1VJRA

Crystal structure of 4-nitrophenylphosphatase (tm1742) from thermotoga maritima at 2.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
261
Chain Sequence
HHVLDKIELFILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLRNMGVDVPDDAVVTSGEITAEHMLKRFGRCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYERLKKACILLRKGKFYIATHPDINCPSKEGPVPDAGSIMAAIEASTGRKPDLIAGKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVKLGKNAGIVSILVLTGETTPEDLERAETKPDFVFKNLGELAKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 4-nitrophenylphosphatase (TM1742) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords 4-nitrophenylphosphatase
total genus 93
structure length 261
sequence length 261
ec nomenclature ec 3.1.3.41: 4-nitrophenylphosphatase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA02
3D6JA 5AK5A 5ALMA 5ALQA 4YCLA 1RQLA 5ALOA 3ZWKA 3ONNA 4KYTA 1QH9A 1RC8A 4QJBA 2X4DA 5AVUA 1Z4PX 2OM6A 4KX5A 5AI6A 2RBKA 3MC1A 2B8EA 5ALGA 5IS2A 3QX7A 2ZG6A 4CF3A 3QXGA 5AESA 3IRUA 2GHQA 1NNLA 3CNHA 1NRWA 4Y2SA 3U7GA 5ALXA 4Y2UA 4H1WA 4UAVA 3SKYA 4EEKA 4IFTA 1L8LA 2B82A 3SKXA 5AW4A 3SD7A 4XOUA 2RB5A 5AW1A 2HF2A 2YMPA 4UMDA 3L7YA 3QU2A 2G09A 2ZXEA 1FEZA 5ALUA 3U13A 4EENA 5AKHA 2IYEA 1U7OA 2ZBEA 3EPRA 2I54A 4CE6A 2FPSA 3W5CA 3UMBA 4CNQA 3B8EA 1XPJA 5AW7A 1NF2A 4C4RA 3CZ4A 2FDRA 2VKQA 2I34A 2ODAA 3HLTA 4UU0A 5AVRA 1QYIA 3WKAA 3L8HA 2AGVA 3L0CA 3PGLA 3UM9A 4YH1A 1N8NA 3F9RA 4BEWA 2C88A 4OHFA 3R9KA 4Y2YA 5A3SA 4J2TA 3N1UA 4UASA 5AK3A 2D2VA 4IG4A 2W11A 4Y3UA 3W5AA 4Y2VA 4YIKA 3B9RA 3QU4A 3K1ZA 1Z4MA 1Z88A 4EX6A 1ZD5A 3IB6A 1L6RA 4UW9A 4EZEA 1TA0A 5AW8A 1YNSA 3ET4A 3OCYA 4BKMA 3N28A 3PGVA 5AIBA 2C4NA 5ALEA 3RF6A 5AK6A 1ZJJA 3ET5A 1O08A 4UM7A 2WF6A 5JJBA 2HF7A 3NASA 4UATA 1Z5UA 2ZBGA 1LTQA 3QNMA 3I76A 1VFPA 1ZD3A 3ZU6A 1ZS9A 3SF0A 1WVIA 2YBDA 4NFLA 2G07A 3A1EA 5AVXA 4DW8A 2WF9A 5AVQA 2FPUA 4DWOA 2HOQA 1PW5A 3ZI4A 3MMZA 1SWVA 5A3QA 3WKBA 2MU1A 4HAIA 3KBBA 3ZVLA 5AW5A 1U2TA 3AR6A 2JAOA 2CFTA 4KN8A 1WPGA 2YY6A 3FM9A 1VJ5A 1ZRNA 1MH9A 1RLTA 2GO7A 4G9BA 1JUDA 3L8EA 2YN4A 3EF0A 3ZVMA 3RFUA 3QYPA 4UARA 2WF7A 5AM3A 5AI4A 4J03A 3QUQA 2YJ4A 3W5DA 2IA5A 2C9MA 1T5TA 3BA6A 4I9GA 3L0YA 4UU1A 1L7NA 2YJ6A 2R8EA 3AR8A 5ALWA 1CQZA 1VJRA 2WHEA 1KYTA 2MSNA 3QLEA 4GXTA 4XE5A 4C4TA 1Q91A 4NAVA 4AS2A 2HO4A 2HEGA 2G1AA 3U7EB 1U2SA 4ZEXA 4Y2PA 3HYCA 2C8LA 2OYCA 3EWIA 3N07A 3QU9A 3A1CA 5AM4A 2FPXA 3GYGA 4BX3A 3IJ5A 3FPSA 3MPOA 2G0AA 1ZD2P 2QLTA 1SWWA 2NO5A 3QGMA 4AP9A 3M1YA 2HX1A 1X42A 1XVIA 2FUCA 2Q5EA 5AKYA 4FFDA 3AR3A 3E81A 3WK6A 5ALLA 1N9KA 2CFRA 3NRJA 2OA0A 2OBBA 2EARA 3ZWDA 3AR5A 1U02A 4Y2XA 3WKEA 5ALPA 3ZW7A 5AKJA 1L7PA 5ALKA 3KOOA 4HGRA 3U19A 2ZOSA 3UMGA 4OFZA 1RLOA 2FPRA 5ALYA 3E84A 3WK5A 3FPBA 4NABA 5ALTA 1L7MA 5FP0A 3QUCA 3KZXA 3I28A 3QU5A 1AQ6A 2C8KA 3ZX5A 2EATA 5ALNA 2ZBDA 3WKDA 3ED5A 3L0BA 3L8GA 1QQ7A 5IT0A 3UMCA 4XPZA 1YMQA 5AICA 4CF5A 5AKXA 3WK9A 4EELA 3I1YA 2YMQA 2JGAA 1S8OA 4RESA 4Y2QA 2P69A 1Z4LA 5A3RA 1K1EA 1QQ6A 3SLRA 4HGQA 5AVTA 1TJ3A 2PQ0A 4YGYA 1J97A 1WZCA 5ALFA 5AW0A 1Z4NA 4Y2JA 2HSZA 1RLMA 2JARA 3OTQA 4UMFA 5AM0A 2FPWA 2B0CA 2HI0A 3ESQA 2JAWA 5AVVA 4KNWA 2G80A 2HCFA 2P11A 4F71A 2W43A 3L1VA 2GHTA 3AR9A 4MUMA 4FYPA 2B8JA 2WM8A 4GIBA 5AI9A 2FI1A 1S2OA 5AW2A 1XP5A 3OCXA 5AVZA 1QQ5A 2ZBFA 4KX3A 1ZOLA 3PDWA 4HYTA 4CF4A 5AI5A 4L6AA 4PNHA 3A3YA 4FE3A 2DQSA 5AI8A 4UM5A 1Z4JA 2RAVA 5ALSA 4AS3A 3J7TA 2Q4RA 2HDOA 4O8CA 4EX7A 4JDPA 2G08A 5AVSA 2I55A 3NUQA 4L57A 1Z4QA 1TE2A 3L1UA 3ZX4A 1RRCA 3S6JA 5ALZA 3KDPA 3QUTA 3W5BA 4BBJA 5AI0A 1T9ZA 1Z4OA 2YJ3A 5AKEA 1LVHA 2NYVA 2O2XA 1RMTA 3OCUA 1F5SA 5AK4A 1RMQA 4F72A 3L8FA 3ZUPA 3M9LA 3NAMA 2GMWA 5AKLA 1EK1A 3FVVA 1RPZA 1TJ5A 2Q4TA 3WK7A 3BWVA 1RKVA 1RDFA 2IOFA 4NV0A 1Q92A 4BEVA 2EAUA 5E0OA 1SU4A 3N5KA 2R8YA 3N8GA 3ZVNA 1J8DA 2IOHA 5AHXA 3FZQA 1YDFA 4NWIA 5ALHA 1ZRMA 3NIWA 3U7FB 3R09A 5AW3A 4XQ0A 1Z5GA 5AVYA 5AW9A 3U26A 1L7OA 4Y2TA 5ALIA 2YMMA 3FGOA 1TJ4A 5AKIA 3KC2A 1EK2A 1Z4KA 2HHLA 3E8MA 3NALA 3SHQA 5IT4A 3OCZA 3NANA 2O9JA 1O03A 3U7HB 1Z4IA 2W4MA 4KNVA 2IOFK 4I9FA 4OCZA 3E58A 4BX0A 1T5SA 1YS9A 4MWOA 5AIAA 4E88A 3OCVA 1RQNA 4YIHA 4JB3A 3R4CA 1RMYA 3WK4A 1ZD4A 1CR6A 2JAUA 4UAUA 4G63A 4ZEWA 5AM1A 2CFSA 1YJ5A 2PKEA 2RARA 4C4SA 3SMVA 5ALVA 3ESRA 5ALJA 1YV9A 2AMYA 4L6CA 2GFHA 4DFDA 3DV9A 2CN1A 3PCTA 4UMVA 3WK8A 5AW6A 3QU7A 5AKZA 1Y8AA 2AUTA 4UMEA 3OPXA 5AKKA 2YMLA 4ZEVA 4HGPA 3TLMA 2WFAA 3WGUA 1L8OA 1IWOA 2I6XA 2YJ5A 3DAOA 4B6JA 3WGVA 2WF8A 2I33A 3B9BA 4Y2RA 5AM2A 3ZTWA 2I7DA 3MN1A 4OD0A 3P96A 2B1RA 3L5KA 2B30A 2QYHA 5AKGA 4BNDB 3EF1A 2P27A 4YCMA 3QUBA 2NO4A 5AVWA 3OCWA 2AH5A 3WKCA 2R8ZA 3VAYA 2G06A 3AR4A 4BNDA 2BDUA 2BDEA 2BY4A 4BX2A 3KD3A 2R8XA 3AR2A 5ALDA 2B1QA 4YCNA 1U7PA 3DNPA 3ZTYA 4BYGA 1WR8A 3I6BA 2YFYA 5T41A 2P9JA 5AM5A 1RKUA 4QQFA 4DCCA 1RKQA 2FUEA 3AR7A 3A1DA 4RETA 2PR7A 2FEAA 2WF5A 4HGOA 5ALRA 4HGNA 3DDHA
chains in the Genus database with same CATH superfamily
2O8CB 3UUFA 5HM8A 5ALMA 3O21A 3F9CA 3BVPA 1W96A 3N2KB 1VLQA 3RC3A 4I5DA 4EKIA 4QRDA 2ODBA 1RJWA 4KBYA 2BGNA 3OZ7A 2AFVA 1I9CA 1KE2A 4JDUA 1UDRA 3WGQA 3TGPA 1SHJA 5IAJA 5JPIA 3MC1A 4ER5A 1T36B 4DGSA 4HNRA 3WLLA 5HR5A 1T3HA 3MG9A 4F2PA 1T26A 4EI2A 3IT0A 2SBTA 1NJ1A 4QU0A 4BMVA 3ILXA 3VKUA 5TQ0A 4LVCA 2ZI4A 1JEDA 1H23A 3P27A 4JI2B 2Z6AA 1EUCA 3V1YA 2X9NA 4YMSA 1G42A 3GLHE 4XWTA 2BVNA 1X7ZB 4EGJA 3SY8A 2BGTA 4NENB 3SXPA 1JDZA 3V32A 1NVUQ 4RVCA 1E3WB 1S2GA 2Q3HA 1Z6PA 2ZWIA 621PA 1MOPA 4Y6QA 2Q7XA 4YRMA 4EHHA 1AKTA 3LGXA 3CUKA 3HG7A 1YONA 1D6MA 4CM8B 3ADCA 4HSEA 1NONA 5A3VA 3IMFA 4OLJA 4PYKA 5JE8A 1D03A 4UHDA 5CXSA 3PI6A 1AUQA 4H7HA 3CLKA 4YMIA 3PXGA 2A9RA 3SJBA 2Y0BA 5CFMA 2P79A 1E5TA 1ONNA 2QM8A 3KE9A 2LWIA 3VZQA 1YOVA 1V1RA 2BEWB 1YBMA 1FS5A 3T7IA 1WBBA 3S4YA 2Z6UA 3HGQA 2JC3A 4JBHA 3V8NA 4BTLA 1O95A 3HACA 4QFBA 4QPDA 2DHRA 2JFOA 1L7XA 3HLTA 1TDJA 5AVRA 1VKRA 3GEGA 1SMKA 2VHQA 4HZUB 2AGVA 4D92A 3CCFA 3NAQA 1I9GA 4YH1A 2O2GA 3F9RA 3VV3A 3QVGB 5CCEA 1Q0LA 2C98A 3RVDA 2B3DA 1SUEA 4NFSA 3HCNA 3C70A 3R9KA 4Y2YA 1SUSA 4K40A 4L28A 2IY9A 3A1VA 1P19A 3IURA 3ZVRA 4C2BA 2D7DA 3KOZA 4UHHA 2JFVA 2CMDA 4QOFA 2JLWA 1S3IA 2X6RA 1KSFX 4Z5XA 3AKZA 2UZ4A 1JPNA 2Q8PA 3G2IA 5KBYA 2PMDA 2H6EA 1YZUA 3ZYCA 4PC2A 4ZZIA 2PMBA 4AX4A 3EYWA 3TLJA 2V9PA 4J1NA 5C5CA 1IHPA 2QVBA 4R83A 1KKUA 4ONEA 4I4IA 2AS0A 1B76A 2E4AA 2H8KA 5LUBA 3LDHA 3TAHA 3JALB 3UZUA 4AY3A 4OIFA 5BVHA 2JJ1A 2CVOA 4K9NA 1JI3A 2Q5IA 4DY6A 1KVUA 4NP6A 4EHNA 3ETLA 4PZ0A 4S1TA 5REQB 4MV7A 2FWMX 1NRIA 2BEUA 1SKYE 1O08A 1WHSA 4GXQA 3TZBA 3RYFB 5JJBA 1SIWA 1ZOOA 3DFFA 4X6XA 1XR3A 3SGLA 3UJBA 2WUVA 4ZZ2A 3SF0A 3KYDB 1E3SA 2WB2A 1ECJA 4YAFA 4PSKA 3VUEA 5C8YF 2A9OA 1E1RD 2QMUA 3LQRA 4K03A 3VMFA 3B52X 4JJ4A 4D7AA 1TYCA 4NFHA 3DBRA 5DHSA 1WB6A 2RHDA 5J4HA 2BGGA 1H3FA 1V3UA 4Q03A 4QGAA 4POAA 3WKBA 1RXYA 2MU1A 2K7FA 1GGKA 2Z2KA 2NACA 3DCNA 3JVVA 1YWGO 4YQZA 3KLPX 4EKYA 4RLFA 4DV0B 5GZ1A 2ERYA 1JTEA 1LQ2A 1ZRNA 1PL0A 1R9MA 1RZUA 3KHSA 3PNOA 1O97D 1YJCA 3BDVA 3MWFA 1QDUA 3GJYA 4FZ5A 2FJPA 3HM2A 3KS9A 4DLUA 4G9BA 4RD4A 4WGGA 1YJBA 2WNHA 3P0IA 2F9MA 5DTQA 3U3RA 4NJMB 3KVOA 3VR2A 1M6NA 1SC3A 2KBEA 2PX4A 2WSMA 1M8FA 4EUNA 2YL2A 2EERA 2FYTA 2VDWA 3L4BA 2ONZA 2C9MA 3ZJ4A 2FN3A 1QAOA 4PX5A 2OPBA 1KJ8A 1AXGA 2NYRA 3PFHA 1NBOA 1QVZA 2H52A 1W48A 4GWGA 4MJLA 1FS4A 4MQEA 5HQJA 5K6AC 1FMFA 4WIAA 3F3YA 4YMGA 5B1YA 1KYTA 5CT8A 2RDMA 3SVTA 3C97A 3GXOA 3MMSA 2ZR7A 1XZDA 1T5LA 1Z75A 4RMJA 1BKSB 1LPAB 5HRUA 3W2FA 1HQDA 3C7TA 5JEEA 4Z8XA 3AJDA 1TQ2A 1I1OA 2P35A 4FNAA 4L51A 1FXUA 4BJ5A 3U7EB 3QE0A 3RHFA 3BMXA 4PPGA 4WZ6A 3SBOA 5TC4A 3R77A 3ZU5A 3Q8KA 4PCAA 4MJ3A 3JZFA 3FCAA 1TEVA 2JLXA 1N1GA 4L0CA 4DQLA 1MRNA 5KYUA 4QL3A 4X66B 1XFAA 2FA9A 4C1BA 5K4GA 4H0NA 2JG3A 1UPFA 2C7RA 1IXSB 2XEXA 1HY3A 4RVGA 3Q88A 3M1YA 4QJ4A 3T4EA 4UXJA 2FUCA 2ZRBA 2DX7A 3FPAA 4DLYA 4G0YA 2RG7A 4Q21A 5FBHA 3PUIA 2BHSA 2AVDA 1F3LA 4NZ9A 4H08A 1P81A 1XZHA 4UTZA 3H65A 5D00A 4XGKA 5IW8A 1HFEL 3DMYA 1FNNA 1I2BA 3OZXA 5JJCA 2UYCA 2P9CA 1LDGA 2UYHA 2PMKA 3DAHA 5DDIP 2FQ1A 3NIBA 1P3JA 2HA0A 3O4JA 3Q41A 4UNSA 4C14A 1ZSVA 1OLXB 5C37A 2WSYB 4MYHA 3UK1A 3VXKA 4RIGA 4QM7A 2X1LA 1C9KA 3CX3A 3FYUC 3H5RA 3AHGA 3TLGB 3K2QA 1GY8A 3LC7O 4M8SA 3RTBA 4EG8A 1TEXA 2C54A 3MJ4A 2AE1A 2V74B 3IAAA 3UANA 3ZDFA 1W94A 4FFWA 4QOJA 5G1NA 3TEJA 3C8HA 4BKOA 1FVXA 3F7MA 4IW3B 2ATEA 3AONB 3OEHA 3DFZA 1NL3A 2A4KA 1H2YA 1LI7A 1U7UA 4C30A 3UOGA 5CYPA 3IE2A 1C80A 5T4HA 4KPYA 4GKKB 3CNBA 3OD1A 4IGEA 3V8PA 1U7TA 4JSYA 1D2GA 2DUMA 1G3RA 1I80A 1QQ7A 2HMTA 1ZQ9A 1YGPA 3W2EA 2C97A 2PGXA 3IAM6 3E15A 1Q1ZA 1HBJA 1TUGA 2QRPA 2YZ7A 3U9TA 3KR1A 4Y6GB 1DAKA 3WX0A 1R37A 4P5DA 3UWOA 1W8DA 3DF9A 3AFHA 2QUHA 3CR7A 1LWOA 1AQUA 2KSQA 3R6LA 2PUWA 3GRCA 2H2DA 1BW9B 1BGVA 3U62A 2CZCA 1UJ4A 2N3ZA 2GZ3A 3H9UA 3P9PA 4A1OA 1SCDA 1DS6A 1I5RA 1NBMA 1VMAA 5FULA 1AK2A 2J5QA 1DX9A 4MQ6A 5H02A 2X4IA 1IG0A 5I7SA 1CQJA 2BBSA 2PX2A 4DL9A 4CM5A 1SKMA 4GP9A 3CVYA 2Q6VA 3GW8A 2B0CA 1HTTA 3TIGA 5BWCA 5AJZA 1ILWA 4HWRA 1U8EA 3WLFA 1CIVA 5AVVA 4WFKA 3K70D 2BHTA 3CNOA 3U7QA 1MAHA 1LXCA 1TKRA 1VCHA 3BCUA 2PZ8A 4MEBA 5TPZA 1KJQA 2B8JA 2VOEA 4XUEA 1AO3A 3ETJA 1SVKA 2IUEA 2KQUA 3KV3O 4KQ2A 1RC0A 3KJNA 2Q1UA 4YY3B 2QS9A 2Q0HA 2ZSUA 5LP1A 4LGYA 2IEGA 4BB0A 2HK9A 3HEAA 2CW5A 3NTOA 3ENVA 4HAOA 1ONBA 4K9PA 3ESYA 3FBGA 4L6AA 3R41A 4RU1A 3UB3A 1KMHB 3HVHA 4K0RA 1S6YA 3A3YA 2VYVD 4M7RA 1I3NA 5FOTA 1TRHA 1LSOA 1UBKS 2DWQA 3D7RA 3BMOB 5J2UB 2Q4RA 2QMHA 2ZI6A 4RK1A 2YW9A 2PXHA 1PFKA 3DM9B 4JU9A 4MV0A 4B6SA 3W5HA 3EGDA 4NZYA 5EJIA 1X1AA 4D3YA 5HZHA 2Q2WA 4N0MA 1Y1TA 1YZQA 2R47A 3ENZA 3PJDA 3H05A 5ISMA 1CZNA 3QLVC 3MBIA 2X5NA 4YJ2F 5C8YA 5IT9A 4PCUA 4D02A 3KDPA 2HLPA 2FHSA 3QUTA 1Q0ZA 2GLUA 2V6JA 3LKVA 4HF7A 1K8ZB 3W5BA 3K0BA 3N8IA 4KR3A 4NOLA 1O9HA 1PZXA 5BXYA 4FJ2A 4EA7A 5HOEA 3H4TA 3X2FA 2JCXA 4FZRA 4LOLA 2NZ2A 3OZAA 4M1EA 2ZYHA 2UXBB 3TYXA 3M6IA 5EKUA 1XV5A 1LK0A 1E7YA 2P65A 4CQNA 1DPFA 3NEYA 3LH5A 4BLPA 5C53B 3M6MD 4IGIA 3B53X 2PX6A 4X6LA 4OHWA 2EGUA 1JKIA 3KSMA 1G6OA 1S4QA 2GMWA 2R7KA 1D8AA 5AKLA 1IB0A 4AK9A 1QGDA 2R44A 1FVOA 1UPXA 3ZXXA 4DMUB 3MBOA 2V3WA 3OQJA 3WK7A 5K0JA 2VJCA 2P8SA 3O2SB 1P5RA 4HG2A 2IOFA 3FUXA 1D4ZA 1AKUA 1IJEA 3ZBTA 1A88A 5C1IA 3G17A 2XOKD 1PZGA 3KCQA 4C78A 4XYGA 4TVBA 4KGVA 5EJFA 1LW7A 5L3VA 2Y1XA 1VCNA 2K7ZA 4G25A 1CVIA 4KEAA 3V4RA 3EFOA 3SQWA 1SNYA 5KNDH 1TF7A 1K3TA 4XWAA 3DMPA 4R3UC 5JCJD 3AXTA 3R09A 4NBVA 2WYIA 4X3OA 5I7VA 3CEJA 1Z5GA 4LXQA 4Q4HA 3ZQJA 4ZJPA 2GZDA 4MLCA 4WERA 8LDHA 3AF2A 3NALA 2XAUA 5IT4A 2B7BA 4OB8A 4H59A 2VDWB 2GXQA 4ZV7A 1PR0A 1VCMA 2Q6KA 3M6UA 1TJYA 2VT7A 3K0KA 2JGJA 3E0QA 1ULZA 5IKMA 1SUAA 1Z12A 2X9QA 4JJEA 2I2BA 2RK6A 1TRKA 3HB4X 1W4RA 5FUWA 3VX3A 4R0VA 3H9EO 5L3QB 4EVIA 3G2KA 5FORA 3K4PA 1HDXA 1UJ5A 1ZN7A 1RC1A 2VBGA 4IIJA 4MI9A 4OH1A 3EZGA 1NFRA 1P1FA 3JX9A 4M9CA 2Q6OA 1TQ8A 3F6SA 4IGFA 1DPGA 1RE0A 2JBAA 4NHOA 1GDTA 2X22A 3E3MA 3NT4A 1S7GA 4DNXA 2IXAA 3NW9A 1YZFA 4WNCA 3E5HA 3WMXA 3ZNOA 4IPTA 3TAUA 1U8TA 5FUVA 4NS1A 1T9HA 2JLSA 1XWIA 4B3BA 4DWWA 4PLPA 2G9RA 1USIA 3E8XA 4RVUA 3WISA 4DR6B 4RK6A 1Y8ZA 3K0FA 3QE4A 5I3CA 3KQSA 1RHRA 4R98A 4TTIA 5ALVA 2QVGA 1I4TD 4UBJA 3GFFA 4FZJA 2O5VA 4N5LA 3RD5A 1LBSA 4BMZA 1XZJA 3CCBA 3JQ7A 1L5KA 2FQWA 3ZE1B 2I78A 3OIVA 4PHFA 1IPEA 3RRMA 4D81A 1HE8B 3OPYI 2HA3A 3OE5A 3G5UA 1N1MA 4AIIA 4EHLA 4F4UA 5U9CA 2PYIA 3TFOA 3AFMA 3NRCA 3AIKA 3OLCX 4FOPA 4ABTA 5F52A 1FTSA 4B6JA 1FW6A 1OI2A 1YNOA 1T2EA 2WFLA 5FWDA 1P44A 2C4VA 2MSKA 3UHAA 4C2AA 1D7OA 2YNMD 3BL5A 5H16A 3M6AA 1Z28A 4XH9B 4TTQA 3WLQA 3PR2B 5EG5A 3A25A 2IF0A 4RZSA 3RC1A 3HABA 4DLAA 4DR7B 3AJAA 3GDGA 1JIXA 3L0PA 2Q5CA 4HN2A 4IS3A 4NU0A 3SMQA 1X1TA 5IDXA 3NTLA 5I7WA 5I8PA 4HAUA 5LSAA 4QXQA 4OXQA 3D6HA 4M1WA 5HJ5A 1XRLA 1JKFA 1GL7A 3FPJA 4IMRA 5EPOA 2WR8A 5IUNC 1E4EA 1UBLS 4AZ3B 5KQMA 1GPJA 3W5SA 1QQAA 1C3LA 3MWKA 3OY2A 4EGSA 4EK9A 3IMCA 1JPUA 2WJ3A 5K6AA 4KL8S 4MGIR 5I7OA 2CUTA 3HYSA 3I2FA 4WRRA 4OLBA 3LPMA 1TPZA 2PKRA 1PX2A 3K9LA 4XGNA 1T15A 1KL7A 2R8XA 3HNOA 3R75A 1V5FA 5CCBA 4OM8A 1D07A 1LLCA 1Y1QA 3VOBA 4FNGA 3QVTA 1POXA 4AXXA 4E7PA 2F3TA 1ZCFA 2HQSA 5EE1A 1QK4A 3MELA 4D4KA 1W46A 5JI3E 2IHJA 1T10A 1UFQA 4BPBA 3EXAA 1P0CA 3ZCQA 3GGPA 4M89A 1RKQA 3T5MA 2C1ZA 3W3ZB 4ZO7A 3BWCA 3HWRA 4Z9BA 2ZWMA 5ESRA 5EWJA 1G3UA 2OGUA 4QRIA 3RWMB 1JNXX 1CUBA 4AT1A 5LN1A 3AM3A 1RXCA 1RFLA 3I61A 1A9RA 5G3ZA 3ZZUA 4BNJA 3CZCA 3VR5H 1IH8A 1HLPA 2DSNA 3PYXA 2FE4A 4A0SA 8MHTA 4Y1RA 3CV3A 1NW7A 3RB8A 5JQWA 2HXYA 2BRUC 3DE3X 4Z4GA 5FB3A 4R84A 1UPAA 2AG6A 4KG7A 3KKZA 2PZMA 2IOYA 1U28A 3R7BA 1M0WA 2FTKE 4BVEA 1K5DA 1BDBA 5IWAB 3QVUA 4IEIA 2WPDA 4DPMA 4GR4A 3KT6A 5HUHA 3EYAA 1EVEA 2YFHA 4W7SA 1ZIOA 2I65A 4G81A 3VNSA 1NMZA 2XVXA 4CCAA 5CX4A 4DLBA 1MCZA 3TGWA 3U9LA 4Z53A 5EJEA 5KJEA 1D5WA 2ZFUA 3CNHA 1KDOA 5TS2A 3S8MA 3VHLB 3O8CA 1QGYA 5I45A 4X92A 3WLMA 3H4IA 3A0UA 2XECA 2OY0A 2ADMA 2YZ2A 2E55A 4IFTA 3SKXA 1P60A 3VTFA 1FJXA 1MIHA 3EZ6A 3AY6A 3VYWA 4E5DA 1U3VA 1TYAE 2QTBA 2DFKB 3QX9A 5CYGA 1P72A 4CM3A 3HBAA 2VO1A 3PTAA 4J1TA 1H22A 1DCTA 2G9UA 4O5OA 2VJAA 2HU7A 2ZBVA 3H17A 2EQ5A 4KN6A 5C4GB 4EG1A 3CVXA 4J0CA 4CJXA 4YRFA 3SZLA 2QUIA 1XQ6A 4D42A 2YJGA 1LLDA 3WIVA 1J9ZA 3T5DA 2C2GA 2DBYA 1XBTA 2IYEA 1NVGA 3JYQA 3AV0B 4QVKA 2VDJA 4R54A 4DNQA 4EDFA 2PDAA 2EW2A 2P68A 4OYYA 5IDYA 2CLDX 4JP5A 4CTJA 4EHKA 3TSZA 2AR0A 1PR1A 1UOPA 1Y7IA 2VJMA 2P0AA 4JC8A 1XO1A 1NI4A 3PHLA 2HSJA 4TRRA 3IAHA 3WYFA 1WX1A 4GKAA 5AFSA 2P6PA 2P41A 3K1YA 4P0TA 3PGLA 1ZSYA 1NKVA 2CJYA 1YDGA 3EH1A 4AMGA 1X7WB 2C7PA 4QTZA 3N58A 5ES3A 4GUDA 1YACA 2ZS8A 1MKYA 3MNFA 3TO5A 3V4ZA 1KZGB 2B1GA 2YCLA 1PWYE 4HGYA 2O50A 2O52A 4J2TA 1XNRB 2OV1A 4B0OA 2QMQA 1WD5A 4QLOA 4ES6A 4BCDA 1MB3A 3HPRA 1U8CB 1WPXA 2BMDA 2PEZA 4FE4A 5LWQA 2X19A 2PD3A 3FRHA 2R5FA 1Z2NX 4DN6A 1UEJA 2IZ5A 2NSHA 3TQIA 1NULA 4I1PA 4AJ1A 2Q5OA 3KJFA 5HXAA 1GN8A 2C9OA 1RWQA 2O6LA 1MXHA 1XA4A 3NZEA 4X0EA 5CBPA 4IDDA 3QFHA 4O4HF 4DE5A 3B3QA 5ALEA 3RDPA 3RF6A 2HA6A 2W6OA 3DT6A 2WZQA 1A71A 4ALNA 2WVHA 4RVFA 1PZMA 5KB3A 2IYTA 4I4TB 2HF7A 4W4TA 1MB0A 2GEBA 3A10A 4QBIA 4TM8A 5IKPA 1FTNA 1Z5UA 2ZBGA 1R64A 4K46A 5D3MB 5JZ9A 1VL2A 2J5XA 4G0QA 4B8ZA 2GF2A 5HF8A 2J9ZB 5IM4F 1E1DA 4NFLA 1KVTA 1YHZA 2X9GA 3B6KA 2PYDA 2WVJA 3BXOA 1M8PA 5T7BA 2WBLC 2IV3A 3C15C 3G6KA 3EVGA 4B33A 1X7WA 1Z6XA 3EZNA 3PQ6A 4KK4A 3D5EA 5CPFA 3A9VA 1ZAKA 3KBBA 1P7YA 4O2BB 4O4HB 4AJ9A 3D4BA 3FGNA 5BV7A 3I5UA 3REQA 1JFVA 4Q47A 1MH9A 3MTBA 4YFVA 3DHVA 3QMPA 2FDXA 1IU9A 2QVYX 5CNJA 2VNAA 1CZKA 3ZVMA 1Z56C 3DOFA 3NYQA 4HAXA 1UBCA 4I9NA 4WT7A 4TN1A 3V4PB 5LYJB 2X6QA 4Y6LA 3ZY3A 3EEIA 1KMCA 4LBZA 4R1PA 3TZ6A 1T5BA 5GGXA 3OOHA 4YJFB 1K6EA 3LBFA 3TQCA 3MGKA 2V6IA 2IYQA 3IKLA 3LOQA 1OFGA 4QPCA 4H7IA 1T5TA 2G71A 3AI3A 1F1JA 3BIJA 3G2LA 3R3UA 4PZEA 4R3WA 4G1BA 4ZOLA 1L5LA 1UC4B 3UCFA 3AESB 1ZHHA 4G65A 4BNGA 3EA0A 2M6SA 3LL7A 4GOKA 1MIOA 1WUHS 2QT0A 3K0CA 4CIXA 1JU3A 3I0ZA 1NA5A 4KSYA 1AB6A 1XZMA 3IJEB 5GJWC 3SICE 1OHHD 3HV2A 1XPUA 2YWRA 2ZT5A 4UHFA 2ANBA 3QTLA 1P1IA 3AETA 5TV2A 3RU3A 4XFJA 5LC1A 1K7SN 3O4HA 5EP3A 1BWPA 3AEQA 3JWGA 3UMFA 2XRFA 4S12A 2VF5X 3EQ7A 2DFVA 1D0SA 2L82A 4LWQA 3EMKA 5DGHA 3RUAA 4DA8A 4OGLA 3WLAA 4GQBA 1PEAA 3BWDD 1RBQA 1PJ2A 1SC9A 4EFLA 5A05A 9GPBA 4U0KA 4MJXA 4F8YA 3LUFA 1J00A 3GFRA 1CY8A 3DTVA 4ZIRA 5JJ5A 2TS1A 3ACDA 2OV8A 4Q9HA 1I36A 2IEBA 1R9NA 3HZRA 1QIGA 4ON9A 4A0GA 3ZC3A 1RP1A 3DLIA 1XMSA 2CLMB 2ZJ2A 4JMLA 3L1JA 5ALLA 1VB3A 1N2OA 1V1JA 1BWSA 1QFXA 3C1TA 3ZWDA 5HX7A 1NG9A 3GPLA 3ZN2A 3KE8A 3CKYA 4Y2XA 1VC2A 4OBBA 2QY6A 3VPSA 1N6IA 3HDGA 1GLGA 5AKJA 3STYA 2NYUA 2W2KA 4HXYA 2WP0A 5BWNA 3K6JA 1EVJA 1CJKC 1W8IA 2P7IA 1H8EA 1SJ9A 1LPSA 2V0NA 3GN1A 2OBFA 4M1KA 3UMGA 1CXZA 1VFNA 3FUTA 2XE8A 3Q7SA 4EPVA 4DNPA 1PJQA 1JVBA 2AJBA 2HSWA 3QQPA 4G4SP 2G83A 4JJAA 4R68A 3TL2A 2AI1A 5FLKA 2W90A 3OJOA 3Q98A 3CONA 1SZCA 5GONA 1O6CA 3JALA 2JLBA 1AN9A 4B6GA 3BHMA 1KPIA 3P2MA 2DR0A 2WUFA 4KAAA 3SEAA 3AF6A 2JCGA 4GPD1 1B0UA 5EEHA 1KDZA 2PL5A 4AZ0A 1UODA 3AF0A 3QWFA 4MR8A 4XPZA 1FS6A 1C7RA 1GA4A 3JVEA 5AKXA 5HEKA 1G21A 3K8ZA 2H2WA 3IBSA 3LLVA 4XVQA 3UW3A 2D8MA 6Q21A 1DIBA 1G8KA 1ORWA 3FNFA 1ZXXA 1S5PA 3NCTA 3TKYA 2YDYA 4Z9XA 4PS0A 1BXRB 5H1YA 3EXIB 2DTEA 3BSYA 5A62A 1Z4LA 1R4NB 2J59A 5HFAA 4AG3A 4C43A 5A3RA 3ONDA 4AYXA 2FQYA 3RGWS 1PJ4A 4YGYA 2OESA 1J97A 2J6CA 3DAPA 2V5VA 3SFVA 2VJYA 1I5EA 3IX7A 5KYWA 2V0CA 1NF3A 3FSEA 4RPKA 4MS1A 2AN4A 4LISA 4L4RA 4PPFA 2PS3A 2HI0A 5F3WB 4AKSA 2WTXA 3KWJA 4ZK2A 3UXEA 2RAPA 1K6XA 1RCTE 4JELA 3G5TA 4CDMA 1OIXA 1TTHA 2GHTA 4LYAA 3T3DA 4QDKA 3V2HA 1FVHA 3OBIA 4F5WA 3KQHA 3GLIA 2A7QA 2QV7A 2XYGA 3AEKA 1X13A 4GPZA 4YJ2B 3K53A 4ZVPA 1U9CA 2PZEA 3B2NA 5ELXA 3IAFA 4G1MB 3HB7A 3PU6A 4YI5A 3U61B 4JYZA 3PDWA 3RU7A 4IP0A 5AI5A 3THXA 4UOQA 4YRDA 3FDXA 2DG2A 3C6MA 4L9AA 2IYNA 3RYIB 4ESEA 4IMIB 3DVAB 5IANA 1A5BB 2XXJA 3A1TA 3CWQA 2D00A 2A88A 2CWDA 2JA2A 3LUJA 4FWIB 4UM5A 1EUCB 3IH5A 5B64A 4TMTA 1NWHA 2NLOA 1O8CA 3ETEA 2ZW9A 4TVKA 4YCCA 1DEHA 3IULA 4ND6A 5EXPA 5GM2A 3F46A 4B7CA 2AR9A 1P39A 2F4NA 4Z1MA 1CRWG 1M34A 2EDCA 4IO0A 4ZI7B 2B83A 2ZJ3A 1P2SA 2EZ9A 1WIWA 4LTNA 2BTEA 2C2OA 4I1SA 3Q8XB 2QBYB 1ZONA 3D8TA 3W7VA 4CBVA 5LQUA 1OXSC 5LLTA 1K9SA 1CRPA 4H31A 3NHMA 1E2NA 2CLCX 4UPVA 2J0EA 3EFOB 3PUHA 3EFEA 4K6MA 5JHGB 2XTJA 3QKRB 3L9XA 3W34A 5GPBA 1OLUB 4R1TA 1F20A 3VYSB 2NYVA 1SD1A 1JBEA 4HQ0A 4JI4B 5GVRA 4EJ6A 1NU8A 5AK4A 1BMQA 4F72A 3GAAA 1FTGA 5T6BA 4JXZA 1Q3HA 3AEUA 3IVMA 3KCNA 3RSOA 3H8SA 1JIKA 5AJWA 3F74A 4E14A 3LC0A 1PJ8A 2PHZA 3C3AA 4NBRA 1K4KA 2R87A 1I51A 3FVVA 4HX9A 4WNYA 3ADKA 3OIUA 4A6DA 3ZD8A 5DTEA 3LHKA 1OV4A 1I7LA 3B89A 4BP8A 2O7QA 3PHHA 3QOWA 3RIYA 1F51E 4GMFA 2E82A 1I7DA 1XJCA 4DB2A 3G82C 3L8YA 1ZN8A 2ZJAA 1USWA 3IERA 4X7MA 5K0BA 1HA3A 4HDSA 1L4GA 5FAXA 1I4WA 1W47A 2CCJA 3MINA 1AURA 4JASB 3ETCA 3I2KA 4CV0A 5JY6A 3ZCRA 3CQ9A 4DYVA 3DBIA 1RM0A 1YCFA 5ALHA 1ORDA 2P9QA 3IOEA 5BQPA 2D54A 5E9WA 1F4LA 1PHRA 4GI3A 4JVNA 4MW5A 1MPXA 2OWEA 4EHJA 2UAGA 4D2IA 3CLVA 3TZLA 5C4IA 1Z83A 2V96A 4UUQA 5KVVA 1XD9A 1P7WA 3L6DA 4WFIA 3RG8A 3THWB 4E11A 3W9UA 3RNLA 1S02A 1SU6A 1EK2A 1MVOA 1MV8A 1RAIA 3PR3A 3FJYA 2Q27A 4PZPA 5D87A 1DXOA 3JQGB 4E22A 1N2CB 1HV8A 4E4RA 1QMPA 1ZG3A 4NZMA 1JWBB 2FQQA 4MRAA 1YL6A 3DONA 2HMVA 2ERCA 1LLUA 1TT5A 4PU0A 2C04A 4D6YA 5SYAA 1P1HA 2O1EA 3IUQA 4DANA 2SNIE 1YZGA 5EOVA 1KPHA 1DQSA 2XUPA 4BE9A 4DV5B 2XCTB 3CCCA 1LVUA 1ADYA 1KO8A 1X7YB 4BZXA 4L1KA 1JR3A 5ICMA 1FK8A 1VPLA 1R0KA 3R3XA 3CEHA 4BGVA 4MHSA 4IWXA 4YP0A 1RQPA 5ECYA 3TVDA 4FQ7A 3HPQA 1B3RA 1KI1A 4FHFA 4OUDB 1K89A 5WRFA 4ZFNA 1QU2A 2YBEA 5CD9A 3GGCA 4HR7A 1E59A 1C7ZA 2CLLB 3JVIA 3CF4G 4JLSA 2VZ8A 4F8EA 4F86A 2VHYA 3C4QA 1JL3A 3MHPA 5FUBA 4HDRA 3DC2A 4ZEMA 1TCVA 3UJ6A 4DJEC 2J41A 3E8SA 1YAJA 4ITRC 2NO7A 2RHRA 4M2LA 3FYSA 3ZU2A 1H6BA 3OD5A 5C18A 1X80B 4M9UA 4UUMA 4R9NA 1V8FA 2VNSA 1N6RA 4RHEA 4BV2A 1Z82A 1TPYA 1LNSA 5FBWB 2AQ8A 4O4LA 3ZZMA 1FP7A 3RS7A 2ZANA 4HNUA 2GPJA 2FF5A 4KXMA 4ER3A 2AL7A 1XOIA 3P9XA 3VSCA 3OVMA 4EW1A 1P1KA 2AUTA 4QAQA 4RLHA 1EI9A 5KWEA 5BR1A 2OXCA 2UKDA 4HDQB 4Q4AB 4GX1A 3WMGA 5BSVA 1U3UA 2E1PA 2HFKA 3P2OA 4XQCA 3GLKA 3M6WA 3PDUA 3PGA1 4W6ZA 1QF9A 3NEPX 4A4DA 4CV2A 1HRKA 3K0SA 1P17A 2L2QA 1XRNA 1R4MB 3QUSA 3U1TA 2C9DA 1UP4A 2I33A 4OHPA 3JY6A 3WGVA 3HVKA 5EJ9A 4MIYA 1XTJA 1C5KA 3BD7A 1Y4AE 4C0SA 3FWYA 5IC5A 1PBTA 2CF6A 2HK6A 3CWZA 1RPJA 4PSAA 3GB9A 5FADA 4I6EA 5CB4A 2JVKA 3GNTA 4LXXA 1Z0SA 4YP7A 5DI3B 3K9WA 3KLMX 3RIXA 1LDMA 3BAZA 4YAGA 3ZDBA 2AH5A 1GR0A 3K20A 3NU1A 3NTXA 4G0MA 4ZVQA 4BNDA 3U4IA 4KIWA 3AR2A 1WHTB 4ER6A 3AM1A 1FB5A 1L5ZA 2ODPA 2RH5A 2XITA 3MQ2A 2B99A 1IJFA 4B82A 4FMCB 4XJSA 3E03A 1Y6RA 1CUHA 2GN8A 4ZN6A 3TLGA 5IDQA 3LHDA 5GIOE 2AKYA 1ONPA 5F2EA 1Y42X 3DA8A 5JR3A 1MP0A 3X1WA 2YXPX 2X7XA 4MKRA 4BUZA 2R8RA 4ZHQF 4LEIA 1NZDA 4RETA 4CEHA 3P9RA 2PR7A 2Q6LA 4XIJA 3VSBA 4J91A 4LWPA 2ZYWX 1ZI9A 1PVVA 4C4XA 1WTCA 1LSJA 1RBZA 3OEEA 4LS3A 4ARBA 4INZA 4M36A 4IDNA 1EX7A 1HL3A 1K0FA 3T52A 1WETA 4Y0AA 3CF2A 5J43A 1TCUA 5IJWA 1KEWA 3PFIA 5FQOA 3T5BA 4JKIA 4NCBA 4DJJA 4V0ME 4IIFA 1Y8RA 3T8YA 3PC4A 1J22A 1PEDA 3D7MA 4QHSA 1IXZA 2QMYA 3VNAA 1XDWA 4RH0A 1UEXC 3ZE7A 3ZIUA 1S8NA 4X85A 3N86A 4LPSA 4UHBA 3U17A 3ZLVA 5IS2A 3EVEA 3MWGA 4GBED 2PPVA 4UKDA 1FNBA 4CGYA 4XVUA 1I3OA 2GN1A 2YS7A 3MT7A 3SHTA 3TD9A 3HGMA 5BYKA 3JS5A 3G8AA 1PWEA 4OMFG 1YB1A 1B16A 1BROA 3MUNA 4U4AA 3F67A 3PFCA 4XQEA 1UJNA 2P1DA 3KU1A 2GBLC 2GUWA 1YCGA 3FHTA 4Q24A 2GEVA 4ZMRA 4M6WA 5F9FA 1L8LA 4MVYA 2Q1XA 1AV7A 1UWLA 1KERA 1V26A 2JFXA 3ORRA 2GJAA 3QPAA 3PK0A 4IUDS 2BKVA 3FUVA 2REQB 3PXCX 2A57A 4LZLA 4R9RA 4WCVA 1T2FA 2R6GA 3ANNA 3H2HA 4JKOA 4D0RA 5AW1A 2VAVA 1N2GA 4BBPA 5ANRB 1U0TA 1GAEO 2QRQA 3BBPA 3LYUA 5JVDA 4NZZA 1THGA 4EB3A 1VMDA 2A1TS 3HKEB 6ADHA 4RJJA 4DA9A 1HPLA 4X84A 3A2LA 1RWKA 3I2GA 2CDAA 4ZPXA 3P7MA 3FOFC 1ZXBA 3E7FA 5FQNA 3GEIA 3M6LA 1WZNA 4WXPA 2OVFA 2OMEA 1J6UA 1AX9A 3C6QA 2INGX 4G0NA 3L0SA 4L2IA 2B8TA 3PZBA 4KUEA 3BSFA 1P3DA 3WP1B 3PSHA 3B8EA 1X7XA 3T5TA 2R84A 2AMVA 2P3QA 2VIIA 4FYKA 2DHDA 4M1MA 4UDYX 2I34A 4TQGA 1JXOA 4H0CA 2W4IA 2J0SA 4GX2A 1RRKA 1STOA 3CMCO 4GF5A 4DIDA 3AP2A 3HA2A 4W9MC 3KTAB 3NV7A 4M0EA 1DXYA 4OHXA 4HQRA 4W8OA 5EXEA 1VGQA 3UM9A 4AZVA 4B76A 1W4CA 1N2BA 1XDSA 1BE6A 2C9ZA 1RE1A 4G0ZA 3TL3A 2WMNB 4YR7A 3GZJA 4ND2A 3L4KA 2X4GA 3ZWCA 3CZAA 1JEJA 2JI8A 3VKGA 1N2CE 2HWXA 5KTOA 1KMQA 1ZK3A 3GUYA 4G97A 2C7VA 2X4LA 3R7DA 1XTUA 2AJDA 2Q2OA 5K2OA 3TCNA 2CHEA 4GL2A 1ESDA 4PINA 4HY3A 1UZNA 5EWLA 1NVTA 1SUCA 1T8YA 5FOXA 2QM3A 4ZOCA 5AVOA 3CKMA 3IT2A 2ORED 1UQTA 4Q16A 4PZUA 3WGNA 4K0KB 4UUPA 1UWCA 1W581 3OCYA 4KPUB 4Q01A 3PGVA 3H1TA 2VTBA 1BWQA 3VM6A 3H3XA 3PHJA 2YV1A 3QVOA 2WK1A 1ZJJA 3EXHA 3GJ8A 3KEMA 4LOIA 1CY4A 1NI3A 4JJFA 1OTYA 5P21A 1Y5IA 4DG8A 5C7IO 4BO1A 1J7JA 1J24A 4V0OA 1YS6A 3S8YA 4NRDA 2OHVA 5EIXA 5GJBA 5I8WA 3EY4A 3MUFA 2QTNA 4MQ4A 3RK1A 1WVIA 2CD9A 2XVMA 4BFWA 3S7ZA 2BUCA 4ASUD 5KYYA 2PX5A 4A36A 4NV3A 2DUNA 1VCIA 2VK1A 4ENSA 4YT2A 3MWYW 4FM9A 5DV9A 2QSJA 5CDSA 2PT9A 3E22B 1BJKA 1ZW1A 2R00A 2JIRA 4L8YA 1ECFA 2GJKA 5UKDA 5E2AA 3EUEA 3CX8A 1D8TA 1NPTO 1J5PA 2ZJBA 4DCUA 4DZTA 1A2BA 1L5FA 3AHEA 1ESCA 4WCDA 1RKXA 3EUWA 1ZN9A 3PT5A 5ICGA 4Q19A 3CZQA 4Z51A 2X1MA 4BNUA 3Q3EA 1GCAA 1SCUB 1E9SA 1B6TA 1WXDA 1UXIA 2DC1A 3BA6A 2ROQA 1EZZA 3HXPA 1JAIA 3MYRA 1IBCA 1U2GC 3RIMA 3EPJA 2PKQO 4E2FA 2OHOA 1A27A 1VJ0A 2P75A 1Y3DE 1FXWA 3ELBA 4C07A 4YXWD 1KBZA 4A92A 1I33A 1RWPA 1E0AA 5E1DA 4PG7A 1ECCA 3L7LA 3PNPA 2YJTD 4TM7A 3ZQUA 1RLIA 4BNWA 3FIUA 4J75A 1AZSC 2OBNA 3GLQA 4NENA 3R8XA 4E33A 3BSSA 3PQ2A 4KE7A 3OTWA 3UFBA 3Q3HA 4AJIA 3SN6A 1CEQA 5L7TA 5DM70 4QT4A 3O8OB 4KPEC 2W2XA 2QLBA 4GVLA 2PT6A 2G28A 1TK2A 4MK4A 3PDIA 2NZXA 3N07A 4BC1A 3SIRA 5AM4A 2H1CA 4E88A 2FPXA 1T36A 1LS1A 3N2YA 3D6VA 2VJNA 4AUNA 1MEOA 2QL7A 4G0XA 4WOCA 1AQIA 5FBZA 1AQYA 1H2RS 4ZGBA 1ZUIA 3U3XA 2EEPA 3V42A 4N7MA 1W25A 3DKRA 2YR0A 2A1IA 3BAFA 3DTVD 3KYCA 4P32A 4R7GA 4Z0PA 4M60A 2BYTA 1W1WA 2I2CA 5EP2A 3O3OB 2J3QA 1O6ZA 2ZI3A 1KXZA 3LVQE 4LHSA 4F21A 3QLVA 2IBSA 3AKYA 3OQBA 3BCSA 1QH1A 1YZYA 2XYVA 2ZIEA 3GVIA 4X1KA 1ULAA 2XMGA 1PUXA 4FCCA 1UJ6A 5D51S 3SQMA 3VKWA 1U5BB 1G2QA 2IHVA 3A8TA 2JHCA 2VDVE 1ZM9A 2J08A 3EARA 2GOYA 2IV2X 3ZW7A 2QQ0A 1L7PA 5TMDA 4DIFA 1TTPB 2AG8A 1A5AB 1H6CA 2DBVO 3KQUA 1R18A 4LJKA 2Z1DA 4KR9A 2Q6TA 3WICA 5F9HA 3E84A 5A2GA 4PRZA 5AVJA 5KNBA 4F8JA 1KI7A 1C1DA 1K0UA 2QR3A 2VPZA 3PS9A 1M5RA 2Q5QA 3M9XA 3OM9A 1QTQA 1P5JA 4IEEA 3ZK9A 3ZZTA 2YXBA 4JJKA 4DSUA 2GASA 4G0PA 1BC5A 4YBRA 3WGYA 1LTHR 3KB1A 3NEAA 1Z5WA 1JFRA 2AOXA 4Z9AA 3L0DA 4AZWA 5M34A 4X8MA 4BVAA 2V54A 4IJ5A 3PDIB 2IY8A 4OH7A 2LW7A 4JLPA 3UMCA 2VT3A 3U44A 3SDSA 4NCNA 4RPIA 4FHEA 5SICE 1QGUB 2J9YB 2JGMA 4LJ5A 1YJAA 4B7ZA 1PT6A 1IM5A 4IO1A 2B7CA 3U60B 2WHXA 2YMQA 3KQVA 3A28A 2ATVA 3UUWA 4M1TA 1YB5A 2DTDA 3UMRA 4M7PA 2AEFA 3OLQA 4EJSC 4LQDA 3AUAA 2LUOA 3ILVA 4JXKA 5CM9C 5AVKA 4KP7A 5DI9A 4XDGA 4BMYA 3AHDA 1ZJ6A 2NAFA 1IK4A 1LB1B 1EU1A 3I8XA 3S1LA 1G5IA 1KHHA 4PF1A 4D8UA 5IVKA 4ERXA 2REXB 3BRSA 1NBMD 2YIJA 5TMBA 3WFIA 3IJPA 5C35A 3KB8A 3WWZA 1YS1X 3BMNB 4NVRA 1O0CA 3FNEA 1OYOA 4IS2A 4IUYA 4ME6A 1UM8A 3KM0A 5KSZA 1O4VA 2FPWA 2FSSA 4Q4CA 4WADA 5BSKA 4H2DA 1VKZA 1PQWA 4FSHA 2ONJA 1ZHFA 2I4RA 3RHZA 4WBNA 5JAOA 2BKAA 2PBRA 4P7GA 4QSHA 3ZNPA 3C85A 2ZUWA 2RHWA 2YYZA 1A8UA 3ITNA 4EUSA 5KSOA 2XQFA 2OV4A 2IUUA 3VR6D 4HFJA 1DIRA 5FPHA 2Q5LA 2FUG6 5E3HA 3P9CA 2C2WA 2PLWA 3QW4B 4WUVA 4K2AA 3KSDO 5HHTA 3EIUA 2X0NA 2EVWX 2IXBA 4KVZA 3AB8A 1JT2A 5I5EA 4KX3A 4G0OA 1H66A 3ZHSA 3CZ9A 1ENYA 3MIZA 4B32A 1RWXA 1YQQA 3SS7X 1JX6A 4DS3A 1ADGA 1QYXA 5TF4A 1JFLA 4U7JA 4LZZA 4K6KA 4ZT3A 1C2TA 2C5SA 3BXFA 2YDXA 3PL5A 3FJ1A 4UDOA 3AB3A 1XPOA 1PS0A 3R5SA 4IMJB 4TV8A 4PXAA 4P9NA 4YAJA 1XRSB 2Z30A 3MPUA 5DKFA 3P9QA 3EZXA 1S2DA 1Q16A 3B78A 4JT8A 4KJZA 5DRYA 3GL9A 5KTTA 3LT4A 2AFIA 4LYFA 4NPCA 4CKBB 2DERA 3Q5DA 1FSZA 1ZWKA 3FFBA 4Z86A 2VXCA 3ONFA 2RMKA 3FWKA 1HL7A 1XPRA 4G23A 4CTMA 3LY8A 1WBDA 4MYCA 2DQKA 3DR3A 1P1RA 3Q87B 1DZ3A 4G5XA 4L02A 3OJCA 4EYGA 1BFDA 2D5AA 2P2SA 1TB4A 2CSUA 1L3IA 1LLQA 3EWSA 3L77A 4Q9NA 1BXGA 5EKXA 4KDEA 4QO8A 3AZPA 1LDBA 3IEUA 2IODA 3LHIA 1B26A 4A8JA 1NMXA 2ZVJA 3AM4A 1JT9A 4JB2A 5H7XA 4YR9A 2Q3MA 4J49A 1LU9A 1VMIA 4YV0A 5JECA 3GGSA 1F5SA 4CKCB 4D98A 4YYZA 1T4CA 4IOLA 4OGWA 5ES4B 4H1VA 5BMVA 4D9CA 1JG3A 4BP1A 4M54A 4OHVA 3CR8A 4JJ6A 3TEMA 3V33A 1VP3A 1KU6A 2QVZX 4TX1A 4AMZA 4BEJA 3URKA 3OE4A 4JR0A 5HCNA 3TZKA 3CG0A 3GAZA 4J16C 1NHWA 4RTJA 1JYFA 2BC9A 2J3EA 4RQTA 2RH9B 1AXEA 2EZ8A 1ODKA 4V3CA 1M0EA 4QULA 1BFKA 3B7PA 3IIIA 2DYKA 3QY9A 3ADDA 3ROPA 4AJPA 4URFA 1QQBA 3GGJA 3OKPA 4H35A 4DBZA 4RE6A 3OUUA 2GRUA 2ESRA 3JRNA 1EHIA 1ZRMA 2VOJA 3M5CA 3M5PA 1QHYA 5AW3A 1HYEA 4L3OA 4I5FA 4PWYA 5KAPA 1DX6A 1VOTA 1EX6A 4YT5A 1E7WA 4FR5A 5AKIA 1BN7A 2WU0A 2R68A 5A6SB 1F4VA 1GN9A 2XIQA 5YASA 4DMMA 3BM5A 4TV8B 1EVYA 1QM5A 3J80A 1F6BA 2Y1WA 3DKVA 1OD6A 3KKQA 3EOZA 1XU7A 3JYPA 3BG5A 3LKZA 4MI3A 4QO7A 4X97A 1AQNA 3SVLA 3BK1A 2FZWA 4ZTZB 1UQUA 1GZVA 1XZKA 1Z0JA 3T15A 3V34A 2VPTA 1B23P 4TYNA 4B47A 3U4CA 1JR3E 3T5AA 5C5IA 5ITZB 2ZYRA 3DXZA 4CKBA 3Q8MA 2PV7A 4EAQA 2YWGA 1PJLA 4B4KA 1GTZA 1OWLA 1U4NA 3O4FA 4JB3A 3GDOA 1FFBA 3D4NA 3LNCA 4TVOA 1C8BA 2A8YA 3DE5X 3GWGA 5GIPE 4FDMA 4PTZA 1ID8A 4KMOA 4HWPA 3JTMA 1NBIA 3SE7A 2YWDA 2GWRA 1WKBA 4OJKA 2DH6A 4RJIA 4PAGA 4ZEWA 1JLKA 1U1EA 1F38A 1V7QA 1XWWA 5C1PA 2IU6A 1KZYC 3E48A 4CWAA 3ICWA 1OE0A 2B61A 3VH1A 1JQDA 1ZJ5A 4YRIA 1NGSA 1NNUA 3BH7A 3ZCTA 1XZ8A 4UCWA 5CA1F 4WOBA 1G38A 1CB0A 2Z08A 1P2DA 3PFWO 5EQFA 1NTOA 2HJWA 5FX2A 2E18A 2J30A 3G02A 2JD0A 4PYMA 3G7SA 4UMVA 6YASA 1T4DA 2BELA 3A31A 4C7KA 1PWHA 5LYYA 4WKPA 3UVEA 1XHEA 4JI0B 4FX2A 4G5RA 2ZRCA 1GSOA 1AS0A 3DV0A 4XWGA 3NRBA 4WBNB 3JARA 3UMMA 4HWOA 2Q4OA 1GZ6A 1EX1A 1HMPA 1Q7EA 2P62A 3M6XA 3UOWA 3I0MA 3I04M 3PV0A 2CDCA 2GN0A 4Q15A 1O9GA 1XXHA 3G88A 3S99A 1Q0SA 3LVRE 5AJYA 3ND6A 1DL5A 4D9MA 4G1UC 2WHQA 3U44B 5IZ4A 3HDYA 3PWZA 1Y9EA 1UL1X 4MROA 4PNEA 1YKFA 3MTGA 1T1RA 4BNDB 3JWEA 3DC7A 1OZHA 2C4MA 3UQZA 3V1TC 1P0IA 5IC6A 3HDHA 5SZHB 1N2JA 2VBFA 2W6NA 4D9JA 1YFZA 5DJ5A 3KDAA 4OOEA 3M1LA 4CEIB 4LCJA 2KMLA 3CYFA 5I3ZA 3TL6A 5L4NA 4UEJA 4RCVA 3WYNA 5B7NA 4BHTA 1RPTA 1BS1A 2ZUFA 2JNWA 4MKIA 2PR2A 4DNOA 6REQB 5KX5F 3NYWA 1QZ3A 2ZWAA 2F3SA 4XD7D 3FNIA 4QQFA 4EFKA 5CTAA 2Q6IA 5DNEA 3Q0IA 2FUEA 1H6DA 3HRKA 3ZGXA 1A4RA 2FEAA 5K3EA 1E2QA 4CLHA 1DADA 3PTZA 1D1PA 4BRZA 1WNTA 4KTVE 1NNEA 3GFQA 4U3JB 5AK5A 1EM8A 1Y1PA 4ZICA 2C94A 3L79A 4QBKA 1CLUA 4K9DA 4R41A 3U3OA 1N3LA 1P3Y1 1VTKA 1FYXA 5FBQB 5TB5A 3EJ6A 4CQMB 1M2HA 1ATZA 3GUUA 3GO4A 2EC5A 3A06A 4LCEA 4RTQA 1UZUA 2I22A 1NT2A 1OLSA 4RYLA 3CH6A 5GWXA 1KQPA 3BSWA 2IQIA 4GGOA 3F7NA 1QIIA 3HK2A 4PY2A 1TW2A 5TE9A 4I1OA 4CF3A 5TT1A 1S1CA 2DCUA 4IYJA 4FDTA 4I55B 3TRDA 3WA6A 2EHJA 2H11A 4HDAA 1PSWA 2QPAA 4OMUA 2AW3A 1G4AE 1FU8A 1HLFA 1RM4A 1ST3A 4EPWA 1UDWA 3DO8A 4EEKA 3WB0A 3IPAA 4EG7A 1B00A 3DDOA 4HI0E 1AOXA 3OZEA 4GSLA 1ULUA 3I64A 2AF4C 3GA0A 2WSSD 5FCDA 5LL6P 3FTDA 2ATXA 2JL1A 5GINE 2BFBB 3R7SA 4KXLA 3I6MA 3IQIX 1N36B 1JKJA 2JCBA 1QLJA 1IQ0A 4J1TC 3B7WA 4MUXA 1AIPA 1FEZA 1P74A 4N65A 3HDQA 1LDYA 1V6CA 4Z3OA 3RLFA 1TAGA 1TIPA 5AKHA 4IQFA 4DG5A 1TO6A 2WUWE 4BU0A 3HA5A 5H3LA 4XCXA 1OXBB 3L05A 1C4KA 4Z4FA 5A0TA 4DV6B 1PBNA 4EG6A 4OVKA 3LQ2A 3NWOA 1V47A 3TB6A 1XPJA 1IOZA 3UC9A 2DUJA 2PZGA 4OY3A 1N7HA 3O91A 1GGEA 3IOMA 1E6MA 4DOMA 3C5VA 2RI6A 4QICA 5E6UA 3EZYA 4KQHA 3NHSA 1DUVG 3F6EX 5C1DA 3GROA 1N6OA 1QYIA 4L15A 2G9NA 4EW2A 1P2TA 1SCUA 1C1XB 2IIPA 3CH7A 3WGKA 4PFSA 2QN6A 3CSSA 1UQRA 4OQEA 1CRLA 3PYLA 3QEJA 1T2AA 2CSXA 1HURA 2C7BA 3ZH9B 4J9VA 1LI5A 1YDEA 2ZSAA 3V00A 5T8KA 4B3HA 2FUG1 1T35A 4KACA 3PIDA 4H1UA 2HB6A 4MHOA 4F9GA 1CWUA 2HHCA 3GBPA 1YRHA 1G4HA 3PXUA 4P38A 2DLNA 1NXQA 1Y4ZA 4IZ6A 5AJTA 1KAQA 1FC0A 1OJLA 2H5LA 3KJZA 3M8KA 2OFFA 4F60A 3W5AA 5EP4A 4MB2A 1JYEA 1KETA 3ZWQA 4U7HA 1E1CB 2R7AA 1NNSA 3OZWA 5IEBA 2AN5A 2W2PA 1YNSA 1M2VB 4Y1FA 2BMWA 2IYZA 2WINI 3GFVA 4HKTA 1EGQA 1N5OX 4DUGD 1DCFA 3STUA 2VDNB 1V7ZA 1V0JA 2C4NA 5CA1B 1N32B 2CMKA 4ZI7A 2P2YA 3C3YA 1Q44A 1YT5A 1DAEA 2JBWA 3L6BA 2RI0A 5EWLB 2XDQA 2IU0A 2H18A 3E3LA 3EXHB 1U28C 3FCCA 4ID3A 4O63O 4P22A 5JMOA 1XVUA 3CZMA 1ZR4A 1E0JA 1GU1A 3N0RA 3NJ8A 3B6EA 2FZVA 4NJEA 3OURA 1YKGA 5T6MA 1EJ6A 4BFYA 3JQQA 1JAXA 1Z13A 4QXPA 1Z6QA 3UJHA 2IIVA 5JDCA 2BOVA 1IBMB 3M6VA 3WNZA 2NO0A 2APJA 2WF9A 1W5AA 2Y1GA 4JITA 5ICFA 2M6RA 1OYWA 2WABA 3KFXA 2W6IA 3ZI4A 2HUNA 2J7PA 2K4MA 3MMZA 4R8KA 4TRJA 4QHYA 3W6OA 5A3QA 4R8MA 3UC5A 3Q9SA 1D2MA 1KKLA 3AEKB 1HDRA 2CFTA 2JAOA 1YI0A 5M7EA 1W0KA 3VR6A 1ULHA 1JR4A 2CJWB 3FM9A 2FF7A 4O2AA 3C5EA 4ZHQB 2PSJA 2RE8A 4G67A 4X1OA 2OAP1 1Y1SA 1S3SA 3DCJA 1LY1A 2ZRJA 5CT6A 1Q3KA 2XF2A 4AWBA 5AXCA 4G1CA 3EC1A 3PIIA 3SIWA 4F92B 1TQ6A 4BQQA 1LV8A 1QX4A 2PSDA 3PQ3A 4WZAE 1U2PA 3RUHA 1CNFA 1USVA 1WPQA 1UANA 1GQ2A 3OT5A 1TIBA 5DSXA 1U8FO 1G0NA 2Y9PB 4L2IB 2OD9A 2PH5A 4RH1A 5LQSA 4JLVA 4K1LA 1Y9AA 1HFKA 4M55A 4TZKA 2IEZA 3UPTA 3FLMA 1H3NA 4W5JA 2W6ID 2WIJA 1KORA 2O8NA 4R1MA 5COBA 1FYDA 1E9BA 4AS2A 4LNHA 3C24A 4PEVA 2G3YA 3EMVA 5FBVB 5KC9A 3A6KA 4L76A 1TVKB 3EIOA 3CT4A 1FNDA 1ZUNA 3KKNA 1T0PA 4M83A 1X1BA 1VL1A 1L1EA 1R6XA 4JLWA 2IP1A 2QDKA 2MSWA 2V7TA 3QXXA 1BD4A 1YZVA 4KQJA 1F14A 4WCFA 3V1UA 5DEIA 1DRVA 1OX5A 1US8A 4M7OA 1E2GA 3DMFA 3ZR4B 4JLKA 4BU1A 2ISCA 3ZKAA 1YR3A 1RAAA 1Y8RB 2H54A 4KLAA 1IJKA 3V8QA 3ZV4A 2I7CA 4CCSA 4MQLA 4L8WB 1GNVA 2W98A 1U0JA 3R5FA 1WF3A 1C3JA 5DT9A 1AUVA 1N8TA 1W49A 4P3OA 1JW9B 4LSWA 4BNFA 2BGIA 3BZBA 4N0QA 2IDMA 2VJQA 4IUBS 5D6OA 2BMFA 5LDHA 3C48A 4DR5B 1WCIA 4LI3X 1ORIA 4YAUA 1VPVA 3FRJA 3DYVA 1TZJA 1KJIA 4MW6A 1PWXA 2PZJA 3JQBC 4BCCA 2POCA 3DDWA 1QIMA 4CF7A 1OH8A 3CRMA 4MXDA 1ISRA 3D59A 2XHEA 4QFMA 5JROA 4WKOA 2IVFA 2ONKA 3IEPA 2BM9A 3N0VA 3I0NA 3NBAA 1EFLA 1VLLA 1R8JA 2QRMA 2WOOA 1QR6A 1CJUC 3BC1A 1X0XA 1JIJA 2DPGA 4TMVA 5NULA 4HGZA 4B4OA 2F55A 4YYEA 1KOGA 3QUCA 4HTFB 4AG5A 3K1JA 4CODB 3KZXA 2B34A 2F3RA 1DHTA 2P4HX 4JOCA 4O6VA 1U2DC 1WS6A 4ZRNA 3LAWA 4OSEA 1CZOA 3AFOA 4UU7A 3KL2A 5ALNA 1EHCA 3OZTA 2UVPA 5CCDA 1KY2A 1OILA 3WKDA 1HYQA 2ZI7A 3IDQA 5CB4B 4YXWA 3NFYA 5HKBA 2JK1A 3PD1A 2ORWA 5D3KA 4TSFA 3MWDB 2MOKA 1GGVA 1S9DA 5IP5A 2PM8A 1QV7A 5JBIA 2I0FA 3WBJA 4RQBA 2ZIZA 2IGTA 4KGDA 1GPBA 2P9TA 4D45A 3H5AA 2GM5A 1Z37A 3MW8A 4TZTA 1CVLA 1T0UA 4CTOA 2R62A 3GLRA 3DPIA 2P69A 2CEAA 4KVFA 2IC5A 1U0OC 2IUYA 2VRCA 3E1SA 3IOCA 3A3KA 4YRJA 4WACA 2PQ0A 1LV7A 2WSSA 1ATIA 1R3DA 4L85A 1GEGA 4XX1A 1P80A 1WSAA 1UXGA 1WZCA 4IIVA 3COPA 1R27A 2HNKA 3EUAA 4G5GA 2QWXA 2ZSJA 4RJ2A 1ND6A 4WN3A 4ZOLB 2XB8A 3WRVA 1USKA 1RYBA 1FDTA 3GRAA 3HBFA 1RLMA 3JCZA 4Q4JB 1FFXA 5IJXA 3OTQA 3WRXC 4UMFA 2FVXA 5IC4A 1MH1A 3CKLA 3D1LA 4ILKA 3KUCA 4FFLA 4O29A 4RZUA 4Z4IA 2GEFA 2VXOA 2AUNA 3MWJA 2I87A 3QFSA 1M2KA 4KNWA 4QGBA 4FMDF 3VHQA 3BQ9A 4V3BA 4H3SA 4RKQA 4XWOA 1QQTA 1RWMA 3BOSA 1O58A 4DDHA 3MERA 4RTMA 1EZ1A 3B85A 1SQ5A 4E2XA 4ARAA 2DUUA 4P7FA 1PVDA 4W63A 1VKNA 2FU5C 3LO5A 4DB4A 4IDBA 4C4YA 3N0XA 5HF6A 3S2FA 1E3JA 4H7PA 1E58A 2V58A 3ZE8A 2G4VA 2QRZA 3ITEA 2JGNA 1UKYA 3QOYA 1O2DA 4N03A 3TIXB 3JQ9A 5BSHA 1U2GA 2DFLA 3NGMA 1Q2XA 3RV3A 3EZFA 2DQSA 3WDLA 4EG3A 5F7OA 4OXXA 3Q12A 5SY6A 3E6AA 3CN9A 1YZNA 3IQXA 3CC8A 2EL9A 4HBZA 4LK2A 4D3SA 3PXXA 3UHFA 1GV0A 1V3TA 1K7EB 2HDOA 1YBAA 2FPMA 1SFRA 3RGGA 1FDOA 4TRMA 2G08A 4RVNA 1S96A 3SU8A 4RBNA 2J3LA 3PCXA 3THWA 4LBVA 4R2MA 1M9NA 3IXLA 4D3FA 5LU8A 3JR3A 2BP7A 2WYHA 2LD4A 3W06A 5E2BA 1Q21A 1SG9A 2RC5A 4NS4A 1E7RA 1RAGA 1ZBDA 5G0SA 3I73A 5EIBD 4ZMBA 3EDYA 4BL5A 4GRIA 4YK7A 3P26A 2IEDA 2XKAA 1FFDA 1LVHA 4O2AF 5DP2A 5LQDA 1J1UA 1JYSA 3U7JA 2OCKA 1QS0B 4JEMA 4MINA 3A6FA 5KI6A 2HGZA 2FY8A 4FEYA 1DDIA 3FF1A 4V02A 2H8GA 2YJNA 1WG8A 1HT3A 3FPLA 1O95D 4RY8A 3P19A 1RI3A 4IJMA 1JSZA 5G4KB 4B3TB 4LRQA 1E3TA 5T3YA 3UT5B 3N70A 4YA6A 2J45A 3UPDA 4AY5A 1KEEB 1KGDA 1TO2E 1MEJA 3RPEA 5A1TA 3DEKA 1GPMA 2XBMA 4FZ3A 4WLNA 1CHNA 1XZLA 3W77A 1E2FA 4D8YA 4X41A 4F0JA 5HBGA 4Z4CA 4TTAA 3GH3A 3HCPA 4GI7A 4E03A 4RH3A 4BEVA 5KO2A 4ARIA 1XQWA 3EPKA 5J5VA 2AEMA 2IHKA 3B82A 1TCCA 1P45A 3N5KA 5BQXA 3UMYA 3H8VA 5EZYF 1FNSA 1VYUA 4Y9SA 2VUTA 1M1YA 1D2NA 1HOTA 2IOHA 3FZQA 1C7JA 2ZZMA 3OCJA 3IKJA 4Z7OB 4WEQA 5KYGA 2XOEA 2A0WA 3IXQA 2KX7A 3F3SA 4Z49A 1M8KA 1RHKA 4NG4A 5AVYA 1BDHA 4M1ZA 4PCLA 2XNDA 4GX5A 4D97A 4U5XA 3SJ7A 5HK8A 3SJZA 4DSAA 2GO1A 5BRJA 4N3GA 4CUKA 1W5BA 3QFCA 3TKAA 3L9WA 4MEAA 4XRGA 4YMLA 3SFTA 1PNTA 1WMDA 2B5VA 2OOSA 4MV6A 1CKEA 1H2EA 1PD1A 3EASA 2FLVA 4KO4S 2C9CA 2CJPA 2P9YA 4OGKA 3TMYA 4OCZA 5LD2C 4OHRA 1T5SA 3GRZA 5DNWA 2OD7A 1W0JD 1QPBA 1RQNA 4V0RA 4CUJA 4JYAB 4FGUA 5KYVA 1HT2E 4BIIA 3EVNA 2QHXA 1SG0A 2XJ4A 2YICA 3HXKA 4PIPA 3STTA 1M1ZA 1PLKA 4TKMA 4CNBA 2O8FA 2RHJA 3D6MA 5FEMA 4RA9B 4LJRA 1H05A 4D26A 1LBEA 2WUDA 4NLLA 3OQOA 4F2DA 1NUTA 3EIHA 4G63A 3L02A 4TOIA 4MR9A 1UWVA 2VJLA 5LZ8A 3IQZA 3H2GA 3I45A 4GMXA 1C7FA 2DQ4A 2UZ1A 3EBPA 3QVMA 4QYIA 2FOLA 5EZSA 4ARZA 2P5UA 2REBA 1UBTS 3UCXA 5KPDA 3SMVA 3WE7A 2G5CA 3AVVA 4JGIA 3H7AA 1LS6A 1SVWA 1RQGA 4NH4A 3HH8A 4IHJB 5KC8A 3PCTA 3IJRA 2LIVA 4TVSA 3HJRA 1IOVA 3GEEA 4UMEA 1TVMA 2XXAA 1COWD 1URPA 3HP1A 3IDOA 4ZI2A 2QLMA 4GSKA 4M86A 3UHPA 3TLMA 2ZJZA 4F7DA 4ZEVA 1ZM7A 1L8OA 1J99A 4QHTA 4US1R 1IXYA 2O2YA 5AD1A 1QE0A 4EI8A 3BFPA 2QK4A 4X1IB 5LZ4A 5BN3A 5IYZB 3L07A 1K27A 1YVDA 1KIAA 3E9DA 4JS0A 4Y2RA 5DHFA 3GHYA 1KK1A 2EKQA 1MX9A 1C30A 2PZAA 1NUPA 3D54D 2I7DA 3ZTWA 1DKOA 4C76A 1QDEA 4I1RA 4CF6A 2VHCA 3A6HA 1NN3A 2H4ZA 2VSQA 1X9GA 1CY7A 2OMKA 2BEVB 1MN6A 2ZRLA 1YH3A 1H0HA 2XMZA 5GM1A 2WV9A 1I3KA 1Z7YA 1YJ8A 5EA2A 4M0PA 4YV2A 4YCMA 3SPXA 4X65B 5K3FA 4NIMA 1EMDA 2F00A 1BVRA 5FPYA 4DSZA 3EXIA 2OAGA 2G06A 1BX1A 4HPWA 2GAAA 3RRXA 1VGRA 4AX8A 1D3AA 2AEEA 3UT6A 1NBHA 4GQIA 1QX3A 1DJLA 1G0OA 2H4FA 2JIBA 3P0EA 2XA9A 4AWXA 5DYWA 5DNCA 2ET6A 2H0RA 3A9SA 5AP9A 1RXUA 1SHUX 3HKDB 1NBEA 3ANMA 3C1UA 4KB5A 1POWA 1XF9A 2XQJA 3N6RA 3NHRA 4ZAYA 3VKVA 3W6NA 3SBXA 3V7NA 3ZOKA 3A6EA 2HLNA 2PANA 3EFBA 2B6NA 1P2VA 3HBJA 3IQGX 4GBMA 5I9MA 4MX8A 3S2ZA 5MGNA 4DR1B 3L04A 2JFYA 2C5LA 2XUKA 3EEOA 3UK7A 3R7FA 4DR4B 2WF5A 4BVBA 5D7NA 4BGUA 3DT8A 2ORYA 5K0SA 5HQTA 3FGPA 5BN4A 3ABZA 5ENDA 2EKDA 1AZTA 2VP5A 2ZQ5A 1SG6A 1VI6A 4BTEA 1RQLA 1XK7A 1A72A 1CP2A 1WM1A 2FQXA 3E35A 3ZZ0A 1XHFA 3OTOB 1FMLA 3KQTA 2NXEA 3OA2A 1DVRA 3JD0A 1LKZA 2P3LA 4JUCA 4AKTA 4ZYLA 4YO7A 5IYZA 1QO9A 2CKDA 4JVSB 3WWOA 4N4AA 1WMFA 3ZIAA 4ZREA 4TWJA 5KHOC 2IITA 1N1EA 5AI6A 3JRXA 3X1MA 3HCDA 4IV8A 3X1JA 3OBBA 4GBJA 5F2OA 4OJQA 1DFGA 3LZDA 4TGLA 4F56A 4A16A 1H2AS 3QX7A 4YQFA 5KTKA 1UK6A 3W6UA 4C0LA 5FA8A 4IHJA 3ELDA 1SBCA 1IONA 4CMBA 2ASVA 5IXSA 3AY0A 1D6JA 1GR1A 1KOJA 1VLVA 5BUZA 4Y2SA 1RI5A 3UAVA 4WTOA 1JMKC 2BR5A 3GJ4A 1NV9A 3PRJA 4BE7B 2NSDA 2WTBA 3KYBA 1XMOB 3UAZA 1ZISA 4AQDA 5FLEX 2ODQA 3IVXA 1R15A 3IQHX 1DFHA 3MMXA 2OG1A 4OG2A 4EARA 4B81A 4F3RA 1W29A 1U1FA 2ILVA 2Q99A 2QEQA 2ZRIA 3OETA 2AQIA 3ON5A 2H4JA 3JYNA 4UMDA 4BZQA 5FHRA 3E3NA 3HMKA 1FQJA 4D3XA 1QGAA 2CGEA 1XKQA 1DAMA 4N5HX 4NY1A 1M54A 3N0WA 1HG0A 4JYMA 4WFQA 4MVJE 2M6KA 5HKAA 2QAJA 2FK8A 2HT6A 3AP3A 3IUMA 3EPRA 4QODA 2ZTUA 2BHLA 1XKLA 1BCSB 2GK4A 2F3PA 3P2KA 1B2LA 3IAS1 5FBLB 1QHNA 1TK3A 1TD1A 3I8OA 3PVCA 4F38A 4DA6A 1ZKDA 4QU9A 3AESA 4N6GA 2HKIA 2PGOA 4OV6B 1AF4A 4KYIB 3CRZA 2NAPA 4QUHA 3OZDA 3RRYA 5L3SB 4CDRA 1QANA 4BV3A 1E1RA 1CNEA 2G1PA 3A6DA 4QARA 4XEUA 4CIWA 3I2HA 2AI3A 5AO9A 1G5TA 3L01A 4RCZA 3NFRA 4B5LA 2XGJA 5EESA 2PUBA 1EP1B 1JILA 2V03A 3ABQB 3KYIB 4BVFA 4EPRA 5JQGA 2WJGA 3CPEA 3FFXA 1DT5A 5D5QA 1JTFA 4ZEOA 4EHAA 4PZCA 1G5FA 2A4MA 1P4RA 2GPTA 4GXRA 1EUZA 3LQYA 2ZXFA 4EFDA 1I7SB 2QRUA 1XRMA 2NQTA 3MCTA 4GZ6A 2H4HA 1DIGA 1UZMA 2C2YA 3V2GA 4NEHB 2Q2VA 4OP2A 1QCYA 3QU4A 2A58A 3HP7A 2FE1A 2PRZA 5H5JA 2JI4A 3VV2A 4P7BA 3JQ8A 4EYEA 2PH7A 1KI6A 1I5OA 1KOLA 4E1AA 1FJGB 3GJTA 3WG9A 5GJCA 1BZYA 2HBZA 1V3QE 2FJ0A 5LCXA 1J07A 3L7KA 4TTSA 5D3MA 2HO5A 2Z56A 3JZDA 4IRUB 4KFTA 1FX1A 3JQEA 3DCIA 4FW9A 3ILYA 4QUBA 4I4TA 5DW3A 2JCVA 3C7DB 1KY5A 1RWOA 1T9GS 4OA8A 4ZRMA 5NLLA 3AUJB 4N3AA 2P2NA 4F97A 3VDQA 5EFOA 2BR4A 5A02A 5EE9A 3WQBA 2QTFA 1BA2A 1X1QA 3CRW1 3TSWA 4JLBA 1ADCA 2JBHA 2CUNA 5B30A 1J5EB 1C41A 4IZOA 4MJ7A 2CHFA 1KI6B 1U90A 1K8XB 4D0SA 5I7RA 3T5PA 4Q00A 5AVQA 1NUAA 4QUDA 2HREA 1SRRA 1EFRD 1ETHA 1WLSA 2BKXA 2WHYA 4RZIA 1HORA 4YB8A 2BAGA 2NUPB 3LVFO 4RLSA 2P4QA 5CW2A 3SFZA 3I9LA 3UKDA 3ZW9A 4Z99A 1ORHA 5B2ZA 2XUZA 4RACA 4BMXA 1NQOA 3EC7A 3TFQA 4HAIA 5JFTA 4X7RA 1OI4A 1NE2A 1U2TA 4NDNE 3WLRA 2NXWA 2GETA 5DMHA 3VGJA 1E0DA 3DB1A 4IGAA 4RMGA 4YRBA 2FSVA 3KPWA 1UJMA 1VLHA 3OY7A 1DAHA 1DAPA 1Y3HA 1Z2CA 2CMFA 4C0BA 1LFAA 3P8ZA 2PH3A 2IHUA 4YTEA 1TVCA 2EV9A 3MJFA 3N2GB 4K86A 2ES4A 5CH8A 4NCKA 1RQRA 3HJAA 4P4TA 1NP3A 2H1FA 3FH0A 4NMXB 1NW9B 4UFNA 1GPNA 3ESZA 3OHPA 3R3HA 5AI4A 3RRJA 1FFXB 4J03A 3GVXA 3URMA 4D4GA 2HDWA 1IHDA 2C84A 2QDXA 3S5JA 3QEOA 5DYYA 2QNBA 4C22A 5H4GA 1G4UR 3CJQA 3HU1A 4ZC1A 1H1LB 3U39A 3PD0A 5JCJA 4EJMA 5IHPA 2R8EA 5C1OA 5B5SA 4TT3A 5A5DA 4B3GA 1NLZA 2I7TA 3B20A 1T2VA 3L1KA 2YTZA 1BW9A 2CDRA 4YCBA 3QLEA 2C2HA 2B1JA 4FD2A 2F8SA 2WVGA 5FOSA 3WMRA 3ZGVA 1N6LA 4CLOA 2A78A 4FOLA 4D1YA 2EG9A 2G25A 1M2JA 2FW9A 2MR5A 3NNDA 4NYMR 4DMCA 4BZWA 1ZM4A 2CE7A 2QX8A 1GCIA 2H1SA 2RIPA 4EO9A 4ZI7F 1NJ2A 1OY1A 2L0XA 3EEBA 4MS3A 4TT3D 3B1XA 1BH6A 3QQ5A 2CNOA 3AHIA 3UOAB 4I3HA 4J9UE 4LJ9A 2I7XA 5GGYA 4JC0A 4QD3A 2D4HA 3CW9A 3D4LA 1OF1A 1Z22A 1OZFA 4WN9B 3SG0A 4N48A 1U0NA 1IEWA 1M0SA 5FHQA 3EDRA 2VPQA 4UM9B 3CUUA 3QEAZ 5ED0A 1ND5A 4AP9A 3ZQ6A 4JUDX 5H70A 3P0FA 3HU3A 3ROEA 2BUAA 4M37A 4MB6A 4ZQFA 4Q48A 3CLSC 4BAZA 1ODTC 3DEFA 2WKQA 5JDCC 3DE6X 1OLXA 2PGAA 3E70C 1UBRS 2DKFA 1FP6A 4XCVA 3G1UA 3ZD7A 2XBUA 1NQAO 3IPRA 3UA4A 6CHYA 3C8ZA 5SYNA 4REQA 2A33A 4LV5B 1G5QA 1GFIA 2DHEA 2HU5A 2YQZA 3QPDA 4LX8A 3KOOA 3AT1A 4HGRA 4R5MA 4Y7CA 3D81A 3WJ7A 4KR2A 4NOMA 3YASA 3RRFA 4ASUA 1W30A 4WLVA 4DG9A 2MINA 1YRWA 2ZSFA 1ISFA 1LBTA 2VWGA 3I58A 3L0ZA 1JE0A 2C78A 4H7JA 3DHYA 1GPYA 2XQVA 1TCBA 3TMAA 2WWFA 3WJ2A 5B36A 1PYDA 2CVQA 2TMDA 1ZLXA 3LP8A 4JC5A 3MT0A 4ZYWA 5IKEA 4PLTA 3HY6A 3U4HA 2YINC 1SUFA 1U80A 1EIZA 1D1SA 2ZBDA 1G5PA 1PNVA 3WYBA 4TSKA 5LB4A 3T4PA 3L7IA 3HP4A 4B5KA 2H16A 1RXIA 1MV5A 4W5HA 4CR6A 1YVUA 4IVQA 2BRUA 1Z7BA 1L5MA 3GDHA 2XLCA 3HCFA 3N5CA 3KUKA 3HJBA 4E5MA 5K20A 1E96A 2WU4A 4G2NA 1USGA 4JROA 3PF9A 3WLHA 3PPVA 4RHFA 3ZV6A 1MHTA 3W6PA 3OAAD 1TMKA 1A8QA 3I01A 3OQVA 4J6EA 4GL4A 4UEOA 3T7CA 3USES 3PEFA 1AGYA 4RESA 4BO7A 2OGZA 4OAQA 4GH5A 2XUHA 1SVSA 4Y2QA 3G2MA 4IAOA 2BHRA 3OFJA 1DKMA 4DA7A 1ZW6A 2VTEA 3T9AA 3QVWA 1XTTA 2O2JA 3RS8A 3KQNA 1QOPB 2I1VB 4JL8A 4MQEB 4PXSA 3OESA 4BFZA 1ZA1A 3DB2A 1ODLA 5EJMA 1IVSA 3TVYA 1L0BA 1QFZA 2QTAA 4JBGA 2HSZA 3TPFA 4YJGA 3MAJA 4U7GA 5ADHA 4FFNA 2W00A 3B1VA 3CLRC 4PIMA 4TKVA 4BNKA 1WULS 3I4CA 4LJYA 5LVAA 4LHXA 4DVGA 1OX4A 1X87A 4JC4A 2W70A 4X6YA 1LSSA 1NHGA 2X8BA 2W43A 1J20A 1Q1NA 2WIGA 3EG5A 3JVDA 3NGLA 4GC9A 2GZRA 4MUMA 4NYMQ 5HTKA 3W8NA 4V0LA 3WRYC 3O8NA 5JUWA 4KNYA 2FI1A 3GOQA 2FWRA 2WTEA 1OU0A 5DBEX 2AYZA 3LLCA 2YKGA 1YB4A 4RE5A 2IQ5A 5CFLA 2ZTMA 3K0FB 4H7EA 2GEKA 3SR4A 4M76B 2XD4A 4BC0A 1FYVA 1Z35A 4JJZA 3RRNA 3V7UA 2YVQA 3K31A 2UZ1B 4NAHA 1U11A 3LE8A 4NYJQ 2PS0A 1W4ZA 1I3LA 5AI8A 4Z9YA 4PG6A 4CM7A 2CJWA 4O2AB 2RGAA 3ZV7A 2H2HA 3TNJA 1Z4JA 1L4BA 4RA9A 4M0KA 4Y1GA 2VDLB 3D64A 4ISCA 2CXSA 1MQ8B 3E1GA 1TZ2A 5IT5A 4ADSG 3QLTA 3PQCA 3E18A 3L1UA 3AJRA 3V1MA 4HBGA 5DIFA 3A2KA 5L3QA 2D1FA 2OKCA 4MUJA 5E4JA 3OUTA 2XUDA 1UOOA 3A36A 1QBGA 4GI5A 4NCIA 3LCCA 4FGJA 2QLNA 2QZ4A 3JV7A 1NXXA 4WLUA 1DNPA 2EJCA 4TKZA 1E94E 4F9TA 3SS8A 5JAMA 1L4NA 4FDLA 1JWLA 1FPQA 1VRVA 4OJTA 4Y7DA 4JLDA 1KARA 1PR5A 1VE9A 2RGBA 4O1IA 5DWVA 1KH3A 1RMQA 1DBIA 4ZKEA 5EHQA 3F6CA 4BMPB 5JNWA 3M9LA 3P2EA 4MPPA 2C3PA 4ODIA 3OWOA 5KMGB 4ZT6A 2W7TA 5ELLA 5K99A 4P2BA 3PUJA 5EKTA 3PI7A 3T34A 1XCJA 5EYPB 5CU7A 1CE8A 2QW0X 1DUSA 2ZKIA 2VATA 4EAAA 3GBSA 4DMGA 1E18A 3FI9A 3IQEA 3SIPA 2P0EA 1Z38A 5G0UA 3EZLA 3N6XA 1SHKA 4QDUA 1U9IA 4PSDA 1PFWA 1EWVA 1QOZA 1A2QA 1DOZA 1RT9A 3N8GA 4NCHA 3E61A 1MJNA 3LC2O 4BGIA 2NO9A 3G0GA 4JOSA 3WIUA 1KEEA 1RADA 1LNZA 3TBFA 1IZ7A 2DM6A 2B8NA 3ELUA 2HD4A 4EF6A 4Z7NB 4HWSA 4BGDA 1WCXA 3DWGA 4O3MA 3LUCA 3GMSA 1KYZA 4Y6PA 1L5WA 4QM6A 4RQUA 2NV2B 1FTYA 1NN0A 4TYWA 3ZE0B 3EGDB 1OCEA 1RZ3A 3E8MA 2HHLA 5C46F 3VVMA 5CB4F 4L3VA 2IHNA 1TA4A 4FMBB 4IIYA 5CIWA 1R0WA 2EZUA 2CEKA 3NPMA 4RELA 3AW8A 1FL9A 3SJUA 3RYCA<