1VJRA

Crystal structure of 4-nitrophenylphosphatase (tm1742) from thermotoga maritima at 2.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
261
Chain Sequence
HHVLDKIELFILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLRNMGVDVPDDAVVTSGEITAEHMLKRFGRCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYERLKKACILLRKGKFYIATHPDINCPSKEGPVPDAGSIMAAIEASTGRKPDLIAGKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVKLGKNAGIVSILVLTGETTPEDLERAETKPDFVFKNLGELAKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-nitrophenylphosphatase
publication title Crystal structure of 4-nitrophenylphosphatase (TM1742) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 93
structure length 261
sequence length 261
ec nomenclature ec 3.1.3.41: 4-nitrophenylphosphatase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA02
2P9JA 2HSZA 5ALHA 2NYVA 4HGQA 3PCTA 2ZBEA 5AVZA 2C88A 4EX7A 3ET5A 2JGAA 3I28A 2ZBDA 2RARA 1Z4JA 5AESA 3SF0A 4YCLA 5IS2A 1QH9A 5ALSA 4RETA 4MWOA 5AK4A 2FPSA 2C8KA 4HGRA 3ESQA 3IJ5A 4Y2XA 4G63A 1LVHA 2JAUA 4UU0A 3SKXA 2FEAA 3ONNA 1U2SA 2YMPA 3N1UA 4UMEA 2HEGA 1ZJJA 2YJ3A 4KNVA 4F71A 2HO4A 2ZBGA 1ZOLA 3A3YA 3R9KA 1ZD5A 3BWVA 5FP0A 2G80A 2FI1A 3QUQA 3E58A 4MUMA 3OCYA 3ET4A 2CFTA 3WK9A 2IOFA 5AM2A 2GHTA 4C4RA 5AM3A 3AR2A 3DV9A 4J2TA 4JB3A 3L0CA 5ALWA 3QX7A 3L0YA 1PW5A 1O03A 2YMMA 1RMYA 4EEKA 3B8EA 5AK6A 4BEVA 4EELA 5AW2A 2YMLA 3L8EA 2GO7A 1RDFA 5ALNA 3ZTWA 3TLMA 3EPRA 4YGYA 3E81A 5AI6A 3ZX5A 5AVSA 2ZOSA 2IYEA 5AW1A 3QGMA 5AK3A 2CN1A 4BKMA 1RLOA 2R8YA 3E84A 3WKEA 2I34A 2JAWA 1IWOA 3MPOA 4PNHA 2G06A 3M9LA 1ZD4A 2FDRA 3ZVLA 2YJ5A 4CF5A 2YJ6A 4AP9A 5ALDA 2B0CA 4BX0A 3CNHA 2JARA 5AI9A 4XOUA 1XVIA 3RFUA 1TJ5A 4OFZA 1O08A 1X42A 3WKBA 4UATA 5E0OA 2NO4A 3QYPA 5AM1A 3E8MA 3KD3A 5AW9A 5AKJA 1Q92A 2OM6A 1WZCA 1Z4NA 5AVVA 2ZBFA 3L7YA 3R09A 1Z4OA 5AKIA 1QQ6A 4UM7A 4Y2PA 5IT4A 4FYPA 2YFYA 1YS9A 5ALGA 5ALTA 3ZWKA 1Z5UA 1Z4QA 1RC8A 3OTQA 3WKCA 2I55A 5IT0A 3AR5A 2D2VA 5JJBA 4C4SA 2B82A 4BEWA 4QQFA 4XQ0A 2HOQA 4FE3A 5ALZA 4DFDA 4XE5A 2GMWA 5AVYA 5AI0A 4YCNA 3QUBA 2CFRA 3SLRA 1T5TA 2QLTA 5AKYA 3BA6A 1TJ3A 1QYIA 2W43A 5AM5A 2YJ4A 1K1EA 1U7PA 1ZRMA 3A1EA 1SU4A 3SMVA 5ALKA 1L7PA 1Z88A 3DNPA 2VKQA 4KX5A 4I9GA 1WR8A 1YDFA 2PKEA 5AKGA 2B1RA 4GXTA 2WF8A 3OCZA 1CR6A 2C8LA 3FPBA 4Y2VA 5AI5A 5ALPA 4UMFA 2OBBA 2WF7A 1RQLA 2R8EA 1CQZA 2DQSA 3NALA 1ZD3A 3AR3A 4I9FA 3U7GA 2G09A 3U7EB 3SD7A 3QU7A 3QNMA 3FZQA 1J8DA 3FGOA 3UMGA 1L7OA 1MH9A 3QU4A 4BBJA 4BX2A 2I6XA 2EAUA 3U7HB 1VFPA 3R4CA 3WKAA 4Y2YA 5A3SA 3ZI4A 3ZTYA 4EX6A 3NAMA 3L1VA 1SWWA 3SKYA 3GYGA 2HF2A 3U7FB 3OPXA 2Q5EA 2ZXEA 3N5KA 4JDPA 3ZW7A 4UM5A 3AR6A 3OCUA 4DW8A 4YCMA 3ZVMA 1T9ZA 4HAIA 5AKHA 5ALOA 3HYCA 1TJ4A 5AW8A 5AVWA 1L8OA 2P69A 4OD0A 1VJRA 2P27A 3B9RA 1FEZA 4CNQA 1EK1A 4B6JA 1Z4LA 2YY6A 2RB5A 3U26A 3QU2A 3F9RA 1U7OA 4Y2SA 5ALMA 1RMQA 3K1ZA 2FPWA 3I1YA 3NUQA 1RQNA 2WF5A 3L1UA 2G08A 3DAOA 3KOOA 5ALYA 2BDEA 4NFLA 1TA0A 1QQ7A 3FM9A 3ZWDA 2PR7A 3KZXA 1YMQA 5AKKA 4EZEA 4UAUA 2FUCA 1L8LA 3UM9A 5ALXA 4BNDA 4DCCA 1Z4IA 3I76A 5AW5A 4L6AA 1L7NA 1Z4PX 4NV0A 4UW9A 2G1AA 3WKDA 1U02A 3N07A 3MMZA 4OCZA 1F5SA 3OCVA 3WK4A 1SWVA 2C4NA 2B30A 2I33A 2PQ0A 2Q4TA 5AVTA 2AUTA 2RBKA 5AVRA 4KX3A 3W5BA 5AVUA 3AR4A 3WGUA 4CF3A 1ZS9A 5AVXA 3QUCA 3A1CA 4YIKA 3ED5A 2WF9A 1L7MA 5AHXA 1RPZA 4CE6A 2MU1A 2AH5A 3L8HA 2WFAA 1RLMA 3KBBA 5ALQA 2GFHA 3L8FA 3VAYA 2AGVA 2FPUA 1YNSA 2AMYA 2B1QA 5AKLA 2BDUA 3OCWA 3D6JA 3W5CA 1KYTA 5AKZA 1EK2A 3WK7A 1T5SA 5AW0A 4UU1A 4BYGA 1LTQA 2B8JA 3OCXA 2FPRA 3U13A 3EF0A 4UAVA 3EWIA 3M1YA 4KN8A 4C4TA 4HGNA 1ZD2P 1XP5A 3QUTA 4AS2A 1L6RA 3QU9A 5ALUA 3AR9A 1Q91A 2R8ZA 3P96A 2MSNA 3W5DA 1RKVA 4IFTA 3L5KA 2IOHA 4F72A 4UMVA 5AI4A 2NO5A 3UMCA 3ZU6A 2FUEA 5ALFA 4NWIA 3PDWA 5ALIA 1VJ5A 3A1DA 3AR7A 3QXGA 2G0AA 1NF2A 4G9BA 2I7DA 1WVIA 3N8GA 2HI0A 3MC1A 2IA5A 5ALJA 1N9KA 3ZVNA 2HCFA 2FPXA 4HYTA 2X4DA 3FVVA 4IG4A 1J97A 3L8GA 2W11A 2W4MA 2OA0A 2GHQA 4HGPA 2HDOA 1Y8AA 5AKEA 2G07A 4Y2JA 2B8EA 4HGOA 5A3RA 3WK5A 3ZX4A 1Z4MA 4EENA 3QLEA 4Y2RA 2R8XA 2YBDA 5T41A 3WK8A 1ZRNA 3WGVA 5AM0A 5AM4A 1S2OA 4BNDB 4UASA 3N28A 4OHFA 2C9MA 1Z4KA 3FPSA 4YIHA 2O2XA 1RMTA 4BX3A 4E88A 2HHLA 1JUDA 2ZG6A 5AW3A 3I6BA 3CZ4A 4RESA 3S6JA 3UMBA 4CF4A 3AR8A 5ALEA 5AVQA 5AW6A 2WHEA 4ZEVA 2I54A 2YMQA 2JAOA 4J03A 3ESRA 4NAVA 4L57A 4KNWA 3KDPA 2EATA 4Y2QA 5ALRA 3NASA 4Y2UA 2CFSA 3KC2A 2Q4RA 5AI8A 3QU5A 3NRJA 4FFDA 5ALVA 4AS3A 2IOFK 3NIWA 4Y3UA 1YJ5A 3EF1A 3PGLA 1RRCA 1WPGA 3L0BA 4Y2TA 4L6CA 4KYTA 2WM8A 3U19A 3ZUPA 1NNLA 5AW4A 2WF6A 1U2TA 2BY4A 1QQ5A 2EARA 3MN1A 1AQ6A 1TE2A 5AK5A 1N8NA 1RKQA 3NANA 3WK6A 1YV9A 5ALLA 5AKXA 4DWOA 2QYHA 4UARA 4GIBA 1XPJA 5AICA 2YN4A 4QJBA 2HF7A 4UMDA 4XPZA 5AIAA 1RLTA 3IB6A 1RKUA 3RF6A 3SHQA 3HLTA 2ODAA 4ZEWA 2O9JA 3DDHA 1S8OA 3IRUA 4NABA 1NRWA 3B9BA 4YH1A 5A3QA 1Z5GA 2P11A 2RAVA 3PGVA 5AIBA 4O8CA 2OYCA 3W5AA 3J7TA 4H1WA 2HX1A 5AW7A 4ZEXA
chains in the Genus database with same CATH superfamily
2REQB 5JISA 2F64A 5GGXA 2PGLA 2ECFA 2BT4A 3G82C 2AXEA 3O6VA 5HJ2A 3K0CC 4BJ3A 1Q83A 1YS6A 2ZYDA 4O2BF 5KYWA 5LXTF 2X2PA 2DWUA 2X86A 3GLRA 4UHDA 1TQHA 3SEQA 4B6EA 2JNWA 3Q12A 2VDJA 4TMTA 1W8IA 4X1KA 3FUWA 1W85A 4XB1A 5T4FA 3B1ZA 3P9ZA 1C41A 1YQGA 3U1BA 2LE0A 1U9IA 4PF1A 4AJPA 5A7HA 5TMEA 5LZ2A 4GMKA 1TTHA 1RM3A 1CZUA 4M87A 2O2EA 4R41A 2Z1DA 5ED4A 2Z98A 2EBFX 4RETA 4FB5A 2F4VB 5A9RA 1VLZA 1P3DA 3O8BA 2I1LA 1B42A 2AG1A 2VZLA 5IF3A 1KQOA 1C9EA 3HL0A 3UXYA 5ER6A 4YUXA 1NY5A 3ZKAA 3KSMA 4EHIA 1LBTA 3PGKA 1U2SA 5JVDB 1F2UB 2EKZA 2YMPA 2AJCA 1N4DA 2D2FA 3HBFA 3LO8A 1V11A 3MCUA 3P32A 4PYQA 4DGQA 3DVRX 5IJWA 3QLUA 3BWYA 5K0LA 5HKKA 3GJSA 4GSYA 1R74A 1AG9A 3GPIA 2IZOA 2P2ZA 1UDWA 3I04A 1MENA 3A3YA 3ZZTA 2BJWA 3R9KA 4HBGA 4FYXA 1PFGA 4A03A 1WDWB 1OGJA 2K6GA 4P3PA 2DUUA 1IAQA 2R6AA 1RWMA 1P80A 1VMEA 2HA0A 3P0EA 4YT2A 3D54D 3TDMA 1LKZA 1U0TA 3V7NA 1YHYA 4FNMA 1CJTC 1II0A 3HSSA 3MNFA 2R00C 1JLSA 3NHBA 4E4YA 5JXHA 1Q50A 3O93A 3LQ1A 4NYMR 3LUKA 1I14A 4ZPXA 3GJYA 4Y6PA 4B8YA 1JHPA 4BJ6A 5AM3A 5LMCA 1T3HA 4IIHA 1EUZA 3AB7A 2OBFA 3I6QA 4X6XA 3E9ZA 4K05A 1RWOA 2ECKA 5KOYA 3DFMA 3D5QA 3K6RA 2FUNB 3W8EA 1BE0A 3A32A 4GR4A 2J5QA 3ROQA 1TGYA 2Q1YA 1T36A 4GR5A 5DCUA 2Y0EA 1NJ8A 2AWOA 4G84A 5J4KA 1JYFA 3OU2A 1FIUA 4YRBA 5JAPA 1XTPA 2Q0QA 4YJGA 1URPA 2F1JA 1DKPA 3KLNA 3R75A 3WSVA 4KLNA 5AVSA 4P3XA 1CUAA 4BFYA 1UWCA 5J5VA 5C8DA 5AW1A 2OBXA 5JZSA 3ZD7A 4DWJA 1Z18A 3SDBA 1EGQA 2CN1A 1RLOA 1V0JA 4HYYA 5YASA 4DNFA 3DFUA 5K3OA 5HCNA 1RKBA 5C2JB 1LBHA 2GT1A 3CLRD 3PC4A 2QSZA 1LWNA 2KE5A 1UMCB 5JEDA 3TGLA 2YXLA 3ZVLA 2ZT8A 4PPYA 3JWHA 4Y8VA 4JI6B 1EP1B 6PFKA 3RVQA 1RRGA 1ZM2A 4B5LA 2ZRKA 2CMGA 1G19A 2RGNC 3RG8A 4W5JA 2LRHA 4ZRMA 4DIUA 1QVZA 4QIHA 4IFIA 3L2OB 5T4EA 4L72A 3ZIUA 1IHYA 2NUAA 8ATCA 5K8CA 4IO1A 1XVIA 1BXGB 2BGJA 4WOJA 3T9FA 3EPHA 4PX9A 1D3AA 4B8WA 3C15C 1SBCA 4X63A 4E6EA 1T9GS 2XQIA 4HLUC 3FDIA 1ECFA 2QOEA 3FRJA 3OUZA 1JNYA 4JOSA 5EMMA 5C5CA 4YRAA 3C3EA 1Y5NA 4ZVRA 1WAMA 1IZ9A 1TIPA 3FWPA 1JHUA 3BSSA 5K8TA 2Q3HA 1EX1A 1KEUA 3BFJA 3SNKA 4Q7KA 1KMIY 3A6PC 1O9HA 4H7HA 1KJNA 3WGZA 4EITA 3O9VA 3A4VA 1X7DA 4NFHA 2D7DA 1UPCA 2YWCA 3KELA 1P2FA 2FX5A 1QONA 1YGYA 3F7MA 4Q05A 3ZUGA 4CKCA 1VI2A 4OVKA 4GMFA 1NR5A 1R5BA 2IXTA 3AG5A 3K8QA 4HUQB 3LV8A 1ECGA 4MTLA 1G21B 4WNAB 4HQRA 5JNRA 2LTAA 5G4KB 2F9MA 1BRTA 3HA2A 3AR5A 3ESZA 1ZD9A 1KL7A 4H6VA 1NQTA 3TQQA 2HF9A 3A4YA 5L8VA 3TM5A 4X6UA 2AV6A 1KZGB 4OYYA 1EFTA 1Y4DE 2HOQA 1WMFA 2HQSA 3UG6A 4Q7QA 2CNBA 1W73A 2V6MA 3BDAA 3UQYS 4OAOA 3IVRA 3O8QB 1KU6A 1WM1A 2AUMA 4MJ3A 1PK9A 4HLNA 2CFRA 4DXDA 4TT3D 2ZJYA 3SYMA 2QTLA 4ZANA 4UBIA 3ZNOA 3CKLA 2J0SA 2D6FA 4OA5A 1W29A 2D62A 2Q45A 4DV1B 1G8HA 1L4EA 3OEEA 1YB1A 2VP3A 1L1FA 2ODPA 3UWMA 4PAOA 4JT4A 1J0CA 2PL5A 2J9FB 1KE2A 2BCGY 1O94C 2O48X 3KLBA 4EDFA 1KR5A 3FG9A 4CCWA 2O1WA 4WFJA 1FTNA 1IE3A 2HPVA 4PQFA 4R9VA 1YRLA 5FH9A 2ZVDA 2O4UX 3FE2A 1R10A 3INTA 4HTFA 2Q5QA 4AYXA 2AK2A 2J41A 3FPBA 5FTJA 3SX0A 2D59A 1KARA 1XTBA 4BVKA 5CFLA 1WU7A 1W34A 1YZ3A 1PFYA 1ADYA 4UXHA 2R8EA 3ZK7A 1CQZA 4MMZB 5A1TA 3AR3A 4Y9SA 5ELXA 3U7EB 2EHDA 4ZOLB 4TKVB 2SICE 1WVMA 1NV8A 4RADA 1E2UA 3QHQA 2J3HA 4J0QA 2UZIR 3RSOA 5J1TB 1P60A 3F8SA 4WZBE 5E2IA 1EE1A 1L7OA 4LXXA 3NT2A 3MJVA 3QU4A 4ZOQI 1QFXA 2HRBA 3RTDA 3IMKA 2H0QA 3NBFA 5JJCA 3AI2A 2Q3EA 2JLRA 2J9XB 4GNRA 5E8JA 2CUTA 3HWWA 4IZIA 4LCBA 4LJ9A 4Q4HB 2J07A 1PTJA 1C30A 2J3LA 3TLBA 1K9SA 2WYOA 2FFRA 1KP9A 1OREA 1PDWA 2R68A 4J7UA 3N5CA 2XVAA 1HTBA 3IAEA 4MDYA 4TMVA 1L1EA 5HX7A 5JPCA 9GPBA 1U28A 3B6EA 3U7FB 1BC5A 3LNTA 3CUUA 3P2KA 1QHIA 4WZ6A 3SQNA 5IEJA 2ZXEA 1WZIA 4XCXA 1GTSA 3W2IA 4OK3A 3MA0A 4IHJF 4ZEMA 2Z5VA 3D7RA 4GRDA 1RAEA 5IABA 2XUPA 3GIDA 3VH3A 3FWZA 2IYYA 4RZIA 4MX8A 3B6MA 1G3RA 1NW7A 1P72A 3AJRA 1A95A 2GESA 1DUVG 3DBVO 4RVUA 4UVHA 2IZ7A 3TSZA 1FEZA 1XVAA 4F1WA 5CR9A 4ACBA 4BV3A 3IODA 3GU3A 3UHJA 3W8RA 3WYGA 1Z4LA 4OFBA 4MW6A 2X6QA 3U09A 1SBZA 4QEKA 2OO7A 3VC3A 4JYPA 1H93A 1RMQA 3HJFA 2QAIA 3N0RA 4HQFA 4A9AA 1ML3A 3IAM6 5F73A 1JQAA 4B0PA 5HZGA 1FF9A 4BNJA 5A04A 4QXMA 5DNUA 4G5RA 2AK3A 2F8LA 3A6LA 3E9DA 3NVAA 3JAWA 3PXBA 4G5SA 3QEKA 4YRJA 2PNJA 3LPDA 5ESXA 2JIZD 5EJ7A 1NW4A 3EDOA 1QQ7A 1WKBA 1XYVA 1I1QB 1LNQA 3OKCA 3DMHA 4I6JA 4PRLA 4JJ6A 2VRCA 1N33B 3K31A 2J7KA 1ODFA 1Y4ZA 4Y67A 4EZEA 2X40A 2XVXA 2ZTLA 1FVFA 4NCNA 1TQ8A 2QMZA 2B9EA 1Y9JA 1YU9A 4OOEA 1A9ZA 1CR0A 4W6QA 3QBDA 3I09A 4P32A 4DCCA 1WUTA 5FWNA 3OM1A 1ZN7A 5A05A 1D8AA 4CDGA 1A27A 2R6JA 3BTUA 3ETDA 3IVMA 3U3XA 4YO8A 3PNQA 4NOKA 3MTQA 1RABA 1JIQA 3OJWA 5IULC 2BYTA 3KZ1E 4BFLA 3R3YA 1N2JA 4Y9RA 1U3TA 4V0NA 3ROKA 1O54A 2OESA 4YXWD 4AULA 4D97A 2NOAA 3NKFA 5HPYB 1E63A 1O87A 1P4HA 1WO8A 5LD2C 4FFNA 4QOFA 2R7AA 1C1DA 1KIMA 1J7JA 3OE7A 2PZLA 3BSFA 4NAHA 4KOEC 3ULKA 3DOJA 3IAHA 2QV0A 3NC1C 4WY2A 2HRZA 4NCBA 1BCSB 1JJBA 1Z7YA 4MS1A 4YBZA 5SZKB 1SUFA 1FQJA 3DF9A 4IKEA 1JQJC 2XBLA 3Q7RA 2DGDA 2BM8A 1RBZA 5A4KA 2IXDA 3EYAA 4BVJA 2HYIC 1DB3A 3MCVA 1TO1E 4RLSA 3D6JA 1BJRE 1CR1A 4PRZA 4DC9A 5C5EA 4N54A 1GZ6A 2O3TA 3PENA 5TPZD 3DVAA 4EABA 4N12A 4IIUA 1GKIA 1YIAA 4O02B 4ZCPA 3V4RA 5KJ1A 4N8EA 5EI5A 5HS4A 3ZZNA 1DC5A 2ZREA 4OJQA 1I6KA 1L4UA 4HQLA 4YBRA 1O9GA 4EPYA 1ISFA 2PKQP 2VAMA 5TS2A 2J6IA 1JA0A 3QOWA 1MOZA 4HZUB 4QAQA 2O05A 3FHLA 2WNIA 3FBGA 3IIKA 1Z36A 4Z4FA 2X77A 2BI7A 4Z3KA 3H11B 5D6OA 1WQ1R 4GC9A 1YRBA 3AR9A 2Z4TA 4D5EA 1WUJS 3RIHA 2MSNA 1C7EA 3C70A 1UXOA 5TPWB 2CMKA 2XNCA 1S1CA 5LCXA 3TOZA 2XODA 3W9BA 2VC2B 1USIA 4P0TA 2N1MA 4DLTA 4KHPB 3Q5GA 1G4HA 4BFWA 1FBNA 1S2IA 2CUNA 2R66A 4X94A 2JI7A 2PMWB 4OA8A 4RTNA 3R0JA 3QI2A 3AVTA 4E51A 4EA9A 3Q2KA 1ORRA 4XCVA 3U62A 3A1DA 3WYNA 2R48A 1JPJA 3BWCA 2QZZA 3CX4A 4WKPA 1J4AA 5EYPB 1MU0A 1O96A 3GA0A 3MTBA 4YUVA 3ER9A 4MPJA 4UHEA 3NTXA 2IYZA 3CH5A 3LCUA 2GAAA 3F6PA 3G1UA 4C4TA 4IDPA 3DOHA 2BFBB 3I6YA 4W1PA 3B13B 3OURA 3L05A 5F64A 3RWMB 3F78A 3WGOA 1PK8A 4H17A 1RWQA 1V71A 1DO8A 1NT2A 1U2DC 1Z73A 4FGUA 4IQ0A 4L5BA 4PSDA 4DG8A 3IEKA 3LDHA 4CKBB 2JLZA 2ZATA 5GV7A 2AEEA 4DLAA 2BHNA 1JFSA 1K66A 4QRDA 3O8DA 3LPNA 4X1OA 1WX1A 3FYSA 1FW8A 2QQFA 3L8GA 1QHYA 1WW8A 4NCHA 1CY6A 4M37A 3WYCA 5IWAB 1FTSA 2HWKA 2QU8A 5HF8A 3WAGA 4DDKA 1NAHA 3QNWA 3WI7A 1YA8A 1OQAA 1PQWA 1RRFA 3AL3A 3GUVA 3NEPX 3QOYA 5D3ZA 1W0KA 2ODEA 2M9MA 3ZHXA 1TL7C 5BYAA 4FFBB 3RR2A 4J1TC 3T9BA 1X2BA 1T4BA 2RCNA 1NVXQ 1BSVA 3U56A 2QMOA 1IBKB 4M6WB 4YRIA 4NU0A 2XUIA 1XVTA 2G8NA 5KQGA 3BYZA 5IZCC 4GVLA 2NXCA 5E6UB 4ZC8A 1MABB 3TS1A 3AUSA 5CITA 3IR6A 1IOWA 1O94D 2Q5IA 3N2GA 3BZBA 2JCGA 4M9CA 5CMLA 5BW6B 1UKBA 4D9CA 2GB4A 4QU8A 4PQEA 1BH6A 2O2CA 2IV3A 5T8KC 3LX6A 1K89A 3FTNA 2AQ8A 1QTIA 4RESA 1XTSA 4NP6A 4D44A 4J3JA 5ALEA 5A4IS 2RC5A 1EXMA 2O3JA 2W6JA 4PG8A 3B6IA 3SIRA 5LZ9A 2GM3A 2DFNA 1GQSA 2HJWA 1I4TD 1X38A 4DQUA 1V7QA 5JS7A 3BC1A 4D82A 5FNVA 1PDVA 1NLFA 3ACDA 4J4TA 4GC5A 4JOBA 5LP6C 2FG6C 4XIJA 1EJ2A 2CFSA 3UXEA 1VHTA 4O25A 4Q7EA 1LDMA 5CDFA 2C2ZA 3H9GA 3MBKA 2R1VB 3CE6A 3UPDA 3MWJA 4TV9B 3T3HA 4WGFA 3DZFA 4ICIA 2HRDA 4ADSG 5LKAA 2ILVA 2WVHA 5LP1A 1WPGA 3HJGA 1VGQA 2OC9A 4S1PA 4KYTA 4LA4A 2WF6A 3C5CA 3ANTA 3I39X 4BBZA 1I6LA 1QFSA 2RH5A 4WZZA 1ZGBA 2P7HA 5AK5A 4DA8A 4DUGD 1YV9A 2ODQA 3VU8A 1GU1A 1YIOA 2VYQA 2AXPA 3OTIA 4KO3S 4OAQA 2IUUA 4ESOA 1JMVA 3IHWA 3KCNA 5A62A 5GQSA 2HF7A 5IJ9B 1LB1B 2RSLA 3DP9A 4BUZA 1ZJ5A 3EG9B 4RBNA 2YFHA 1ZK4A 2J0UA 2AE2A 2V7XA 5GY7A 2VBFA 1NM5C 3G5AA 4PCVA 3LWNA 2ZR0A 3P5BA 1FRFS 1DQZA 3O8NA 3QTBA 5EKTA 3FDZA 4F6CA 1HV8A 2O2IA 3IRUA 2QN9A 5ANRB 1H05A 3O9ZA 3ED1A 1CNMA 1E1KA 1RFGE 1O95A 3G79A 4YH1A 1S9DA 4PCLA 6REQB 2LD4A 1PGPA 1UXKA 3NS7A 3AKYA 2OKCA 1YF3A 1HKHA 3J7TA 1ORVA 2Z4SA 621PA 3AOEC 2CXTA 2J4CA 1JR6A 2HSZA 5FPPA 3D2BA 4D8UA 4U2DA 3ZWBA 3LY8A 3BOSA 3V8NA 2GPWA 3ZHBA 4OXNA 1HZZC 5AVZA 1I4DD 2OXCA 3T52A 4OQQA 1ML4A 3UUGA 2HRCA 2RB4A 1L0BA 3KEQA 4FB4A 2Q99A 1MH1A 1E2LA 2WG0A 1XCBA 3KG2A 3NT5A 4XGRA 4YCLA 3R7WA 5EKXA 1D0VA 4QJIA 5E6RB 4JUIA 1J23A 3ILVA 1ZMRA 2C07A 1NI4A 1MRSA 1UKEA 1Y80A 3OOYA 1Y3FE 2C8KA 1PLKA 5EHIA 2JHFA 1S8NA 1MC8A 1MEJA 4LPKA 3EK2A 4HX2A 3PV0A 3CZRA 8LDHA 1VECA 3FCUB 3IP9A 3NWBA 4QSMA 3ICOA 5TJHA 3EQ8A 1ZJJA 3KALA 2FJUA 4YRDA 1D9ZA 2G71A 2Q50A 4DY6A 4I9UA 4YR7A 5J4YA 3ZXYA 1LU9A 4H1HA 4YALA 4F8JA 1UC5B 5KMGA 4YJ2B 1E99A 1XRPA 1ZOLA 1BWQA 1QGZA 2VWPA 2ZSUA 2JVKA 3H5NA 2UKDA 4MXDA 1KAGA 3TGWA 2AMFA 5TC4A 5IK2D 1GZ5A 4E3WA 2XGJA 4F1KA 1QFYA 2F1HA 4CM7A 5A6VA 2RGGA 5JBNA 3FMFA 2DQYA 5DHPA 2OFFA 5FPKA 1RI1A 4LNUB 5JRZA 5C51B 3GAFA 1LC3A 4UTOA 1TT7A 3IIIA 1NL3A 2UAGA 2WJYA 4GG1A 4RK7A 5C1IA 1YCGA 4LVNA 4C2BA 5KWIA 3U6KA 1AGNA 5EWJA 4UTNA 4R6XA 3W6ZA 3WA6A 4CIXA 5C3MA 4PM4A 3CLUC 3NC0C 5ALWA 1S4MA 1AGRA 1SKQA 4UNPA 3W2HA 1SUCA 3K0EA 1GGMA 2J9GA 2NUTA 1VCHA 2CHUA 1I9CA 4L9WA 2ALJA 1KYWA 4HBZA 5KYNA 1QIIA 5EIOA 5BSHA 3ZWXA 3WNQA 5BMVA 2IVFA 4JLJA 4MKIA 2D1RA 1P4JA 5FOSA 3MTAA 5DGDA 5DNEA 3GL9A 1XRJA 1YJ8A 3D4BA 2TMGA 3Q6NA 1CJVC 1SCUB 3W7AA 2IYEA 5JMOA 4JSYA 1Z3IX 4LJ5A 4TTIA 4EW2A 2AJDA 4REQA 1PJ2A 5DASA 1J0XO 3C1TA 4BO2A 1L4LA 2ZR9A 2Z8XA 3QEMB 2R8YA 4NK4A 5K3BA 3ROFA 4RTRA 2C3UA 4E2WA 2EG9A 3PRHA 2C4MA 2AX3A 4CG3A 1B41A 2C2XA 2PCLA 2M1ZA 4JR1A 2W2KB 5CUQA 4L1KA 4CMKA 5F4ZA 1KETA 1QG0A 3ROXA 4PSCA 3V33A 2FRDA 4YQYA 2WJZB 3F5SA 4GOXA 3TAHA 4UPDA 4COOA 1U0GA 5IDXA 3T1OA 4HUJA 2VCYA 2XUAA 5HIMA 5HTOA 1MHPA 5DGTA 3D6TB 1EVJA 2JARA 4L73A 3RASA 3W2EA 2FR1A 3RIEA 1TJ5A 2OV4A 3COSA 1NJSA 3AFGA 5DJ5A 4LNHA 1ISGA 2JGFA 2IYNA 2E4YA 4DNQA 5KKCA 1UBJS 4LYEA 4UATA 1QVAA 2X1HA 5CB4B 1XJ5A 3OKFA 3LHFA 5DB4A 3KD3A 3RUHA 1H85A 3RWOA 3F46A 2HT6A 5DWDA 3I2JA 2BJHA 1NBWB 5DXJA 5HJEA 5CG1A 4QL3A 1G38A 3N39C 5HIJA 1QRDA 4MROA 2W48A 2PRIA 2HMVA 3I5MA 3SHFA 3FPAA 1C0LA 1NNSA 1XGKA 3H17A 4FMDB 3DR5A 3GCDA 2XUFA 4NMWA 4A3SA 4DV6B 5K8IA 2CSXA 1MQ9A 1C3OA 5LD2B 2CT8A 4CMAA 1X70A 2VNAA 2FLWA 1TLLA 1M2EA 2PMKA 2Y0CA 3NTVA 1GEEA 1RC8A 2ONZA 5E4TA 4BO6A 4R9NA 1Z29A 1JR2A 1YCFA 2BV3A 1Q11A 2ZPAA 3IDSA 1SHZA 1MO6A 4I2VA 4QQFA 8GPBA 4GPAA 1M6VA 3HVJA 3OFKA 1KAQA 1PL8A 3Q2OA 5ALZA 4XE5A 5SYMA 1XRSB 2AI1A 2OV1A 4U8GA 4JCOA 3BEDA 2J4DA 2C03A 2PANA 1A50B 1C1XB 1P1CA 1Y3DE 3AUFA 3H8WA 3LC0A 4R2XA 4EB0A 3DEAA 4OGGA 2C29D 2CLKB 3QRWA 5JECA 1NVTA 2G5GX 2JGMA 3QHPA 1K1EA 4ID9A 1ZRMA 4PCUA 2QE7D 3NDBB 4YRFA 1DV1A 2JCXA 4M0CA 3KWLA 1RAAA 2Q8PA 4HWKA 4LE1A 4ZU3A 5HMMA 1U8UA 1G2PA 4ER5A 1T8YA 4MR8B 3AF0A 1GG2A 2YWHA 3RF7A 1Y1LA 1TAHA 2DY0A 4O2BB 3ZWVA 4R0MA 5A03A 2GK6A 1N7JA 3EEIA 2KHZA 4I9NA 4BNGA 4W5NA 1R0XA 2VHTA 5F21A 4I9FA 3G7SA 1KC1A 3ACBA 3AW9A 1KNXA 3V55A 3CFYA 3ZU5A 1EVYA 2QSYA 2ZM5A 2ZIUB 3M6VA 4DHWA 2BUCA 1IEXA 4KBFA 5EHGA 3STTA 1IVSA 2JJMA 4OLFA 2XUQA 1DQNA 1RI4A 4RZHA 1F8FA 4X92A 1QSGA 5IAGA 4C04A 2XZOA 1RZRA 1DIAA 1DLJA 1ZK1A 4FZJA 4B47A 4GF5A 5K0TA 4LDPA 5KTKA 2BMEA 2H2HA 3WDMA 4EBFA 1B1AA 4OB8A 1Z6TA 3KVVA 1EM8A 1N5KA 1YL5A 1OV6A 4D43A 5ISMA 3HN6A 3RUCA 5JNVA 1K5DA 5AUNB 1VRCA 2H4XA 1FP1D 1F5NA 2DP4E 1GNRA 1TW2A 4DA9A 1YXMA 2IT1A 1ZI6A 3Q2IA 3K8ZA 4M8LA 1WBDA 1RXVA 5GMOA 4CIAA 3SJCA 4CEIA 1RZUA 4IAOA 3U5TA 3TEJA 1G8YA 2CD7A 1M0EA 5LA6B 3OU7A 4G25A 3SQWA 2FV8A 1GGJA 2JIQA 1WMBA 3AR6A 9LDTA 3GCWA 1IK6A 3A9SA 2F3PA 4GMXA 1RAHA 4QGGA 4AN4A 1ZN8A 3V1LA 1YH3A 4KTTE 3QE3A 4UPVA 3RSGA 3JPYA 4I3HA 5B2EA 2CNNA 1HDGO 3QMVA 4TYWA 1YZNA 1W5FA 1NVKA 2VTKA 2Z57A 3EOAI 3ZCPA 3BDVA 3TVTA 4BJ1A 2RIPA 4RHFA 1NSFA 2YVLA 4ZDKA 1YA6A 1MQ8B 2QW1A 1CY0A 2P9ZA 5C3UA 5MFPA 4URZR 2ENWA 4ARVA 1GTJ1 4TL6A 4IM7A 4BQPA 5I7FA 2PXHA 5JZMA 3VZPA 4EEZA 5LDHA 1XMSA 2NSDA 1TVMA 2VT6A 3LUAA 5U1PA 1ULSA 2I7TA 2VQ3A 4M9ZA 3ZS8A 1QOPB 5DXFA 1A9QA 5F1OA 4YREA 2EJCA 2OFOA 4CM8B 1DO2A 3NBZC 4GECA 1T4MA 2A0YA 3ZIAA 3H8VA 4EKDA 4UNIA 2XLBA 3ETCA 5BPFA 4JXJA 3IE2A 3H0KA 4ZJPA 4XB6B 5C35A 5E1BA 2QIPA 4ZJZA 3CZQA 3P9RA 1OT5A 2GVDC 3GVCA 4HDRB 3U4GA 5AKKA 1G59A 1FFYA 4O0MA 4RJ2A 1ULZA 2H5IA 1BN7A 5LBIA 3Q7SA 1ABEA 1EBBA 3AY3A 5ECWA 4YDQA 4WT7A 3DLAA 1L8LA 1TU4A 3QQ5A 1YJQA 2JK0A 4PC2A 4X61A 2V9CA 2WJHA 2XB8A 3DMGA 4YP5A 1P2VA 1B15A 1UOPA 3EY9A 1GUBA 1KEPA 3GR6A 4RA6A 1L7BA 3N07A 3R5TA 4IF6A 1RVDA 2GN9A 4FHZA 4R31A 3NHKA 5CM8B 2HZ7A 3CJTA 2CWDA 3JQ9C 4AB1A 4ZGBA 2FWIA 2P2SA 1ZU4A 3KWFA 3RHZA 2GCIA 3AR4A 5LUBA 4BFXA 1WUYA 3MG9A 4CF3A 4DF3A 2QTFA 2JFVA 1XC7A 2O8BA 4JLOA 1RTKA 1Y81A 2QVBA 3AP2A 3EDCA 2NTYC 1H8ED 3O3OB 2VJPA 4Q9NA 4HB2A 5CXQA 1L7MA 5EEHA 1TFUA 1CTQA 1EFPB 3A6EA 4FFLA 2KSQA 1GU7A 3IAAA 4K9PA 3FTPA 1SQGA 1U9IC 1NJ1A 5DU2A 1NP3A 4JLDA 4S3MA 2ZWMA 3VO9A 3W04A 4DMCA 4ETMA 3L8HA 3QPBA 2H5LA 4E33A 3S99A 3CLUD 1A8UA 4FZRA 5TQVA 4QM7A 4FJ0A 1L5SA 2ONJA 1SKBA 4LJ8A 3WLEA 3U9SA 4KQJA 3R0QA 5FBHA 3K0BA 4LE2A 4RJJA 5FFFA 2WJ3A 4PO3X 4JD5A 2ORVA 5FAXA 1JRLA 5JCPA 1YQQA 3HKCA 3F47A 1KOGA 3BH6A 1RLIA 3NJ4A 4QFBA 4HUTA 3WK7A 2IY9A 3H0CA 3WHIA 3TD9A 5CLHA 1M2OA 5U4XA 2Y1LA 1H8HD 4OXQA 4UU1A 1I24A 5HW0A 4P4SA 2J9ZB 4RXMA 1JHAA 1YQDA 1IZZA 2HSJA 4WNCA 3NFRA 1OC2A 1W93A 3L9XA 3FKJA 4ARSA 3F97A 3VR0A 2DUNA 4N0EA 3KPWA 2Z5GA 3OQNA 3ITKA 3PQCA 4MB6A 5K8JB 4EGSA 3OJFA 3B38A 2QDXA 3NYRA 1RKVA 4ZGGA 1LBQA 3E15A 2OD2A 5GOTA 4G8BA 4Q9HA 3TECE 2OCLA 4IFTA 2NU9B 4XWKA 4NF2A 3GLKA 2JFQA 2JGDB 1KY3A 1JTVA 3V8BA 1JTFA 1Z12A 5HQ3B 2A8YA 4O4IB 3UMCA 4NZMA 1A5ZA 2PS1A 1KYQA 1M7BA 2SKDA 1G2IA 3F96A 3RK4A 1FTYA 3M4NA 3ZHRA 1P31A 5ALIA 4HOYA 1IQ0A 2RI0A 5FR1A 5EJFA 2E5FA 3WGIA 3ZBQA 5G3ZA 5IVKA 1XEXA 1VPWA 2G0AA 3ZU2A 2OWEA 1AH2A 2IYFA 1IB6A 2BKUA 1NNI1 3CUEF 4YRPA 2Z95A 4DIKA 1CUYA 4BAGA 1T6NA 1BH2A 4C6HA 1BVRA 1UQRA 2TMDA 3DJFA 3DZDA 4FYKA 1WA5A 4G1FA 4JEHA 1G5IA 3OETA 5DHUA 2IUFA 7GPBA 3LMKA 1XVLA 2YZ2A 3UENA 3WHPA 4WJLA 1FA9A 3UJCA 1HSOA 4BNZA 5KYKA 2FMFA 2I80A 5J2UB 3FVTA 2OK7A 4H35A 4YECA 4NCKA 2FN9A 2X5OA 1MX5A 3A9TA 3CXRA 2GNOA 3O26A 2WQ7A 3HYTA 4RPCA 3USZA 3SK0A 3MB5A 1BROA 3O31A 2DTDA 4ZREA 3E53A 221PA 1OBOA 2Z2KA 4G56A 5BSFA 1UMKA 1VSVA 2Q28A 3NHUA 1AA6A 2FDCA 3PNYA 3FHTA 1TMGE 3ZD6A 5CVUA 4BHTA 1JQDA 3ISVA 1UC8A 3UKDA 4QFMA 4C21A 1A8HA 2B1GA 2WB4A 5FNVF 2ZB2A 4YCJA 5HZKA 4NMHA 4YUWA 4NOMA 4XD7A 2VOEA 1H0RA 5D5QA 3SBOA 4I8DA 5EE0A 4ETWA 3W9SA 4A73A 4LTMA 4UQLA 1XZHA 2B8WA 2XUGA 2IHTA 3H3JA 4BXOA 1R6BX 3HV2A 4GYJA 1O8BA 4F46A 2ZIFA 4RYLA 2ISQA 4WBXC 5BW4A 4JJ4A 4OSOA 2CJFA 5LYJB 3CPSA 2QRKA 2Z9CA 3KWMA 3GMSA 4O1HA 2QZ4A 3CZMA 4G0MA 4Y98A 5CH3A 2RHBA 3ZXUB 1G8JA 1V2GA 1XVUA 2FSFA 2NXEA 2V0NA 5TF0A 4DZTA 3SXUA 5DHAA 2YWXA 2CV2A 3CUSA 4TZKA 4LXYA 1GGEA 1AS3A 3ZE1B 3HRIA 3OZGA 3D3KA 4OHOA 1T4GA 3R3SA 3WQSB 1PX0A 4QULA 5K20A 1SIWA 1ZJWA 3HC7A 3DE3X 2UUPA 1QRRA 1ZI8A 2I54A 4NBUA 4WIAA 3VPHA 1QQBA 1R0BA 2X22A 5FLEX 1W2WB 4GS5A 3U31A 1E9SA 3HN7A 3QENA 5GM2A 5ALRA 4Y2QA 5BQ5A 3C3YA 4CM6A 4KP7A 1JEDA 2JFHA 5JNTA 3DT6A 3GYBA 1H9CA 4P9NA 3KSDO 4OXKA 3RS7A 4AKIA 3ORQA 3RO7A 1J99A 2V58A 5EZYB 1ZXLA 4RF2A 4C7OB 1HOXA 1PJ8A 4RX1A 3HUUA 3OH8A 4Q7MB 3OUUA 4MUXA 3RKRA 1Q6YA 4PV7A 4ABYA 4B3FX 3VKHA 4Q16A 4FOTA 4NS4A 3N2YA 4XGKA 4IIBA 1VG8A 3NHAA 5FBRB 4R54A 3BKWA 1OIVA 2P5UA 3FYHA 1BXRA 1C4OA 1C2TA 4JBGA 5EE5B 1M2HA 4H0CA 1JG1A 3HA3A 4HPXB 5D3KA 1AQYA 4WLUA 1EWYA 2QJOA 2XVMA 3LKZA 1YUMA 2A0UA 3ZOZA 3VYTB 2G9QA 1KJIA 2Y93A 4GQAA 4N3GA 3WV4A 3ETGA 2EFGA 4Q3CA 3UWPA 3DQQA 1KK0A 4F84A 1RBMA 4NDNE 5CCBA 4WLOA 3KEOA 1U5BB 1VJTA 2ANBA 2B94A 4WLFA 1IL0A 3S3TA 3WL3A 5BOSB 1GDTA 2SBTA 1N3LA 1PJQA 4QX6A 2IIQA 3T94A 2ORWA 3D5EA 4TXMA 3FYCA 4C6TA 1MV5A 4L78A 3U5ZB 4XSHA 1SC1A 1XEAA 3AEQA 1O4WA 3U60B 4CMEA 1X9IA 2WW8A 1UMDB 2P11A 4GYYA 5GM1A 1OZ0A 5THXA 4B71A 4EI9A 2A5YB 2II6A 4B34A 1YFLA 4HC4A 2HX1A 3OZFA 1A2OA 3FIJA 3WV5A 1M5RA 2L18A 4P84A 4KPUA 3RV3A 3O2SB 2HXYA 2X2EA 1BDMA 1A8IA 4Y1GA 3R9WA 4EW6A 1PTJC 1YOVB 2BSXA 2C4UA 1PEDA 1EP3B 2GBGA 1BHJA 1ACJA 1GADO 2JAPA 2BEUA 1SGWA 1RU3A 5HKAA 5JCZA 4OTZA 1YDEA 1U28C 2I03A 1QTRA 2Q4OA 2WZQA 4HAWA 1LFAA 4P5DA 3P5SA 3ANXA 3VPXA 3ITDA 3NEAA 1FUUA 2SNIE 3VR2D 3R6GA 3Q3EA 3T8YA 5AESA 1MXHA 4JKOA 3KYCA 1SXHA 2ZWIA 3LT5A 2BEJA 1OBCA 1ODLA 1QH9A 1E7SA 1ZQ9A 3FHCB 2F1RA 2FUG1 4MWOA 5EJEA 5FWDA 4CI0B 3EA0A 4BVBA 1CQJB 5T6BA 3RVSA 4HGRA 3FTQA 3DEFA 3LKVA 2V1UA 4Z51A 1IN4A 1RWPA 4GM4A 1FDTA 3EEBA 4HWTA 1N5LA 4MUEA 4ND6A 1MN6A 5KTYA 1E3QA 3CE9A 4QGFA 3V1TC 5BMVF 3N0WA 2HK8A 1H1LA 4DCOA 1FP4A 4F71A 4A0QA 3B53X 2ZBGA 3L6UA 2I2CA 2QUHA 1OI2A 4FUTA 1GG8A 4Z3DA 4YAIA 1E2MA 2WPNA 4XJVA 2C9YA 1XQ9A 4ETIA 3D1JA 1ID8A 1Z35A 2JH9A 2GUGA 5SV2A 2CF5A 3IV6A 1PFWA 3OLZA 2QRPA 3Q8MA 4MUMA 2E5LB 4MVJI 2C7BA 3KTAA 5IRCD 3MM4A 2OCAA 1J21A 2D0OB 1IHOA 4F4HA 1N5IA 1Z28A 3LRXA 2GHTA 4Q4JA 2B35A 1N3YA 1NPYA 4FFWA 4IUCS 4Z9BA 4C4RA 2BFAA 1CXZA 2ZRJA 3OLQA 2I6SA 1SIOA 1JVBA 1O1YA 3GRYA 4UU7A 4AZ3A 1AK9A 2FEMA 3GFSA 1S7CA 2F62A 2AFIB 2D1SA 4D9IA 4NJMA 1RWNA 1PS8A 3B6JA 4GI3A 4QDKA 4AJNA 1FDRA 4R1OA 3U80A 3G5LA 3PFGA 1RJEA 2WFLA 4UDNA 3W79A 4A8PA 3H4IA 4NRDA 3TLMA 1FQKA 1Z2DA 1HNNA 2FW8A 1KI9A 2PFSA 5AI6A 4I1VA 5DYTA 3ONFA 4GKBA 4UJ3A 1K3UB 4X1IA 3HR7A 5HWSA 2NX2A 3GJZA 4KJZA 1Z6YA 4LG1A 5EQDA 3L7DA 4DSAA 4AF7A 3D6UA 3R7FA 1ZL2A 5DNWA 5F2OA 4JLAA 1IWOA 4GKKB 5MF6A 1QG4A 3ANNA 4JLNA 4LAFA 3WIEA 3LK7A 4OQEA 4UZEA 3CG0A 1VCIA 1X87A 3AQIA 3FPHA 1DNPA 2QT1A 3BFXA 3G3EA 3NHSA 1LLUA 2BBOA 2XMRA 4RTLA 3HTXA 3H83A 4GKVA 5ALDA 3ZY6A 1VLMA 4Z7JA 2Q5LA 1NTRA 4XR9A 2PSDA 3E9QA 1UJ4A 1EUQA 2A9VA 1L7RA 3RFUA 1Z25A 2CJWB 2VUSA 4XYEA 1OB2A 1IZYA 4MO2A 4K88A 5IAAA 1QGED 1KY4A 3ISJA 3ENVA 5IBQA 5KREA 1P44A 2CV1A 3ENKA 1EFVB 4FD2A 1XU4A 2SHKA 2JBAB 4R68A 1KU0A 5H02A 5B4VA 4D1YA 4YRNA 4FR0A 5KSYA 4LOJA 4Z86A 1ZFNA 3FVRA 3KUXA 4HWPA 4CMBA 1X7YB 2IEYA 1WCXA 4Q24A 1CE8B 4BV9A 2W00A 1V25A 4CV2A 1FP2A 2JJ2D 1DDIA 3QM1A 1RYFA 1QE0A 3AESA 2ZBFA 4R2IA 1HM5A 4RW0A 1Z4OA 5H4HA 4A26A 3HMKA 1P4AA 4DYHA 3HBLA 3OJLA 1SBQA 3C1UA 3R3WA 4GBED 4Y2PA 4C0WA 1JHOA 1W2HA 1R16A 2VQEB 5JQGB 1USUA 1PTKA 1JZQA 3MFQA 4ZO7A 2ZUWA 1W75A 1B6RA 1QIHA 4D26A 5A4AA 1OWLA 5G1PA 2D2VA 3NR2A 4H08A 1ONNA 1Y6ZA 4PIPA 3REQB 4ZCSA 3I83A 4RC9A 5BV0A 3OQ1A 1P33A 5A3JA 3K4QA 4EGAA 2IP2A 2ZW9A 3PVZA 3QFCA 4DFDA 4R84A 1TZ2A 4IV0A 3W2TA 1OT3A 1VE5A 3GVIA 2O3RA 2W2PA 4YJFB 4CG1A 1ZJZA 4YCNA 5IJZA 3T3MB 1K88A 2BKEA 4ZCQA 5BUQA 1DC4A 2B6NA 5I45A 5CPFA 3JXEA 1UBCA 5FPQA 1Q7EA 4J6FA 1MO3A 1TJ3A 1GPJA 3DTNA 4H1VA 1TZMA 4N18A 3CZAA 4QPZA 4R2WA 4ZA2A 2FEWB 3A1EA 3AONB 3BJZA 3UWKA 2NO9A 5B3KA 5J59A 3V8MA 5EIXA 3PWZA 4KMSA 4MUHA 2G1JA 4EUSA 1ZHFA 1G55A 1M2VA 1WR8A 5BORA 1Z75A 1SZJG 1YDFA 4AKSA 1G20B 2YTZA 4DYVA 2X4IA 1BX0A 2ZBQA 1EDDA 4GXTA 4Y2VA 1OMOA 2BFDB 3TIFA 1D1PA 1US8A 5JT1A 4MLCA 1FFSA 3MOGA 2HA4A 2C4KA 2NU6B 2Q3DA 4JN6B 1Z74A 5EJ5A 3A4TA 2Q49A 4INPA 2X9NA 2VKTA 1IWPB 4EQ6B 1YL6A 5LQSA 4O4HA 3I1IA 4BLOA 5BR4A 4HDKA 2XDYA 1XEWX 4KRYA 4BRZA 4YWHA 5FORA 3RRYA 1Q22A 1DRVA 2CXXA 5AVKA 2XTJA 2UYCA 1FL9A 2BMJA 3LH5A 1NWHA 4WNYA 5IEBA 3SYRA 3A4NA 1R4AA 4DR5B 3OEED 3QVVA 3GNLA 4ZQBA 1YQ9A 4KNYA 4INZA 1NC3A 4W6ZA 1JQLB 5HUQA 3U0BA 3W6NA 1YTLA 3AKDA 1A04A 2XWPA 1KEVA 1THGA 1F6DA 2RGXA 5EVJA 1G5HA 3ZV6A 4ARUA 4Q1DA 3TTUA 3WB9A 1THMA 2AOWA 4WERA 4YCDA 3V8RA 4ZYLA 2HA3A 1BG6A 4YMWA 3IIMA 2GK3A 3WL4A 4C4ZA 2W2OA 1H5NA 1PCXA 4XI9A 3V4PB 3PR3A 4A2PA 3RARA 1DG9A 2ZUSA 3SBXA 4L75A 1MBZA 3BMCB 4QXAA 4TQ9A 1CUDA 4Y2GA 2O23A 1HXHA 1Y98A 5FUQA 3ZVMA 2ZQYA 4C3ZA 4HAIA 4TYPA 1MA0A 4PZDA 3UK1A 1L8OA 4DJTA 1REQB 2C9OA 4S1WA 1U2EA 5CBPA 4D4LA 3U0VA 2XXJA 2ZIVB 3DTVA 3IMCA 3WIOA 3QSYA 1GLGA 2JRCA 4YMSA 4LHVA 4G5YA 3UJ7A 3NQ41 2NUAB 2I2DA 1YE3A 3QW2A 1OJ7A 3GLVA 1TF5A 3A31A 3HY3A 4LWQA 4P8RA 3RHSA 3VYRB 4BO7A 4ZVLA 2PMBA 3P1JA 3DOFA 4L0CA 3MJTA 2FWMX 5BWCA 4BQRA 3AUJB 3DEKA 3U17A 3U3DA 4OP3A 4ZI3A 1EWQA 2ZRBA 1P29A 2FPWA 4FX5A 1A72A 1E6CA 1Z6GA 3GXOA 1GFSA 2WF5A 4I3FA 4IQFA 3FSJX 3S40A 1O6BA 1SXJB 2GEBA 3QPUA 4HLQB 1DCMA 2VUTA 3AHJA 4LHEA 1J8MF 2VG8A 3F7NA 1L4NA 3KOOA 3NHMA 4L5JA 2PYDA 3MAGA 4QXRA 2IRWA 3UV6A 4DE5A 3JSAA 5AOCA 4B3SB 5JJKA 4O3MA 1R0RE 2Z6VA 2PR7A 3JD4A 5COQA 4ZFNA 3V4VB 1CVIA 2J9YB 1WS6A 5T64A 3SC2B 3B5JA 4AUNA 2A9RA 2DWQA 4JP5A 1DKMA 3KFXA 3BT7A 4KITB 3B78A 3ZXXA 1MVNA 1Z4PX 3AETA 3H6HA 3WX0A 1AKQA 2JI9A 2QN8A 3ONDA 4P5EA 3WOVA 4CWAA 1O95C 2A1UA 4MR9A 5I7RA 5JAUA 3WK4A 1ICEA 3GEEA 1WP9A 1GQRA 2PR2A 4FK8A 3C0KA 5AXCA 3RYFB 1I32A 4BAZA 2Z04A 1NVVQ 3LHKA 3MWDB 4N3BA 4H7DA 1JR3E 1L9XA 1USVA 2TMKA 5I9MA 4RIEA 4TWJA 1I3OA 3SSAA 4C4YA 4OMFG 1TCVA 3TRDA 4UHBA 4DCUA 5AUQA 4NECA 1R4MA 2QZ9A 3VOTA 5IANA 3T5GA 5U9CA 2Q0XA 4QC2A 2FPOA 4E11A 3K9CA 1NOKA 1UC9A 2JFGA 4KACA 5AJZA 5C7YA 2VRCD 3O75A 2HHAA 4EL0A 2LBPA 3KQOA 1RR6A 4G5FA 4QTUB 1Z0SA 2JLWA 1RLMA 1OTYA 2J32A 3L0ZA 2F1OA 3OF3A 1G18A 4D3XA 2QRZA 2PNFA 3R7DA 1QPZA 4US0R 5A6SB 4N6OA 4Q7JB 4JGGA 5F12A 1XDDA 1CPYA 4NZOA 4POOA 4N7RA 3SWWA 4PX2A 3BREA 1EG2A 1TMYA 4JVSB 2I6TA 1U0JA 2PQ6A 2GN1A 3UTCA 1QV6A 3CF0A 4DRXA 4ESEA 5L4LA 2DFDA 3IB3A 3VYVA 3DO8A 3RU7A 3EMKA 3D4LA 2FEKA 2HL6A 4MPDA 1NJGA 3C5VA 1V9SA 2I9PA 3OE7D 2Y2UA 4ACAA 2H17A 3X1WA 4O2LA 4TS9A 4AMGA 5JSZB 3QE9Y 2W83A 3G8BA 1OLSA 2ZJ7A 3K15A 3R3XA 1R6XA 4GZ6A 5AQ1A 3I4CA 2H08A 3CPEA 1ZD2P 3KAQA 1W35A 3LQRA 2Q2NA 3LYHA 1WCWA 4I7EA 2R8ZA 5DM0A 5G0TA 5G1NA 2GETA 5C9ZA 1GOTA 1QC5A 4QATA 1AT1A 5H80A 2ODBA 1R15A 3PRKE 3UJ6A 3G68A 1FW6A 3F7OA 2ZE8A 2C77A 3IA2A 1C0PA 4WSOA 4HJXA 4FDTA 3L5KA 2ZGVA 1R1DA 2GPTA 3PXXA 4HB3A 1CUVA 1K6XA 1S2MA 2NO5A 4FR2A 4U8HA 4BLQA 1XNRB 1S8FA 2TRSB 3DZJA 3OLXA 3ZU6A 3KEGA 1E1DA 2BF7A 3D0OA 3WIBA 1VIMA 3K1AA 4Q03A 5HCIA 1Q5PA 4Q82A 2QPOA 2PUFA 4BZZA 3AR7A 1Y63A 3QPDA 3CEPB 5F1PA 2CXHA 5DM4A 4ZYVA 3W4KA 1E18A 2PUGA 4I0WB 4GD3Q 1N75A 8OHMA 5IJ0A 1Y3CE 1FUYB 3FMPB 1Z5NA 1OBFO 3TBHA 3L7IA 2B4YA 3WLTA 1DEHA 4WA8A 3F90A 3I64A 4XWTA 2Q2QA 3IUNA 1NP6A 3HUDA 1R0SA 1PUJA 4YP0A 4IGIA 3HMQA 4KUHA 3PFBA 1V7PC 2ZT6A 3SDZA 4E2ZA 3W05A 1KIFA 1TJPB 3KT0A 2JDIA 1N2OA 4Q4AA 4XM0A 4JBIA 5JLJA 2UXCB 2HCFA 3VTZA 2J59A 5JCXA 2VJLA 3P4YA 2DUMA 1K8RA 1WHSA 2FRDC 2FZEA 4HSEA 5E4FA 2HH9A 1QMGA 2J4FA 1GY8A 2PWBA 4KYUA 4GU5A 3UMVA 3ZCUA 5JNSA 2G07A 5CVJA 1OFTA 1SHLA 3ECCA 4OP1A 4ARZB 1QJ4A 4JVMA 4R01A 3WISA 2VHUA 2VSOA 3FCOA 2EBHX 2J5RA 2WU8A 2AN3A 2ZCVA 3D7SA 4IEFB 3M6WA 1FC0A 4EPTA 2A5JA 1H3FA 5E38A 1LRLA 4K3VA 5IYZF 1KJJA 4C08A 5JOQA 1HFJA 2HJGA 1Y9ZA 4MV0A 4YV0A 3FPSA 2H1OA 3AU8A 4JI7B 1U3GA 4OGLA 2QAGA 5FXMA 2Z1MA 2VF5X 4MNTA 2HAEA 4NCIA 4BQOA 3TMAA 1K08A 3SJBA 2NSJA 4U63A 1E2FA 2BGTA 3ZHOA 1UXHA 1DMSA 2EQBA 3IP3A 3L8YA 3VZQA 3P0IA 3TPZA 1QRSA 4RVOA 2GN4A 2W4IA 3T38A 1DIBA 3Q1LA 1P5JA 3S6JA 5KIAA 2VDLB 3AIOA 1OI4A 1TYCA 4J0CA 1KHHA 4I6EA 1SU8A 2E55A 2H06A 4W4TA 2GAJA 4WNIA 4WCVA 1ODCA 1IG0A 1VIYA 4KIJA 3SFZA 5DSZA 4X3CA 3RQSA 2VIIA 4K26A 1VHQA 5KQRA 1LSSA 1NI3A 2WMOB 3AHHA 3QXJA 2Y68A 1G8FA 1W0KD 5CA0A 4F85A 3AV0B 5AJUA 1N2EA 4YAOA 3WGKA 3DKKA 2JRLA 2NVBA 2R47A 3PD7A 5HS6A 5HHTA 3CVJA 4MWZA 2XLCA 1VSQA 4EB3A 2WHYA 2PT5A 5CM9C 5K4GA 3HM9A 4G0QA 1EFLA 1GPBA 1YJ5A 3IXMA 1Y5IA 3GA5A 3ORSA 3C3JA 3PGLA 4QT4A 4HEHA 4QJ3A 2JCBA 3JV7A 1HQYE 4J75A 3ZUPA 2LCIA 2DY1A 2C2HA 1T1GA 2ZXUA 1B7GO 1TU0A 2BMAA 3U61B 3ZTTA 5EAIA 3S8MA 2YVQA 1Y3HA 2RCYA 1DARA 2X2FA 1ZXXA 2FDXA 3PC2A 4MV9A 4YB8A 4CLDA 3Q3CA 1M7GA 3I72A 1G8AA 4H0NA 3JZAA 1XXHE 3MAAC 1CRQA 4U7PB 3OJCA 3QKRB 4X8MA 5DWQA 2W6JD 3ZJ5A 5G3YA 4KN6A 2QYHA 3VYWA 4AP6A 3WDKA 4BBPA 1BDJA 4MIEA 4RTSA 1OYVA 4R2LA 3I9LA 2OXTA 4DREA 4PANA 4WXEA 2QUKA 1Q0QA 1GRRA 3DWIA 5KZMB 4EKYA 3IB6A 3W90A 2HJSA 3HABA 4C6SA 2FCAA 2QY6A 2XVYA 5SZIA 3X1DA 5DLPA 3JARA 4KDFA 1ZM7A 3JQ8A 1OTHA 3TOXA 3SX2A 3HJTA 3J80A 4CQNA 1E2GA 3CF6R 4BNIA 4ZXFA 4KLRA 2VL7A 3B9BA 3ML1A 4WFIA 2DPLA 1HLFA 3QPVA 5AIBA 5KVCA 2Q6VA 4F96A 2OSVA 1DU4A 3N6XA 4HGYA 4MITA 3NWJA 3RRNA 1O96B 3G2MA 4MLDA 4RV4A 4UVIA 3HFGA 3T5DA 5I4IA 2B61A 4HTAA 1ILWA 3BJEA 3M4YA 3PNSA 4KLAA 4DEYA 1TA9A 2DHCA 1Q74A 2QD2A 3AI3A 3LCVB 4KQIA 4NH0A 3UB3A 3V7UA 4BMSA 2UUBB 1VKOA 2ZBEA 3S1AB 3C39A 4L3WA 4P81A 1FDWA 3KLOA 2YUIA 1VMKA 3DVQX 3HL4A 2IHJA 3I28A 3V1NA 3FLAA 1CP3A 2FNAA 2VWHA 4PC6A 5DIZA 1G7CA 3SVTA 3C4QA 3DZHA 4X95A 2C3PA 2FXVA 5I7HA 1V47A 1F06A 4HDSA 3N2KA 1Z8HA 3AWIA 3VSEA 4MH0R 3FUCA 4GX5A 1STOA 3JCZA 4N9QA 3X3HA 1O95D 1FFWA 2ODWA 4WOKA 1RYZA 1LW6E 2JAUA 4XARA 2CYBA 1DBWA 2XTZA 3H9JA 3JSXA 3N1UA 4UMEA 2XV1A 4ALMA 2Y1DA 4LFBB 4II7A 1BCRB 1SZPA 1DEKA 1NSYA 1MIOB 1XG5A 2QU7A 3UTDA 3RS9A 3P2OA 1QFJA 5EZQA 1E66A 1W76A 3K9GA 3DHWC 3ASZA 3ME5A 4ZQEA 3VNVA 1ZU5A 3UA3A 3DO6A 3ET4A 4JEUA 3N2GB 5FF9A 5K3FA 4YV7A 3KOYA 1SCNE 2Q9CA 3AUUA 4X20B 3ZDEA 3KFVA 4DS3A 4OH7A 5B7QA 5HZHA 3CBGA 3OD5A 5CLIA 1K5PA 5DN6D 5FX2A 4M60A 1V8OA 5JJ5A 2CLFB 3HXPA 4NESA 2A86A 1ZH8A 4YVFA 4L95C 1UBHS 5LSAA 5IKXA 1RI2A 3IT1A 3JVUA 4LV5B 4PPQA 3RK1A 2E1PA 2YYZA 3G6KA 3MGKA 4XYBA 2OLJA 4DLBA 1OASA 1QHNA 1A76A 1FUKA 1YB4A 3OBBA 1LX7A 2VSFA 1W6RA 2ZI3A 1WXFA 3EG5A 3P94A 3PEUA 4MARA 5EMLA 1DIOB 2I3AA 4EB8A 4XDYA 3VNQA 5F7XA 1W36B 2WWIA 3U44A 1NVVR 3FNFA 4H15A 4JA0A 4P2BA 1MORA 2FY8A 3BHJA 3PF8A 4R2MA 4XWOA 1YCDA 3PIIA 4B81A 4J2HA 3D3NA 3SSNA 4WY8A 1M34A 1SK8A 3TJRA 4MKRA 4MR7B 1XKQA 1EH5A 1ZMXA 5EXSA 1OD6A 2ZUCA 4KE9A 3L7AA 4N0PA 2CKMA 2HK7A 1I0IA 2J33A 2VHQA 2ZS8A 2JEOA 3G5UA 4QUEA 4ZCLA 5ITVA 2W5UA 1J2YA 3B52X 4MK4A 5A3VA 2B25A 1GL9B 4MMYB 5IUKC 3WBFA 3BRQA 3DV2A 5L4NA 3VKGA 4MIYA 2OMKA 2MSWA 2WJWA 2PBZA 3KJIA 5FBKA 2PRJA 1PWHA 5D7NA 3CNHA 1VIDA 1XRMA 1QIDA 2I6QA 5AI9A 5FFNA 2D2IA 4BVGA 1YR9A 1VYTA 2B69A 4MQFB 2VJKA 1ULBA 3GZJA 1EXNA 2ZJ4A 5CYPA 3EVDA 3VSDA 1UKVY 3MGGA 5LBTA 1TEZA 3K9FC 2P5TB 2QMEA 4D4HA 2O0KA 3F5FA 3PJGA 4F04A 2N46A 5KPDA 1KQGA 3DMNA 2Y3IA 2RHTA 2XNJA 1RQ2A 3BBLA 3PQ6A 5AM1A 1XHLA 3MT9A 4QG7A 2FN3A 2PEZA 3PFHA 2GX6A 4MUJA 3C3CA 5FADA 2GA8A 3Q6MA 2VJYA 3EAGA 3T7DA 4C5BA 5I7OA 2V6BA 4UD6A 4F4DA 3HJCA 3PRJA 3PX3A 3WYBA 2JHAA 2QDKA 3DONA 4O2AB 5C37A 2HA5A 1LSOA 4L22A 4JI0B 2FWJA 1JLLA 2WM9B 5ALTA 1J1UA 4DLUA 3PDJA 3EXEA 3G8DA 4GVXA 5BT9A 1TTPB 4JEMA 1ZRHA 2OYRA 2D1FA 1BMFD 3BWBA 3KVRA 5BSRA 2I55A 3P19A 4GYKA 4DCMA 1G0NA 5T67A 3GLHB 1Z2AA 3JVEA 4IX9A 3JQFA 4OG2A 4YP7A 2YHIB 4IDFA 1ENOA 2Q9UA 4FDMA 5JS8A 3GI1A 1NQXA 4XQ0A 4O4HF 3ZLUA 4KI7A 2PLWA 1H2HA 1TUEA 3D3QA 3G0OA 1SUDA 2CBGA 3SC6A 1H1DA 4WN9A 1P39A 4E2XA 1O0CA 3JYOA 3H6GA 4ZRDA 5LQRA 2W8BB 2AJ8A 4X54A 3CTPA 1EDEA 2G9VA 3NHRA 1YRYE 3GBPA 4UAJA 5HRUA 1I2BA 2SCUA 4WCFA 3K5PA 1CYEA 3I23A 2ATEA 4HWSA 3X1MA 1WBJB 3R0IA 1QVRA 1SU4A 4P22A 2JLAA 1Q14A 1UM9A 4HXFB 3OQIA 3NOXA 3Q6IA 2DKOA 5KMGB 1MX3A 5KNBH 3OQHA 2D0DA 3A8TA 2QL7A 1D03A 1U6KA 1ZH6A 2VJOA 3DV0A 3G9ZA 1AU9A 4CUKA 4UNRA 2NP6A 1CR6A 3UMRA 2OBBA 4UBMA 4UDXX 2P0YA 3T61A 1NN0A 2G1UA 2ZAOA 2RH8A 2A57A 2ZFUA 1MDBA 2CLEB 3JWPA 3D4NA 3IOCA 3IQFA 4YUZA 1U7DA 3CN7A 4H31A 4DCNA 1OWMA 5M5BA 2JBHA 2PZJA 2L82A 4Y9DA 3F8TA 4MCIA 3ZPXA 1GAJA 4X0EA 3R7LA 2RE8A 2MT9A 5F7ZA 3FGOA 1LD3A 1YVEI 3MERA 3QVLA 3SU8A 2D3TA 5I7UA 3GPLA 1HNWB 1K7EB 1U9JA 4RQUA 5B7NA 2Z3VA 3DOIA 3EDYA 3HCWA 1CVLA 1JBKA 2IYWA 2PZAA 4U9HS 2IZZA 4OKIA 4EYEA 3GK3A 2AOUA 3LECA 3ND7A 5KHLB 3N7AA 1ITZA 1EDOA 3O3MB 1I33A 2IEAA 4EVSA 1BO6A 4YRTA 5BMVB 3KSBC 1BNCA 2YS7A 2C58A 2Z5FA 4PW0A 2O2JA 3DB2A 1IY9A 2CBXA 2FMXA 4PSKA 1NRIA 3PKZA 2SKEA 1ZKMA 3T3GA 5LZ8A 3OFVA 1ILEA 4LE0A 4UHCA 1BD4A 3ZVKA 3L84A 5DNYB 3TIGA 2PX3A 5C1DA 2EVWX 3FLMA 3PZBA 1QMPA 5AW8A 4QBGB 4TYNA 3ZDCA 4U2FA 4H4DA 4ALLA 3PUHA 4BVHA 5JANA 3E0XA 1GA6A 4Z9XA 1XQ6A 3I6MA 1RZRD 5I8ZA 3KB6A 1BA2A 3K9HA 1G6Q1 2RK6A 3A9VA 4OD0A 4OHCA 5ECYA 4DCGA 1JB9A 3W4IA 1E6WA 2PE5A 1OXXK 2GZHA 1JR3A 3AH8A 1NHWA 2GTHA 3DMPA 4B6JA 1J00A 1N7IA 3IR7A 5K0BA 3I2IA 3WMFA 4KAJA 5B1YA 4BKRA 3ILSA 1PKEA 1KQFA 5FO1A 2QPLA 4RDHA 5KQSA 3O7MA 1KYYA 4URXR 3IILA 2ERCA 3NUQA 2IW1A 4ZAXA 5FOUA 1GN8A 1J9ZA 1ORDA 2X3YA 1DCTA 3OWXA 2B21A 3STWA 4LRUA 3OA2A 5BPHA 2P68A 3EE6A 1ABFA 5BMOA 3L43A 4EAAA 1Q12A 1V1JA 2GH1A 2VPZA 1Q0ZA 4W1SA 1NMXA 1GUDA 1Y7PA 2Y1XA 2BH2A 2QZSA 2RC6A 1I0ZA 4WEQA 3PDCA 2I4IA 5CXSA 4EJ0A 3CV3A 1XJCA 1R8XA 3I9V6 2IU4A 1WCIB 2W6ZA 3MVEA 3WTCA 2MR5A 2ZUFA 3LT1A 2YXDA 1VL8A 1D6SA 2WC1A 2TS1A 2M32A 3QUSA 3BAZA 4NY1A 1YB7A 4CMEC 1ZI9A 3AHEA 3K2EA 2BD0A 4TS1A 4U9UA 1M2FA 1XA0A 4RD0A 3ZHYA 4Z5XA 1NRXA 1QR2A 4I5IA 4BCBA 5AVTA 1XPOA 1UP7A 2JL1A 4FIDA 1JSCA 4R8SA 4TMWA 4WZBB 3D3WA 3W5BA 3GBVA 4U00A 4DEXA 1A9PA 2HW8A 1RHKA 1A4IA 1XHEA 5HA5A 3U49A 3ZIAD 1DTSA 5EHQA 4N5IX 3QUCA 3GJ7A 5GONA 1U0RA 3OVMA 3MPUA 4JUFA 4U0JA 2AOXA 2XB2A 1NE7A 1OCEA 4TVSA 2G88A 2GZDA 4A6EA 4S05A 5L3SB 4EFNA 3F4KA 2IP4A 3MT8A 3HDTA 3JZFA 3Q9UA 1QIJA 1IWBB 2WJ4A 4WXPA 3U40A 1RXEA 4D3ZA 1MOQA 2VP0A 1KI7A 2JEYA 4QDUA 3O1HB 1PNOA 2H1CA 5EQFA 4KO2S 3IE0A 3VAYA 5CT6A 1HFEL 4FP9A 4HADA 1BEZA 4ROTA 3HUTA 1KSFX 1Z56C 2B5WA 4D9BA 1BVUA 2W2XA 2EZ8A 4DV3B 3LLCA 4TSRA 2H7VA 1G5FA 1LH0A 1KYTA 3QFFA 4LSZA 1TKCA 2QRVA 4C07A 1QIGA 4P3KA 3V4OA 1ESDA 1HQKA 1NU8A 2H00A 3G0GA 2B99A 3ODPA 4ND3A 4WKCA 3HRHA 2Y1OA 1R7RA 3KK0A 4AO6A 3ZCRA 1QU3A 5I7AA 2CL7X 2CDCA 2Q9BA 3FRHA 3PZRA 4GBGA 2AA3A 3LGXA 2ZDGA 3QY9A 5F98A 3HCDA 1SUEA 1TT5B 2BBTA 2YBEA 5AH0A 4RPKA 4E30A 3P0HA 2OGTA 3FCAA 4C03A 2VP5A 1N5RA 3BDIA 4CLXA 3KDSE 4G1UC 2OOSA 2ZI7A 3SVLA 3UFXA 1WWKA 4PTZA 4H4CA 5BT8A 1YC2A 1FVHA 2IXFA 3I9FA 1KZ9A 4EHBA 1YZLA 2P1ZA 2QX8A 1VCMA 1YR7A 2YINC 1DRWA 1OX4B 3DS8A 1QYXA 5LPNA 2WWTA 10MHA 4IIEA 5KKAA 1GCGA 3ZK9A 4LBVA 4QNNA 1OHHD 2P8JA 5EWMA 4QXQA 3SQMA 1G1AA 2QX7A 2P3SA 3VMFA 1JT9A 1L7XA 2DPYA 2A4MA 2VDKB 5DCLA 4GM0A 4O1MA 1KRWA 1KH3A 5HVNA 4R69A 1GR1A 1TYDE 2XECA 2GPSA 3LTNC 3RAFC 3CWQA 3GF4A 2B4KA 3MTJA 4HWOA 4XDGA 3TAXA 4AG5A 1LW7A 4ZHSA 3LPCA 2AOTB 1NG9A 3CEAA 2IYUA 2VRBA 3HV0A 4N3AA 4D42A 3FLEA 5EP2A 3ZLBA 2QW8A 4ZI5A 1ZUNA 2DWPA 3MINA 4IOKA 3ZVNA 2G5PA 2AR0A 3FYDA 3OT1A 4HYTA 4JGIA 2JHPA 3X1ZA 1N6RA 1ZZEA 3GDOA 4PLZA 1J97A 2HKIA 4AFNA 2YHSA 1Q17A 1UDCA 4JQZA 3DFIA 2DWOA 4JP2A 1G8SA 2HA6A 1ENYA 4JYMA 3TDKA 2B8EA 2HUPA 2QMHA 4PFQA 2VH5R 3WK5A 1G21E 2PQ2A 1LJUA 3ZX4A 4BO3A 2BFCA 4UCXA 5CA0F 4L4RA 2GZ3A 5IMBA 3FOBA 1I6MA 1HFWA 3FETA 4X62B 3NPMA 2CUKA 2GBFA 4CLRB 2YYAA 5JFTA 1E5DA 5BOVA 3BTVA 3FX2A 3OY7A 1Z4KA 4DA7A 3ON5A 3TE6A 1QE3A 4IWNA 2X0KA 2DKFA 2YASA 4AX8A 3S2UA 4DTIA 4XVUA 4DJDC 1CV2A 2HQRA 1NX6A 4E88A 4Q6BA 5AW3A 3PEYA 4H1TA 1A2KC 5LZ4A 1PQPA 3SHOA 2JLYA 2OPHA 3R0XA 4IH4A 2O0LA 3QYFA 1IN8A 1T26A 1UKYA 1CY7A 3AR8A 3QIAA 2IE0A 4JFAA 4W7IA 4RANA 5AHRA 3TZHA 3WQRA 3K0AA 4XGNA 3ZGVA 3KKPA 4LKOA 5FV7A 3OFSA 2C31A 2JD0A 1LVUA 3CUKA 4G0NA 2MMGA 4R9UC 3RDPA 3ZD9A 2AN5A 2ZS9A 1DKUA 3LPMA 3OQMA 3TLAA 1XTZA 1DAGA 1P1HA 5ES4B 5IDQA 4QFCA 2LGJA 4XD7D 4E7OA 1XQ1A 2F1IA 2FFBA 5EJAA 4MQLA 1X80B 2FN4A 2LP4Y 4XVQA 3STYA 1QV7A 1CG6A 3EQZA 3QK7A 4RA9B 3S0JA 4U3JA 3VBCA 2X8JA 5FWYA 5I6DA 2FGKA 2O7RA 1JPNA 4GM1A 4A1OA 2X4GA 3HO6A 3PJDA 4FNGA 4OJTA 4YAEA 4WXMA 3U19A 2JZOA 3SQOA 4KUGA 3HKCB 4EFLA 5AW4A 4FUQA 1SVWA 4KE8A 5K6RA 2FWPA 5CFRA 1KH1A 2XQJA 4N5LA 1GXSA 5JIBA 2ZTHA 5UKDA 3T9AA 4BEJA 1DOHA 3ELUA 3O74A 2C92A 1B8VA 4PXYA 2YJGA 4AM8A 4ZPJA 4UARA 2QTGA 2OGSA 1KDOA 2HCTA 3DLIA 1DWUA 3AWDA 3UJNA 1QUFA 1ZUIA 2AEMA 4RMJA 1FU4A 3WBJA 4HH0A 1RXUA 3NGMA 4A5SA 3L07A 4MKXA 3I0MA 2QK4A 3EWNA 4N6GA 4RD3A 4C0KA 2VJNA 4J91A 1MD9A 3JYHA 1GKYA 1MEOA 3COPA 4K1LA 1M1ZA 3GDGA 1NXPA 4W63A 4MVXA 1VSTA 2PT7A 1IXZA 5K0GA 1Q3TA 4OB7A 3TX6A 1I2ZA 3ZTYA 4LGVA 3S7TA 4B82A 4XSVA 1XEXB 2RI1A 4HG2A 1B14A 1DXHA 1K0UA 1POWA 1W4RA 1KRXA 4QQRA 4I8IA 4UJ5A 2ZRIA 3NGLA 5C7IO 2CCKA 4C0HA 1TW3A 3WY9A 5BVGA 1TOAA 3B85A 1N5OX 1J07A 1NT4A 1UT6A 3QYAA 3PCTA 4K7JA 2EFCB 4XDHA 4E07A 1VXRA 4KQ1A 1SHUX 5FPHA 2FYTA 1WU8A 3EZLA 1NYRA 1BDIA 4DJEC 4NG4A 3L49A 5LQKA 2V74B 1K7XB 5IPFA 1RAIA 2QM8A 3RRMA 4YAUA 4RD4A 2NZVG 3IP1A 4U2CA 2GYWA 2EJVA 4H7IA 5K3CA 3NAQA 3BXZA 4UXJA 5HFJA 3B1VA 4E32A 4D0GA 2QRLA 4MKZA 3PXEA 4PVCA 1JEEA 3IDQA 1GTMA 4F5WA 4DEVA 2YWJA 1IQUA 1T9KA 2WYHA 4L74A 1FX0B 3QFTA 3F98A 3JAKB 4CEJB 3IJEB 3N8KA 4D9NA 1QH0A 3KQPA 1CX9B 1KK3A 3LLSA 3RVRA 2BAGA 3O83A 5L40A 2H0RA 2JAXA 4Z4HA 3CR8A 2BTQB 1YQUA 1HT1E 3OUTA 3PEVA 5A06A 4PO9A 1KSJA 5EEGA 4ZK6A 1Z2NX 4LC9A 4EECA 3K70C 1JI0A 5TV2A 4C14A 1NC1A 1J1IA 1V8BA 5TS3A 4YQZA 5U4QA 4PBTA 5TT0A 3WADA 2G7MC 2X13A 1E2IA 3OZUA 3WDLA 2GYYA 5TARA 3UOAB 4I5FA 4AS1A 2W8ZA 1CJUC 4EY7A 4ZCIA 2DBZA 2G28A 4Z8YA 3WK9A 2NPIA 1Q1GA 2PGNA 3SXUB 2JIMA 3GMDA 4RS4A 4AN0A 4Z3OA 2VTVA 3U7QA 2VYNA 2JZNA 4TN1A 1QF6A 4GFDA 4AF6A 4DADA 3DLHA 3PR2B 1Z16A 4KIWA 2G6TA 1DIRA 2QL9A 1IY0A 1RMYA 4Y7DA 3F6CA 3TOVA 4WKOA 3GCZA 3CVUA 1AUQA 1O58A 1UPUA 2VWQA 3IQDB 1TTTA 2PUCA 1S3FA 1WHTB 2E49A 4QBFA 2VYFA 4KFRA 3EGEA 5FYQA 3NJ8A 3ITEA 1OFIA 3AEKB 1DADA 2PSEA 3TLCA 2BEWA 2ZBUA 5H3LA 1TZJA 4L0DA 3NXKA 1EQUA 1RE0A 5IYZB 1H94A 2ZRLA 4Z1OA 4EJFA 4LRSB 1PQYA 3JD0A 4QYWA 2ERYA 3TQIA 4O3FA 3O1IC 4YUYA 3E84A 3AVVA 1M76A 1U0OC 1ARZA 4KQCA 3FZNA 3H5LA 3MPOA 4LY6A 1T4DA 3L41A 1Y33E 1ZD4A 2IHUA 5DYNA 2FDRA 1IXRC 5PNTA 2YJ5A 3TXYA 3AVUA 4YRQA 5KNBA 4N9WA 3WGYA 3ZW9A 4XRGA 4CKWB 3R8CA 1Z2PX 4RJIA 3RFXA 2OAP1 4XX0A 4B35A 1EVQA 3ROEA 3FTDA 4DCVA 3EBPA 3WNDA 3QBTA 1AN0A 5FB3A 1GQYA 1Y37A 2IP1A 3AIMA 3DDUA 2DPMA 4U7JA 5DLYA 1BU5A 4PAMA 2MINB 4U5XA 3G9UA 1GLVA 2JVJA 3KHSA 2DCMA 2QORA 2Q1WA 2XYHA 4Q3EA 5G41A 1P0MA 3JALA 1KP3A 5NULA 3WKBA 4BC0A 1JVNA 1T8TA 2M1XA 1L3CA 2BP7B 1IHUA 2NO4A 3KUCA 4RORA 2WIJA 4Z0HO 3CPJB 2IOQA 4XUCA 4KQMA 4LDZA 4QELA 2VO1A 1R6VA 4IIGA 2GSDA 4J0EA 1J9GA 1WZCA 3CHYA 3HDGA 4P4UA 3TW8A 4EZIA 1KYVA 1IJFA 1XAGA 3M4XA 1P0IA 2I91A 3ADPA 1JZTA 4YT4A 3G2IA 1P2DA 2JIBA 4JNKA 1E96A 2FFHA 4N40A 4ZCTA 2WTUA 3E48A 2HSWA 4D7AA 2A1TR 5CX1A 2XH8A 4ER7A 5L53A 2XD4A 3DXZA 3L93A 3P9IA 3ITNA 4A0FA 4AYWA 2BEUB 3CQ9A 3EUWA 3RTGA 1A97A 3DHYA 4PYNA 2QS9A 3SHWA 4OBXA 4DLWA 4PXSA 3IAM1 3ENNA 1OU0A 3IEXA 1OLXA 3E9CA 4NKRA 4D6YA 2GFQA 3H19A 3AF3A 2JS7A 3O2NA 2R5NA 4OYLA 4XPIB 3L7JA 3RVDA 5LWHA 4AJOA 1HMYA 5GZ6A 2DQZA 5IFLA 1GM5A 5BWNA 4RKWA 1JAYA 5CFQA 3ZKWB 2HXGA 1Z2OX 2JIPA 5LB2A 2YJ4A 1R18A 3L4BA 1LLQA 5K0NA 4MVJM 2WAAA 4EHFA 2E89A 3N0XA 5HEKA 2K2WA 4JT2A 3BJMA 2SKCA 1H1LB 1X6VA 1ZJ6A 4CTOA 3ND9A 2Z8YM 4MQ6A 4EG1A 1NWCA 1Z8DA 4JDUA 3TX2A 3DTTA 1FNCA 5FI0B 3EGVA 2W70A 3M6XA 2K7FA 3F6BX 1PSDA 2FZ5A 2OCYC 2AJTA 1PG0A 5AVJA 1BEUB 4Q1BA 5JD5A 4EGQA 1YBMA 3IOBA 2PL3A 3KTAB 3OWOA 2GD1O 3J7AC 1VZ3A 1N0IA 1QRAA 1JPVA 3CSUA 2O8VA 2IODA 2PY6A 4KCGA 3ZVRA 1I2AA 3AJEA 1LQUA 4D2IA 2AG8A 4EY8A 1SKAA 4D4IA 3TLKA 5C4IA 1FFAA 1ATIA 3UMGA 4AZ3B 3EIXA 3D31A 5TXGA 4E22A 4KAXA 2VT2A 1VKRA 3NJRA 5FBWB 5KUTA 4N5HX 5EIHA 1ISHA 3C3BA 1MQAA 1SCQA 2QAGC 3E9NA 3ETHA 5H68A 4PFJA 2NO7A 2YNMA 4TRMA 5SYNA 1EK5A 1H2RS 2REQA 3DBHB 5PGMA 4M54A 4NI5A 2CJXA 4YROA 1U63A 4IV5A 2FZWA 4Q21A 3TUIC 1NKSA 1SOMA 5L45A 1V7CA 3MK31 4LXGA 1QYVA 3N8HA 4X1IB 1T9BA 3FUTA 5C52B 1U7UA 2BE9A 3GLIE 3CBQA 2H1IA 3PHCA 3RS4A 4HNSA 4E4RA 3G2JA 1EWVA 3WWOA 1VJCA 2WD7A 3CN9A 2I1WA 3HACA 3P52A 4WEOA 5E0KB 1L1QA 1K6EA 4XB2A 3RS2A 2P6NA 4G89A 1G4UR 3LA8A 1LPAB 1SBYA 3PG5A 3HYCA 1WETA 1L6IA 1WY5A 3A6JA 3U3MA 5CNKA 4PSUA 1RWVA 2Y1KA 3W9YA 1L5QA 2ISCA 2WWGA 3ANYB 4TSKA 4ZQHA 3B9RA 3C2QA 5EHZA 1SB8A 3B1JA 1F2UA 3U3ZA 5JVDA 5C8XA 1GTVA 1WXDA 2AC4A 2Z58A 3B70A 1ZKDA 2O8EA 4OUDB 3R8FA 2DR2A 4M8NE 2PU7A 5IXSA 3LGAA 3E3NA 3FPJA 1AO0A 4DR6B 1NBME 3EGXB 3I1YA 4CUZA 1RQNA 4A92A 4UBKA 3IMFA 4X8LA 4AZ0A 2DG2A 3HG7A 5GONF 4RH0A 4FZVA 5ALYA 2EL9A 3MYRA 3IALA 1T2EA 1EFAA 1QHHA 3OMWA 4URUR 5G0VA 3UJ3X 4PSAA 2XBMA 3NWEA 3WWEA 5KEIA 4XVCA 1UXJA 1EGHA 1K27A 2EBUA 3S68A 5ARBA 2ZKLA 1ZGCA 3AK4A 2Z6QA 1CF2O 4XGIA 5KAPA 4FGWA 3ZGOA 3KQKA 3M2PA 4R7TA 1XSEA 5KVQA 1R0LA 3DTVD 4M1KA 1FMCA 5DTMA 3I76A 4BNDA 4YMGA 1V1RB 4UW9A 2Y6UA 2IPAB 2QQ5A 1N36B 1W25A 4YO7A 4ZODA 2H3HA 5A5VA 3UYKA 4W5WA 1QIKA 4C89A 3QMMA 4QOIA 4KOAA 2OB2A 5EXPA 4EZBA 1NA5A 2CF6A 2R25B 3K70D 1KAEA 1L8XA 1WXWA 1J7KA 1XMVA 3PXDA 4Q3LA 3UJDA 3DMRA 5B64A 1XF1A 2B7BA 4G01B 2POCA 2ZJAA 3GGJA 1LI5A 5DVZA 1T5HX 4TL9A 7MHTA 4MHOA 3QOFA 1U1FA 2O6HA 5F9FA 2O06A 4ERXA 5KWJA 5GINE 2DPXA 3OKPA 4LMAA 5E2BA 3D8TA 4NCAA 1UMCA 2OCIA 3AUXA 2NXJA 3PUXA 3KQLA 3RS8A 2XYVA 5B53A 3N76A 1X94A 3KKNA 4MUKA 3IXQA 4P4TA 4MP6A 2CD9A 1WDKA 1MO5A 3RFCA 4CZ2A 4XM2A 4FYWA 1P2BA 4JROA 2DECA 3WB2A 4ZQIA 1US8B 1ZVJA 4DSOA 1BXGA 5KO2A 3EZ9A 2VF7A 4Q1AA 3IMEA 4IJ6A 5AKZA 1XNGA 1QP4A 2DYKA 3BHIA 4KRXA 1Q2XA 2FMUA 2HN9A 3EHDA 3Q0IA 3L6CA 1KK1A 3SSOA 2DPHA 2PJUA 4BB0A 1V96A 2P78A 4FWIB 1ZGJA 4YX9A 3FF1A 1BRMA 4IXNA 1NQWA 2YIJA 3RGGA 4E94A 5GZ3A 1KJYA 2COUA 2HJ9A 3EWIA 3O8OB 4QPDA 3VH1A 3CM0A 2VRWA 4MRMA 3TO5A 5EHNA 5LZ5A 5EKUA 2PBFA 1XP5A 5FQOA 4RPGA 3KUKA 4CNBA 1Q91A 3L4JA 1N6PA 3KOMA 2NADA 4FXOA 4JX9A 1EFKA 1ZDMA 2KLHA 1H4TA 1SM4A 1QDEA 1XDZA 1Z0KA 2Y2VA 3HPQA 3KB1A