3AA 5IDWA 2J0QA 2YJZA 5AI4A 1NDHA 2HIHA 3I6ZA 4W1PA 3O8CA 1C7JA 3ZWNA 1XDDA 4AMYA 1TEZA 3W9BA 1O6BA 1SJ9A 4GF5A 5A2GA 1S3GA 2FK8A 2Q8QA 2YZNA 3FUTA 5CNKA 2GN9A 3TVTA 3OTQA 3QG5A 4DEYA 5E8RA 2ZS8A 1ZUWA 3L82B 4BEBA 3ZWPA 1M3SA 3I2FA 4PRLA 4K88A 4H1HA 4DHWA 1B0UA 5AHXA 5G4LA 4D8TA 1H2XA 3KQKA 3H13A 3RAFC 5EQJB 2AUTA 5G3YA 4GMKA 2JW5A 2FQWA 4HDRB 3S2FA 3N07A 7AT1A 1JS1X 1KFBB 1ZVMA 3PUIA 1KYWA 1N5RA 1DAEA 4RK6A 4EYSA 3NP9A 4GX5A 3LT2A 1PR4A 1X87A 1MVLA 3QP9A 2O8DA 3WWDA 3GOQA 3E2PA 5GVRA 1DG3A 4PS0A 4ETMA 2XMZA 3BXPA 2I6GA 1VG8A 4OHFA 5EVCA 1GPYA 1SC9A 3PNKA 2GBCA 4C6RA 2YDYA 3FSRA 2UZAA 2C42A 3NAGA 3MAAC 4A1FA 4BVLA 2I4OA 2FWJA 1GG2A 3AUYA 3O4RA 3SMVA 6REQB 2L17A 3I5MA 2FWNA 3NJ8A 1M34A 1QPBA 1RLOA 4W5QA 4RO0A 5IWCA 2HK6A 1OFTA 4KNWA 3K70C 3WLPA 2X86A 4TV8F 4B2IA 3PNVA 4UDOA 4YAKA 1ACJA 1FQWA 4M46A 2XQJA 2WTNA 4PC2A 1NQXA 3B3FA 4NEHB 4WVLA 4HGYA 3X1DA 3DOJA 1AG9A 3HYNA 4TN5A 5HJ7A 3MWDA 2R65A 3P2MA 2X1VA 3DZKA 3MCTA 4INPA 1WPQA 1QR2A 3GWZA 1UFOA 4R3WA 2YWGA 4E51A 5JH7A 3HTXA 5HCIA 3BRCA 4Q24A 5F78A 5BURA 1KBOA 2EZUA 3VAAA 2MYPA 3BWXA 4W7IA 2Y0CA 5AKGA 3ZDXB 1FW8A 1WLSA 1SQSA 1U9IA 3R5JA 2K4MA 3TVDA 2GVDC 2PHZA 1Q74A 1U4OA 1FL9A 1V4BA 2WJAA 2ZGVA 3D8SA 4MGEA 1YS6A 1F4PA 3EW7A 1J8YF 1M2OA 1L7RA 4JSYA 5B12A 3PHIA 1TTPB 1QSGA 2JBAB 4D9MA 1S3IA 1G8HA 2VUIB 4AZ3A 5JCZA 2Z1MA 3KYCB 5EJMA 3JWEA 1ZD3A 1S2OA 1W5TA 2D00A 2DJ5A 2V1XA 4R5MA 4R7TA 4EA6A 1TCVA 1NX6A 2HPHA 1EHIA 1CY2A 2EOAA 2OGWA 3EIWA 1NUUA 5CVDA 4K03A 5BSRA 1CS0A 1PJ8A 1JLHA 4HQOA 1VLQA 1SD1A 2QEQA 3AILA 4NFLA 2IV3A 3DONA 3RFFA 1BVYF 2G0NA 2BSQA 4HO1X 5T6BA 1DIBA 1SVLA 3CLRD 2JGDB 4JLVA 3WYNA 3U0BA 5J2TB 3FCOA 1JIIA 2LNDA 4LOJA 1FSGA 2FEAA 5EMJA 2I6FA 1YRYE 3ONEA 4L5CA 2R0QC 2PT5A 3LYUA 4MUJA 3WSWA 3L0SA 2IU0A 4F4DA 2GM3A 4DGQA 3J80A 4N41A 3PQEA 2AC2A 1R5JA 2QROA 3VYVA 2VT3A 2QN7A 1UC9A 2B2CA 3QOXA 3D8RA 3NAMA 4J1QA 2G08A 4OAPA 4UNPA 1KJIA 1WR8A 2PMEA 4BGVA 1WL8A 4RQAA 1NXVA 1KF0A 1KH3A 1Q0RA 1ZAKA 5CDHA 5C8XA 4PSAA 1PTKA 1EAMA 3VO1A 1Q0HA 4M0DA 1CZKA 5AJZA 4IDEA 5B53A 1OPRA 4YALA 4U2EA 3SC6A 4J8PA 4NCIA 4CEIA 1BFKA 1G8PA 2E5FA 2IYYA 2QD1A 4ZDJA 4LAFA 3VSDA 4HFRA 3SM9A 1KFEB 4NMMA 2ZB4A 1HXHA 4URFA 3VVLA 2QV0A 1BQEA 1LK7A 4QZVA 3FFWA 1XP5A 1LI5A 3EDOA 4JJIA 4FYJA 5EI5A 4F38A 1XHFA 2ONJA 4W7SA 2LW7A 4GWKA 2PEYA 2OE2A 1Q7RA 3T9DA 1UM9A 2Q6TA 1N6PA 4WSOA 4KAFA 4E3WA 5EE0A 2PGNA 3IH5A 3S70A 2C8VA 2V54A 2DSNA 3WK9A 3EGXA 3CH4B 1XMQB 4RH0A 1W6UA 3EIEA 2GCOB 4W5HA 2G72A 4OP3A 6LDHA 5DHFA 3LCCA 4R71A 1C5KA 1GAJA 3K71B 4FSHA 3SYRA 1Z16A 3ZJ4A 2QTVB 6PFKA 4RZQA 3BL6A 1XK7A 3F8WA 2ISSD 1EUZA 2RGDA 2OGSA 4JVNA 4Q03A 1UQRA 5JCJD 4EHFA 1XCGB 4HEHA 5FO0A 1JEYB 1C9NA 3CN7A 1T4BA 2QN6A 4U6NA 5AI0A 4I9NA 3WNDA 4KRFA 1CXZA 1J7KA 3Q7QA 5FKJA 5C3MA 1CVIA 4AQDA 1O03A 3FPFA 3MERA 5F7OA 3STHA 4HVLA 3OTHA 3ND7A 1LTHR 2DT5A 4F5EA 2HU5A 3AP3A 2OFWA 4FHDA 2FJUA 3WHLA 4DQKA 2VYQA 2ZS9A 2XITA 1KRWA 2CUTA 1KYYA 4NCHA 5GJWC 1QG0A 1RZUA 4K9DA 4Z0PA 1IY9A 5KTRA 3EFOB 2C54A 3W2TA 1BVRA 3Q7PA 4HLUC 2JLAA 4DT1A 3ZNNA 1K0UA 3NALA 2ISQA 3C15C 1TIKA 4TL7A 4XGRA 3MVEA 3TGWA 1B8NA 3T7TA 3MXTA 4Y9UA 1BRMA 4B3IA 1ETUA 2BFDB 2WWHA 1VIDA 3IUYA 2PLAA 4DC9A 2YVUA 5EZ5A 1HKUA 5G41A 4I81A 1RWOA 3UVEA 2FFQA 2ZE5A 3N2GA 4UTNA 4BQSA 4TVBA 4GZ6A 1AMNA 4O8ZA 1WNTA 1P8AA 3KB6A 3LLMA 3C45A 3UPTA 1JR4A 3OF3A 1EA5A 4HDKA 5HKAA 3B6JA 3JYHA 2DY0A 3WL4A 3LH5A 4DJTA 4O5AA 4PZ9A 3QUTA 4BZXA 1Z6AA 2JI8A 3MTDA 3NM6B 4CIWA 3JAMA 3E03A 5IVKA 2Q21A 2WIGA 4QATA 5ICEA 2C7BA 4H3SA 4H60A 1UANA 4LY0A 1EE1A 4UTRA 2VDPB 3K8YA 1NU6A 3RH0A 2RONA 1CHNA 1ZJZA 2QD4A 1GA1A 2PUEA 3A6LA 5CDFA 3SE0A 2OBYA 5ALRA 1N9GB 4PSKA 3MMXA 1ZO8A 1QRDA 4O0MA 2GYUA 4ZZ2A 1XPOA 1L9XA 4UNRA 1N33B 1QYDA 1U02A 3GJ7A 4MUMA 1Q0TA 4K87A 2AFIE 1R0YA 1SU4A 3AOEC 3KYJB 2ZUFA 1N2CA 3I05A 5E7QA 4DL9A 1M0WA 3DMGA 10MHA 4HUQA 3R8CA 2A1IA 3T06B 4LBVA 5JJKA 3D6JA 3BEDA 4X84A 2JASA 3S3TA 4A82A 1EXVA 4FZVA 1ISSA 1JQKA 1DRVA 1SXJD 3TMAA 3BB1A 2K7ZA 4DV3B 5TXGA 1IJFA 1ODCA 2P7IA 3E82A 3EDQA 3NHRA 5LLTA 3SQMA 2XCSB 2A0XA 1Z0IA 1R10A 4J0KA 1QH8A 3GJZA 5EIAA 2F43A 3IS3A 2HBRA 3VHXA 2ATVA 3L0BA 3M0EA 3KE9A 4JBYA 1ZIYA 2XTZA 2X0EA 3ANNA 4C22A 4EPVA 5BMOA 2Q1UA 2J9GA 1M6WA 1N0WA 3NASA 4FFNA 4IV8A 5IDYA 4Y6LA 3RSGA 1ZW6A 4OQZA 1S7GA 2G67A 3WWYA 4FW8A 4QASA 1L1RA 2PU7A 4LE2A 1GR1A 1JF8A 4N0MA 3C74A 1Z63A 3PNSA 1T3GA 5CHYA 4QBGB 4O4HB 4C05A 3EGDA 1TQ4A 3OEEA 4QXPA 3CZ4A 4R9NA 4DMLA 2H7VA 3F5MA 3ZLTA 2XEXA 3CNOA 1I1HA 4CKCB 3LZCA 3FYUC 2AFHA 2ICAA 3KSZO 2BHSA 3TNDA 1LLDA 3N2ZB 1R6UA 3PE3A 1AB6A 2HJHA 3D3KA 3UTCA 3ETGA 1E1NA 2BFCB 4P0QB 1E79D 1UF9A 1UZMA 1HI9A 1YUMA 3PJGA 2I4NA 5JSYA 1BW9B 1O4VA 1UPCA 4LSZA 2R25B 5AXAA 3GZNB 4TQUS 4Y9TA 3O83A 4G0WA 3L7YA 2EWMA 1U94A 4YDSA 3BTVA 1L4BA 2GPYA 3GG9A 1HNWB 1AGPA 3RVSA 2NV0A 2BLLA 1WULS 5CA1A 3O95A 1MAAA 3N58A 4M1SA 5B57C 5EEGA 1IL0A 4LRXA 1JFSA 1GQYA 2IY9A 2D7DA 3PLNA 2O19A 1IUPA 3O9VA 4INAA 3X1MA 1G5RA 4Q9LA 2XKBA 1I32A 2NUPB 2VPYA 3QIVA 4GQAA 2OBFA 5ALNA 3TJRA 3NDBB 3M4XA 4QVIA 1PF7E 5C5EA 3LYHA 3ET5A 4U2DA 3WNVA 3PQDA 2HJSA 3A9VA 1M1XB 3FFTA 3WISA 1D1QA 3ZXXA 4Z9YA 4RH1A 4BBJA 4CUJA 1CQZA 4WCVA 3UJ3X 4CIDA 4MGKR 5F12A 1OTHA 1UEXC 1OB5A 4OQMA 3OEYA 4CMIA 2NMVA 3EY9A 3NYRA 3FYTA 2IZ6A 4L8FA 1TK2A 1V3VA 2ORIA 1RHJA 1K06A 4LQ4A 4RY0A 1JDBB 3P0EA 4WBXC 1D8AA 1KPIA 3DOEA 3KTAA 4MUBA 4X8MA 3L6CA 3OZEA 4JELA 3GRYA 4WA7A 2Q6VA 5TEVA 4DDUA 3QF4B 3CT6A 5DVZA 4ZHSA 1KYVA 3EXAA 2P4SA 4AJLA 3NHZA 4CKBB 4DJEC 2ZUVA 4S1TA 3OSZA 2OOSA 1Q14A 3L93A 5J1SB 3DM5A 3FR7A 3MLEA 3VC2A 4LJ7A 1LZKA 3CEPB 3WLLA 3GLGE 1MJGA 2CDBA 1KJYA 2GPWA 3OT5A 1J09A 1RYFA 3I23A 1XD2A 3SHVA 3QIAA 3NGLA 4I4TF 4RA6B 2J3LA 1P7ZA 3LQQA 4L08A 1WVMA 3M6FA 2IOFK 1PE0A 2MOKA 3RC1A 2BAGA 3FSJX 2PZGA 2CLOB 2VA9A 3L6OO 2NU8B 4QJ3A 2O7NA 1I2BA 3R2JA 5CB0A 4N7MA 4N9WA 4IDOA 4FBGA 5CK4A 4AI6A 4G0PA 1RQGA 1Z0SA 2R47A 5CK5A 4WBNB 2JLYA 3H4MA 4R6XA 2ZBEA 2QTBA 3ESAA 3EUWA 3S7TA 3TLXA 3L5OA 1J2JA 1U2TA 3OCVA 3D6TB 4GOND 1HE5A 4KG7A 3VHQA 2D4HA 1K97A 2WF7A 4QWMA 1XHEA 3R40A 2Q3HA 3IX7A 2B37A 3FZNA 1IM2A 5BSHA 5K1ZA 2YHAA 2ON6A 4G1BA 4J76A 5L40A 2YHBA 1FDOA 1ULZA 3A7DA 2IGBA 5A4DA 2WOJA 3T0IA 1SC6A 3KOYA 5HGXA 3DBRB 3G9QA 1E32A 3ID6C 3O2NA 2WTMA 3VX4A 5A3JA 4G9GA 4H18A 3TRHA 3FWYA 3KS9A 4UUBA 3ZW7A 1N2OA 4H16A 4ALNA 1WW2A 1YAHA 4KDEA 4QPNA 1DU4A 1XJ5A 2OG2A 3IQEA 4HL6A 4MUNA 4FN5A 1P5JA 1RYYA 1OFGA 4LZOA 4BXOB 1WPXA 3DMNA 4K9QA 3WZ2A 5MN4A 1WV0A 5DMXA 2A35A 3G7UA 1CRWG 3JQAB 3K6JA 3LUDA 4FYVA 2WPDD 2WU1A 5AVKA 5BXYA 1ID1A 1AUQA 2C4KA 1AUOA 4H4CA 4WACA 1E6CA 3DB2A 4DQLA 2DPYA 3DXYA 5JAHA 2KI5A 3CZMA 4DRXB 1NY5A 1LK0A 4KIUA 1DHTA 5A9TA 5LYJF 3RRYA 4E5PA 1JKJB 3UH1A 1H3EA 3OWXA 4MVJE 1VI2A 4OQDA 2VLIA 3RSLA 1YZFA 1ZXLA 2IOFA 2XNHA 4ALMA 1ZCFA 4CU2A 2H17A 2Z09A 2DQYA 3DP9A 2YH2A 2AK2A 2BGUA 5IP5A 1U7XA 2HMUA 1Q84A 2IEIA 2ZP1A 8LDHA 1E1KA 1PVVA 4G5XA 2O3QA 2G3YA 4MXDA 3WTBA 4L4RA 4AYWA 2BISA 3QXSA 4LXGA 2W43A 3IDSA 4UXHA 3RF7A 1HYBA 3HCOA 2OAQ1 4JI0B 4WECA 2HH9A 1CS4C 1SG9A 4CRWB 1WETA 1JUDA 2XBUA 3GLSA 1T91A 2QJOA 2Q9UA 2ZK7A 4Q1EA 3WMRA 4B8WA 4CR7A 3MCVA 4AP6A 1MJNA 3EHDA 4JWTA 1JYEA 2D5AA 3BD9A 1XR3A 5B55A 4FFVA 3DVQX 4E12A 1VKHA 1XKXA 5AK3A 5HK8A 2Y6UA 3VGPA 2XWSA 1P1RA 1JHRA 3B82A 1RAGA 2AKAB 3C8DA 4QDXA 2QORA 1W4CA 3BG5A 4FOTA 4LNHA 3EZYA 1NSFA 2WD8A 3RD5A 1JKMA 3L04A 1E3WB 1E7YA 1JQEA 5KNBH 4FEEA 5G1NA 1T8UA 2QM0A 2P0AA 4XDHA 4EUHA 1USUA 2HN9A 5CB4B 4FDAA 1RFGE 2HLDD 3VMFA 3ZUPA 4B0OA 1YZYA 3F74A 3NWOA 3DD1A 3WLEA 5LOVF 2CEKA 1XELA 2EKDA 3NPMA 1R6VA 5G0UA 9LDTA 4ZCLA 1NUQA 3KE8A 4LTNA 5U4QA 2Q4OA 2H65A 4A36A 3RYTC 2X19A 4OXRA 2FRDA 1GRNA 2HV8A 3LUBA 3BH7A 1HYHA 3DKVA 4ZC1A 4TLLB 5B58T 5CU7A 4NEQA 2C88A 3WLKX 4Z4GA 3VYRB 3N2LA 3V1MA 1G8GA 1FXWF 2L69A 4RUKA 4RTLA 2ZSAA 4QWWA 1XDZA 3KQSA 3R3ZA 4BQIA 1O96B 2H4FA 2ZITA 3GT3A 2NNWB 5EQDA 1FX0B 5JNRA 1UP7A 2KWIA 3FHLA 3I30X 1BDIA 1OYVA 1GZ6A 1W85B 3PFHA 5CT5A 2G9VA 1FMLA 4OCZA 3WRYA 2XA9A 4Q66C 2CNLA 3TOXA 4B43A 4URWR 4OYLA 1Z34A 3Q2IA 4LE0A 1JLRA 1V5FA 2CV0A 3ZWQA 4AICA 4C4AA 5FTLA 5ITZA 1Q22A 4FDUA 4Z0NA 1TRKA 1ENOA 5EOVA 5LSAA 3EPJA 2C4TA 3OP4A 5F9FA 4C3OB 1MNQA 1GG5A 5FUYA 4D43A 3CLSD 3PE4A 4BNZA 3HNPA 2CWDA 4NAVA 2VPXA 1L5SA 1QANA 2V6FA 2ZLBA 4YMUA 2GJSA 2Z8YA 3ASYA 4S2EA 4W5OA 4Q7EA 2VHUA 5H02A 3B5EA 4GLFA 3CF6R 3ZV6A 4D0RA 3R7DA 4LFCB 4ZI2A 2YV3A 2B99A 1KIMA 1X1BA 3AR4A 4C6TB 4XYLA 4P3XA 3PRHA 2DWUA 2HLNA 2RHWA 4TKUA 5E1BA 1BWPA 1XT6A 1ZG3A 3EHEA 4GH5A 3C3EA 4P93A 1C29B 4R8MA 1G7CA 2O5RA 4MWSA 3W8NA 3ZD7A 4C76A 3WLOA 1QUFA 3OBIA 3N8KA 3DYBA 3HRIA 4CT0A 5HF5A 1OGIA 2AJBA 4AJOA 3KK0A 2WWIA 3C41J 3H3JA 3I3SR 1CJSA 4TYYA 4YUYA 4JEHA 3IVMA 3D81A 5HRAA 3S8MA 1RADA 3FIUA 4N3NA 3DEJA 1LLUA 2UZ3A 5JPIA 3H4TA 2VOEA 3N8IA 2ZBDA 4GC5A 5FUBA 5TDHA 2NZYA 3SC3A 5BQPA 3BGIA 1DIGA 3RC9A 4GPBA 1SZCA 1K9VF 2Z8XA 1OZGA 3RW9A 4ND8A 2YHIA 5CT4A 1I1NA 1PR0A 3H75A 2XJ4A 2AW5A 3HVRA 2JLQA 5FUQA 3WLHA 1X15A 1PL6A 1XRMA 2XIJA 5AVYA 2ODQA 3LQRA 1XZDA 3ESBA 4G37A 4MGYR 2CMKA 3BIWA 5AQEA 2X6RA 3VR1A 3WL3A 3ZDYB 3PXDA 3ZU3A 5BSFA 4LJRA 1C9EA 3BMNA 5IM4A 1N2CB 1P91A 2BRUA 3NGMA 3UKOA 1V7ZA 1VB5A 5HKOA 3IUEA 1U6KA 4XWTA 4YJ3A 3L7KA 4LWQA 3M70A 4OJTA 4CDGA 1U98A 5JAOA 3W9SA 4NCXA 1X86B 1B8VA 4TMFA 3K92A 4QJIA 2Z6QA 3OZTA 1PV1A 5LMCA 1M1NA 4OV6B 3AHJA 5JFOA 3SX2A 3IR5A 4D9JA 4Z7OB 1ZMOA 4G5SA 1W25A 2YBDA 3P4XA 2MYTA 4R81A 4AZVA 2YNMA 1RPNA 2ZETA 1I0ZA 4TSRA 4E94A 2WRZA 1XAIA 1XTKA 1S4QA 1DFHA 4TLCA 1I4TD 2FG7C 4QT0A 3UO8B 1I4LD 2RBKA 4YT8A 4WKPA 2DFLA 3ZJTA 5TNXA 2VSXA 2X2OA 2WKQA 4OXYA 1Z17A 2C92A 2IJGX 4RSMA 5FOXA 1DS6A 3ZHXA 1TPZA 3NCHA 5JXHA 4RD2A 4U2CA 1R50A 1XTBA 2H2GA 4N49A 3ZJUA 1SQ5A 3ZDRA 4B48A 3PL1A 3NB0A 3O3CA 3TL2A 4RTNA 1XZIA 1OFVA 3TPZA 3FSEA 4IINA 1QF7A 3HE3A 3N5KA 2BCJQ 4GXTA 4BNYA 1PJAA 4WPGA 4LY6A 1X7YB 2GEKA 4HAXA 4CG3A 3KWMA 4MUKA 1HA3A 3WB9A 4RNDB 4XAQA 2PJRA 2GEVA 1IBMB 1T2AA 1UJ5A 4V2IA 3ZHOA 1JIQA 4O33A 4IJKA 3SD7A 2VRCD 3BCHA 1V43A 1XVTA 5FWNA 4WXPA 2CNNA 1YS7A 4LX8A 5F3RA 3F1LA 5CD9A 1WDWB 2HL6A 4XDZA 1G20A 1QP8A 1C3EA 1Q7EA 1TYZA 3IQFA 1IATA 4HLDA 4RMHA 1EYZA 2GM5A 2W6JA 3OY2A 5IDXA 2F43B 4WTOA 1EWVA 1OLUA 1MC4A 4Q1CA 3AIIA 2O2HA 1YV9A 3L8ZA 3IDOA 1RPJA 4GVXA 4Y3UA 5C53B 3ETJA 4ACBA 2DP4E 2AE1A 3H2IA 5HMLA 2WD9A 4MH0R 5KVCA 5LDGA 4A3SA 1E3LA 1LQUA 1QBGA 3AF1A 4MMYB 1RR6A 2W2LA 3IILA 4Z0HO 2P4HX 3RVKA 3LUHA 1J5XA 1QG4A 2WF8A 3A6FA 4KPUA 3DLBA 5E0OA 1TLTA 3IEXA 4XWWA 1QNLA 3I3OA 1DO8A 4B3XA 3ZGNA 4MV6A 1N0HA 2B36A 3LOPA 5BSEA 2R7KA 4H6XA 4OA5A 4RTJA 5ARBA 2R7LA 4AUNA 2R3SA 2WT8A 4BWGA 5EJEA 4UQPA 1KZ1A 3AX6A 1ONPA 1XB2A 3NFYA 5TIIA 1YKSA 2DQKA 3AFOA 5DHPA 2FP4B 1KEWA 2PRZA 1U8FO 2VJYA 2QN3A 2FGJA 2BEJA 1L5VA 2CKDA 4GZMA 3AIKA 3SY8A 1ODKA 5AI9A 5L4SA 1MAHA 4FXPA 1GUYA 1NSTA 2J5KA 3EDMA 2FMFA 1F8UA 3KQHA 4LKRA 2PYDA 3DFUA 3O21A 1XZMA 4CU5A 4AJKA 4K9KA 5AUPB 3R3SA 5G40A 1JVBA 3KDPA 2Q5LA 3LLCA 1UJ4A 1L6IA 1RQLA 4KDCA 3OU7A 4S2UA 3N3AC 3MC1A 3HEAA 3OETA 5MN5A 2VYND 4TS4A 5JJCA 3F46A 3UT0A 4OEHA 4MWCA 3DE0X 1RT9A 4UHBA 1ZNXA 2I2CA 2B8WA 2JRCA 2ZYVX 5EZYA 5AK4A 2QB5A 3QVMA 3IE2A 4Q4HA 3ZCVA 3BIOA 3TD2A 3MT9A 4N1AA 4PGMA 1FNMA 5IH7A 1JJVA 3OAAD 1OH5A 1WCV1 3CPJB 1UJCA 1CIPA 3MWEB 5JSKA 3WYDA 4YRLA 3W77A 3RIYA 2IUYA 4PYQA 1ODIA 1S2LA 5F3DA 4Q21A 4PIMA 5HRUA 1ZPDA 3ORQA 1JIUA 1J8QA 2QR2A 3WO1A 2KHZA 3OZDA 2ZSHA 4K9SA 5BV7A 3D1VA 2J31A 3TMYA 5K0BA 4QO8A 1BHSA 3K5IA 3OY7A 1IONA 3D3QA 3USZA 1Z6YA 1KI6B 4U4AA 4Z0TA 4BN0A 1E6MA 1M8GA 4EW1A 3GLUA 4ZOQI 3CZRA 4Y2HA 3QKUA 4PZPA 3SG0A 1TUEA 4CV0A 5DW0A 2RGWA 1N57A 1P9NA 3MCAA 1UZLA 4PZUA 5C5DA 1SY7A 1J7JA 4WRRA 2ECKA 2WMNB 1C1XA 3WGHA 2CNWA 4QU8A 4CGYA 3KT0A 3QX9A 1MJFA 5ALWA 3ZV7A 4J91A 1I2CA 5IJ0A 5JC1A 2XUKA 4HI0E 2HDHA 3AZPA 1UM8A 3E35A 1WSAA 2IPOA 4UVGA 3T41A 3B1YA 3TLEA 1YS9A 4NBSA 2XOKD 5FPQA 1ZYUA 3NXKA 1Z7EA 4AXBA 2VI5A 2ZG6A 4QPJC 1PQPA 1QS0B 3E61A 1EFDN 4XX0A 1ULUA 4PHGA 2JZNA 2VIIA 5C46F 3IQIX 2A30A 4UTPA 4ZDKA 3V1LA 2G1KA 3LX6A 1NUPA 2EATA 3PUKA 4OMDA 2ZI3A 3KBBA 4CQLB 3A4IA 3LG2A 4QDJA 1CZLA 4WFKA 1ZR4A 1GCGA 4KQFA 3LP8A 3MLBA 3I9KA 4I9GA 4QUIA 2ZAYA 4WESB 3TBHA 4FBMA 4Z1OA 9ATCA 5FBHA 1DWPA 2F48A 2YWRA 4A26A 3W78A 3HEMA 2ISCA 1CYDA 3BMCB 2CXTA 2O20A 2C78A 1JE1A 2GD6A 5F2NA 4YXWA 2ZI7A 4NHOA 4OLHA 4WL0A 2HHAA 2WOOA 2E48A 3G17A 3LZ6A 4QOHA 3WQBA 4ZJZA 1IEVA 1U4SA 1NN1A 1SKYE 1GLVA 3ANSA 5H83A 1ORTA 4KO4S 3SIPA 2JCSA 1VRVA 4LYEA 2DF8A 3HUDA 2J4FA 2VUSA 5TMDA 5LUAA 3KXIA 1RI1A 2AYXA 2NN3C 4JBIA 3WJ2A 2Y93A 2G4CA 2Q1XA 4L50A 4JYBA 4HDOB 5DTIA 5TGTA 2EVWX 2QLBA 3GLHB 2J0VA 4HNQA 2HJRA 3I61A 1VRCA 3KWJA 1N1EA 4PRYA 5I7FA 3RNOA 2QRGA 3PEWA 2R44A 3O94A 3C3CA 3QVVA 1ZHHA 3ND8A 1ONBA 1I3OA 2VP9A 3A6ZA 3BMXA 1ATIA 2I3AA 3FYHA 4HQ0A 1GTSA 1HLFA 1KOFA 4IMRA 4ARCA 2D5IA 3T3EA 1JA0A 1QZ3A 1TZKA 2E0IA 3NORA 4IIVA 3HPQA 4FT2A 2IEGA 2QGFA 3VPAA 4WFQA 1JIXA 4RZSA 5FL3A 4C0AC 2FEKA 4QXMA 1Z39A 2IUFA 2VJBA 9LDBA 2EC5A 4DIEA 3T3NA 2X0NA 2ORYA 1LQTA 2FQYA 3FY4A 3DMDA 3GIWA 4TXLA 4XRRA 5DBGA 5K3AA 1M10A 3ZOZA 1NVGA 3EFHA 3MS7A 4Y6PA 2AMLA 1FVOA 4XJXA 2QSZA 4D9HA 4FZ5A 2YHIB 5IBRA 3THXA 3KV1A 2Q9CA 1K2WA 1WUKS 2AUNA 4HTAA 4LZPA 2HTFA 5ADVA 4DB4A 1JZTA 3B5JA 3LT1A 3WXBA 4DUPA 3ZE1B 1X8JA 4JJ7A 1YACA 4D8WA 1P72A 3G9UA 2ZAGA 2NUTA 3VR3A 4R2XA 3SF0A 4CF3A 2QWXA 1VPWA 4GI7A 4Q82A 1UFKA 2UZ1B 3DZFA 3KPYA 2ZWOA 3RADC 3RTDA 1HL3A 3CR8A 1EDZA 2PNJA 2XZTA 3NPAA 2JI7A 5E2BA 7MDHA 2PT7A 1Z75A 1Q21A 2CLIB 1EB8A 1H2HA 2C8KA 1YQEA 2G4VA 2RC6A 4RF4A 4N6OA 3LDAA 4TROA 2Q45A 3NHAA 5FOTA 2FUNB 3I6MA 3PZRA 5LWHA 1CF4A 1AQ6A 1QVZA 2IZOA 1J0CA 1JR3A 2LDXA 4XFDA 3GFPA 1CJVC 3HJGA 4DNPA 4EIWA 2A78A 2OHFA 4EFKA 4XXHA 5GIPE 1HF3A 3GU3A 3NEYA 3L8EA 1K8RA 3M5CA 3E84A 1JG2A 2VH2A 3N05A 2J45A 4IH9A 3TI9A 3L4BA 2ODBA 4FILA 2YW9A 1XLTA 1Z4LA 1XRSB 2Q5HA 3K9CA 1CUEA 1QGUA 1ULTA 4JKOA 4LZLA 4XE5A 1KXZA 3T6KA 3U3RA 5A5DA 5DHQA 5KYNA 1I0LA 4PNHA 3RHZA 3GOHA 1K63A 1NY6A 1BCSA 4UHEA 1YFLA 2WD7B 1Z4MA 4LYHA 2I2BA 3VDXA 5MGNA 1HM5A 1QIHA 2EP5A 4BFYA 4YROA 1OSNA 3MRXA 3O8BA 1HDXA 4QFBA 4EKYA 3FOAA 2FMTA 2EYQA 5FFNA 3RSCA 1C7ZA 1YZQA 2DJIA 2HNBA 2P69A 2QAGB 3EAFA 2ZIWB 3IMGA 2FE4A 2O3TA 4MW9A 4XUCA 1T15A 1R4NB 3GT4A 1KMHB 2HGZA 4L22A 1PD0A 5KHOC 1I5EA 5EGNA 3GCDA 4ENRA 1WB4A 1DEHA 3P5BA 4I2VA 2X0IA 5ALHA 4REMA 4M22A 3V5NA 4QECA 4YV7A 1YR8A 3ZH9B 5CG1A 3EPHA 1JFTA 4KIWA 4FCWA 1JZSA 3ZIAD 1A7KA 3UMRA 4M3NA 3T95A 1W30A 2HSDA 2WTEA 3ABZA 3QOWA 5HIIA 1UXJA 1MABA 4KUGA 3BBLA 3AHIA 1IZ8A 1YZGA 3RKUA 2O8BB 2F4NA 4B8ZA 5D00A 1JXAA 2H52A 2H7YA 2HDWA 3VR6A 2DXIA 4OQNA 3IAHA 2CD7A 3KQLA 1VIYA 1E3WA 1G66A 2WJIA 4XCXA 3OPYI 3ESQA 4QLOA 1TA9A 4IDAA 1UK7A 4I1VA 4J0GA 3IE0A 5F2OA 1LX6A 2CL7X 1GPAA 3HCPA 3AR8A 2Z1NA 3EAGA 1TJNA 3L77A 3PSHA 2X8BA 2P9HA 3D8HA 1FUUA 3NI2A 5IK2D 3ZU4A 3THWA 1FUIA 1VLVA 4GRAA 1GY8A 2PV7A 3DXZA 4HAVA 4ISCA 3YASA 4EY5A 4BB0A 1Z7WA 3NHUA 1OFUX 3SKYA 1WKVA 3CO0S 1EVZA 1GPWB 1LS1A 3FCAA 3QHPA 4Q02A 4RZ2A 5IDQA 2J41A 1FJHA 5M29A 2UYGA 5A04A 5J2UB 1L5OA 1KAHA 4GI5A 3A14A 4ZT5A 4JBWA 4EJFA 2QR3A 4U02A 1NW5A 1DBWA 2ZUUA 4C2AA 3VV2A 1VL0A 1ADYA 2HPAA 1KIFA 2JJ2D 1A0OA 3NOQA 1CR1A 4RZ3A 4AZTA 1EXNA 5IF9A 4LX0A 3MZ0A 4TLEA 2X77A 3V8VA 3GZTB 3ELUA 1ISHA 1QYXA 1UDAA 2H4HA 4YJ3B 4DIOA 3OE1A 2WZBA 2Q99A 4K26A 2PUFA 3WA6A 1OFIA 3ZTYA 5J2UF 3MGKA 2GEUA 3MXOA 1K6MA 3BC1A 3JWGA 1ZLXA 1H2ZA 4LJ6A 4U9IS 4AS1A 1XE3A 1JAXA 3S8YA 1AIPA 1NXSA 1RBZA 2NPOA 1PGJA 1NZDA 1YDMA 2NUTB 3DMFA 4HADA 2CLSA 5ALUA 5DIZA 2YIDA 5KKNB 4BQNA 2X5OA 4Q4HB 3I4FA 3GJ3A 3K2QA 3E9QA 3HDQA 4ZQBA 2RBEA 1DV2A 1LPAB 3HFSA 3INYA 1EP2B 4L73A 4O2BA 4CLOA 5L4NA 4NH0A 4XYBA 2XUFA 4XLLA 1BX0A 1TT7A 2YJGA 2H1VA 3HHEA 4H7JA 2PGJA 3CH6A 1PZNA 3LCUA 5DSZA 4PSUA 1W36B 1DO0A 1N3IA 4XGIA 3ZI7A 3A05A 5KX5A 4N3GA 2V8BA 2HF2A 2EJCA 1QHNA 5DX1A 1XPRA 3OQ1A 2EQAA 2RI1A 4KSCA 4P0TA 1SUSA 2AG0A 3OKPA 4AP9A 3OOWA 5ERGB 1UPFA 4C7JA 1J00A 1XN4A 3KDSE 3M9LA 3SQWA 1M1YA 4PTYA 1TA0A 4G1EB 2RCYA 1ZGJA 1WBBA 3HKDB 4IYRA 2JKYA 4NAUA 4O4LF 1P4SA 4CTJA 1PJ2A 2O06A 2XE6A 4FI3F 4LZJA 1IMJA 1VJDA 2VCYA 3AI2A 5TQJA 3KJXA 3PICA 1TO6A 5HFNA 5IVPA 5K3OA 1EBFA 1CNEA 2XUHA 2Y1FA 2G9ZA 2G63A 1T8PA 2PUTA 4W5WA 1J99A 1XZCA 3GJ5A 3H8WA 5KS2A 2OVBA 4D3XA 4RM3A 4WERA 4JQCA 3HBJA 4BYMA 1E6EA 1ID8A 4PQEA 5JG7A 1QGUB 3FW1A 2BMDA 3CWCA 2ID9A 4U5QA 4Y2RA 4ZODA 3VYTB 2R79A 3AG5A 3N9IA 3GQBA 2B92A 1Y7TA 1DWQA 2JPDA 3ENWA 5H81A 1EP9A 1GNPA 2VPPA 3OIGA 4G86A 1SMKA 1KORA 3GH3A 3LSTA 1GZHB 5KYXB 5CT8A 4TTTS 1U2GC 3BDVA 1RAEA 5IULC 5J59A 1RLMA 2P5UA 3RS9A 2IYSA 4K6CA 1A76A 1L4UA 1M1YE 3UXYA 1T24A 1LF5A 1KEPA 1DFIA 2GEJA 4IZIA 1Q3HA 3HDJA 4M60A 4M88A 3AVQA 4JP1A 5EMLA 4YRPA 1OIWA 1NQAO 5TPWB 4E5VA 4M1YA 2HCFA 2ZXUA 3R74A 4DJ5X 3PXGA 4ZCRA 1HY3A 1UMBB 1GPKA 1PFGA 3PQ8A 4LF5B 4LQCA 3I5AA 3H9JA 3COVA 4WGFA 5EQFA 2QT1A 5C31A 5LZ5A 3RIEA 3IIEA 3OJLA 1A9SA 4CFYA 5DM4A 5JMPA 4F86A 3PA8A 1MTZA 1RI5A 3KAPA 1WSBA 5EY5B 3IRUA 4EATA 3C24A 4XJTA 1SURA 2ZRQA 5F51A 4ML3A 3HVIA 4MULA 5CXQA 4L6CA 2EWWA 4DUYB 4E5YA 4MLPA 1W6RA 4FT4A 4XTCS 5E1DA 4AYXA 3ESDA 3T3PB 3DL7A 4MCJA 4NONA 4JDUA 1CD5A 2ZTLA 1SU7A 3PWSA 4LS3A 5DNDA 3QMVA 4ZZ3A 3BJMA 3EYAA 4LHEA 1SO8A 4GDMA 2DZDA 5JYDA 4OGWA 1ZK4A 4AO7A 3D54D 5LVAA 2IA5A 1NR1A 1QIGA 2FNAA 1X7ZA 2CVHA 1Y63A 3H87A 4JJAA 4KWIA 4YR9A 5DB4A 2V65A 4DCUA 1IVSA 2UUBB 3G0GA 1AKUA 1FS6A 3RS3A 2A84A 4MKXA 1TEVA 2B94A 1XKLA 2HGSA 3O82A 3UMYA 4JI4B 1FFYA 2AFIA 2SBTA 1V1JA 4Z4EA 2W93A 4TMWA 3VPDA 5KVSA 1X77A 1T6NA 2HWKA 5LOVB 2X42A 1ANKA 2DR0A 3A4VA 1M2GA 3MHPA 4JIMA 5GV8A 4CG0A 4OF4A 3I6IA 2JJYA 1JU9A 3HJAA 3O47A 1K5HA 3FHJA 2QX8A 3EE6A 1GPUA 3HDVA 1IHYA 1TMYA 3FETA 3TB4A 3JSXA 4LOHA 4TMYA 4HXFB 1BCRA 2NO5A 4LBWA 4RPLA 1D4FA 2VJPA 3SLRA 4IOMA 4O2LA 3SZUA 4HVCA 4YV2A 4ZAYA 4MQUA 2GUWA 3AM4A 1AGXA 2GO1A 2F90A 2Q7DA 1P7PA 1H1LB 1WDMA 4B09A 1NURA 2X7HA 1OIXA 5FQOA 1D8TA 2DBQA 3VUFA 1VG9B 2F3UA 1SKMA 1D03A 3HA7A 4G0VA 1UBGA 1QFJA 1G1AA 2I3GA 4B2LA 2J8ZA 3B3QA 3JQAA 4IDBA 4EW2A 1GAWA 2WV9A 1GSAA 3TUJC 1NGSA 4CODB 3M3PA 3RRMA 1I7SB 2O7QA 5E6UA 3IUSA 4O2AF 1VSVA 2I54A 1DAGA 1NQ5A 1KDVA 1AKWA 1BAPA 1NYTA 1Q1BA 2WAXA 2LWIA 4ZT2A 2BGIA 2C8LA 3JQEA 3EVNA 4QSHA 2VQFB 1U5BA 5L7WA 2PQ2A 3R44A 4P98A 4IR7A 2D5BA 2FMUA 4L2IB 4RFSB 3Q5DA 5BN1A 3CMMA 5IC4A 1C3LA 3HLKA 4NOJA 2CDCA 1KGSA 3KZCA 4IGKA 3WRWA 3IMCA 4RCZA 4A9AA 4B6EA 4C4XA 1TYBE 4ZU1X 2X9NA 3C3JA 1BKYA 1IWPB 2LP4Y 5HE9A 1FVXA 4Q16A 4E03A 2MWMA 1E0AA 2MMGA 1J1ZA 4M87A 1DIRA 3HVUA 4FOPA 4KXYA 3SHFA 1U1DA 4DS3A 1FFBA 1I80A 2PBRA 3KSRA 8GPBA 2FW6A 2BUCA 3FF4A 1KO4A 5BSVA 1T1EA 1D2CA 2ZR0A 3B1XA 3JAKB 1BDBA 5JDIC 3MGAA 4F6CA 2IOQA 4FJ2A 1MRSA 3GARA 4YJ3F 3O1LA 4ZCIA 1BGVA 1UT8A 3LPLA 3OCCA 3PVZA 1NZFA 1WQ3A 1I33A 2PSEA 4MKFA 1FQJA 2AXEA 2G07A 3KJHA 5CR9A 5FPHA 2CHUA 1D2AA 1I6MA 5EJ9A 1Z5NA 1A4IA 1FDWA 1P5ZB 3DBVO 1EFCA 2W83A 4MS4B 1IY8A 5E7IA 2X6TA 3WS7A 1G17A 4PR0A 1FU7A 3NC4A 4I46A 1KMQA 5KYUA 3KSBC 5I5GA 5I7HA 4IOJA 2ZJ8A 4NZMA 4KX3A 4RJIA 1RM4A 1KDRA 1ZNZA 2O7RA 3GEIA 1KZYC 2DC1A 3N8NA 4OJKA 3WK5A 4ACAA 2J3EA 1PJ4A 1WCWA 1EZZA 3EDCA 1PZMA 3DOFA 2XT6A 3CTPA 3FYCA 4DBZA 1UIMA 2COEA 3CZAA 3PKIA 3JQGB 4ZJPA 3ETLA 1MOZA 1GCUA 2FR1A 2H1OA 2EKQA 2IU6A 2BZ1A 2YZ2A 4OYHA 1O96A 3OM1A 3Q7EA 1UDBA 5EIBD 1JU4A 3A1DA 5DM1A 2GERA 3WYGA 3AUTA 4AN1A 3ESYA 3G82C 2IEZA 3L46A 4MP3A 4L7VA 3NBUA 5KKAA 2JH8A 3WP1B 2GT1A 4TSKA 1FJXA 1KC1A 3MFYA 2D2EA 5KNBD 3UMMA 2IV7A 4GLOA 5F1KA 2QYOA 2CXSA 2QRHA 4UTZA 3LT0A 1P9LA 2Z2YA 3FM9A 4IGFA 4ALKA 3DHWC 2GEBA 1CIJA 1Q17A 4N5DA 3EWAA 4NEGA 4EGJA 2Q5QA 5T67A 3FDJA 4RHUA 1NXXA 3THXB 3ZE2B 4BFLA 1EVKA 1FSFA 1O95D 3H1BA 2YINC 1YBVA 3H3FA 4G0YA 4MV5A 4RD6A 3ZIAA 4BMSA 2YDXA 4F3TA 1BHO1 1X3LA 2FPGB 1YQGA 2PR7A 3JQFA 1JEQB 4IJUA 2XLBA 2EZ8A 4Y6RA 2FX3A 2O7SA 1Y3AA 2JH9A 2Z56A 2ZIAA 1E2NA 1XJ0A 1ISRA 4PXAA 3RIHA 1I13A 3WKAA 1SXPA 3CMCO 1CHDA 5EWJB 2WB4A 4QYIA 521PA 2V6JA 3IALA 2XMQA 3TTWA 4DQ0A 3KTDA 1HLGA 3AVXA 3A37A 1BSVA 4K3VA 2QZ9A 4UC0A 4DMMA 5ICCA 3J7AC 3ZEAA 4HQNA 4LHXA 2HNKA 5TS2A 3UJ8A 2V4MA 3AB8A 3I34X 3IEVA 3TB6A 3QU4A 5HZGA 1YQUA 2GLXA 1JB1A 2F3SA 2HRZA 2PSHA 4CM5A 3DZ8A 1MV5A 3QYPA 1NNEA 1LSSA 2JRLA 1Y5NA 1C2TA 3G8AA 3EC2A 1C2YA 1PEDA 1ZLYA 4EWLA 3EQ2A 3OPYA 4U9HS 1UPAA 1TU3A 1PQUA 4HB3A 2IYQA 1L8AA 2ZYAA 1SUEA 2AMJA 2DHRA 4ZA2A 2WJWA 3OJEA 1DADA 1OC2A 4P22A 4H3HB 4PGHA 4BVBA 1JQ5A 1CUCA 3ZH2A 4ZYTA 1JR3D 1P2DA 4PQFA 4F5DA 1Z7YA 1T9CA 3F2VA 4N7JA 1YZLA 4PWZA 3ZV5A 5CLJA 2JIOA 1UINA 2AZMA 2K5UA 4ND2A 4W1RA 2P5TB 4NJEB 5K4AA 3E22B 1J25A 1Z47A 3SSAA 5AUNB 5J4VA 5KYTA 3EN0A 1SM4A 1Z5OA 3T5DA 2NSDA 4DBLC 3KTAB 1FPMA 3AHGA 2YZKA 4GR9A 4IVPA 4KQHA 2GDZA 2D62A 4ZZ0A 5BRNA 1NQTA 1OTXA 4AZ0B 2QMUA 3LF1A 2A1TS 5ESDA 3PX2A 3QVOA 5FO1A 2HCRA 2C7PA 4TWZA 3U4DA 4NATA 2BDUA 4RIGA 2J46A 4FDTA 2IDKA 4BMZA 5JVDB 3OJOA 4D9GA 1UBUS 1Z0KA 2OMEA 2OXRA 2X5KO 4B9EA 4E30A 1P6UA 5KX5F 4H17A 3ETNA 5HA5A 1Y37A 1EFLA 3LDGA 3QY9A 5EUCA 5IKPA 2Y1KA 4H7IA 5IAKA 4U39A 1VE9A 4R2HA 3P2JA 3SX4A 4JXZA 1RQRA 1T6XA 2F1RA 4QDOA 2V5AA 1KQ3A 3DV9A 3SR0A 2DWPA 3FPGA 2OCLA 4MIOA 4YWJA 1IXZA 1MAVA 1N6OA 4RF5A 3VU9A 1Y7IA 2BEVB 3ACCA 4IIUA 4AZSA 4GE3A 3LKVA 3LUFA 3K4HA 4L5IA 4L95C 4NQZA 5D8DA 4OU4A 5AVUA 5L4LA 2E5WA 5G1OA 3AHHA 4PF1A 5E2IA 1RRKA 1S2NA 3E9MA 3G7SA 3VZRA 5CEEA 3AVTA 3A3NA 2EERA 2F9LA 4ZCQA 3UCEA 3V1YA 4F97A 4B76A 1VPLA 3EVZA 4M7WA 3DF9A 4EECA 1G18A 1YJCA 1KBZA 2WE8A 2Y1XA 5JNTA 1ECCA 3AKZA 1USWA 2YMLA 3W5UA 4DLSA 2QQEA 1QFSA 1KPGA 2BFAA 3H0CA 4PFKA 1Q16A 3FUCA 4DYVA 3BUSA 3M1IA 3WA7A 1S5PA 2N47A 4QYMA 2NQ2C 4XJSA 5EKXA 1GA4A 1QCCA 4F85A 4BKOA 1N2BA 4LXUA 4UBOA 1KI3A 4D79A 4IL5A 2YV1A 2ABWA 3JASA 1QGZA 1O8CA 2HF9A 1PZEA 2Q2OA 2PKYX 2XWPA 3HN7A 4G9BA 4R05A 5JRZA 4NJMB 3PC4A 4MYHA 2NVBA 3Q3EA 1YQDA 2ZSFA 3WYFA 3E70C 3LPNA 1R9NA 1JEJA 5H3LA 5HUQA 3PJRA 2J30A 3I0ZA 4RKFA 1IN7A 3NAZA 4MPRA 2XT0A 4O1MA 4Y9SA 3J81k 3WKDA 4IF6A 1SCUA 4M6WB 1OU0A 3A26A 3AUAA 3ILSA 3K0EA 2EG5A 4OFXA 5IASA 5BVGB 1XI2A 1O94C 3TCKA 1TLLA 2GF9A 4F72A 1WMFA 4XEHA 3UAOA 4CMEA 1E98A 3BJZA 3JWJA 1PJSA 4H0FA 4CM8A 1T5HX 4IIJB 1UBLS 3ZDFA 4DLTA 4BRZA 2NP7A 1D2HA 4DJJA 2M1XA 4LJ5A 4POOA 4M8NE 2DPGA 5K6TA 2J9FA 3ASUA 3R3XA 2IK8A 3S5JA 4XQ9A 4FLMA 2RH8A 1AT1A 1EXWA 2GJ4A 4S04A 1YRWA 2CK3D 1RC8A 5G0WA 1P7YA 3OOHA 3DAGA 4D82A 2PAFA 3GLKA 1DAHA 3G59A 3PKZA 4YAUA 2PPVA 2RHRA 3BKXA 3FPSA 3M33A 2PD3A 4O59O 1N1MA 1IOWA 3ZBPA 2Q5IA 1XDUA 1Z3IX 5AOVA 2ZJOA 5HIMA 2IWHA 1V45E 1M8KA 2GBPA 3I0MA 5TR9A 4EUNA 4WLNA 3H5NA 4M0MA 2P3OA 4BC0A 4BQEA 4DY6A 1D1TA 4O2AB 1GDDA 3T52A 4G5RA 3BJRA 3GRRA 1TCUA 4A8HA 4EG3A 4Q5IA 2Z04A 4F45A 1FDRA 1Y89A 1L4EA 3AESB 1ZS9A 4ZI5A 1E2PA 1L1EA 1U2SA 3AG6A 2GZAA 4KQXA 2FX2A 3SXJA 3R3VA 1U99A 2X1LA 3UEOA 4YJHB 4Z6KA 4BX2A 3USES 1MQ9A 1M1UA 2GYWA 4I5IA 5B1IA 3SZRA 1C3JA 1DI0A 1XAHA 2PDAA 1H2RS 4ZK6A 3K94A 2PANA 4PZCA 4YP0A 3ZWYA 1L5HB 1D0IA 2GAAA 3C3WA 3WJAA 4YMTA 2J67A 1O8BA 3E8SA 5JNVA 2VTBA 2NXNA 3KZXA 2GRUA 2GYVA 3ENKA 3QI2A 3C8MA 1D7AA 3CGGA 3W5VA 4F1WA 4MRMA 5E8JA 1O89A 2J4CA 4EMBA 5IT5A 3DOUA 3BXFA 2VSYA 3E22A 3KOOA 4HH4A 4NRDA 3UJAA 5B2EA 1ZA1A 4PLFA 3LZDA 1G8AA 4REOA 5FA8A 2QUHA 2HX1A 3SR4A 1WEKA 2OV2A 3HQ4O 2RGEA 4OUDB 1LBHA 4PG6A 3IOCA 2GUGA 1KEEA 5CYGA 3I8XA 3THYB 3AFMA 3BXXA 1Z35A 1JWBB 2PKQP 2YCBA 4FS3A 5L6MB 2HM7A 2J5BA 1QHIA 4H7PA 2OGZA 1QQ6A 4UM8B 2WK1A 4AJ2A 1UDXA 3OZVA 1CRPA 2VEOA 2B7BA 4V0LA 3EOAI 3E0QA 4HAYA 4OHZA 3P9SA 3IBCA 3TK1A 3ZDEA 1GQOA 4JZYA 4UU0A 5DGXA 1FDUA 3ZKAA 3EARA 3UT5B 1M2HA 4OHPA 4EO4A 1D4OA 1RZ3A 2CE7A 1W2GA 4AN0A 2RIPA 3DA8A 5L51A 1WXWA 1P45A 3TZ6A 4J4HA 4MDEA 4LF6B 4X45A 1EFVB 1OU4A 4ZKEA 4PU0A 3NTVA 5EWLB 5IXJA 1O6FA 2X40A 2PU5A 2FCRA 2CK3A 2AS0A 2V9ZA 5EKDA 4KGDA 3TS1A 4DV2B 1PX2A 1UBKS 1XZLA 3DQPA 1K4MA 2BZGA 3FRHA 2E1RA 4GVPA 3DUFA 2DFNA 2JEZA 3V1NA 5FWXB 4CHTA 1K8QA 5KQGA 1TIPA 4OOEA 1H6BA 1GTRA 5B2FA 4F46A 3LKBA 4WN9B 2WHQA 1NT2A 2LKCA 4G9EA 5FPYA 1EUCA 2OC4A 2WSSA 4I1OA 4Q1FA 4YCMA 5KC8A 1AS0A 1J39A 1Y7HA 2FN8A 3LFTA 1Q19A 4YRSA 4LHWA 4KO3S 4KH1A 2IPXA 1WQ1R 3BYZA 4X6LA 1ZM2A 4XH9B 4E33A 2B1JA 2HA3A 4INOA 1J8FA 1DUIA 5LUBA 2VXCA 2OBXA 4H6WA 2QZ4A 4O8CA 4BN4A 1QLJA 4ZCTA 2G5TA 1XMXA 3DC7A 3IKVA 5JXGA 3AMVA 1VI5A 5CLQA 3WLRA 4YCDA 5KYGA 4J0FA 1L5QA 3I32A 4B3MB 3M6XA 1XP8A 3ZD6A 1BDMA 4PX5A 3S5UA 1UMKA 1KXJA 4I6GA 4OB6A 2ZR7A 4UZSA 5HKLA 2GEFA 3MK31 5G2OA 3UK6A 1JDUA 2QPOA 1MO6A 4IG4A 1N6KA 1GYPA 2FPPA 2HRQA 3CLHA 3G2LA 3NEAA 4GE0A 4PYKA 4LOKA 3P26A 4M8IA 4FB5A 1D2MA 3R0QA 2ACWA 4FGZA 2CYBA 1TZ2A 1TQ2A 4V38A 4MDYA 4ZRNA 3JPWA 2J33A 3PC6A 4I7EA 4LZWA 3PGKA 1ORDA 2H51A 1MR3F 5JASA 1T8RA 5DO9A 3UICA 1H93A 3FWZA 1DJNA 4QOGA 3HCBA 3VR4A 3PR3A 3ZHSA 6YASA 2DCUA 2BRUC 3COJA 2X13A 2WZCA 2PWBA 1LDYA 2CNKA 3N1UA 5EHZA 1Y1PA 2HREA 3QUCA 4OREX 5IYZF 1OYWA 1Q7GA 4XA8A 4DPMA 4ZVQA 4G1VA 1VBKA 4H1UA 4YO7A 3R3WA 3SBOA 1O5IA 5HSGA 3WBBA 2EGHA 1HTWA 3OQ6A 4LJLA 1QFZA 1GNTA 5FULA 3EASA 3VYWA 1U1EA 2BC9A 4S1PA 2FR0A 4K0KB 2C2GA 4MRPA 1GKKA 4Q34A 1ELOA 4B6QA 4DHEA 4IIEA 1QWOA 2X7JA 4E3ZA 1U2DC 3EBOA 2UUCB 4L28A 2DFPA 1OGJA 1QX3A 2HQBA 2OKCA 2WIBA 1JLKA 3O03A 3FYDA 5CD1A 1M0EA 2OHXA 4QO7A 4B80A 3PYLA 4DLVA 4DANA 2CY0A 3EIQA 4BAUA 3LPDA 5BSWA 1Q11A 4P86A 1GSIA 4YP5A 1YT5A 3MA0A 2I8CA 5IJAA 4JI6B 4KFSA 1JIVA 2WWVD 4PG8A 1W35A 3LBIA 1Y9ZA 3EJWA 2FRDC 1L1FA 4AL4A 4UFPA 4FGWA 1L5MA 4NBVA 3F97A 2C00A 1CCWA 2YUIA 2B4KA 4D3YA 2C2BA 4JENA 2E4XA 2QX7A 3IAS1 1DEXA 2P6PA 5C18A 2M1ZA 4NESA 1I7PA 4BNWA 2PZMA 4FWBA 1JMKC 1QX4A 4FHCA 2DTEA 1VHWA 4GSKA 2P78A 1JJ7A 2ZE7A 1FDVA 1GGMA 2IC5A 2VF5X 1EGQA 4IUDS 1RYBA 4KSYA 4NPHA 4QDZA 4ZT6A 3FFXA 2Q8NA 1F48A 4HSEA 4KWCA 4Y0AA 5JNWA 2OBBA 1EP3B 4DJAA 4TT3A 4KZKA 1JKIA 4Z3DA 4PINA 5FL7D 2YQZA 4OLAA 3BERA 2C83A 1Y1TA 2G36A 4YH1A 3EIUA 3FPAA 3I9OA 1T1IA 3LLUA 3TXAA 5CLFA 3FNHA 3RRNA 3UYLA 1DC8A 2QM8A 3EVAA 5CA0B 1TZBA 3NWJA 4EM6A 2YC2C 1MU0A 4ZOLB 3LGAA 1T36B 3C70A 3FOWA 5TQ0B 1IQPA 3W7VA 4A5SA 1YUBA 2FK7A 3N8GA 4YAFA 5DV9A 3ZQJA 1RMYA 4ZVNA 3EYWA 3RYIB 3VI4B 5J5CA 1R0KA 3K6KA 4G5QA 5KPDA 1NNUA 1MABB 1D0SA 1U4NA 2AC7A 2HK9A 4H08A 4RVSA 2A92A 4U0KA 4HNGA 2D74A 2RHDA 1E1QA 2J3JA 2WTXA 4HX9A 4N0QA 4YQZA 2YWXA 5FUWA 4Y2YA 1F6BA 2IPAB 5B1EA 2P8JA 3AIMA 3U3JA 2XZLA 2R8ZA 2O48X 1E4EB 3NO4A 3QFSA 4MVJA 2B5VA 2V7WA 1Y5LA 1P9RA 3INRA 1EJBA 2YBEA 3H8VA 4FYYA 3S28A 5K01A 1OH8A 2C8JA 2NT4A 1N1DA 4Y2JA 5GQSA 1AA6A 1EU1A 5DYNA 2WMOB 1XZJA 2CNOA 1T9BA 2P2DA 4IDDA 1CF9A 5H0IA 4N8SA 5JQGA 1M54A 4ND6A 2MCFA 1YCDA 3OF5A 4BRUA 5AVXA 3JATB 4J6FA 1ZCBA 3ZVNA 1D4ZA 4BJ6A 4Y1FA 2PQ0A 3FI0A 4TYNA 2RDMA 2ZBGA 1NMZA 2Q1SA 1KH1A 3NVKI 1E1LA 4LF7B 5KOJA 2GA8A 5I5EA 5IXSA 3WIEA 4F84A 1D5WA 3SMQA 4ZDWA 4B2PA 5HCNA 4F3KA 4TTQA 3LCMA 1OI3A 3V7NA 4QM7A 3QPBA 1JDTA 1JPVA 2INGX 2X5XA 3CG4A 4NYJR 1BA2A 3HUUA 1O58A 4Z1MA 4ZI7F 4MWZA 3QTBA 5TSDA 3ZHUA 4CF7A 4PYNA 4BGDA 1U9IC 3L6EA 4BO9A 1JHMA 3T7SA 3DR5A 4QOFA 4KQMA 4EH1A 2OZKA 1LZLA 3ZBUA 3D6UA 3B60A 2ERYA 3UTDA 4AF6A 1ECFA 4OQLA 5LNK6 1XEWX 4G24A 5JRJA 2WG0A 4BX9A 4BDSA 4KAJA 3GPDG 5LQAA 2C9DA 4FMBB 3IAS6 4YB8A 5HZKA 2DR2A 1TYEB 3FHTA 5ICFA 5JQWA 5KOHB 4DLLA 2K87A 2REXB 2V03A 1KP9A 2HJGA 4MP8A 4HG2A 3HYLA 2X3YA 2Z9CA 4RA6A 5G3ZA 3U7EB 3VBCA 3ILVA 2E7ZA 1SXQA 1ZJ6A 3DBOB 3KOZA 1H4QA 1E3QA 2E1PA 1NBMD 5J3JA 4QTTB 4CN9A 2OYRA 4B33A 3PFNA 3W7AA 3P8ZA 2DR3A 2ORED 1U28C 4AYTA 1U80A 5J2TA 1ZD1A 3P32A 3ITEA 3WMEA 2ZCVA 1EA7A 1JJIA 4QU0A 4IHQA 1JPNA 2O23A 1YJBA 3A4MA 3JVVA 4YASA 3UUFA 4XLZA 3LHSA 5AW7A 5CIQA 1MZVA 1KYTA 1XJWA 4R54A 3NAQA 5IAAA 1P1KA 1JEOA 3IEUA 2C2YA 4MIKA 2EEPA 4YRKA 4MQEB 2J0EA 1UK6A 3KEFA 4NJMA 4Q00A 2IHKA 3FOCA 4IIJF 4OD0A 3V00A 2DETA 3JD0A 5ECWA 5EMMA 1IQUA 1ZEMA 1K1EA 3TLAA 1RAHA 1NG1A 5K8JB 4EAAA 2QN9A 5JS1A 5A4MS 3WTCA 4GXNA 1MH1A 1W48A 3KJGA 2GZ2A 5K9ZA 1C30B 3PIIA 3V2UA 2RKOA 2IXTA 2J7PD 2Z6VA 4RDIA 4OK5A 3M3HA 3BCRA 4PXSA 3K2EA 2A86A 3MJHA 1PI3A 3SSOA 1P8JA 4J07A 4IICA 4AO8A 5J40A 1WKCA 1J24A 3LIPA 3CURA 1O1YA 4KWEA 1MORA 2VDJA 1C3OA 3WLJA 1CDDA 4HEA6 2JAPA 4II3A 2VAMA 4H0CA 1SK9A 1G98A 1QV6A 2X7XA 3EWSA 3D59A 4CLXA 3UA3A 3WMXA 3WVNA 4UAGA 1PYGA 3GZNA 1QPGA 1D2GA 4ENTA 4O63O 2DMRA 2EFEB 1G41A 3O7MA 3SI7A 4TUYB 4ENSA 3L0PA 3OOSA 1PG2A 3A2MA 3SJAA 1VDZA 1IPFA 1O94A 2RHLA 1E60A 1VJCA 4A8JC 4YPVA 5CA1B 3PLAE 5A4AA 1PWHA 4X54A 4PAMA 1RIIA 4V0NA 3H0KA 3ABSB 3REFA 2BV3A 2OAP1 3OHMA 4L9RA 5SZKB 1E89A 4QUHA 5JDCA 3UHPA 2HA2A 3BHMA 5LP6C 2UYCA 3IKMB 1JBKA 2D59A 4YI5A 2OO7A 1CWUA 3A1NA 1G9TA 1KQNA 1R0WA 1JQAA 4Q7QA 1M6VA 4AKHA 3UK2A 1FF9A 4BNIA 1RC1A 3R9IA 5FPKA 1CJKC 3GBVA 1CQXA 1U7TA 2ZR8A 3F49S 3U4HA 3I92A 1S89A 4XD2A 3UB3A 4ZT4A 4B87A 3D0QA 2AZ4A 5DH9A 1KQOA 2FPPB 3CSSA 4HZUB 1RQPA 3DWIA 5CT9A 2CXXA 4PRKA 4BV3A 5BQ3A 1C80A 3DE6X 4JGBA 2I33A 4GKVA 4KE9A 4RL4A 1QK3A 2N46A 4ABYA 3MJTA 3HYRA 5KX5B 2QLLA 3U37A 2XZPA 1F06A 3NKVA 4QAJA 5AJXA 1QV9A 3OZSA 5C3UA 1HMYA 4FYXA 1A8HA 1TD1A 2PQMA 3B78A 3ES9A 4RDCA 1YONA 1GNVA 3WWZA 1SELA 4CMCA 3A31A 3WGTA 2RGYA 3GMDA 3G02A 5DK4A 1OIVA 2A4KA 3Q7SA 1XTRA 1N2CE 2O3UA 2XA1A 3PDWA 3SFTA 2WFLB 1YK0A 4Q7MB 5BYBA 2W6IA 1FXSA 4CR8A 2IEAA 3GLFE 2BHNA 2HI0A 4RA9B 3WV5A 3WGYA 1QVRA 1RYEA 4R69A 5T57A 2Z2KA 5F98A 3OC6A 1PWZA 1LC0A 4X41A 5EHGA 5AVQA 3ZIUA 5BV8A 4Q9AA 3CVUA 1GAXA 3DVSX 3FTEA 2XMPA 4N6GA 1L4MA 3M5WA 4K46A 4LZZA 2JLVA 2I62A 4LGVA 4I4NA 4MR8B 1IK4A 3KYDB 5LL6P 4EQZA 4IDPA 3WAGA 3AJRA 1COZA 1NJ6A 1XLTC 2GPSA 2JAQA 3FVWA 3K9NA 3OFND 1YBAA 4D3DA 2BBSA 2WYUA 3ANYB 1TPYA 3UJPA 3ER8A 3OQJA 1QHSA 4FGLA 2B4YA 5AVZA 3D3WB 2ZSUA 1Y8CA 3NT5A 3AF2A 5DE3A 1XCJA 1OXUA 4IVRA 2H48A 3E81A 3OUTA 2PRIA 3RKRA 3ZXYA 1KGDA 5HK9A 1NXWA 1RE1A 1Z2NX 1RM0A 1REQA 3WMFA 1TTTA 3ETDA 2P5SA 1QYIA 2DHQA 3U4IA 3C5HA 5DASA 2OCAA 3FNRA 1ZRNA 3JD4A 2I7DA 3ZHYA 2V5UA 3H11A 4MEAA 4WN9A 2ZVPX 1JDZA 4NMHA 1UJBA 2I99A 3D4IA 4M36A 4G63A 3O90A 2XAAA 2QVBA 4XVQA 1RD4A 3MTAA 4QXRA 1QZZA 2PL5A 1D9XA 5EUQB 3BFPA 3F6SA 5ALQA 3A6HA 2VHJA 2C1XA 2NUBA 4M0LA 4RV5A 1YJ8A 5DK6A 3RB8A 4N12A 2FPWA 3UENA 1ESCA 4KFRA 3E9DA 1GTJ1 5E1MA 4NABA 2PS0A 3BGOS 4UHCA 2HIAA 3KR1A 2DVMA 4LA4A 1Y1RA 5JADA 3KQNA 2QW1A 1ZAYA 4I5EA 4DXHA 3P97A 3DE4X 2AWNA 2FGKA 1JTVA 821PA 1UJNA 1QKJA 2A58A 2VXYA 5BWBA 2W2XA 1RIFA 3VHLB 4AJ9A 1IXKA 5JS8A 2V0GA 1Y1SA 2FEXA 1PUJA 4ANFA 4CG1A 5LP6F 4YUAA 2FZCA 4D02A 5NULA 1CSEE 1AKRA 1NE2A 4M98A 3U1VA 2IHTA 3VX3A 2IVZA 5FB3A 4A8JA 4DUGA 4YCCA 4CM7A 4M21A 4I9HA 2QG4A 4TLAA 1AURA 4LMRA 4W1QA 2H5LA 3QEJA 2ZRPA 4EQ6B 2FMHA 4OHVA 4KV9A 2Q5JA 2L2QA 3IAAA 4MKIA 1MGPA 2VH5R 4HN4B 4BCDA 2NVWA 4YJFB 2XWJI 1JHVA 2BJWA 1VDMA 4BMXA 4EVQA 3TSCA 4IHAA 4P9NA 1KO7A 3JWHA 4HQKA 2QR5A 3F0TA 3FD8A 3G5MA 4Q47A 2G9NA 2PKCA 2MSCB 1V5WA 1G38A 1XZGA 2ZWAA 3A6KA 3A6JA 4PEVA 1BMTA 4EG1A 2JVJA 4YECA 4JA2A 1JSLA 2IFTA 3BN3A 4NMXB 4BQPA 3HB5X 3A3YA 3EIXA 3NRJA 3DBRA 4YDQA 2BY4A 2GWHA 3THRA 3GV0A 4ER7A 5DM70 4I9UA 1ADCA 3CUSA 3M1AA 1NR7A 5B6IA 3KVNA 3WL8A 2YYZA 5LQNA 1GSOA 1KJJA 2CJYA 1H0RA 4CZ2A 1IHXA 3GLVA 2DECA 3IULA 1VM6A 5KWJA 2CFOA 4WXHA 1RDFA 2H4JA 1MC5A 4A2CA 3PQ7A 1Y8ZA 1XHLA 2VDQB 4P82A 4BE9A 1U2RA 2GBLA 5C0OE 3WDMA 3ZW9A 2B4TO 2NZ8A 2YMPA 4CDMA 4UFOA 3L4BC 3CVOA 2ANCA 3EZ2A 3OQIA 3V8EA 1DAOA 1XCOA 3NKLA 4RLQA 3JU3A 3Q88A 3GLIA 2QL5A 1ORIA 3F9CA 5EIHA 4YONB 5A7HA 3VDRA 4CF6A 2F67A 5LFAA 1C8VB 1U8CB 1YBMA 3NHSA 2AFIB 4KWTA 2WFLA 3W3AA 2FPKA 3NV9A 4A0QA 3JZIA 4BS9A 3GEGA 4MB0A 2YFYA 1GUZA 3PTZA 5DT9A 1DE0A 1HEYA 2ILVA 5K3FA 3MBKA 4PV7A 1CR0A 3AVVA 2WQ7A 3U2QA 3QF4A 4UEKA 2Y2VA 3M81A 4DKJA 3R24A 3EA0A 2F1KA 3DTNA 1JX6A 4NARA 1R15A 4QX6A 4UE6A 3MELA 1DXQA 1IPEA 5K0SA 3SVTA 2WM2A 3PC2A 5K4GA 1Z7GA 2EW2A 5EJ6A 5AM0A 3E7WA 1NBIA 5CVVA 3TDNA 2QRVA 4MJ7A 5L6LB 3AKYA 1JW9B 2IRWA 1JHDA 1ZU5A 3FUUA 16PKA 2FZKA 2OCDA 2Q62A 3MILA 4ZEWA 5I47A 3T5AA 4ADSG 4RWZA 4WLVA 3TLCA 2D06A 3CUUA 1YB1A 3BVPA 1NVKA 1MUUA 4N18A 3ND5A 1RWKA 3AJEA 4GMDA 5B3AA 4US2R 4B4KA 3AERA 3K1AB 4IZHA 3ZCTA 3LLVA 1G5QA 3C3PA 4NR0A 1EVIA 1I1OA 4GMXA 4Q4CA 4LKOA 3Q8KA 1LPNA 1VSQA 1OTYA 5A4IS 4MPTA 2FFJA 1K9SA 1MRNA 4UEOA 5CA0A 5HZHA 4EA8A 1DBPA 3OLCX 4FMDB 1TZCA 4YHBA 4UJ5A 1G3RA 3DF7A 3MG9A 4J75A 3BOSA 5KHAA 1T36A 2G88A 2ECOA 3HCAA 4B5LA 4F9EA 4ZAWA 2BI7A 5B5SA 2Y1DA 4F8YA 2QDXA 3T7IA 1NI5A 3OIUA 2WABA 1MO5A 3L43A 3LY7A 4ZFNA 1G3UA 2WNSA 2CB0A 3H17A 4NQRA 4KEAA 3QFHA 1EUDA 3N2KB 4PBSA 3RF6A 2IBTA 3PX3A 2F55A 3ZWOA 3FH0A 1INLA 5E3HA 4BO5A 3KUXA 4PZAA 2DYKA 2D7JA 3IVGA 4KGXA 1NKVA 1HBJA 1W5BA 3SS7X 1J56A 2PXHA 1SFRA 1XFDA 3UM9A 5K45A 4HYQA 2NV2B 4P38A 1W0CA 2FZLA 4QOSA 4DUGD 4EG4A 5A1TA 3OWHA 4O4JA 1A69A 1SXJB 3ZGYA 4KJXA 4Q9NA 5C7IO 5E4TA 3WBJA 2QTTA 1NW8A 4MR9B 4NOKA 2MJLA 1RI2A 4L0DA 2QIPA 4YUVA 3R7BA 4JDPA 3NANA 3NRBA 1E2LA 4MV0A 4PG5A 1LTKA 5AKJA 5BPFA 5LNK1 1UBTS 2O4CA 3EISA 5CAEB 4HY3A 5K03A 1H2FA 4FMCB 1T8SA 5DGCA 3QEBZ 4TMTA 3LRXA 3THOA 2JD0A 4A2WA 3Q85A 5B30A 4PX2A 5F7XA 3AVUA 2REQA 4X71A 3PCXA 3WGNA 5BVHA 2HO4A 2ID8A 3R6WA 3VDMA 2EP8A 2QK4A 4BRSA 4MAMA 2J9YB 4BLRA 1Y4SA 1PS8A 3GEEA 3LXUX 4OIFA 3WADA 1DL5A 3D7SA 3H18A 4JJFA 4MLDA 3AI3A 4UU7A 5KYXA 4RW0A 4AKGA 3N59A 3EVGA 1A8PA 2R86A 1ML4A 3LK7A 4TKLA 2BFBB 2FDRA 2D8MA 2WWTA 2XHZA 2ZJ7A 4PS1A 2A5YB 4XX1A 1KO1A 3TZQA 5JU6A 2XYVA 4F4HA 4HCJA 3ZZMA 2DUMA 3LBYA 2Z83A 2OV6A 4UUNA 1QIKA 4KQ1A 1Q7TA 2B7LA 1T2NA 1RKUA 2DKNA 1FTWA 2WIDA 3UWSA 3GMSA 2AN4A 1V11A 5EERA 3VPBA 3TSOA 5C81A 3CIFA 2FEOA 1P3DA 1A82A 3DBHA 1MX9A 3P5SA 5D3ZA 1FNSA 5C2JB 1DPFA 2I6XA 5JYCA 4EHAA 1JFVA 4XB6B 1XMSA 1CETA 1CJCA 1XLWA 3CUVA 2OWDA 4FK8A 4JI5B 3RVMA 2CHGA 1SVOA 3JZDA 3VM6A 5FL7A 2EYUA 4LECA 4LY3A 4YWHA 2UUAB 1QIJA 2OHHA 1AQYA 2E4AA 4MV4A 2C77A 4WCFA 3R4VA 1FLDA 2R87A 4CEHB 5U1PA 1BX1A 1UUFA 2Y1GA 3QWAA 3TD6A 3BJIC 3AVYA 2AFRA 3ESXA 5H1YA 3GFGA 1IN5A 2I71A 5B7PA 1O57A 5CRIA 1CZRA 3T7KA 1IXRC 5IABA 2V9CA 3DV0A 5JH7B 3FKQA 4M1MA 1KVRA 3EODA 5MF6A 1QHHA 3FJ1A 4TV9B 4C0QC 1PUIA 4Y2SA 1PEYA 3JQRA 3EMVA 2PPLA 2XQVA 1T2UA 3KUKA 4ZOCA 5GOZA 4G0UA 2JAHA 5CFRA 1P5RA 1R3DA 1FUEA 1YMUA 2FN7A 3N0XA 2GK7A 3QLTA 4JBLA 4LXHA 4OGFA 2ZBFA 2MSDB 1RP7A 3VR3D 3H2ZA 3PDIA 4DLAA 4D98A 5AD1A 3G0OA 1DHRA 1GDTA 4JFAA 4KBGA 3GROA 5K0FA 1A5SB 1H8ED 5EHNA 2WJPA 4J4TA 3HP7A 1Z2EA 3VSAA 1IBSA 4LYYA 1E5TA 4HWOA 1IFXA 2BM8A 3C4JA 4FEAA 3MS2A 3KELA 1XRNA 2DLNA 3AR2A 3M6LA 5BYAA 2BM0A 1QRAA 5K0ZA 5DOZA 1PSDA 1B14A 1BXRA 2D1FA 3ICCA 1IAVA 4DA6A 2X15A 3AEUB 3QNUA 4Y67A 5AKKA 3PIRA 3PUHA 4PN7A 4FNOA 1KE2A 2EKPA 4FONA 1GN8A 2WSYB 2YOGA 3E2MA 3EF1A 4L4YA 4OQ4A 5J43A 2QUAA 1XQXA 3T0FA 1YB2A 5CUQA 2I4IA 2JCVA 3AFIA 3AVPA 1FFCA 4OH7A 1NF9A 4DCCA 5EWLA 1XLUA 2JG3A 3OLWA 2BMWA 1L8LA 2YNMC 3DO8A 4PBTA 3V80A 1EM8A 1IUNA 1AUVA 1F14A 2OZLA 3FFBA 1RLIA 3BK2A 3ROZA 3TR0A 1A97A 4OB7A 2I7VA 4E2FA 3JVUA 5AVJA 2C1ZA 1H4SA 3G2JA 2A88A 1L5KA 4DDVA 2Q6LA 1BE6A 5C8ZA 1PFYA 1N2JA 3AP1A 3K35A 3N2GB 4KMOA 4MROA 4R0NA 5F52A 1T13A 3B9RA 4C0BA 2R48A 2AOUA 1G4UR 1L3IA 5EEHA 3QYJA 4AKIA 2BFFB 1MG0A 5F5NA 4M1OA 2XJ9A 3TAXA 4MWDA 4N5LA 4JK3A 4CM9D 5JDIA 3UMBA 4QTUB 2PD6A 1BVHA 1E9EA 4X8LA 5HUHA 2Y2UA 3ELDA 4R8LA 3DE7X 2O8DB 4R2IA 1CR2A 3HP1A 3REGA 2PL3A 1HFJA 2W6JD 1KDPA 3MJDA 4LVOA 4NZZA 1JL3A 2IP1A 2JEYA 3QLEA 1DTWB 1ZIXA 3I5UA 3WGVA 1Q3KA 1RBMA 2PBLA 3CFYA 4MA0A 2RGBA 4FS8A 4OXKA 4E22A 5BV1A 4EGCB 1TAQA 4CCSA 3KR9A 3WGOA 5D2CA 4W5NA 1MDBA 1ZN7A 2QYHA 4J16A 1ZJWA 3K9QO 1EESA 1B43A 4DA8A 3HVJA 2ZJ3A 3KTFA 4QQKA 4UFNA 1SUWA 3UA4A 5I7SA 4OKNA 2IUEA 5DHAA 2C9OA 1AE1A 2EX0A 1ZSNA 2G82A 2JARA 1TC2A 2XF8A 4QQNA 3OPQA 4YYEA 2ZJAA 2O8CB 4H7KA 3L02A 1TUBB 2DUJA 2XOKA 3OMWA 4CDNA 1C14A 3G2MA 1PJZA 4FOLA 3C6YA 5H3HA 4ZOLF 2NPFA 3SYTA 3T9CA 3TZEA 3CLTD 3JVIA 2QTMA 1PS9A 4KGVA 2I91A 3EPLA 1IOLA 2O05A 2YN2A 1I4WA 4FYPA 4AUKA 3H5TA 2WAMA 3MUOA 2GO7A 4IOLA 1S8FA 2QTNA 3KEMA 4FD3A 1E5XA 3JQ7A 2HEGA 3MFQA 2VAXA 1SOUA 4MUYA 1DEOA 3ZWCA 4ARAA 3L05A 2MSKA 4MYCA 1G2OA 3CH7A 3CRW1 2R6FA 2XT9A 1JECA 2BHTA 4NU8X 3RWOA 4BLVA 3RBAA 3HJNA 5K8TA 3FCCA 3P9ZA 1L4YA 2OLKA 4HDNB 5ADHA 1IB6A 4PAGA 4BATA 4ESHA 3FCEA 4JNCA 3FDIA 4PZYA 1IY1A 4PZDA 2IUUA 1KK3A 3JQFC 4JR0A 3RQIA 1SKAA 3P9XA 2NT3A