5HIIA

Crystal structure of glycine sarcosine n-methyltransferase (gsmt) from methanohalophilus portucalensis (apo form)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
245
structure length
241
Chain Sequence
SDHYEEEYVLGFVDKWDELIDWESRAESEGDTIINILKERGVKKVLDVATGTGFNSVRLLQAGFDVVSADGSAEMLVKAFDNARDHGYLMRTVQADWRWMNKDIHDKFDAIVCLGNSFTHLFDEGDRRKALAEFYALLKHDGVLLLDQRNYDAILDSKHAHYYCGDTVSVYPEHVDEGLARFKYEFSDGSVYNLNMFPLRKDYTRQLLHEVGFQEINTLGDFKETYKEDEPDFFLHVAEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine sarcosine N-methyltransferase
publication title Structural Analysis of Glycine Sarcosine N-methyltransferase from Methanohalophilus portucalensis Reveals Mechanistic Insights into the Regulation of Methyltransferase Activity
pubmed doi rcsb
source organism Methanohalophilus portucalensis fdf-1
molecule tags Transferase
total genus 93
structure length 241
sequence length 245
ec nomenclature ec 2.1.1.156: Glycine/sarcosine N-methyltransferase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hiiA02
1XJ5A 4O29A 2CKDA 2O05A 2ZWVA 3ELWA 3BUSA 3RW9A 1MHTA 1TW2A 3GRZA 2OB2A 2PWYA 3KU1A 1KYZA 2E5WA 2QYOA 5ICFA 4PYKA 4ATNA 3SGLA 3E23A 3FUVA 3REOA 3MB5A 4HG2A 3P9NA 1EJ6A 4PCAA 4UOEA 2NXEA 5KQRA 1D2HA 3A27A 2PXAA 5K0JA 3K6RA 2I62A 2JHCA 2PXCA 2V7EA 3PT9A 3SM3A 3CBGA 4ER0A 2CMGA 3BGVA 2QM3A 3D2LA 5P8WA 1NE2A 1RJFA 3KPUA 1RJEA 3KR0A 3TLJA 3DTNA 5GOZA 4GC5A 2C7PA 2AOUA 2P3QA 2AOTA 4BLUA 2PLWA 5CCXA 3X0DA 1I9GA 2ONZA 5EIWA 4C4AA 4RVGA 5LQNA 2ZSUA 1KYWA 3BGIA 4PINA 1DCTA 4BP1A 4RTRA 2AN3A 2EJUA 5EZSA 5GINE 4RTSA 2UYCA 4CKCA 4CKBA 3GDHA 2YX1A 3GRUA 4YUXA 3ELUA 3G7UA 3AWIA 4RTNA 2OXTA 3ER8A 1ZG3A 5ICEA 1QANA 5DSXA 3DXXA 5E1DA 3B5IA 1WZNA 5HIIA 3P97A 4DF3A 4AUKA 1IXKA 5IKMA 2BM9A 4M7RA 1XDUA 2PX4A 5FULA 3TRKA 5T6BA 4ER7A 2O07A 4POOA 1EAMA 1SQGA 5HOQA 4RWZA 3KQMA 3LCVB 8MHTA 1M6EX 3LPMA 2BR5A 1VL5A 1QZZA 3FTCA 5KQSA 3GIWA 3HCCA 5CM2Z 5EEHA 5LQUA 4P7JA 3UBTA 2XBMA 2VP3A 3T7TA 5FADA 4X1OA 5GIOE 3ER9A 2ZW9A 4OX9Y 2YTZA 3CCFA 5K0EA 3GJYA 3L8DA 1N7IA 1R74A 1R8YA 2Y1XA 4RTPA 3HVIA 5DM4A 4ISCA 2HTEA 3KQTA 1FP1D 2YQZA 1INLA 5LQKA 1L3CA 5FHRA 2P3LA 3NWBA 4PCLA 4GOLD 4B17A 3PX2A 3ELYA 1AF7A 1FPQA 3FPFA 3PB3A 2I9KA 4KVZA 4OQEA 4XUEA 3P2EA 3BWYA 3TKAA 5U4XA 3FYCA 4EVIA 4HTFB 1SUSA 4F84A 5EKUA 2WA1A 4KDRA 3UZUA 4YUWA 3LGAA 5DM1A 4KRGA 3OPNA 4HC4A 2GB4A 3NMUF 1SUIA 5EZQA 2Z6AA 2EX4A 2BR3A 1KPIA 1N2XA 3TKYA 1JG2A 3BKWA 2PBFA 2ESRA 5FQNA 2OPBA 4E2ZA 2IH5A 3MAGA 4RVFA 1JSZA 3FRHA 1JR4A 4GQBA 3P71T 2GAFA 1WXXA 3B89A 4IKPA 4P7GA 5KS2A 3CC8A 3NTVA 2AN5A 4NECA 5EHGA 2VDUE 4M37A 1JQDA 3SMQA 4KIFA 3TR6A 2ERCA 2FRXA 3G2PA 5EGSA 1Q0TA 1N7JA 2ZIGA 3Q87B 2IGTA 2YXLA 5LQRA 3FTEA 1ZKDA 1SQFA 3R6TA 5C1IA 3LECA 5DM2A 3VC2A 3HCFA 4PGGA 5CVUA 3KQVA 2UZ4A 3EVEA 4FT2A 5BXYA 1JG3A 2I7CA 2PX2A 3HVJA 2AVDA 2PWPA 3NDJA 3LBFA 4R6XA 5DTMA 2BR4A 3KQQA 1RI4A 3DXYA 1SVUA 3EEYA 1XDSA 1WS6A 2OKCA 3LCCA 3OE5A 5E2AA 5EEGA 2UYOA 5IH3A 4KW7A 2PT6A 4C05A 4K6MA 3BKXA 3JWGA 5M5BA 1VP3A 3M33A 2P41A 4X63A 1UIRA 5EOVA 3DLCA 4AZTA 3LCUA 3KKZA 4DA4A 1AQIA 3KR1A 4ER6A 1U2ZA 1BC5A 4DKJA 1XTPA 2G1PA 2FCAA 3SR4A 5E8RA 3THSA 3K0BA 3JWHA 3V8VA 1EG2A 2OYRA 1KP9A 3PFHA 3SXJA 2C7QA 4LG1A 4OBXA 2PX8A 1G60A 4M38A 4PYJA 4RTJA 2OO3A 3EEOA 2DULA 3O4FA 3CJQA 4JXJA 1ZQ9A 4U7TB 4PYIA 2C7RA 1L3BA 3MHTA 3G5TA 1HMYA 5EG5A 2G72A 3R24A 3C3PA 3UFBA 2C7OA 3FUTA 2QRVA 2EG5A 4F86A 2AOUB 2CWWA 2AOTB 2ZIFA 3OU6A 1KPHA 3R0QA 3U81A 4OA8A 1RI3A 3RIEA 1F3LA 5HZMA 1X1BA 1VLMA 2O57A 2AZTA 2NXJA 3EVAA 3G2OA 4ZTBA 3S68A 1NW7A 1O9GA 2YXEA 4AZWA 2G71A 2N47A 4EMSA 1QYRA 3BWMA 3CJTA 3UJ8A 3CKKA 4PYMA 4RTMA 2F8LA 5CVDA 3ANXA 3PS9A 2NP6A 3HA5A 5HEKA 1ZHFA 5K03A 1YF3A 3B3FA 3I64A 5EMKA 3KQOA 3P9KA 1UFKA 3RODA 2LD4A 2B3TA 4RSRA 3T7RA 2P8JA 2A14A 5GP1A 4KWCA 4Y2HA 4R8SA 5E9JA 5HIKA 2IH2A 4GBED 3P9IA 4L7VA 3ELDA 2B78A 3M6WA 4OBWA 1JQEA 4MQ4A 2P7HA 3E7PA 1YFLA 3HTXA 3CJRA 3LBYA 1O54A 5DPMA 1QAQA 2P7IA 4BLVA 3EVZA 2H11A 3PVCA 3A7DA 1AQJA 2IH4A 3IHTA 3OFJA 3G5LA 4HGYA 4HH4A 4EKGA 1FBNA 4FZVA 5E9QA 1JG1A 4CTKA 3G89A 5K8VA 3CVOA 3NWEA 2FK7A 4GOND 3TMAA 2O0LA 2AOXA 5CVVA 3Q7EA 5FUBA 3H2BA 4BP3A 3KHKA 2VS1A 4RX1A 3TFWA 2ZZNA 2B9EA 3I5UA 2WA2A 3DMHA 5HIJA 3LKDA 5E9WA 4GEKA 1L9KA 2PVCA 4GOOD 3IV6A 1UWVA 5D1HA 5CVJA 4G56A 3SSMA 1HNNA 1NV8A 3HEMA 3DR5A 2YVLA 2P3OA 5FTWA 2ZVJA 3FUUA 5BW5A 1FJXA 5T67A 3AY0A 1G8AA 1G38A 4BY9E 1YB2A 2PXXA 3QOXA 3DUWA 5EQJB 1QAOA 5DRYA 2HNKA 1O9HA 3BWBA 4DMGA 3BT7A 3OU7A 3OZTA 2QY6A 2YXDA 5KYGA 5C9ZA 5LQCA 2EFJA 5DX1A 3LL7A 3EPPA 4C08A 3FPHA 1XXLA 5JR3A 2WK1A 3ID6C 1BHJA 5K01A 2OB1A 2BH2A 5DXAA 3HVKA 3OZSA 1H1DA 5E1BA 1JTFA 1SG9A 3GRVA 2AOWA 2ORED 3DLIA 1M0EA 4Y30A 5DTRA 5T64A 5FA8A 4XUCA 2H1RA 1NW8A 2ZBQA 3MCZA 5H02A 2UYHA 2GLUA 1IY9A 3HP7A 2P1DA 2PT9A 3LKZA 1VIDA 3SSOA 5DX8A 4PNEA 3C6KA 5FCDA 5HILA 4E32A 4KIGA 3OZRA 1YUBA 2FK8A 2AVNA 1KR5A 4LWPA 2FPOA 2G8NA 5DXJA 4RYLA 3HCEA 4HGZA 1P91A 3GCZA 10MHA 3BZBA 4R05A 4DQ0A 2JJQA 3HCBA 5GM1A 3P9CA 1X1CA 3EMDA 4AZVA 2XVAA 5K0NA 2XVMA 3TPZA 3KPYA 3KR9A 4F85A 2FHPA 4E2YA 1XDZA 3B3GA 3JWJA 4WVLA 4PIMA 5GM2A 4M36A 4QDKA 4CKEA 3I9FA 3MERA 5EHIA 3C3YA 3THRA 4RVDA 1AV6A 3DMFA 3DULA 3HVHA 3A4TA 3G8AA 4P7FA 2ZLBA 3R3HA 4E31A 1NW6A 1L1EA 1Z3CA 2QRVB 3I53A 3FRIA 3LDGA 2GH1A 1R00A 1R18A 4QTUB 5F2KA 5K05A 2NP7A 7MHTA 1QAMA 1BKYA 1M6YA 3FPEA 4RTOA 2AR0A 3KQPA 1VE3A 1D2CA 3GRYA 5BP7A 3PLAE 2NYUA 3VC1A 3HA7A 3GRRA 2K4MA 1NT2A 3UJBA 3NW9A 3LDUA 5EPEA 3UJ6A 2Q41A 3DMGA 5G02A 1G8SA 5F2OA 5FWAA 2NXCA 1RI1A 3QOWA 1G6Q1 4FS8A 1EQAA 3KQWA 4C06A 2IFTA 2BZGA 1RI2A 5EVJA 1X19A 1X1AA 3GU3A 3KPJA 3KR2A 3UJDA 2KW5A 2OZVA 2IBTA 5JUWA 2ZBRA 1MJFA 3SX0A 4YUVA 3P2IA 4YMGA 2R6ZA 9MHTA 1NBHA 1JTEA 2XYRA 3T0IA 4X60A 1KIAA 2H00A 4WXHA 3PFGA 5DRTA 2JG3A 3MCTA 4A6DA 4FT4A 4IV8A 1I1NA 3A26A 3NDIA 1KXZA 5MHTA 5KVAA 1TW3A 1BOOA 4PONA 3GWZA 4PYNA 3NVKI 4YV0A 1WY7A 4E33A 5F2NA 5ICGA 4IV0A 1TPYA 3KQYA 5EMMA 2FYTA 2PV0A 4OQDA 3GXOA 4QVGA 2AS0A 3UA3A 5FHQA 2YR0A 2ZZMA 5CD1A 2ZWAA 1YZ3A 3MTEA 4MHTA 1IM8A 3KPWA 1P39A 2V74B 5HIMA 1P1CA 3HM2A 2VZ9A 5GIPE 1VPTA 3HCAA 3MTIA 1V39A 3OFKA 4YMHA 2IBSA 2I6GA 5DSTA 2BM8A 3EVDA 3EGEA 1RI5A 3TOSA 3B3JA 2ZZKA 3FPJA 3EMBA 3P2KA 3AXTA 5DWQA 2JH8A 5CIYA 4FSDA 3B7PA 3FTFA 4YUYA 4QPNA 3V97A 4YV1A 5LR6A 4IWNA 2P40A 2HWKA 2B2CA 4OA5A 4XCXA 3DP7A 3O7WA 2ZFUA 2IP2A 4LECA 4QPPA 3A7EA 5E1OA 1YFJA 2QE6A 4GOMD 2IPXA 3LSTA 1I4WA 4EK9A 4X61A 1B42A 2YUIA 4HSGA 1WXWA 3IEIA 3QV2A 4A6EA 3GO4A 1OR8A 4PGHA 2JH9A 1SKMA 3G2QA 4RTQA 3WSTA 1G55A 4DM3A 2B25A 2PGXA 3LX6A 4PYQA 3F4KA 2JHAA 3O31A 4MWZA 5EKXA 4DCGA 3DOUA 3PX3A 1XVAA 2ZULA 4YV2A 2OY0A 2CL5A 2ZTHA 3HCDA 1VQ1A 1JSXA 3KPVA 3NVMB 5C0OE 1XCLA 2P35A 2OBFA 3G2MA 4AX8A 2AN4A 5DTQA 1ZGJA 3DXZA 1WG8A 2JHPA 3HA3A 1X1DA 1Q0SA 2PY6A 3UJCA 4E2XA 5K0BA 3I58A 4PYOA 5D1NA 3C6MA 1RJGA 4ER3A 2XYQA 1NW5A 3BGDA 3GNLA 3OE4A 4CXMA 5EC8A 5B1SA 3R9XB 2ZBPA 5DM0A 4DZRA 5LSAA 3BXOA 3PTAA 4CTJA 4QDJA 2VDWA 3VSEA 2AOVA 1F38A 3FPGA 5K09A 1R8XA 4FGZA 3UJAA 5FA5A 3M6XA 1VBFA 5CUQA 4BLWA 1FP2A 5LQAA 2NXNA 3LHDA 4FR0A 3FYDA 4FP9A 1T43A 4P7KA 3M70A 4PWYA 4V0QA 5DLYA 5EMJA 1P1BA 2R3SA 4AZSA 4P58A 3EVBA 1L3IA 4ER5A 2ONYA 4PIPA 1PJZA 2GS9A 5GWXA 1KPGA 2CMHA 3LDFA 4YUZA 3ERCA 4QQKA 1VP9A 3EVGA 1NV9A 3P8ZA 4EQZA 3G88A 1XCJA 2ADMA 3UJ7A 2IDJA 4GC9A 5CCBA 3UWPA 3EGVA 4E2WA 2ZIEA 2PSSA 1YZHA 4QTTB 1NW3A 3TQSA 4FSXA 5HFJA 3FZGA 5K0FA 4MTLA 3FTDA 5CVEA 2VDVE 3SSNA 3FUXA 3JWIA 2ZCJA 3C0KA 3MGGA 5E2BA 1EIZA 2NNWB 1JQ3A 4HRAA 1ORHA 4C03A 3UJ9A 5BW4A 4HTFA 4RVHA 1R6AA 3NJRA 1ORIA 2DPMA 5DX0A 4GUAA 3AXSA 3SVZA 1NBIA 2O06A 3GGDA 3E8SA 3M6UA 4H0NA 3BWCA 2GA9A 3M6VA 3EVCA 5FQOA 4U7PB 2HR1A 4GF5A 3A25A 3ORHA 1PRYA 2UYQA 4Z2YA 5LQJA 2PKWA 5EIFA 2Z6QA 3T7SA 3EVFA 3VYWA 4RV9A 3M4XA 3HNRA 1RJDA 3OCJA 4QQNA 1DUSA 4QVKA 1Y8CA 3UA4A 1JG4A 5E1MA 1KHHA 3EGIA 4PYLA 4EKIA 5DT2A 3TM4A 4E30A 3FUWA 3MQ2A 1DL5A 4V0RA 1D2GA 2PJDA 3IYLW 5K0LA 4XUDA 5K0GA 4LWOA 3CGGA 1ZGAA 5ERGB 4CWAA 4C07A 3ME5A 3TM5A 2PX5A 2GPYA 2G70A 3DH0A 2Y1WA 3KQSA 4C04A 3G8BA 3OU2A 5K0CA 2HMYB 4MIKA 5E8JA 4KDCA 2IIPA 2HV9A 2EJTA 5FWDA 2IDKA 4R6WA 5ICCA 4E70A 4RTLA 2XYVA 4X41A 5EMLA 4RTKA 1NKVA 4DCMA 2Z6UA 4R8RA 3AJDA 3E05A 1EJ0A
chains in the Genus database with same CATH superfamily
2VHYA 2NU6B 2AHRA 5CW2A 3W9UA 1QVWA 2QGFA 1NP6A 1XRQA 1Z4KA 2VYCA 5DFAA 4DNOA 4POAA 4O4IF 3RTCA 3WKEA 2GPBA 4BRZA 1WXIA 2QYOA 2ZYDA 1VBKA 1C9DB 1TKCA 2PX6A 3DF7A 1HYEA 2IZ6A 3PHHA 2WEKA 3RD5A 4IVNA 1QGAA 1C7RA 3HB9A 3P9NA 4KDEA 4UOEA 1A2OA 3TQOA 4AMVA 1PJBA 2CDBA 1UXGA 4O33A 1XU4A 5I7UA 2H1VA 2PH3A 1W48A 2RI1A 3A1VA 3O73A 3OEYA 4MVJE 5GVRA 3TZ6A 1LC0A 1RJFA 3HZRA 3CIFA 5FR1A 3EUEA 2QQEA 4N3CA 5JMOA 3ZWCA 5CCXA 5EKSA 1HNXB 3T9FA 4YRLA 2ZSUA 1G2QA 4FNAA 3KAQA 4HN2A 3LM8A 5A71A 3B5JA 4EG7A 1VE5A 3P5BA 4F9GA 5AW6A 1V7PC 2OHGA 4LDAA 1BHSA 2VUUA 4EAQA 3NYWA 4G07A 3NIBA 1PZXA 1WHTA 1US8B 4PLGA 3TEFA 4AUKA 3G0OA 3NIGB 3OWXA 4C14A 4CT5A 2F7SA 3GLHA 4DSUA 5EIBD 3FHLA 2HADA 1H5QA 1KKUA 3CO5A 4ER7A 1SXPA 1F8FA 1GCOA 3ADOA 2Z2JA 5HOQA 3M82A 4LISA 4BAUA 2GHTA 2HJ9A 4RDCA 1H2RS 3CR3C 1PHPA 4WZAB 4AAYA 2AI2A 1QZZA 3HU2A 4BP9A 1AZWA 1M2JA 2YMQA 2XYPA 3EDOA 5K3DA 3VUEA 4ZYTA 3BE6A 3D6FA 5KQSA 3TUIC 3GIWA 1TAUA 2WJ3A 3RJTA 1BMFA 2VNHA 4BLOA 1L5RA 2REXB 4P5PA 4PSVA 1AIPA 4ZJPA 2CV0A 2D3WA 2NO4A 4JYPA 2G80A 5LDGA 3GJYA 4R9RA 1IWBB 3UPUA 1R6TA 1US8A 2IHTA 1Z0DA 1PFKA 3UXHA 1EK1A 1QDEA 1SZPA 2JI4A 3BHMA 2GTHA 1HQCA 4XAQA 1CXZA 3W8DA 4MP8A 1DEHA 2R62A 4INAA 3JAMA 3Q3CA 4LJ5A 5ALGA 4PLZA 1HSZA 1OMOA 2L17A 3TLGA 2ZUEA 2NO6A 4CIBA 4EVIA 5IM5A 5BSVA 2MHCA 3O4HA 5EKUA 4DUYB 5AJTA 3EG9B 1C2YA 8AT1A 3Q3IA 1P17A 2C1XA 2YFKA 1YL7A 2EC5A 2FPPA 2ST1A 3CV3A 1TO6A 2PN1A 1I3OA 5BN4B 8ABPA 2AMVA 1E5QA 5AVZA 3FWZA 3ZE9A 3GEBA 3R8XA 3K2IA 3KZVA 2YJNA 5FQNA 5B55A 4AJ9A 1GVHA 4OHOA 4BX8A 3LO5A 1BAPA 1RR6A 3TH5A 5JZVA 1JSZA 3IESA 2WWFA 5I8WA 1UKZA 1AS3A 4NOJA 1XF1A 1GD1O 1DRWA 3NETA 4KIFA 3LQ4A 4RV5A 5AK4A 3LG2A 2YXLA 2CVHA 5DTIA 4PZZA 3UK6A 4PG6A 3LECA 1U2RA 4GR4A 3HCFA 3EG9A 4PGGA 3AVYA 3RFXA 2RHGB 3BE4A 1JG3A 4WK2B 4AROA 5CYGA 3Q11A 3OZEA 3TVYA 4B5LA 2R6HA 3BF8A 1JUDA 4Q9IA 2RAPA 3VU1A 4DIDA 1NM5C 3GXBA 5DZSA 5EFZA 4HT3B 5F3DA 4CG0A 1Z6XA 1SVMA 2Q8NA 4OTZA 1E1YA 1U3FA 1U5CA 3UHPA 4MR7B 2XKJE 2QTMA 4KJXA 3DFMA 3LCUA 2XT9A 1AQIA 1PSZA 2G1PA 1U1EA 4NULA 4TT3A 3RF7A 2J87A 3L18A 3F8WA 3NEYA 5JCJA 5KSWB 1E3QA 3DMYA 2DOKA 4Z8YA 3UCEA 4F91B 1KP9A 1O94D 2AUMA 3IEXA 4XQ9A 3H1GA 1OD6A 1SC4A 3K1AB 4L50A 1I14A 2B4TO 4H4DA 4NAVA 1FZQA 5CLGA 2WJVA 1BO6A 1CYEA 1FJGB 4D3YA 5F7OA 5CNIA 2CK3A 4EO7A 1B7GO 1XOIA 2WU3A 3STWA 1RXIA 4PYIA 4GP9A 1RRMA 2J7KA 3N2GB 3H6HA 3LC1O 3ZWXA 2R8RA 3IT2A 5BQPA 1KMIY 3NKLA 1MIHA 2P2LA 5H59A 3WWDA 1BU5A 2HC9A 3S0JA 3UV6A 2O57A 1V47A 1O97D 2NXJA 4ZO8A 3ZWPA 5HS4A 5FD8A 3VYSB 4TMFA 2WBLC 3BWMA 4OFZA 1COWA 2PDAA 4MUIA 4OMDA 4R1QA 1L7NA 4HFMA 4JQCA 4UUOA 1VCHA 2PVPA 3K1AA 2YRFA 2ILTA 3FNIA 1XZCA 4ZOLF 1YF3A 3WRVA 4L85A 3FX2A 1VM6A 2QE7D 2RONA 4IG9A 3IQHX 5GP1A 3PD0A 1J5PA 1E2NA 1QHYA 4IX1A 2PO5A 3UHFA 3B60A 1MV8A 4INZA 3BMXA 1NQAO 3E7PA 1XRLA 3QXXA 1SBNE 2AX4A 2WE8A 2E18A 2JPDA 2IZ7A 3EVZA 2IYUA 3VAAA 3PVCA 2Q0XA 5HKLA 3T95A 3IHTA 3RK1A 1IXZA 1OVMA 3EASA 4O3FA 4YFVA 3IKTA 4QZVA 1JVSA 3CVOA 4QA9A 3U17A 3G9TA 4WNCA 5TPWA 5JQGA 3UVEA 5CDFE 3TMAA 1CCWA 5JATA 3UV3A 1FDSA 1HQDA 1L4BA 4QREA 5FI1B 4BP3A 3FSRA 3AM3A 1WBDA 2DY1A 3ABSB 4JFRA 1OPRA 3V3KA 2BI4A 5HIJA 1QTIA 4GEKA 3QWBA 1VPWA 2ZREA 3CS3A 4TRRA 3R5XA 3UXYA 4AY6A 1NXSA 1VB5A 1RYDA 3F9RA 3JATB 1C80A 3FUUA 4OLHA 4LJSA 3RH0A 3UG7A 1NQTA 3C6ZA 4JKIA 4R9NA 3P4YA 5AKGA 4HN9A 1ZGGA 1WU7A 4ZI5A 3V8MA 4CR6A 2Q3FA 4E4RA 4BLQA 4P5DA 3BWBA 2EW8A 2DPGA 1RHKA 1Z28A 1QHIA 4FXPA 4LAFA 4IX9A 4D81A 2QY6A 2XOKA 4KN9S 1LBHA 4NE7A 5JSZB 5LQCA 4UULA 2GBGA 3C3EA 3LWBA 2QZ4A 1JA0A 1FFAA 4PO8A 5C34B 2B34A 2IY9A 3L0DA 1RADA 2IHYA 1NVTA 4QG3A 1TF7A 1V9SA 3F47A 3I6MA 4ITRC 5FH9A 2RARA 3PKIA 3SIRA 2IA5A 4OHCA 1QIEA 1NW8A 1E9SA 4MGEA 4M8NE 2O5RA 3DPSA 3OJWA 1YR7A 3OAAD 2FDRA 4KG7A 5HQ3A 1ST2A 5HCNA 3VBEA 4JUIA 3SSOA 3D31A 3UWMA 2F64A 1QX3A 3WP1B 4QYWA 3MN1A 3A28A 4QX6A 3TCKA 1KH2A 1KR5A 1OBFO 2BZ1A 2IUYA 4TM7A 3SBEA 1ISRA 5TEWA 4M53A 1DKNA 4YRPA 5JSZA 1D2MA 1EFPB 1C8KA 2FE4A 4DCVA 3TPZA 4EHBA 1G4AE 4GOJA 4OXIA 3ICCA 4G1EB 5C4GB 4CLEA 5IS2A 4K87A 2BGUA 1KO7A 1P72A 2JGJA 2O2EA 2WJ6A 3DMDA 3MJCA 4HLQB 2Y27A 4PIMA 5A1TA 4PRKA 1M2FA 3W06A 3R74A 5REQB 1VLLA 2B0JA 3G8AA 2A5LA 3R3HA 3M89A 1ZVKA 1IN4A 3HJRA 3U6KA 1FL9A 2W11A 1U94A 5A1JA 2AEFA 4CM5A 5JD4A 3FRIA 3TQTA 3LYUA 4GAEA 4QTUB 4R1NA 1RLTA 3WNQA 2XRMA 2H4HA 3I9V1 1JAHA 3VPCA 4D8TA 3FPEA 1Z4PX 3L4KA 3ETCA 3KQPA 4DJDC 3D6AA 3LPAA 3GRYA 4Z0NA 3IDQA 3DBVO 4DEVA 1XNQB 1RTTA 2P4UA 3ND9A 3L7AA 2AR9A 4Q4DA 4AX4A 3PEWA 1T9GS 3WNZA 2ZI3A 1VZ2A 3CSUA 5KYXA 4BCCA 4CL8A 4GOKA 1C9MA 1DRJA 5DGTA 3HXPA 1MVLA 2XWJI 3T7CA 3IERA 3K1ZA 4M0EA 4D98A 3W4JA 1RI2A 3AIOA 1MO4A 1H85A 3AHIA 4HGQA 3WA7A 4XYGA 2XCUA 2F43B 1FA9A 2A33A 4X90A 4ZCLA 1GUFA 4KQIA 4Q39A 4C30A 4EHLA 2QNIA 1G64A 3E5RA 3WAKA 2VYQA 3KSDO 3SJ7A 1NJ1A 3F71A 5CLJA 1QPGA 2GK7A 2JJ2A 4LDQA 3ST7A 3X1ZA 5EZ6B 4Q16A 3VKUA 3T0IA 1PW5A 4DR7B 1GLGA 1Y42X 1WXEA 2I4RA 2K7ZA 3VPAA 1IB6A 5ESRA 3ER6A 2JFVA 1E6KA 2BEWA 2PZFA 3C3BA 3GPBA 2DFDA 1ATZA 2I34A 3PXAA 1IMJA 2F9FA 4HI0E 4MQ5A 4IV8A 2FSUA 3GBSA 4LXUA 4HNUA 1NMXA 1ZMBA 3ENQA 3R6DA 5DLDA 5DBOA 1ZC3A 1J0EA 3VI4B 3QNUA 2F43A 3U7GA 1GCUA 1Z73A 2QMHA 2YWDA 4GLJA 4FCCA 3VHLB 3IUMA 1JG6A 1OCEA 1KZ9A 1GDHA 3OO0A 4GDFA 1XNGA 4L4UA 4TVBA 4US0R 5AW7A 1KJWA 1QYVA 3JRWA 5JASA 1OF1A 1TUBA 5E0KB 4MHTA 1GDTA 3W9SA 2P2YA 3NCHA 2V9CA 3Q41A 1P1CA 1KJYA 1EK5A 3IT0A 3OO1A 3R7DA 2V3VA 3I92A 5A4FS 1F17A 2TMYA 2BKLA 1L4GA 1QK4A 3ETLA 2C42A 2ATCA 3OT5A 4MWTA 3UMRA 2RHBA 4GZ3A 2ODNA 1U1DA 2IZ5A 4CUZA 1IN8A 3QMWA 5I8ZA 1DADA 1E6EA 1FJ2A 4IIUA 3ZIUA 4DR6B 3COZA 3D4OA 3DL0A 2HWKA 4HX9A 4XCXA 4YRTA 5T8KC 4ACBA 5GTDA 1CK4A 3QSYA 5KTSA 1Q91A 5AI6A 4P98A 2WD7B 3RS2A 2F8SA 1K86A 4LE1A 2JA1A 3H8VA 5C8YA 2DC1A 2IUEA 2HO4A 3DFKA 4S24A 2IWRA 3TQCA 3WGMA 2RIPA 3CEPB 5ITZA 2AYZA 3I1IA 1T1SA 3PXGA 3KUCA 3UOGA 2G07A 1DG3A 2OGSA 4MGHA 4EM6A 4IHJB 4WK0B 1XVAA 2H51A 2J9XB 2DM6A 2WUEA 2FX3A 2ZULA 2QI9C 3CYFA 4I4LA 3B51X 3OECA 2DQYA 4Q3OA 1SKYB 3R5JA 2UVPB 2B4YA 4FHFA 4DT1B 1DHTA 4RJKA 5FPHA 1SIUA 1GGVA 3P27A 1ZOPA 3EQZA 4D0NA 5KQMA 1UUFA 2JIOA 3DEFA 1JTVA 3ETJA 3OMLA 1XLTC 3FHOA 3I6BA 4DADA 2IZ1A 2OHVA 3AR6A 4YMIA 1NWCA 4I4TF 1UPBA 2GD1O 1XV5A 2PX3A 2HA2A 1R8XA 3EEQA 1SH7A 4WEOA 1VBMA 1VBFA 2ZITA 4G8BA 2YYYA 3D1JA 1ZIXA 4C6HA 1Q77A 3CVUA 4P7KA 4X5OA 2UVPA 2RC5A 3WKCA 1BGWA 4RY8A 3K6KA 2XGGA 3S4YA 4P58A 3ESYA 2OK8A 3M1YA 4PZDA 4DG8A 2CMHA 3LFHA 4JQSA 1TUGA 4EP1A 3W2EA 4W5TA 1ESMA 2ZYWX 1BD3A 1TZMA 2CYAA 1YCFA 4YLYA 5JRDS 2XUDA 3OWHA 3LGXA 3PVZA 4XSVA 5DBIA 5FR2A 4R5MA 2M6LA 3BMOA 2WMNB 2VJYA 3ZBPA 3L8MA 4LF6B 5B2FA 1CKEA 1Y3BE 2ZIEA 3ESAA 1EGQA 1Z29A 1PS0A 2FSIA 3QE2A 4BQOA 5AW8A 5HFJA 3HC7A 1YU6A 1JFFB 3LLMA 4MVYA 3FPSA 2VDVE 3ZCQA 1BNCA 1YQQA 1MN6A 3REGA 4CU2A 2IRWA 2PZJA 3HJAA 4ILKA 2PRYA 2NNWB 3GT0A 3L77A 4N6GA 5HFNA 3P9RA 3QKUA 2ZYSA 4RYDA 4IF6A 3N58A 3H2YA 3C41J 4YAUA 2CHEA 1ISIA 1FXUA 1I1OA 2QLLA 4JBGA 1TVKB 1ATIA 2NO7A 4OREX 5TPZA 1PJSA 3T4PA 1G5PA 4DRXB 1XZQA 2O06A 1VIMA 1JGTA 2JLSA 4MVJH 2GA9A 1NN3A 3A2MA 3ZLBA 4C3UA 5BV8A 4N3BA 1OPXA 5TB5A 3DL4A 2FSSA 3MCVA 1ZINA 4NBSA 2B4QA 2IY8A 1J90A 4QUIA 4MR8A 1BVUA 4RF2A 4MLZA 4ARVA 3K0FA 4GX0A 3WDMA 1P81A 2J9YB 1JG4A 3VR3D 1JFFA 1YR9A 4Z99A 4G0VA 5DHFA 5DT2A 3KCQA 3MQ2A 2XMRA 3N8IA 5GV8A 1D2GA 4RELA 2XZPA 1RYMA 4HQRA 2DBYA 3TI9A 1EU1A 4CWAA 2EIHA 4QUAA 2GPYA 4TV9B 1OHHD 3UICA 4KE9A 4EELA 4Y7CA 4BVGA 5G40A 2R5FA 1RHRA 1F5NA 3RVQA 4I8IA 2B6NA 3CF0A 3FFTA 2QR2A 2RGNA 4FPXA 4IXDA 3RF6A 2HFJA 1OLUA 3GT3A 4OU5A 3MWDB 1EX9A 2O05A 3ELWA 3N07A 3CINA 4HAZA 3R0JA 4H0CA 3HADA 4OXQA 1VI2A 6GPBA 3PNKA 3CM0A 2XKBA 1W4AA 3NVAA 2G88A 5FOVA 1V25A 5KIAA 4PQFA 4AJOA 2C31A 4K9RA 2V54A 1TCCA 2O19A 3IR5A 5ALUA 3C4JA 3M1LA 2XUQA 4Y0VA 5H8WA 2MR5A 3HXTA 1D2HA 2R97A 2V0CA 1F5SA 3VOAA 1FSSA 1EVEA 2OCPA 4JU9A 1SD5A 3L7NA 1G8YA 3T7JA 3T1VA 3R9WA 1DMSA 3EZLA 1ETHA 1H8EA 1HI9A 1NSYA 5FEUA 1F7UA 3PXEA 2I29A 4KMRA 5D01A 4KQ1A 5EUCA 4AJ4A 821PA 4LSGA 1BVYF 1VE6A 4QJ5A 2R60A 4ZT7A 5EXTA 1XRSB 3I0ZA 3AONB 3MWDA 1FS5A 1SG0A 1U0OC 2GF9A 3C3WA 3A4MA 4I14A 4X20B 5K3CA 3I2GA 3I23A 2RGUA 5CT6A 4WLFA 1E9CA 4NK5A 5DK4A 4BZZA 5C3MA 3KWLA 1JA9A 5LQDA 3KFVA 3D8UA 3P1JA 4UC0A 1UH5A 2GXUA 5CYPA 3WBBA 5JVDA 1SCUA 3BL5A 3E8XA 4HNHA 5EP4A 4AJ1A 5IKMA 2ZIXB 2X8BA 4RH1A 1S0UA 2EJWA 5EJFA 2GBPA 2QY9A 5HOEA 3MW8A 2X5NA 4POOA 2GYWA 3GRKA 3SZRA 1GUBA 1JR3A 3KD3A 1BFDA 4K88A 1QYIA 1WCYA 2ZJ8A 4FFBA 4O8CA 2P2GA 4KDFA 3HKEB 4OAPA 2C94A 2Q4EA 4KK3A 5K0GA 5AI9A 1UEIA 4GX2A 3EIWA 3OPMA 1JQAA 1A9SA 4H4EA 1JHXA 3OCCA 2ZIXA 4B80A 5IFLA 1XEFA 3P7MA 2P3LA 4G4GA 3KQNA 4QUDA 2R6CA 3SOPA 3PX2A 4L8LA 2W5UA 4DMUB 5BWLA 1Y8RA 4IMJB 4R83A 1ULTA 3ZXXA 4YJ2A 3VNVA 1IC6A 3B12A 4UUPA 3P2EA 4RK4A 3WGIA 2JGNA 2GK4A 5BWMA 3L7IA 1FYFA 1X42A 5DHQA 1ND5A 1Y63A 4W1PA 1U5BB 1OWMA 1Y5MA 3WNDA 3HKEA 2GHIA 3H86A 3KRTA 1EFAA 2XR1A 3Q5GA 4LJ7A 4G0NA 4EI2A 1IHXA 3CZQA 1K8RA 4F8JA 2YYAA 4CCYB 3F1KA 4G5GA 5AQEA 4HN4B 1CZRA 3MAGA 4Q3BA 2WAAA 4ZVRA 5J1SB 4DCOA 3P0FA 5KYNA 4DAEA 1WPGA 2NQTA 5DT9A 5EHGA 4C0HA 3SMQA 5KSPA 3TR6A 1OREA 1RJ9B 1JLKA 2FRXA 5JNTA 2I7TA 2IGTA 1CHNA 5DDIP 3JQRA 3TNJA 1JFRA 4JJ7A 3MUNA 1D2EA 1U5BA 3H6KA 1P2TA 3DTTA 1LVGA 3NBAA 3C3KA 4FT2A 1WSDA 1YAHA 3HVJA 3WBKA 3ZVLA 1AGNA 1T9ZA 3HP4A 2IDMA 2C2YA 2FUKA 1KXJA 3KQQA 3ZWWA 5HKOA 2OKCA 2EQ5A 4YR9A 3TZBA 2VWHA 5A6SA 1EUDA 1WLYA 2FW7A 4BNFA 2H92A 1E20A 4AZ3A 3STVA 1O03A 3AYXB 3B38A 3KWJA 4WLUA 5KOHA 1UPTA 4C4XA 3U3KA 1GFWA 3UB2A 4QLOA 5E8RA 1J2RA 5B6JA 4TWBA 4RFSA 3NU1A 5EHQA 3GN2A 3Q5DA 4EY4A 3WB2A 2ODQA 2YWHA 1UXKA 2OD9A 4W7HA 1TQ8A 2OO3A 4TMKA 2C4VA 2CJXA 3CLHA 4PXAA 3PFFA 2R6DA 2XYHA 4AC9A 1V35A 4BNZA 2OC4A 2DUNA 5AESA 2I66A 3O4GA 1VKNA 4B7XA 1GTRA 1HMYA 1RCTE 2Q7DA 4WDQA 1PR9A 1ES9A 2H3HA 2I6UA 1U9YA 2QM8A 2QRVA 3OE1A 4NOKA 4TLAA 4DM4A 4CQNA 1XZJA 3TFOA 3HZOA 1E7RA 2VYND 4JVOA 5G4KB 1UBNA 2HLDA 4D0SA 1PZNA 1O0SA 4QTZA 1T13A 3QELB 1Z5WA 3I6ZA 4CKBB 4Q05A 4AUNA 1BGXT 2B7CA 4YC7A 3CJTA 1T2NA 1U8YA 1QZ3A 5ES3A 4F06A 4HZGA 4MAAA 3BK2A 3INRA 1Z25A 1T26A 4GPEA 4HB2A 3G68A 3I28A 5CGQB 3U1BA 1G8PA 1SEVA 3DEJA 1ICEA 3PDHA 3QXHA 5HIKA 3HLKA 4HPJB 3V1NA 3PC7A 3GNSA 4IIYA 3B7WA 2G7MC 1U0HC 2GRUA 3AB7A 3JQ9C 1E2IA 3AOGA 4CKWB 4P6VF 1O54A 1OLOA 1ZLXA 4MKGA 1K0FA 1RQRA 1HDRA 3FMIA 3DPUA 3QELA 3JQFC 4RPJA 721PA 1G21B 1ZKMA 1W30A 2WFLA 2W0MA 2XJ4A 2QQFA 3CUSA 4WESB 4BIMA 4EKGA 4Y67A 3CLRC 4U7FA 1V7QA 5IDYA 2JNWA 1JMKC 1JHQA 2PZGA 3DEIA 3G89A 4FHEA 3ZZ0A 4CTKA 4XX0B 2PRSA 1ODLA 1MC8A 4PRZA 4YFYA 1N5IA 1KARA 2O0LA 1CJBA 5CVVA 3RUHA 4YH1A 4AKSA 3KB6A 4DDWA 3RAEC 2O52A 3DT8A 2P2SA 1GQFA 2WF8A 1G16A 5FIUA 2OAQ1 3RVLA 3SHQA 2DPYA 4AURA 4D8UA 2E4ZA 1UWVA 4CT4B 3MWKA 4LGVA 3USES 3DZDA 2JJ8A 2R7NA 2ECQA 3I39X 1PD1A 4RABA 5F9MA 3AKZA 1GFZA 3JYLA 4J0EA 1G21A 1PR0A 1EGVB 3FCUB 4QAJA 4U7JA 1UBGA 2OTCA 1H6AA 4WESA 1UBOS 4NG5A 2YDYA 3UMJA 2HBZA 5L4NA 1YE3A 1TAHA 4FMDF 1Z75A 3ND6A 4F5ZA 1MJ5A 1MT3A 4NYMQ 4XX0A 5ALPA 5SICE 3VJLA 4OQYA 3A0UA 1ORVA 4AKEA 3C98A 2X6QA 2DUJA 2A3NA 3ED1A 4GQAA 5LB2A 2NPIA 4LV5B 4QEZA 3C5HA 3RUFA 4MVWA 3RRXA 1NXOA 2WK1A 3KKKA 4QPDA 2BH2A 1OOEA 1TGYA 4KJZA 3P2OA 4BPRA 4X1KB 5DE3A 3FIUA 5CT5A 3ZZUA 4B71A 3DLIA 1NF2A 4Y30A 3L02A 5A4AA 3ZXUB 2XTZA 3PEUA 4MROA 1F8YA 2H1RA 3H13A 1JFSA 1N2EA 2OGWA 1R7RA 2JGMA 2HWUA 2JARA 3NG1A 5KNLA 2BMDA 2ILVA 3R3WA 2PK3A 4BQEA 4GO1A 1DKLA 1GG9A 2G8NA 2GCGA 4HYEA 3TR0A 3K1YA 3D7MA 1E59A 2JFPA 1XA3A 4IJMA 4N7MA 2HUNA 3V8BA 1QHGA 3HR4A 5B2ZA 3IB6A 4YA6A 4TQAA 5HF8A 1U28A 1P4JA 3H2SA 4F92B 2BJHA 2C2OA 4X1KA 2GEKA 3ODPA 4U9IS 2VQDA 4O4HA 5DNUA 4K46A 5EWJA 4NICA 3FH0A 4NH0A 4Y2YA 1UJ5A 3NTRA 4N82A 4DAOA 1AV6A 2EAUA 2OORA 3ZC3A 4ND7A 1QK3A 2JCVA 3BSYA 1A88A 2GZMA 3CX8A 2Q2WA 4Y2JA 1NJ2A 3OCXA 1FSZA 3L0BA 5AUNB 3OA2A 5I9SA 4F1KA 1R18A 3PKZA 4GVXA 4JOBA 4CODB 3ABOB 1GL3A 2VQ6A 1E1NA 4DREA 3PNPA 1U2EA 3LS2A 1JA1A 2XQFA 5IJZA 4PFQA 3B78A 2O14A 1A8QA 1OU0A 1UBFA 3DMGA 2SKCA 1OLSA 5BR1A 1ZN9A 2E2WA 3Q12A 1QP4A 3RLFA 2CFOA 3WP0A 3K9WA 1P0MA 1L1QA 3Q9SA 2P5UA 2PUBA 3MRTA 4L0CA 1ZH0A 3GNQA 1GAXA 4LBVA 4HNAA 2BEKA 4HAVA 2IYNA 3IA2A 1TCAA 1R5NA 3LF1A 3EIFA 1TQHA 1XB2A 5BPHA 1F6WA 4OYLA 1GV0A 3A6HA 1T5HX 1C7QA 1NJGA 4NJMA 2Y05A 1E3IA 2R7KA 2R4UA 1VLHA 3DZHA 1RQLA 4RPKA 2J7PD 3IP1A 3OJ0A 4QU9A 2GPWA 3H5NA 3NTLA 1DAGA 1TF5A 2WU4A 2YY7A 2ZT5A 3TRDA 1I24A 2KS6A 2G9VA 4QLAA 4V0KA 3MCTA 1TM1E 3FGNA 2BM1A 2YZ7A 4JUCA 3WGQA 3WL7A 4OFXA 3GB9A 7REQB 4W1SA 1KZGB 1L5FA 2XXJA 3C8UA 3GWZA 4C6RA 4RD6A 1ZI6A 5CBKA 5F2NA 5IFKA 2C84A 1G5HA 3CZRA 1DJNA 3GBPA 4NMWA 4OIFA 2QSYA 1SR8A 2P9TA 3K5PA 2OZKA 2FPMA 3O6VA 4B73A 1C7JA 4RKEA 2PUTA 3VKFA 2F62A 1P39A 2DWUA 4MEAA 4MI3A 4ZP1A 5MGNA 3RSZA 1XDBA 5LJLA 2AE2A 5J1TB 4R0NA 3QP9A 4GD3Q 5KKCA 3RSCA 2CXPA 5B64A 5IBRA 1N6RA 4EG0A 2ZUVA 3QF7A 4G01B 4RJJA 1RI5A 4TUYA 2H1IA 4LOKA 5FWYB 3RYIA 3EMBA 4AN0A 1TXGA 4UM9B 4KXQA 5EI5A 4C4OA 4XEUA 4Z4GA 5M2QA 5HBGA 3V97A 4JP8A 1LJ8A 2FFRA 3S2IA 4NYJQ 4DSOA 1E18A 2PA3A 2OV1A 2FW0A 1PSWA 3A1WA 4OP2A 2CZCA 3NFRA 5AJZA 1GPAA 3EY4A 4FHZA 1GZHB 3UWDA 5K2OA 3FKSD 4LMBA 5D5QA 3BIOA 2PUDA 1EZZA 4MDFA 3LH5A 4JP5A 4LJLA 1FUUA 2ZJFA 3EGDB 3E3LA 3H1PA 3IEIA 5CXSA 2WMOB 4TKMA 2C0QA 5AH0A 4FFRA 4C2UA 2B25A 2PGXA 3LX6A 4ZYZA 1XAGA 1U7PA 3JQBA 4M76B 3WK7A 3IBFA 4WUVA 2I6QA 3ZX5A 1T4CA 1H5NA 5SZIA 5C5CA 1KFCB 1GZ6A 4HFNA 4EVQA 2B20A 3B2EA 3F6EX 4FHDA 4LFCB 5JXIA 3B2QA 5FT9A 1PEKE 3SYNA 5C80A 2C1EA 1XP8A 4WHMA 4XPIA 2EBUA 3I58A 4CIDA 2O8BA 3C6MA 4UU1A 2GASA 3VKHA 3GLHE 4ZPJA 1PK9A 1YDWA 5IAGA 5HNKA 1Z26A 2FAXA 3TBHA 1UMBB 5DO9A 2WFMA 2ZBPA 2KX7A 1YL5A 3L1KA 4HH3C 2OYCA 1SBHA 2PNFA 4QT4A 2R79A 1J1UA 3IJRA 5JBIA 1IM2A 2DQ4A 4U8HA 3I04M 1X7GA 3RU2A 4DWJA 3CCBA 5JY6A 5B7PA 1X92A 2YMMA 1FP2A 1QP8A 1UOPA 5K2MA 2NXNA 4LXIA 4YPVA 2VEDA 2AZ4A 3NAGA 4FP9A 4J90A 1JDBB 1ETUA 3FF4A 4ZRNA 5ESWA 1PJZA 1U1IA 2F8MA 5GWXA 1EFLA 2TECE 2FQ1A 3GDGA 4K1XA 1HDIA 1G98A 1Q83A 3DOEA 3QWAA 5DGIA 5DYIA 4A9AA 2OBMA 5KVSA 3OHSX 4YO7A 1ZD5A 1L5WA 3LV8A 4PXYA 5D51S 3WKDA 4F2HA 5KTNA 4R8KA 5BSEA 4D97A 1RQ7A 2C5EA 4WY8A 4QG7A 1R4ZA 5ADVA 3D8HA 4BTVA 1G8JA 3M3PA 1C8VB 1JSCA 1DZIA 2ZYAA 5AOCA 2Q6TA 3SN6A 2P75A 1AXGA 3AJEA 2EZ9A 3D5QA 1OFTA 4R51A 1EVLA 1Q14A 2EJVA 3DBLA 1CZHA 2NADA 4FMBB 5KSOA 3UBMA 2X13A 1VMIA 4YPOA 4BEBA 3K20A 1B0PA 1NONA 1SU7A 2DPMA 5DM60 2CD7A 1ZWLA 1NBIA 2EL7A 3FDJA 4JELA 4HDCA 3OI7A 1E2UA 1A5TA 1YFKA 3KJFA 3NPAA 4RVUA 5JYDA 4K05A 4JHLA 1WNTA 3AERA 1B16A 2ONJA 2PKWA 3L6RA 3RSOA 3AFNA 1CUCA 2FFBA 1NBAA 2GKSA 2ZAYA 2ZB2A 3AZQA 3H83A 1P1FA 4KWIA 5ALZA 5THKA 4M8KA 1F51E 1DX4A 1Y8CA 1C8BA 3OTHA 1E7YA 4GRAA 1LW6E 4EBBA 5IH7A 4PYLA 4C7OB 4UVEA 5JJLA 4LDJA 1ZNXA 3FVWA 2XRFA 4MWCA 1QHNA 4B8WA 3TVTA 1DIGA 1RRCA 4U9HS 4E5SA 1YCDA 4D8YA 3V4PB 1IWPB 3PDCA 5GZ1A 3H2ZA 3DYIA 5LXTB 2X3UA 5DNWA 2IKSA 2IIPA 5FWDA 4IDBA 3GQVA 2I2FA 3MK31 3HGTA 4D3FA 3GCXA 2BT4A 3OCVA 1OASA 3G17A 4NFHA 1GNRA 4DCMA 2Y71A 3MPOA 3HVHA 2GBIA 1GPWB 4IFTA 1BG6A 1GAWA 4XQCA 3T54A 3R7SA 5JVDF 5K8TA 1JHYA 4Z4QA 3EZ9A 1GLVA 2QVCA 4CKXA 5J4VA 1F3OA 1GIAA 4RJ2A 3WISA 1N6LA 1QK5A 4X71A 5CAEB 3WSVA 4ATNA 4MVJD 4EDHA 4EPYA 2XQKA 1C0KA 2IWHA 3DZIA 2OG2A 1KO1A 3KOYA 4A0RA 2QT0A 3QPUA 3G2NA 1HRKA 4RA6B 5KQRA 3R41A 4UREA 4X7PA 5LLTA 4Q3DA 1WEHA 1JU3A 1XI2A 2I62A 3HGQA 4L4RA 4FJ1A 4LX0A 4Z9BA 5IEBA 3AIKA 5BQOA 3SM3A 5I3ZA 4UXJA 4GIBA 2ZBGA 3TLJA 1M8PA 2BI7A 4KUHA 3WWPA 3JTEA 3DJYA 3DFUA 5HYVA 2ONZA 5A0FA 3KJEA 1ZNYA 3I1FA 3TD2A 1E9VA 2P9ZA 3STTA 2VLIA 3BL8A 4PXSA 1N2BA 5MFZA 4LJYA 1BMTA 1XF9A 2CSXA 1B8PA 4JN6B 5EXXA 3WX0A 3SD7A 2CWDA 3UAOA 1Z13A 1QANA 3DXXA 2WQZA 4HZUB 4KCGA 1B14A 1WULS 4PQRA 4YJ2F 5HIIA 2GAOA 2J67A 3BXPA 3ROGA 1QX4A 3D0RA 3NAMA 4V3BA 3IR7A 4TYMA 1A5ZA 2ZAIA 2MSDB 1G0OA 5G0SA 4DUZB 3KU4A 4XKJA 3MS7A 3JVVA 3T15A 2YHIB 2HU5A 4IW3B 2X9NA 5MN4A 4DLNA 1VL5A 4WBXC 1CP3A 2WHPB 3Q8KA 1SXJB 4IRUB 5JAQA 3FTCA 1PWHA 4NIMA 1UQRA 4LYYA 4MXDA 1ZMOA 5JFOA 1H0HA 2VP3A 3M4ZA 1WTAA 4HEHA 1E1CA 5UKDA 2ZUCA 3HBJA 4HZUA 2CKMA 3PFWO 4M1EA 1G5QA 4YJFA 2FMTA 2Y1XA 2TMDA 4LHXA 3BZUA 3NHZA 3W1WA 2C77A 1U6KA 1X7XB 3H5LA 4JGGA 4Q9DA 2GD2A 2MDTA 5C52B 1UR5A 3K6SA 5KINB 4E6EA 1HETA 2X9GA 2DTEA 1D2RA 3P45A 3TKAA 1EINA 4I5IA 4ZTUB 4B4KA 2H57A 1PJ2A 1SXJA 3RV4A 4KDRA 1JHOA 4PO1A 5DM1A 1OAAA 1JZSA 3FB4A 4ML3A 3B85A 1L7VC 1UBSB 4H6XA 3OICA 2HOQA 4OFWA 2MMCA 1QIFA 1EDBA 1N0UA 2X8JB 2QGZA 2YIJA 1IQ0A 1UBMS 3QVUA 1FJHA 1I51A 4J03A 4A8JA 3BN3A 1W1UA 3IOCA 3CE9A 1THGA 1YKFA 4CQMD 1TGVA 1X3LA 4V0MA 4ZDKA 1JQDA 1JIXA 4R7GA 1UADA 2GR9A 1L8XA 4G1BA 4WVFA 1II9A 1ZMTA 3LCJA 1M5UA 2GWRA 4LQLA 2W6PA 3V5NA 2WUDA 1LLUA 3R6TA 4IIGA 4N40A 3WO0A 4UTVA 3OF5A 5KWVA 2VSYA 2ACWA 4Y7DA 3GJ4A 1I94B 4AP9A 3D54D 2B83A 1UXOA 1C3JA 5DW0A 2X8JA 3UUWA 2DKNA 1P6XA 4EL0A 4FQ8A 3C3XA 1ESDA 3LLCA 3GMIA 3C6BA 4NZZA 4ZGWA 3FCEA 2QBYB 2B98A 2BD0A 2EW1A 3D0KA 4A03A 2XWQA 2CNWA 3E0QA 4Z53A 3KM0A 1HV8A 1F9EA 4DKJA 2AI1A 2FJ0A 2Q3BA 1XELA 3VR6A 4FEGA 2RKBA 2Z56A 4CIAA 1F1BA 2CNOA 1OYYA 4JUDX 5FBHA 1UEJA 5LP6B 3SJAA 1JBQA 4JT2A 4LG1A 1HH4A 4G41A 1CULC 1LBEA 3QLVA 4NEGA 4YCJA 1CUEA 4ZAZA 4YCNA 4CFSA 1ORWA 1LUAA 4G0WA 4K3VA 4ZYXA 1ZQ9A 2JEZA 3G5TA 2VTDA 2EWVA 1PL7A 4K6OA 5A03A 3UFBA 2H17A 5JRZA 2AMJA 2CWWA 4DNPA 4A15A 1ONNA 3QWIA 4JENA 2VJAA 4MLCA 4TV8A 1ABBA 1KMHA 4BBPA 2O0KA 1U99A 1XQ9A 5ITWA 2QBYA 3R0XA 1JJIA 3R2JA 1A3CA 4ENTA 5EMNA 2E6UX 2FSVA 2YXEA 3IBYA 1VE7A 1CEXA 2N47A 3QMMA 4KYUA 3QWHA 4D5EA 3CKMA 4UEOA 4XB6B 4CMKA 2ZAMA 2YMPA 4G5OA 4OJKA 1Y6JA 1TQ4A 1Y8QA 1ZITA 5IK2A 5AVSA 2ZVDA 4PZAA 2VP9A 3B3FA 4DLKA 3O8DA 1VGRA 3T1TA 2EV9A 2QX7A 2R8BA 2LD4A 4MCJA 2C57A 4AO8A 1J5XA 5IXYA 2J9FA 4DXHA 2G63A 4E5KA 3SVTA 4MI1A 2VA9A 2JCSA 1B0AA 3DUFB 2IXFA 1KAGA 3FR8A 4L4YA 1UDCA 4D3SA 3CR8A 3TW8A 1YFLA 1Y3HA 1U0LA 1UZAA 2AFHA 1J25A 1SPXA 3NRCA 4JL5A 3ONEA 3EUAA 1EFVB 4IQFA 1VKJA 3RFFA 2DERA 2VF2A 4Y2RA 1FXSA 2WZDA 1XU7A 3N39C 2VP2A 1DC4A 2WJGA 4MP6A 4AS3A 4BMXA 2DQKA 5K8VA 1JXMA 4BJ3A 1YQ9A 1P8JA 4LN1A 1QONA 4YYZA 5IF9A 1OBOA 1I33A 5ALDA 5A4DA 2JB9A 3BFVA 2D13A 1U0JA 3JVIA 3KVVA 2ARKA 2IIQA 1DDOA 4NH4A 3DEYX 4YTEA 2BUCA 4M1YA 3C5EA 3MGCA 4AFNA 1H4SA 3OLYA 2RGWA 3M1AA 4B48A 4TTTS 3DZFA 2OT3B 2PZEA 2YVLA 3GK3A 2NPOA 4AYXA 3FYUA 2QYTA 1PLJA 1EFVA 1NRIA 4IICA 2NUAA 3FHTA 2YN2A 4MPRA 2WIDA 4YJGB 4LSZA 4BO6A 1ZM2A 3ZLJA 1KFJB 3GLIA 3EQ7A 2FLVA 1PQYA 4OM7A 1VLVA 4RK5A 2PSDA 3ZWBA 4CEJB 2W48A 2WWGA 2WHYA 3A32A 3OFSA 4O4HF 5ALWA 4C08A 4PS0A 4B6SA 4GZLA 2BFEA 5AKJA 4MCAA 3L6EA 3LVQE 1ZI9A 3P4XA 1X0VA 1NVUQ 2GJ9A 3W1VA 3MS4A 3QTLA 2H1HA 1QLHA 5LZ7A 3ZVRA 1B93A 5L8VA 3AHDA 5T64A 1XEXA 4J0GA 4RK7A 2HJVA 1SXQA 2PNJA 4YCLA 1DJMA 1M0SA 4PNEA 1TNDA 1SU4A 4MMZB 4DVGA 1AJEA 5TS3A 2PU5A 3RHFA 2GWHA 5JD3A 3WQRA 1Z4IA 3DE4X 4EH1A 5HRUA 3U5TA 1D03A 1IOZA 2VUTA 2XODA 3SX4A 4ZK2A 2TYSB 4HMPA 3ZTYA 4M99A 4AZVA 1IJKA 4KGDA 4RZUA 4QYTA 4UHCA 1FYVA 1Z8DA 1II8B 4IPTA 3SOZA 4IINA 1DWPA 1E5DA 2Z3WA 4P33A 4J4HA 2IYSA 4CKEA 3LXMA 5FAXA 2FSGA 2O3SA 3T9CA 4RHTA 4TVSA 3OM1A 3AR4A 4WERA 1JQJC 3AI3A 4E5PA 1XNRB 3A4TA 3G5UA 1Z6GA 2BGRA 3HMKA 4KGXA 2FKNA 5HK9A 3NTXA 1S9DA 4B83A 5EIAA 2X3YA 2GVDC 1N78A 5F2KA 2BUBA 4DLZA 3G23A 1DTWB 1DIAA 3K9QO 3K31A 4Y1RB 3A2NA 1F0YA 4LZAA 4X3PA 5B4TA 1VE3A 2L18A 3FZNA 1SWWA 4QRDA 3OKCA 4P4UA 4BV2A 2PEYA 2X9QA 3IUEA 1TT7A 1WA5A 1VHLA 2R8XA 2HSWA 1K7YA 2ZI5A 1E3JA 4EKYA 1JEYA 1II8A 4E5DA 4GYWA 4NESA 2JGDA 1NY5A 4U63A 4TL8A 1JSRA 2A9JA 3RGGA 2WTMA 4Q5IA 1PWEA 1VMEA 2NV6A 4G5YA 1C7FA 4JX9A 2BZGA 2QR3A 2D3TA 3EDMA 2JBAB 4MW0A 3HLYA 3GJSA 2AHOA 2YIVX 2V6GA 5FTJA 5DGHA 5DGXA 4DCJA 1X6VA 3ENVA 5F2EA 4FNGA 3UJDA 4DSAA 1ID1A 3NHFA 1IYZA 2CLEB 5JUWA 1DIRA 3EGXA 4GMDA 1DTWA 1LEHA 4FOPA 3T3MB 4GPAA 3R0VA 3QYAA 4F3CA 4TUYF 1UZMA 4DIUA 1E89A 2PCLA 2VAXA 3H7AA 4HH0A 4J29A 1KIAA 4KP7A 3KL4A 2PCJA 3OA0A 4FFNA 4IJKA 5IYZA 1G9TA 2P9GA 1WJGA 1OSNA 3AF0A 4FW9A 4GRDA 4UAUA 2WP8J 1WMFA 3WB0A 3UGQA 1JLRA 3OT1A 4R9VA 2D0OB 3NRBA 4CV3A 5AJVB 1G0NA 4EFNA 4GLFA 2J3IA 2CXTA 4WLEA 2FRVA 2H06A 3ANTA 3RWOA 1FBTA 4BE4A 1H42A 1S2NA 2OL4A 1EG7A 5K6RA 5DXFA 2EQBA 3GXOA 1LCIA 2WTBA 2XMPA 5D3ZA 3W77A 1SY7A 3SK0A 3FZYA 2XUAA 2F3SA 1WBBA 1HEUA 3EYWA 2DFVA 3KLBA 3KPWA 1XTUA 4UFNA 2C3PA 2OQVA 2BRUA 2VZLA 3IMCA 3W5BA 3B9PA 3LHSA 4LOLA 1G7SA 2GJSA 4H6WA 3TAHA 3MTIA 4BLPA 3TXAA 1G3MA 3VTKA 3DGFC 3E22B 2X8WA 2HU2A 3A8TA 3PJFA 1Z4LA 1SKQA 2IV7A 4FGWA 5ITSA 1KWKA 4D43A 4HCJA 1BVHA 3OQIB 4QJIA 2I03A 1ZRNA 3EZFA 1WXGA 3A9TA 3HUFA 4LK3A 1ZLYA 4QXQA 1DG9A 1WMSA 2GCPA 3RBXA 4YV1A 5GJBA 2X76A 2OECA 4KZPA 4J6EA 4EUHA 4DLWA 2VCYA 5IBQA 3VGPA 1AO3A 1EX7A 1M10A 1RAHA 2X0JA 3EXHB 2CDNA 3LUHA 4JI1B 3TOVA 1ZVJA 2IY7A 3IIEA 2BKEA 3BMNB 1PJQA 2QW8A 4HDSA 2HSZA 4Y1GA 1XTKA 2D5LA 7YASA 1OLXB 4PG4A 5A06A 3F74A 1KO8A 1Z0ZA 3GPDG 3IUPA 4Z9YA 3E22A 4Q3NA 1QRRA 3HCWA 3OEHD 4CFYA 4BEWA 4JXZA 1DCMA 3HBFA 4ND5A 3UPDA 4OLAA 1PP4A 3AOEC 3OQIA 4B0PA 4KU4A 2ZTHA 3AI1A 5FLYA 1J7KA 2ZJ3A 4D0LB 2IU4A 3H84A 2RH9B 4LZLA 1G5FA 3NVMB 1IN7A 3N8DA 2OHJA 4EFKA 1C4OA 3BREA 2DCMA 2QEQA 4YJKA 2W83A 2FE1A 4F0JA 3HA3A 1ORTA 4ABTA 2EZ8A 1EWTA 1ZN7A 3L84A 4ER3A 3GNLA 3OE4A 1YOVB 3D6NB 4RCVA 3TZHA 2NAPA 3HYRA 4OQNA 5LD2C 2RHMA 1JR3E 1RCFA 2VXOA 1CNMA 4QBFA 5CEEA 1R4AA 4N8EA 3TCXB 4Q4AB 5D7NA 3KKQA 3A3OA 3LOUA 3H4IA 1Z6YA 4MS1A 1DJLA 2W6ID 1ULSA 2X42A 3GGOA 2RHWA 1SRRA 2GSDA 3FZEA 3TDNA 4B3BA 4NPAA 4BLWA 4CR7A 3R5HA 1R9MA 5ELMA 1T43A 3GZ4A 5DLYA 2HCJB 2W6QA 3A0RB 5EMJA 4C0SA 3GLFA 5GPBA 4CG2A 3F73A 2VF4X 2AZXA 3PGKA 1ZY2A 2FEMA 2LIPA 2NU7B 2XGSA 4MV3A 5KWJA 1PEYA 4HWKA 5JH7B 3BIXA 3OH8A 1YOVA 5AHKA 1YD7A 3B1VA 3E48A 4ITVA 1GRRA 1KKLA 3PENA 3IIJA 1ECFA 2NM0A 2ONKA 4K2AA 4BLSA 4QU8A 4PC1A 2VHWA 4YAFA 4EG4A 1ZA1A 4M1KA 3FZQA 4LTDA 3RT7A 1QV9A 3Q0IA 2DSTA 3WZ2A 4ALIA 5KDDA 2PUJA 2XA1A 1ITZA 1KDOA 2V6MA 4XGKA 1CQJA 2Z9CA 1T6YA 3AY3A 4H59A 1BW9B 3UJ9A 2M1XA 2PL5A 5BW4A 5LN1A 3DNPA 4TRJA 3AHJA 4MINA 1RJWA 4Q7MB 1K0UA 1NVVR 1W35A 2IXEA 2Z2XA 3VTZA 5HUQA 1J2YA 1TJYA 4QFDA 4TS4A 5ESXA 2YWCA 3EVCA 4Z0PA 2V9ZA 5KX5A 2KM1A 4I55A 5HE8A 2UYQA 4NRDA 1SNYA 1J0BA 2FY8A 4BJHB 4M46A 5EIFA 1Y1TA 4JGIA 3PITA 3QU2A 5HUJA 3N1UA 4P53A 4AYWA 4CEHB 1CFJA 4P54A 1YR2A 4NTZA 3FBTA 1MG5A 1LTKA 3AHCA 1IG0A 1V8BA 2VDOB 3TM4A 3ZLVA 4AP5A 3HCOA 4M6WB 3NI2A 3HR7A 1GEGA 3GELA 4BWFB 1Z2NX 1I0ZA 3EXEB 2A1UB 1BW9A 4Q9AA 4C07A 1G9SA 1OXKB 3DF9A 1AGRA 1JZTA 4U7HA 3KSZO 5CD9A 3Q3EA 4I6GA 4ZI2A 2AQHA 1WMEA 1E5VA 3O4IA 2VTVA 2IDKA 4R6WA 1QMPA 2H1SA 2LPMA 2NTJA 2XE4A 3TDKA 3ZLTA 4DCUA 3C45A 2FF5A 3O1LA 4WGGA 4X41A 5DYTA 1L5HB 3WMRA 2PS9A 1QC5A 2ONCA 1YDEA 2RGNC 2V5VA 5AJXA 4EHHA 4YMLA 5ALJA 2FN9A 3L1IA 3Q8WA 4CEHA 2IS4A 1T2FA 3HKBB 3U4DA 5KO2A 1L4NA 3KU1A 4DR4B 2P90A 1KYZA 2E5WA 2XDAA 4P4TA 1EFRD 4YEDA 4PYKA 3SGLA 4EGAA 3PA8A 3S27A 4X95A 4NJEB 1RBQA 4FYWA 4IV5A 4MW6A 4WK6A 4EVRA 1Y9DA 1K8ZB 1QYXA 4XASA 2UDPA 2QPAA 2H3EA 3GGJA 4XDGA 1VCMA 5BSGA 4FQ7A 4OYRA 4BKUA 3OM9A 5E3JA 3IJEB 1RJEA 3L0CA 3TYXA 3DTNA 3OTQA 1NA5A 2YVKA 4FINA 4LDRA 4MUNA 2O23A 2OXCA 4N01A 4MDEA 4LYHA 5LQNA 4L78A 4A26A 3T61A 1CQZA 1KQ3A 3L7LA 1OWPA 1X8LA 1OH6A 3KLOA 4BVBA 4CKCA 1H5UA 5JAIA 3BSSA 4W63A 1B23P 3G7UA 3WL4A 2FFJA 2A30A 3O3MB 5DSXA 1R4MB 4EG6A 3B5IA 4KXWA 2DE0X 1ZM9A 3VR5H 2H4JA 2WW8A 2AKYA 5KAPA 1MW8X 2RJOA 4KYTA 1PJLA 2RK3A 3CLRD 4MH0R 4ANFA 3OT4A 4MUJA 3ZTTA 4G65A 1DOZA 3C6QA 1FPMA 3EFEA 3OIUA 2ECOA 4CCSA 3D3KA 1TZJA 1DT3A 1Z15A 4I08A 4P0TA 4L6IA 1GZ7A 3I9OA 1RHUA 2FPIB 4BC1A 2JIZD 1G59A 2EBWA 1K1EA 3OKAA 4FSHA 4GUDA 4M0UA 3DAFA 3ROZA 3C5VA 4ENWA 4P7JA 3UBTA 1PJTA 5KU1A 4G85A 1DOAA 1AF4A 3ER9A 1XCPA 4OX9Y 1HURA 1ZRSA 4R5HA 2QVBA 2AB0A 2GMWA 3PFBA 4BX0A 2YH2A 3HFRA 2L2QA 1XTSA 3DVRX 4FIZA 2QT1A 3KG2A 1OYWA 4ISCA 2HTEA 2VT3A 3SDBA 2QTVA 3NWBA 5ADHA 2OZPA 1T2AA 3LUGA 4UVHA 2WJIA 1RWKA 3B9QA 4G84A 4REOA 1VSUA 3BWYA 1SO8A 1W0JA 1NU8A 2FPIA 3EEIA 3BE5A 3USZA 1CZLA 4KRGA 2YKGA 1JT2A 3HR8A 1FEZA 2JBWA 2OHOA 1DX9A 1G1MA 2B37A 2IXBA 2VF8A 4C7KA 1IIBA 2ZT8A 4QGAA 5EZQA 5FPQA 4TTQA 1KPIA 1VMDA 4DDKA 2HSDA 1HORA 1XVVA 4JLJA 2G8LA 3ROTA 1E0SA 2HIGA 1JDTA 4ZAGA 4E2ZA 4WMLA 4NZ9A 3MCUA 4R31A 4CDGA 1JR4A 1Z5VA 3LUCA 4DXAA 4OL9A 3E3MA 3KEQA 4G8JA 2XTMA 1GZDA 3D6MA 2ZIGA 4FHGA 2MYNA 4QOEA 4N49A 4TYPA 3DQQA 3MBOA 2KJQA 1LVUA 3O8LA 1I4DD 5C1IA 1G6KA 3JASB 4TV8F 3HYLA 3ZHRA 3GRFA 3HMQA 1SM4A 4DV5B 1C2TA 3COWA 3E2PA 2PGNA 2XD9A 4ZAYA 5IH3A 3A6PC 2UYOA 1R12A 3AL0C 1Y1PA 4Q4HB 4RC9A 4JB8A 1UMDB 1WE2A 2Q4BA 1QYCA 2IYYA 5IU6A 3IAS6 3R5FA 2A5YB 4M89A 2I4OA 1WBJB 1T2EA 3GQBB 3RVMA 3P0RA 4R81A 3U7RA 3ADKA 2C2ZA 3ZGNA 3DL7A 2VOJA 5EE5B 4OBXA 1SG6A 4GWGA 4X44A 1HT0A 5MGBA 2CVOA 2V6BA 3IAM6 4OV6B 4DB4A 3O4FA 4BFYA 3ASUA 3ZH2A 2Y1DA 2BIFA 1II0A 2QENA 2OCYC 2QRJA 2QLNA 2VDKB 2G72A 3VPBA 4BQRA 4DC1A 1XQ1A 3KUKA 2X86A 1VL6A 1R5OA 4JSYA 2ZIFA 3RYFB 1IVNA 3PEEA 4Q4HA 2VI5A 3SLRA 1XSEA 5CT9A 4A5SA 4QBTA 4B3SB 1G17A 4EOGA 2FZWA 1P29A 2A59A 2QXUA 4NK4A 4Q3LA 4YRJA 5ALIA 3U0BA 1U7DA 4YCSA 2Q46A 4EMSA 2EYQA 4UHHA 4W1QA 4KGVA 5J9FA 3ZK9A 3IPAA 1BFKA 4OG2A 3A4YA 5EXPA 4DTCA 1FW8A 2RAUA 2YFYA 3HA5A 1R5BA 3GC6A 1PO7A 4GBGA 3PTZA 3KALA 3P9KA 5JC8A 4KNVA 4W5QA 1MVNA 4E7PA 2F48A 2GJAA 3TQHA 1C3LA 3PHCA 3SM9A 2IH2A 4GBED 3NBYC 3R40A 3RYFA 3LVRE 4NV0A 3KEFA 3QUBA 1ODSA 2Y1OA 3I3SR 3L7CA 4YMTA 5FWXB 2EWMA 4XYMA 1P5RA 2QRQA 2V8BA 2JAUA 3EIUA 2CVZA 1F14A 4DBZA 3C7AA 1GKKA 3LHKA 3PJGA 1XRJA 4ENRA 2H11A 2A0WA 1AQJA 2XOEA 4ZU6X 1IBSA 2PIAA 4BJ6A 1T5OA 4CM9D 4RLQA 1YSCA 3N2ZB 3U19A 2P4HX 1VPLA 1RYBA 2X4DA 2XNDA 421PA 4JOCA 4I3HA 1Z6QA 3B53X 1WWKA 5B6IA 3QLTA 2B9EA 2Z6AA 4OBBA 2EFGA 1GNVA 1NYTA 5L4SA 2PMWB 4XIFA 2B0CA 3WLEA 4GGOA 5ILOA 4K3UA 3ZDRA 2OP0A 3N2IA 1MJGM 1QNLA 3R20A 5AVOA 5FTWA 1WM1A 3A04A 3ZY4A 1CJUC 4LPKA 4MI6A 4PPYA 1Z38A 1T36B 2P67A 4EF6A 4U6SA 3BJIC 3WLJA 2YOGA 1N0VC 2ZRAA 3HV0A 4DMGA 1BGVA 2P1RA 3JSAA 3UO8B 5BSHA 3BX1A 3OU7A 3ETGA 3RS4A 3WYDA 2YJ4A 1LU9A 5JNUA 4KTTE 2HU8A 4K5QA 1G7CA 4EYSA 5C9ZA 2DB3A 4P1ZA 5DX1A 3VO8A 2HMUA 1IN6A 4J1SA 5AR1A 2C3UA 3R7FA 2B36A 4NBLA 2A88A 1EXWA 5AW0A 1NXQA 1H1DA 4XOIA 1H8HA 2FTKE 1OB2A 2CLLB 2Q5LA 1JHUA 3KKLA 4ZMRA 3CVXA 2HPHA 1PWZA 1CWUA 3FPKA 2W2OA 4II2A 3EJ6A 3GRAA 2EBHX 3HP7A 1V3QE 2WTNA 4LIPD 3S1AB 1KJZA 2H8GA 3VU0A 1QR2A 4UAJA 5IX8A 5AOBA 1M2OB 1GPLA 3GEPA 2HT6A 1DAPA 4HGZA 4BVLA 5ED4A 1SVNA 2WIFA 3U26A 5A3RA 4Y1EA 4AQYB 2BEUB 5T7BA 1FOEB 3A3NA 3FAZA 4G5SA 4RLFA 1ULHA 3E2IA 4TLEA 3AETB 5A5DA 5CDGA 4QL3A 3JAKB 4OLBA 1CR0A 3JWJA 3CRVA 3S8YA 1DBSA 4B3FX 5KYUA 2IEDA 2NG1A 3G6WA 4C5AA 5AVJA 1SXGA 2D7CA 2NSHA 4YECA 5D87A 4JJKA 1AXRA 2OORC 5JEEA 4RA9A 1VKHA 4PCVA 4ZOBA 5IWAB 2A7XA 3F6BX 1TK2A 4ZMSA 4O3MA 3EGCA 2FR0A 3LDGA 3LA8A 4I1OA 1EEHA 5IYZF 2DFLA 1Z8NA 3HKCB 1M2OA 5FBKA 5LMUB 2DX7A 3PYLA 1D2CA 3VPXA 2BEUA 4DSZA 3AB8A 4F2GA 2ORYA 3IP9A 3E1GA 3L82B 4AQDA 2PE5A 1CVLA 3UJBA 4LF9B 3BWXA 1ECGA 2G0NA 4GI3A 3X1KA 4AO7A 2ZUDA 4HAUA 5K8CA 3QOWA 1RI1A 4ZOCA 2OFOA 4FS8A 3ZW9A 5KNDH 2LE0A 3ZKWB 3BRWA 1FNNA 1O9BA 3D2AA 1KY3A 1CSEE 1EAYA 4LTNA 1LLFA 3STUA 2VTBA 1SURA 1L4MA 1WP9A 2AFIA 2ZSKA 4NLLA 2C82A 3H2HA 3KR2A 3RARA 3WOVA 3UANA 1H0KA 2PBRA 2ET6A 3C39A 2OSVA 3FCOA 3HKCA 5DIFA 5C4MA 1Q7RA 4FYXA 1BYIA 4NMMA 4OQZA 3E3NA 2RDMA 1YB5A 3TIXB 4C20A 3G0HA 4IOMA 1D5CA 5E2IA 3TAUA 1GZ4A 4ESOA 1RPZA 5IHPA 5EP2A 2IXDA 4L73A 1R16A 3O3NB 4ZDJA 3V4FA 5I51A 4FWBA 4R8VA 3K8QA 3L0SA 2D1YA 4GYKA 4TOIA 3WHKA 4G63A 4GKAA 1VJRA 4IIEA 4ADSG 1EUCA 2RAVA 1JYSA 1R9JA 1QVVA 1NVWQ 3A26A 3NBZC 2NTVA 1BOOA 4PTLA 4M54A 3LX4A 4CVNA 4PYNA 5L3VA 4P35A 5DVZA 1I6LA 4OHVA 4A4DA 1ZH4A 4MQEB 1UDXA 1NSTA 2WZBA 2ZRDA 2BMWA 3N8KA 3LY8A 4TSKA 4YONB 5B57C 1WB9A 4QFBA 3GPLA 4KHPB 5FL7D 2P6PA 1LX7A 1F1JA 2B2NA 1Z22A 3CUWA 1NF8A 4KN6A 4RZQA 4XJXA 4C6SA 3QJ5A 1M5TA 3WOHA 5H0IA 1M6NA 4YLGA 5H81A 1L8QA 3PKJA 2I9PA 2ZETA 3PQDA 5BSMA 1WEKA 3UOAB 3SE0A 1JHAA 4OUDA 3FGOA 1ZH2A 3V34A 4Z54A 2QVLA 2VPIA 2IT1A 2ZZKA 1KJ9A 5BUCA 1OFUX 3V3TA 3FTFA 1KNXA 4BVEA 3X2FA 2FVXA 4OQMA 5AMXA 4BGIA 2VDQB 1A7AA 2WJZB 1VSBA 2HPZA 1V71A 4RPCA 2ABWA 1L5LA 1UBHS 3SE7A 2B1RA 3UV7A 1OZHA 2H08A 1C3XA 2HREA 4BIIA 5ERYA 3DEZA 2ICAA 3K9HA 4X24A 5AXCA 2DPXA 5DP2A 5TSDA 3GJ0A 4CUJA 2BGIA 1W36C 3LVFO 4IDFA 1WXWA 2FW6A 1OIVA 2J09A 3CZ9A 5JPIA 3QYFA 1FFXA 2YHAA 4HFRA 4MUMA 3VZPA 4ZGBA 1QG2A 3KXDA 5CH5A 7REQA 1SKMA 4B3JA 5A9SB 2PZ8A 13PKA 3EFBA 1DV1A 2OQRA 3JQBC 1FTYA 3TOZA 4G37A 3RAPR 4EA6A 2VRCD 4IIJF 4ZJUA 3MWYW 1Y33E 4QBIA 4Z3DA 1OAOA 3VSBA 1TZCA 2JFBA 1QPBA 2P35A 2ZYTX 1C7IA 2W98A 3EE6A 3EIXA 1RYYA 3LU1A 3CNEA 3QQ5A 3R0ZA 2P6UA 1CBUA 4TKVB 1WG8A 4WLVA 3DYBA 1MO5A 4TXMA 5BRAA 4C4RA 2XYQA 4GI5A 3AP2A 1W2WB 5JD5A 3HCNA 4HAXA 4A1OA 3HEAA 4JP3A 5D8DA 5L3QA 5L9AA 3WDLA 1EE1A 3NLLA 1IMOA 4P34A 3BCHA 4LUCA 3ECSA 3RFTA 5KKNB 4PE5B 2A0YA 1F38A 1BMFD 1EWRA 3ZBTA 2NV2B 3SC3A 3C7KA 2VK4A 1X94A 2EFCB 4LYEA 2WJHA 5KDLA 3WNCA 2OV2A 3QXSA 1KZ7B 4FCVA 4M0FA 5IC5A 1CS0B 3TR5A 5DW3A 1NVFA 2C98A 5HUHA 1W4ZA 4B9AA 3HCRA 4BMPB 1Y5RA 1O6FA 2ZBEA 2R87A 4HEA6 1AHHA 4D82A 1IBCA 2WAMA 4KQ2A 3HWSA 4M9UA 4Y2TA 1V4VA 2WIJA 4QQKA 4E07A 4LYAA 4AICA 3D6UA 2HHLA 3ZKAA 4Q34A 5EMHA 1XVIA 4A0HA 1BMQA 4QUGA 3C1AA 1KJQA 4XFDA 4RHFA 3HNOA 3UWPA 4BFVA 2Q3CA 1O3YA 4WFKA 3CF4A 3LCMA 4Q1EA 3TQSA 3O1IC 4BMNA 1TX4B 5EKDA 1EFTA 3DTVB 3EJWA 3R3XA 5CVEA 3TF5A 3ZY2A 1CS0A 5GONA 1ISFA 3KKMA 4LF7B 4UE2A 2AJBA 4ZRDA 5GQSA 1JPJA 4LE2A 3F8SA 2OVFA 2CBGA 4WNAA 4HTFA 3UT5A 1JJAA 5CA0B 2JGFA 4KFUA 1Z9BA 2BUAA 3DV0A 3OETA 3L4SO 1ISJA 3B8HA 3QX8A 3RPEA 1UDAA 4HB4A 1Z16A 3F67A 1C3VA 3E8SA 3OQVA 1NL3A 3HQ4O 4I1RA 4EARA 4U7PB 1NGSA 3OIVA 3RGWS 1FXWA 3EXIB 1K4KA 5DM70 3CW9A 3WL5A 3GMSA 3T7SA 4HGRA 2P9YA 4KWEA 3CA8A 3JYOA 3CCCA 3GFRA 3KVRA 3HB1A 4XDYA 3HDQA 1P44A 2R85A 2V4UA 4ZQIA 3CWQA 4ZREA 5DNCA 2WKPA 4A0SA 3TEMA 1E9BA 1SOMA 5CFNA 4ZT3A 3RKSA 2PRIA 2PUEA 4HGNA 4IS2A 4ZI3A 1QIDA 3LJKA 4J75A 1TMGE 1D4ZA 2P9EA 3A1UA 2JIRA 3GEEA 5JG7A 1VA5A 4MIKA 3ENZA 3VPSA 2XCOA 4I1YA 4KFTA 2PWAA 4A2QA 4R3WA 3RK4A 1E94E 2VJQA 1I7NA 1LGYA 2POQX 2WTAA 3C3MA 4RTLA 2WUFA 1A27A 5CDTA 1FVXA 3VPFA 3CQ9A 3AJDA 2J08A 3MD0A 1N6NA 4L0QA 1K2VN 1IJFA 1YBFA 3BUSA 3MT7A 3TQFA 1MHTA 1MJHA 2C07A 5DBEX 2CCKA 1KEUA 3QE4A 5H68A 5DH9A 4BL5A 4ZQEA 2JGKA 1KSGA 5B36A 1GA6A 2O0JA 3KUUA 4HG2A 3KHTA 1EJ6A 3PQ3A 2WSSA 3G0CA 3DMRA 4JZYA 2WWWA 4EHJA 3O0TA 3VPGA 3QWFA 2JI6A 2O3RA 3KQLA 5LP1A 2XDQA 4BNKA 1M75A 2H2WA 1A7JA 2IEBA 5EWMB 1IXYA 3FCYA 1ZVQA 3I2KA 2W2XA 4ZI7B 2MSKA 3T9DA 1GPH1 1E6WA 5EQTA 1TU0A 1MO3A 5IJ9A 2PQMA 4FGKA 1QU3A 3RVBA 4BNIA 4N03A 2CL6X 1A9TA 2GPNA 4XJVA 5B30A 2Q5FA 5GINE 1Y1LA 2YX1A 3M0EA 3WA6A 2XQIA 3E35A 1TMKA 1XDWA 3ELUA 1JU9A 3KTAB 1QE3A 2WI8A 4JWKA 4NFYA 1JDNA 3W8NA 3WGGA 2O3JA 3A2KA 3TOXA 3B1ZA 3ETNA 1A98A 1ULBA 2J0UA 4NL4H 4QRIA 4C2TA 3UAVA 3H1AA 2XMQA 5JW6A 2YZMA 2HQRA 5GJWC 2XWPA 1G66A 1ZUNB 2AFHE 5DEOA 1H65A 3R3JA 1XX6A 1UXJA 4H35A 2QG6A 4K0KB 8MHTA 1KOFA 4IRMA 1GA4A 2CB9A 4DUGA 4ZI7A 5AVXA 3W2GA 1GKUB 1GAEO 5CK4A 3G2IA 4JFAA 5IXSA 1BDIA 2LDXA 4F45A 4OQQA 4Z86A 3ZZ1A 1A9RA 1E6UA 4X8HA 4K6CA 4AQ7A 4RANA 1GZ3A 1P2VA 1VCNA 4B3DA 3RROA 1Q3TA 2B6HA 1I3NA 1X2EA 3T3NA 1Q16A 1DKRA 3RVRA 5TVKA 1C4XA 3RADC 1JF8A 4H3SA 5FHRA 2VFAA 3BDVA 3PQ5A 5DI3A 1L4FA 5HJ7A 1RBZA 5ELXA 2WDZA 4OQEA 4K8RB 4KE6A 1WUTA 2PS1A 3B82A 1SUSA 3I2FA 4MW9A 1FFWA 4B74A 2ZTVA 1B41A 4IEEA 5LNK1 1T5BA 1SXJC 4HHEA 3VR5D 4CL0A 2C7BA 1RFGE 3AUYA 1UFVA 5AK6A 3CZAA 1QDLB 1YB7A 5JD6A 1P7CA 3ZZNA 3TKYA 2B8NA 2LXNA 4U3JB 1S02A 1LJLA 2O2DA 2X7HA 1N5MA 3RRNA 1DIHA 3TNYA 2NZUG 1QVRA 1T0PA 1HYBA 4A8JC 4NMHA 3HJUA 3EISA 4QRHA 1N3BA 1NVBA 3GUUA 3DVSX 3AEUA 1AM4D 1MRNA 1UKEA 1W88B 3IVCA 3G2PA 3WGYA 3TPFA 1D0IA 4EMUA 3BXXA 3PI7A 5FUMA 5THQA 2XE7A 2ZTUA 3Q87B 5B53A 3HSKA 2G76A 2M6KA 5BVHB 1FNCA 5H3HA 5I4KA 1DXYA 5ALMA 1NR1A 4ZAVA 3KE8A 3ZY6A 3A6GA 1NXWA 1NQXA 3H0CA 4EGJA 5LOVB 1QR6A 1OX4B 2PWPA 1E3TA 3TXYA 3ZTWA 4U3JA 2BE7A 1WS6A 3ONVA 1WXFA 3ONDA 2C2WA 3JWGA 2O8FB 1N33B 3GOHA 3VZSA 4OF4A 1AUOA 5JQGF 3W4KA 4GWLA 3VR4H 1QGOA 4MO9A 3JV7A 1L8AA 2Q2OA 1BC5A 3IBGA 4R3NA 3UJPA 2X2OA 2E5FA 3CUEF 5TQ0B 1C1DA 3KUXA 4MWDA 1N5JA 3MJRA 4M38A 1KVTA 1BRMA 3CUTA 4B6PA 3QLVC 4GPD1 2G28A 2AUTA 3A2LA 4JKOA 3GJTA 4M7PA 1K98A 4UUMA 2HKIA 3DHWC 4L2IA 1QZTA 3H1EA 1AS0A 4D92A 4E0BA 2AOUB 3DBRB 3MCWA 1OT5A 3U81A 4ZV9A 3RIEA 2I8LA 2HW8A 2EHJA 2OZEA 3ZE2B 4EF4A 1FX1A 1GSHA 4X93A 4C6TB 3F7MA 5IT9A 4ZTBA 4WASA 4CGZA 1H05A 3MMPA 3DDOA 4RQTA 2FSVC 3ACCA 2CFCA 4G2TA 1F4LA 4O1IA 2RGBA 3T5BA 4BDSA 1UC9A 4DPLA 2GM4A 4TWZA 1ILEA 1EZ1A 4XQGA 3D7KA 3R9IA 4HDMB 4QIHA 2G0AA 2WNHA 1WCXA 2QU7A 5H3CA 1KSFX 1UFKA 4FN4A 3BDAA 3JYHA 2W2LA 3VI3B 4OHYA 1J06A 3CH5A 2A9KA 3INNA 3L93A 3OLZA 4QFMA 4XGIA 3VNAA 3SIPA 1UAYA 3U0VA 1JQEA 3JYNA 3NZEA 2P7HA 1FDRA 3NP9A 4MQ4A 1RWWA 3I45A 3JVDA 1CR1A 2A9VA 2ZBVA 4FHCA 5HCIA 4D25A 4C6TA 4MKXA 1T8PA 2NVBA 1E32A 1D9ZA 3QH4A 3VPHA 2HMSA 1JKJA 2Y67A 2CFSA 4UCFA 4OHZA 3W3AH 2IH4A 4KRFA 4IOLA 3AF6A 2P9FA 4XRGA 1V3VA 4OGGA 2GPJA 1YRHA 2KE5A 3U40A 3OTOB 1RRFA 2Q0SA 1KI1A 2DUUA 2C83A 3L5OA 1EKXA 2D2FA 3JS5A 2GILA 3K32A 4GOND 3OJXA 2DJIA 2V7XA 2HGZA 3I1JA 4J6FA 3VZQA 4NU6A 5A3JA 2QDXA 3Q6NA 4RZ2A 4TXJA 2IVZA 1XJWA 3FCCA 2FW9A 3F0TA 2ZZNA 2F6RA 5CFLA 3NHPA 1FUEA 4H6VA 4AF6A 1DBPA 2FN3A 4JGBA 5CNKA 4U02A 5LQSA 3VJMA 4HL6A 2D62A 2HLNA 4YNBA 1LZLA 4P80A 3U9TA 3FTQA 3R4CA 4FCTA 1T5LA 4F71A 2YV4A 2GBCA 3L8CA 3FYUC 3ND7A 4GP6A 1T2DA