5HIIA

Crystal structure of glycine sarcosine n-methyltransferase (gsmt) from methanohalophilus portucalensis (apo form)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
245
structure length
241
Chain Sequence
b'SDHYEEEYVLGFVDKWDELIDWESRAESEGDTIINILKERGVKKVLDVATGTGFNSVRLLQAGFDVVSADGSAEMLVKAFDNARDHGYLMRTVQADWRWMNKDIHDKFDAIVCLGNSFTHLFDEGDRRKALAEFYALLKHDGVLLLDQRNYDAILDSKHAHYYCGDTVSVYPEHVDEGLARFKYEFSDGSVYNLNMFPLRKDYTRQLLHEVGFQEINTLGDFKETYKEDEPDFFLHVAEKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine sarcosine N-methyltransferase
molecule tags Transferase
source organism Methanohalophilus portucalensis fdf-1
publication title Structural Analysis of Glycine Sarcosine N-methyltransferase from Methanohalophilus portucalensis Reveals Mechanistic Insights into the Regulation of Methyltransferase Activity
pubmed doi rcsb
total genus 93
structure length 241
sequence length 245
ec nomenclature ec 2.1.1.156: Glycine/sarcosine N-methyltransferase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hiiA02
2B2CA 5FULA 4KIFA 3M6WA 3RODA 2VDUE 1XCJA 3ELYA 3GRZA 2FPOA 2V7EA 3WSTA 2ZIFA 2AS0A 1WS6A 5DTQA 2DULA 1JQ3A 3HEMA 4PYNA 3ANXA 4GUAA 3HCAA 2NXCA 2QM3A 4RTMA 4M7RA 2AOTB 3JWJA 3KQYA 3UA3A 5GIOE 2Z6UA 4HH4A 3KHKA 2BZGA 2ZZNA 3DMFA 5FWAA 4RTQA 3HVHA 2F8LA 3GXOA 3BZBA 3M4XA 4R6XA 2HMYB 3A26A 3QOXA 1ZKDA 2R6ZA 5DX1A 3AWIA 4YUYA 4ER7A 2IDJA 2XYQA 3NWEA 3OU2A 2PKWA 3P9NA 2OB2A 2UYOA 4GOND 2YVLA 3FYDA 4PIMA 2UYCA 2NP6A 2ZWAA 4PCAA 5E1BA 5C0OE 4AZWA 4RTJA 3NW9A 5ERGB 3CKKA 3NWBA 3R6TA 5T64A 1TPYA 3OU7A 3PT9A 4YV0A 3LGAA 5DTMA 1N7JA 3RW9A 4CTJA 4DCMA 2EFJA 1L3BA 1RJFA 2O57A 3G88A 4GOLD 3HM2A 1ORHA 5DRYA 5KS2A 2VP3A 2PVCA 2PXAA 4PYLA 3P9KA 1KYZA 3CVOA 5E2AA 4RTRA 2P1DA 3CGGA 4UOEA 5E9QA 1JG2A 5CVEA 1G8SA 4QQNA 3K0BA 3GRYA 2XVAA 4P7JA 3B5IA 3LKDA 1EIZA 3OU6A 3UJ8A 5FQOA 4P7KA 5K0NA 3AJDA 1JQEA 1INLA 5GM2A 3DH0A 2JHPA 4GBED 4L7VA 4OQEA 3HA5A 5DX0A 3SX0A 1FPQA 4QDJA 3OFKA 3UA4A 2ZIGA 3BWCA 4XUDA 4JXJA 3P2KA 3ER9A 3SR4A 4E31A 3ID6C 5G02A 3EVZA 3BGVA 1KYWA 2AOVA 2HV9A 2IFTA 3L8DA 1JG3A 2ZVJA 3FUTA 3TOSA 2NP7A 1NW6A 2IPXA 3DMHA 4C07A 5FHQA 2PX2A 2ZTHA 3LDGA 3LX6A 4U7PB 3SMQA 1VPTA 5HIKA 1EJ6A 3FRIA 3HTXA 4XUCA 5EIWA 4R05A 2PY6A 1AV6A 4LWOA 3UZUA 4E2WA 2ZBPA 3CBGA 3THRA 1FBNA 2VS1A 3DXXA 4X61A 5CM2Z 3E7PA 3EGEA 2ZZKA 3BKXA 3JWGA 1R8XA 3SGLA 4P7GA 2I62A 5C9ZA 3K6RA 3EPPA 4HGYA 4RVDA 2IBTA 4QVKA 3CJQA 3G7UA 4E33A 3HA7A 1IXKA 2HWKA 2IGTA 2PXCA 3HP7A 3NJRA 4RV9A 5EQJB 3NDJA 4QDKA 2ERCA 3OFJA 5CVJA 2GH1A 1P1CA 3UJAA 1XDZA 4AUKA 4BP3A 3ERCA 1RI2A 3SVZA 4RTOA 4A6DA 4E2XA 5EMLA 3KPWA 5KQSA 3O31A 2ORED 3AXSA 5E9JA 1G38A 2GPYA 1D2HA 3CC8A 3SSNA 1P39A 1SQFA 2DPMA 4K6MA 1KPGA 1N7IA 1VE3A 4HGZA 4XCXA 4POOA 2K4MA 1X1BA 1BOOA 4QTTB 1Q0SA 3T7SA 2N47A 5F2KA 4YMGA 3FTDA 1D2GA 4A6EA 3VC1A 4OQDA 3LBYA 2BM8A 3I9FA 9MHTA 2IIPA 5EVJA 1I1NA 4HTFA 4GOOD 3FTFA 2H11A 3P8ZA 1QZZA 2AOUB 5GWXA 3UFBA 1G55A 4F85A 2ONZA 1SQGA 4RTSA 2C7PA 3R9XB 1TW2A 2OBFA 3PX3A 4PGHA 5GM1A 4CWAA 3OPNA 3BXOA 3M33A 4DQ0A 1X1CA 1M6YA 4PYMA 5EKXA 5DM0A 3KQOA 3ER8A 2ZSUA 3TMAA 5ICGA 5T67A 5DX8A 3CCFA 3LDFA 3KR2A 5IH3A 4YUVA 5BW4A 4RVFA 1AF7A 1ZG3A 2B78A 3KQSA 3I58A 1WY7A 1WZNA 4MWZA 2JHCA 2ZWVA 2C7OA 2P7IA 10MHA 4AZTA 3G8BA 3G8AA 4EVIA 1NW8A 3HVKA 1NE2A 4HG2A 2YX1A 4IKPA 2QY6A 3B3FA 4DA4A 4BP1A 3SSOA 5HEKA 5HIIA 3HA3A 4O29A 2IH5A 2BR5A 5E8JA 4P7FA 2C7QA 2QRVA 3IHTA 3O4FA 4NECA 2IP2A 1SKMA 3SSMA 3TLJA 1Y8CA 4YMHA 3HCBA 4RVHA 1QAMA 1H1DA 3E8SA 1FP2A 2ONYA 4PIPA 2EG5A 5FHRA 2ZBRA 4PYQA 3E23A 3HNRA 2PXXA 1UWVA 3NTVA 3HCEA 4IV0A 4KWCA 5E9WA 2ZLBA 3ORHA 3C3PA 1XDSA 3EMDA 4U7TB 5CCBA 4YV1A 3T7RA 5U4XA 2FYTA 3GCZA 4DMGA 2AN4A 2HTEA 1VLMA 1SUSA 4HC4A 2G8NA 3P71T 2YXEA 3BWMA 3I5UA 3C3YA 3LCCA 4IV8A 3TQSA 2CMHA 1XDUA 2ESRA 3FUXA 5K01A 5K09A 5LQCA 4AZVA 3TPZA 5K0FA 1R8YA 3NVKI 1YFLA 3DXZA 5DM2A 1JQDA 2UYHA 3THSA 3EMBA 1T43A 3AY0A 3DMGA 4R8RA 2E5WA 5EZSA 1IM8A 3HCCA 5D1NA 1RI3A 1L9KA 1L3IA 4X1OA 5EPEA 2GAFA 3MHTA 5LQNA 5CCXA 3KQVA 3VYWA 4RTLA 1VIDA 3UBTA 4PYKA 2YUIA 2Z6AA 1SG9A 4FT2A 5BP7A 2C7RA 5DPMA 2XYVA 2WA2A 1KP9A 2Z6QA 4EKIA 4PYJA 5K05A 4YUWA 3M6XA 4EK9A 1F3LA 2O07A 3R3HA 5E1DA 5LQAA 3GDHA 1ORIA 3KR9A 1QANA 4OX9Y 2NXEA 1EAMA 4KRGA 1M6EX 4C08A 3V97A 3GNLA 4P58A 3P2EA 2ZZMA 3NDIA 3OZRA 3C6KA 3TFWA 3UJCA 4DZRA 3G2PA 2P3QA 1P91A 3R0QA 4PYOA 4DF3A 4OA5A 1NV9A 5K0GA 1RJGA 4H0NA 2OYRA 1XTPA 5LR6A 1NV8A 4CTKA 3A25A 3H2BA 2Q41A 4R6WA 3IV6A 1Z3CA 4QPNA 3GWZA 3JWIA 2NNWB 5DSXA 5K0EA 3V8VA 3FRHA 1NW5A 4KIGA 5DTRA 1RI4A 3NVMB 4M36A 4FSDA 3KKZA 5E2BA 3UWPA 1DUSA 5FA8A 1MJFA 4ER6A 5C1IA 2PV0A 1PJZA 5CD1A 5E8RA 1NBHA 1NT2A 3GRVA 5CVVA 3FPJA 3O7WA 4XUEA 1BC5A 1R74A 2PX5A 3GRUA 2G71A 2ZBQA 3ELWA 4X63A 3T7TA 3LSTA 5CVDA 5P8WA 2IH4A 3BUSA 3B3JA 3I64A 2JJQA 1IY9A 2PWPA 3VSEA 1JSZA 1JG4A 3G2MA 4PGGA 2B3TA 4WXHA 3G5TA 1X19A 3G89A 4RTKA 3G2OA 2PWYA 3OZTA 3EGVA 4X41A 2Y1XA 3KQMA 3G2QA 2AVNA 2ZULA 3MERA 2PT6A 3FYCA 4IWNA 2AN3A 3EGIA 3JWHA 4DKJA 2XBMA 3KU1A 4PWYA 2HNKA 3GO4A 5H02A 3TM5A 1G8AA 2H00A 1L1EA 3FPEA 2OXTA 2P3LA 4KDRA 3M6VA 2ZFUA 1AQJA 4RTPA 4AX8A 5EMJA 1TW3A 2AOWA 2AN5A 5ICEA 3OE4A 5F2OA 5KQRA 3KPJA 5LQJA 1UFKA 5EGSA 4MIKA 7MHTA 5KVAA 2I6GA 3IEIA 1KPIA 4HTFB 1R00A 2P8JA 5CUQA 5M5BA 4BLWA 2OPBA 1ZGAA 2EJTA 1PRYA 1N2XA 4DCGA 3OCJA 2IDKA 2YTZA 2P41A 4QVGA 4E2YA 4OA8A 1NW7A 3LPMA 1SVUA 4FT4A 3RIEA 1DCTA 1XCLA 3DLCA 5DLYA 3P97A 3FPFA 4PCLA 2CWWA 2YQZA 2EJUA 1JG1A 3P9IA 3B89A 5FWDA 2G72A 3HCFA 5DM4A 1UIRA 3KQTA 5JR3A 4GF5A 4LG1A 4Z2YA 1JTEA 1MHTA 2Y1WA 2CL5A 5GP1A 1JR4A 4PONA 5DM1A 3BWBA 2G70A 4MQ4A 1AQIA 3SM3A 5K0BA 5DWQA 4CKBA 2O05A 4FSXA 2WK1A 1XXLA 4BLUA 3D2LA 1FP1D 2ZCJA 5K03A 4LECA 3Q87B 5LQKA 5GINE 2H1RA 2NYUA 2JH8A 3LBFA 3FUWA 4FP9A 3ELDA 3MQ2A 2BH2A 1VBFA 3OZSA 4F84A 2EX4A 4Y2HA 3BKWA 2PJDA 3AXTA 4C03A 1YUBA 3DULA 2IH2A 3TKAA 3CJRA 4Y30A 4RTNA 2HR1A 2ZIEA 1P1BA 3C6MA 5EHIA 3DOUA 4C4AA 4RX1A 3GGDA 1X1DA 3DP7A 5KYGA 3LL7A 1BKYA 2P7HA 5FA5A 2OY0A 4GQBA 5HIMA 4C05A 5HILA 4QTUB 3PFGA 3A4TA 2A14A 2IBSA 3LDUA 3DTNA 2BM9A 2NXJA 3KR0A 4QQKA 2B9EA 2LD4A 5HIJA 3UJ6A 5T6BA 3KPVA 5K8VA 1NW3A 4RVGA 4EKGA 3GU3A 2XYRA 3QOWA 4R8SA 2I9KA 4AZSA 2GA9A 3DUWA 3M6UA 3BGIA 3DLIA 3KPUA 1BHJA 5E1MA 2AZTA 2FHPA 5DXAA 5EEHA 5BW5A 1ZQ9A 1KXZA 1L3CA 4GC5A 5EZQA 4GOMD 3FZGA 2GB4A 4HRAA 2PT9A 3DR5A 3ELUA 3M70A 2PLWA 4PNEA 3PB3A 2KW5A 1ZHFA 3IYLW 4BY9E 1KIAA 4G56A 4M38A 4X60A 1RI5A 3P9CA 4ZTBA 4QPPA 3PS9A 5EOVA 3HCDA 1ZGJA 3F4KA 4ER5A 1WG8A 2V74B 2PBFA 3BGDA 4KVZA 5CIYA 3EVGA 5ICCA 5MHTA 3MTIA 3FUVA 2I7CA 1O9GA 3NMUF 4E70A 1SUIA 5LQUA 1VP9A 3PVCA 4KDCA 4E2ZA 1RI1A 5IKMA 2JG3A 1X1AA 3E05A 4FZVA 5B1SA 4ISCA 2WA1A 3MCTA 2FRXA 5FTWA 4CKCA 2FCAA 3P2IA 4DM3A 3PX2A 2JHAA 1KPHA 8MHTA 4KW7A 1KR5A 5EC8A 4EMSA 3FPGA 3U81A 1O9HA 4M37A 4RWZA 1JTFA 3UJBA 3S68A 4EQZA 2O06A 3MGGA 5HOQA 2CKDA 2OO3A 1WXWA 2PX4A 4FGZA 3BT7A 5LQRA 5F2NA 5EMMA 1VQ1A 3A7DA 3QV2A 2AOUA 3FTEA 3TR6A 2P35A 1QAQA 2XVMA 3A7EA 5E1OA 3GJYA 2P40A 2VDWA 3TKYA 5K0JA 3EVAA 3UJ9A 4GEKA 3TM4A 2PGXA 3X0DA 2VZ9A 3R24A 3PFHA 2VDVE 4YUZA 1DL5A 1U2ZA 3MTEA 1Q0TA 4C04A 2AVDA 3BWYA 2GLUA 1VP3A 5JUWA 2QE6A 1QAOA 1D2CA 2ZW9A 3FUUA 3LKZA 5DRTA 5DT2A 2FK7A 1XVAA 2FK8A 1EJ0A 3FTCA 3KQWA 4FR0A 5EHGA 4BLVA 1NBIA 1I4WA 4YUXA 1YZHA 5HFJA 3SXJA 1YF3A 2G1PA 4V0RA 2YR0A 1EG2A 1NKVA 5HZMA 1YFJA 5EG5A 1RJDA 1YZ3A 3KPYA 1M0EA 1I9GA 4V0QA 5DSTA 5LSAA 5D1HA 5GIPE 1G6Q1 2UZ4A 3B3GA 1B42A 1XJ5A 3B7PA 3EVDA 2QRVB 2QYOA 3GRRA 4CKEA 5DXJA 4MTLA 2OZVA 1EQAA 5EEGA 4C06A 4HSGA 5ICFA 4ATNA 4CXMA 2B25A 5FADA 1KHHA 3I53A 3LCUA 4WVLA 2PX8A 3REOA 2GS9A 3TRKA 4LWPA 3A27A 4B17A 2AOTA 3HVIA 3MB5A 5FQNA 4RYLA 3G5LA 2AR0A 1V39A 5FCDA 5EKUA 1OR8A 1HMYA 1WXXA 4ER0A 3MAGA 2R3SA 4E30A 4F86A 5CVUA 4YV2A 1FJXA 2BR4A 1R18A 2CMGA 3EVBA 3HVJA 3ME5A 4GC9A 4OBXA 1YB2A 4MHTA 4PYIA 2BR3A 2YXDA 3EEOA 3LCVB 1VL5A 4FS8A 5EIFA 2P3OA 3KQQA 3KQPA 1R6AA 2YXLA 3EVEA 1HNNA 2ADMA 2PSSA 3UJDA 2O0LA 2OB1A 4RSRA 5EMKA 3T0IA 4E32A 3LHDA 5BXYA 3OE5A 1QYRA 3EVFA 3MCZA 3UJ7A 5GOZA 3C0KA 5K0LA 5K0CA 3PLAE 1RJEA 2OKCA 1G60A 3DXYA 5FUBA 3EVCA 2NXNA 1JSXA 2JH9A 3EEYA 3LECA 1O54A 2UYQA 2AOXA 3VC2A 3PTAA 1F38A 4OBWA 4ER3A 3KR1A 3CJTA 3GIWA 3Q7EA 3FPHA 4PINA
chains in the Genus database with same CATH superfamily
5F64A 1ETUA 1FUYB 3PNVA 2EFEB 4B43A 5K8UA 4NK5A 2EJCA 1XHFA 4A26A 4CT4B 1T6YA 3PEEA 2YL2A 3ICWA 4Y8VA 2IXAA 4KH1A 2PQ0A 3HEMA 4BCCA 5JXIA 3P19A 1AKRA 3OHMA 3MF4A 4GUAA 2Z6UA 2GXUA 1ADGA 4R1LA 1MNQA 3I28A 1ORVA 1B3BA 3JVVA 4LOHA 4RE5A 3SC3A 2ZRQA 5FWAA 1TTQB 3B36A 5D5PA 1TUGA 3FGZA 5FLEX 2WZBA 1E9SA 1JS1X 2HMYB 5K20A 3KP1A 2J31A 3I6MA 2CJPA 2R6ZA 1NRXA 4JLVA 1KI4A 2IEZA 2P4QA 1D04A 1EVLA 2XUOA 5HE8A 1YB1A 2A9OA 3OU2A 4DLVA 3VYRB 4QBTA 4PIMA 3FTPA 3I4CA 4LXGA 1QZUA 5E1BA 3R75A 1NRIA 4UHBA 1H9BA 4RZ3A 4YV0A 2CXPA 4BJ3A 4CTJA 3IIEA 4K9SA 3RW9A 3FR8A 3ET5A 3A9WA 4N3GA 1FIUA 3VJLA 4J9UE 3C48A 4R2HA 4PQYA 1T6XA 1YDWA 3ROZA 1A9TA 1SBCA 4OXKA 5JS6A 1FXWA 3MTQA 1UQRA 3D31A 4F4DA 3LIIA 4WOCA 5EINA 3QE4A 1TFRA 2OK8A 4QJ4A 3SZGA 1FU8A 2GN0A 4IVRA 1YC5A 3EE6A 1EIZA 2O0JA 2QTNA 1SVIA 4EHDA 2QX7A 1MB9A 2WYWA 2CL7X 1VG8A 4JX9A 4AP5A 3IRVA 3ZBUA 3O4JA 4YRFA 3LC2O 4LXUA 1JG7A 3SQDA 1DKPA 4MRVA 4U2DA 3K6KA 3AI2A 3WK6A 5B6PA 1J0CA 3R3ZA 5EHXA 1HDRA 3ZXXA 3V3KA 1JHQA 5JZOA 4ZI7B 1U31A 1BVRA 3K35A 4UNPA 1WMFA 3T3MB 3TRHA 3EVZA 2GEDA 2WFAA 5H59A 2AG6A 3GJ5A 4TTVA 3V00A 4ED9A 5KKNB 2P1ZA 1F2TA 3U3KA 5EJ9A 3C8UA 1QQTA 1GSOA 1E4OA 1LI7A 5G1OA 3LX6A 4FFBA 3SMQA 3DKVA 3LVFO 1MGOA 1E7MA 3ORQA 5FI3A 5TV2A 4CIYA 1QR6A 2D0DA 4R5HA 4DM4A 1NQWA 1DBRA 3CA8A 3H8JA 5DGHA 1JW9B 2QZ4A 3IHLA 3T38A 1HLFA 5EJFA 1PSDA 5JXWA 3I4LA 5DI3A 3CPHA 3EGEA 2ZZKA 2C2ZA 1SC1A 4PSDA 1DAKA 3NHZA 2AYYA 4RKFA 4ZO4A 5EP1A 3K6RA 2WJ4A 4HH0A 5B37A 2X9GA 2J0SA 3EPPA 4K05A 1Z8DA 2PMEA 2Q5EA 4S24A 3NTQA 1QYCA 5ER6A 1QQBA 2QRZA 3ABRB 3O3MB 1Z82A 1W8DA 1KVQA 4QDUA 1JJ7A 1VMDA 1JLHA 3VX4A 4ZN6A 4AUKA 4L73A 3ERCA 3W5IA 1LX7A 2WYOA 4M7OA 3U3RA 5A4AA 2X8JA 5BWMA 3IQZA 4QEDA 5EMLA 5KQSA 2OLEA 3ESQA 2OAQ1 3AXSA 2QQEA 3LC7O 2AHRA 1JLMA 2FGJA 4UBIA 3U37A 4QQ8A 1REQA 2CMDA 4YAOA 1CY7A 4N18A 4PLFA 1ANKA 2I3DA 2MYUA 2JGDA 3E9ZA 4JLUA 1XZJA 3KSMA 4K6MA 3VAZA 1MORA 3PE4A 4KQKA 4UUBA 1O0BA 5TGDA 1TM4E 4LXQA 1BGXT 3DQZA 2KPOA 3MJEA 3N86A 1FZTA 2AYZA 5IK2D 4D41A 2H1OA 3G0HA 2R48A 2XODA 4ZK2A 5EE5B 4QUGA 4B3GA 3OOHA 5CT9A 1D0IA 5C7LO 3BTUA 3I0NA 1G55A 1M7HA 2JLAA 4QUHA 3RG8A 4B82A 1P2UA 1XB2A 4FMPA 4IFTA 4MPDA 4OIFA 1L1FA 1P1JA 3V4VB 3BXOA 3DEIA 2BMJA 1G21B 3ER8A 4H3SA 4TRJA 4LC0A 1FMJA 3COSA 3HJBA 1GPWB 2PNJA 1YK1A 5FBQB 3T5GA 3QJGA 1JU9A 3DT6A 4M89A 3PDIB 2GSWA 3I1IA 4DCJA 4B6RA 4W1SA 2P2SA 3U7GA 1S2MA 2QJFA 1A7AA 1CEXA 3U0BA 3QU9A 1QHHB 2Y1KA 3HJHA 4HG2A 2E4UA 3OIGA 1CSEE 1NA5A 2MIIA 1RMYA 3HA3A 1ND6A 4O29A 4DSTA 2AC4A 2R6HA 1FDRA 1FFHA 1OROA 1HY3A 4WOPA 1L4BA 2FWRA 3VR5D 1FQOA 4YAKA 3GFBA 3VV2A 3F1LA 3Q7SA 1G8KA 3TTWA 5CB4A 4O4JF 3O1LA 2R62A 1C7EA 3KSBC 1WBBA 5JYBA 3ANTA 4O1MA 3ZHYA 3BDIA 3AESA 3GMTA 2HHCA 4FOSA 5JCOC 3DC7A 4OKSA 4XGNA 2IW3A 4Q9DA 3K1JA 2GHRA 4N1AA 3SOZA 1JKXA 3VNRA 1T4CB 4NJMA 5CVCA 2VEOA 1W19A 2IRWA 2G8NA 3P71T 4MUMA 2RKWA 4M6WA 3LMKA 2GKGA 5IHPA 3O8QA 2O8EA 5BSEA 1WMBA 4ZYTA 5K0FA 2MYNA 4H16A 4M0PA 3OIWA 3JD4A 3T1VA 4BO5A 3NOOA 5A62A 1YFLA 1QPZA 3N8DA 4EZIA 1P0CA 3OLCX 3THSA 4TLLB 2O7SA 1DKLA 1U3FA 3NHBA 4J1QA 3DMGA 4D43A 4AN0A 4UCWA 3O7MA 3IE2A 4BYMA 5K2OA 3HO1A 3LVQE 1UDXA 1UINA 4FMBB 3PEFA 2DAPA 5EPEA 4LRTB 2CYAA 1E5LA 1NR5A 4UTRA 2ZWIA 3JASA 3UBTA 3HLYA 3BEDA 1R0WA 4WXRA 4IWXA 4GSKA 4RD0A 1DC6A 3LSYA 5GY7A 3C3DA 3ENZA 3ND8A 4MMXB 4XA8A 4ZP1A 3EAFA 4DMMA 4W5JA 4H3KB 4HL6A 4TKVB 1BVYF 3INGA 1IBLB 2VN8A 3JQGA 3VPXA 3MBIA 3G0IA 4EK9A 5KDLA 3W8FA 1SXPA 5JJIA 4NESA 3FFAA 4I8IA 4I55A 1POXA 3OLXA 4WA7A 4JHXA 3C3KA 1H93A 4GLFA 1JHUA 1UJ2A 1Y5MA 1JR6A 1M83A 1CF2O 2VG8A 4GFDA 1GUYA 2PZEA 3CVJA 3FMPB 4ZT3A 2CVQA 3CPJB 5LOVF 4XARA 1QU3A 5AK6A 4XIJA 1QE0A 4U7DA 1HYBA 2W42A 1UFRA 1P4SA 2VTBA 1BRMA 1ZUHA 4Q9LA 3RVSA 4Q3AA 1CVRA 1GPUA 1XCBA 2J46A 2OCYC 3QENA 1XVLA 4UFOA 4XWYA 1NW5A 3VHRA 4B76A 2VYVA 2NWQA 4L1KA 4OM8A 2I8CA 3U7FB 1QE5A 1U0JA 2YMLA 5FFNA 5LPNA 1QHXA 3FA2A 5I7EA 2IW1A 1TJPB 2C9BA 1EWRA 2CLOB 5L53A 5IDYA 5EQDA 1BC5A 2QE7A 3NETA 5TMEA 3AFHA 4LNHA 3BDAA 5HF5A 3CVVA 2BGTA 4KQ2A 4EG6A 5JH7F 1XR3A 3Q1KA 4M7WA 2W6MA 3B1ZA 1M2OB 1T9ZA 3CLTD 1NC3A 1PYDA 4PZPA 4CLDA 3GN2A 4WXHA 4LOKA 1X19A 4WK0B 4B7ZA 2IYOA 2P79A 3WYBA 1B41A 4RD4A 2A9VA 1HT0A 1PWEA 4KMMA 4X65B 4CMIA 2AVNA 5D85A 3RAFC 2XQFA 1DFGA 3NPAA 2AN3A 2RJ3A 2XVYA 4IEFB 3UK6A 5F51A 4LRSB 2WJWA 5LZ4A 1S3FA 1KY3A 4KGVA 2QMUA 4Y1GA 5JFOA 1HLDA 1XSEA 3H2KA 2G9NA 5BNZA 4RTPA 5FLKA 4TM8A 1D8AA 4NBRA 2Z2IA 1E8NA 1WW8A 3U13A 3Q8LA 2GMWA 3A0UA 3UTCA 4CM9A 4MP8A 4ZI3A 3EZYA 3DVRX 5I7AA 3M5DA 1Z6YA 4G1MB 4MIKA 1JHMA 5D3MB 4RVNA 5IKOA 2AEJA 2HMSA 1D7AA 4MSUA 3AHEA 1W4AA 1ZIYA 2R6JA 3IERA 3GLHA 2VYFA 3N0VA 4UHJA 1ZUD1 4DV5B 1XD2A 3VH3A 1G7CA 1R0BA 5EJ6A 3D6MA 2V03A 3LPMA 4JL8A 3ZQUA 2EGHA 4IH9A 3VPAA 5JAQA 3AKCA 4PZLA 3T99A 4C0HA 1RM0A 4AWBA 3MTJA 4F96A 2JLXA 2D06A 2O2HA 5J1TB 3RWOA 3DE7X 4AUNA 3KAQA 2FR8A 4LBWA 2P78A 4GF5A 2FZWA 1Y3FE 2XMZA 3IJPA 4UXJA 4Z2YA 1J5EB 1ZY2A 4GM4A 2IHZA 2ZYRA 4NV0A 3N75A 3T9EA 5HOEA 3EXEA 3QI7A 3GVXA 2YIVX 4IIYA 1TK9A 4ND8B 4CCSA 4Z8XA 1NTOA 2BBOA 3IURA 1FDUA 3NEJA 1FP1D 1GKUB 3TLAA 5GINE 1CDEA 3SXUA 2XMQA 1RMQA 2CGEA 3F96A 4J2HA 4U9HS 3UMGA 1WB9A 2OZEA 2PGAA 3BKWA 4Y98A 4OOEA 1QGUA 1LBHA 2J41A 3TSAA 4CT5A 4RTNA 4WWHA 4QBHA 1EQUA 1KSGA 4P34A 1GAEO 1P1BA 5CHYA 2EGUA 4KFCA 5JSKA 1X1DA 4HOYA 4MYDA 4R9SA 1DU4A 2O2SA 4FI3C 4IDBA 5C8DA 1J4AA 2VTVA 4IXDA 3WLOA 2Q0QA 2ONCA 5CD9A 3BL6A 1ZM7A 4YAFA 1BD4A 1V5EA 2XMDA 2ISQA 1JZTA 1D0VA 1T9GS 1OZFA 2XSZA 3DTNA 3IQXA 3WFIA 1YNSA 2AQKA 4PXYA 1WEKA 1KMNA 2OORA 3D3EA 3M89A 4M7PA 2DHCA 4P3NA 1T13A 621PA 5KU1A 4UTVA 1T4BA 3FAZA 2DT5A 1F0KA 3K0FB 2P3SA 2R2GA 2Z2ZA 4JJIA 4DSAA 3R9WA 3WWEA 3H2GA 4FUQA 1BHJA 2YCBA 2FHPA 4K86A 1N2OA 2YHSA 3IEMA 5ICMA 5BQFA 3RADC 3WLPA 2K2QB 1VSTA 3KEMA 4M9UA 4R9RA 1YZQA 5ALDA 4BMSA 2XQIA 2JBAA 2PT9A 3KETA 4AQ7A 2VF8A 1NUTA 3WP0A 3N0XA 3DBLB 1UL1X 1HGXA 2NT3A 3F4BA 1YZFA 4U0KA 4AJNA 4ZCMA 1H2ZA 2WVGA 2XE6A 3GZ4A 1XC7A 1HT1E 4UFPA 4G56A 4ZOCA 1IAVA 4ZT2A 4QPPA 2J3JA 4P4GA 2CBZA 3WQRA 1NM5C 3RUIA 3ZOKA 3OQIA 4ER5A 1J8DA 1ULUA 5K6AA 3KZKA 4XVCA 1NPYA 1O9GA 2JKYA 4Q1DA 5HKKD 2I6FA 4CQLA 1E4VA 3WGYA 2Z8XA 5F33A 2VHXA 2JHAA 4H7JA 1SXJD 1PW5A 3RWBA 1G3RA 3FPGA 4L0CA 3H0CA 1N32B 5FL7D 2Q6OA 3BXPA 2PKEA 2FV8A 3JTMA 5AXAA 2W6JD 2WHYA 5IMBA 5JU6A 1FDSA 5GQSA 4GOKA 4V0SA 4YCDA 4PAQA 3GGOA 2FP4A 4G36A 3C98A 1N33B 4FOOA 3PHJA 3FDZB 3PFHA 4NCJA 5BQ5A 2CDBA 5MDHA 3H1PA 3A2LA 2GLUA 5ARBA 4D42A 2DRIA 3N2ZB 3U7HB 1FJ2A 1J90A 2GAJA 2I6TA 1XVAA 2I22A 2VCHA 3CT6A 5A9TA 5J47A 5C5CA 4GMGA 1NHGA 2E1RA 5LNK6 1T4GA 1ZBDA 1MPXA 2G25A 2XUDA 4L27A 4MLCA 4ZAZA 3IA2A 5FP0A 1XCPA 1NKVA 1VMIA 4I4LA 3RUCA 5IU6A 3PI6A 4KGZA 2QKYA 4JUAA 1V48A 2ILVA 4B75A 1M76A 1O2DA 4D8YA 1M8PA 1NP7A 4W8GA 3KPYA 5JMOA 3K31A 1JE0A 2WEKA 2ODTX 3PZRA 5DSTA 2X15A 1GA6A 1SD2A 3B7PA 4I1SA 4RNDB 4HS9A 1M1UA 3V8NA 4CXMA 2ZAGA 3HJFA 2GLTA 2FSVA 2WUVA 3OPVA 3RUHA 5CA1A 4YQZA 2O3SA 3QLEA 1C7FA 1W76A 3I53A 2QOEA 5TF0A 1SMKA 4OI2A 4QLBA 2P5TB 3CINA 3U4QB 3TEFA 1U0SY 3HN7A 1WU7A 5CJ2A 2D5IA 2GZMA 3S2ZA 2A1IA 2OCAA 3CONA 3A6HA 1HDIA 1WXXA 1ZS9A 2BF7A 3QI2A 5EN4A 1XHLA 3KB2A 2Y93A 3ZX4A 2QSJA 4GC9A 1BMTA 2C95A 2IZ1A 4I6GA 2QTHA 3IUNA 4PYIA 2OPHA 2IYSA 2OL4A 2HRDA 3GWGA 3LCVB 1S9HA 1K86A 4FYMA 3ADBA 2YXLA 3K6JA 5C80A 4DEXA 1Z7BA 4LBYA 4N9WA 4O1HA 5KEIA 1SC9A 3WIBA 1C8BA 4BV2A 1PG0A 1ITZA 1QSGA 3DXYA 2H18A 1E5VA 4JVNA 3R3XA 3T1QA 2DUWA 1F60A 2QN8A 2B4TO 2W6IA 3BB1A 4FQ8A 3T1YB 1PR5A 5AKHA 1T2AA 3LWDA 3CWQA 3UWDA 1QNFA 1VL8A 2J7PA 2JGIA 2PL9A 4U2KA 3C6YA 4EP1A 1U3TA 1JH8A 1IC6A 4GZ5A 2FR8C 3JQAB 3ELYA 3EWIA 4Z1MA 4ESOA 3IXQA 2GZAA 2DVMA 1PF7E 3FSGA 4WKCA 2IHJA 3PHIA 4ID9A 1APBA 2C20A 4C0WA 2HBQA 5IABA 2CSXA 1D2MA 5FWYB 1GTRA 4DB4A 1JNYA 5EZYB 2H9YA 3VOAA 3WO0A 2H08A 4LN1A 3UA3A 3MSCA 2V3VA 4BEBA 2OO7A 2QN2A 3INRA 3HCRA 4I55B 5T8KC 4D45A 2PZLA 2JHFA 1P2TA 3OUTA 3STWA 2PT7A 3E7XA 3STVA 4CTNA 5F98A 1D5WA 4MYRA 4BNJA 2BJHA 3GLHE 3HDHA 4UZSA 5B7NA 3SHWA 1X8XA 3K1AB 3QG5A 2B2NA 2G5TA 1NJFA 4ZYXA 1L4HA 2PRIA 1NBAA 4WN9B 3EOBI 4BO1A 1JH9A 3JZFA 4AUEA 3QFFA 5A4FS 5GJCA 1T25A 1ZINA 4AJEA 4G26A 2Q2VA 2WSSD 2TMDA 3A06A 3ITNA 1KYZA 4YGYA 3RVLA 2EKZA 2I2AA 3JQ9C 2BJVA 1WTCA 4ZQGA 1C80A 4Q0MA 3OOEA 2VUTA 5F7OA 4C2BA 4KLCA 3K5PA 4OP1A 2H2FA 4PTZA 2PGJA 3ROTA 3QEKA 5K0NA 1B43A 1C81A 5KNDH 3IMCA 4B3IA 3UXMA 3IP1A 5JY1A 4L7VA 4ZV4A 5CDGA 2A9RA 2CFRA 3BTSA 3KB1A 4ZO7A 3BZWA 1HE2A 4Y0AA 3BM5A 3QIVA 3OFKA 1W94A 1C7IA 3AB3A 3ZOZA 2Z5GA 3AESB 2ZWPA 3FW1A 3JVEA 1OFUA 3KKNA 4E31A 2H7YA 4I4NA 3QEAZ 1W9MA 2FW0A 5JD6A 1ABEA 1IQUA 1BQEA 1TCBA 2PTGA 1XA0A 3MRTA 1I3OA 2TS1A 1Q16A 3PQ2A 4H27A 4OFXA 2FU5C 1NMYA 3EIXA 3SJAA 1QVRA 1PT7A 1AA9A 3AP3A 3L0BA 2UXDB 4MHSA 4IFIA 2PKQO 4AJPA 1QJCA 4XOUA 3I5XA 3F1KA 3M81A 1NF9A 5HCUA 4G4JA 4TT3D 4KR9A 2XMGA 4ACAA 1JIJA 3S7TA 5JPDA 1CF4A 4G6ZA 4BQEA 5DKFA 1XE3A 2RGUA 4KQ9A 1V1MB 4I3GA 4TSRA 4UVEA 4UZEA 4ZT5A 1GCAA 2C58A 2O2GA 2NVUB 4ES6A 1N75A 4OD0A 1SR8A 1DX4A 2GPAA 3VO8A 1WJGA 1HDYA 4IYRA 4QYIA 1ECBA 2X86A 3HJNA 3WICA 1HV8A 4DNOA 1RFLA 3Q4GA 2I6QA 3TSYA 2PLAA 4BEJA 3M6AA 4S2UA 2IGTA 1YDFA 1N2EA 2X2EA 1SOMA 1U3VA 3WMXA 4BZWA 2ZT8A 3PI7A 1JWLA 1YRLA 4JU8A 1ZDMA 3UJAA 1II0A 1DWOA 1ACMA 1DIHA 3A3KA 2JFHA 3A2NA 1VHQA 2G7MC 3R3YA 4CN8A 3TJZA 1DQSA 2PPVA 1EI9A 2FOXA 2YJ3A 4UNIA 2XTZA 2HEIA 4I1OA 1PQ4A 1CZLA 2GILA 2CXNA 1PJSA 2ZSAA 3MINB 4ZQBA 2J5BA 5E38A 4BFCA 2MSWA 2X7JA 2J07A 3HKEA 3MQFA 3QVVA 2ERXA 1L5RA 1CIJA 4A0SA 3GK3A 3GJ4A 1ZO8A 4GBJA 5J63A 5IJZA 2HDHA 3JX9A 2D1QA 3G8DA 2AFHB 2I7XA 4WSOA 5TPZD 1LSSA 1QZZA 5DHFA 3REQB 2ONZA 1QWSA 3ONEA 4EY3A 2OBFA 3PX3A 1H6BA 3G8YA 4HCJA 4PYMA 1Z45A 2MMCA 5FOVA 5A7HA 3NTLA 3IVRA 3UAYA 1JGTA 5B1EA 1W581 2PD4A 2CFSA 2PTHA 3KSZO 4HGPA 4NRDA 4J0QA 4RVFA 2OMKA 4CFSA 4OEHA 4EUFA 4BNFA 3A6DA 1LF5A 5SZKB 1GNLA 1NN3A 2AXEA 2PZJA 2IHKA 1TVKB 1WVGA 3QKSA 4OMDA 4ZC8A 2HIGA 2JB9A 1FTGA 1Z0ZA 3DAGA 3GUHA 2OGWA 3KTAA 4BGVA 4DEYA 1GL9B 2Q1TA 1UC4B 1UZMA 2WPNA 5ALOA 4X94A 4V3BA 2J4FA 2V5UA 2V7UA 1HLPA 2JLQA 1SCUA 2GWRA 5JAPA 3EIOA 2IIQA 3JQ9A 3OEED 3BILA 5FNVA 4BRSA 3TRIA 2C2WA 1E3EA 1DP4A 1Y33E 2Q3EA 1QP8A 1FP2A 2FUEA 4QOIA 3UMYA 1EE9A 1JIVA 1H6CA 2YWRA 3ITKA 5FT9A 3AEUB 3AUSA 1NU6A 2VC2B 4HMQA 4B8WA 1RKXA 1VBMA 5KOHB 4OL0A 2OV2A 1E1DA 1KGSA 2GPJA 4KVFA 4K6HA 1DOAA 3GGGA 4FFSA 4DMGA 1B8NA 1OI4A 1CWUA 4EB6A 1KDOA 1JIQA 4Y0VA 4UVIA 4TVKA 2I2BA 4AZVA 5IM4F 1Y9JA 2WJAA 4QGHA 3FY4A 2R84A 1W5FA 2KMLA 2A84A 3T9AA 2GDZA 2A59A 1L7NA 3GFSA 3CLVA 5K8CA 5TC4A 3SF8B 1YCFA 3TO5A 3K70D 4F93B 1SZDA 2R11A 2CHUA 3QU5A 5D1NA 2ZR8A 5FRDA 5EXPA 4A6PA 1RI3A 2CHVA 1NQXA 2YWXA 4Q4AB 4YN3A 3EXG1 3COYA 4MR7A 1I51A 5BT9A 2A57A 4F7DA 1UJMA 3CF2A 4Q93A 3W05A 3OE1A 4X8MA 3ZJ5A 1I1QB 1IVNA 1A9OA 1RXVA 3SHQA 1Y8AA 2GX6A 5BP7A 4IDAA 1ECCA 4IMIB 1WA5A 4PZYA 1KP9A 1P4GA 2YMQA 3X43A 2WAOA 1V2HE 4RW0A 4YUWA 1G9SA 2NADA 2UKDA 2ZUFA 2REQB 1E0SA 5GJVC 3FNQA 1Q0UA 4GOXA 3X2FA 3DMTA 5HZKA 2NXEA 3EPJA 2IHYA 1GITA 1M6EX 1Q1GA 3HRKA 3LOPA 3GNLA 1EFDN 2C2KA 3GDGA 2LDBA 1IN5A 3MLEA 5H4HA 3KWMA 3UJCA 2DEUA 4GNKA 3K2BA 3FR7A 3TIVA 2QRHA 4LA4A 2JGMA 3EOAI 3TLGB 3E22B 4BV9A 2ZI9A 1XTPA 4FGLA 1PNOA 5F4BA 4G09A 3VKWA 3DYVA 1ZLYA 2IL1A 2KQUA 1KJNA 4QPZA 2QMQA 4C0QC 3A3YA 4KE9A 2OO5C 1E92A 3Q7RA 4URUR 4S1TA 3WHKA 4QNNA 5B1IA 5AT1A 4AJIA 1RI4A 2NAPA 4M36A 4EJSA 5K7SA 4TXLA 9LDBA 4NY1A 3NIDB 2EQBA 4C87A 5ALWA 2VPXA 4MWTA 1E9CA 5IANA 4RIEA 4UBJA 5JC8A 1GWNA 1ZOPA 4LE0A 3DEKA 2COUA 3SK0A 3U3JA 1NNSA 2UVDA 5CVVA 1EM8B 4IGAA 2C9YA 2IXFA 3MBKA 3Q7IA 4L8WB 4LY3A 1BE1A 4JEIA 4MUBA 5EKTA 1ZGBA 3LBNA 3KEGA 1SUEA 4ZGGA 4PLHA 2Q5IA 1A3CA 3DCNA 3GGPA 1CCWA 5CX4A 1Q6YA 5HKAA 4NEQA 3A36A 5GOTA 1EWVA 4C4RA 3G2OA 1Z2EA 2O50A 4YP0A 4HAUA 5FO1A 3HB9A 1G63A 1WUKS 4MPTA 1LLFA 4F5EA 1PIWA 2IHBA 1Q0HA 4YRCA 4WBNF 3L8ZA 1RQLA 4EPTA 2TMYA 4B2YA 3KU1A 4U2EA 3SQXA 2HMAA 2XJ9A 3QXCA 1G8AA 1WWKA 1X7YB 4LSMA 5SYMA 3TM5A 5M29A 2P3LA 1E5DA 3MLAA 1HKHA 3UV3A 3EPHA 3AINA 3LYLA 2RGRA 4PF1A 5CPFA 2H2HA 4YP9A 1M2NA 3WZLA 4PWZA 3V46A 5JZBA 2E6KA 3LA6A 2IDZA 4PS0A 2AN5A 1BA2A 4LVOA 1F51E 2H5JA 5AHWA 2XVXA 3KEOA 4IDFA 2DY1A 7MHTA 3HP1A 5H9VA 5JZ9A 4A8TA 3T9CA 1YZGA 3B6ZA 1E1LA 1SM4A 3IMKA 3EFOB 1KEEB 1LB1B 2JIZD 3N87A 4FMDF 3H2HA 4B7UA 5M5BA 2Q2NA 1FP6A 2DJ5A 4L08A 3FWNA 1YA4A 3OCJA 4FEYA 2PKRA 4NP6A 3AVOA 1K66A 1SRRA 1MOSA 5CP8A 2RMKA 2ADFA 4XFKA 4A0RA 3L8MA 3P97A 3PA8A 2BMEA 4MYSA 4P4SB 3ZI4A 2PRKA 3L40A 4MLDA 4PZUA 3KQTA 4DT1B 5BN4A 4OK6A 4URWR 3L93A 2PCLA 1KAEA 1ZSVA 2BSXA 2IQ5A 1JLSA 1VG9B 3F5FA 3KYDB 2YHBA 3FKJA 3JRXA 4NARA 4QXRA 5IFKA 2R8YA 2Y0EA 4HQKA 3CU5A 4YQFA 1XZQA 5LA6F 3BORA 1N92A 3GF4A 2H1HA 1U0RA 1WDKA 4FLEA 1XNJA 1C3OB 1S2GA 1POWA 1SIOA 3KJHA 4Z5XA 1RZRD 1VCOA 4CHTA 2NPOA 2D62A 1HSZA 2A94A 4F6RA 4TMKA 3X1YA 3MG9A 4EI7A 1X7WB 2X8BA 1EZ4A 1TA4A 3GROA 2BKLA 3EA5A 2RHHA 1HF3A 9ABPA 1TT5A 3SFZA 2H0AA 1SHLA 4JJ6A 1PO7A 3MWKA 1DPGA 1JFSA 4MVJP 3KSDO 4IQ4A 4EJ0A 2FUG1 3SIPA 3ZWDA 5FWXA 3FM9A 1GA4A 1SUPA 2QL7A 2ECKA 3EH2A 3A4TA 3FBTA 4IJ6A 2W6ZA 2XGGA 4MV0A 4OHPA 3VYSB 3UV7A 2H1LA 4GWGA 4AB1A 1USIA 2QR5A 4TM7A 2G5PA 4OHCA 3JQAD 1E2MA 2IJGX 4RLHA 4AG6A 3EIUA 4JI1B 2MDTA 2CJWA 4MVJH 1YVPA 3EJWA 2D7JA 3BGIA 2EFDB 5DLDA 4JI2B 3DOOA 3WLEA 2ZR9A 1VHWA 3B1XA 1N3BA 2VJOA 3MJSA 4BIMA 5BN3B 2AFIA 2QTVB 4NU5A 1Y4UA 3JALB 4WOBA 3BFXA 3G17A 1V7CA 2E49A 2DECA 4PHHA 4EHHA 3EZXA 1G2OA 4OYLA 4PR3A 3RU2A 3ICVA 3P0JA 2WF7A 2PGIA 3QKIA 4J16C 3Q3GE 2C96A 3WQHA 4AAYA 4EOGA 1KIAA 2C94A 3OSZA 4HR7A 2EP7A 2NUPB 2ZUTA 1YK0A 2HGZA 2HPVA 3F4KA 3F6RA 4PC2A 3DDHA 4TKLA 2V74B 4UUMA 2DFVA 3HBMA 3ND5A 4CLOB 1GU0A 4A73A 4C7BA 3GRCA 3V8BA 1FLDA 4HDRA 3O73A 2ZRMA 2EZTA 3C3MA 3H13A 3VJKA 3ZCXA 3W8EA 4DMCA 4TRRA 5ESRA 5B1SA 2FRXA 4IIFA 1K7YA 3WNCA 2D1SA 3PX2A 1MOZA 2ZJBA 2YYAA 3A4YA 4KBGA 1TGYA 5BOSB 1D9ZA 3MD9A 4TZTA 2VNJA 3EC2A 1XU9A 4FCCA 1FRQA 1H1TA 2FEOA 2G1KA 3OI7A 3GNQA 2PX4A 3IAXA 1AQLA 3RREA 2Q6VA 2A7XA 2BZ1A 5LQRA 4EHFA 3W5VA 2VF7A 2BGRA 2V5VA 4EUHA 1ESEA 5JT1A 1FNNA 4FS3A 1I2MA 3CEHA 2C07A 1DMSA 1H0KA 1X2BA 5ECWA 3ZBTA 4BWGA 2D74A 2CLIB 1T1GA 1XMIA 2J3MA 3GFOA 5T6MA 2M6LA 4CG1A 4ZZIA 2HHLA 1VJRA 1OWMA 1OWOA 1QHNA 3LF2A 1IVSA 1LRKA 5DJ5A 2VWPA 1RXSA 2ZTMA 2Q1WA 2Q4OA 4XB6B 4YDHB 2Z5FA 4HQRA 1U1IA 3GBVA 5BR8B 3RV3A 4GYWA 1QFSA 2AT1A 1AGPA 3UK0A 5NULA 1B6GA 3NCTA 3B53X 3W7BA 3K6SA 3SDZA 3BSWA 2HF2A 4K9KA 2OTCA 4H08A 4OU5A 3F78A 4BO4A 1XV5A 2OV4A 1JB9A 1LY1A 2BMVA 3SJ7A 3W06A 3EFEA 4D26A 4WVFA 3WR5A 1XRJA 2I3ZA 4B2IA 1SBQA 3RRJA 4M98A 2QAGA 4FX5A 3ULKA 4GI5A 1GKYA 3VC7A 3B3GA 4D3FA 4ERXA 4RESA 5LP6F 1HT3A 3F3YA 5ES4B 3A6PC 3UAOA 3OCWA 1E6CA 3WQQA 3H4IA 1VHLA 2R6GA 1W4RA 1ZI9A 1UM9B 1DZ3A 2SHKA 3FYUC 4DCCA 4ZYVA 5JDCA 2HKIA 1MU0A 4PO1A 5EKUA 1QZTA 1FLAA 3KJQA 4AX4A 3D4IA 4IXTA 1EK6A 2Z8YA 1Y4ZA 4B80A 2OBMA 4GKBA 1KOGA 1N9GA 2OAGA 2XT6A 2ACKA 1UKBA 3HVJA 3EVBA 4DR6B 1R0LA 2DF8A 2HCBA 1F2TB 1V96A 1JHZA 1G8MA 3R0XA 3UN1A 2O2IA 3DEJA 2OR3A 4U7HA 2V0GA 1H1LB 1N2CB 1SXIA 1ADJA 2PT5A 2XKJE 3Q12A 1ZSYA 5E4JA 4MRMB 5EMKA 1YZLA 4ZV9A 4E32A 5KHAA 2M1ZA 4LJKA 4PFKA 4DDVA 1R5NA 4PLVA 1CEEA 1J0XO 3T7KA 5DDIP 2NX2A 1NKTA 4QRIA 5GV8A 2WIGA 1QQAA 4M53A 1NJSA 2WT9A 3PTAA 3D1JA 4ARAA 3VPBA 3E84A 1SNYA 4ZYWA 1PR2A 2QNBA 2A4KA 3I2JA 4LGMA 2JGKA 2JK1A 4J1TA 1IY2A 1T8RA 2ZYWX 5CCEA 1KMIY 3AFOA 1GG9A 1QJ4A 3AQ4A 3KOOA 2ZIFA 4JIMA 4DLTA 3SYMA 2WPDA 3EZNA 1K7EB 4P3KA 1LS6A 1KR2A 5DTQA 3AETA 1N77A 3EDCA 1QC5A 3T5MA 1PJLA 1SA0B 4W9RA 1USVA 3LYAA 1PZHA 1TXGA 1RPJA 4L2IA 4RVUA 5EIBC 3UCFA 4B87A 2XOXA 1DGQA 3L8FA 5EIBD 2WWYA 4RBNA 1JVBA 2PQ6A 3C15C 3L4EA 1HTBA 5ALZA 4LJYA 3ESDA 1DEXA 1NMQA 3AWIA 3N2LA 3WE7A 2XYQA 3NJ8A 1IZYA 3TW8A 3M2PA 5L7WA 2Q4BA 1LJLA 3P9NA 1GQSA 1RRFA 1JR3E 4NENA 1PWZA 2YH2A 4Q1EA 4F9TA 1YI8A 3UGJA 1ZQ1A 2ZWAA 4MKIA 1AUVA 1XLTA 4AZWA 1NFRA 1YA6A 4YXFA 3ZWVA 4B7AA 2VRCA 1B2LA 1S4QA 3N8GA 3RSSA 5LLTA 3IQGX 4XLLA 3H2ZA 4BFZA 4MVJD 1DDGA 3OJLA 2BSAA 4PBRA 2VF2A 1TVKA 1UDBA 3UW3A 4OLAA 1ZGCA 4UCFA 3COPA 1M6NA 2EARA 4K9OA 4KQ6A 2BKEA 2ZRPA 1MNAA 3PNPA 4C6HA 4DRXA 1B15A 1DEHA 3FFXA 1NF8A 5K3EA 4UHEA 3MA0A 2BBSA 3LWZA 4IUDS 1NLFA 1BX0A 5KU7A 2QT0A 4P7KA 4TMFA 5SYNA 3UKOA 5BNIA 3W5AA 1NDQA 5GM2A 3SHFA 1IIBA 3JD3A 4WACA 1GG2A 5GTDA 1E4EA 3ZJUA 4ZVVA 5TT1A 1IUPA 4K9PA 4GSYA 3IALA 3OO0A 3MVEA 4AJKA 1N6OA 3PUIA 3WAJA 1SU6A 3U3OA 3UMSA 3G2IA 4JI8B 3OJEA 3UCXA 4RIIA 1A04A 1GR1A 4IEIA 5I48A 1P75A 5JNWA 4KQIA 4MQBA 1JG3A 1P9WA 3FUTA 4CQJA 1Z0AA 1TZ2A 1CFZA 3J81k 4Q21A 5HBGA 3TSCA 1J1IA 1OT5A 3PXCX 4I1RA 4IQFA 2O8CA 2P2CA 3KLBA 1FVXA 4Q9HA 3V2IA 3HPQA 1E8MA 4R05A 1U7HA 1ZW6A 2WWGA 1MQ8B 3DAHA 2ZYAA 3DXXA 1CR1A 3GLQA 3IBFA 1P1HA 1KFBB 2HREA 3KOXA 4W9NA 2ZYSA 3DOCA 3R8CA 5F23A 1XTJA 1D2NA 4Z7JA 3WJ2A 1BU8A 3NO4A 3RYCA 2DXIA 1EHYA 4IVPA 4E15A 2QD3A 1M1YE 4A16A 3FX2A 2K7ZA 1GZHB 2GHQA 5AK3A 5T4HA 3GCGA 1ABFA 6CHYA 3R0JA 5D84A 1NP6A 1HE3A 4F8JA 2ZIUB 1GGJA 2QZSA 3ZHRA 4HWTA 4RM2A 1IUNA 5EWMB 3FLEA 4V2IA 4DR1B 1C9EA 3VPGA 2PG3A 2VYVD 2VYQA 3ABSB 3CWZA 1V5IA 4AKGA 1CQPA 2DUMA 1I33A 3UPTA 1DEOA 4IILA 1JDVA 3HADA 1LQ2A 1PFQA 3AUUA 4LMRA 4HGZA 3FNGA 2BRUA 3QMVA 5AVXA 2A92A 3OF5A 4HUJA 1U8XX 3FVVA 4WCFA 5EIAA 2N47A 2D2IA 1WHTA 3P20A 3N74A 1QKKA 2IUEA 1D2GA 3AEXA 4N3AA 3SZRA 3F5SA 3OMWA 2CLKB 2BEVB 2FEKA 3B2NA 3CN7A 3F8WA 3FGOA 3ZU3A 3I1FA 2H11A 5KQPA 1HI9A 1VL2A 3H2SA 2AOUB 3P8ZA 4LC1A 4Y9TA 4Z4HA 1QX4A 5HR5A 1E0KA 2B4AA 3KOMA 4IWYA 4B3JA 4GXNA 3FPCA 3TMAA 4IDNA 4QEKA 2FTKE 1AS0A 3G85A 2FF5A 2JCVA 3C3AA 2I4NA 2ODWA 3K9HA 4NCIA 3RNOA 5BY2A 3DDOA 4CKCB 1D1QA 2JGNA 1CQWA 1MX5A 1IHOA 1OGYA 2WUDA 2ZWVA 3LH5A 1OB5A 5KSPA 2DUNA 4YRZA 4MLPA 1T9AA 1HZZA 5GPBA 2O7QA 5KJCA 4HAVA 2DM6A 3HKDB 4PLPA 4L5YA 4N7MA 4IP0A 2VP4A 4CM9D 2GM3A 2XXAA 4EZEA 4FHEA 1K6IA 2HDOA 2IP2A 3RC7A 1PJ4A 2HPHA 1G5HA 2P9EA 1S8OA 1U2DA 3OJWA 5MF6A 2IXDA 3E1KA 1YVRA 3Q2IA 1QAMA 1GTMA 1R8QA 5HJ5A 1Z6XA 3L4JA 3FIJA 4E2FA 3TQHA 4G67A 1WPGA 1Z8HA 3ORHA 3K70C 1RRMA 2YZ7A 2CNDA 5I5GA 3H9QA 5IAOA 2JK0A 4JQYA 4H7DA 2HTEA 4HAWA 1FUEA 5AW3A 2YXEA 3E5HA 4P0PB 5FWNA 2PUCA 2DTDA 5FJIA 5AOAA 2C7OA 2K7FA 4E4RA 1I6MA 4F2PA 1CUEA 4HNVA 3LQFA 5IBQA 1TUBB 2O3UA 2OHOA 3TD9A 5BUCA 3M9LA 2NACA 3P2YA 5AKXA 1URPA 1CJVC 2RHRA 3CUVA 2DQ4A 2GEVA 2J32A 2PBZA 3EQ9A 2V97A 3ONFA 4Y1FA 5ELXA 5B3JA 3PDCA 2CMKA 5LQNA 5BUQA 1C1DA 5JSZA 4RTLA 3BPSA 3GLGA 3HO6A 4FMCF 1Z08A 4AY2A 2XBLA 1P45A 3D81A 4L07A 4DQKA 1JDJA 1YHYA 1TF5A 3SVTA 1E60A 5DPMA 5IASA 3OZIA 1VCIA 2WIBA 3NEAA 3OJFA 4UEQA 2O4CA 3AF3A 2A5GA 3V1KA 4H2DA 2ZAYA 1F8FA 2P9JA 1T9KA 1KTIA 4P7BA 1F0PA 2IYYA 1GZ4A 4ZC1A 4WNIA 1ORTA 3JV7A 4P93A 2F3QA 4JT8A 2XSZD 1DT5A 4OA5A 4J1SA 4ZRMA 3ZHQA 2YWJA 5K0GA 1N0WA 2OYRA 1ABBA 1O89A 4PFJA 2QTRA 3UQYS 2RGYA 4A2CA 4CTKA 2JHGA 4EHIA 1ZJ4A 4GR5A 4QPJC 5AOCA 2YJTD 4JI7B 2W4IA 1DDOA 3TAUA 4QGFA 3SE7A 3AERA 3NPMA 5DP2A 4KYVA 5KOYA 5EXEA 2OILA 4H4CA 1PVVA 5CB4F 3DVLA 1GA1A 3HCOA 3ZGNA 3R5XA 1ZM3A 3L7JA 4ZJYA 3WL8A 4DRYA 7ABPA 4F11A 4XUEA 1QRSA 4LJAA 4YJ3A 2PM8A 2NVWA 1L4FA 3ELWA 3DGFC 3OFSA 4LDJA 3HPRA 3SCZA 2Z4SA 4IVQA 3E9NA 4ARUA 1A8UA 1R6TA 1FTWA 3HNOA 1FVFA 3K0HA 1EX1A 1OQAA 4FEGA 4HZUA 4K3VA 4NJEB 5GGXA 1RHQA 3SQMA 1QUEA 2DBYA 2Y99A 1C5KA 1QOQB 3AR5A 4NTZA 2H4JA 2YFQA 3MYRA 1L8LA 1GDDA 3BMXA 1UBEA 2XITA 3DBVO 3VVLA 3MFQA 3OURA 2H48A 1TVMA 4JNKA 5ALQA 1ECJA 4DABA 4KRFA 1QRRA 5ELLA 4LJRA 5C34B 4HNTA 2BCGY 1Y89A 1H0RA 2QJOA 2RC6A 1U8AA 4ZJZA 4S05A 2BLLA 1ZITA 4B2LA 3IE0A 2RI1A 1BEUB 1SCNE 1UOPA 3DBRA 5SZIA 3KJFA 3QEMB 5DYTA 5JXGA 5G3ZA 4KKVA 3ZU5A 1ZEMA 3P96A 3BWDD 4PZDA 4QELA 3R76A 4YP7A 4IZHA 2RJNA 3ZI0A 3DQPA 2H8KA 5F2OA 1CJCA 2WAAA 1J1ZA 2B9VA 3PFWO 4FHGA 4FPXA 3R7BA 3WMWA 1H23A 1JJAA 4B4VA 3HLTA 3NTUA 4GECA 4QHTA 1W49A 4D1YA 4H17A 3DV0A 1SCJA 4G97A 1KVSA 1P72A 1R9NA 2OCGA 2P8JA 1HX7A 3EWSA 5A2GA 4BLWA 1CLEA 1P2SA 3DCJA 3KSUA 4QBGB 2X1HA 3AEUA 3I92A 4GPBA 2E89A 4YS6A 5IM5A 3DVAB 3HL4A 2WWTA 5BURA 1MQ9A 3OY7A 2UXBB 3S40A 3IGFA 4BYGA 3DC2A 2VSNA 4NYJQ 4I8XA 3A1DA 2CZGA 3P9IA 2OO5A 1H69A 5AMXA 2GTPA 4GR9A 1FNMA 1RAIA 1JHVA 1USKA 1ESZA 3R3UA 4HWGA 3KXIA 1IIRA 2JD1A 3GR6A 5TDHA 5BVGA 4OPMA 4XIFA 1COWD 3F7OA 2ZUBA 1W4LA 3SM3A 5CDUA 1O58A 5K0BA 4MROA 5ALMA 2ZSIA 3MT0A 1MKYA 1RYNA 1SHJA 4CKBA 4B6GA 1PX2A 4RK1A 5IJ9B 4RK6A 4I7EA 2VXCA 4BNIA 5ITVA 2YWHA 3D2LA 4TQUS 2IUUA 2CBXA 4RPCA 2SECE 5FPSA 5K03A 3RYHA 1UT6A 2H1RA 1NUUA 3ZTWA 4ZALA 3DBRB 1X7ZB 5ALJA 3RI3A 4NFSA 3L01A 1I13A 1EXWA 1HURA 5EZYF 4GP9A 4J0FA 1V0JA 4EAQA 1EP2B 4MI9A 3GUCA 5KSZA 1B6TA 4Q7JB 3I9V1 2ZANA 4K46A 1HC7A 3HACA 1ATIA 4ISBA 3SQLA 4CLOA 3C7TA 1NBMA 4OQPA 4UEWA 4LYHA 4BO2A 2F3PA 1AG9A 3FYHA 5HQ3B 2VUSA 1XZHA 2NUPA 5G4KA 3QW4B 4EDFA 3KWFA 4EHAA 3M3PA 1W5AA 2ZJ6A 2J0UA 3BE5A 3P0EA 4R9NA 1P2DA 4C05A 4CCYB 2PUHA 4OHWA 1OH5A 1F1BA 2NSHA 3H87A 2X6RA 3KIPA 2IEDA 1BHO1 1CULC 1LK7A 2FPIB 4M1KA 4QXMA 4CCAA 2PVPA 1SCQA 3RBZA 1K6JA 1UWKA 6REQA 1A5AB 3SHTA 1FJGB 5HIJA 1W87A 2A1TR 4QNMA 4RAQA 3RPEA 1XEXA 1EVYA 3I32A 3PZBA 3BIFA 3KE9A 4YAGA 3EISA 4FFVA 3GGSA 4Y9RA 4PLZA 1UXIA 3QIAA 4BAZA 3M6UA 2Q9UA 5HRUA 2XDQA 3C8HA 3DVQX 4OQQA 4LWQA 4B5LA 1RZUA 4ZIRB 1DQPA 1KHTA 4US2R 1KJ9A 4GC5A 2GDJA 1DX9A 1FFWA 4J2TA 4NBUA 5F1KA 3TBFA 4DL9A 1A9XB 4JBXA 1SC4A 4QTZA 5KHOC 3NKVA 3TNJA 2WWFA 3BMQA 4MX8A 4C89A 4DNXA 3EXAA 4KFTA 1HG0A 4EYEA 1HK7A 2BUAA 2GD0A 1GNRA 3QEJA 4WK2B 1U8CB 1CY8A 2P9BA 3BWVA 1YIOA 1XZEA 4N54A 4UDYX 5FTMA 3B9PA 3BHMA 3V7WA 1WG8A 4E21A 4WBNA 1VLVA 3R7NA 3NU1A 5JSUA 1ZJ6A 2PLNA 1DJLA 1F12A 3NMUF 4KO4S 4E70A 2QD4A 1U7UA 4QG7A 5JBIA 3ZE0B 4YROA 5CEEA 2I1QA 4Z86A 1D2AA 3QTLA 4J1NA 4B31A 1D8TA 1B0AA 2NUTB 2RBKA 2MT9A 2FCAA 2JEYA 4CKCA 8MHTA 2ZRJA 2IYXA 3BHNA 4MA5A 3ZNNA 4A8JC 2DYKA 2GEUA 2G08A 4RMIA 1MRNA 2WSSA 4JBGA 3PU6A 5CJPA 1RHJA 1LNSA 3MWEB 2RGAA 3JU3A 4KN9S 4O0LA 4PAGA 2XZPA 4XYGA 4XVHA 4R7TA 3BT7A 4HADA 2X4LA 3HSKA 4ARSA 1P33A 3FBGA 3OFVA 4RQAA 3LVRE 1KSHA 4OUDA 1QP4A 3NM5A 1O8CA 4C21A 4E13A 3UTDA 3TM4A 2VDVE 1Y9DA 2WP0A 4G5RA 3PFCA 3E3AA 3A4NA 3FTQA 3QE3A 4MQFB 4Y2GA 3PHGA 5JYDA 3KT3A 5DRTA 1AGYA 2VK1A 3CNQS 3DV9A 4ZCRA 3FTNA 4MQMA 3AM3A 3I61A 1KS2A 3WGZA 4IM7A 3HVRA 1YF3A 4ZQIA 3CPEA 4M1MA 2I1LA 4RPLA 1KH1A 2RG7A 3V9PA 1PJ3A 3B9BA 1WSBA 1BYIA 1O95A 2YW9A 5AKIA 1Z26A 3G1TA 3QA3E 5A5FA 2VSYA 1GYQA 1DBVO 5CFQA 1T2VA 3ORSA 1KY2A 1RWXA 2X22A 4TT3A 5SV2A 2B4QA 3RU9A 3ZDQA 3AUFA 1T8UA 4UM5A 3WYAA 4C78A 2FLKA 4FQ5A 4YUAA 5BQXA 2YJNA 2WFMA 1XCMA 1XJCA 2OD9A 3AIMA 2R2AA 5GONB 4BMPB 4B6PA 4FYXA 1V2GA 1GGVA 4ZU1X 5TQ0A 4FGWA 5DHAA 1E69A 1T1IA 1XAHA 1MPTA 1J23A 2AMLA 2QXTA 3GFRA 4HYEA 5AHKA 1FS6A 1XZFA 4I08A 4J9VA 1FDVA 2F17A 2IYAA 2VP9A 1NGSA 3G0OA 4ABTA 3O4IA 4OQFA 4LGCA 4BATA 2OECA 4FWBA 2WMDA 1KOLA 2Y1FA 3S29A 4G8BA 5A0FA 2ADMA 2NSDA 3OKPA 1VG1A 2O0LA 4RSRA 4YGXB 2DR0A 5EFOA 4WDQA 3BD6A 3EVFA 3TLEA 4OKNA 4CF6A 4DZZA 4BC1A 3PLAE 2OKCA 1K0FA 4QO8A 1IBMB 3N28A 3C6BA 4PVCA 1ECFA 2GYWA 3TOXA 3CH7A 4DLAA 3WFJA 1M6WA 3GQVA 1X1EA 3KG2A 1Y8ZA 2OQRA 4NOKA 2IYWA 4QUAA 1T36B 5KVCA 4KIFA 1QTRA 5TPZA 4K3UA 2NTVA 2X8LA 2AS0A 4DRXB 2RHCA 3SHOA 5B7QA 3V6MA 3EJ6A 2AC2A 4OUDB 3C1UA 3BXZA 3HB4X 1AF4A 5BO5A 2JATA 2CC2A 4NHEA 3PKZA 4OH1A 3I30X 1QZ3A 1VHTA 3K8QA 4DQLA 1MEEA 1J7KA 2FQ1A 1Z9BA 2QR3A 2C2OA 2SCUA 4EEKA 4E46A 1NBOA 1LRLA 2P2YA 3K96A 2HI0A 4JWTA 3S2EA 4WBXC 3KTOA 1KDRA 2I91A 4Y0NA 1V4NA 3H6KA 5B58C 5C1OA 4DJJA 2WTUA 1Q1NA 1C1HA 1CDOA 4R2WA 2H31A 3G88A 3GFQA 1KH2A 4N49A 2O8CB 5BRNA 1A8HA 1AMUA 1RS0A 4O0MA 3TLZA 1EDBA 2Z4RA 1X42A 3AETB 4KYIB 4BX9A 3U44B 1R66A 1XRNA 3R5JA 1BCRB 1IN4A 2EBHX 1Y9EA 4KRYA 4DC1A 2P1DA 4Z9XA 4MS3B 2K5UA 4DSNA 5BMOA 1CNFA 3D43A 3KV1A 3LKDA 1A76A 1SCDA 1SIWA 2J9YB 2OZPA 3OG9A 4GPZA 4OQ4A 4PCUA 4EX6A 1TZJA 1D07A 1P0PA 2GM9A 2O3RA 3ANSA 4HEA6 4N01A 3C5HA 3TWOA 2C92A 1JJIA 3HA5A 4FKMA 1G7TA 3PICA 2H0RA 1TLFA 2ISCA 2OYSA 3B6KA 4O5OA 3T9FA 2CFIA 4PVDA 5IZ4A 1U0GA 3T3DA 1NF3A 1SULA 2PQMA 3SDSA 4XYLA 1NI4A 1EA7A 3UV6A 3VR6A 1KC3A 2CY0A 4E09A 4ZMRA 3IOBA 1EVIA 2VDRB 3C3EA 3OPMA 4X1IB 1OBVA 5ILGA 3V80A 4G2NA 4OGWA 1XHEA 2FN7A 3IIIA 4DNFA 1P2VA 1YIAA 1NLUA 1P1IA 3GLFA 2ZTHA 1A69A 3NCHA 4EVSA 4L3WA 1ZD3A 3UMVA 3AVUA 1CZNA 1PS8A 1VCHA 1ZMBA 3QUCA 4I2NA 4K2HA 5AUPB 1LH0A 2QTCA 3UNXA 3NLLA 3AF6A 3O82A 3T34A 1H4SA 4X61A 1RU3A 2JF0A 4LKRA 4EBBA 2IEAA 3NASA 2W98A 4MUHA 1UKYA 1RDFA 2IVZA 2UYGA 4U5XA 4WFIA 4ZDWA 5C9ZA 2JJ2D 4KK4A 5BMVA 1C8VB 3TEJA 3LKVA 5HTOA 1Y5RA 4DQDA 1W5BA 2BDTA 2Z6VA 4NEGA 2BSQA 1PSZA 4M8SA 1V41E 2YCLA 4WOJA 3HA7A 4MR8B 4LQDA 1V95A 3NATA 2JASA 1QC5B 2G8LA 3DT8A 3DTYA 1XDZA 4IG9A 4KMOA 4QATA 2FDRA 3JVDA 2ZI4A 5E95A 1GADO 2YOGA 2W8BA 5F3DA 1V3TA 3CY6A 3IUJA 1H5QA 2AKEA 2BEKA 4AN1A 2K4MA 2N46A 3M6IA 1U2EA 4P83A 2EDCA 2X14A 3B6MA 1HSOA 5EP4A 3AGPA 3O3OB 1J9GA 3G6KA 4PG7A 1U2QA 2P6MA 1UAYA 4OATA 2YN4A 3QVMA 1E9EA 2R8ZA 4NH0A 2BM8A 3W2GA 5AICA 2IIPA 3JYOA 4WKBA 1HE1C 4OHZA 3U7EB 3VU3A 4NYIQ 4NAHA 4YCAA 1G0OA 3RAGA 5JXHA 1TLLA 4G1BA 2CXSA 2YN2A 3KD3A 4KE7A 3BH6A 4FZJA 4MKHA 2B0JA 3KZNA 1V7PC 4R81A 4K0RA 1JSLA 2ODAA 4G41A 4HEQA 2INGX 2HZBA 2XIJA 3IAFA 4PZZA 3SXUB 1MJGM 3VSAA 1PQUA 4Q7MB 4AIRA 4ZZ0A 1I4OA 3EXIA 4ZOAA 4DPKA 3I04A 4YUVA 1ZG3A 2B78A 1VE9A 3T41A 1PR3A 4A0HA 5E3HA 4G3XA 3WKAA 1NMZA 1UP6A 2ZBVA 2ZT6A 4FE7A 1H42A 1V1MA 4W9NC 2P7IA 3WI7A 1J20A 1MF7A 5DN6A 5T41A 4NNOA 1TUEA 2NTEA 3C97A 1L8OA 4R2XA 4XD7D 3RCBA 3DAFA 2PNFA 4KV9A 4R9UC 1BFKA 4OUKX 4AECA 1WZCA 2QW8A 4OHFA 2XF2A 3LUCA 5H68A 4DVGA 2O2ZA 5F3RA 4G8CA 2R8OA 3OAAD 3ZHUA 1K06A 1DQNA 2Q6KA 4HDNB 1JVNA 1L7QA 4X20A 2AWOA 2EV9A 4EF6A 2WMNB 1RHRA 2LR0A 2PS9A 4HYYA 5HJ2A 2M1XA 2C2XA 4D4KA 1Z6ZA 4F04A 1XDSA 2JLSA 1B6RA 3OPQA 3PYXA 1CQXA 4OTZA 5D3KA 3MW8A 3R6WA 3AVTA 1RM4A 3HDGA 5TQ2B 3ZJVA 1XLTC 1S2DA 3CEPB 3FOAA 1NXOA 3LCCA 3LW8A 4KQJA 1JJFA 4NZPA 1NNEA 5LQCA 2EL7A 2IYQA 3F3MA 2JKVA 2ZJYA 4CBVA 5E7MA 1S3GA 3CLTC 3EH1A 1O6CA 2D5CA 2R5NA 2VPTA 3FDIA 4UUQA 5K99A 4J6EA 4PG6A 3DEFA 3AEYA 1DRJA 1K4YA 3JQCA 4G5OA 3RUDA 4DUYB 1F4PA 1XPUA 2ZDQA 4XGKA 4D0LB 1GAJA 1WAMA 1WQ3A 5TR9A 1XTRA 3O92A 2HJHA 2ECOA 3L06A 4MYUA 1YR1A 1N2SA 1QMGA 3GAZA 3S8MA 5JCJD 4O2LA 5AK0A 1KJZA 3LCMA 2IOQA 2WA2A 1G59A 1F0YA 1YAHA 1D6MA 1N2IA 4NCAA 5TB5A 5AW7A 3VI4B 4MEJA 2EERA 1JQAA 4GX5A 3PBKA 2XCTB 4C7VA 1P7ZA 3TCKA 4OX9Y 2UXCB 4DGSA 4QQFA 2YY5A 4G9BA 3UOGA 4CYMA 3P2EA 3C6KA 4WY5A 3IKMB 1XCOA 4X1KB 3WB0A 4NDZA 1MABB 4G0NA 1CYDA 2RIRA 2WD8A 2PA0A 3RU7A 1B6SA 4M1ZA 3F98A 1OKKA 4AS2A 4Q7QA 1TYZA 3QY0A 1WKBA 4C4OA 2ZSFA 1R0YA 1XTUA 3NVMB 1VSBA 4TOIA 5IF3A 4KQFA 3DQQA 3IPAA 4QYWA 4QYMA 1E3JA 1A9SA 2XXJA 3I04M 2PV0A 5B12A 1WHSA 3LZCA 3WRYC 3CMCO 3Q6IA 3EGCA 4HLQB 2ZYVX 3OQJA 4LV5B 4X1KA 2J09A 3UB3A 1SRQA 1M2VB 4EBFA 4FK8A 5AM3A 5LZ9A 4XW2A 1EUCB 4RFVA 1ZLXA 4FKZA 3J7AC 3N6RA 2F1OA 2P2DA 2ZWOA 4R1OA 1MO3A 1X13A 4PG4A 1X7GA 2AMFA 2RAVA 1A50B 3OZAA 3QX9A 4L0QA 2QVYX 4E51A 2A7QA 3LRPA 2WJJA 4GI2A 4C0AC 2MCFA 4O2AF 3T5AA 3D4PA 2H16A 2XXAB 4AJ4A 1MV8A 1W5SA 3JYQA 3ZIDA 4FNAA 5L9AA 1GUBA 4QECA 1YXMA 3MERA 4XJVA 2VAWA 5EYPB 1G3QA 3BICA 3LLUA 5ALHA 4CQMB 1UBKS 3CF0A 4TTJA 5AW6A 3SSAA 3KVOA 2HLPA 3GO4A 1XLUA 5KNLA 1XDBA 2H00A 4DJEC 1Y1SA 2FPRA 3AGQA 3FPEA 4RLFA 4BFUA 3CVUA 4YMWA 3TL3A 4LK2A 4E11A 1FSSA 1QFMA 3M9XA 4GM0A 4DNQA 2W6OA 4HNHA 3DLBA 5EMJA 3LFUA 1DTWA 1CRLA 1TTHA 4NCBA 2PYDA 3DO5A 3GPCA 1AKMA 1F3OA 1WBJB 2DBRA 2W11A 1FYDA 1NNI1 2IUYA 1I0IA 1P5FA 1UFKA 3KPJA 4HQOA 3IEPA 2Z56A 1VGQA 3UWSA 4RDXA 4CRWB 1TK3A 4BB6A 1UFQA 4NOJA 4DLUA 2Z04A 5C8YF 4N7RA 3L7LA 3S99A 5AHXA 3EF1A 2XH8A 4GS5A 3BYZA 1LSJA 4JK3A 1BX3A 1JIXA 3ANMA 3OJXA 2GO7A 4QVGA 4Z51A 4B2PA 4KEAA 1YB7A 2HF8A 1T5OA 2BJWA 4WLOA 3I9NA 1OJ7A 4JBNA 2F8TA 4KPYA 3WAGA 3KE8A 4MITA 5FWDA 2QTLA 3HCFA 2XQKA 4TSFA 5DM4A 4CI9A 4HH1A 1UIRA 1U3CA 1JMVA 3EQ7A 3QHPA 4JASB 2WWVD 2PZMA 2XV1A 4HBZA 2JFNA 4LG1A 2I71A 2YBDA 1QH8B 4U3JA 3T9DA 1KZGB 1LA2A 1IMOA 2ZBGA 3DA8A 2ICAA 3T0GA 3WWPA 3IPRA 3TRFA 1AQIA 2XT0A 2C54A 3MWDB 2FETA 5GAJA 5EIXA 1G4AE 1M0SA 1QWOA 1SZCA 4KDEA 3QTBA 4URFA 5IAJA 2XYGA 2NYUA 3RTCA 4CLRA 2BEWB 3BEOA 1Z4IA 2C2MA 4JKOA 3QOYA 4RV4A 1FFYA 4YCLA 3L18A 2GAOA 2R6R1 1QQ5A 3K16A 1XO1A 2J0UB 4DDMA 5EE3A 4OLJA 3OZBA 1WETA 3GEBA 5BVGB 2G6BA 1ZPDA 4CIWA 3IBCA 1XI2A 4ACBA 3C6MA 3WYDA 2ZBFA 5CNIA 4HX2A 3OEHD 1BS2A 2GEBA 3H6HA 3TUZC 4B3SB 1ZCAA 2LRHA 2ZJ8A 3RRYA 4ZAYA 3UUGA 4D9MA 3C5CA 2EKPA 5A5VA 5KHLB 3BH0A 2PUTA 1Y3IA 4N39A 2DPYA 1CJUC 2RGCA 3KAPA 5G0WA 5I7OA 3S8EA 2GZSA 1N3LA 3ZEAA 3BK7A 1KK0A 3NOVA 4C76A 3HU3A 3UJPA 3ENWA 1DAPA 4Q3KA 4WFJA 5K8VA 2X8JB 4E6PA 1AKWA 3LJKA 1HYHA 3OVMA 4N5MA 1HPLA 1E18A 2X5XA 2YXBA 4XDZA 2AZTA 2YINC 1FF9A 1T35A 4MA0A 3WYEA 2WDPA 4WXEA 4F71A 1LJ8A 3ZDXB 3RAEC 4Q19A 1U7ZA 3B2QA 3NBAA 4GSLA 1F8XA 521PA 3FN4A 1L4EA 5DGXA 4Z99A 1LDBA 2XRFA 1V8FA 1Z2CA 5EXXA 3UKDA 1I2AA 3HC7A 4RLQA 5HVNA 1SCKA 2R87A 3OPYA 1U0BB 1ZHFA 4KI7A 3IYLW 4BFXA 3FI9A 1T3TA 4AK9A 3I45A 3HB1A 2D2EA 2BP7B 2IYEA 4EVRA 1J00A 4GICA 4WASA 4ZEMA 4CL2A 4MI1A 4DDUA 3WZ2A 1U4NA 5CIYA 3EPLA 1LBTA 1ELOA 2JJ1A 1JQKA 4OMCA 4TMTA 3SBDA 1YR2A 3FWHA 4AU1A 1VP9A 4CDGA 4KDCA 4D9CA 5DM60 3Q3JB 5IKMA 2FQXA 4RE6A 2P91A 2XMBA 3MCTA 1MC8A 4NCXA 4DM3A 4WCVA 3CLKA 3OIYA 2ZJ3A 3JYHA 4L7QA 3UHAA 1V43A 1W4ZA 1ECGA 1KYVA 5T3UA 5BSVA 4P82A 5BMVB 3K70B 4EF4A 2CW5A 2O06A 1UOQA 3OLQA 3RIHA 2QRUA 3W9BA 5HOQA 3OP1A 1KDPA 2AH5A 1VECA 2I7TA 2KSQA 4I8DA 4EKNB 1FTYA 1LRJA 1RRKA 2HDNB 2RAUA 4ZARA 5ICSA 4LXTA 4DLNA 2PFGA 1DS6A 2P40A 3W5DA 3EDOA 4R7GA 2WINI 1KDTA 1S4MA 1R10A 1VP3A 5IVPA 2XKAA 3TTTA 1YL6A 3MINA 2C2GA 2GUWA 4R54A 4B74A 1DADA 3U44A 3FTCA 5EHGA 3MCWA 5A06A 3OM9A 5F7JA 5HRAA 2HJWA 5JWOA 3GAFA 4BGEA 4ND7A 5BYAA 2BMDA 2YR0A 2EKLA 1DV1A 4FC7A 1ODLA 1PP4A 1QHFA 2ZYIA 2A9FA 3O2QB 4I55F 4J3JA 5FORA 3T8YA 4NMMA 5KTOA 1TUIA 4RY9A 4B8ZA 3LBHA 2FZEA 3RH0A 2XUGA 2H4ZA 1N5KA 3OT5A 4ALNA 5DYWA 4KZKA 4E1BA 3U1VA 5EMNA 4MTLA 1EFCA 1CUBA 1Z6QA 2KE5A 1DKRA 1DKQA 1L7MA 2X6TA 5ALPA 4DREA 3EXG2 1J8QA 2ZSEA 3LK7A 1VFNA 5KBYA 1Y6QA 3E3LA 4QEZA 3KT8A 1G98A 1U9ZA 5EE1A 1L5SA 1P5ZB 3A27A 2VSQA 1P1KA 3P9PA 4CU2A 3D5TA 4EW2A 3LT1A 1QX3A 4GPTA 2MSNA 1GCGA 3AHDA 1LDMA 2ZI6A 3CXUA 1DI0A 3PD1A 3IOMA 1TO2E 2OC4A 4J3FA 4P32A 3WLNA 1R18A 3OOYA 3ME5A 1W75A 4OBXA 4BVJA 3RS3A 2CDCA 1FEZA 5JNLA 1LFAA 4E5DA 2UDPA 3N58A 3KQQA 3SNKA 1UBLS 2Q45A 5BSWA 3MD0A 3KQHA 2XEDA 1XIVA 3T0IA 3MCVA 2IBMA 3PUKA 1OY1A 2HFKA 2OXRA 3DFUA 3GLVA 2ZYUX 4FOTA 4HZGA 4L16A 3R6LA 4RF4A 5K0LA 4ALIA 4EI2A 1AUOA 1ZIDA 4ITRC 1GRQA 4B7CA 1NVGA 1II9A 3MT8A 3Q9LA 4MB6A 1O54A 3NBFA 3CO5A 4DC9A 2D7DA 4FZ5A 2CMFA 5C52B 1V26A 4LOIA 4L5BA 1UQTA 2EX1A 2GFQA 1M1ZA 3PD7A 1JWBB 3T94A 2BGUA 1WCXA 2J33A 2X9VA 3A6ZA 3PDWA 1WE2A 4GVLA 4WJZA 1QU2A 1U2PA 3FVTA 1RFGE 1KTVA 1L7VC 4I19A 5EQTA 3U49A 2E21A 3ZJ4A 4JJEA 2L69A 3FCEA 3CEJA 2IV2X 1VPEA 3H6GA 3I37X 3JS5A 4PHFA 2EDAA 2QM0A 3USZA 2O1SA 4O6VA 1K8RA 1B7GO 4DY6A 3BRWD 4KQEA 3UOAB 1YTLA 4Q18A 4G07A 4PXAA 2ZM5A 4B44A 3M4XA 2ZT7A 4ECAA 2CLEB 1IBCA 1ZKDA 1FUKA 1CUSA 3PNKA 1OFHA 1MN6A 3D6TB 4Q4JA 4R1PA 4WFQA 3ZKAA 1E7RA 3PFNA 2GXSA 1CNEA 1AXGA 4UBNA 4FR5A 3QVOA 4YRIA 2VUUA 5D6NA 5C81A 2JZCA 3DWIA 4MCHA 1F17A 4A4DA 3QE9Y 4H7KA 2RSLA 3LGAA 5DTMA 421PA 1I3NA 3RR2A 2UZ1B 1ORHA 5DRYA 4EABA 1Z6AA 5BWNA 1C3EA 3OIVA 4G0WA 2OKGA 1TNDA 2GOYA 4L74A 4JU9A 4QREA 1RIFA 4QM7A 2GNOA 1KARA 2RGEA 4NATA 1ZA1A 3ZZUA 1NVDA 3PLRA 3FVWA 4UOEA 1EEXB 3DBOB 4LBZA 3HXTA 1C4XA 3VJRA 4HFNA 1BVUA 3BRQA 5FTLA 4MH0R 1QG6A 1FMFA 1FP4B 1H2HA 1E2UA 1USGA 1W6UA 4YXWA 4JIGA 3ZVNA 4OQEA 3NC0C 2ATEA 4V0MA 5KSWB 1JAZA 1FP4A 1YS9A 3GFGA 3JVIA 2VA8A 4JC4A 4AZ0B 3QJ5A 2ZJ4A 2VHCA 4HGQA 4F3YA 2MINB 4Z53A 2VI5A 2IP4A 1F1JA 4HNAA 3P0FA 2G4LA 4CM7A 4QDZA 2HBYA 3W5CA 4CJXA 4WNAB 2RHDA 5KTTA 2ZPTX 2GCGA 2QX6A 2W7TA 4F9FA 1QKJA 1Q7TA 4FNMA 3R7WA 5EESA 4B4WA 4BVFA 3D8RA 4RIGA 3BK2A 3F0TA 2Y92A 1X8LA 3N0RA 4DIDA 5IT4A 3G9TA 1BQ3A 2PY6A 4FDAA 1LLUA 3ROKA 4KN6A 1A2KC 1GAXA 3CBGA 5F9HA 4RD1A 1QM5A 1PK7A 4L5CA 4KLRA 3IKTA 1A1VA 1L4KA 4WZAB 4EJ6A 3FOBA 4B3RB 3F6PA 1R8XA 3HU1A 1MR3F 1CR4A 1UXHA 1VKZA 1BW9A 2H6EA 1RP7A 4I4TB 4XFDA 2UUBB 5ES3A 4YJFA 4DIEA 1L5OA 4Q7KA 3RANA 1H0HA 2XOEA 4RV9A 3RC2A 1YBFA 4CV3A 3WA7A 4JJ7A 4LF5B 4UM9B 1YE3A 1GNTA 1P1CA 2GH1A 3TW0A 4BP3A 1PUIA 2VCEA 5EA2A 5MGBA 3O94A 4X0EA 4AY4A 2PIDA 1RBQA 2LPMA 4D5EA 1IFXA 1PL0A 3O31A 3STXA 4BX0A 2HRRA 2AG1A 4QXQA 4DT1A 2B21A 4OHXA 4RDIA 4HPXB 1KPGA 1G5IA 1FXWF 1PNQA 1KJJA 2C82A 2Z83A 4QO7A 1GLVA 1ULHA 4E5PA 1KETA 1X70A 2QN9A 5AHOA 4O4IF 4I1YA 3I72A 4RZIA 5A5GA 1N2JA 2HMTA 1JKJB 4RMJA 2OCLA 4BNDA 1Y6FA 3FJOA 2ZVPX 4Z9BA 1P44A 4YAWA 1NULA 3TPCA 2NUTA 2OQVA 2PUEA 1I01A 1EFRD 2GKSA 3PWKA 2CNWD 1WPQA 3GARA 2REOA 5IVDA 1FYEA 2NV2B 4BKOA 1J24A 3CH6A 2WB4A 3HKCB 4UPEA 2WI8A 3HR7A 1PFWA 2AFRA 4BX2A 2Q6IA 3PFBA 4PFQA 3ASUA 5FBLB 5ADHA 3PC2A 3SJBA 2IZOA 4ZFNA 2F43B 2QQ5A 4BNGA 3EGWA 2PU7A 1Z5GA 2GI4A 3LDHA 1E6KA 1ECPA 3DS8A 4IVNA 2OENG 2ZB4A 1KWGA 3G8BA 3INTA 3LIPA 3NHFA 3ZGOA 1RZVA 1V8BA 3FZNA 3ANNA 2WSBA 1LS1A 2JPDA 4LNAA 3T5TA 4IJMA 5KVSA 4LRYA 3NRBA 3A04A 2CNBA 2P5YA 4FEAA 2OV1A 1UKEA 3ZXIA 3IHTA 2H54A 1UBRS 1XZNA 2WG1A 3H0KA 7AT1A 1O6FA 1Y8CA 5G53C 1EA5A 1MH1A 1SXGA 2VF5X 4YWHA 4ALLA 1BE8A 3PXBA 1Y7PA 2AB0A 4RVHA 2GBIA 4GDFA 4JYCA 1LZKA 1AOXA 1JR3D 2C83A 2M6KA 1MAUA 2P0AA 7MDHA 3M1IA 2AUMA 5COAA 2DSNA 3L43A 3I8OA 3NTVA 3M34A 4RJKA 4O4LA 1U90A 2HK6A 3C3PA 1KVTA 1WXGA 1G7SA 2B94A 1TF7A