5HIIA

Crystal structure of glycine sarcosine n-methyltransferase (gsmt) from methanohalophilus portucalensis (apo form)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
245
structure length
241
Chain Sequence
SDHYEEEYVLGFVDKWDELIDWESRAESEGDTIINILKERGVKKVLDVATGTGFNSVRLLQAGFDVVSADGSAEMLVKAFDNARDHGYLMRTVQADWRWMNKDIHDKFDAIVCLGNSFTHLFDEGDRRKALAEFYALLKHDGVLLLDQRNYDAILDSKHAHYYCGDTVSVYPEHVDEGLARFKYEFSDGSVYNLNMFPLRKDYTRQLLHEVGFQEINTLGDFKETYKEDEPDFFLHVAEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycine sarcosine N-methyltransferase
publication title Structural Analysis of Glycine Sarcosine N-methyltransferase from Methanohalophilus portucalensis Reveals Mechanistic Insights into the Regulation of Methyltransferase Activity
pubmed doi rcsb
source organism Methanohalophilus portucalensis fdf-1
total genus 93
structure length 241
sequence length 245
ec nomenclature ec 2.1.1.156: Glycine/sarcosine N-methyltransferase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hiiA02
10MHA 3EVBA 2OZVA 3KPVA 1RJDA 3BXOA 5HIIA 2CL5A 3NDJA 3EVDA 2B3TA 5FWDA 2NXJA 2ZLBA 4HGYA 2HWKA 4OQDA 3G2QA 2Y1WA 4BLWA 4E2ZA 4YUYA 3DTNA 2B9EA 5JR3A 5DX1A 2C7QA 2BH2A 1NW6A 3FTDA 2BR5A 3KQSA 1VLMA 1JG1A 2JHAA 5K03A 1ORHA 3K0BA 4PYNA 5G02A 3NDIA 3EGVA 1JSXA 3IHTA 2QM3A 2IBSA 2YR0A 3E23A 4A6EA 1R18A 2CMGA 1BKYA 4PIMA 3MERA 5EKUA 1XTPA 4P58A 1NV8A 2GLUA 1RI4A 2UYOA 4U7PB 5DRYA 3R9XB 3LDGA 3P9NA 3T0IA 5K0EA 2WA2A 4RTMA 2ZCJA 4MQ4A 1EJ6A 4QDKA 3TM5A 2YUIA 1SQGA 3M6VA 2CMHA 3EPPA 3FPEA 4OQEA 3DLIA 3SXJA 2ADMA 2G71A 2VDVE 3TKYA 4ER3A 4DCMA 1IXKA 1M0EA 5K8VA 2C7RA 1SQFA 3DUWA 4MTLA 5EMJA 2EJTA 2AOUB 2IDJA 5KYGA 2R3SA 2PLWA 4KVZA 1NKVA 1KPIA 1RJFA 4F84A 4YV0A 1YUBA 5U4XA 3DXYA 2EG5A 3TRKA 3UJBA 5BW4A 1SG9A 3I58A 3EVAA 3Q87B 1JQEA 4YV2A 4OBWA 2C7OA 2AVNA 3BZBA 3FUWA 3PB3A 3U81A 4AZSA 5DX0A 5CVVA 1AQJA 2YTZA 2HMYB 2ZULA 4FT2A 4PYJA 1YB2A 4DM3A 3ANXA 4C4AA 4RX1A 3EVEA 2IBTA 3LCVB 1TPYA 2VZ9A 2AN3A 5HILA 3SVZA 1I1NA 3IYLW 3D2LA 5LQCA 1KPHA 1RI2A 4KW7A 3GCZA 4AX8A 2ZFUA 5EVJA 1EG2A 5ICCA 3B5IA 1HMYA 3EGIA 1UFKA 3QOXA 4FGZA 3OU2A 5HEKA 4C07A 2EX4A 2UZ4A 1L3CA 1INLA 3LECA 1NE2A 3PS9A 2PT6A 3MCTA 2G8NA 4QQNA 1KYWA 4B17A 4C03A 3KQVA 4ISCA 4ER7A 1P1BA 3HCDA 3NMUF 3GRRA 1FPQA 1KYZA 1L1EA 4OA5A 3P2IA 3B7PA 1SKMA 3SSNA 3KR9A 5EOVA 5LSAA 3ER8A 4M36A 5DT2A 4E33A 3AWIA 5CVJA 4PGHA 4ER5A 2UYHA 4HH4A 5HIKA 3UJ7A 3NW9A 1WG8A 2ZIFA 1P91A 3KQQA 4GEKA 1PRYA 4P7GA 5KVAA 4KWCA 1L9KA 4KIFA 2NYUA 2QY6A 1G60A 4O29A 1UWVA 2NXCA 3HM2A 5EHIA 4KDCA 4DQ0A 2BR3A 5M5BA 2PJDA 1G8SA 4CKEA 2G72A 4U7TB 2B78A 3NWBA 4WVLA 5CM2Z 3KQMA 5FTWA 1YF3A 2ZZMA 5FWAA 2FYTA 2OKCA 4HTFB 5CVEA 1SVUA 3FRIA 2JJQA 4P7FA 1N7JA 3OU6A 2ESRA 3A7EA 3I9FA 5CVUA 3ELDA 1O9HA 4EKGA 5K0GA 3GXOA 5H02A 3GRUA 3PTAA 4WXHA 5EEGA 3IEIA 3T7TA 2P7IA 3UA3A 3EVZA 4V0RA 3GDHA 2AN4A 4PYQA 4IV0A 3OU7A 3REOA 1AF7A 3UFBA 1DL5A 3NWEA 5D1HA 1ZG3A 1VP9A 2YXLA 2ONYA 2PGXA 3CJRA 5DSTA 2BR4A 2ZZKA 3GJYA 5E1OA 1Q0TA 3HVHA 3V8VA 1WXXA 3GRVA 4XCXA 3QOWA 2VS1A 4X1OA 5DRTA 3FPFA 4R6WA 2O07A 3MHTA 4CTKA 3P2EA 1TW2A 4FS8A 2ZIGA 2QRVB 2VDWA 4PYLA 2OB2A 5EC8A 5P8WA 5F2NA 2I7CA 3HTXA 5E1DA 3E8SA 4NECA 2Z6UA 1WY7A 3LCUA 5FHRA 1AQIA 2R6ZA 2ZBPA 3SX0A 1ZKDA 4FSDA 3P8ZA 5CD1A 3G2PA 3KKZA 3C3PA 3I5UA 1VE3A 2PWPA 1PJZA 3G7UA 3FYDA 5FADA 4CKCA 5HIJA 5EMMA 2A14A 3TM4A 2AR0A 1KP9A 1XDZA 2AVDA 3C3YA 5F2OA 3UJ8A 3B3JA 4DKJA 1X19A 5DPMA 3K6RA 1BC5A 3HCCA 2OXTA 1R74A 1VBFA 2HTEA 2ZBQA 4GOOD 4ZTBA 2IH2A 3ERCA 2V74B 5DLYA 2PX4A 3ID6C 3HP7A 3GRYA 3DMHA 4E2XA 4M7RA 3LHDA 1JTFA 2IP2A 3VSEA 1FJXA 3T7RA 1G8AA 1XDUA 3HCEA 3M6WA 5CCXA 1MHTA 3WSTA 1P39A 3UWPA 4HSGA 1TW3A 3CKKA 3G88A 2VP3A 3HVKA 4QTUB 2I62A 3KQYA 2BZGA 5EQJB 3TKAA 3EMBA 5EIFA 4E2YA 3EVGA 3KQPA 3DR5A 3BGVA 3BGDA 3UJDA 4RTQA 2H11A 2GA9A 1WXWA 2OB1A 2PX2A 3P9CA 3EGEA 1NT2A 4IKPA 4RVGA 3M4XA 5K0BA 1R00A 2OO3A 4QVKA 1O9GA 5DM2A 5GWXA 3FYCA 3TQSA 5C9ZA 1UIRA 5DM1A 3RODA 4E31A 3TLJA 2P8JA 1G55A 1NV9A 2ZIEA 5E1BA 2AOVA 2OBFA 1F38A 5DXAA 4OBXA 4EVIA 3DH0A 3V97A 2ZTHA 3AXSA 4BP3A 1JSZA 4RTNA 4LWOA 2C7PA 1Z3CA 5E9WA 3PFHA 3B3FA 3KPJA 4R8RA 2Z6AA 1JTEA 1RI1A 3KQTA 4PYMA 4K6MA 4AUKA 5DM4A 1Y8CA 3FUUA 4GBED 4YUZA 4ER0A 4DA4A 2AOXA 3LPMA 4DMGA 3TOSA 4QQKA 3UJ9A 3C6MA 3PLAE 1L3BA 1EIZA 1VQ1A 5K0NA 3MB5A 3KQWA 5EPEA 1QZZA 5K0LA 1R8YA 1OR8A 3ELYA 2IH5A 3FUXA 1R6AA 4KRGA 5E9JA 1NW5A 4X63A 1IM8A 3HNRA 3GRZA 1XCJA 4RV9A 4CWAA 2NP7A 4PYIA 1DUSA 2Q41A 4PYOA 5EIWA 5GM1A 4BLUA 5T64A 3FTFA 1YZ3A 2IPXA 1SUIA 1H1DA 5DTRA 2P40A 5HZMA 4QTTB 5CCBA 1XXLA 3VC2A 1EJ0A 9MHTA 2P35A 1L3IA 3G8BA 2E5WA 2AOTB 3THSA 3R24A 4EMSA 3FPJA 4YUXA 7MHTA 2JG3A 4E70A 3KU1A 4PYKA 5DWQA 1RJEA 2AOUA 3G5TA 1NW7A 5FCDA 5GOZA 3OE5A 4BY9E 2H00A 3QV2A 1D2HA 2ZBRA 2YVLA 5HIMA 4DZRA 5CIYA 3M6XA 4GF5A 1ZHFA 5ERGB 2ONZA 3ORHA 5GIPE 2GAFA 3B89A 1VPTA 3CJQA 1JG3A 3FUVA 3OCJA 4RTOA 5E2AA 3DOUA 3FRHA 1YFJA 3FTEA 5FUBA 1VIDA 4BP1A 3OFJA 2YXEA 1QAOA 5ICGA 2PY6A 4FSXA 1I4WA 5KQSA 3A26A 3KPUA 3BWBA 4R8SA 5T6BA 2YQZA 5KQRA 4YMHA 4GOMD 1O54A 2GB4A 5K01A 3DMGA 2GS9A 2XVAA 3M33A 3MCZA 4AZTA 1D2CA 4YUVA 4LWPA 4GOND 1G38A 2NXEA 4AZVA 2ORED 4Y30A 3G8AA 3EEYA 4ATNA 1YZHA 1ZQ9A 1QAQA 3KHKA 5GINE 2I9KA 1B42A 3HA5A 1FP1D 1XJ5A 3PX3A 4RVDA 3R0QA 2ZW9A 2UYQA 3MTIA 4P7JA 1KR5A 3OZRA 3RIEA 2AS0A 1M6EX 3LX6A 3LDFA 1YFLA 4QPNA 1NW8A 1X1DA 4RWZA 4E32A 3TPZA 3BWCA 5EZSA 3A4TA 2B2CA 2ZZNA 3JWHA 3LCCA 4V0QA 4CXMA 1BHJA 3X0DA 3ELUA 3GO4A 4PIPA 3OFKA 3PFGA 3PT9A 5FQOA 4XUDA 5IH3A 3NJRA 1QANA 4Z2YA 3O4FA 4F85A 5GIOE 1DCTA 4XUCA 5EZQA 4M38A 2IGTA 2BM9A 3GGDA 1XCLA 4L7VA 3DXZA 4QVGA 5CVDA 2PSSA 4HGZA 3L8DA 4HTFA 2PXXA 5FHQA 4DCGA 2F8LA 1Q0SA 3DLCA 3TR6A 1JR4A 2DPMA 5BXYA 1KHHA 2HV9A 1ZGJA 3Q7EA 4KIGA 5HFJA 4C04A 3LBYA 2O57A 3OZSA 4E2WA 2ZSUA 4X60A 4M37A 2WK1A 1EQAA 3G89A 1JQDA 4RSRA 5C0OE 3CVOA 3VYWA 4X61A 4RTKA 3EVFA 1M6YA 3GNLA 5B1SA 4RVFA 2PX8A 2PBFA 2XYQA 5K0CA 5K0JA 1X1BA 2YXDA 5EGSA 3E7PA 5EMKA 3HCAA 4CKBA 1VP3A 4UOEA 3EVCA 4G56A 5KS2A 5LQRA 2YX1A 3UJ6A 1SUSA 4RTRA 4LECA 4R6XA 2JH8A 4IWNA 4Y2HA 4F86A 3SMQA 4PWYA 5EEHA 5K05A 5EHGA 3BWYA 2FRXA 2GH1A 2QRVA 2CKDA 3BWMA 3P2KA 2EFJA 3KPWA 4HRAA 1P1CA 4QPPA 4KDRA 3NTVA 2PT9A 2ZWVA 3UJAA 4OA8A 3BUSA 1QYRA 3EEOA 5FA8A 4POOA 1N2XA 3CBGA 3PX2A 5DTMA 2UYCA 3SGLA 1U2ZA 3TFWA 3PVCA 4PNEA 3A7DA 5LR6A 5FQNA 1FBNA 1T43A 2NP6A 3LGAA 2P7HA 4C05A 2V7EA 2CWWA 1R8XA 4H0NA 4YV1A 3MGGA 8MHTA 2JHPA 1IY9A 2EJUA 3G2OA 2G1PA 3ME5A 3R3HA 1BOOA 5JUWA 4XUEA 3NVKI 3MQ2A 1KIAA 1X1CA 5K0FA 2XYRA 5DSXA 3TMAA 1F3LA 2P3QA 1N7IA 1KXZA 2WA1A 2DULA 1WS6A 3I64A 4E30A 1EAMA 3GIWA 4FZVA 2VDUE 2ZWAA 1HNNA 1XDSA 1VL5A 1RI5A 4QDJA 2LD4A 4RVHA 3CCFA 4X41A 5LQAA 4EK9A 2QE6A 5CUQA 4YUWA 2HR1A 4A6DA 2I6GA 3A25A 3P9KA 5E8JA 3M6UA 3BGIA 2NXNA 2H1RA 2JHCA 3HA3A 3G5LA 3LDUA 3P71T 5FULA 2OYRA 2ZVJA 3R6TA 3T7SA 3M70A 2AZTA 3HVIA 2N47A 2OPBA 3BT7A 3LSTA 3SM3A 4RTJA 1D2GA 4GC5A 2XVMA 3KQOA 3DMFA 3RW9A 4C08A 1AV6A 3AJDA 3HEMA 4PCAA 3JWIA 1NBHA 1G6Q1 2HNKA 3SSOA 3ELWA 3DULA 3KPYA 4EQZA 3E05A 1WZNA 2FPOA 3FPGA 4GQBA 3OE4A 5E9QA 2IIPA 3UBTA 3KR2A 1XVAA 5T67A 5LQJA 5DM0A 3G2MA 4JXJA 2K4MA 3CGGA 3HCBA 3HA7A 5DXJA 3KR0A 4FT4A 1JG4A 1NBIA 2G70A 2Y1XA 3JWJA 5GM2A 5C1IA 3HVJA 4RTSA 3MTEA 2P3LA 1V39A 2IH4A 4DF3A 4OX9Y 2PKWA 3CC8A 4PONA 5EKXA 3DP7A 2QYOA 3F4KA 3LL7A 3SR4A 1ZGAA 3THRA 5FA5A 3O31A 3UJCA 2JH9A 1QAMA 1NW3A 2O06A 3KR1A 1JG2A 5EMLA 2FK8A 2AN5A 4CTJA 5F2KA 2FK7A 2IDKA 3FPHA 3UZUA 4LG1A 2P3OA 2P41A 2PWYA 5E1MA 3VC1A 3P9IA 5ICEA 3B3GA 3FZGA 3EMDA 4GC9A 2XBMA 3CJTA 2PV0A 1KPGA 4FR0A 4P7KA 5HOQA 1JQ3A 3AXTA 3MAGA 5IKMA 3GU3A 3LKZA 4YMGA 3S68A 4RTLA 2FHPA 4EKIA 5BP7A 2ERCA 3NVMB 3DXXA 3LBFA 3C0KA 4HG2A 3JWGA 2AOTA 3AY0A 4C06A 5K09A 4MWZA 3GWZA 3HCFA 4IV8A 5ICFA 3UA4A 3BKWA 1RI3A 1ORIA 5LQKA 5E8RA 3ER9A 2XYVA 3O7WA 4RTPA 2BM8A 5EG5A 2Z6QA 1RJGA 5D1NA 2B25A 3IV6A 5LQUA 2KW5A 3FTCA 5MHTA 3H2BA 4AZWA 5LQNA 4HC4A 4GUAA 2OY0A 1I9GA 3P97A 5DTQA 1FP2A 2PVCA 4BLVA 2AOWA 4PINA 2NNWB 2O0LA 3C6KA 2P1DA 2GPYA 2PX5A 4PGGA 3I53A 3LKDA 3OPNA 4R05A 3A27A 4FP9A 5E2BA 5GP1A 4ER6A 4GOLD 4PCLA 5DX8A 2O05A 3BKXA 2IFTA 2PXAA 3SSMA 2FCAA 4MIKA 1X1AA 1MJFA 3FUTA 4MHTA 4RYLA 2PXCA 3OZTA 5BW5A
chains in the Genus database with same CATH superfamily
4J1TC 1GUBA 4JUBA 3WNQA 2I2XB 4K0RA 4OQDA 2Z43A 3KYDA 4MPJA 2XRYA 1OHHD 5D86A 2VP2A 4A91A 2Q5CA 3ZC3A 3IT3A 3MCUA 2BH2A 3KKQA 3HJTA 3RYTC 1W46A 5DEOA 1X7HA 5K51A 3VR3A 4J4TA 3I83A 1ZC3A 4OQNA 5B3KA 3G49A 1Y33E 4K6KA 5ILOA 3FMFA 1I14A 1WDLA 2FZVA 3CG0A 3SBDA 3QU9A 4I1VA 4B7AA 4H1TA 1L4BA 5IDYA 4RD2A 1YRYE 2H51A 3MERA 2BDEA 5JISA 2IIBA 1B2LA 2DWQA 4U9HS 3LDGA 1E0DA 4EJMA 5BYKA 3VKWA 1K8RA 2IXAA 1IN7A 3P9YA 4M1QA 1CQZA 3O8BA 2WF8A 2UV8A 4OG2A 5EZYA 4CLEA 4G25A 1H6CA 2H4HA 3BIXA 4WK2B 3WQHA 1A4RA 3IBCA 4NENB 5BVHA 5SY4A 1NRWA 3LE8A 4MR8A 5TMEA 2ZYRA 3F0TA 4PM4A 1V8OA 2I3DA 1XPUA 1KRWA 3KETA 2JK0A 4F9GA 4F1JA 2CYAA 4F97A 3OQVA 4HAXA 4WKGA 5JD6A 1DX9A 4R68A 3LOPA 3MBOA 3O8NA 1T2FA 3CQ9A 1AVTA 4ZQGA 1FJHA 1SC6A 1OMOA 1DHRA 4K2HA 1MOSA 1GQFA 2G9UA 2WYUA 2YHSA 3EVAA 4JKIA 4U7WA 4XKJA 3BZBA 4AZSA 1E0JA 4X6UA 2R84A 1WBJB 3PDIB 4C5AA 1NJSA 4TKVA 2AV6A 4ZCIA 1WBDA 1NWCA 4ZAZA 2A0YA 4QC2A 2W6IA 1CDOA 3ED1A 3I0ZA 4OYYA 1Z56C 2XNCA 1SULA 1U0NA 1S0UA 2AN3A 4KFRA 5L3QA 4BP9A 3L0OA 2YVKA 3IAAA 2RHDA 4MHOA 3WVNA 1GPMA 3KKMA 4E14A 4EVQA 1Q19A 1W85A 3F6YA 4W8HA 4LF6B 1UFKA 4TVOA 1J9ZA 4W82A 3GW8A 3MWJA 4P93A 4UCWA 5HEKA 3W8EA 4BGDA 5JYBA 3LECA 4E5MA 4KSBA 1AHIA 2A7XA 5A4DA 3FPBA 1E3MA 1B0AA 1NP7A 1YQWA 3RSGA 3D8NA 1X92A 1J2TA 1JT2A 1RLJA 1Y80A 1BMDA 4B17A 2PZKA 4ER7A 2ZROA 3HCDA 4MZXA 5HNKA 3HR7A 3O1LA 1FPQA 1OJLA 1VHWA 3BIFA 4GOJA 4B4WA 2FU5C 1P77A 3TQFA 3AHFA 2IWHA 1K89A 2P2GA 5CDGA 4F2HA 5HYVA 4WKNA 4PGHA 2GAJA 3HXMA 2JGJA 2I8CA 3DAYA 3DO5A 4G84A 2UYHA 3BHIA 4OYHA 1FX0B 2Z8YM 4LHEA 5D8DA 4XDGA 3GVHA 2WMDA 5IG2A 2X8JA 3EA0A 1ISHA 1NI5A 2HA2A 1PZEA 3ENKA 4B81A 4TZ0A 4BX0A 4Y2TA 3DV2A 1GNPA 5HF9A 3A4NA 1J1ZA 4AJPA 5B5SA 1DFHA 2DLDA 3P9ZA 4GXTA 4HWTA 1FPMA 2FE1A 2JFXA 2J3MA 1LPAB 2FYTA 2V6JA 1I5OA 2GHTA 2XWPA 3GNTA 2XMQA 4D0RA 4W5OA 1KFEB 5CHYA 4TLDA 3VNSA 4AJEA 1YDWA 2J6HA 4DG8A 4IMRA 2B8NA 2PYIA 3JAKA 4UJ5A 2C9CA 2CNKA 1BROA 1CYDA 3VR3D 1I32A 5HJ2A 4G5GA 5BN3B 2ECKA 1EVZA 1TVEA 2QS9A 1J2RA 2G80A 5AK4A 4LF8B 3QBEA 1S2MA 3WFJA 2WWHA 3O2QB 4OHWA 4AJ9A 4UDYX 1R0CA 3VSBA 3L8FA 5LOVB 5KU7A 1HBJA 1HEIA 1W4AA 1DQSA 4O4IB 1VKZA 1D4OA 2JNWA 4QOHA 5CH3A 5DRTA 2Y0BA 3CX4A 4TUYB 2N3ZA 4YJHA 2QJRA 3A4VA 3WWYA 5JXHA 1MBZA 3JQAA 1HEYA 1GM5A 4AJJA 3GLHB 2ZOSA 3UENA 2O54A 3GAMA 4ZKDA 3BIWA 4HNHA 2AMYA 4HYYA 3IIIA 4KLRA 4QUBA 5EC8A 4G8DA 1HM5A 1UFRA 3E8SA 4JWTA 1KQPA 4OIFA 2PMDA 1RJ9B 1O5TA 1T9GR 2QRMA 3W90A 4C76A 4F4UA 4NCAA 1GL7A 3DLPX 4ZMSA 3ET5A 2ZI5A 3O26A 3KJXA 2VHTA 1K08A 1Z3IX 1K3UB 1VA5A 1V8ZA 2IU6A 1J2EA 3B70A 1PS0A 3K4PA 4ILKA 5DCYA 3WYBA 2QVGA 4YPVA 1KXJA 1SURA 4W6QA 1W8IA 4AIIA 4ESVA 1XDZA 2H63A 3HWSA 4G0QA 3ZV5A 2GNAA 4D4JA 2N1BA 2W6ID 1AZWA 3VZBA 121PA 5BWNA 5KYKA 5KTYA 1KKMA 3QHQA 1R27A 2PX4A 2VWQA 3GRYA 3NASA 4FFVA 3U9SA 1FJXA 3OT1B 1FXSA 5E7JA 5H4HA 1T8SA 1XDUA 4D4LA 4IDAA 3TFQA 2IY9A 4ZRNA 3FKQA 5IC4A 3GL9A 4QXAA 5B3JA 2PMEA 4QPCA 3RTBA 1BTOA 2ZJYA 3GCGA 1WXDA 3E5MA 3TQHA 4DTIA 2NZ8A 1U2DC 4LUCA 3DZDA 3DTTA 4X44A 4G5FA 3RBVA 4OQLA 1QLWA 4LNUA 5A9TA 1RWNA 3ZVLA 2BI8A 2NT3A 4L5IA 5KYUB 3AF6A 1Y6ZA 4JGGA 3ND6A 4I81A 4F2WA 3QEMA 2FPGB 3RU9A 3A9UA 4CETA 5A0TA 1ZP6A 3IUSA 4IKEA 2IYPA 2QU7A 3OF3A 1Z62A 3ZQKA 5JROA 4EOGA 3CLHA 3WKAA 3DH0A 1K06A 2BVNA 4J9UE 1V1RB 2OBMA 5IZCA 4ZDJA 5TE9A 4DA9A 4PLCA 1J1IA 4QXRA 1A9YA 3L6BA 5DM70 2PZFA 3PDUA 4KIJA 1JTEA 4Z0TA 1C1DA 1KJIA 3PUJA 3PXDA 4CLDA 3CRQA 5A5EA 4AQ7A 1PEKE 4NZ9A 4O2AF 1QIKA 1L7XA 3PE4A 4JOCA 3AJRA 6LDHA 2NG1A 1OX5A 4PZUA 5AK5A 5FKJA 3C6MA 1EP3B 2V7QA 3MB5A 2AFHB 4YRZA 2C9BA 2XCLA 2Q7DA 1NC3A 2A5LA 2H6EA 1HZZA 1TEHA 1U3UA 1VZ2A 1ACLA 4CDMA 3IQGX 3UQYS 5CFQA 1O8CA 1RRGA 2QW0X 4HDOB 5FWXA 1XXHA 2Q6VA 4RF3A 2F1OA 3HXLA 1YQEA 3W3AA 4DT1B 3NTRA 5KPDA 3N2KB 3CKYA 1JEEA 3COJA 2UUOA 4I99A 4CFYA 2A1UA 3FVWA 3L6OO 2DG2A 4H0FA 3JQAD 1EJ0A 3K7EA 5THQA 2ZJAA 3OUUA 4ZPJA 5FNVA 3TUIC 1BQ3A 4YUXA 4N7MA 4MQ5A 4FBMA 1ZEJA 3KU1A 3TKLA 4Z86A 5DWQA 4LDNA 5KB3A 2B4RO 2G9ZA 4AROA 4AUEA 1Z0IA 2GVNA 2QD4A 2R85A 4I6JA 4CIVA 2X22A 3E15A 2WZCA 3PI6A 4DOMA 2GPNA 3KBOA 1FFWA 5F2EA 4FINA 2F1JA 2D59A 4KREA 1BQEA 2WNIA 1V1MB 4NE7A 4WQMA 2AK2A 1QGDA 2QPLA 3ODGA 3CJQA 3OCJA 3U4QA 4MO2A 2FDCA 1RJWA 2QVXX 2JIQA 4S0ZA 4EG5A 4HWGA 1G8GA 2FWJA 1TAHA 5CX1A 2WBLC 3R6GA 4BP1A 4OXIA 1QAOA 3PFIA 2C9MA 5B3LA 1JZQA 2FI1A 3KPUA 1N77A 4AMUA 4MP3A 2IS1A 2J6BA 1O54A 1T5LA 1QK4A 1W94A 4IIEA 3RYIB 1TQHA 4ETMA 5C5DA 1C7ZA 1N32B 4JOBA 4YWHA 1E6WA 2G5CA 4BC1A 3A6FA 3H8SA 2FZCA 2AC7A 2XMBA 1HDRA 4OAPA 2A86A 2OG1A 3G5AA 4MB2A 4YJ3B 3FMIA 4BGEA 4J29A 1QAQA 4DR3B 4FDVA 3PEWA 1JXQA 2XGGA 4BO2A 4NI5A 1N9GB 1XE3A 4P4SA 3TI7A 4DUGA 5FWYA 2V1XA 1EWQA 4AD8A 4LFAB 1U98A 3RIEA 2BMVA 1M6EX 3KOXA 4HQLA 3GLSA 1MH9A 4YDRA 1EBFA 4JLOA 1NLZA 3H2YA 1OXUA 4W6ZA 1TKBA 2DU8A 1NSFA 1G4HA 2JFNA 4X8HA 1XI2A 1C80A 2FMIA 2H5EA 2ECFA 1WO8A 2XB8A 4PIPA 2W9XA 1VLZA 2PSHA 1KMIY 4OU5A 3PT9A 3R7NA 1I30A 2GN0A 3TCXB 5H3HA 2QNRA 3G02A 4MULA 1JHMA 3R0ZA 1PSDA 2BM9A 4LVOA 4EKNB 4BWGA 1HH4A 1QG0A 4HH3C 1L1FA 3H86A 4UVIA 3W34A 4DZZA 1OGIA 3LK7A 2PXXA 3BXEA 4HDMA 2JGLA 2CNLA 4KODA 1XZIA 4FQ8A 5BXYA 3S2FA 5ADUS 3L4JA 2A9RA 2D5BA 2PH7A 2J5QA 4K86A 4I5DA 1Y1SA 2FPSA 4JU8A 4B3BA 1HYQA 2V7QD 2YVUA 3PVSA 2BUCA 4AQDA 4X61A 2XEXA 3H1TA 3O2NA 3DZHA 1FMTA 3P26A 3QKRB 3U80A 2BEKA 2HF2A 5H81A 3RTCA 3VU3A 2GN6A 4QICA 3WQQA 1DFGA 1OLXB 4O4JF 1GEGA 2G6TA 1GEEA 1UIMA 3O94A 3OD5A 4TWIA 1Z06A 3QBDA 5EY5B 3W3AD 1WMBA 1KMCA 2C82A 1EK0A 4MWGA 4AT1A 1Y5IA 2CN1A 2VI5A 3H75A 2XBLA 3H5AA 5L4NA 1NMQA 4CM8B 2ZRIA 1YL6A 1ENYA 1AQUA 4Q24A 2FMXA 3G5MA 1BJKA 1UT5A 2N42A 1T2DA 4E3ZA 3SE0A 4KPUB 1JDPA 1E9CA 3BCHA 2DFVA 2FNAA 1SFRA 3LSYA 4YJKA 3RSSA 3VRHA 1DELA 2FOIA 4FW8A 4F7DA 4BWYA 2CUZA 3PJFA 4OK6A 3ETCA 2WMYA 5DI3A 3CR8A 1LDBA 4AZ3B 1ODSA 3IEUA 1ULBA 4QECA 1RXWA 1QSGA 2PRZA 1ND5A 4ZV7A 3USES 5LP6B 1FTSA 2M1ZA 1LJ8A 3GGPA 1BX0A 1JKXA 3M1IA 4Y2PA 3IT2A 2Z5VA 1UP4A 1X7YA 4MMXB 1ODKA 1YR2A 6ABPA 2E55A 2ATIA 4OXQA 2J67A 4LXUA 2F9FA 5K0FA 1ZU4A 4BO6A 3BJZA 4OH1A 4ZAVA 3VNUA 1PJQA 2EFGA 3KDPA 1PYOA 2R8YA 4ND3A 3MOGA 4U2BA 1LBIA 4O5AA 2DY0A 4B4DA 2QJOA 4BLSA 3JVEA 3JARA 3ANMA 5CUQA 1U31A 1VJGA 4KFSA 3S1SA 1T8PA 2I6GA 4YCJA 3R9XA 5BMVA 4HXFB 1T35A 4LVNA 4QO7A 4CKZA 2HMSA 5GJBA 1HDCA 1KMHB 2I2AA 3UGKA 2G6BA 2H1RA 2JJ8A 2Y1KA 4DUGD 2A94A 1M34A 2HZBA 4WW0A 3ZG6A 2A30A 3NDBB 2GEDA 1XK7A 3M70A 4LFCB 3V7FA 4PAWA 4YAFA 1W7AA 2IYTA 3CLVA 3A37A 3EHEA 2DQYA 2RGXA 4R69A 3SM3A 1M1YA 2TMDA 4GC5A 3EC2A 2Q27A 5JAUA 1CUGA 1Z63A 1AV6A 4ZO8A 5MGBA 3CB4A 2EKDA 3HR4A 1G5RA 3F3KA 3ZUGA 3HLYA 1B0ZA 2WIKA 3AFGA 4NABA 5FBVB 3SN6A 4FZ5A 2G04A 5JHGB 5INTA 1ORWA 1XZEA 3J81k 1X2EA 1V48A 3AJ8A 5AHXA 2XTMA 4M1WA 5LWQA 1R6XA 3KJNA 4PEVA 4D8WA 1RQXA 1XLWA 5JNUA 1EFPA 1UOQA 1W4RA 1BCSA 1NR1A 3SYTA 4MV3A 2CL0X 4G3XA 5KWJA 1ZLXA 1IN6A 5AI0A 4GX2A 3D8SA 1Q57A 3SR4A 1ACMA 4B2YA 4GRAA 4JH0A 4QJ4A 1SUBA 5F12A 3HY3A 3NBMA 2NTYC 3C3JA 4DIFA 1I4DD 1G9SA 3DLAA 5AKKA 3MTDA 2ZJOA 1PJCA 1D4FA 2HU5A 3FPHA 2YBDA 2E4UA 3EA5A 3EZ6A 1K0FA 2BD0A 1VL0A 1F14A 1FP6A 2H9YA 4XX0A 4YQZA 4FEEA 2XBMA 1MX9A 1T5DX 1EDBA 5JQGF 3STWA 1GDTA 1OGJA 1KNXA 2N46A 3LKZA 5DV9A 4HDRB 2PU7A 2WJVA 1F06A 3OJCA 4UBKA 4R3NA 3WIOA 2CL7X 1PFWA 1Z6AA 3KWJA 4CLOB 3OTOB 2Y93A 1SCNE 2IOFK 5TQ2A 4ALNA 5FDFA 4CT5A 3DCJA 5DCUA 3BKWA 4AWXA 2E9SA 3AJ9A 4HSEA 4XI9A 1JQBA 1G21E 1Y1TA 4QGAA 3A1EA 1PGOA 2XYHA 5LQUA 2KW5A 2DBZA 2Z2IA 3KHUA 1J24A 1L9XA 3NEAA 4PPQA 1Z37A 3V8RA 3ZE0B 3K9QO 3LWDA 4TV8B 4Z2AA 5FRDA 1KQNA 5BWCA 4CEHB 1ZCZA 3A2MA 3AKZA 4EUHA 4F71A 2C4VA 1TADA 2GAOA 2NNLD 3S70A 3TSYA 3O83A 2FN8A 4GZ6A 4U39A 4RKFA 1FP2A 1PG5A 1ZSNA 1ISIA 2CXUA 2PVCA 2R4QA 3OF2A 4IDNA 3ZCVA 4C0SA 2H59A 2CHVA 3A28A 2CFCA 5IUJC 1UBJS 1JGTA 2ZRDA 2PSFA 3OM9A 3WYEA 2AD5A 5IFKA 3NWOA 2OCIA 3QE9Y 4OCZA 2BPOA 4IRMA 1CY8A 1P2SA 4NS1A 4W63A 1IK6A 1KAOA 1TCCA 1MV8A 4OLAA 4DIMA 4O33A 3RIMA 4YP7A 2BKLA 4LDPA 4NU5A 4MV1A 4BV8A 4X45A 3AEKB 4G4JA 3MMPA 4LQLA 5HF5A 2BFDA 3R5SA 3A9CA 1OKKA 3JQFA 4C22A 4ZCQA 3TBKA 1P9WA 5CM9C 2XUHA 2DOKA 3GNQA 3WS7A 3FY4A 4F46A 4HJRA 4KQ9A 2MU1A 1FFXB 1ORHA 5JYDA 4D4KA 3RT1A 3HFSA 4B0OA 2VUUA 1K97A 4C30A 4ZHQF 2ACVA 1R18A 2FPIB 2FV8A 3OQPA 3ZHYA 2A33A 5AFSA 1KI6B 2ZXEA 3WK8A 1XEFA 5CXXA 5KYWA 2GLUA 1Y5MA 3DL7A 3WV5A 4EYOA 2WHPB 3ZNOA 3LC2O 5CMLA 4D8YA 4D3DA 5IXYA 3K30A 4RF5A 1I7LA 4IJMA 2F2TA 1IH8A 1IAVA 1Y4DE 2HK9A 3I09A 1UK6A 5TR9A 4MUMA 1DKMA 1GT6A 4EJ0A 1IRIA 2UVDA 1XJQA 1XA0A 5B3AA 3WYNA 2GM5A 1C1HA 2GYVA 2I4TA 2IDJA 4I50F 4LSWA 4RL4A 4XVRA 5DH9A 5H0IA 2Q2OA 3K31A 4HGQA 4EJSB 3GYGA 3PYLA 1E7YA 4ZVQA 3UQZA 1TM2A 3RUDA 1UDWA 1FYXA 3RYHB 1YUBA 1VMDA 2QOEA 3HFRA 2ZS8A 3H5VA 4PICA 1PWEA 4XZ3A 3H9JA 1LRLA 3I58A 2Q5LA 1JQEA 1P45A 3MXOA 2RE8A 2XT0A 3I6YA 4ZU6X 3U81A 5HE8A 4BN5A 2B0JA 2A4MA 4RXTA 3WLAA 1WMSA 2HMYB 4IOJA 4RXUA 5CDHA 1EFHA 4LYAA 4WZAB 4C4AA 4US2R 2PG3A 2IBTA 3EGDA 2P77A 2Q7XA 4ZTZB 4DQVA 3V8MA 1OI7A 1QFZA 5L3RA 1EYZA 4FSHA 3V80A 3CLKA 4K9LA 1IIBA 5KKAA 4KW7A 3JS5A 4D9FA 4RVUA 2QNIA 2VSFA 2O9JA 3JTMA 2Q5JA 3WGKA 1JECA 4GXQA 1QE3A 4ALIA 3E2PA 3NHJA 1MH1A 2GNOA 3EXIA 5E6UB 3KQNA 1S02A 3WIUA 7YASA 4MUJA 2F7SA 5GPBA 1ECBA 1WVIA 3EQ6A 4D9GA 1CJBA 1BOFA 4C0KA 4FYJA 1L1EA 2WWFA 1I2ZA 2A0KA 2JD2A 3Q12A 2BM1A 3A2LA 4JJKA 3S8MA 3KZKA 1HQYE 1E98A 1GRCA 5L4LA 3DAHA 1JDUA 2JW5A 2DX7A 1LSJA 1GR1A 2HJRA 4M1OA 3ZU4A 1FP4A 2C9OA 4J0HA 3ESXA 3ILSA 3IT1A 3VU1A 2QF7A 4ZYUA 1P7VA 1WQ4A 1K6XA 4NQRA 4RSGA 2Q4TA 5HM6A 4FWIB 4WBXC 4IVNA 5FUVA 1YMUA 4CM9D 4UMVA 1LI4A 3NNDA 4LZJA 4AMGA 1CK4A 2G72A 1IULA 3ANTA 4RD3A 1SOAA 3H2SA 3C8HA 2P0YA 5BN4B 1LY1A 1Q0LA 1D7OA 3COWA 4HTFB 3TSAA 3IUJA 2BFFB 1RWVA 2GEVA 2XX3A 1QNFA 4WSOA 5LDGA 2WHEA 1EDEA 1OKKD 4GU5A 2QSJA 5H02A 4EJSC 4U5XA 3KKPA 3DV0B 5KTRA 4ZD6A 4DIUA 4N47A 3E18A 1AF7A 5FBWB 1QHEA 3QFSA 4LYEA 1RTKA 3JAWB 3SNKA 5KYXB 2FRVA 2Q0XA 3R7BA 3B60A 3HA2A 2NAFA 3L1KA 3LRXA 2BFNA 2D06A 2VS1A 1QCZA 2QMYA 2EWWA 1UKEA 2IYFA 2VA9A 4KEAA 2HQBA 1DHTA 2WF7A 3C3EA 4JC8A 3O90A 4FS8A 3TQRA 3WJAA 3A11A 5HFAA 1E79A 3UPTA 5DBHX 4DCVA 1V7PC 3OX1A 3QU2A 4R2IA 4X71A 1UDAA 2E1PA 1CW2B 3CLSD 4FC7A 1LPSA 4OL0A 5TMDA 5ISMA 2VPWA 5F1PA 2TMKA 1SCUA 2OZLB 2XCQA 5CTAA 3C2QA 1S4MA 4KN6A 1ZEMA 2Z56A 4J0QA 3UGTA 3VPXA 1WEKA 4AB1A 4AN0A 3DEIA 1HEUA 1TCAA 1W5BA 1QM5A 2IYEA 3G1WA 1IBMB 3D4OA 4G97A 1BHO1 1QHFA 1NX9A 3UCXA 1X8LA 1HDYA 1AKRA 4W8GA 1XGKA 1ESZA 1RM4A 2O2YA 2W58A 3LQ2A 3MYYA 4K9KA 1N5RA 4RLFA 1F51E 4K9QA 2OXTA 4A1OA 5IHPA 2D3TA 4GOOD 3MZ0A 1K75A 4FFMA 4JVNA 4X1IA 3O8CA 1EDOA 3V2GA 1P3JA 3NDRA 3OKPA 1RZRA 5K3BA 4R5HA 4LCJA 3LHDA 5DP2A 4DR2B 3O3MB 1WMDA 3EGCA 3H6HA 5L9AA 1C7FA 1NM5A 1P39A 3D4BA 2P6RA 3MMSA 3RYCB 1SHTX 1PWHA 1OLSB 1KZYC 4M4SA 5JNTA 1HNZB 4OUDA 3UV3A 5K6RA 5LYYA 4E2YA 2LE0A 2P62A 3OJLA 5A5FA 1CDDA 1ZCFA 4LOHA 2QVLA 1V9LA 3RUEA 2Z6VA 1KFCB 2O8DB 3NU1A 3R3UA 1TTHA 1Y3AA 2Y77A 5DM2A 2CV0A 4I1RA 5L8VA 4YRCA 1E7WA 3H2GA 3U31A 3TUZC 2XEDA 2Z2JA 5G41A 3QVJA 3ETGA 5C51B 4ZVTA 4I14A 3HUFA 3EXEB 2D13A 2XF2A 3OLYA 4OLJA 3M0EA 1F38A 1RRKA 4LGCA 4NTZA 4U6SA 4B3XA 1TT5B 2WDZA 4BCBA 3ZZNA 2EYQA 2RK6A 1JRLA 3E0XA 3RYFA 4Z1OA 5EHNA 4QXPA 4G0WA 4BRWA 4YT4A 1IAQA 1WPQA 2WUEA 2FUCA 1U90A 5DWDA 1C3OA 1I51A 1M2OB 2QG4A 4P0TA 3UHPA 1GRVA 4WLEA 5CCEA 3C98A 2WZDA 2OHXA 2O7RA 3DF7A 1KEZA 4GMGA 2C61A 3TEMA 4EQ6B 4RY0A 5EQFA 3OLWA 4AX4A 4EMUA 1CHNA 4D4IA 1L3BA 3M3PA 4GBMA 4L8GA 2R6AA 3WTCA 2Z0MA 3ITEA 4NEHB 4AY4A 1YHNA 5D3QA 5EP3A 4JVOA 2RGWA 4UULA 4Z9YA 2ZQZA 4RHYA 1JDJA 1FFAA 3K0FB 4CPDA 3AG5A 2QX8A 4HFNA 2WU4A 3EG9A 3HACA 1ZH2A 4KRFA 2Z9DA 1KYYA 5I8WA 4GPD1 3C3CA 1PQ4A 3I4CA 1DWQA 1Z34A 1J1UA 4JP3A 5C80A 2QY9A 4A0RA 4YRTA 5EWJB 1DIGA 3H18A 1QQ6A 4EGCB 2AOTB 3FF4A 3WLOA 3GHHA 3TAXA 4RJTA 4BNNA 1WDWB 1Q50A 2J4CA 1F6WA 3GHYA 4BO8A 4DQKA 3ND8A 1RZ3A 3ZZMA 5K45A 3G5TA 4N8EA 2Q1SA 4E12A 3NTQA 3LKVA 3WI7A 1F1BA 3DQPA 5T7BA 5HIMA 4ECAA 1RMTA 3I01A 5K7SA 2GESA 4C0LA 2PUAA 5D5QA 5EIAA 1ICIA 2CZGA 2FFBA 2Q3MA 1ES9A 4LF4B 2LVBA 1ZSVA 3VAAA 1HSOA 1PKXA 4A15A 2EF0A 3PE6A 2K6GA 3F71A 3WBBA 3PGXA 4LXIA 2O1SA 1F4LA 3C5EA 5FI0B 1NXPA 4C7XA 2GZRA 2YUTA 3NNSA 1RZRD 3THWB 3LHFA 3M33A 2R6HA 2NM0A 4G8BA 4GZ5A 5ALZA 4FMCF 3BFVA 3S81A 4RE5A 4EHDA 1O03A 2JAXA 4O1HA 1VTKA 3L6CA 1GT91 4M21A 1PR4A 1YZHA 3I05A 3TNYA 5TPZD 2V03A 5FBHA 9ABPA 1B42A 2G09A 2NUBA 1IG3A 3U2QA 4RA6B 4A82A 1V4VA 2XI4A 1WXIA 1XVLA 1KR5A 4Q1BA 4TT3A 1MC8A 3HXKA 1UBSB 1SWWA 3QHAA 2BEWB 2VHXA 2PUFA 2EZTA 3DA8A 3OEYA 4BBAA 4DB4A 1Z8HA 4B3SB 1USKA 4RK5A 1AGPA 3L8ZA 4WZBE 1JPJA 3Q3IA 2OQRA 4YP9A 3WZLA 2ZZNA 2VP4A 1YS1X 4JBXA 2ZB4A 2EQBA 1K7XB 2KBEA 5E3IA 4YR7A 1NNEA 1IXZA 3LCJA 3PFGA 3UCFA 3UJPA 2IYXA 2R47A 1JV2B 3F3MA 1VIMA 3NJRA 5IH3A 3KSDO 5H4GA 4P0PB 1ML3A 5G53C 2YIDA 1M75A 2PZEA 1V6AA 2CW5A 2QN2A 4ROSA 3FLMA 3I04M 2Z2ZA 3N6RA 1Z0KA 1NMEA 2JDIA 4N0DA 1UZLA 4ZYXA 2X9NA 1ZGJA 4GVXA 3GFVA 3PJGA 1Y9DA 3DEJA 3L8GA 4M37A 1TMOA 4ED9A 4UUAA 1EFDN 4DNFA 2ZJ6A 3BFPA 2Z08A 1CUDA 2LDXA 4K28A 3UK6A 4RTQA 1GA4A 3SYKA 3EDRA 5B1SA 4WPGA 4F4FA 4OBEA 2V7BA 3GZNB 3KG2A 1R10A 3E7PA 3QWBA 5EGSA 5DNWA 1EA5A 1W1UA 3PDHA 4PPGA 4Y2VA 3WP0A 2YY6A 3C6XA 3MCAA 3QEOA 1JILA 4YROA 1R5BA 3DL0A 4LECA 4OGLA 2JH8A 1OXMA 1Z38A 2YZGA 3RJMA 2VL7A 5ADWA 1ZJ6A 5BWMA 1NI4A 3AL0C 3JPYA 4PWYA 2H2FA 1CZNA 3EDYA 3I6MA 3OFVA 1QTQA 4BMVA 5J2UA 2C2WA 1YZLA 2H18A 2HPAA 1PVOA 5F33A 2B1GA 4PTZA 1WCWA 2XSZA 5AI6A 3W2EA 5FI5A 3TOXA 4CM6A 4GZMA 3CLRC 3WRYC 1L4EA 2GXUA 4MW2A 4XJXA 1X1TA 2PO7A 2RBGA 2YH2A 1XMJA 2H54A 4EFNA 3AVVA 2VPTA 1B76A 8ATCA 1YBVA 3DHYA 3R9IA 3SGLA 1AUOA 3R0IA 4X65B 1OW3B 4K0KB 1EIWA 5JMOA 4K5QA 4P34A 4KQKA 2CXSA 1KI4A 4PZPA 1TO6A 3AY6A 3GJSA 2XHZA 2CCGA 3D43A 2CDNA 2A35A 4JN6B 4Q3CA 5D3ZA 5G4KB 3ZY4A 1GLNA 1OBCA 1GTJ1 4KZKA 2G1PA 1T4GA 5AW8A 3M1AA 3PZBA 4BRZA 5IH7A 2NSJA 3UBMA 3LMKA 5IZ4A 3SE7A 4PGFA 4AN1A 2IXTA 4W1RA 3NX4A 5DSXA 2P3QA 1E1YA 1KXZA 2YWJA 5JDCC 3SFVA 4RANA 5CEEA 3ZJYA 4YO8A 5IAEA 4UNIA 3S7ZA 4EHLA 4F7WA 2WJIA 4FYHA 1LUAA 4ASUD 1H8HA 1U8ZA 1UBMS 4MWSA 1E9DA 4AY6A 2GARA 1C9JA 2Z2XA 3NH9A 3MQ4A 4P3NA 3L05A 4KDFA 2VOEA 4JSTA 4MVJA 4N6OA 1Y34E 4ZVNA 3HA3A 4JYZA 3G5LA 2HRQA 3H6GA 5CYOA 4BFZA 3PFKA 4TT3D 1WQ1R 3GC6A 5C8YF 4QEDA 1ZGCA 5K2OA 1EFTA 2EOAA 4RVCA 3DOEA 4FM9A 4RY2A 2QPAA 5BQOA 1P1KA 2LP4Y 1CNFA 5C3UA 4BATA 1TZJA 3E3AA 5C35A 5AVTA 5L3SB 5IM4F 3QWAA 4FU0A 1GQOA 1WB6A 3B1ZA 3CEPB 5A5VA 1JEDA 4MCIA 3MWFA 4LYFA 5CNMA 2G77B 3UK0A 1QVVA 4DABA 4Z7QB 2ZITA 4F4JA 1DJQA 2BMFA 3T7TA 2K4MA 1DC3A 3OI7A 1UPTA 4B6GA 5CYFA 1QH0A 5ICCA 3MD0A 4OHZA 1V39A 4DA7A 2PKWA 1WW2A 5BV7A 2B8WA 3C3AA 4Q1VA 4D9NA 1GOTA 1QFSA 4DW8A 2PGDA 4Y2RA 2EBWA 4Y1RA 3AUFA 3DUFA 2XOXA 4EZIA 3E9QA 4IUYA 2SECE 1GAXA 3UZUA 2QMOA 5KNLA 3CIFA 1QG6A 3BL5A 2WAMA 3P9IA 3UG7A 1D8TA 1BKSB 1U2GA 1AKUA 2ZAOA 1Z2DA 4Q1AA 4JR0A 1KPGA 2W5UA 3EQZA 1KZ9A 1W29A 1JQ3A 3BXZA 2IS4A 2RB4A 4Y6LA 5IKMA 1ESMA 2WKSA 4YREA 2ZS7A 1PT6A 2FSVC 1K8ZB 2O1WA 1CD5A 1W88B 3AEUB 3G0OA 3HJGA 3PRHA 4EHKA 2G9RA 2W43A 3B9PA 3T5AA 4L8LA 1O89A 2HJWA 1PZHA 3HCFA 4MWZA 5TQ0A 3RUFA 1KI2A 1Z5UA 3R3WA 2JZOA 5ALEA 1RTTA 1SBQA 1F7VA 1E8DA 1PNRA 4RTPA 1C7JA 1JMYA 3UH0A 2V9ZA 3B3AA 3F8TA 3NT2A 3PPWA 3L5KA 5L4SA 2NGRA 4PX9A 1IY0A 4BE7B 1ENOA 2ZR9A 1FOEB 4A8HA 1VIAA 4CFSA 1B6RA 4HQRA 3T4UA 1QFMA 3NM5A 3ESZA 1NFFA 2ATEA 3BJIC 3G0DA 4OHBA 2COUA 4A0QA 4F6RB 1NMSA 4TN1A 4DLYA 5KHOC 2CLOB 4HUQB 3S7TA 3RIYA 3MTJA 2GPYA 1F0NA 2PX5A 2RBKA 3LM8A 3A27A 4FHZA 2GWRA 4XFJA 4ER6A 4CGZA 3NWJA 5DX8A 3KSRA 5DT9A 4G0OA 4YAJA 5H9VA 4HRVA 4YS6A 2CJWA 4V24A 4M0DA 2AGVA 3KPVA 4UE6A 1QYVA 3QU4A 4YH1A 4B82A 3U56A 4RF2A 2PKXA 1H8HD 2ZCUA 3BTVA 4HGYA 4AKSA 2OBBA 1CE8B 1YNSA 3G2QA 3N3AC 4LY0A 2CL6X 3HXQA 2R7NA 4MVJD 3ZZ0A 5BWOA 4NMWA 1DB3A 3DE2X 5A2GA 1TJYA 1U4NA 1KJJA 3GEIA 3CW8X 3ZNQA 1T0BA 4IH1A 1JG1A 2DKOA 3W5VA 3QFTA 1TEXA 1T9HA 2OD2A 2A6PA 4L28A 3K96A 4DIDA 4P31A 3EGVA 4OKSA 3A3PA 2CXQA 3D3JA 1Z2OX 2C0PA 3E23A 4WE3A 5FO0A 2V5VA 4C4YA 3FOEC 1W36B 2RHWA 5K3CA 1NBOA 1M7BA 1THGA 3E35A 2X86A 3OBIA 4UCFA 4EB8A 1XWIA 4GMXA 1YOVB 2W37A 1Q0RA 1N8KA 1UANA 3MJHA 3PP8A 3WLRA 1OF1A 1JBEA 3U4MA 2WJPA 4NVRA 4XLZA 4RTMA 1B6TA 3AFOA 2REQB 1BJTA 3R9KA 5ALPA 1B41A 4KBGA 3ZGLA 4WZ6A 3HY4A 5EKDA 5K8VA 3FPAA 2D1QA 5AUQA 1J5XA 4HJXA 5C8ZA 2C9DA 4ZVOA 5ES4B 3JXEA 3JQ7B 3WRVA 1JFLA 2C99A 1JLKA 4F84A 3ZY2A 5GONA 1IZ0A 4TLAA 4MVJI 3EBLA 1M2GA 3NBYC 2BUAA 2F3UA 5ARCA 2H9AA 3OM0A 4I5IA 1YQGA 3CE9A 3QVTA 1EB8A 2ZULA 5KEIA 2QYSA 4RMHA 1QBKC 3WE7A 3G6KA 3K2QA 5EE9A 3VDXA 2OGWA 1MO3A 1TU3A 1JFRA 4HAUA 1LW7A 2BP7B 4GPBA 1L4HA 4IVPA 2PRJA 3B85A 3H2ZA 2G0TA 1A4IA 3A4YA 1LX7A 4MMZB 5FF9A 1U04A 4IJVA 5AXDA 4GR5A 3DFUA 2EX4A 3FHCB 3ZKWB 2R68A 1GV1A 1DJOA 4Q48A 2PT6A 3BE8A 1F17A 2C4KA 4XGKA 2A59A 3VPDA 3ADDA 1P1BA 3DOIA 5F73A 3DVRX 3DVLA 4EY7A 3C7KA 1PQYA 3B7PA 4QFBA 5EIBD 4UNRA 3V00A 2P2DA 1XWFA 4QOGA 2FW9A 3EWIA 3ZNNA 1GG2A 4BBJA 4EPWA 4Z8XA 1CR2A 4QGGA 3ZWVA 4URUR 2I6UA 4C9BA 3TDNA 4ZCTA 4HF7A 4DA0A 1CKEA 3RC8A 1VMAA 4B7UA 2CNBA 3HY6A 3OWOA 1WSAA 5DHAA 2Z95A 1HGXA 2JIOA 3C41J 4KN9S 2GD6A 5BN5B 3K6SB 1X38A 1PR9A 2J59A 2L42A 3A14A 1YI0A 3GFSA 3LY7A 3PR1A 5M5BA 1CF2O 5KJEA 4BMZA 4ARCA 3ZEIA 3RVBA 2XCIA 3KQMA 1C4OA 4ZVRA 3KEQA 3E7XA 3AOEC 5FWAA 3CV3A 2NVUB 1BD4A 4P4NA 2ZTMA 3ONEA 1VCMA 1SZCA 3IEKA 4O2RA 4F12A 3OU6A 2ESRA 2J5BA 3C48A 3EZ7A 1DIOB 1UK9A 5MFZA 1TIPA 5BVGB 4E13A 2XUKA 5ALIA 4KVFA 1V2GA 3C16C 4D8VA 2QKYA 3BE4A 1IVNA 3RAFC 1QCYA 1W34A 4J0IA 5DJ5A 1BXZA 1W5EA 3H9UA 3GRVA 3BDAA 3PI7A 3JQQA 1CIPA 4MPPA 4REMA 4AJ2A 5LD2B 3ZCTA 1A97A 1JPNA 1OFUA 1YHZA 2XQJA 1IZ9A 3SJAA 3TW8A 3W0LB 3GQBA 2J5XA 2BGRA 3GLIB 3B1YA 2CJPA 1J8QA 1ZRNA 4U63A 3EYAA 1M6VA 3UWKA 2BFWA 2FWAA 1I3MA 5BSMA 3F96A 4QUAA 2YINC 5KDOA 1MG0A 1JVSA 4G9GA 1E7SA 4HZIA 3SC6A 3WNCA 3JYPA 3LNCA 2GD1O 5H3CA 4Y6RA 3EXHB 3NI2A 5G0TA 1ZI8A 3MJFA 3UGJA 3B5JA 3C6ZA 1LI5A 4G37A 2WAOA 4QAJA 2W2NA 2ZSEA 2GZDA 4WCDA 2LZ0A 5HIJA 1T3ZA 2A14A 4KU4A 2AR0A 3DP9A 3IVCA 4E5KA 4R1MA 1OLUB 4EEXA 1GAEO 1QIIA 1X19A 1P0CA 1E1CA 1Z26A 2H9IA 3CLTC 1R74A 4NJOA 5DPMA 5EZ5A 4KH1A 3V1NA 4AURA 3TLXA 3CUEF 1WZIA 4D2IA 1HFEL 1N5KA 1SZDA 5BSEA 2O7QA 4QOJA 4D6XA 4F04A 4LVCA 3U19A 1I36A 3HABA 5LMZA 2GEBA 4OI4A 1WSDA 3R6DA 3OIUA 1R12A 3LHKA 5EQJB 1SBYA 4TTRA 5LA6F 3ASYA 1MZPA 1T9DA 3B6ZA 2J3IA 2WG2A 1DMSA 1JFFA 1JF8A 1TC1A 1VRVA 4DDMA 1A9RA 4EZBA 5KNCA 3M1LA 4MKHA 1N5JA 5KOIA 1RAHA 4WFQA 1R9MA 4X1KB 1XYVA 2Q0SA 3AETB 5DP1A 3ZV7A 1NVBA 3L1UA 3M6IA 2H1FA 4IZHA 1I24A 1T26A 2ZI3A 7REQB 3UKOA 1L6RA 3Q41A 4G1EB 5LD2C 4RBNA 2HYDA 4JT2A 1TA0A 4G4SP 3PUXA 4BGVA 4NZZA 1BVRA 4QDZA 1RI1A 4O0LA 3T8YA 2D1TA 1ZU5A 2ODQA 2FP3A 3K6JA 1EWYA 2AW5A 4GBED 5T41A 2ZUTA 3WBKA 4CV3A 3ECCA 4UHKA 4ID3A 1B7GO 2FW6A 3U44B 2P9CA 2BYTA 1CB0A 1QGED 1W4ZA 2DYKA 3I42A 1EIZA 2GM3A 1QK5A 2PQ0A 1QZZA 2SKDA 2Y68A 2VT3A 1OR8A 1USUA 4EGFA 5CFLA 2HLPA 2D54A 3FUXA 1IMOA 1BFKA 2W6PA 3TNJA 2AHOA 3C15C 3B78A 3IH5A 4FFRA 5L40A 4N18A 1UC8A 5KYGA 1EX9A 1VSUA 3G0BA 4YEDA 3ENZA 3DVAB 2VQEB 1AK2A 4O4HA 2CXPA 5AW5A 1OFIA 1E3WB 5ITZA 4E0BA 3GT7A 3DMDA 2VT6A 1RC0A 4LKRA 2P35A 3L07A 3MWGA 5ALOA 1IBCA 3GJ4A 3PKJA 5U1PA 3WRXA 1A69A 3FPJA 3LUGA 5FOQA 3PRJA 4JYPA 1I94B 2FSUA 3QKSA 4B31A 2A58A 3NHZA 4NV1A 5DK6A 4DPLA 4EF4A 2R7LA 3GPCA 3TIGA 3REGA 1UPAA 3SX4A 3DHNA 3SNHA 2JI6A 1I5RA 4BY9E 2C4UA 1D2HA 2M1XA 3RC7A 4CMHA 4DZRA 3SIXA 2MINA 2WTNA 2HQ1A 1ZHFA 2LIVA 3HJRA 2CNWA 5I3ZA 5JLJA 2FSFA 1B73A 1G2OA 2J9XB 4C14A 2SBTA 1PGQA 2HCRA 5A1JA 4IO1A 1R3DA 1VIDA 3O4VA 5JAPA 5M29A 2GN9A 3L02A 3QPDA 1I4WA 1OI4A 5JPDA 3QEAZ 1DJMA 3P9QA 1AXEA 4YMHA 3QW2A 3K0AB 2WJ3A 4JVLA 2X76A 5EHZA 4DLUA 5JRZA 3G17A 3OMWA 2NXEA 4B32A 4E22A 1MCZA 2PEZA 4TUYF 2R48A 3DZFA 1L5LA 4A0SA 1UDRA 3HO6A 2NUAB 3KYDB 1M76A 5F35A 1VJ1A 3K15A 3D3WA 3OVMA 3HNPA 4NJEA 1FP1D 1XJ5A 4Q3DA 1GSOA 3V1KA 2C97A 4G26A 1JWBB 1MQ9A 1W4CA 4GPEA 3PQFA 1EXVA 1TKAA 1R0WA 4ABYA 3UEOA 1VI2A 5KNCD 4C4ZA 1ZGGA 1QIEA 2IL1A 4F3YA 3PQ4A 3RO7A 4DNPA 1CS0A 5JY6A 1TZMA 3KLPX 3IP8A 2XZLA 1DVRA 2FWIA 1M67A 1SKYE 2B2CA 1YZKA 3GA5A 3JWHA 3R23A 4HYQA 3W04A 4ZK2A 3NHYA 1FF9A 4YHBA 4X7PA 3NBXX 1VGQA 3H3XA 4NR0A 1L8AA 1SELA 5GZ6A 5KVVA 1JLLA 3LRPA 5EZYB 2WIGA 3T5PA 2Z2YA 2AT1A 3KZ1E 3NFRA 1AO0A 3ZIDA 1T3HA 2WUVA 2YS7A 4MR8B 2F1HA 4ZCSA 1Z2AA 4IF6A 1YK1A 4Q9DA 3CT6A 4ZYTA 3D8UA 3EVNA 4W5TA 2XDAA 2X15A 2RI6A 3BX1A 4B46A 2CD9A 2W6NA 1OA1A 3D7LA 2G8LA 4TL9A 5DYWA 3LOUA 1IB0A 2DQKA 1XKQA 4YRNA 5DHTA 4A8JA 3LZDA 1KH3A 1VJTA 3AERA 4ID9A 1DT3A 2QUBA 3OLCX 4TKVB 3WLFA 1E5DA 3UTDA 2QRLA 5LQRA 1QP7A 2ZKIA 1E9EA 2D2IA 2G1JA 5T4BA 2XKAA 1J23A 1SOWA 3W9SA 2WHRA 3SMQA 2P9ZA 1ECCA 1H3FA 3KEGA 2X3YA 5L3QB 4DV6B 1GUAA 1M7GA 1JU9A 3BWYA 1YJXA 2JFYA 1W85B 1Y82A 5J63A 3T9EA 3L0YA 1R6UA 3T3PB 1CUSA 4WOPA 4OTZA 1KETA 3DYVA 2PD6A 3LBHA 3QG5A 2Q99A 3WGIA 3G9ZA 3ZOZA 3K5IA 2VH5R 5DTMA 1ZA2A 1L5HA 4HNSA 3RFTA 4KX5A 4D7AA 1W93A 1HOTA 1ENZA 3IPCA 1W4BA 5SYMA 1MJNA 2GXSA 2H7CA 4QAQA 3E4CA 1QS0A 1V8BA 3R3HA 2JVJA 1WDTA 3OE1A 1KEUA 2X8JB 3H8VA 2XTAA 4XUEA 5HF8A 2XYRA 3TMAA 2H1LA 4LGVA 3IS3A 4FYVA 2DULA 3EIXA 3EIUA 5G4LA 4J07A 1RQ7A 1V6CA 4GEGA 1U94A 2ZUDA 2RMKA 1GU1A 2D6FA 3DVSX 1Y5LA 3IJPA 4BEBA 5EFZA 1JHVA 1AGYA 5HPYB 5KX5B 2IW3A 2ZVJA 3T7SA 3HK2A 3LWBA 5EPUA 2BFBA 1CUIA 3OAAA 2TRSB 3FIUA 5AM1A 5DYTA 3OSUA 3OQBA 4P84A 2ZAYA 3UB3A 5CFZA 1HYBA 1A1SA 4F96A 4CR7A 3HEMA 2GBFA 3UK2A 1NVXQ 1RPNA 4DLTA 2QN3A 4CVNA 1CUHA 3X1ZA 2OAEA 2I65A 5DYGA 1Z5ZA 2EP7A 3OE4A 3JQAB 3OECA 1QGZA 3FSGA 5T67A 5KMGA 4YRAA 1UBOS 2M2IA 1BSVA 3D7MA 4JXJA 1YJQA 4J0CA 3GA0A 5ALTA 3RFUA 3SR3A 4GRIA 4E6EA 4ND6A 1GSAA 5HOQA 3RRZA 3JWJA 3TXYA 1JT9A 4GR9A 2CHGA 4YPOA 2DUNA 5JS8A 3BQMB 3JY6A 1VFNA 2J08A 4DXHA 4QU0A 3STVA 3MSXA 4PC7A 2ZUWA 1P2TA 3DHWC 3TO5A 4ZHSA 3CZCA 3VHRA 1AE1A 2FK8A 2AN5A 5JD5A 3F6PA 1M72A 2QTAA 2FWBA 5BT8A 2IDKA 1EDZA 1U0BB 2ZTVA 3AY3A 3P4XA 3AHHA 4N5HX 4RK7A 4CM7A 5HKBA 3ND5A 4B8ZA 2FW1A 4I9NA 4Y6SA 2WKPA 4ZU3A 3RHZA 1GGVA 5I7WA 2H08A 4YMGA 3PL1A 1ZFNA 1I13A 4PHCA 1M2JA 1XTVA 3HO8A 2QUKA 3LUDA 4OU4A 1T4DA 2VATA 1BN6A 4GQAA 1F8YA 1GNQA 3MG9A 2H1VA 3O91A 4FOLA 4HADA 1L1RA 3QXHA 2GBIA 4DQUA 3O92A 4H3VA 1CS4C 4GQIA 1QC5A 3G8YA 2Z6QA 2HSZA 3RDPA 4R83A 3ETJA 3UMRA 2WILA 4UM5A 1JA1A 4LNUB 1CLUA 1SVOA 3H2BA 4MV9A 5MHTA 3JZAA 4D81A 3ZJ4A 1RACA 4PQRA 3IHLA 3DT8A 4X85A 4YBZA 1ETHA 1XF1A 4JLBA 4A92A 1DRVA 3LFTA 4ARUA 1J9GA 4FNGA 3JTEA 4XWYA 1K9SA 1I7DA 4OD0A 3T7IA 4D26A 1GZ5A 1VXOA 2A5JA 4PGGA 4DMHA 1UAGA 3ZDRA 4O02B 2M32A 5EHQA 1G8FA 4UARA 1UPUA 3C4JA 3WLSA 3RJZA 4II3A 3ANLA 5DYIA 1JSRA 3M4NA 3EEQA 3D6VA 1M3SA 3SXJA 4XXHA 2FKNA 2X4DA 3OIGA 3OZTA 1GRRA 1ULHA 2Y71A 3R0JA 1C1DB 2G0NA 4UE2A 3FDJA 1FS5A 3L92A 3R0VA 4RESA 3LPCA 3CZ5A 3OOJA 1JEQA 1SHLA 2OZEA 1JEAA 5CH8A 1P33A 4KQ6A 3UW1A 4I1OA 5DX1A 3UA4A 4HH0A 4Z4EA 2Q6KA 1XZJA 2I4LA 3I28A 3TE6A 1BRTA 1EBUA 4Q34A 2EX1A 3UJNA 1MOZA 3OAAD 3AUKA 3GZ4A 4NESA 4Z7NB 4IGAA 3IUMA 3GVPA 3B7GA 3LQYA 4PC2A 4FGWA 4XYEA 1XXHB 2IV2X 4DYHA 4H27A 4XWAA 3WNDA 4MV0A 5AQEA 4P58A 2J9GA 3LQRA 4B6PA 1SNYA 2A1UB 1R66A 1ADBA 5FV7A 1XRNA 1IDN1 4IGKA 4L9SA 4UAVA 3DBLA 4MDHA 4B3RB 3TM5A 5KC9A 3AR7A 3FSGD 5A4KA 5FNVB 2IH5A 3FPEA 4QJIA 2DPXA 2F43A 1QHHA 2YIVX 5IMBA 4DF3A 1QHIA 4GLJA 2X0IA 3NR2A 4LBWA 4TQGA 5B3JC 2ZUBA 1EU1A 1HY3A 1NMZA 1SH7A 4IJWA 2PTHA 1H6DA 2ONCA 4XRGA 4OFXA 1PV2A 3PQDA 4KFTA 2XNSA 2DBYA 2HHAA 3U4QB 4WZBA 2O2SA 4GL2A 4YV2A 3BFJA 4GBGA 2B8TA 4E7PA 1XZCA 3OQIB 1ADFA 4QBGB 4WINA 3RKRA 4LPSA 4TYWA 2FEAA 4DM3A 2J9YB 3FDIA 3JYQA 3EVEA 3V32A 2OGUA 2O52A 3PC8A 2VZ9A 1V43A 1R8SA 2EGGA 1UQTA 1Q0QA 3VH3A 3CVYA 4L6IA 4AX8A 4E4YA 4ZAFA 4EFMA 5EVJA 3KZNA 4WJKB 1UPBA 3UF0A 3OCWA 5IZCC 1CY6A 1TJNA 3KVRA 4QM7A 4QNNA 2RKOA 2UZ4A 3VZQA 4Y6QA 3N59A 1WNTA 2KHZA 3KIPA 4LWQA 3OIYA 2IX3A 2YCBA 5ES3A 2HTFA 5LLSA 4MUBA 4IQGA 4QQNA 4IIBA 1ZITA 3CW2A 5AVVA 4KOEC 2GEUA 2YDXA 1OYWA 2WYWA 3KQVA 3N2GA 4C3VA 2VZEA 2X8WA 2ZWIA 5DBGA 5AP9A 2C5LA 1G5TA 4GMDA 5M2QA 4RMNA 1SKMA 1DXOA 3NIWA 2Q50A 1NVDA 4TTJA 2C3YA 2NOAA 1SA0A 3NP9A 2VSXA 3BAFA 4QLAA 1HZZC 3TLGA 3UJ7A 1THTA 3I9LA 2B34A 1R0XA 3OIDA 4Q4AA 4S3MA 4ZU1X 4N5NA 5B2FA 2C92A 3A6KA 4P7GA 1IN1A 3H9BA 1EVKA 2HY7A 1L9KA 4B4VA 4IQ0A 1CU1A 5FH9A 5JCPA 2CF6A 4UEJA 1RLIA 5EESA 2BR3A 3COZA 1EGAA 5L95A 3Q8KA 1JG7A 2NV2B 1IUOA 4FMPA 4RLHA 1N2ZA 3OICA 4U7TB 4EFDA 2H5LA 4MUIA 3S2SA 2RJ3A 3R41A 4HDMB 2P9FA 2AI3A 3DE0X 1A5BB 1T1RA 1UBEA 3I9V1 4B73A 5CVUA 2VR1A 4C4SA 1J06A 1VFPA 1RHQA 2VUHB 4NBNA 5BQXA 1M7HA 4CKCA 3CX6A 2D00A 5BV1A 3T34A 3MJSA 4BAZA 3ZK9A 4HX2A 2HA3A 4D3FA 1DL5A 2YXLA 3C3KA 4TV8F 3FHJA 3W1WA 2NO6A 5E1OA 2LPMA 1SD5A 2O2IA 3TYXA 1RP7A 3U3KA 3DFFA 3GMDA 1PX2A 1YQDA 3LVRE 4JL6A 5F3DA 4M9QA 3VTZA 4BE4A 2HO4A 3DEYX 3R4VA 1ZAYA 3V8EA 1FXWF 4N0MA 5B2ZA 3F5SA 1F1JA 2WINI 3WMGA 1WY5A 3NANA 3QXCA 4CL0A 4F06A 4EO4A 2OB2A 2O59A 1OBVA 2I2CA 3I39X 3UHAA 4ZP1A 3TLEA 5FPYA 4EF6A 3AVXA 2Z6UA 1P18A 2IXDA 3SDZA 4NBUA 3U9LA 1ZKDA 4W8OA 1WOYA 4B2IA 4WJLA 2SKCA 1MC4A 2H1WA 3KKZA 3V33A 1GITA 1E8MA 5TNXA 2P5SA 2QUAA 4M55A 4QUHA 3K9NA 3CTMA 4L57A 5A9SA 2GK6A 5DI3B 4IDBA 1LBHA 3PQ8A 4N6NA 3WA6A 3FVVA 3GEBA 2PAAA 2PL1A 2O19A 2VTKA 4JA0A 2RB5A 2PS3A 2VTDA 3C3WA 4PLPA 5EMMA 2OXFA 4DCOA 4G89A 3IVGA 2W6CX 1GUZA 3G13A 1X7YB 4JUCA 4OMUA 2OP1A 4RIFA 4C4PA 5I01A 3IELA 5BYJA 4XVHA 2H1HA 4RJLA 2NZJA 3VPSA 4I4CA 3TQOA 1H6AA 3HCEA 4UMFA 4BZPA 5CCXA 1SHJA 1P61B 3TZ6A 4DBLC 4FHDA 3C8DA 4M88A 2ADFA 4N3NA 1A71A 4WXMA 4YRMA 3JARB 1XRLA 3G88A 2VP3A 3HVKA 1QR2A 2QMHA 4YP5A 1Y42X 2XZPA 3KD2A 4ZJZA 5BMVB 3EVGA 3KQPA 5LKRA 2R8XA 2H31A 5BR1A 2H11A 5BQPA 2OB1A 3BJMA 4B7ZA 2CFOA 2H57A 3CZQA 1YDFA 3KXLA 3QYPA 1RYYA 4QOIA 5JO9A 2NO4A 4NLLA 3R7AA 3T3MB 1WCIA 4MA5A 4KBFA 1M1YB 1V8PA 3TLYA 1K8YB 1Z22A 5EJ8A 4CMKA 4BO4A 3T5MA 3Q3HA 4O0MA 4EG8A 4K6GA 2Q9AA 3ROQA 4U2CA 3QZUA 3WSWA 5KWEA 3RAEC 3ZGXA 2XTNA 1E94E 1FFBA 5K8UA 4HNGA 1U8EA 3E3LA 3VNBA 4JJ4A 1NAIA 2IHUA 3B3FA 5JZMA 1EFPB 4RY9A 1XELA 1BCSB 3OJFA 2IE8A 2VZ0A 4HQOA 5KZMB 3PSHA 2WP8J 2L19A 2VF2A 3RSCA 2FR0A 2ZYVX 1ESEA 4BMYA 4ZAYA 3HP4A 2YMMA 4MUGA 2RKBA 1NN3A 2D0DA 2J0VA 1T6XA 1VXRA 3RRYA 4DCPA 5TLSA 4N41A 5EPEA 5B57C 4KJZA 4MAAA 2BTQA 3WJ1A 1J6UA 4QUDA 1MW9X 2Q2QA 1UM9B 3HR8A 4DWJA 1DBRA 1YTLA 4OQQA 4YRDA 2WKWA 3W5IA 1QONA 2G4LA 1RZUA 2GO7A 4HP8A 3PV0A 1BMTA 4HQNA 4OO3A 4XX0B 4DV5B 3NHBA 1DUSA 3DL2A 3KUXA 3WL5A 3UT6A 1H66A 1XWWA 2FSHA 3E9ZA 3IESA 1U1FA 3TIIA 3PCRB 1OZ0A 2XMDA 5HZMA 3W3AH 3IILA 3IHKA 2EL9A 3T41A 2FP4A 4AP9A 1XTQA 2EEZA 1ENPA 1YB7A 1ZWLA 2QD3A 1GGEA 4AP5A 2C42A 4HY3A 4L4RA 5COQA 2OQ2A 4R2XA 3B6JA 5BO5A 1TMKA 3DHEA 4B4UA 1QQ7A 4EW3A 3ABZA 4LS3A 1KY3A 1U2PA 4Z4HA 1Z4IA 4GRDA 3NOVA 3HGMA 4H9GA 1P4AA 2VIIA 4XLLA 1UBCA 3H16A 3RKSA 3FR8A 2J45A 5E2AA 3FTEA 2ZYAA 4YRKA 5JJBA 3D4NA 1G291 3UHFA 3KWFA 5CB6A 4L74A 4BTLA 2QZSA 2X1VA 1MAUA 3ND9A 1HDOA 4OX9B 4P4LA 1GL6A 2WRZA 3C3BA 3MA0A 2ZEJA 4KO3S 3ZZ1A 3KJQA 2GASA 3I1JA 4V0ME 4JQYA 5ALNA 2WWXA 3G5UA 4FCCA 1D2CA 3AUAA 1KZ4A 3BULA 1NLYA 4IIHA 2HBYA 1GZ3A 3VV3A 3N74A 3P0HA 2W42A 4ESEA 4PHTA 3AHIA 1B4DA 1Z29A 2VWPA 5TB5A 1QQ5A 2V7UA 3N0RA 4BWVA 1ECFA 2BHRA 1SU4A 2DUUA 3TUJC 3IUNA 3LAWA 4P7JA 1FA9A 2QP9X 5K3DA 5J2TF 1GGHA 4HV4A 1Z35A 3BSYA 4J7UA 4NF2A 1EPUA 1Z6QA 3OUTA 3K8QA 4Q00A 4WA8A 3BWCA 3TPZA 5LYJB 1OC4A 1P2VA 3OC6A 4NIMA 1GA1A 5BSRA 3T9DA 2XRZA 3PIIA 3ZJUA 4IDDA 2ET6A 2CWDA 4MYRA 5D85A 2B21A 5JAMA 3ZCXA 3ICPA 4YMTA 1MJGA 5EJAA 3CBQA 1MNQA 2PN1A 3ICWA 2X2OA 5CA0A 4YRIA 3ROPA 3DXZA 3Q8MA 2GHQA 2CLDX 3U0VA 2YY5A 2DFLA 4OMDA 2QUJA 3RU2A 3LT2A 5IVDA 4TLEA 3TR6A 1W59A 2DPMA 1ZJ5A 1SEVA 4AF8A 3EDMA 1L7VC 2ZSUA 3T12A 4CEJA 1BN7A 1F4VA 4F1WA 1XTSA 2DE0X 4X8LA 3W7BA 4KXLA 2O2ZA 3RM3A 1NHGA 4LXXA 4YRLA 1IC6A 1MOPA 5FA6A 5K0JA 1V41E 4GMFA 5F9MA 2O6LA 3E82A 3GT3A 1FLNA 1US8A 4RWEA 4H7PA 2JCSA 3OZWA 1R6BX 1ZOSA 3DZCA 5J5AA 1G20E 1R9JA 3CLUC 1UP6A 1D8AA 2Z5FA 1B8OA 1WDKA 3EGDB 1N7GA 4QGBA 3KB8A 4BNDA 4W9NA 3ZWQA 3PXUA 2GH1A 2W71A 2RG1A 4YC7A 5CXSA 1EGVB 1NN1A 1YVUA 2EFJA 2R60A 2WB4A 4WKBA 3U4HA 1PR5A 2ETVA 1KI1A 1QIHA 1ZIDA 2ZWVA 4RKQA 5FR1A 3EXIB 4JI6B 3UYLA 3WGZA 1U6JA 1C0PA 3I6QA 1UJMA 5JAOA 2FE4A 1E60A 1QGAA 2WVHA 4TQ9A 1GPWB 4AECA 4CF7A 3TL3A 4NOLA 3LZCA 1CUFA 3DJYA 1YMQA 4G8JA 1OWPA 1PVDA 3AB3A 3JQFC 4WZAE 4C7OA 1V35A 1MX5A 4C0BA 5C7OO 2RHRA 2J33A 3DAFA 1L7OA 2GWHA 3HU1A 4CDGA 3MLAA 3R5KA 4YV1A 2OOKA 1N6PA 1IY9A 1Q20A 3I0NA 3RUCA 1TK9A 2JAWA 4O2BF 4R2JA 1BOOA 4OXRA 4F56A 1FP4B 3AUXA 3DE6X 5T4EA 5GADl 4FE4A 4UDXX 4CCSA 1O8BA 4KXUA 1M9NA 3AR4A 3AH8A 2UU9B 3WGYA 1D07A 3ZS8A 4ZMRA 4RVHA 2LD4A 2YJGA 1CLEA 5DOZA 5CB8A 4RD0A 2XUFA 4BZXA 3AVUA 2RARA 3RK0A 2J31A 2PS1A 1L5QA 1O94C 3A1TA 4AYXA 5DK4A 3QJYA 3RLFA 3UOGA 3IAXA 1LTKA 3T7JA 1T5BA 1N2IA 1T9BA 3E9YA 3QTLA 4NEGA 5JS7A 1GPKA 1KMNA 1JX6A 9GPBA 2QORA 2GRAA 3GZJA 3LWZA 2HM7A 2PGNA 3V1MA 3OZUA 4DSUA 3IHWA 4BVJA 2AB0A 2X4IA 3F90A 4XM2A 3DNFA 3GT0A 3SVTA 4UTNA 4I46A 3IT0A 3D4PA 3E05A 4L50A 4ZQHA 4RO0A 2BTEA 1MAAA 5IPFA 5MN4A 1YS4A 2IE0A 5DNDA 3TG2A 4FN5A 3JALA 3DW1X 3NV9A 2XUIA 3NM6B 4CRWB 1NBIA 3WLPA 3FCXA 2EW2A 4AW9A 1XVVA 2GCEA 4BB6A 4E5UA 1XN4A 1L4LA 3IB3A 1LX6A 3OPVA 1SCUB 4A2PA 1TM3E 1KI7A 2ODEA 1EM6A 2PQ6A 3LL7A 3T35A 3WNZA 4P36A 3UJCA 1SJ9A 5EUMA 2VAPA 4L95C 4CTOA 2DTXA 5H59A 3AVWA 4HDAA 3OKCA 4O8ZA 2CYCA 4QXMA 5DNVA 2IJGX 2GBPA 4XYMA 2PS9A 2Z3WA 2C78A 3B3GA 4ZYVA 4MHSA 2V3CC 4RIEA 1U11A 2LRHA 4XA8A 4OP2A 5ICSA 4WEOA 1G7SA 2GZMA 2BHTA 2WJGA 1KOJA 4QULA 3DPUA 3AXTA 4MA4A 4WRRA 3QPAA 4X1IB 3CSSA 5AUPB 5A71A 4B43A 2ODNA 3HWX1 4WY5A 1E3TA 3W5DA 2CHQA 3DXXA 1STOA 2XB6A 2CNDA 3C74A 4U2GA 1C30A 1O57A 1G1AA 1FTWA 1NNLA 4KR2A 5THKA 1EJ2A 4AMYA 1Z7YA 3WHKA 2C7BA 5JEEA 1IUNA 1D5WA 3RWMB 4OUDB 4K3UA 4LJ6A 5ECDA 3VYUB 4J2HA 3GFBA 4REOA 5LDDC 5FBKA 2AW3A 3HBAA 5TXGA 3CUSA 3VTFA 2VHZA 3N2IA 5DMXA 4DJ5X 1L7EA 1ZH6A 2R2AA 5AJVB 3AGQA 1A8SA 1LTQA 1MVLA 2HIGA 4Z9AA 2KI5A 3NC0C 3SLGA 1G8PA 1SVLA 2BM0A 3BVPA 3PFFA 3QQPA 1ZICA 5DTQA 5JSHA 4LNHA 5JNRA 1ZMXA 1YR1A 4HNAA 1E2FA 2I3BA 4FP9A 2Y92A 2HU2A 5JRDS 5ER6A 2BFCA 1E7RA 4EDFA 4BL5A 1KDOA 5FTKA 4FDMA 4N3AA 2PXAA 2HHCA 3ZI7A 3DFZA 1OU0A 3NBKA 3FUTA 1T9ZA 1NYTA 1YRBA 3GJTA 2MSNA 3HS3A 3OHMA 5CGQB 3DCNA 4QBKA 1XRMA 2FLKA 1EVQA 2QTVA 1C3OB 2UKDA 1DQZA 3EVDA 2HLNA 2B3TA 1T1SA 4M0PA 4OK3A 1P1HA 2R11A 3CWZA 1NJ2A 4PG5A 2ZLBA 3K9LA 3T6KA 1COZA 3U7RA 5BR7A 3GLKA 1KO4A 4MRNA 1DJLA 1MPTA 3L7KA 5ER9A 5HSGA 2GN4A 4OMCA 3K9GA 3LC7O 2C7QA 4YJ2A 2HOQA 2VXYA 2YNMA 1DAIA 4Z51A 4DY4A 1FS4A 3EEBA 3IMEA 4EAQA 3GUHA 1RNLA 4E94A 1HXHA 3SHTA 2NTNA 1SC4A 3K05A 4K6CA 4MWBA 4AFNA 4PLWA 4JDUA 5CIQA 4A6XA 3IDZA 4EYQA 3ENNA 2FX5A 1L7NA 1SB9A 3EG9B 2CLLB 2CVFA 4IQ4A 1NV8A 2VSOA 4G5SA 2UYOA 4LE0A 4WLOA 1T5IA 3G1UA 2WAYA 1VLJA 1ANKA 3BXHA 3I23A 4GOKA 4MQ4A 4D0NA 3WL7A 1U5BA 2FF7A 2NACA 3TJMA 2KPOA 4WV3A 3MS2A 1Y1KE 2ZUVA 3HBNA 4AG5A 1GJRA 1YSCA 4P5EA 2GD2A 3SHFA 1WLSA 4FIDA 5JE8A 3VV2A 2MR5A 2B8JA 2X77A 3MJDA 2WIFA 4HLUA 4KVZA 4EB0A 3ESRA 1EE2A 2P9EA 4JYMA 5E4TA 4DLVA 5CA1F 1LD3A 5AVOA 2A67A 3I12A 2IVFA 3VBEA 1A72A 3DEKA 1N3LA 3ROEA 1FC0A 1FIUA 3PB3A 1ESDA 4D8UA 1R1DA 2VDMB 4OFZA 5CDFA 3RQSA 2D2FA 4Q66C 5DBFA 4F4IA 3C5VA 5BY2A 1D6MA 1LB1B 1O6BA 1VJ0A 2YMQA 3CF2A 3ONVA 3LCVB 1PT5A 1CT9A 3UVEA 4QBFA 5DN9A 3U3DA 5LQCA 2VLBA 1ZW6A 5IBQA 1ECPA 5KWSA 4F4CA 1WKBA 3FVRA 3AG6A 5IAJA 1CG6A 3ZDBA 1INLA 2XB9A 3EH1A 4B6FA 1Y6RA 5D7NA 4B3IA 2W2LA 2ECOA 1SPXA 6NULA 3DPSA 4M0EA 1Z4JA 3VNAA 4QDOA 1FFCA 1T0PA 2AJTA 4DDHA 4DRYA 3KT6A 3C3MA 4JVMA 3UM9A 1ODIA 2PYZA 1IQUA 4AY3A 1M8JA 1WSBA 2I54A 4ENWA 4O2LA 5DOVA 1UXIA 5IDWA 2QP4A 3ZXIA 2KQUA 3VAZA 1MLDA 4US1R 5DGHA 1OZAA 2WSYB 3DCIA 5FYQA 5BNIA 2YRWA 2VN8A 2YWFA 4INJA 1DX4A 1P91A 2B99A 3GXBA 4FGUA 3VM6A 4YCMA 3KQQA 1FDWA 3SK0A 2F8SA 1N8NA 3DBHB 5CRIA 3RU7A 1G60A 1TAUA 3VZDA 4DQ0A 2ZRPA 3UB4A 4E11A 1WZ2A 4ZO6A 4WVLA 5DYNA 3MTGA 1Y8RA 5FTWA 4CDNA 2H8GA 4EA9A 4TV9F 3GI1A 2OHGA 3P5SA 4LBVA 1A76A 1Y4ZA 2Q5QA 2LUOA 4IYRA 4B83A 4HMPA 1D04A 1O96A 1V0JA 2Q5HA 2JAPA 1W0JA 1L0BA 2DPYA 1QO9A 3AFIA 3JD4A 3T3GA 3W79A 4KAJA 4CIYA 3PTAA 4M89A 1Y4AE 4NFSA 1IHPA 2YNMD 1WAMA 1WHTA 1YJAA 1N7HA 2VKQA 4S1OA 2IWRA 3DFIA 3SPXA 5NLLA 4D96A 1JQKA 1XEWY 1V6SA 2VYFA 4ZC8A 1JEJA 1A88A 5DSTA 2DGDA 3E1KA 2PUCA 2H7YA 3GJYA 1R0RE 1V96A 2YW9A 3IQFA 1R16A 4ZCLA 4WK4B 4YXFA 1C8BA 4XDHA 3ZHRA 4R6WA 1NI4B 3E03A 4AMZA 3Q7IA 1N1DA 5J1TB 1N5IA 2OGZA 4MGZR 5J2UB 2Z1MA 5LLTA 1SCIA 3JWEA 4LZNA 3PLRA 2WWWA 4R8MA 3FJYA 5ALVA 3ZV4A 1N6KA 1XL0A 4X54A 1NRJB 1PX0A 1Y6QA 1O08A 4WKOA 5KVSA 1QYDA 4BNXA 2A7QA 5TMPA 4KLZA 3SEZA 4R1PA 3GLFA 1KAHA 2VEDA 4QIHA 2VJMA 1NUSA 5B6PA 4D02A 4GKAA 1FW8A 4B7CA 1ABBA 1BDHA 3B36A 4MIOA 2PUVA 3FYDA 3B6KA 3GPDG 1R0SA 2C7GA 1WULS 2B6NA 2GXQA 3H2KA 3IPYA 3MGCA 4FQ5A 4X91A 3VMFA 2Q3CA 3GBPA 1XZPA 5F2NA 1YL5A 1X7ZA 1RM0A 1ZNXA 3FAKA 5B1IA 1BC5A 2XWBF 3NAMA 4YVFA 3KXPA 3W77A 2VJAA 2IYOA 4HNQA 3HZHA 3N8GA 1G16A 3FN4A 4N5MA 1HX7A 1EXNA 1UK8A 2F8TA 2YS6A 2R44A 1MW8X 3O4HA 3V34A 4IJ5A 4E5VA 1KVQA 3HEAA 4URWR 1YZYA 3FNFA 3NHKA 4KO2S 4D4GA 1CUZA 4W5WA 3EF1A 2OFWA 2HWWA 2QN8A 3A6HA 4RS4A 2W2LD 4XSVA 3IVAA 3U3MA 2Z04A 3Q7RA 3ZE7A 1GUFA 4QT4A 3BZUA 4DB2A 1NIPA 1GDDA 1OU4A 3BGDA 1A77A 2EP5A 3DDCA 1MB4A 2HMAA 3CR3C 1RRMA 2QR2A 1QZUA 3EGEA 4UJ3A 4ZN6A 3M4XA 2YJNA 2QTMA 3R7FA 3RKUA 2BBTA 4M3NA 4N54A 3QFFA 4QVKA 2QLNA 3MK31 2WIDA 4GPTA 5IDVA 2ZT5A 3UO8B 3VO8A 3RV4A