1VJRA

Crystal structure of 4-nitrophenylphosphatase (tm1742) from thermotoga maritima at 2.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
261
Chain Sequence
HHVLDKIELFILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLRNMGVDVPDDAVVTSGEITAEHMLKRFGRCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYERLKKACILLRKGKFYIATHPDINCPSKEGPVPDAGSIMAAIEASTGRKPDLIAGKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVKLGKNAGIVSILVLTGETTPEDLERAETKPDFVFKNLGELAKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 4-nitrophenylphosphatase (TM1742) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords 4-nitrophenylphosphatase
total genus 93
structure length 261
sequence length 261
ec nomenclature ec 3.1.3.41: 4-nitrophenylphosphatase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA02
2OYCA 3ZI4A 3U7FB 3WK7A 3PGLA 3EPRA 3F9RA 4L6AA 2RARA 2B82A 2YBDA 5AM0A 2D2VA 2YMMA 3L8HA 2R8ZA 3NAMA 2X4DA 1ZD5A 3L1VA 4J03A 5AKYA 4HGNA 2HX1A 4UU0A 2FDRA 4IFTA 5AW8A 2W43A 5E0OA 4XOUA 4UW9A 2HHLA 3SF0A 3BWVA 3OCUA 3WK6A 3ZWDA 4JB3A 4YGYA 2YJ6A 5ALDA 2EATA 2Q5EA 3B9BA 4YCMA 2YJ4A 3OCWA 3CNHA 1Z4LA 4Y2YA 1K1EA 3U7EB 1YV9A 2AH5A 5AIAA 5IS2A 4DW8A 1CR6A 3ZX5A 2HO4A 4BKMA 4O8CA 4YCLA 4F71A 5A3SA 3DV9A 3U13A 5AKKA 4KX5A 4OD0A 3ED5A 1QQ5A 4UM5A 4HGPA 4HYTA 1SU4A 1EK1A 2FPXA 3QUBA 4BBJA 2C8LA 3M9LA 2FUEA 1CQZA 4HGQA 3ZU6A 1ZRNA 2B0CA 1YNSA 4CNQA 3GYGA 3KD3A 5ALPA 4UMVA 2IOFA 3QX7A 1O08A 4C4RA 3I76A 3WK5A 3I1YA 2FPUA 2G1AA 3QUQA 1T5TA 3AR2A 4CE6A 5IT4A 4XQ0A 1L7OA 2HF7A 3B9RA 5ALOA 3B8EA 2AMYA 3R4CA 1NNLA 2W4MA 3U26A 3RF6A 2NYVA 1YS9A 3W5DA 2EARA 3ZVNA 1RKQA 1RLMA 1U2TA 3N1UA 1VJRA 1TJ4A 1EK2A 5AI8A 3E81A 3SD7A 4ZEVA 4AP9A 1RPZA 2C9MA 2C4NA 2HEGA 5FP0A 1ZS9A 4Y2RA 3SKYA 3AR8A 3PCTA 1F5SA 4IG4A 1TJ5A 5AW2A 4KNWA 3EF0A 3L7YA 2YFYA 4KX3A 5ALGA 1YDFA 4HGOA 2EAUA 5ALYA 3FGOA 4BEVA 3WGVA 4OHFA 3ESRA 3N07A 2I7DA 2WFAA 3AR7A 1Z4JA 2YMPA 3DDHA 2PR7A 1SWWA 2GO7A 3NRJA 4Y2PA 3AR9A 2CN1A 2FI1A 3WKBA 4EELA 2AUTA 1L8LA 1Q91A 2R8YA 3MPOA 2CFSA 1L7PA 2HSZA 3WKEA 2DQSA 2OBBA 4YIKA 1ZD4A 3E8MA 2YY6A 3FZQA 2GFHA 3AR4A 3BA6A 2Q4RA 4UU1A 3WKAA 4HAIA 5AKJA 5IT0A 4FFDA 1Z4PX 1LTQA 3ZWKA 3L5KA 3A1EA 1Z4OA 2WF5A 3RFUA 2I6XA 3KOOA 4NFLA 3WK4A 3EF1A 1Z88A 3DNPA 4E88A 4GIBA 3QLEA 3W5BA 1RRCA 2MSNA 2IYEA 2FPSA 4FYPA 2WF9A 3CZ4A 3SMVA 5ALZA 4Y2SA 2HDOA 3HLTA 2ZOSA 1X42A 3TLMA 2R8EA 3MC1A 1Z5GA 5ALIA 5ALMA 1Z5UA 2ZXEA 3WKCA 3OCVA 3SLRA 1NRWA 2I34A 1WZCA 3WKDA 3A3YA 2P27A 1VJ5A 1LVHA 5ALWA 4I9GA 5A3RA 2RB5A 1ZJJA 2C88A 1WPGA 3L8GA 4KYTA 2I33A 4NWIA 4NAVA 5T41A 2JAWA 1IWOA 4UAVA 4BNDA 2MU1A 5AW1A 3I28A 5AK3A 1U7PA 5AI9A 1N9KA 3QU2A 4BX2A 5AI6A 1RMTA 3OCZA 2C8KA 4DCCA 5AW5A 1RLTA 2IA5A 4RETA 2OA0A 2ODAA 3W5AA 5ALFA 4EX6A 1U2SA 1J97A 4FE3A 3ZW7A 2G09A 3A1CA 5AESA 5AKLA 1YJ5A 5ALSA 2G0AA 3NALA 5ALNA 1RC8A 1ZD3A 3ESQA 2YN4A 2FPWA 2RBKA 5AM1A 3I6BA 4YH1A 5AVRA 1PW5A 3SKXA 4L57A 4NV0A 1KYTA 2NO5A 3ET4A 5AKEA 2HF2A 3NIWA 2WM8A 4EZEA 5AVQA 3OCXA 3QU5A 4DWOA 3ONNA 5ALXA 3NUQA 3QU9A 2YMQA 2ZBDA 4XPZA 5AVXA 2GHQA 3SHQA 4QJBA 4C4TA 1QQ6A 1QH9A 3K1ZA 3L0CA 1TA0A 4H1WA 2PKEA 5AW0A 2BDEA 3VAYA 3QYPA 3MMZA 2CFRA 5AM3A 4F72A 2IOFK 3E58A 3KZXA 3L8EA 2O2XA 3L0BA 3PDWA 3D6JA 1ZD2P 2B8EA 2I54A 4KNVA 2G06A 2HCFA 4Y2TA 4UMFA 4OCZA 2FUCA 2IOHA 1Z4KA 1WVIA 2P9JA 4L6CA 2JARA 4UM7A 4B6JA 4EEKA 2JAOA 5AHXA 5JJBA 2I55A 5AK4A 1MH9A 2NO4A 4BX0A 2CFTA 3UMCA 4Y3UA 2B30A 1RMYA 3NASA 2P69A 3R09A 5AM4A 5AKIA 3OTQA 3FPSA 5AKZA 3ZX4A 5AM2A 2AGVA 5AW7A 4Y2XA 3QUCA 5AVSA 5AICA 3U7GA 4KN8A 2QLTA 3ET5A 3QU4A 4XE5A 3N28A 5AKHA 5AW4A 4CF5A 2PQ0A 2YJ5A 2B1QA 1J8DA 3FVVA 2P11A 1O03A 2G07A 3QU7A 3N8GA 1XVIA 4Y2JA 5AK6A 4AS3A 2QYHA 3S6JA 1SWVA 3R9KA 3ZVMA 4OFZA 4UAUA 2RAVA 2WF6A 2ZBFA 4G63A 3WK9A 4CF4A 4UMEA 3QGMA 4Y2VA 2HOQA 3ZTYA 4I9FA 1ZRMA 4CF3A 5ALKA 3MN1A 1FEZA 5AVZA 2B8JA 2G08A 2ZBEA 3UMBA 1TJ3A 3KDPA 2GMWA 4PNHA 2FPRA 1L7MA 3W5CA 2VKQA 4MUMA 1RKUA 4UARA 1T9ZA 2G80A 2BDUA 5AIBA 5ALEA 3E84A 5AVUA 5ALHA 2ZG6A 3FM9A 1T5SA 3KBBA 3QXGA 4DFDA 4HGRA 5ALTA 3L0YA 5AKGA 1L8OA 3NANA 1L6RA 4JDPA 4Y2QA 3ZUPA 4AS2A 3IJ5A 3L1UA 3WGUA 4MWOA 4BYGA 2WF7A 3DAOA 4QQFA 5ALRA 2HI0A 3OPXA 2WHEA 5AM5A 1Z4MA 4UATA 4EX7A 2JAUA 3OCYA 4UMDA 2ZBGA 4BNDB 5AVVA 4C4SA 3QUTA 3KC2A 3UMGA 1TE2A 2YJ3A 1Z4QA 5AW9A 3J7TA 3HYCA 5AI4A 1Q92A 5AK5A 1S2OA 3ZTWA 1N8NA 3FPBA 3PGVA 1RKVA 3A1DA 3AR6A 5AI0A 4YIHA 2Q4TA 1VFPA 4J2TA 2O9JA 4RESA 4BX3A 4BEWA 5AW3A 3IB6A 5AI5A 1RDFA 4ZEWA 1RLOA 2W11A 5AVYA 1S8OA 1RMQA 3QNMA 2FEAA 5AW6A 2JGAA 1YMQA 5AVWA 3U7HB 5AKXA 2R8XA 5ALVA 1QQ7A 2OM6A 1QYIA 1AQ6A 5A3QA 5ALQA 3U19A 1Z4NA 4GXTA 3EWIA 5ALLA 3ZVLA 2GHTA 5ALJA 5AVTA 1XPJA 3L8FA 2YMLA 1Z4IA 3N5KA 1Y8AA 3AR3A 4YCNA 2B1RA 1WR8A 4UASA 1XP5A 3UM9A 1L7NA 4NABA 1JUDA 4G9BA 1RQLA 1U7OA 5ALUA 3AR5A 1ZOLA 4EENA 2WF8A 2BY4A 3IRUA 3M1YA 3P96A 4ZEXA 1U02A 1RQNA 4Y2UA 3WK8A 1NF2A
chains in the Genus database with same CATH superfamily
1C30A 3B6JA 1UXIA 2HTFA 2FMHA 2IYSA 1XKQA 1R4MA 2VSYA 1SHZA 1FYFA 3G2LA 4DV0B 1OX4A 1UBRS 1J2UA 1YQ9A 1Z12A 3OC0A 4JJ7A 4M9XA 1TZCA 5FRDA 3PWTA 2VJPA 1LA2A 5MF6A 3COJA 4UTRA 2N42A 3EFOB 4QFCA 1HT1E 3AZPA 2BM8A 4XM1A 4RA6B 3G8YA 3NIFB 1B00A 1QSGA 2GB4A 1E2NA 3WJ7A 3L93A 4BRSA 3BMNA 1XDSA 3RRNA 4H1VA 5T5QA 1ISRA 1PCXA 2J0VA 4I1IA 4WOKA 1UKAA 1A8PA 1HBJA 2QK4A 2HMAA 1NLFA 2B4RO 4EDHA 5CFZA 3FR7A 2X0RA 4YWJA 1O9GA 3UV3A 2UXBB 4I6EA 4OIFA 5AUPB 3QEOA 5D5QA 5I4IA 1A7JA 1WMEA 3RVNA 2FHSA 4F2DA 1SXIA 4N1AA 4AS1A 1NVDA 1Z08A 4LZWA 4CT0A 1A9ZA 1M66A 3AF5A 3V8BA 3O1LA 3Q98A 1CR6A 2A7XA 2VDRB 1WKBA 2WB4A 1ZMBA 1E6KA 1S4MA 3U13A 2ANCA 2CXHA 2FWAA 1ZVMA 2GLTA 4LOHA 4MUJA 5AKKA 5A2QA 1K88A 1M8KA 1W4ZA 4OD0A 2HA0A 4NDAA 3KQWA 4WERA 4G1EB 2RSLA 1GHTA 4TRNA 1Z82A 4FHZA 3A1NA 1ZSNA 3C4JA 2XCRB 4FGWA 3G5LA 1P4RA 2OV4A 3ZU3A 3SEQA 1B8OA 1P33A 4FNMA 1VQ1A 4KPGA 3VUEA 2Q4DA 3A4LA 4MR9B 2PS0A 5HW0A 4QUJA 2KS6A 3MMXA 4I1UA 4R83A 5ALPA 1W96A 4E5VA 5JHGB 2BTEA 5CVEA 4TS3A 4YS6A 3MBKA 1CZOA 3WGTA 3DMDA 2ST1A 2GWHA 2BFOA 4YV2A 2QM7A 4GD3Q 4WKBA 4ZMRA 3QUQA 1BHO1 4MUYA 2IEBA 4UUPA 1D2EA 3BWMA 4GRIA 4WEQA 2F3RA 3N74A 1LQTA 4W63A 2X3YA 3WLJA 3CG0A 2BFCB 4YRJA 2QSYA 4MYUA 1YS4A 4PU0A 3GLTA 4Y1FA 5DCYA 4ZQEA 1DEXA 3WICA 3V4VB 2IDZA 1OH8A 1ZK1A 3EWAA 4NIMA 4HWSA 1XRRA 2O8NA 1Z38A 3MFQA 1FTWA 3U4CA 5KC8A 1UBKS 1W5TA 1VJRA 3UTCA 3IVRA 4M0DA 2Z9CA 1O6ZA 1P9LA 4MVJE 3SD7A 2A92A 5JS2A 2FEOA 2JHPA 3FRJA 5FPTA 4AULA 5LMCA 3G0OA 5LBIA 1L4UA 2IEZA 4BLWA 2QRMA 5IXSA 5MGNA 4HQ6A 3WLQA 3L01A 4BO3A 1V3VA 5IKOA 2WUDA 4G4JA 3A6EA 4C0KA 4B32A 1F3LA 2Y1EA 3T3EA 2A84A 2HQBA 3L7YA 4U2EA 1K8YB 2P79A 3RYHB 5I8WA 1MKYA 1AGXA 3HY6A 3LHIA 4OGKA 4O4HB 5FLXA 4H0NA 2FQYA 3V2GA 1QO0D 1WB5A 2R68A 3CZ9A 3E35A 4EVQA 2EAUA 4JL6A 5F9MA 3ZJ5A 4PG8A 2XUIA 3T1NA 3IALA 4C0XA 3NS7A 1E3JA 3ROTA 1ZUNA 3OMWA 5G1PA 5DJ5A 3AUAA 2Q9UA 3WMFA 5JZVA 2IYOA 3GJSA 4CLOB 4IIJA 3B1XA 2J5BA 4B85A 3OZFA 2OB1A 4HS9A 1NL3A 2IYTA 5A5EA 5JNRA 1MHTA 2CV0A 2V0GA 1VHTA 3OT5A 4LJKA 1Q6YA 1SUFA 1U1EA 3MPOA 3G8BA 4LXQA 4ZQGA 2HSZA 4DARA 1POXA 1ZUWA 3HDHA 4I2NA 1AS0A 4R8KA 3PEFA 1MC8A 4UEKA 1MG0A 2I2FA 2VH5R 3I2JA 4ETNA 2ZPAA 3FFBA 3GGPA 4B8WA 4Q66C 1FP4B 4ZDKA 4A0GA 4IUCS 1VLJA 4MDHA 3T7AA 3FMFA 2YZMA 3WKAA 4AIIA 2XCSB 1A69A 2R6DA 1EHYA 2VUTA 1E8DA 3NNSA 1JHVA 1LTQA 4DG9A 2AR7A 1Z4OA 5KCMA 4DPKA 4I6JA 3DHYA 4QXOA 3KOMA 1X7XA 2VWGA 3FWPA 3OZAA 2IXDA 3HA5A 4FONA 4QDKA 2I4RA 1QDLB 2OILA 1T8YA 2WJIA 3LOUA 3A1UA 3W1WA 4BWGA 1XEFA 1ZK0A 3DBRB 1UBNA 3Q8WA 4D8XA 2CLIB 2G40A 4C07A 5BN4A 1PE0A 2BR4A 2E5FA 4N3BA 1TVCA 5D5PA 2I78A 3QUSA 3DCNA 2H06A 4G85A 4MV8A 2MSNA 4AC9A 4FFVA 1PKEA 5JFTA 1USGA 4GQBA 3CBGA 1C29B 4BAGA 3HH8A 4GZ6A 2Q4OA 3SZOA 1G21A 3RIGA 4D97A 4CR7A 3VU0A 5KVQA 3MQFA 4QEZA 5I7FA 3HEMA 2Y6VA 3SF8B 4LXIA 4UHCA 4YRLA 1CQWA 1THGA 2O0MA 1IVNA 1XQ9A 1N2CE 1FL9A 2JFQA 3FGZA 3P1JA 5YASA 4EJSB 3WZ2A 1W85A 4BV9A 3BD8A 1W76A 2ZIWB 1N33B 2K7FA 1LF0A 1R0CA 4N6NA 3RC2A 1M1YA 1E1LA 1E9EA 3O4FA 3H5NA 2H31A 2IUEA 4FQ5A 4D6PA 1V6SA 4C7OA 4AG5A 2GHIA 3BXOA 1TDJA 2H65A 1VJ5A 3CPSA 3MCAA 5JFGA 2EFGA 2OUKA 4H17A 2H2IA 3V7YA 2H5IA 5G2OA 4HD8A 2AYXA 3L8GA 4Q18A 5J43A 3U17A 3FPLA 2X86A 1S2GA 4OUDB 3V42A 4G0XA 1U1CA 1RHJA 4LJ6A 1X74A 4H0FA 5LPNA 3JQBC 1PTJC 3NNDA 2Q6OA 2XGGA 3CXUA 4M0FA 2O23A 1NPTO 3HBJA 3HYTA 5SYNA 3WE7A 4G1BA 5BRAA 4CL2A 3K70C 1ZNYA 5D3MB 1R6AA 2OAEA 2JASA 1JDBB 3VFDA 3A1TA 2G4CA 3OOHA 3OWOA 4WRRA 2UV8A 3KZMA 4HEJA 4EY7A 1ZSYA 2HA2A 4NBUA 5A9SB 3NWJA 4EX6A 1GPAA 2XVAA 4LY3A 1HDZA 1R6TA 2VDPB 1J0AA 2F1KA 1Z9BA 1KZ6A 2HREA 4K3UA 5I01A 1IBLB 3UMJA 2CJFA 2HO5A 3OFVA 1P6QA 1QQTA 3P0RA 4P5PA 4IICA 4E33A 1ZKDA 4PGMA 5FWYA 1NNEA 1ORIA 3FTQA 4PCLA 2W0MA 4W9NC 3IKTA 5IDQA 2QJFA 1N7IA 4MCAA 3CRRA 3WS7A 3WXBA 4DSOA 1YXMA 5AVRA 4RE5A 2FMIA 3N2KB 4A26A 3FOEC 5C8YA 1F14A 1NMEA 1QHHB 3ANSA 3EWSA 4L57A 4QC2A 2C4WA 2NO5A 5F76A 5B3LA 3MBIA 2GA8A 1YMUA 3ACCA 2VK2A 1V1RB 2CBXA 1NA5A 1QXSA 3BH0A 5IRCD 5CCEA 2QRUA 3MTJA 4X54A 5BWLA 5IKXA 3AXTA 2EZUA 5J2TA 4QNRA 4IW3B 9GPBA 2GUWA 5L3QB 4CQNA 2YMQA 4LJYA 3W8NA 4XYGA 4GPTA 4KFRA 4QJBA 1VTKA 1FS4A 3K1ZA 1JV2B 2P8SA 5LBUA 4WBNA 1A7UA 2RCNA 2Z8ZA 2OVBA 3TAXA 1V1JA 2QORA 3D31A 4WLNA 5LA6B 3QUAA 1QRUA 1T9AA 2X9VA 1B76A 1LRJA 2ZIVB 4G4GA 1ZVQA 5IVPA 5EZYF 2BTOA 1DRJA 1DIBA 1UFOA 3IO5A 2GCOA 3RKSA 3VOBA 4I5IA 5AM3A 1I7SB 1OT5A 2RI1A 3WOHA 4F72A 1N77A 5JR3A 5M29A 5CFMA 1CIJA 1W88A 3DLPX 5KNBA 1K4YA 1JALA 3LG2A 3D6MA 4LRSB 4DVJA 3DEHA 2V54A 3L79A 3HGTA 1TTQB 1MAAA 1S01A 421PA 4Y2TA 4RDHA 2Z3VA 1DAMA 3ADCA 4AK9A 3AVXA 2QQ5A 2HBRA 2NVOA 4FWTA 1UBMS 4O4IA 4UNIA 4GM4A 2REQA 5JJKA 3LLSA 4YP5A 5LKRA 2PHZA 1E20A 4BNNA 1OH5A 4UBKA 3B6IA 3FLEA 1UBHS 4ZRNA 3FIUA 4WMLA 2PZMA 3C3AA 1NQ5A 3CZ5A 4TVOA 5BSFA 2NO4A 2VAVA 4HUJA 4O4HA 1LFDB 3NC1C 4BCDA 3BTSA 1GSOA 1SXJE 3K9WA 4QUBA 4F4HA 1E3QA 3PNVA 2F55A 2C3UA 2G9QA 2JH8A 1HT2E 4M55A 1FNNA 1Y7LA 3ZX4A 1E2DA 1EBBA 2X1VA 3UEOA 3DDZX 2BSQA 1T13A 3PC8A 4LJ9A 3AG6A 3L7LA 1VYVA 2IYWA 3ZNNA 3IIIA 4L4SA 1J07A 4LRWA 4YJ2F 1S8NA 3R7DA 4JD5A 4X71A 1NBOA 3TW8B 3U3XA 1XMSA 3C7DB 2I4OA 5DGHA 2XLBA 1YF3A 2WJYA 4G1MB 1B8UA 1GAWA 2JJYA 3F78A 4G0WA 3R74A 4W1RA 1HNXB 3NCTA 1JB9A 1JG1A 2IOQA 2WHYA 3IQFA 3VH3A 2ZCJA 1EGAA 4FYWA 3OPYI 4U9HS 1ISGA 1GJRA 4OM8A 1YIDA 5H70A 4YP0A 3GLVA 1ISFA 5GVSA 2RHRA 3U4IA 4OSEA 4QOHA 4XWAA 3OEHD 5H3HA 2EQ5A 1KPHA 3UBTA 1CUUA 2OY0A 5JRDS 4DDHA 4P98A 5L3SB 2JI7A 3RGGA 1EM8A 1YHNA 1ULUA 4IQ4A 3WSVA 2WAYA 3S3TA 1GZSA 3LBYA 1EPUA 4O5OA 5LUBA 1OXKB 3NOQA 3J81k 3FSEA 2CFCA 3RO7A 3ZWXA 2I6QA 2F4VB 3L77A 3IIKA 3KQVA 2LWIA 3W9SA 1QP8A 2OXEA 3HR7A 4RHUA 5G4KB 3EDOA 3N87A 1B6GA 3ZH9B 2L18A 4DT1B 4KDCA 3PDHA 3LXXA 1P91A 3O8DA 3OO0A 4C6TA 1OIVA 1QOQB 3KBBA 3QWAA 4IIFA 1F2TA 2HF8A 3UENA 2HLHA 4HPWA 3P0HA 1E5LA 2HM7A 5JVDF 3M9WA 2BBWA 2I2XB 3Q3IA 2DRIA 2W6NA 4TLAA 3HWX1 1NUHA 2QM0A 2QW8A 2DM6A 1XNHA 2WIDA 5D1HA 3N2ZB 5I3CA 5LYYA 1BC5A 4A2WA 1VOTA 4JR0A 1W85B 2WJPA 4LOAA 3VR5D 3O8CA 4E2FA 2RBEA 4W9MC 1F17A 2YCLA 5M5BA 2WVGA 4ARZA 4BEJA 1Z4QA 3W77A 2O54A 4HDQB 1GNVA 4REQB 1W73A 4AF7A 1VC2A 4ZZ1A 3NTLA 3CW2A 4D45A 4NNPA 3E9CA 1H5QA 5AQ1A 2X9LA 2WB2A 1YVRA 2ZROA 1YVPA 1E4EB 2IHJA 2HV8A 2WVJA 2ATVA 3PXUA 5EVJA 3VTKA 4AW9A 1D2AA 3MUNA 3E22B 3ZS9A 1XJQA 4XX0A 4C0QC 5AW3A 1OBHA 5A03A 4U5XA 1Z62A 4MPPA 2HA7A 3E9RA 4NEGA 1T1IA 1Z6AA 1RLOA 2DCMA 3Q10A 5SV2A 3OFNA 3EQ6A 4MXDA 4IKPA 3Q0TA 1WZUA 2D0PB 2I6UA 4AICA 4BNKA 1J25A 3OKFA 3R5JA 4NNOA 3WLTA 2NVUB 1PLJA 2QPOA 1SBIA 3ITNA 5CA1F 2R7AA 4B7AA 2ZJ1A 3ILVA 2R1UA 1EXWA 5ALQA 1XVVA 5DM0A 2R1VA 4YFVA 3U19A 3IUSA 6REQB 3OLYA 2H4FA 4CGZA 1JDBC 1UPAA 1V2GA 5ICCA 1AA9A 2FSVA 3TZQA 3NW9A 3L8FA 4YDQA 4HKTA 1NLUA 4G9EA 3LYHA 4L4ZA 2Y71A 4QNNA 2XVMA 5TRTA 3T1HB 3AR3A 5J1TB 3ETEA 2ZUFA 3F9CA 2YY5A 4WFKA 1R9NA 2AN5A 2C83A 3ULKA 5JWOA 1G7RA 3ILXA 2A5FA 3EASA 1J5XA 3UM9A 1AKWA 2HD4A 4UBMA 1WU8A 2F1HA 1YDEA 1XFAA 1ZHHA 3ECAA 4D5EA 3AJEA 3AETB 3LXUX 1JUDA 4OMCA 4EVRA 2Q6TA 1FJHA 5J59A 1W1IA 4FD3A 2YDXA 1Y0BA 4FLEA 2PTHA 4IH1A 1JFVA 4Q03A 4CMBA 4M49A 2WNSA 3QBVA 4X97A 4ZK6A 3ENZA 1IHXA 4LF8B 4W8HA 4GSLA 2JIZD 4H60A 3M33A 5EE9A 2XE4A 2EJWA 4W5HA 3WK8A 5KX5A 1GVHA 4WLEA 3ROFA 4DWWA 3IE1A 3ISJA 4C43A 4JLNA 3I0MA 3LXRA 3KQOA 3EPRA 3F9RA 2HN9A 5KTMA 5M3BA 5CCDA 4ND5A 2ZYTX 4YEDA 1ZJ4A 5AM0A 3B51X 2CLEB 3D1JA 1U8FO 4D41A 4OQ4A 4EP1A 5IH3A 1VMEA 4YJFA 1Z3IX 1CIPA 2EJBA 2YVAA 4DC1A 1U3WA 2ONKA 4M0MA 4NYMR 4X1OA 2C2WA 4MV9A 3L1JA 4QARA 2JLXA 4Q1FA 3EG9A 2HRZA 3EJWA 1T25A 4AJ9A 2HBZA 4PYLA 2ZTMA 1TNDA 3GJ6A 4CNBA 1FUKA 4CV2A 2OO5A 2AOUA 5HDQA 1K9VF 3SF0A 2JHGA 1JG6A 4NMLA 3H1EA 4OJKA 2E0IA 4ZVVA 4D81A 4TRJA 2H52A 3N2EA 4KWTA 1AHPA 1D5WA 1W93A 4OXQA 2QB5A 3LOPA 2C3MA 4XIJA 1PJRA 3GQBA 4UZFA 3TGWA 2XD4A 1HA3A 4YCMA 1YULA 3AONB 3E53A 4DEYA 1ZHOA 1WMDA 5TNXA 3T7JA 3UFXB 5U9CA 3PC8C 2DBQA 3PX2A 1VYHA 2Y0CA 4G5HA 4HEA1 3NC0C 1V45E 4J43A 3X1JA 1WY5A 2PVCA 4D3SA 4ZFNA 3RROA 1JKFA 2YL2A 3OIVA 2BYTA 1K2WA 5HYVA 2ZTHA 1T1JA 2GPWA 1G4HA 4V02A 2A35A 2H7CA 3C6XA 1AB5A 3RIYA 1J2RA 1A71A 3DA8A 3WRXC 2EJCA 1USKA 1QAOA 2FRVA 2PH5A 4G8BA 2B20A 4F5DA 4MDEA 5FTLA 5BSHA 1VSVA 4KO2S 5T8KA 1CQZA 3ZLTA 1OWNA 2WU8A 1B43A 2QSUA 2Q3FA 4GG1A 5DBFA 2J67A 4QOFA 3T1QA 4R0MA 5BSGA 3KUCA 4XH9B 5I9SA 3GJTA 1NXTA 2VTDA 2E3JA 4ARZB 5B2EA 5LZ2A 4Z4IA 1SM4A 1R8YA 1XD9A 4FQ8A 4XWKA 2QX9A 5ES4B 1MD9A 3QJYA 3K6JA 4CG2A 3SE7A 5ADWA 2VQEB 1T3LA 1TM4E 1PZXA 5CLHA 3LYLA 4I1VA 2O4CA 2EW1A 4QUIA 3DO5A 3JYLA 3EMBA 1TM3E 3LVQE 4P7FA 1E9AA 1V4BA 1ZGBA 1EAMA 2OZKA 2G1JA 5KYUB 3C41J 1JWBB 1THZA 3AIIA 4OH1A 1FU4A 3FI9A 2XA2A 1KAHA 3PQDA 4QREA 4JZYA 4MQEB 1FFCA 2XCUA 1ODFA 1MV8A 2R7MA 3FNGA 3IYLW 2ZJ7A 5KMGA 4F86A 2VAPA 3EGOA 3GUVA 4UZEA 1O89A 1P2SA 1Y7IA 2RCYA 3UFBA 5BURA 3S4YA 4M6WA 1SOAA 4XUDA 4PSCA 3NOVA 1FS5A 2A0UA 5DOVA 5BMVB 1P61B 1VPTA 2VT2A 3COSA 1OBOA 3CX4A 2HJVA 5F5XA 6YASA 2C9MA 2UAGA 4KIFA 1D07A 1OH7A 2DX7A 3OM1A 1V3UA 1NFQA 4R6WA 1UIMA 4X1IA 3TNJA 1R0RE 1Z5VA 3GD5A 3HVUA 2JD2A 4CI0B 1WTCA 2WVAA 1NUSA 3F46A 5JSZB 2H08A 1QZ3A 4LDRA 3HBLA 1MW9X 2BT4A 3RJ5A 3PQFA 4NV3A 1M2OB 1SQFA 3F6CA 3LP5A 5KTKA 1MFPA 3TTWA 1R16A 2I7XA 3A6HA 2XAAA 1GQSA 4W99A 4RTMA 1F51E 3KKNA 4PPNA 1PEKE 2HLNA 3BB1A 1YDFA 1E3TA 1UK7A 2OCKA 1GUDA 2G77B 2QN9A 4P54A 1PU2A 4YJ3A 3WGVA 4P35A 5K09A 4CBVA 1DL5A 4D9NA 1JPUA 1NF8A 2IP2A 3RAEC 3FWNA 3AR7A 1OE0A 1VMDA 3KSRA 2KM1A 3OF3A 1DAIA 2VNHA 4JOBA 3ZWAA 1LI4A 3E4DA 3OKPA 3B7GA 4E2XA 1BXGA 4YMVA 2VR1A 3UMRA 2A0WA 2Q1YA 1Q83A 5JAOA 4R3UC 1JKJB 2BF7A 2P9GA 2V0NA 1IL0A 3QITA 4F4JA 5ICMA 2RHTA 2FPIB 3VV2A 4KVGA 4TTQA 2DLCX 1KMHB 3ZXUB 2IPMA 1NQTA 3PFBA 3HA7A 3S2ZA 1W0JD 3ABSB 3DMNA 4LYHA 1K97A 3TZHA 3GQBB 3Q7EA 4L7VA 2BISA 2XCIA 4ZYYA 1LPSA 2XXJA 5E7QA 4JROA 2A9FA 2Z98A 3N0WA 4U6NA 4BO2A 1OAOA 1WEHA 3DEZA 4RD1A 5B4TA 4MEJA 4BNGA 1Z33A 3A1EA 4FB4A 3NKLA 4C9BA 1BMTA 1V11A 4G2NA 2HYDA 3NVAA 5DBIA 2VP0A 2ZQZA 2YHSA 4OL0A 2KPOA 2XA1A 1DBIA 1TT5A 1T8SA 4BO8A 3KYBA 1ZPDA 3H5LA 1GR1A 3F6PA 1IN1A 3QLEA 4CM3A 2J5QA 5DWVA 3A6FA 3T9FA 1RRCA 3L40A 1SZPA 1HF3A 1DEKA 3C8DA 4QT0A 1IQUA 2JCVA 4DCUA 3HVKA 1YRYE 3ENKA 5JFOA 3A58B 1LF5A 2WR8A 3UB2A 1EB8A 5FBQB 4ND3A 4EH1A 3V4LA 3C43A 1NX6A 2P5UA 3PFGA 5KYKA 1NN0A 1VXRA 3DDNA 3DZBA 4TM7A 1TJPB 4PONA 1SIBE 2QN7A 4I8DA 2C7QA 1EXNA 3T4EA 2I4MA 2IC5A 4KR6A 4ND7A 1TCUA 2PEZA 4BNFA 1NJ8A 4A10A 1U2PA 3THXA 4REMA 2ZIAA 3EPPA 4BTLA 3ZE8A 4HT3B 5IJ9B 2HK8A 1BJKA 1MOZA 1QMGA 2E2WA 3PRHA 1R0YA 4KQHA 2DKNA 1YBHA 2BKEA 4EARA 3L8CA 1TKRA 4I9GA 2IZ6A 1A1VA 4CM9D 1GGMA 2L2QA 4RZIA 3CB2A 5IN4A 1V1RA 2E4YA 3O84A 1MB2A 2Q7OE 5IUJC 4RMGA 4QL3A 2CCKA 2D1SA 2P8JA 2R25B 1G2PA 4AP6A 5HILA 4MO2A 3PNSA 4EWLA 3SQXA 1E1RD 2QL7A 1JSXA 1LWOA 1YS7A 2Z2XA 1WNTA 3U44A 1FOEB 3CZMA 4QFMA 2LKCA 1G21B 5BV7A 4GX1A 4BNVA 5CEFA 1PVVA 2Q3JA 3R3JA 5FEMA 3B20A 3GF4A 1JLRA 3B3AA 2A8YA 4V2UA 1VHQA 2XF8A 2B69A 2A2ZA 4YWHA 3NOOA 3HSYA 5IH7A 1UOEA 3O82A 5HRAA 2CLFB 5EWLA 3MIZA 7YASA 2NO1A 1E8NA 5AXAA 3GOQA 1DCFA 3RVDA 1PJZA 2Q3EA 3W3AH 5EMJA 3HU2A 4UVEA 1GRRA 2ZVPX 4AKTA 2Q3BA 2CL6X 4Q9AA 1EFHA 4YFYA 5GJVC 3VR0A 1RM3A 2B92A 4LDNA 4J4TA 4B2IA 1OVGA 3UY4A 1V8PA 4ZODA 1QH0A 4A0FA 3SOPA 4RCYA 1TK3A 1RHQA 4Y6OA 2WJHA 3PUJA 2NQ2C 1U7HA 4ITVA 3IPYA 2XWBF 4IIBA 1M8FA 1GNTA 1XKLA 1KIAA 3EISA 3L84A 2P9CA 1YS1X 3GPDG 3WGYA 2AQKA 3PXCX 4L50A 2OLKA 3CF0A 3NBFA 5SY9A 1ADBA 1VIMA 4WVLA 2IWRA 3LE8A 3V8NA 3NH6A 4B81A 2I3GA 4IDEA 1NTRA 4S1VA 4AKHA 2VDWA 1N8TA 4EUNA 4AUEA 3G13A 3TSYA 4BGVA 2C4KA 2GEJA 2FG5A 3HZRA 4PAOA 5IDVA 4U6SA 5IAAA 4WNAA 1U7WA 1JNYA 3FCUB 2HWKA 1Z7GA 2VSXA 2ERXA 5FPPA 4B40A 1NJ6A 1I7LA 4P4GA 8OHMA 1KI2A 1GADO 1T35A 4QHYA 4LE0A 1Z0UA 1V26A 3BBLA 1QP0A 1P80A 4PVDA 4EJ0A 1EDDA 1N4AA 2C54A 2X5JO 4KO1S 1DOAA 1PT9A 1Y7HA 2IOFK 3EIUA 3J81A 1YDWA 3NWPA 3PUWA 5KYYA 1QU3A 4ZA2A 4DGQA 1GZ5A 3H05A 5TQ0B 2BEUB 2B8EA 2J4FA 3G68A 2O2ZA 1W59A 4N8SA 1DBVO 1XTJA 3JVEA 5I8PA 5BN4B 2R7KA 4EIWA 5B1YA 1TPZA 2Y27A 5JWHA 4DDTA 1Q5PA 2PFSA 1HQKA 4K9RA 2X58A 3GRAA 2V1XA 1FYWA 3HS3A 3CKMA 2GN9A 2Y0BA 2QTHA 1AKMA 3LIPA 1SG9A 3LCUA 3L7DA 3ZD7A 1V1MA 1EX6A 3KELA 1LSJA 2VNAA 3W2IA 4C6SA 2HDHA 3TN7A 4P32A 3ZY3A 2QJTA 4X64B 2VC2B 3EGXA 2OFXA 1UC8A 2WTNA 4X5OA 3M6UA 3OTQA 3H16A 1GQYA 3EC2A 3O38A 3OZ7A 4NBNA 5LP6B 1U7XA 3PQEA 4JV5B 3DAPA 3RFVA 2ETXA 2AYYA 3MQ2A 2ZYUX 1E2BA 3ZDDA 4I8XA 3QELB 1L5GB 4LV5B 4E30A 3U7GA 3L6DA 4AU1A 1T3HA 2V9PA 4ZO7A 4P22A 3CZAA 1CQJB 3K1YA 4BKQA 3H3JA 1JLLA 2GBCA 4IHJA 4H7FA 4FBGA 5EESA 1CLUA 5CNIA 4BCBA 4HFJA 2B1QA 4PBRA 2E4AA 2J9YB 4NOMA 1B74A 1H6BA 3ROEA 4UQLA 3K71B 4KSYA 2X3FA 1P17A 2ASVA 4IOMA 4GPEA 4LDAA 1KJNA 1T2EA 1VE7A 3ZBQA 3HCBA 3IXMA 4G1UC 7REQB 3HSKA 2GAJA 3DOIA 5KKCA 3A7EA 4Q1DA 4HYYA 4KE7A 3C5CA 1J70A 4YAIA 3H3FA 5LZ9A 5FBVB 2A14A 2GD2A 2QZPA 3DE7X 1Z0JA 3L7OA 3FCOA 5IYZA 4PO3X 3HABA 3NVKI 4CT4B 3P32A 4XGIA 5CT6A 4GICA 3SHTA 5B4VA 3K1AB 1S2MA 5CX1A 3UOWA 4JLKA 1XU4A 1EFDN 3LWNA 3OSUA 4NG5A 3RUEA 1FB5A 5ECYA 1KOLA 4GLJA 4EGSA 3WMGA 3H8SA 3GRKA 1HTWA 1Q1EA 2A5JA 5KYTA 1T0UA 4ZHQF 3N59A 4ZGBA 1XTRA 4HO1X 3ZY4A 4ZOCA 121PA 1T9ZA 4RY9A 1UQUA 5DI3A 1HMPA 5KJ1A 1T0IA 3PHLA 2G8LA 1T1GA 3DUFA 2B94A 2O8BA 3ECSA 4HGRA 3OFND 1WUKS 3OLXA 2XQIA 4J29A 3OP1A 2XT9A 1QIIA 1AUQA 1QNLA 2C7BA 2XDQB 3CRW1 3F1LA 4MWSA 4WKPA 4MROA 2HU2A 5ESDA 3TTXA 2Z9BA 4TL6A 2ILTA 1KH2A 2YIDA 4BMZA 1SNYA 4QIHA 3ZY6A 4YCCA 2V5UA 5B7QA 2CWWA 3W2TA 2OQVA 3HE3A 4QQFA 3NP9A 2HI0A 4CMCA 4L8GA 4PYIA 1PEYA 3RJZA 4Y18A 1CEXA 2GRJA 4GBMA 1JTFA 2ET6A 1O5TA 3U62A 3HXOA 1QZXA 4DS3A 2PH7A 3C4QA 1H4VB 2NUTB 2ORWA 2C94A 2XE6A 3NHZA 4Q9LA 2YJ3A 2JK1A 3GDFA 5K0NA 2XVZA 5TGDA 3WRYC 4UOEA 4K6FA 6ADHA 2OFFA 5AW9A 2EFEB 1YA4A 2VVTA 4J6EA 3RSGA 3K9FC 1KU6A 1PUIA 3Q40A 4UCFA 3FG9A 4QUEA 5I9BA 1TRKA 2QE6A 5IDYA 1NW6A 4QTTB 3EFBA 2OFPA 3D5TA 3PGVA 1RKVA 5ETJA 2HXGA 2MCFA 2EP7A 2P4SA 4UUNA 1Z2PX 3CWQA 3OI7A 3S68A 4LF6B 2QM8A 1AF7A 4YCSA 1MAHA 3EVDA 4CPDA 2ZCUA 4ID9A 2OOSA 4OJMX 5EIHA 2QUIA 4GHWA 1G2IA 4IO1A 3RIXA 2YWRA 3AL3A 1MNQA 3B60A 3F90A 1RE0A 2FQXA 4JU8A 6LDHA 1Q3HA 3V3KA 2RGNA 3CY6A 3S1SA 4PYQA 3TLCA 2ODPA 3PQ7A 3ELWA 3OJOA 3FPJA 1M2VB 1MX1A 2MMCA 1ZR4A 2ID7A 2JI9A 1A3CA 3AKCA 4J3FA 4ER6A 2H4JA 4ZDJA 3C85A 4ZI7A 3HEAA 1MO2A 5HE9A 3VRHA 5ELXA 4YYEA 3VNUA 2Z5VA 3MTDA 4DV3B 2XNDD 4EMBA 5HKBA 1C1DA 3A14A 2E1PA 4QDUA 3JAWB 1WZ2A 4WJLA 1HETA 4RVGA 5A4AA 3UAXA 1WD7A 4CHTA 3I72A 2RHGB 1N2OA 2I8LA 5KNCD 3KJFA 2YMLA 2UUPA 2J1LA 1TMYA 4DOMA 3SJCA 4EBFA 1B6TA 1EXMA 4KXFB 1XD2B 5BMOA 5K2OA 4LA4A 4WDQA 4TZ6A 5DISB 4E32A 3VTZA 4X6YA 4IXWA 3OA0A 3NQ41 1WXQA 1DWPA 2C5LA 4MUEA 4V1CI 3ROPA 1AQYA 1Q0HA 2VRWA 1NUTA 1DIGA 4R1NA 4BRZA 3X1XA 3U6KA 1AZTA 1CDEA 5EE3A 4EHFA 2DWPA 4TYQA 1EUCA 1R3DA 4PZ0A 2CJYA 1XTQA 3NBQA 4ZVNA 1XZJA 2WSBA 3KV3O 4H9GA 3IRUA 4K5QA 4UUQA 4HDSA 4EENA 3HO6A 4RVFA 1TAUA 4O02B 2PWYA 5C46F 1U02A 3A37A 5HS6A 1YB6A 4HNTA 4OK5A 1BHSA 2OOKA 2XXBA 4JQZA 4BO9A 2X41A 2E87A 4F3NA 1I7QB 2K87A 2PK3A 1L5LA 2H4ZA 5LKAA 4EHIA 4EOGA 1N57A 3A06A 4X90A 1P5JA 2YBDA 3A4VA 3LUFA 2O2IA 4MP6A 3ZHTA 2I91A 4L2IB 5HA5A 4F3RA 4ZCIA 3HZZA 5SZKB 1IJEA 2WDZA 3L8HA 5TSDA 5B30A 2YQ5A 2OCPA 3AESA 4KHZA 3RS7A 3BQ9A 2AKAB 4UFPA 1RRFA 1ONOA 3ML1A 5IC6A 3GFFA 2YHBA 3FSRA 1Z29A 5FD8A 4B3DA 2HFKA 3WFIA 4B84A 3BDIA 1JYFA 2NSJA 4NMWA 1IG0A 1X3LA 2UZ3A 2H8KA 2WPDA 3OEWA 3PQ6A 4FW8A 3A8TA 4OJTA 4OQQA 1SKQA 5G0VA 3GZNA 4C20A 4TT3D 2VS1A 4B7UA 2JCBA 1ECGA 5B36A 2VPWA 1NXSA 2WZCA 3L6BA 2XOKD 1WHSB 2Q28A 5ICEA 1PK8A 2PS3A 4JLWA 1DTSA 4JEUA 1D2NA 4QPDA 2FEMA 5E7MA 4ZZ0A 4H7HA 5BV1A 4WXHA 1QBGA 3U7EB 1AXRA 1A0OA 1FRQA 1MR3F 2WHXA 3HRHA 3ILSA 4JMPA 5AMXA 1G5TA 2W5UA 4BNTA 4CKEB 5IS2A 1XPOA 1CEEA 2PJRA 5B37A 2PIDA 2PA3A 4A8JA 4CQLA 4DBLC 4EJSA 1FLNA 1P0PA 4KIJA 1X7ZB 3DULA 3O0DA 4GFDA 3RVMA 4E08A 1IONA 5KNBH 3L5OA 4C01A 5L7WA 4UE2A 4I9UA 3ZU2A 1I4OA 3BRCA 3OIUA 5FHQA 3BN3A 1CR4A 2C58A 2H2FA 3E1SA 1ENYA 2B83A 2W6ID 3D7MA 3E61A 3P8ZA 2UYCA 5ILQA 1WL8A 1DGQA 3F3KA 4QHSA 2ZFUA 2KLBA 4N18A 3AJDA 3FYUC 4Z54A 3MJTA 1VB5A 1U6IA 1W36B 3F1KA 1KI4A 2B1JA 3C3JA 4HH4A 1Q0RA 2QIOA 5A4FS 1U8UA 2WQ7A 2W2PA 3I1FA 2SCUA 5ES3A 4J0GA 3HRKA 4C4RA 1CNMA 1Q21A 5DTQA 3WK5A 1T29A 3LY5A 4RBNA 4GYJA 1IN5A 1F0YA 3BREA 1NRIA 2V45A 3Q9LA 3N53A 1TKBA 4KXQA 3AHDA 4JLVA 4RPJA 2QVZX 1XCOA 2L19A 3F6SA 2C2YA 1Z28A 3WG9A 3HM9A 2XUKA 3ZDYB 1NI4B 1DCTA 1ONBA 1TMOA 3RSFA 3SBXA 3KL2A 2ZEJA 2IEDA 2ODWA 1HUQA 3ZV6A 1CQJA 3RWOA 2FR1A 4ZT7A 1X38A 1Z5PA 1TLFA 4RXUA 3VI3B 4EKIA 1AN0A 3A7DA 4ILKA 3HK2A 1HE5A 4JKYA 1I14A 4NR0A 5CJ2A 2ZWPA 2E9SA 3KR9A 3LUJA 4GP6A 4TV8B 1YQGA 4ZEVA 4P3OA 2H1WA 1NE2A 1UBFA 2R1VB 1R10A 2VYCA 4HATA 5T3UA 1ONSA 4X6LA 5A4MS 3E27A 4ND6A 1E6UA 1O1YA 4RK7A 1ZQ9A 3WIBA 4BQSA 5J2UF 4H15A 1I8TA 4EL0A 1Z0IA 5AW2A 4ZICA 2FMUA 3EF0A 4XX1A 5BNFA 4ZCMA 4A23A 3KKZA 1I2AA 3A6GA 2AWOA 2QE7D 2ZIXA 3K94A 4IRXA 4XJTA 3A3PA 4YLYA 4RVOA 1U0OC 1U90A 1W5FA 1VJ0A 2HPHA 3M6VA 1QFYA 4FGSA 2QVLA 4W5QA 3ICQB 1MTOA 1Z0SA 2BFEA 2I7DA 4BQPA 1AQJA 3SBOA 5JNWA 3G88A 3DKIA 1PJ2A 4LBWA 2YN2A 2BN4A 1NM5A 3I1IA 2FI1A 1WS6A 4BWFB 5EZYB 4PXAA 3M2TA 4PFSA 3P20A 3UH1A 1L8LA 3KAKA 3NU1A 2WV7A 4FZRA 1V95A 4NCIA 3HCNA 4EGAA 2FAXA 4OQMA 5F98A 2PSJA 4RXMA 4U6QA 3EVGA 3JQEA 4DJEC 1F8FA 1KYIA 5AUQA 3GUUA 4TLLB 5K0FA 2JFYA 5K0ZA 2XB4A 4OV6B 3A2KA 3GAZA 2FFAA 1UZLA 3HBNA 4FT2A 1NVWQ 1CZLA 3MW8A 4G5SA 4UU1A 4EG4A 3CLKA 2RI6A 3DP7A 4QG7A 3RRJA 2F43A 1SHUX 3DD1A 3LYAA 3GNSA 4FGUA 5CGZA 3U6BA 1EHCA 3EVNA 4BQNA 1KK2A 5F1YA 3A04A 2XYVA 2NTYC 3T5DA 2O1SA 1FNMA 5GONF 2Q7XA 1P7VA 4DDWA 4GLOA 2AG5A 4CIWA 2I6XA 2IYUA 4LE1A 4OG2A 3HB7A 4Q1CA 3UUWA 3OU2A 4EG5A 2GKSA 2Q6LA 1Z6XA 1Z74A 3A4TA 3D2LA 3ES9A 4MQ6A 2O4UX 1CE8A 4JLJA 3X2EA 3MUOA 4X24A 3UK6A 4RWEA 2OBNA 1SCIA 3HJRA 5DTJA 4BQFA 4UZSA 4CCWA 5DGDA 2AXNA 2PA0A 1TT7A 5CH3A 1I9GA 2IU6A 4OHBA 5A1JA 2X15A 3KYCB 5E1MA 2EGUA 2HDOA 3DZCA 3X1ZA 1G38A 1R15A 1KPIA 3Q87B 3F73A 2RE8A 4MR7A 3UUEA 2AZ4A 3S27A 1XDBA 1VJDA 1QLJA 4BE9A 1RJGA 4MLCA 2HEIA 5ALIA 3SX0A 2FFRA 2QMOA 1X94A 2DOKA 3CLTD 1G2OA 4R5MA 4YRRA 4KKVA 5F51A 3OX2A 3PEVA 5DX0A 4H7PA 5K3CA 2PKQO 1Z25A 1E0JA 2A9RA 2C20A 3JQAB 3L4SO 3IR5A 4GOMD 4X1YA 3USES 4ETMA 2DC1A 3FTPA 2P27A 1CRLA 2AUMA 1O58A 4S1NA 1ELOA 4OHOA 4WCFB 3LT0A 5LR6A 5M2QA 4Y9DA 3MLAA 3BUSA 4PC2A 4Y6LA 1I1NA 1NUUA 5FWYB 1TCAA 3JALA 2VDOB 4H16A 3PT9A 4P08A 2FV8A 4IZOA 4MGZR 4RZUA 1TZKA 5HQJA 1Q1BA 4G0QA 2QNRA 2OK8A 3B5JA 3OLQA 3LUCA 4RE6A 2CLCX 3KLMX 1T6XA 5TPZD 1Q0ZA 5DBHX 1V9SA 4UOQA 4NE9A 5D00A 1WZEA 4MIYA 2NPFA 4ZKDA 1F0KA 5BQPA 5IVKA 1UH5A 2IITA 5U4XA 1MX3A 1WA5A 3EOZA 1WX1A 2PO5A 3OUTA 4EJFA 5ALFA 2BFEB 1UEIA 3RT1A 1GFZA 4F4FA 1WNFA 2CUKA 3A4MA 1NAHA 3FOAA 1FUYB 3G2HA 4R40A 3DMHA 4RVSA 5AKLA 5I8ZA 4AZ3A 1JHPA 3VR6H 1ZM2A 1FYDA 3OLWA 3G8AA 4LJRA 2BI4A 4PM4A 3V4PB 2QZZA 1HXHA 1MZVA 1QUEA 2Y67A 3JQQA 3NBXX 3CSUA 3OJWA 4LN1A 4YJHB 3TLAA 3VGJA 4AY2A 1YZLA 3LC0A 4DIEA 1G5PA 3IFSA 2PBFA 1TCVA 1XE3A 2WUWE 1L4FA 1RHKA 2NT4A 3RUPA 4B0PA 4L72A 3DF9A 4DC9A 2XX3A 4B3HA 1EEXB 4NG4A 3RRYA 1IBRA 4R9RA 2RHMA 1P3JA 1XRNA 2J41A 3HB1A 1UAYA 2WT9A 3HY4A 4HLUC 4XSGA 4LJAA 1X1DA 3SBDA 1YE3A 5I9LA 4N5NA 3KE8A 1WM1A 5TMEA 3EDQA 3UBMA 2AFIA 3GLGB 1TUBA 4FMPA 1PRYA 5LZ8A 4B2YA 1Y8RA 1DBSA 2Z2JA 1QQ6A 1SXJA 2KE5A 4NATA 1HFKA 2K4MA 1JBKA 4ABTA 1AXGA 4PBSA 1ZOOA 4UTZA 4QBHA 2DLNA 2VF5X 4JT2A 3LPMA 4P84A 1Q50A 2GN0A 4PAGA 4BZQA 1S2DA 1UMCA 3VX3A 2FPIA 3UPTA 4GQIA 2WYIA 1DJOA 3IP9A 4NL4H 1J1UA 2A5GA 4KPEC 3CLRC 4LK3A 3BIJA 3ODPA 1V5FA 4GOKA 3ZCPA 2CNBA 4OQZA 1DIHA 2FPGB 3UH0A 4B33A 4QGFA 3PFIA 3MGKA 5JDCC 3ZDRA 1XNRB 3KEMA 5KHAA 4H6PA 3PQ4A 3SY8A 5LOVA 5MHTA 4BQIA 1AZWA 3GNTA 3HUEA 3EXAA 4JP8A 1PD0A 4RJIA 2PS1A 4LHYA 5BNWA 1V5GA 3QWIA 4ARBA 4E12A 4F56A 1K3TA 1U0GA 2FUCA 2ID9A 1R6VA 2WWIA 5ECDA 3K70D 4N6GA 1E96A 4OHYA 3KOUA 1KOFA 2SKCA 3L8MA 3GJ3A 4FBMA 4Z9XA 3WHIA 3O7WA 4PZCA 4Q9KA 3ZWPA 4E3ZA 3G5AA 4AXBA 2GARA 3SNHA 3HXTA 4I14A 1S1CA 3S7ZA 1QO7A 2WD7A 4YRFA 4TSFD 5IT5A 4Q3EA 1I0ZA 4JR2A 3SSOA 4MIOA 3L0SA 1C3EA 1JQEA 1S9HA 4Q24A 1NJ5A 1DJMA 4DR6B 3H9GA 4RF5A 2XUPA 3L49A 5AM4A 1BGXT 1EGHA 1A50B 4LCEA 5IAKA 4B8YA 4RTSA 1EWQA 4BMYA 1Y34E 4JGIA 1QHIA 1E2QA 5TPWA 1DC8A 2P2NA 2RG1A 1XG5A 5CM2Z 4MKGA 1SKAA 3OEED 5JNLA 3T3NA 4EFMA 1VL2A 1NXOA 3H0CA 3B1YA 2PCJA 3RD5A 3TO5A 2QDKA 2ZTLA 2AC2A 4GLLA 1M34A 5ULLA 3FZYA 5ARBA 1YFJA 3JY6A 4IFBA 1KJ9A 2LPMA 5LLSA 1LDNA 3L82B 2J85A 3NHUA 4B4DA 1C50A 3WFJA 5IJWA 4MGEA 1E6WA 1T2DA 2R85A 1EA5A 3OSZA 2OD7A 4IDFA 2YRFA 3BL6A 3MB8A 3JWGA 3PFHA 3LNCA 4JWKA 3UICA 3V7FA 4AS3A 5BPFA 1USIA 2HHJA 4LRTB 3U60B 1CX9B 3CJQA 3K2IA 4F1KA 2WF6A 5KI6A 1H3EA 3EXHB 3QEMB 5GY7A 2QRZA 4O4LA 4UHKA 4PIPA 3AV0B 1FNCA 2B25A 1NVUQ 2FWJA 1PI3A 2XYPA 3GJZA 4QJ4A 4UTXA 2JLWA 1GZUA 3P27A 4PFJA 2B8JA 1NSYA 3UMBA 2Z08A 1TJ3A 3GGDA 3SDBA 1VG9B 4K0KB 4LNAA 1OFUX 3Q2KA 4F84A 1A76A 4HNGA 2VDMB 3RVKA 3TZ6A 4DA9A 1T5DX 4NCBA 3LPNA 2P3LA 4MI1A 2WYWA 3P5SA 3PRKE 4FWBA 4J6FA 1W44A 1ZUD1 4BVGA 5ALEA 4EG6A 5L4SA 2REOA 3PLRA 2IXGA 3J80A 3BHNA 3V2HA 3PGXA 4WWHA 4DIBA 1RXIA 2VQ3A 5JNTA 1JJIA 3KEFA 3MF4A 5HK8A 2QT0A 2LW7A 3L0YA 2VLIA 1BU5A 3HO8A 1JH8A 2JAQA 3OIGA 2FR0A 4HNSA 1E1YA 1RXUA 4W8OA 2GILA 1E3DA 4FKZA 5JVDB 3NT5A 5IKEA 1DUIA 1IG3A 2BJWA 4BYGA 1K9SA 5JYEA 2GK4A 3R6WA 1QNFA 4A7PA 1RWQA 5BSTA 3BZBA 4MI6A 4X41A 2ZJBA 3ZH2A 5IM4A 2J0UA 5HZKA 3UGJA 2CHEA 4RFVA 4NV1A 3I62A 5D3QA 4AO6A 2JJ8A 1KJYA 2C2GA 4IDOA 4OI2A 1KXJA 4ZN6A 4YP6A 3B3QA 4A36A 1QZUA 2GERA 2XT0A 5HM8A 1CE8B 1ZKMA 2V8BA 4NJMB 3TDKA 3CGWA 3HYCA 4C7BA 1V3TA 2H1RA 3VHXB 4L5IA 1P81A 2G7MC 4M9UA 2ATCA 2V7VA 5C53B 2H2GA 1N5DA 3EJ6A 4RF3A 4X7RA 5A0FA 1YVEI 1EVJA 3K73O 4ZOLB 3DOUA 3CN7A 1PEAA 3L0PA 4A0RA 3ZCUA 2P30A 1SIOA 5J23A 2AMJA 3ZHCA 4NBWA 3SYKA 3QSGA 2P3QA 3RLIA 1KEPA 5ICFA 3V8EA 4FMDB 1IVYA 1FDUA 1WP4A 3GGOA 4QOGA 1G0NA 3QNMA 2FJPA 3ETDA 4M1OA 2RGGA 3F8SA 3D3KA 4EHJA 3AVYA 5JD4A 1NPDA 5AVWA 1GZ4A 1UC5B 1JVSA 3EEFA 1XZFA 1JEJA 1ZXXA 1QQ7A 1IU9A 2JZOA 1KEUA 4NJEA 2R1TA 3OZDA 2Q46A 4D4KA 1P0FA 2HT6A 2IYPA 4YT5A 4KYIB 2G28A 3FROA 4KXUA 4F4UA 1YH3A 2GK7A 2JIZA 3VVCA 1PIWA 3B36A 4A8HA 3VC3A 3LPLA 5HG0A 3T1OA 1TPYA 2Y76A 5MFZA 4JC4A 2G8NA 2E6UX 2DBRA 4JLOA 5AOVA 3C45A 4M36A 4F96A 4UTVA 5JD6A 1YZGA 4GDMA 4GMFA 4LJ5A 2IS2A 3K2EA 1L1FA 1ZM3A 2HDWA 1GGVA 2CE2X 3D4NA 4PX5A 3VH2A 2Q3MA 3NAGA 3FFAA 5AP9A 1R7RA 1Z6TA 1N5KA 3IL2A 2ZUVA 3DC7A 4BO0A 1SCNE 1BW9A 2WIGA 3I01A 2YNMC 3LGXA 3F2IA 3VOSA 4YY3B 2H17A 2B5WA 4H77A 1BDJA 2NXCA 2C5GA 1VSBA 4BTEA 4M8LA 1U8TA 2ZI6A 3FKSD 4OP1A 4R3WA 4KPUB 5KQGA 1D0VA 3A11A 4KCGA 3W6OA 2WJAA 4CMJA 4DLLA 4LE2A 5KQRA 4LNUA 4M4SA 4Y2UA 1RR6A 2VWHA 3ANXA 3ROZA 3VZSA 1ZGJA 5E38A 3SG0A 3OLVA 2ZDQA 3VKUA 4W5RA 3IESA 4U2CA 3KSMA 4WZZA 1OA0A 2B82A 2PS9A 3U3MA 1Y8ZA 4HH3C 1YR7A 4HRVA 1WWKA 4HRAA 4IDPA 3U1VA 2R8ZA 5JECA 2CJWB 1QORA 4JL8A 3U2QA 1MPXA 2HNBA 4NFHA 3KPVA 2JLUA 2IQ5A 4RPCA 5LQDA 2HX1A 1LDEA 4IFTA 5IKPA 5J4LA 4HWGA 4KIWA 4YK7A 1IZ7A 3EZ2A 4WFIA 1BXZA 1J1IA 1DKLA 4YECA 1PFYA 5LOVF 2RHCA 5I9IA 2OLEA 3DWFA 1Z8HA 2V7XA 4H3HB 5DI3B 1SBNE 4MYSA 3OOEA 4R1OA 3CU5A 5JATA 3O3MB 2HHCA 2GEFA 4DC0A 4ZP1A 2I6GA 4LGCA 3SVLA 1WBDA 1TFRA 1NC3A 1ZX1A 4XW2A 3GMSA 1CG6A 3T4PA 4EFKA 2ZR7A 4B3TB 2PFKA 1SG0A 3H9QA 2BI8A 1H4QA 1LH0A 1Y9ZA 2Q62A 2X5NA 5HDBB 2ERYA 3SXUB 5BUZA 2CY0A 4FOOA 1DT3A 3PLNA 5HOQA 4YP1A 4QOSA 5B6JA 1SKUA 1Y1SA 3DFKA 3DV9A 5BV8A 3HBMA 1ISJA 5HBRA 1J8YF 1TGYA 2CZGA 4L6IA 4Y1EA 4I9NA 3KLBA 2QEQA 3UA3A 1H3FA 1URPA 2MTBA 2O7VA 5AJTA 3ED5A 5DEIA 1A77A 2X0NA 1WW2A 2CDBA 3HA2A 3TX2A 1SU4A 1EK1A 2HRBA 1X1QA 2I99A 2C8LA 2GZRA 2VXOA 5E4FA 2B4QA 4KMSA 4MV5A 4AZ0B 4KC0A 3H42B 3F96A 3CLRD 3DD5A 3C0KA 1EFVB 3MXTA 4OYLA 3EGDA 2QTVB 2FVYA 3FUXA 3IELA 1SXPA 2QTLA 5ECGC 3BE8A 3NOXA 3IAEA 4IINA 4RLFA 2AKYA 2W6JD 5CLQA 4CKBA 1J5PA 2YH2A 3DXFA 4MRMA 1OOEA 1HQDA 3ESAA 1KE1A 2FGJA 4QJIA 4EG1A 1M6YA 1JEQA 2GPAA 4AFNA 3G0CA 3GLSA 4PAWA 4XR4A 4R8MA 4MHTA 4LF7B 5KU7A 1Y8QB 2OGSA 3OMXA 3TEFA 1X1BA 2PUVA 2YXDA 1B16A 3RYFA 2H59A 3TLKA 1C80A 4KXVA 4IGIA 3ZDCA 4P4LA 3DBIA 4C29A 3PZBA 2JLQA 4NZNA 4TXMA 1ZM9A 4W7SA 2XD9A 1TTHA 2B78A 3PC4A 4I1OA 4S24A 5DLDA 4AWXA 4FX5A 3C14C 5FTJA 5E9WA 2QTFA 4U1RA 2GAAA 5E6RB 2RIPA 1J20A 1CVRA 1RQXA 2IYFA 2XRFA 3MG9A 3QP9A 4XVHA 2NVBA 5D3MA 1H5UA 3MRXA 2C9CA 1IZZA 1I3NA 2CEAA 4KQWA 4JP2A 5DP1A 1ZS9A 3TQQA 1H6CA 3MOGA 1E2JA 3LK7A 5E3IA 3LO5A 2ZI7A 1G6HA 1MB3A 1DHRA 4ZTBA 3BK7A 2YJZA 5IT9A 4FIZA 1DKNA 5A4DA 2O8DB 2Y1WA 4FCTA 4MULA 1DFIA 3M8KA 4KUEA 3E5MA 1TO1E 3E5HA 4XIFA 4GS5A 1GZHB 1VZ3A 2UYQA 3FUWA 1VRVA 1HFJA 1XD2A 1Z6ZA 2Z95A 3PBKA 4FHDA 5PNTA 1IBMB 3CJRA 4W1QA 2B4TO 2PY6A 1YU9A 4PZ9A 2VPQA 3TXAA 3Q8XB 4ZHSA 2QTMA 3DDHA 4IZIA 1AGRA 1SWWA 4Y2PA 1O94C 1TEHA 3G02A 1A97A 2CN1A 3B1WA 2HK7A 3R6GA 4DIUA 1TUGA 1U2EA 2CUNA 3INYA 4OQEA 1MDFA 3AFNA 3EFEA 4LOKA 1TIPA 2HSJA 4EY8A 3LCCA 2B5OA 3HUDA 5EXPA 3S0JA 2Q4BA 3Q7QA 3S2FA 1XA4A 2XGJA 1VPEA 2V6BA 4IRMA 5B58C 5JS6A 1PNRA 1BFDA 4FIDA 4X62B 5JXHA 4G89A 2CHFA 3AR4A 3KVVA 3MINA 4OSPA 4QLAA 1BYUA 3SS9X 1ADGA 1TMGE 2O3SA 3NEPX 2ZUTA 3H5RA 4JVLA 1SRQA 721PA 2VTVA 3H4MA 2R96A 2WLTA 7AT1A 2P6UA 1GPNA 5FUXA 2PXXA 2VF2A 4G1FA 4NK5A 5CBKA 4MUNA 4R68A 1FSGA 2DT8A 4LJLA 5E2BA 3EOAI 1A8UA 1SUWA 3KEOA 2PTGA 1YQXA 3EF1A 1YZTA 2ZIXB 3QEKA 4KQ9A 4UKDA 2OXCA 3NHLA 4IBOA 1Y9JA 1KZ1A 1PDOA 1YU6A 1LVGA 1PFQA 1ZU5A 3N2YA 3NEYA 1FBNA 3ZNPA 1E99A 3F5SA 4MUKA 4OYHA 3TB4A 4DQ0A 3LOQA 2UZ1A 5LLTA 5E1BA 1T9DA 2JHAA 4B8ZA 3RB8A 5DTEA 2WF9A 4O5AA 1XPRA 3OZWA 4HP8A 3BQNB 4J0IA 2VHQA 4PSAA 4J8PA 4YTEA 5CR9A 3U44B 2CV1A 4DNOA 1X42A 2CLKB 1KGSA 1II9A 2RGEA 1W2WB 3MC1A 3SX2A 2GOYA 3G9XA 4NDNE 3DQZA 1II8A 1TJYA 1XELA 2ZRIA 3V48A 4MW7A 1R6UA 3QE0A 1P0QA 4CTJA 4EVSA 2AEJA 1CZUA 1SOVA 4Y0NA 5D3ZA 5CDHA 1J2JA 2GM9A 4O1HA 3ZD8A 2BCJQ 4O2AB 2QAJA 3IPLA 4JDUA 3RYTC 2ZDGA 1AK2A 1E7MA 4F5ZA 5CMLA 4DJ5X 4XVQA 1FRNA 1WCIB 4LJSA 1E6EA 2RK3A 3KP1A 4YJGB 4BNYA 2HF9A 1UBUS 3A3YA 1GDDA 4QFDA 2AQHA 4GYKA 1COWA 4S2EA 3HJBA 1DB3A 3K8QA 3LT5A 4Z99A 3WNQA 2DE0X 1VJGA 3GHHA 4C5CA 4QUKA 1FMJA 1WZNA 2CKMA 1IUKA 4EKNB 1LBSA 1PG5A 3FW1A 4OB6A 1H5NA 4EGFA 3ND5A 2C77A 3M6WA 1ZA2A 4DA7A 5JZSA 4N65A 1OXUA 1S3GA 2QZJA 3NDIA 4N3AA 3MGBA 3DF7A 3UWOA 1K6EA 2FQQA 3T34A 4V2IA 1R8JA 2ZETA 4BX2A 4A16A 1O4VA 3RSLA 1P0CA 1FBTA 1N7JA 1C1XA 2EG9A 1KIFA 1M8GA 2FOLA 1K92A 4Q5IA 3FR8A 4YI3A 2WJ6A 3P9QA 4S05A 4BGDA 4E22A 3HL0A 3UAZA 1NBEA 3V1LA 4ME6A 1F0PA 3GD7A 3OQBA 3VJRA 1FXWA 1XVAA 1CP3A 3CMCO 1U1DA 1H2WA 1L4YA 2FN3A 4MPDA 1E59A 4YC7A 4K28A 2BKVA 3L06A 3WXMA 4AN0A 4DV7B 1R0WA 5DBOA 4GPAA 2P4HX 1MTZA 1KMCA 4HLUA 4A6PA 2Q8NA 5KSOA 2IEAA 2ZQYA 2NU8B 1U3CA 4XZ3A 1G6OA 3ZD9A 1EM6A 4AZSA 4D3FA 3WTCA 1KYTA 1OV4A 1P4GA 1T8WA 3ET4A 4RPGA 1P2FA 1TIBA 1SXJC 2HL6A 4EECA 1YGPA 3OOYA 1RC0A 4CV1A 3NX4A 5FA6A 4CCYA 3UK2A 2FK8A 2DY1A 5LP6F 1N9GB 2FPPB 1OYOA 3DBRA 3IEVA 4FX2A 4FC6A 4WZBA 4BP1A 5BVHB 4FU0A 3BSFA 2QAGC 3VJKA 2C9YA 3MT7A 4MNTA 1YL5A 2VL7A 4NFYA 3HPQA 2G63A 5LWQA 5K4AA 3T8YA 2PKEA 3ZHUA 4PYKA 1JLMA 5TS2A 4JCOA 4BB9A 2P3SA 2FOIA 4R8VA 5DWDA 2DQ4A 2WWXA 1QGUA 4AMVA 4REOA 2WHQA 1Q1ZA 1YI8A 4MRAA 3DB2A 4YRAA 3CS3A 3GY0A 4C1NA 4QU0A 3HACA 2HJSA 2JHFA 1HDOA 1SK9A 3IQDB 3H5TA 4KIGA 4K1LA 2CYAA 3L8EA 4L8YA 3ER8A 3I2IA 2VDKB 3CVUA 4CEHA 3UHJA 5JISA 4IEIA 4KV7A 3VYVA 1JR3A 3I0NA 1ECFA 1GCOA 2WV9A 2CZQA 1DG9A 4OL9A 3TX6A 5A7HA 3C6KA 4M22A 3Q12A 4RIHA 1RWKA 3A1SA 3I2HA 3IURA 2VDNB 5BWNA 2DUJA 3UJNA 3WRXA 3BB4A 3SM3A 1VJTA 3OU7A 1X86B 3HRIA 3NM4A 4BASA 1FQOA 3JRXA 3OD1A 3V1NA 4WGGA 3OQIA 4O2LA 4OHWA 1PWXA 5EXTA 5H1YA 1R5NA 3G2QA 2O8DA 1S89A 2OMEA 1NBAA 3SC3A 4E31A 1KBQA 4US2R 4DUPA 1YASA 5AK4A 2JGNA 4BDTA 1YKGA 4HNAA 1JMKC 1ZJZA 1LRKA 2FW0A 3DR5A 2HA5A 5LJIA 1ND6A 3R09A 2RB4A 1GLVA 1G42A 4HDNA 4DYDA 1W8IA 2UZ4A 1YRWA 2F8MA 4MSUA 1RZ3A 4UDXX 1LW6E 2J6BA 4DJDC 1CY4A 2TECE 1HEIA 4Z0TA 1W87A 3O2QB 3B1VA 2WT8A 4NH0A 2M6KA 3U0BA 4EAQA 2GI4A 2XZLA 3BXXA 1W30A 3VSDA 4RCVA 4OQXA 3VR5H 2PZBA 4YRIA 2LIVA 4OEHA 2EZTA 1DAFA 4G41A 4X60A 3JSXA 3R7LA 1WCV1 1J8DA 1EFRD 1HRDA 2GZ1A 4XA8A 5DCWA 4RL4A 5JSUA 4X66B 1IQRA 4FFLA 1RQPA 4P4SB 2C04A 1XVIA 1ZIPA 1ZM4A 3Q4GA 5D85A 3RTDA 3CEMA 2IVFA 1M9NA 2QYHA 1L4BA 2J45A 2YOHA 3OECA 3PHJA 4LJ4A 1SWVA 1QC5A 4MB2A 2AR9A 5DW0A 3D6AA 1RLUA 1GRCA 4L78A 2Q9AA 2OYSA 1UMKA 5E3JA 4TV8F 1GU1A 2GR9A 1NOKA 4LC0A 1CY2A 3AP2A 4YCJA 1P1FA 4RY2A 3ZEIA 5HJ5A 5FOVA 1XI2A 4MMZB 4PZLA 3TWOA 4A8TA 4UTNA 4WA8A 1FEZA 2VDQB 1O5OA 7ABPA 5B6IA 1VKRA 4OATA 5BNIA 1IHDA 4P93A 3SLKA 4CDRA 3QVKA 1XL0A 3CE6A 3SNKA 3BXZA 1OTHA 4LX0A 3ILHA 3WIDA 3OZBA 4B4KA 4P3KA 1EFLA 1MRZA 5DWQA 2KHZA 3I5YA 3EQ7A 3II6X 1W581 1LGYA 4U9UA 2IU3A 2WAOA 5FO1A 3EB9A 1WEKA 1KGDA 1L9KA 2R87A 4ZXPA 4GZ3A 3EIEA 2CV2A 3QPWA 4AXXA 3WL3A 3O4RA 3MAAC 1UL1X 1NRJB 2AFHB 3RTEA 2QJRA 1H1DA 3RW9A 1HL7A 1SUEA 3DB1A 3DLHA 1P45A 1O9HA 1UAGA 3WQBA 4EJSC 1EFKA 2B34A 1FPQA 3N0TA 1W5SA 1DC5A 5EKSA 3BM5A 1BKSB 1FX1A 3AKZA 4TTRA 1I2MA 5CW2A 3KSAC 3BA1A 3K1AA 2GNOA 2QN2A 1RSZA 2OD9A 4LXUA 1Z35A 2ZBGA 2M6LA 4D82A 5H4HA 1C4KA 3E05A 3OA2A 4P7JA 4C4SA 4PC7A 4YREA 3EE6A 2R65A 3VYSB 4CLOA 2QYOA 1XZPA 5KJCA 1YL7A 1HDXA 3FPGA 2IBSA 3JQ9C 3N6XA 2AF3C 3VNVA 2WU1A 2X0KA 3MJEA 1RQRA 5KB3A 1YB1A 2CXRA 3AR6A 3UW1A 4DG5A 1NSTA 4YIHA 3ZZMA 3UPUA 2P5SA 4I5DA 4Q01A 1EQ2A 1USUA 5LJLA 5DLYA 4F38A 4RESA 4WKCA 5EP3A 1FFHA 1U9ZA 5AXBA 2YWBA 3P19A 1RDFA 3DJFA 4WD3A 3ZU4A 4JS0A 4OMUA 4XWWA 1EVKA 2IZZA 1II8B 1S8OA 4NZOA 1ZQ1A 2FZ5A 2JJ2A 2VXYA 4M0PA 4QODA 5EHQA 1C4WA 1UWVA 2RHBA 4JSYA 3TW6A 4DCNA 3OX3A 5C7LO 2BEJA 1KK1A 4C03A 1UM9A 2OQ2A 5AKXA 4AJ1A 4C2AA 2W0SA 2YBEA 4DJFC 1QYIA 2BC9A 4HQRA 2VZ8A 4HV4A 1QE0A 4MVJH 2LCQA 1XK7A 2B8WA 1KP9A 4JYMA 4QYMA 1LX7A 4WAUA 5FUYA 4F12A 1QVAA 3EWIA 3GEMA 3VU3A 2OL4A 3HWSA 1XEXA 3KUUA 4JUIA 3ZW8A 4S0XA 3LQ1A 1DRUA 2PGJA 2XZPA 3BK1A 3H7IA 2ODQA 3O8QB 3E7DA 4R2WA 3ST7A 4JJGA 1U81A 3MNFA 1TZJA 4F6LA 1IEVA 2CLOB 1X14A 3A4NA 4RFLA 4XEUA 4MJXA 1YNOA 4FHFA 4UEJA 5IM4F 5FBRB 3ZC3A 1C0PA 3CISA 2EFJA 2ZQ5A 3ABQB 5F3WB 3TOZA 2TSYB 1JE0A 3FA2A 2C5BA 4QXMA 4QYWA 2UVDA 3PNQA 4JBWA 2XMQA 4PIVA 3GAFA 5ABPA 4I46A 5EMLA 4BAUA 1T5IA 1TK9A 4A8JB 2GYUA 2PMBA 4QZVA 4L9SA 3QF4B 1JPVA 3EF3A 2WNHA 4EW2A 1K6JA 1QX4A 5HCNA 4V3BA 4GVPA 2YFKA 5IPFA 3P96A 3AW9A 3KXPA 1EGQA 4GZMA 1RNLA 4JC5A 1RRGA 1JJVA 1JSCA 2ZS8A 3PC7A 1EVYA 3WGMA 4LNUB 5KBYA 2GD1O 3EXHA 3QEMA 2AK3A 2CLHB 4Q4LA 5GZ6A 1D9ZA 1FRZA 1II0A 3B1KA 1PZGA 1RJEA 4HEQA 4Q6BA 2WQZA 2YFQA 3NYQA 3FMPB 2GDJA 1CRWG 3M4XA 3R0IA 3FNIA 1M76A 2VHJA 4WXYB 5LQNA 4FR2A 4PANA 3DR3A 2Q3CA 2XHEA 1KQNA 4BMNA 4EHKA 4YBRA 4CM4B 2IDJA 3CG4A 1G16A 4BBAA 3QKWA 1TX4B 2NP7A 2BP7B 1KL7A 2VDJA 2YWXA 5CT8A 2VJYA 3AVQA 3JD0A 3KWMA 1WCYA 3DMTC 2L0XA 3PDIA 5KVCA 1KEEA 1G5QA 2XY4A 3R3UA 3I9LA 4RKRA 5DTIA 4ZYZA 4W6QA 4XQCA 1ZH8A 1J2EA 2WOJA 1NV9A 3B6ZA 4BC0A 5CFRA 1DLIA 4C87A 4OM7A 1J24A 3ZJUA 2ZU0C 1R4NB 3DAYA 3KT0A 3OICA 4NSNA 3TQIA 4B3FX 3BWVA 1A7AA 1R4ZA 2P9TA 4OX9B 4FDVA 3CPEA 3B3FA 3H6GA 5KAMA 4LMAA 4OLAA 4EQ6A 1ZO8A 4DM4A 1Z2EA 5F64A 3BMOA 3L4KA 2QUBA 1P73A 3VC1A 2RK4A 1E1CA 4PPGA 4DB2A 2GSDA 1RI3A 2AFRA 3R77A 3CRVA 4IFIA 4PHFA 4XDZA 2VZEA 2ROQA 1KWKA 4F0JA 2LZ0A 5BYAA 4FSXA 1L5ZA 3V1YA 3AINA 1CVLA 3UQZA 4F1WA 3W3ZB 1S9DA 3Q6MA 1KO4A 1KY2A 2VRCD 5ANRB 3FOFC 3NETA 4KX5A 3JQRA 3OFSA 2ACKA 2WUGA 3WGZA 1MG5A 3AHCA 3SK0A 4OI4A 2YW9A 4U02A 1KDTA 3HC7A 4JNCA 3UT5A 3JD2A 3L4BC 1E2LA 1GNPA 1RCFA 1DXOA 4LXTA 1OXBB 1D2HA 2NPIA 3H1GA 1K4MA 3I53A 1U0TA 4HDOB 2ZJZA 2PANA 2BW0A 4JX9A 1CU1A 3P4YA 4KODA 4HGQA 1E77A 1G5RA 1S2LA 1UEJA 2WIBA 3OJFA 1N5JA 1YNSA 2OAP1 3NGMA 4K9QA 5H3LA 3REQA 3DQPA 3BWYA 4D3DA 3FNBA 4UMVA 3EQZA 3PPYA 3C6QA 4FW9A 4NPCA 4U9IS 3TVTA 1WXIA 3KCQA 2DPLA 3V1MA 3FPHA 2WC1A 3AF6A 1O8BA 1G3RA 2QJOA 4LRYA 2E5WA 1YRHA 4FOTA 4TMTA 5B12A 2FPUA 2EGGA 4WSOA 4KPFC 3AGQA 3KSBC 2D74A 1C1YA 1P7YA 3GRZA 3L6RA 3RDPA 3O03A 4WACA 1UOOA 4LWQA 3ZW9A 2IEGA 1Q7TA 3EBPA 2JKVA 2CNWA 1Q20A 5EXSA 1ORTA 1Y9DA 2J3JA 3QNUA 4ROTA 3UWKA 4BFTA 5CIYA 1U2QA 3EXG2 2A94A 2GVDC 1NNUA 4WNYA 4ESEA 5HKKD 1WHTA 3DS8A 3P2KA 1ZCAA 2QQFA 3P0EA 3NORA 1U65A 3LY7A 1EGMB 4BLQA 5SYMA 2D0DA 1N8KA 1C7RA 3QYAA 1PZHA 4NI5A 4YJHA 3T99A 4ZYWA 5IFLA 4IGFA 1T0PA 4G0NA 3V5NA 4EO9A 2PUJA 3TD9A 4JJKA 1W4LA 3L8DA 1B8NA 4NCNA 2F59A 2X5OA 2ZIEA 3DPSA 1D09A 4PS1A 2CYCA 1DADA 2O07A 2R6AA 3HI4A 5H83A 4MPJA 2OP1A 1FMLA 3LC7O 4M38A 3TW4A 4CV3A 3JAKB 5BN1A 2P6PA 4JXXA 1ONPA 5LYJB 2ZRFA 2WFLB 1C7ZA 3IHLA 2HZBA 2BF4A 5FR1A 3GUCA 1ZLYA 1HDGO 4QWMA 3T4XA 5CFOA 1YJQA 1Y3IA 4J0EA 3CVYA 3OJCA 2PR7A 2VPPA 3D43A 2DBZA 2Q2NA 2V7QA 1C7IA 4V0QA 3KR2A 4CIAA 4WUVA 2J7PA 3MWEA 4EELA 3T1YB 3H13A 1SC3A 3L4EA 1Q77A 5JJCA 3FMGA 3RUFA 4JC8A 2Q41A 3B78A 4KQ1A 3Q2OA 1GEEA 1YB2A 2PCLA 3BTVA 2I29A 4MV4A 2VDWB 2CVQA 3GZTB 5FFNA 2CD7A 1LV8A 1UIRA 3KOWA 4F6CA 4FYIA 1M72A 1QH1B 2Q49A 4XM2A 2R44A 3OU6A 4N5IX 5L40A 3G85A 2Q9BA 4K3VA 2I1VB 2EIHA 1H8EA 3LC2O 1JA0A 4JBGA 1PJSA 4GP7A 2R6JA 2JBAA 5A7FA 1RIIA 1U0SY 3KT8A 4IILA 3E2IA 4O08A 1QHEA 1E4OA 1K0FA 1C3OA 2I22A 4BAZA 1JAHA 1LKZA 2WU3A 1JFLA 3KOOA 1PAUA 4NFLA 2FMXA 2HA4A 5CPFA 4A6EA 1YBFA 3RAPR 1JFFA 4YALA 3JZFA 2WMDA 3CB4A 4QGAA 5C4IA 1IOZA 3W5BA 3CH6A 1UXHA 3GC6A 2J33A 3GVIA 4JJIA 4KVFA 1RFGE 2QF7A 2VOJA 3EVAA 4KQCA 3R7NA 4KR7A 1BE8A 2HFJA 4NBTA 4ZPXA 2YWCA 3WAKA 4YQYA 3SMVA 4V24A 3EGVA 3GDOA 1C1HA 4YAEA 5ALZA 3TXXA 4EW6A 3LQYA 3LO8A 4KRYA 2CXXA 5FQOA 2R8EA 5EZSA 1O97C 4QPZA 3PRYA 2ZLBA 3O94A 2QUJA 3PXEA 5JH7F 5T8KC 3HB9A 4B09A 5FWNA 3AYZB 3HDJA 2PM8A 2FUG1 1ZZEA 1KDVA 4AJKA 3WMWA 4GPBA 3MS7A 3WYGA 2YUIA 2OLJA 1K27A 4KB5A 5A04A 4GR9A 3THXB 3KB2A 1LS6A 3NBYC 3PE3A 3TMYA 4L27A 3TNLA 2MSCB 2CXQA 1WUTA 4G09A 1QH8B 3H7AA 5ALWA 4CFSA 3Q72A 2F17A 1E5TA 4CEJB 1JLLB 1KEZA 2CXOA 3NVMB 4FYKA 1TAHA 1R6BX 4KYTA 3WJ2A 5CB0A 2FK7A 2I62A 2XKJE 1M2NA 3JX9A 4EGJA 3DTTA 3IBYA 1CIVA 4ZRDA 5K51A 1H1LB 3L0OA 4HVLA 4CETA 3I28A 3B7WA 2GXAA 2K7ZA 3OG9A 5EJEA 2FSGA 3OLZA 4RHEA 2XNHA 1XTPA 4LRUA 5E0KB 2HRCA 1ZK2A 3U9LA 5K99A 4J7AA 1H2HA 4JSRA 5EWLB 5H5JA 1B41A 3RBVA 4EY3A 3IJPA 1UOPA 3RJTA 1P8AA 2PRYA 3N05A 4UPEA 2WRZA 1KP2A 3MJSA 1TECE 5KDOA 1XLTC 5F5NA 3UOAB 3DFZA 2J7PD 1U4NA 3B52X 3HJUA 4OI0A 4KMRA 1JX6A 3EAGA 5EIBC 1CYDA 1G4AE 2IHTA 4UVIA 1W19A 2NO9A 3ENNA 4R9UC 2OG2A 3A1CA 1SOUA 1E4VA 1HG1A 2NYUA 1N5RA 2IXAA 2QQGA 2QVYX 1E1CB 1KMIY 3AC0A 3R4VA 3R6LA 4I5GA 4R51A 2GGSA 5DGTA 5F1OA 3RUCA 5KNDA 3QTTA 4IJ6A 2ZBUA 1KZGB 1V96A 1Y80A 3K1TA 5HFNA 3U4AA 1FQJA 1JQBA 4I19A 4WECA 5BOVA 1YC5A 5KWJA 4U3JA 4ACAA 1JEOA 3DLBA 3MHTA 1FU8A 2X8JA 4J1TA 3T9EA 4C4OA 3WWOA 1OWMA 3RYIB 3D5QA 3U3JA 5JSKA 4C3VA 4B1FA 4E13A 3MMSA 5AVQA 2C5AA 1BTOA 1KJWA 3IAFA 2O57A 4HLCA 4ERXA 1D0SA 1G41A 2I1WA 5B3KA 4HPJB 2AFHE 2HU5A 2H9IA 4IL5A 4X0EA 3ZXIA 4DZTA 4EUFA 3BTUA 1XZEA 3AFGA 1RD4A 1D4AA 4YA6A 3GXOA 5IM5A 2FGKA 5K3AA 5KX5F 3FDXA 2BMVA 4WXRA 5EP4A 1VRWA 4H1WA 3PQ8A 4BU1A 4HYQA 2WAAA 1QP4A 2A0XA 1G21E 1P9WA 4QUHA 4ZOLF 1P1BA 2VCHA 1KQOA 2GZMA 4J0FA 1AKUA 2I4IA 4MS4B 1OYVA 4QM7A 2ZRCA 3LX4A 4C4YA 3NHFA 4TXHA 4ZI3A 2A67A 4IDAA 4RKWA 2IKQA 1T9CA 1THTA 5D8DA 1ZBQA 1RM0A 3QMWA 4IIYA 1IQPA 3CM0A 1Z0DA 2JAHA 3IOBA 2WJZB 2ENUA 4PZAA 5JS7A 3MUFA 2I1QA 4FJ0A 4MW5A 2QN3A 1QX3A 1Z07A 1Y3DE 4GEKA 5TARA 3VI4B 1XLTA 2BP7A 2JARA 4V03A 5G53C 4Q9DA 4JI0B 1XU9A 4B6JA 1MHPA 5CHEA 3AI1A 2WJVA 4DMMA 1Z8NA 4I50F 1T8RA 1YZNA 2Y05A 3IR6A 4MWBA 5AHXA 2IUSA 4F8YA 2G6TA 2XF2A 3FNHA 3R9XB 5T6BA 4HVCA 2AJ8A 3VNRA 1JXMA 3FYHA 2NADA 2JGEA 4PLGA 1OGJA 4MV3A 1ST3A 3WBFA 1ZXLA 1BWPA 1JMVA 3N8HA 1MXFA 2HWXA 4J9VA 1E5DA 4GP9A 4MKZA 3RS2A 2ECOA 1HC7A 2FQWA 3TM5A 3WL5A 5K3OA 1XWIA 4KN8A 4OYRA 3KSZO 2IK8A 5IBCA 1YCGA 3A2NA 4QUGA 4C89A 4BN5A 1US8A 3PGA1 1Z8DA 3WV5A 3ELDA 1MDBA 4A1FA 5EE0A 4RH1A 4EUKA 1LBTA 4K0RA 1T2FA 1XAHA 1O03A 3T38A 1AUPA 1I7NA 2NYRA 2XLCA 4WQMA 2WFMA 2IBTA 3UATA 2R5WA 3ZQKA 5I9NA 1IRXA 2WD7B 2GM5A 4LCBA 3VKVA 3JTMA 1DTWB 1VLHA 2A1IA 1L2TA 1F4LA 4XR9A 2RAVA 3W0LB 1SXGA 2XA9A 3ONWA 1N9GA 1L7BA 1GZ7A 3ZLBA 2CBGA 1WXEA 2Z83A 1U9IC 1S8AA 4ZWNA 5GIPE 1KAEA 1XDWA 2I2WA 4FNAA 4R2KA 4HWRA 4HGZA 1CNFA 4MP3A 1Y37A 2AXEA 2CB9A 3PITA 4AJOA 4BLUA 3LDUA 4F45A 2Q6KA 3UB3A 3AFMA 1W1UA 3N58A 5CT9A 5EFOA 4KACA 4NX2A 4BIIA 1OB5A 1K8ZB 3KUKA 4TWJA 4ADSG 4ZAXA 2FPRA 5KYGA 2UUBB 1FSPA 2VK4A 3C6YA 4LZOA 3SYLA 5DCUA 3YASA 2B7BA 4CRWB 4Z6KA 5C4MA 5C52B 3A9SA 4B5KA 4JYPA 4JYZA 4YAKA 4LFBB 1RI1A 4YUVA 1GPH1 1CY6A 3FDZA 4CLHA 1QTQA 3ZV7A 4KFCA 3W9YA 1P9RA 1FQKA 2P41A 5CA1A<