1VJRA

Crystal structure of 4-nitrophenylphosphatase (tm1742) from thermotoga maritima at 2.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
261
Chain Sequence
HHVLDKIELFILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLRNMGVDVPDDAVVTSGEITAEHMLKRFGRCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYERLKKACILLRKGKFYIATHPDINCPSKEGPVPDAGSIMAAIEASTGRKPDLIAGKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVKLGKNAGIVSILVLTGETTPEDLERAETKPDFVFKNLGELAKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 4-nitrophenylphosphatase
publication title Crystal structure of 4-nitrophenylphosphatase (TM1742) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
total genus 93
structure length 261
sequence length 261
ec nomenclature ec 3.1.3.41: 4-nitrophenylphosphatase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA02
2YMPA 5AW1A 5FP0A 2BDEA 2ZXEA 3SKXA 1Z4KA 3WK4A 3PGLA 2B1QA 3FM9A 4NAVA 4OHFA 1YDFA 3ED5A 2AUTA 2RBKA 5AK5A 4B6JA 4Y2PA 5AI9A 5AKYA 3WK5A 3N1UA 2Q5EA 4Y2VA 3FVVA 4NWIA 1TJ3A 2YMMA 2HX1A 1RPZA 4ZEXA 4J03A 3NASA 3SF0A 4BX0A 2WF7A 2HCFA 5ALQA 3QNMA 5AK4A 5AM3A 3W5CA 2JAWA 2IOHA 3L8FA 4UW9A 5AKEA 1F5SA 2FUCA 5ALTA 4BNDA 3F9RA 2W43A 1NNLA 3MN1A 1RKVA 4J2TA 3B9RA 3FPSA 2YY6A 2IA5A 3OCZA 4HGQA 3QUBA 2GHTA 5ALVA 1WZCA 4UMVA 4IG4A 5AW7A 4F72A 1RKQA 5T41A 1Z4JA 1QH9A 4Y2TA 3P96A 3L8EA 3RFUA 1Z4PX 4E88A 3ZW7A 4UU0A 1ZRMA 1U7OA 1RMYA 3ZTWA 1WPGA 4EZEA 2W4MA 5AIBA 3N28A 3UMCA 1Z4QA 1L7OA 3SD7A 4YCLA 3ESQA 4ZEWA 4CF5A 2NO5A 2FPXA 2R8EA 1L8LA 3L7YA 4YGYA 2R8YA 2ZBFA 5AW8A 3K1ZA 5AI4A 3ZUPA 5AM0A 1VJRA 4CF4A 3I76A 1ZS9A 2FDRA 5IT4A 2JAUA 4DW8A 3QLEA 5AKXA 1X42A 5ALIA 5A3SA 3U7HB 5IT0A 2P11A 3IJ5A 2FPRA 3U7GA 3TLMA 1Z4IA 3QX7A 2ZG6A 1RDFA 1U7PA 3DAOA 2C4NA 2CN1A 2OYCA 3BA6A 4EELA 3BWVA 2QLTA 4YCNA 2C9MA 3L8GA 3S6JA 4O8CA 5IS2A 4G9BA 3QUCA 3A1CA 2OA0A 5AW6A 5ALUA 4UM5A 2GMWA 2NYVA 2W11A 5AK6A 3FPBA 5AESA 3KBBA 5AVTA 2FEAA 3OCUA 4MWOA 5ALGA 4EX7A 5AICA 4JDPA 3W5AA 2G1AA 3ONNA 4AP9A 4EENA 2ZBDA 4L6CA 1CQZA 4JB3A 2DQSA 3M9LA 3ZI4A 5AW4A 4QQFA 3PGVA 2BY4A 2GFHA 4PNHA 4KNWA 1RKUA 3L1UA 3MPOA 5AVYA 1RLOA 2JARA 5ALMA 3WKDA 2P27A 3QU2A 1U02A 2G08A 1QQ6A 2IOFA 2EARA 1ZD4A 3OCYA 3EPRA 5AM4A 1J8DA 2FPSA 1RMTA 3WGVA 1EK2A 1L6RA 2FPUA 2C88A 5AM1A 4GXTA 2IYEA 2YMLA 2I33A 2WFAA 2HEGA 3AR5A 3ZX4A 1QYIA 3KD3A 1SWVA 1L7MA 4BKMA 4I9FA 2JGAA 5ALFA 5ALNA 3W5BA 3WK6A 3A1EA 2MU1A 5AW2A 3MC1A 5AW5A 3ZVNA 4UMEA 1FEZA 1ZRNA 3NIWA 5ALRA 3SKYA 4C4RA 1XPJA 4NABA 3ZWDA 5AIAA 2YJ6A 5AI0A 3CNHA 4RETA 3ZWKA 2Q4TA 3CZ4A 5AW3A 2WM8A 4UU1A 5AKHA 5E0OA 3OCVA 4HGOA 2HF7A 4OD0A 4KX5A 4I9GA 2WHEA 2FUEA 4EEKA 5AK3A 1VFPA 1TJ4A 3KZXA 4NFLA 4UARA 5ALEA 2HSZA 3U26A 2WF9A 4Y2UA 3D6JA 4HAIA 3UMGA 1LTQA 3SMVA 2ZBEA 5JJBA 3ZVMA 5AVWA 5ALPA 3QU4A 2HF2A 4FFDA 2YMQA 3QYPA 1YS9A 1Z4MA 3R9KA 5AVQA 1TJ5A 2VKQA 2G07A 3U19A 1S8OA 3WKEA 4KNVA 2YN4A 1S2OA 5A3RA 3NALA 4UAUA 3WKCA 2D2VA 3L0YA 3AR8A 1O03A 4UMDA 3L5KA 4CE6A 1L8OA 2CFSA 2QYHA 3A3YA 5ALZA 3RF6A 2YBDA 3AR9A 3WK8A 3MMZA 2IOFK 2G06A 1K1EA 2B82A 2ODAA 2I6XA 3EWIA 3FZQA 2RB5A 2MSNA 4AS3A 3OPXA 1TE2A 3L1VA 3FGOA 4DCCA 4BBJA 3HYCA 1Z4NA 1YJ5A 4EX6A 2R8XA 4F71A 5AVXA 1SWWA 4Y2JA 3KDPA 3WKBA 5AM5A 4L6AA 1L7PA 4AS2A 1O08A 3AR2A 1YNSA 3ZVLA 2ZOSA 4BX2A 3ESRA 5AHXA 3WGUA 3IB6A 3DV9A 5AKIA 5AI5A 5AVRA 3E81A 2FPWA 3EF0A 2HOQA 2I54A 1SU4A 1ZD3A 5ALXA 2NO4A 4IFTA 4UASA 3R4CA 3J7TA 4Y2SA 4YH1A 3KC2A 1U2TA 3NANA 2B1RA 3N8GA 5AVZA 4CF3A 1JUDA 3SHQA 1N9KA 3ZU6A 1NF2A 4BNDB 2ZBGA 3OCWA 2CFRA 4G63A 4Y3UA 1QQ7A 4GIBA 3PDWA 5AKZA 1QQ5A 3WKAA 2C8KA 3M1YA 5AI8A 2B8EA 3ZX5A 1RLTA 1U2SA 3IRUA 1CR6A 3UMBA 2PQ0A 2BDUA 3VAYA 1T9ZA 5ALSA 3QGMA 5ALWA 4HGRA 4XE5A 5ALLA 4DWOA 1YV9A 3QUTA 3E8MA 4OCZA 1IWOA 2I34A 3GYGA 2RAVA 4HYTA 4L57A 1ZOLA 1NRWA 4DFDA 4XPZA 2I7DA 1L7NA 4H1WA 2AH5A 2AMYA 4YIKA 3NAMA 5AW0A 2YFYA 3DNPA 2G80A 3L0CA 4C4SA 5AKKA 4RESA 4BYGA 1WVIA 1YMQA 3QU9A 5ALHA 1RQLA 3I1YA 1PW5A 5AM2A 2B30A 3QU7A 2GHQA 1Q91A 2JAOA 5AVUA 1RLMA 3L0BA 4FYPA 1RMQA 2P9JA 1Z88A 3B8EA 3WK9A 2PKEA 1Z4OA 4YIHA 4FE3A 2WF6A 4HGPA 3SLRA 3AR4A 3E58A 3QXGA 1Z5GA 5ALKA 1RC8A 2Q4RA 3QU5A 3B9BA 4Y2QA 2HO4A 3PCTA 3I28A 3E84A 2HDOA 3U13A 3UM9A 5ALJA 4KYTA 2B0CA 1WR8A 5AW9A 1KYTA 2X4DA 2WF5A 2YJ5A 3OCXA 4BX3A 3NRJA 4Y2XA 1ZD5A 1Z4LA 3KOOA 3U7FB 2R8ZA 3AR6A 4KN8A 4BEWA 4OFZA 1T5SA 2EAUA 4QJBA 3ET4A 3AR3A 1Q92A 2C8LA 2GO7A 4BEVA 2OBBA 5AVVA 3R09A 1T5TA 2EATA 3N5KA 4Y2RA 4HGNA 2G0AA 1AQ6A 4UAVA 5AKJA 4YCMA 3QUQA 1ZD2P 2AGVA 2OM6A 1Y8AA 2CFTA 3DDHA 4NV0A 1Z5UA 3NUQA 5A3QA 5ALOA 3N07A 2PR7A 4MUMA 3U7EB 1RQNA 2I55A 3HLTA 5AKGA 1RRCA 5AVSA 3W5DA 4CNQA 2O2XA 3ET5A 5ALYA 4UATA 3WK7A 1N8NA 2HHLA 3L8HA 4UMFA 2YJ3A 5AKLA 4XOUA 2P69A 3EF1A 4UM7A 3I6BA 3AR7A 2G09A 1LVHA 4XQ0A 1MH9A 1VJ5A 5ALDA 4KX3A 1XP5A 4ZEVA 1J97A 3ZTYA 3OTQA 2WF8A 3A1DA 4Y2YA 1EK1A 4C4TA 1TA0A 2HI0A 2B8JA 5AI6A 2O9JA 2YJ4A 2FI1A 1ZJJA 2RARA 1XVIA
chains in the Genus database with same CATH superfamily
1PEAA 5JASA 2PH1A 3CE6A 3GT0A 4ZEOA 4DZRA 5I7OA 2X9VA 5FP0A 3W4IA 1EUQA 4HATA 3LOPA 1EBUA 4IO1A 1DRKA 2UUPA 4P7FA 3RVJA 3A6FA 3R6GA 4AJOA 3AESB 1CUVA 3IO3A 3JQAB 3PPWA 3ZHVA 3I5XA 4AP6A 3WLSA 3R0QA 1V39A 1SHUX 4RHUA 1WXHA 3ED5A 5JSKA 1OA1A 4GZ3A 2WSSA 3QHQA 1W581 1GZHB 1ZUD1 2P9CA 4Q9IA 3ZWNA 4PCAA 5FLXA 3TTUA 3JY6A 1N7JA 4DQKA 1QZXA 1HRKA 2YXEA 2JHAA 4LC9A 3UAOA 5K8CA 4QLOA 4ZEXA 2AI1A 3BGWA 1OFTA 2P41A 4OQYA 3VPSA 4KH1A 2I2BA 2NSDA 4XZ3A 3WGJA 1C1YA 1E3EA 1ZKMA 1Z08A 2CKDA 4R5HA 5ALQA 4A8TA 4UM9B 4M1TA 4OHXA 4JOQA 1PK9A 3W2EA 3CG4A 1OAOA 4TXMA 1QWSA 3QWFA 5ALTA 2ATIA 1IM8A 3ELWA 4QUHA 4XKJA 4QYXA 3GV0A 3GP3A 4YAEA 4E2FA 2I4TA 2WD8A 5K0ZA 3HN7A 1KI9A 3O8NA 1PGNA 4LXIA 3NEJA 4ZVSA 2ZT7A 2OHVA 1T3ZA 1RSZA 3AB7A 3HKBA 3LE8A 1C30A 3M6XA 2FX5A 2REBA 1PNOA 3ESAA 3PUYA 4ATNA 1I01A 1I7SB 2QIPA 3DGEC 4X1OA 2RHMA 4TOIA 2XCSB 3EG9A 4BIIA 2IYAA 1P6XA 4PG8A 5EWMA 4U2FA 3AHGA 3P9CA 3WSWA 1HF3A 1XEFA 4TZTA 2QGZA 3REQA 1JH9A 1GEEA 2CHUA 2VYVD 3F6YA 3OTOB 3E03A 3F6RA 2H17A 3HJHA 3VUFA 3OETA 3R3ZA 2HWUA 3BDIA 3HKEB 3PQ8A 1TAQA 4FYIA 4M9ZA 4DG9A 1MQSA 1J9GA 2Y0DA 5TRTA 3RYCB 4NQZA 3GLFB 4KUHA 3IAAA 5FA6A 2DKNA 3OPYI 4IV8A 2I4OA 4OFXA 5HQ3A 3H4IA 4EG6A 2GRUA 3RFUA 1FLVA 1Z4PX 4W5QA 1L5YA 1LTHR 3QJYA 2H57A 3UCXA 3MINB 3FNQA 1JTVA 2ZS7A 1K6JA 2JJ1D 5DSZA 4BBPA 3P9YA 4KE9A 1TM7E 1PGJA 1T8TA 1TZ2A 1UOQA 2PKQP 1WABA 2QGNA 3HH8A 4M1MA 2O5CA 3KALA 1PBTA 2B69A 1FDSA 3RB8A 4IOMA 2EGHA 4JP3A 2BAGA 3M81A 3QQPA 2QU8A 1UM9A 4HNUA 1HE4A 3SD7A 1E79A 3EVDA 4S35A 3OM1A 1WE2A 1VL8A 4KQKA 3KP1A 1A96A 5AW8A 2CZCA 1T9HA 3B38A 2A9FA 2FR1A 5BURA 3Q9NA 1E2MA 2FDRA 1F0NA 1QO9A 1H2FA 1HE3A 1VKZA 2XCOA 1QIJA 3H3FA 3HU2A 3PGA1 4RTPA 4Y9TA 2ONYA 1Z34A 3VO1A 4KYVA 4E3WA 1GTZA 1OAKA 5JYDA 1RYDA 3TD2A 1G98A 4RD0A 3ZH2A 3VJLA 4JH0A 1TDJA 2O59A 2O54A 4HQ0A 5FLKA 2J0VA 4NU5A 5HILA 3L4EA 4HC4A 4MMZB 2HO5A 1AH2A 3I30X 4TQ9A 2BGMA 3VU1A 2P9EA 3T4EA 1JHOA 5IS2A 1KE1A 3NVKI 1DTWB 2ZUDA 3ECSA 1C2YA 1E0JA 4YV0A 4D4LA 1QRTA 2BGJA 5IUKC 2IS6A 2ZSFA 1DQYA 1D1SA 1WQ4A 5HMLA 4WLVA 4IV5A 4BMPB 3CQ9A 1IEQA 2FUKA 4CMJA 2IY7A 3LQYA 3QKWA 3BFJA 1VE5A 3LX6A 5CT9A 5HF6A 3VU9B 3W5AA 2RHWA 1ID8A 4QFDA 3MYRA 2G1AA 5I8ZA 4XFKA 2FLVA 4BCDA 4F1WA 2FWAA 121PA 5FTLA 1ETHA 3I39X 2HADA 3K5IA 3O4IA 5TT1A 1EP1B 1FUKA 2WWXA 2X42A 4LKRA 4OY3A 1CQZA 3UA3A 3QM1A 3A6EA 3I9KA 1Y6ZA 4NCNA 5EOVA 5AW4A 3L82B 5AJUA 1T5LA 2X1LA 3ZXUB 2E4XA 4C5AA 1QPBA 1Q7CA 1SUDA 2VUSA 4CCWA 2J48A 1SBCA 2C99A 4N0QA 3ZI7A 4C0LA 4UUNA 5DULA 4C7JA 4S05A 3ZTTA 2HT1A 2ANCA 4RZ3A 4U2GA 4C2AA 4NESA 3DMTA 1CUAA 2BZGA 4N03A 3W4KA 4DREA 4NCAA 2D2EA 4CG0A 3F2VA 3H1GA 1Z0ZA 3R7FA 2EKQA 2X7HA 2FPUA 1ACMA 2C88A 2NPOA 1JR4A 1TTTA 1Q7TA 4RTQA 3Q3JB 1FNBA 1N2EA 4YAFA 2B4QA 2I4NA 1FDRA 5F2OA 3SXPA 3PZRA 1EBFA 3TCKA 4QWWA 1MABB 2I67A 3GCWA 3H05A 4IDGA 2C57A 4TRMA 1FFHA 2JI7A 2VF7A 4LGYA 1T8PA 1NVVR 4D6PA 1DPGA 5ESRA 2PO5A 3VXKA 2DPHA 3RU9A 4NVRA 1QGAA 4OK5A 4ZXFA 1Q0QA 3GFSA 1H2ZA 1EQAA 5DYYA 3NORA 3WNZA 5C9ZA 1JLLA 5HKOA 3PEFA 1L5NA 1XTSA 1QG0A 1WMDA 1ZJZA 2A9KA 1XZKA 2NUPA 2WFLB 3ZBQA 4C4AA 1MJGM 2R68A 3RC1A 3BQMB 4YV1A 2Q1SA 1FSFA 2OCYC 2W2KB 5C7LO 3K3PA 4EQ6B 4TTRA 1E7YA 4RCYA 2F9FA 3TE6A 4X6UA 1ZRHA 3GJQA 4DQUA 1H4VB 1PFQA 1OH7A 4AJKA 3BWEA 1UJCA 3MSCA 2Y0PA 3EZFA 3WG9A 4A91A 4PFJA 4UBOA 2C2BA 1RYEA 1XV5A 5JWHA 2ZUWA 4AUNA 4C2TA 1SHTX 1XZMA 4IXMA 3CRVA 1EFKA 1XVUA 1VM6A 4B3RB 1GNQA 3LUHA 4LC1A 1E58A 1C9DB 2PGXA 3KLBA 4ZVQA 3WWYA 1JDSA 4YMUA 3PNVA 1P9NA 4L02A 1EFCA 2JGRA 4M55A 1U8TA 1BYUA 1XAIA 1IVNA 1GPWB 3GJZA 1I10A 2AFIB 4UHJA 4URYR 3Q10A 3QENA 4RPCA 1RWPA 1UP7A 1YQWA 2II6A 2R84A 1PZXA 2A1TR 4KBGA 3RW9A 2YMQA 4CKBB 2V4MA 3V5NA 4LJ7A 1LY1A 4M0CA 5AFSA 4PVCA 3NAGA 4HKTA 4LJSA 3LPCA 4IQ8A 4PPFA 3TYXA 4D8WA 2JGKA 1PS9A 2H4WA 3C3DA 4RY2A 4X6YA 3D8TA 5LKAA 1TKCA 4RY9A 2ZSKA 1L7AA 1W8IA 4ZVOA 5FEUA 4JC5A 5LD2B 4OL9A 4AURA 1NDHA 1R2QA 3OZRA 2J3DA 5KINB 2V5VA 1U0RA 4D74A 2EW1A 1JP7A 3S3TA 5EE1A 1ONOA 1N1MA 1F8FA 3LRTA 4OOFA 1QORA 4UUPA 2JBAA 1SEVA 1QOPB 1ZKDA 1EI9A 3VR6D 5JQGB 2AHOA 1B4DA 2RH4A 1QGED 2HLDD 4KSCA 3V4ZA 3CEMA 2PX4A 2JH3A 3CKYA 3EXHC 4MEBA 3PEWA 2C4MA 2VKTA 1WOMA 4PF1A 2UUOA 5F5XA 2GA9A 1YJQA 3W9UA 5LLSA 2R48A 4ZU3A 5TMBA 3T38A 4JGBA 4AZSA 3N3BC 4B09A 1JKMA 2ZJYA 1O6GA 4LFBB 4IGAA 2IXTA 3F49S 5CAEB 2OV8A 1MO5A 3H5IA 1RE1A 4OI1A 1FW6A 4BB0A 3BQNB 3BD7A 1CULC 3IOMA 2QR2A 4W7IA 3UAXA 1W36B 1D2NA 2DTEA 4E5SA 4ZZ1A 4M36A 1Q1GA 3KJEA 5GV8A 3REFA 1Y8QB 2A5DA 5KSWB 4ONEA 2OYRA 1KY2A 1F17A 1KYQA 3BZUA 4EKNB 1NM5A 1W96A 1QH0A 4DQ0A 1U0JA 1Y7PA 1CKEA 4NULA 4C4XA 1RCUA 4GX0A 1ZJYA 4Y2GA 2Z4RA 4NHEA 4GBGA 2YASA 1MPTA 1N6LA 1XQXA 1XZCA 3M2PA 5JO0A 3F5DA 4RHCA 4TX1A 1C7ZA 4HSEA 2PR2A 1UINA 4GYJA 1JILA 3H0KA 1QDEA 2ADMA 1FFXA 4WFIA 1WHTA 2B4KA 1JQBA 2VDVE 4LHSA 3OD5A 3ER8A 6NULA 2P78A 3ZZ1A 4KI7A 4Z7QB 3UMMA 4M0EA 1KO7A 4NG4A 3KB1A 3SE0A 4A8JC 3IOEA 4ND5A 3B89A 3AJ9A 3Q87B 2BELA 2WJVA 3P9ZA 3OFSA 4L5JA 1HDOA 2PUVA 3DEIA 1AIPA 3L06A 3LW8A 3SZGA 3V00A 1CQIB 1RHKA 3A3KA 4MI1A 5B4TA 3QIAA 1L5SA 3KL2A 2JLXA 4A23A 3S55A 4ZDWA 5K45A 4ARZB 2JZCA 2XGOA 4JEHA 4Z9YA 3YASA 1N3LA 2GN4A 4X41A 2HMVA 5H80A 4P6VF 5EL0A 1QNFA 3BE8A 3SHQA 2E89A 2V9CA 2BZ0A 1DWOA 2RGYA 3OQ1A 2OCBA 3QBEA 3UT5B 3G1UA 1GADO 2Q5JA 1K9VF 2Y76A 2CYAA 2ZCUA 3O0DA 1DJMA 4C87A 5CJ2A 4NENB 1DBVO 2GBLA 3A6ZA 2VYCA 4J16A 1Z2AA 2AJDA 5KYWA 5C8ZA 3ZQJA 4IHKA 4BRWA 2HU2A 4YMIA 3MBIA 2MSWA 1BMFD 1W35A 2VRCA 13PKA 3KOYA 3ZZNA 4TXJA 1OYWA 3LGSA 3STWA 3T3PB 1XL1A 2YY5A 3GYGA 1MX5A 4C0HA 3T1TA 3M3HA 4BTVA 5ADHA 4TS1A 4TMFA 1CQWA 1JQAA 3RABA 4EY3A 2GJKA 3CLRD 4XPZA 1RM4A 1IN8A 1QHXA 1FK8A 2Q4DA 1V5EA 2ZB8A 5CVUA 2WSSD 4G4IA 4RA9B 5FOUA 3OQOA 1VJGA 1JXQA 2CXPA 4YIKA 3IOCA 2R00C 4LVCA 2R1ZA 4JLSA 3RHFA 2XIJA 4ZVPA 1WPRA 1IHDA 4UZSA 1XMQB 3DDSA 1R5NA 4LMAA 2OQIA 4FKZA 4D0RA 1CFJA 1YQUA 1ZVKA 3WGLA 2OZLA 3E35A 4XSVA 3G9XA 3QPBA 2HBRA 1NR5A 2XBLA 5FFMA 2I6SA 3CBQA 1NQVA 2ZETA 1T1EA 3JAWB 1JHYA 1VE6A 4OBWA 1YR1A 3V7NA 1Q91A 1YZKA 2BN4A 5JQWA 3FNIA 4BAZA 2XWSA 1KU6A 1U2EA 3SFZA 2RK4A 1U4SA 1Z88A 5E4JA 1NMSA 3O26A 2OAQ1 4EP1A 3VYSB 2MIIA 1EH5A 2ZVPX 3A1FA 1ECBA 1UODA 4N3BA 4XX1A 5HZKA 3ZNOA 2O8FB 1TUBA 2PJZA 1QAOA 1V4VA 3C7KA 1ULAA 3WBJA 4FSDA 3FB1A 1I14A 1ONPA 3LGXA 3TSZA 4A2WA 3AFNA 4MQ6A 1CRPA 2EWWA 1WY5A 2G83A 4XIJA 2ZRFA 2XOKA 4I7EA 1FNSA 2IT1A 1E6CA 1E9RA 4JLPA 4WXPA 1AKEA 4KYTA 1DX9A 1NF9A 3ZLJA 1G55A 1FPQA 2PK3A 4XYGA 4ZRNA 4HWSA 3P4UA 1KKMA 1O97C 4QSMA 3RFTA 5KOIA 1UJ6A 2CNKA 2ZI3A 4BFVA 2PUTA 3HKEA 3I04A 5KVAA 1OJ7A 3RYCA 4OYHA 1PJ4A 5FOXA 2Z9DA 2Z8ZA 4X85A 3I9LA 1NVKA 1EG2A 2IS2A 1D1TA 2FVYA 4DQDA 1KZ7B 1RXWA 5ANRB 5AVVA 1GCAA 4YQYA 2VJOA 4Z4EA 2OZKA 1T5TA 3FWHA 2QRMA 3TW8B 1IMJA 5HP4A 2QPTA 4G1VA 4HGNA 1QOZA 2CLCX 4HXFB 3D4OA 3PX2A 4D9MA 4WBNF 3DT6A 1XO1A 2GB4A 2MWMA 3WOHA 2C78A 3GGSA 4LV6A 4XW2A 1NLZA 1E79D 1U4OA 4NZ9A 4BUZA 5ILOA 1UK9A 4U5XA 4C22A 4E5KA 1GPKA 2ODBA 2WAXA 1T2FA 2P9BA 4N0EA 1YD7A 1T6BY 3BSSA 4IDFA 2IL1A 4QOGA 5EY5B 2W2VA 1PTKA 4AMGA 4D3DA 4CLRA 5IZCA 1LLQA 4QQ8A 3LVRE 1RKBA 3V32A 3SR4A 4NXNB 4GXQA 3AUJB 4MPRA 1HEIA 2WT8A 2R9VA 3JWEA 3SZUA 3T8YA 2YJ3A 2MTBA 5CLGA 2G72A 3AL2A 3FPGA 1RFGE 4GKAA 1Z0SA 4XOUA 1VP9A 2RHTA 2P5YA 2X0KA 1G42A 2X5XA 4QC2A 1ZQ1A 4HR7A 4XTRA 1I80A 1OTYA 2I66A 4QGHA 2XUGA 1MH9A 3K09A 4OO3A 3KSAC 4ZVTA 4RFVA 4TQUS 3EG5A 1XP5A 3AIMA 1J1ZA 4R9SA 3TM5A 5T64A 1EWQA 2ECQA 3L79A 2VDOB 4HFNA 2Y4NA 3GP5A 3QLUA 4YPOA 1V1JA 1SVIA 5DRTA 4LI3X 4J1TA 1E62A 4PY2A 1ZH6A 5EIEA 1MQ9A 2JASA 2YZNA 2O20A 4UEOA 1ICEA 1PNRA 2CBGA 2YJ4A 1XI2A 1EG7A 1RXVA 1Z15A 2WTBA 4CIYA 1BU5A 4GOJA 5ICMA 5I7FA 4GE0A 2VT3A 1FFYA 3WB9A 4NPCA 1R5JA 1HM5A 1WF3A 2DETA 4IOJA 2NVWA 3HJTA 4G4SP 3RRMA 4OEHA 2XQJA 3WK4A 1SBZA 3FVQA 2W4IA 4KJZA 4TUYB 2IWHA 3M6IA 3DXZA 4NAVA 2P7HA 4OHFA 5FBHA 1E1KA 2QK4A 2X4LA 3K53A 4IDEA 4INPA 5E4TA 2WMDA 4XUCA 1TK3A 4MDYA 5GTDA 1VE3A 1SB8A 2HFKA 2NVBA 2RHGB 1QIHA 3CLTD 3D7LA 3WK5A 2JGFA 1OA0A 3QBDA 3OKAA 2IBSA 2OCXA 4NWIA 4YQEA 1G291 2YVKA 3R0XA 4MVJE 4BNJA 5JNSA 2QX7A 4LJKA 3Q12A 4RK7A 1VJTA 3K0AA 1L4FA 1CUBA 1T0BA 1W85A 3FR8A 1LBIA 5ILGA 3WXBA 4C43A 4PAGA 3DZGA 3LM8A 3DP7A 3NBFA 2G77B 4D9GA 4YUZA 3KQMA 1C50A 1JKJB 4UW9A 2AV6A 4PLYA 1WTCA 1ZVQA 1DSSG 1UZAA 4KN9S 4KPUA 5GPBA 4BNDA 8AT1A 2WT9A 4P80A 4PX2A 2QBYB 2DBZA 5BWCA 4B3SB 2I2WA 3QOFA 5L8VA 1MVOA 2FDXA 5F3DA 4CEJB 1UEXC 1VLHA 5C1PA 2VSFA 3H6GA 6PFKA 3FE2A 3HNRA 4RMGA 4FZRA 3CT4A 1LPNA 3DXFA 5TPZA 2GCPA 5DASA 4EABA 1JPNA 3C87A 1Y7HA 3I3OA 1X7HA 4DDWA 2NZJA 4CDMA 5ALVA 3ZG6A 4PGGA 4E5UA 2EG5A 2IFTA 2W2KA 1ICIA 2QLFA 1CZOA 2YXDA 2YDXA 1XXHB 1J90A 1GL9B 2YTZA 3IP7A 3OF5A 4HX5A 2ODPA 3BFVA 2XYGA 2JBWA 4D43A 3D02A 1XCOA 4AZTA 4YMLA 4NHOA 5IVPA 4H08A 1ZMOA 1Z2CA 3SSNA 2Q8QA 3BREA 1QBGA 4O6VA 4YMWA 1BJRE 4MA5A 1TO2E 3GLRA 2R5WA 3G9TA 1L6IA 3ORQA 4YDQA 3L05A 4E33A 4JJKA 4MWCA 3DLPX 3VSCA 3UJ9A 1L4KA 2JLQA 1EE9A 1WUHS 2Q7OE 1PDOA 5BN3B 1ZM2A 3F5MA 5FBKA 2W4MA 4O4LB 2WIGA 4EO9A 3D3EA 3WNQA 4IF4A 4IVPA 5M5BA 3CPHA 3VO9A 4IMJB 2WJPA 4JMPA 4Z9XA 1GJRA 4CF5A 3OX4A 1Q7BA 2PMBA 3ZGYA 3L6RA 3OCCA 2R8YA 1K8ZB 4RGYA 4QGSA 1KFEB 1QX3A 4OQQA 4ZIRB 3CR3C 2YIVX 1ZN9A 2DECA 2AFHA 1UBUS 4UM8B 1SOMA 5I9LA 1IIRA 1AB6A 1WXWA 3LO8A 4H31A 3VR4A 2NACA 1R0WA 1X42A 2GARA 3A70A 3HPQA 2YZGA 4MV6A 5FYQA 4EG1A 1Y4DE 3ICPA 3U7HB 4ZAVA 4DLRA 4ZK2A 4NYIR 2NN3C 2FWPA 5DI3B 1C80A 1EWRA 3CF4A 4C3OB 4UTVA 3ZEIA 3FAKA 4A6XA 1M73E 4XDHA 2CN1A 2JLUA 3THYA 2NZWA 2JLCA 3L4SO 2J6IA 2QLTA 3ASVA 3DMNA 2NW6A 2LKDA 4XJVA 5DF1A 5BOVA 4DG5A 3WYFA 1IVYA 2XZLA 2VDNB 4UEWA 1I7DA 2G70A 1T43A 4GP6A 5EUBA 4O4JF 5F1YA 1KYIA 4MYTA 1NWCA 3R3XA 1ISMA 4PLPA 5DOVA 3U17A 2XUOA 3FPBA 4WK4B 4NMXB 1SKBA 1CZNA 1RYMA 1QUEA 4HOYA 4RD2A 1OFIA 2QTMA 1TJNA 4ND3A 2Q29A 2FPIA 4PHFA 1WX1A 5ALGA 4YJDA 1J7KA 1MC8A 2C95A 3G0OA 4B3DA 3QMWA 3FDZA 4DBLC 3LUPA 3PXCX 4EHLA 1T4MA 2CLSA 2JHFA 2VSNA 3Q7QA 3URKA 1GEGA 3C1AA 5DCYA 4XWOA 4N6NA 4B47A 4YDHB 1IXRC 5BQFA 221PA 1MB4A 2BCJQ 1R18A 1JNYA 1JFLA 2P4SA 3KQVA 2K87A 3PRJA 4GXNA 3ADOA 4UHDA 1YTLA 5C8YB 1BGVA 1Q77A 3R1IA 1USWA 4YREA 2OMEA 2GAAA 1KI8A 2FQXA 2NU7B 1R88A 4JL5A 4R83A 1HQKA 2GJAA 4L2IB 1V9LA 3I0NA 9LDTA 1YZLA 1AURA 2RHJA 5EFOA 4JITA 4LBVA 1XTUA 4N18A 1RE0A 3A14A 1PR0A 2COUA 5A6VA 1ULTA 3HSYA 1OR8A 1H65A 1JBKA 3ZXXA 2RGRA 4YP5A 1SWVA 1WLSA 1ZD8A 5JCJD 4RTSA 4RK5A 3KS9A 2FGJA 1XF9A 3GNTA 3KVOA 3LBNA 3B6EA 3JWGA 1RJFA 4WEQA 2GPJA 4ZDIA 3VNUA 4OHCA 4YK7A 2KE5A 3A1EA 4WY2A 4ND1A 2QN2A 2H06A 1M1YE 5GZ3A 2ETVA 2VP4A 2SECE 4RGQA 4ZC8A 1NV8A 4AQ7A 3AKZA 3QKSB 1E9CA 1YBHA 4EY7A 3X2FA 1MR3F 4JJFA 5AI0A 4BGDA 4QT4A 1K7FB 3CNHA 3HLKA 1YR8A 1Z5VA 5JDCC 1M2JA 2VA8A 3IQFA 4C0KA 1KFJB 3OQIA 1F0YA 2KHZA 3QK7A 4RIIA 5T8KA 2JAXA 3OCVA 4QDOA 2J3IA 1SBIA 3CH6A 4P1ZA 4JX8A 3H0CA 2P7IA 2WHEA 2EG9A 4HFMA 3QF7A 1GY8A 4E1VA 5KVSA 3OJOA 1F5NA 1TYAE 2VRCD 3KYDB 4U7FA 3TOXA 4AO7A 1KP9A 3DOFA 3LPAA 3PGMA 1M54A 1EYZA 1KJIA 1KTVA 1R00A 3WSVA 2ZBVA 2QX4A 3JQAD 1UKVY 4R0MA 2FFJA 5JH7B 4ZQIA 1KK3A 4FT2A 1N5KA 4M2LA 1DOZA 2ZBEA 1VC2A 4HUQB 3E9EA 1ZIYA 2LRHA 5KWVA 2I4LA 5A5VA 2Z2KA 1M72A 3C7CB 5LZ8A 4FFDA 2DPMA 1IN1A 5TNXA 4A6PA 5ESXA 4OQPA 1TJ5A 3K2IA 1Z6ZA 2EKZA 2Y99A 1S0UA 3IQIX 4AMBA 2GN9A 1HLPA 3BCHA 5B57C 5IDQA 4LXTA 3N6RA 1Z6AA 4PX9A 1KZ9A 4EL5A 4ZKEA 3I37X 1L7EA 3PPVA 3MFYA 3Q9LA 1IUPA 4YRRA 3U40A 4ODIA 2PS0A 4CQLB 3X1WA 4P3XA 2AX3A 2AQIA 1YZHA 2CC2A 1KK2A 1CDEA 3QBTA 5JWOA 5JFTA 3L93A 2GEFA 4Y0VA 2Y0EA 2CDBA 4ZXPA 1KZ4A 2UUCB 4O4HA 5KTMA 4LQ4A 2EW2A 3AL3A 1P4SA 3E4DA 3H5OA 3PUVA 2QUAA 1E7QA 3IVCA 2XOKD 1JQKA 1KMMA 1FVXA 1BOFA 4ZGGA 1CDOA 1CETA 2GKSA 3B6MA 1IN7A 3ZK9A 3L7JA 1JIIA 3QKIA 4HUJA 3L1VA 2B8TA 3UK6A 1V2GA 2QQFA 4JHLA 4ZI7B 4BBJA 2XHEA 4N5DA 2PZBA 3UMYA 2ZJ8A 4FUQA 5HUJA 3UVEA 4PPQA 1Z5PA 3ZHYA 2A0KA 1W34A 3OBIA 4X91A 5DHRA 1YJ5A 3L1KA 5LWHA 4FJ0A 2FKAA 1B6SA 2VHQA 4BKRA 4KRYA 1BW9A 1QCDA 2D62A 3B3FA 3EGXB 4KWHA 4ZYTA 5JCXA 3VYVA 3UXMA 2C2WA 1JFFB 1N57A 4ZYUA 2BFCA 1FPMA 1UWLA 3KSRA 2AXEA 4TT3D 2GPTA 4WCDA 4QBFA 3PFWO 3PVSA 5CX1B 4CM4A 1C81A 4EFLA 3ADKA 1GN9A 1M8GA 2ZOSA 3Q88A 5TVKA 5MFZA 2BBWA 5BRJA 2TSYB 4UREA 4YCJA 4XVCA 3G0CA 2QLLA 3EVBA 4MUIA 1QHHA 1U3GA 2ZSBA 1U2PA 1LWOA 2QF7A 1LSOA 4F60A 3NEAA 4DCGA 5EE0A 4UUMA 1AZLA 4R3UC 3C15C 4DLPA 3RO7A 3IAM6 4R3WA 5E1BA 4YRSA 2Q1TA 2IEZA 4K6FA 1CF4A 1H9CA 3JYHA 4FR5A 4Z2YA 1LK5A 1SVLA 4WVFA 3SDZA 1E64A 2R6JA 2A57A 4QFMA 2VQFB 1TU4A 5C31A 1F7UA 1O7JA 2WFMA 3ZHTA 1A2KC 1BKSB 1JJAA 1Z0AA 3S28A 2QENA 2C3YA 3FJ1A 4U7JA 2GA8A 5I5GA 1XTRA 1U1DA 4JMLA 4KQ6A 1KXJA 3KJHA 1NXSA 1ITZA 4IKPA 2VNHA 4ZJUA 3C3XA 4GICA 3FCEA 1QCCA 3LWBA 3QI2A 4KIWA 4WKBA 3IPAA 2WJ4A 4BP1A 2QW0X 4DA0A 2BMJA 1VA5A 1DOHA 3G8DA 4QJIA 3WGTA 4MQUA 1NXPA 3PNPA 3R7LA 2P40A 2X13A 4G63A 3L7NA 5JSZB 3KZKA 1MBZA 4YUWA 1H5NA 1M2VB 4N3GA 3RVQA 2J5RA 4R69A 4IFEA 4CDRA 4HDNA 2A58A 2GZ2A 4IJWA 3MSXA 4P5PA 1AGRA 4FSHA 4MGHA 3RFFA 3OT1B 4DWJA 4GLLA 5F23A 5FB3A 2NXEA 3GXOA 1OB5A 3ZYCA 1Y80A 1YH3A 5ALLA 1XROA 3QI7A 5KYUA 1P77A 2VNKA 3JSXA 4J0DA 3MWLA 4B6RA 4Z3OA 4XUEA 4CF6A 1CU1A 3C16C 4AJPA 4PYRA 3G2PA 5D3MB 3UBTA 2ZYSA 5F33A 1X1DA 1SUIA 3S2YA 5F77A 2C4TA 4E0BA 5HGJA 3MWYW 2V7VA 3O92A 3F8SA 3HHPA 3FBWA 1HR0B 3SN6A 2VN8A 3ZE8A 1N0WA 1GZ6A 1K08A 1SHJA 1T2DA 3PV0A 2G80A 4RD6A 3K6RA 5LCXA 1V26A 4MW5A 3UICA 5PNTA 1NVAA 2Y9MB 4BZZA 1HQCA 5FQOA 1WVIA 1RP7A 2CJXA 1U8FO 1D4OA 2E18A 2FRDC 3GNQA 4PZYA 4M7RA 4JXJA 5FI1B 1IBLB 2YWHA 3LLSA 4DSZA 4UCXA 4PU0A 1DOAA 2EZ4A 2CD7A 4QM6A 1CDDA 1G9XA 7REQA 1DLJA 4REMA 1ATIA 2GXUA 2ZAIA 4HLUA 5CVEA 4PBTA 1Q1AA 1SKMA 4H3VA 3QFFA 2WV9A 3ETCA 3ZZTA 3CX4A 3IDAA 2AN3A 2JA1A 2ODNA 3QKTA 4QUJA 3IVRA 3WKCA 1OF1A 2PZGA 4R8RA 5LKRA 1XZEA 1M6YA 1P5HA 3BXOA 3MWEA 4GSLA 4OQDA 4BVAA 5BUQA 4RULA 2LE0A 3G2QA 4TV8B 1J2JA 2V7UA 2XOXA 4ZALA 5JROA 3CLSD 1Q1ZA 3CU5A 3PQCA 5TSDA 5L4LA 3TLBA 4RH1A 4CLOB 2NUAA 5K3SA 3T5CA 4CMEC 1K4YA 2QROA 3UJPA 1PD0A 1PG0A 1T3LA 1XXHA 1PYOA 2A5FA 4KRGA 4N4AA 2VP6A 3DDUA 5I4CA 4C7OB 1C0IA 5A7HA 2BKVA 4DMUB 1JV2B 4O2AF 3VDXA 2CEAA 1C8VB 1UWVA 4FGSA 2ODWA 3BGIA 1XZIA 3JQ8A 6AT1A 1DHRA 3WMRA 2X40A 2CDAA 2FN8A 3KUCA 5FO1A 2HH9A 4V0RA 5FWNA 1QU2A 3FHCB 1NBMA 5AJTA 3WB0A 1R0SA 3JW8A 4PAQA 3RNLA 3UOGA 5BUCA 2G0AA 1XZBA 2KW5A 1K8XB 2RSLA 2Y1WA 3CH4B 3K5HA 4POAA 4U2EA 3PD7A 1UPFA 1QIDA 2COEA 2NXJA 1OWPA 2VBFA 1ZD2P 3BFPA 4IDQA 4YBRA 3T0FA 3X44A 1ZOOA 3AHCA 2X5KO 1TA9A 1AHIA 1EM8A 1XK7A 2W8ZA 1MOQA 3CKLA 1AM4D 1NVDA 3DDHA 1KSFX 3GFTA 3NKVA 4EF4A 2XMQA 3OSUA 2AG8A 2NU6B 1UADA 1QO7A 5CNMA 5EPEA 4G5QA 4II2A 1A5TA 2DFDA 3D3NA 3H8JA 4ZV9A 1KBOA 3OTHA 1E0SA 1RZ3A 3SBDA 1W5TA 5LMUB 3NBZC 1CNEA 2XA9A 1NATA 1IJKA 2CLFB 5GJVC 1ILWA 2I4MA 4F0JA 4H7FA 2D2XA 2WTNA 5FOTA 1RYBA 1NRXA 3CWCA 1V25A 3H2SA 2XTAA 2XX3A 4LRSB 4MEJA 3VR4D 4NYJQ 5NULA 1AKYA 4K9OA 2J9YB 3EXG1 4LECA 2QJWA 1WB5A 2QMZA 5DI3A 2I3ZA 2I8CA 5JV5A 3FIJA 3WIEA 4JNKA 4E2YA 5JZMA 4QVIA 4KZKA 4ZOBA 1G20A 4BATA 1TO6A 3RQSA 4GMKA 3JYNA 3KKEA 1WMAA 4KVGA 2R6AA 4XVRA 2ID8A 4TXLA 4U7WA 2AUMA 3EDQA 3CCCA 2W37A 3BXXA 3JQ9C 1MO2A 1OI3A 2D5CA 3ETGA 2C2MA 2JBHA 2WIFA 1EK1A 3Q7EA 4NBKA 2QOEA 3MQ2A 2SKEA 5SZIA 3V1KA 3Q6NA 3CYFA 2ZRLA 2IP2A 3EIXA 4O2RA 3MMSA 3MLAA 3FPCA 2UDPA 4IMPA 4UQPA 3WDLA 5IF3A 1SHKA 1NW6A 1QVVA 3U1TA 1ZX1A 3KZ1E 2PXCA 3LBFA 3QHPA 1IVSA 4Y18A 1YRLA 3PL5A 3KJXA 2WAAA 1WETA 1X2EA 4BY9E 4FYWA 1F8GA 3WB2A 1MB9A 3HGQA 3WWPA 1V35A 4L07A 4QPJC 3VR5A 4C1BA 2GYYA 2C2KA 5JU6A 4W6ZA 5H5JA 3PQ2A 1BVHA 1L7XA 3P9SA 3SKVA 1VCHA 1G16A 1V48A 1WUIS 1YDFA 2Q9CA 4JASB 2G4VA 4CIAA 1GZ4A 1GTG1 4L51A 2QJRA 3W34A 4G9EA 4DCJA 2I8AA 5CYPA 1L3CA 5AKYA 1JSZA 4YXWA 1O0CA 5FA8A 4Z3DA 1UPBA 1ZL0A 4OAOA 5H83A 4HQRA 1NP3A 2WU0A 1C0EA 5EIOA 4OF4A 3FVTA 2CF6A 1OXUA 3KWLA 3PT9A 1Z5NA 3V1YA 5CB8A 1L4LA 2DU8A 1TM2A 4YV7A 2L82A 1NUPA 4JIGA 3ZDFA 1FFAA 4IFBA 2VHZA 3BIXA 3KWJA 1AGYA 2CXNA 3R3YA 4CQMA 1XEAA 3P4YA 2KMLA 2ZDGA 5T4HA 1V4NA 1M2OA 5JBNA 3I0ZA 3TG2A 5EAIA 1KPHA 4CV1A 3GT3A 2JH9A 4AJEA 4YCNA 4FS3A 1G9SA 2WHPA 4J2TA 1T4DA 2QAGB 2LBPA 1DAMA 2IPXA 3OJEA 4RIFA 1PX2A 2YHBA 3OFNA 1W59A 3UG6A 2ZUSA 3Q7TA 1E4EA 3ZV4A 1GCIA 1MENA 1G1AA 4L6IA 5ELLA 4EH1A 4YTEA 1S2GA 5LWQA 3Q8LA 3HYTA 2OZPA 3Q4GA 3QEKA 4L5AA 3G02A 3DFMA 4MIOA 4Q19A 4R9NA 3WWZA 2VPQA 1ULUA 4KYIB 4OSOA 5C0OE 4MI9A 4F5EA 4E4RA 2V03A 5FPPA 1UJBA 3IAEA 1I4DD 2QLMA 5KJFA 4KVAA 5GGYA 3Q3EA 3TAUA 1R4NB 3LLUA 1H1DA 2Q2WA 3E61A 3N70A 2PJRA 3KYDA 1Y3FE 2V55B 4BVKA 5HSGA 2D5AA 3R0VA 3O8OA 1QGYA 4YJKA 4DANA 5JBIA 1RXIA 1IN5A 4WZAA 1USGA 3OIFA 4U0KA 1L7VC 3GCGA 3KLMX 4A0FA 5AIBA 3V97A 3P9KA 2WIBA 1GPUA 3FNRA 3V7FA 1JDBC 3ZD6A 2H48A 3HY6A 3JQQA 2YIJA 3RG2A 3AM1A 1H2EA 3OOJA 4Q9LA 2XWQA 3H6HA 4I55B 5GGXA 2BI4A 2WINI 5KQRA 1QZTA 1L2TA 2YCLA 4K5QA 2XQGA 4W1PA 2NSYA 4AB1A 1R8XA 4KXMA 1OLSB 3ZUPA 4CF4A 2QP4A 2R8RA 3GT4A 3K9BA 5CLLA 2Q0HA 3T5MA 3TQOA 1RHQA 1AC5A 1P61B 3GRZA 3NUGA 4BVBA 1GCUA 1SCAA 1ZMTA 4LCJA 3ZU3A 1G6Q1 2BEWA 1Q22A 1UMDA 3GQBB 1D0SA 4RACA 5ITVA 2Q21A 3I64A 3JZMA 3UMFA 4JJAA 3GEEA 1TCAA 1E1QA 2ORYA 4OHBA 3TLZA 2ZG6A 4YC7A 4BP3A 4ARCA 2R1TB 2R25B 6REQB 2F2TA 3EQ6A 4BMDA 2AC7A 5JR3A 1K68A 1RI2A 1YB7A 4KR9A 1UBOS 5JADA 4PC6A 1Y1KE 2ACVA 3DVRX 4RH3A 2FLKA 3V2IA 5AJXA 4ABYA 3ZW9A 4MR8B 4EGCB 1J2UA 1W1IA 4JT4A 3ULKA 3R0JA 4HFRA 1LJLA 1WVGA 1Z2EA 2ZRPA 2PPVA 3BRQA 3G89A 1BMDA 1I2CA 4PPNA 3S29A 1T5DX 2GYUA 4RPKA 1CJVC 1PZGA 2PSSA 5ED0A 2QZSA 3OZDA 3T3GA 4DB4A 1VRVA 2OKCA 1D6NA 3EVZA 3GJ3A 5C4IA 4RH0A 3VR0A 1UXJA 5A6SB 2H5LA 1NW7A 3EGXA 3H65A 4G1UC 1REQB 1NJFA 3OPNA 3ZZMA 3OHSX 1FQWA 1VKNA 1WCV1 2DQSA 2Q5QA 2VQ6A 2YWBA 4LJ9A 4M88A 3L1IA 1YACA 3ZIAA 5JNWA 2HSDA 4JROA 1VLVA 1LBEA 2HQ1A 3H75A 4AKIA 2EJWA 2V98A 1ZUIA 3IJEB 4J76A 3GLFE 4PFKA 4GX5A 2PGDA 1X8JA 1U02A 2I76A 3HS3A 1U80A 2ZQ5A 3KQSA 4D44A 2JCBA 3I6ZA 3NX4A 3E9DA 5SZHB 2NUTB 4S3MA 3DL2A 4AJ9A 5AVOA 3L84A 1NN3A 3P71T 3QF4B 1E3WA 1HNXB 3E9CA 1LVUA 1EQUA 2Q5OA 1DIRA 4M53A 1VDMA 1CX9B 1JEJA 3E6AA 3IGFA 2W6OA 2DAPA 5GADl 4K6MA 3TF5A 4F3NA 1G8GA 3D7NA 2NYAA 4QU0A 1QYIA 2Z9BA 3KD3A 2VDJA 3GUCA 1HOTA 3P52A 1JE1A 4LQCA 3PEEA 3BMOB 1IBSA 4LF8B 3KHSA 4BO5A 3WWCA 4JOCA 821PA 1JQDA 3OP4A 3V6MA 1J70A 4LVUA 1XZQA 3R3UA 4L0MA 2J67A 3BJZA 1E0KA 1YASA 3AJ8A 1EXMA 2K5UA 2BEVB 3CF4G 3C4VA 3EZXA 3KKNA 3V80A 4ZOQI 1NLUA 2PIDA 5AXAA 3UC9A 2ZR8A 4WA8A 1Z7EA 4FB5A 4NABA 1YC2A 4RFLA 2NTEA 2VUHB 1T4GA 2DQ4A 4EDFA 2ZZMA 1U0HC 2FPMA 4J7AA 4I1VA 2TS1A 4FEGA 4J9VA 3GZJA 1Z73A 2GK3A 1RXEA 5IVIA 2HA2A 4RTOA 1WJGA 1EFHA 1NVXQ 1WXQA 1X1AA 3BIJA 3AUYA 1R50A 4PIPA 3OLZA 4Q1CA 1B1CA 4WCVA 2H4JA 1U4NA 1WXFA 4EUEA 1GA6A 4R8VA 1U11A 2HU5A 3CEHA 4Q4DA 1RWXA 3VYTB 3GJTA 1P18A 3W78A 3OOEA 2I99A 1OZHA 3G7UA 1ZNWA 3STTA 4AMVA 3I09A 4TN1A 5I7AA 4P7GA 1W1WA 1Y6QA 1P3DA 2CD9A 3ND5A 3IR5A 2JFZA 3K15A 3B7WA 2JI4A 1N5RA 2IUUA 5LQAA 1VQ1A 1GRCA 4ROTA 1UEJA 2FF5A 3O74A 3ZK8A 3TBHA 3VX4A 2HDWA 4ZU6X 3W7VA 3AEKB 4D0GA 1TLLA 5JZVA 3L4KA 1DBQA 5J2TF 5HR5A 4LXXA 3PQ6A 1EEXB 4X24A 3OIDA 1VYVA 4KNVA 3GPBA 4DSTA 5K8UA 4RMNA 2JG3A 1JIJA 2R79A 2IU0A 3AGQA 2WIDA 4JYAB 2DKOA 2QMEA 3PXDA 1SA0B 1KBQA 2VDPB 4XAQA 2W8BA 1HY3A 2FEKA 2HV9A 2R2AA 1X0XA 1JR3A 1P0PA 5BSTA 3WMXA 4ZMBA 3UHPA 1RM5A 4LCEA 2EL9A 2QYHA 2IODA 3A3YA 3BTVA 3LCMA 5F52A 3BHJA 5EUQB 2Q0SA 2LD4A 2WU8A 2XDQB 1JAZA 2O2ZA 2YBDA 3KR2A 1JS1X 3OJWA 3PXUA 4MO2A 4R0NA 1NXWA 4UHFA 4ZWNA 2YWCA 5CIQA 3VNBA 4UCWA 4AY6A 3HO1A 3K96A 3ENVA 4TV8A 2I6XA 3I5YA 4JI4B 3BBLA 3RE1A 4CIBA 3BXGA 1U1CA 4N9WA 4W5RA 2AT1A 5KQMA 3ROGA 1M74A 1E4OA 2XUFA 2O1SA 4MUFA 4RK6A 5E7JA 1IATA 4GG1A 4M9RA 3G1TA 4X20B 5H7XA 4A73A 2ZE5A 5CFNA 5I3ZA 1AKTA 1S7CA 5K0GA 2AYZA 2P6UA 5U4XA 4MA4A 3K73O 3KAQA 4EX6A 3JAKB 2LKCA 4D97A 5KYKA 4Y2JA 1N2IA 2V97A 1IH8A 3OU6A 3AZQA 1SH7A 3WKBA 1T4BA 4XQCA 2FFRA 4XVUA 5ADUS 1NRIA 1UXOA 2ACKA 1NXTA 2PZMA 1NBMD 4RAQA 4L3VA 4QUIA 3RC3A 4UTPA 1FZQA 5EXTA 2FPKA 1GXSA 3H2GA 3RF7A 1ISSA 1JFRA 1HDRA 3SZOA 2M9MA 3W0LB 4PR0A 4BUJA 3LT5A 2G0NA 3PFKA 2XR1A 3IB6A 2PUCA 5HFAA 2ZRNA 3IULA 1XNJA 1WBJB 2I3DA 3DV9A 3Q72A 1YMUA 4AUKA 4YMVA 2WWHA 2OR3A 3EC2A 1ACLA 3JQBC 1X13A 4HNTA 3COYA 1CY2A 5CB6A 4QPZA 3ZVRA 4BMZA 3R3JA 2SCUB 1XTVA 5IT9A 2VHCA 1Y48E 1Q0LA 1YS7A 2P1DA 3ODPA 4HDQB 5K6AC 2AFIE 2I54A 3EZGA 4H3SA 1VECA 5B3JC 4FYJA 5G0SA 4Q7KA 1Q44A 4Q3EA 2Z2YA 5J58A 3ZY6A 2O1WA 3OT5A 1GGKA 1NIJA 2WC1A 3WGOA 1DC5A 1HETA 2AZMA 2OECA 3OESA 3TCXB 5JANA 4UNRA 1LGYA 2UAGA 1G1MA 5A4IS 1N8KA 4QRIA 2GM5A 2OV6A 2ZSDA 5JG7A 4E5DA 4CMGA 2OFWA 2VZ0A 4XEHA 1AUPA 4KCGA 5EJ9A 1E2NA 3H5VA 1QLWA 2XVZA 5I9MA 1KDRA 1JH8A 1P5JA 1P9LA 2I6FA 2IH4A 3WJAA 3ZD7A 3G3EA 4G0MA 4ZMRA 1NVGA 4DUZB 3TNJA 3ZHUA 4FS8A 4U6QA 4EIWA 1M1ZA 3EXHB 3TQSA 2JFUA 5C1BA 4NL4H 5AHRA 5BP7A 4P93A 4C4ZA 3HJUA 1TKBA 4XE5A 2B21A 1YR9A 2JPDA 3ZI0A 1RVV1 2VZEA 3Q2KA 2YWEA 2VAPA 3IAFA 1AF4A 2R7AA 4OCZA 3T54A 1IWOA 2B7BA 2HKIA 4PLVA 3X3HA 3WGIA 4HLDA 4Q37A 3WYGA 1K4KA 2E5FA 3I4CA 4LHEA 3ZCVA 4WJKB 3VR5D 3RPEA 4JI0B 1M5UA 3QLJA 2UUAB 4IDOA 2WUFA 4LV5B 1G7CA 1HE8B 4ZI3A 1ODFA 1V7CA 5KMGB 4C30A 3GBVA 4RSHA 1PSZA 1PG2A 1OLXB 1I3MA 4PRKA 4TL7A 4EGSA 2JFBA 2PUAA 2R5NA 4X6XA 1MORA 4FFLA 3MWFA 3M1AA 4FFVA 3ZWPA 4R8MA 4DLAA 1NUQA 1V4BA 4BZWA 4LMRA 2HCJB 2ZJ4A 4ZOLB 2CNLA 1SIBE 4RTRA 1QH8B 2HMTA 3AY3A 1WL8A 2VVTA 3RU2A 4CMKA 3RHZA 2HK9A 1P4AA 1YA4A 4A7PA 3SSAA 2AXQA 5EKSA 1YQ9A 4D1YA 1Z4OA 4FE3A 2WF6A 3KQHA 1JG2A 3KXKA 1KJQA 3QXCA 1A8UA 2V6IA 4A8JB 4LV8B 3RUHA 2QAGA 3D2AA 4BO4A 7AT1A 1BE8A 1UT8A 1HXHA 4MWGA 4QSHA 1PD1A 3OFND 3HUTA 4PQFA 1JHRA 3NOQA 2CXSA 1QGDA 5FF9A 4MJ7A 4ZTBA 4JQSA 2YV3A 2ZRIA 5CLJA 1F2TA 1NBAA 1Y8RA 3LXMA 4M1WA 2YZ2A 2YFHA 3BD8A 3HB7A 3QELB 2Z8YM 4Q6BA 1AGPA 5BUZA 4KL8S 1NAIA 4CUJA 1SM4A 1SPBS 1XMPA 2P68A 3IXQA 4GLJA 4L16A 5G40A 5EJEA 5K3EA 1WZEA 1FYFA 1HO3A 3D8SA 3NNNA 4JYPA 3DCYA 2IUEA 1RD4A 4PXYA 2W2QA 4JBYA 5EIBC 5GJWC 3VR3A 3FGZA 2IU4A 1EGHA 2UVPA 3AR3A 3R8CA 4B87A 3NKFA 5IRCD 1DAGA 1GZVA 3M89A 1UPCA 3NWOA 4MAFA 2NYRA 2X2PA 1QFYA 2FVXA 5JCOA 1N1DA 2P2YA 2GK7A 1PT9A 7ABPA 1SURA 1CUDA 2SHKA 1M6HA 3GCZA 2IHTA 4PZZA 4BIMA 2ONKA 4CL8A 1C0LA 2XQIA 1P7CA 3I9NA 4Z4FA 3WBKA 3HU5A 1P1HA 2QL6A 3PJDA 3BIFA 4E11A 2WTMA 4IQ4A 1X1TA 1O57A 5FRDA 3EGEA 1W87A 2WUGA 4MVJM 5HQJA 4V1CI 3SQLA 1XDGA 3GGOA 4I55A 4Z1MD 1U8XX 1CZRA 5CDTA 2YQZA 1MA3A 1VL0A 2Q1WA 1WHSB 4WADA 1SCNE 1A5ZA 1PWHA 2CLLB 1ZNYA 1G8MA 4MVYA 1CJCA 1L8QA 4N47A 1VPDA 2JF0A 4MRMB 2WJAA 3WRYC 4CI9A 2YUTA 1AMOA 1RI4A 4EPYA 5AXBA 3AR7A 3ST7A 1BJTA 2QEQA 2QLBA 2BUCA 5A71A 1Q21A 1QKJA 3P2MA 4TMVA 3GJ0A 2AG5A 3V3KA 4BO8A 2PO7A 4NBRA 1F2DA 4OHPA 3E3OA 4ZVMA 4EYEA 3PT5A 3GXBA 3AP1A 4ZEVA 2QVLA 3LD9A 4LNUB 1UPUA 1ZH0A 4N7RA 1P45A 2XKBA 4JBIA 2D8MA 1JI0A 1X38A 1NI4B 1A71A 3RSSA 5JAMA 4FEEA 4F9TA 2GR9A 1VCIA 1UKYA 2IHYA 3LX5A 2JEOA 4X7MA 3DWEX 4DLUA 5L95A 4ER6A 2X0RA 4LFAB 1OXMA 3CE9A 1KRHA 1IN4A 1CSEE 1VG0B 1U0NA 3ER6A 5AWFC 1ADCA 3P0FA 3FTEA 3HHEA 2XCIA 3FWZA 3D4NA 3NHBA 1Z33A 4G5HA 4YRPA 4FHCA 5CJJA 5HKBA 5JFOA 2P6RA 7MHTA 3ZCRA 3KVRA 5LB4A 4B31A 1ADBA 4EY8A 2KX7A 4RF2A 4DVJA 5A6SA 4ABTA 2P65A 3GDWA 3HFJA 2EYQA 4EW6A 1JKFA 3IO5A 1TZKA 3MCTA 3JD4A 4RC9A 5C46F 2WTEA 3ZIAD 4M8IA 3ESCA 4UPVA 2QD1A 2I5PO 3FOZA 2RBKA 3GRCA 4E08A 1MAHA 3LJKA 4UXIA 3L6DA 4IYRA 4BTEA 5IWAB 4JCOA 3HVUA 4G2TA 1E1MA 1Y5RA 1XJ5A 4Q39A 4Y7DA 1XNRB 4OOEA 3IQXA 3JALB 1RPZA 4BB5A 1KMQA 3EGDB 4J03A 1T15A 2JZNA 3C7AA 4BX0A 5EP4A 4ZAZA 4IUDS 4BKQA 4YAUA 1OBCA 1O89A 2WSLA 1FE8A 1XU9A 3GDFA 4EHJA 1XCJA 1X7WA 3RU7A 1F5SA 2FUCA 4CMBA 1HI9A 1TT5B 3QFHA 2BHNA 3KQPA 4P38A 4LJ8A 2QTAA 4QNNA 1GZ3A 1NKTA 1SIWA 1NNLA 2ON6A 3L4BC 5MHTA 2J9GA 3C45A 3GLKA 4OFWA 1RNLA 3BFKA 1UBLS 4DA7A 1PUIA 1N25A 1S96A 4HAVA 3MBOA 4HDOB 3GJXC 5DVZA 4J91A 2WEKA 4UCFA 1UZUA 1IBRA 4IZIA 3LXXA 4V3CA 2JVKA 3VH1A 3G8BA 1R15A 3DO8A 1VSBA 5CFRA 2Z9CA 4NV1A 3EGVA 4RHYA 1MOSA 2ACWA 4OAQA 4RSMA 4XARA 1L4HA 3DE0X 3GGCA 3JWIA 3NWBA 4PLHA 4I3GA 2A5LA 5JCZA 1R6BX 4OQFA 1L9XA 3D7KA 4Q00A 1GQYA 3MJHA 1WB6A 3MCVA 4HDMB 2IV7A 5D7BA 4IP0A 1D03A 2A59A 3OKFA 2V7WA 4KXYA 5BYBA 1SEPA 1H5QA 1LLFA 4HWPA 4IIEA 3WYNA 2Y68A 3KLNA 2Q2VA 2QD3A 4M7OA 2QM3A 2FP4B 3K32A 1SK9A 4J3JA 1JU3A 4XGNA 4XWTA 4YECA 2FSVA 1URPA 1VHLA 2H52A 5DDIP 3SVZA 1Z35A 4G0NA 4CIVA 3N39C 1XXLA 2HIHA 2R8EA 1RXUA 2FWIA 3AU9A 4DA9A 4EJFA 3WL7A 3FUVA 1NVMB 2FW1A 1VCOA 1J0CA 2GBCA 3ZDZB 4AG3A 2WZQA 4MCHA 1P4GA 1SA0A 2B36A 2PL3A 2IH2A 3BGDA 4C6TA 3S8YA 5HK8A 1JR3D 2DJIA 2AJTA 1FMCA 4WA7A 4F8EA 3OUUA 1KAMA 3P8ZA 2R96A 2Q9BA 3VJMA 3BJEA 4D3ZA 3U7GA 3MB5A 1W73A 4OVKA 2NVOA 4D9EA 1I3CA 4GOXA 1H5UA 3DMGA 1VHDA 2G36A 3PRKE 2XADA 1IZ8A 4L9AA 2XE8A 4MKRA 4RPLA 4URZR 4EPTA 3D4LA 3P20A 1CDZA 3DAHA 3K9GA 1QFXA 4IH4A 3A36A 3CF0A 4ZAFA 4EB0A 1ZIXA 2MYPA 1ECJA 2C7BA 3I05A 4YJGA 4X64B 1M7GA 2B25A 4BVHA 2F17A 3MGBA 3A2KA 1CUEA 1SKYB 4C6HA 2HDHA 5FBQB 1E2BA 2HXSA 3FDXA 1C1DB 2I71A 1VSUA 2H1RA 5MDHA 3J7AC 4EX7A 5AICA 3OU2A 1G4UR 2YYAA 4BQSA 4S0ZA 3WGQA 1ID1A 4E7OA 1KC1A 4X9XA 3H9BA 5ISMA 3AM5A 2QTZA 4U9UA 2GEJA 1FP7A 4PYNA 3TNLA 4DR4B 1QTQA 5BQXA 5L53A 1TB4A 2FSGA 5L51A 1AVTA 4NDZA 3RVNA 3VZBA 3A4TA 4EI9A 1XA4A 4ZK6A 2AE1A 3T1NA 2GFHA 3F7TA 3R44A 5BMVA 1ZOSA 3U3ZA 2BHLA 1G4HA 1FW8A 1FX1A 1YNOA 2WM3A 1G8SA 4GWLA 4LYEA 5FUYA 1XAHA 4CR7A 2P2CA 2V45A 2NO1A 2IXGA 5CPBA 2ZM6B 3RSQA 4RL6A 1GR0A 3HA7A 3E7FA 4G37A 4DEVA 1DQZA 4YDSA 1NRJB 1TOAA 4RK4A 2JANA 2BR3A 1GV0A 1DEKA 5EGNA 2HJVA 1L5VA 1E2PA 3BXHA 2QN3A 1NVTA 1HTTA 4F8JA 2PJUA 2A86A 4ERXA 4DY4A 3IEKA 1VZ2A 3LL4A 3AH8A 4Q9HA 4DT1B 4BXOB 2NP7A 2BFBA 3ZR4B 1X1CA 3MGKA 5B12A 3VSEA 2CJYA 1BA3A 1J0BA 4R8KA 5JMTA 4MV9A 3ERCA 3B13B 4HQNA 3EEQA 4W8GA 4JP8A 1I0LA 1UBNA 4XGIA 5AW2A 5AW5A 4V2UA 1Y42X 4EYGA 4W6QA 4C4RA 1XK6A 1TJPB 1IY9A 3DWIA 1C8KA 1LDEA 3P2KA 4H3HB 2ILTA 3VVLA 3ZWDA 3U16A 3PSHA 4N6OA 3G2NA 3SM3A 1ZGJA 2ORIA 3EMBA 4TKVB 3NTUA 1O9GA 4CKCB 1IOVA 2ZWMA 4DNPA 4TZ6A 1EJBA 4ZHQF 1OKKA 3M7IA 4IKEA 4YJFA 5JRZA 2RHBA 2AHRA 4UTZA 2ZR9A 2F48A 5CDFA 3K9LA 1HEUA 1YFZA 3SQOA 4D0NA 4DJ5X 5B3KA 5J2UF 1VFPA 5GINE 2WU3A 2ZT8A 4F9FA 3IEMA 1WDLA 3RYTC 2E87A 3KEMA 1K5PA 5JALA 1SXQA 4A1OA 1K7CA 4LSMA 4ZPJA 1S2NA 1FA9A 2RGUA 3ND7A 2GNPA 5HIMA 1OUMA 3SM9A 3OG9A 3AQIA 5KYYA 3ZDCA 2WVHA 4CPDA 2ZTMA 3AJEA 3R7SA 1BXGB 4GR5A 3T0IA 3QG5A 3GLGB 4MHTA 3GLVA 1P1RA 4P8RA 1TVMA 4U3JB 5CK4A 5KVCA 2VJDA 1CQPA 4W1RA 4IWYA 4WZBA 4HTFA 2XNCA 3KOXA 2FZEA 4HWOA 3ZN2A 1U1IA 3GI1A 3KUKA 5LBIA 3S99A 3G2JA 1OWMA 4R68A 4PG7A 1MOZA 2J41A 3VZDA 4ETNA 5JFGA 3N3AC 4GPEA 4ZO7A 4AZVA 1XYVA 5TX7A 1GTL1 2M1ZA 2BR5A 3AVQA 3ILYA 4WCFA 3TQQA 4ZOLA 4DY6A 5A3RA 3R5TA 1IOWA 3MGGA 4Z99A 4DDMA 5TQ2B 1QH8A 2PX2A 4KW7A 4IIFA 3EPHA 4INZA 1C2TA 1DAKA 2YNMC 3EY4A 3R6WA 1E1LA 2Z3VA 4Q4HB 4EA6A 2V1XA 4WNCA 4DCTA 3K72B 1L8OA 4M21A 4ZCRA 5BVHA 3QUSA 4FBLA 1YJ8A 2O07A 5K3AA 5D3QA 3T9EA 4MUGA 3G2IA 1Z2PX 4MW1A 3RS5A 3PFHA 2IITA 1T9DA 2C2XA 2XD4A 1UAGA 2N1MA 1GLNA 2EXXA 2RHHA 3M83A 3OY7A 2O7QA 4R05A 1C0PA 2X5OA 3E2MA 3IAXA 2PVPA 4BB9A 1Z8NA 3ZGZA 2AW3A 4QQKA 5JMOA 3FAZA 2EFEB 2FWBA 3TLKA 4LYDA 3KPUA 2CXOA 4DLWA 5JAPA 4DMLA 1EXDA 1TE2A 1RM0A 3HMQA 3LNTA 5KQGA 5CH5A 5EKUA 1XYGA 1D3AA 2GCOB 4REQB 5A05A 4ID3A 4ZQFA 1A9XB 4ZVVA 1SO8A 2D54A 2O0KA 3QVTA 1PEKE 2G88A 2ZRHA 4F71A 3Q5EA 4UBJA 3EFOA 3VR3D 5E7QA 4Y98A 2HQRA 4H0NA 5HDQA 1E5TA 5GM2A 1V96A 3DBLB 2BKUA 1L7QA 3O8RA 2FUG1 1NY5A 4FWBA 1QF9A 3LSYA 3U81A 3C14C 3W5IA 4KE8A 1XL0A 3A9VA 1FUYB 2FSFA 3E7WA 5D3ZA 5IBCA 5KQPA 3AW9A 4ZP1A 4DCNA 4I08A 4X8OA 1JXOA 4KIGA 5JNTA 2FAXA 4UCQA 3HCDA 3ABQB 1PV2A 2O8VA 3N2ZB 4BX8A 4CUZA 3E9YA 3L7LA 2YOFA 4XRGA 3QPAA 2VBGA 3TUJC 4O08A 3TRIA 2WTUA 2X2EA 5H1YA 5CA0F 2A7QA 3RYIA 2E5LB 1WS6A 5C1IA 1R4MB 2D06A 4HHEA 4R54A 5TLSA 1XCMA 4XH9B 5ELMA 3W8RA 1N9ZA 2PMDA 3MGAA 3QVXA 1F4LA 4XIFA 4O2AB 2MMCA 3PE4A 2HOQA 1E2FA 1Q0SA 3OH8A 4R1QA 3RRNA 4KREA 4MRMA 1DFIA 1UL1X 3ONVA 1B0UA 1BEZA 4YS6A 5H82A 4E4TA 1GT91 4C7XA 4B4WA 2XVAA 3BWCA 4IIJA 1N33B 4WY8A 4XIIA 1KZ6A 5KU1A 2GN6A 3HFRA 3KFVA 4PS0A 5I48A 4RM3A 5KJCA 5BYKA 1XKTA 3IP5A 4E94A 4LNUA 4G4GA 3O90A 5JJIA 4GIBA 2XA2A 1J00A 5AKZA 4Q9JA 2FEWB 1L5WA 1CNMA 2REOA 5EWJA 1I0ZA 2EX0A 1CY0A 3KV1A 1RC1A 4YYZA 2PAFA 1ZUWA 2BGNA 1R8SA 5REQB 5IDVA 1X39A 3DQZA 3D5TA 3KEOA 5IJ9B 4P7KA 1N92A 2JJ8A 4ZVRA 4EVRA 3QGMA 4B45A 1X80A 2I3AA 2FZ5A 4DWOA 3HJNA 4AULA 1N2SA 1VHJA 4KG7A 3JSAA 3RROA 1UC8A 2NQ2C 4ISBA 3ZLUA 4D6XA 3DVSX 3EEOA 4OHZA 2X19A 1Z83A 4GI1A 2BGRA 1RWWA 2JFGA 1NBHA 4IUBS 3HXOA 1IJEA 1MJ5A 4J0JA 2I6QA 4M0MA 2AKYA 1FVFA 2IYYA 2C77A 3FSRA 3MOIA 4G85A 4DV1B 1ODTC 3EVGA 4HS9A 4YLEA 4B3CA 4DIDA 1KAHA 1TFRA 2C00A 3MTJA 3KR1A 4P53A 2YHUA 4QO7A 3NXKA 2VG8A 2ZB4A 4ES6A 3Q0EA 3PA8A 1BEUB 4J0QA 3PU6A 4I3FA 4V2IA 4YJ3A 3VHXA 5KOJA 1E2IA 1WV0A 4EHHA 1MJGA 2R6CA 2Z57A 1KC3A 2YYSA 4JL8A 4EBFA 1SVNA 3R3SA 1T35A 2AL7A 3RC8A 1YDEA 4K7JA 3L6CA 5FPHA 3H2KA 1R4ZA 2EQBA 5JYBA 3FPJA 1B8VA 1EZ1A 2CF5A 3VNSA 4TROA 2DHRA 2DFKB 1ODSA 5EJ7A 3RSOA 5JSQA 4IIJF 1FYWA 1CUYA 1RLUA 5KTRA 4I5EA 5HOQA 1S4MA 2IUYA 1Z37A 2XB8A 3INYA 4INAA 5ITSA 3NYWA 1PU2A 421PA 3UXHA 3B51X 2BVNA 2HCRA 4J7UA 2LCFA 2KS6A 2HUNA 2P9YA 3H1TA 3NQ41 4I5DA 5HKLA 1SQ0A 1W88A 3PC6A 5AXCA 1WR8A 3OCJA 3I2KA 3IUQA 3R6DA 5JBQA 3EPJA 3LL7A 4BQNA 1X3LA 2Z4TA 3EK2A 5CIYA 3TVDA 1RBMA 1ODLA 1PNVA 1SZJG 1Z4LA 4G0XA 4CDGA 3L8ZA 4OI0A 2ILVA 4NARA 2AOUB 3M4ZA 4KN8A 1RRKA 1MW9X 5KU7A 4NSNA 1TX4B 4EFKA 2DPLA 3QTLA 5K6RA 1HLDA 3TECE 1SVUA 1YS6A 3KSBC 3FIUA 4O2BA 1I3OA 2BP7A 3HJGA 3A7DA 3HK2A 2J08A 1E63A 4MP6A 2HWKA 4ADSG 4W7SA 4RO0A 1MVLA 3QP9A 3GEBA 3TKYA 3D6MA 4LG1A 3O1JC 3IS3A 1U7UA 1PSWA 1XJQA 2RH8A 4HN4B 3UENA 4OLAA 2IKQA 3GVHA 3K0EA 3L18A 4HI0E 1NHGA 1Y8AA 2CFTA 2CYCA 2GUWA 2WZBA 3BBPA 1X1BA 1DMRA 3DFKA 4YJ3F 4NEGA 5CVDA 1G41A 4MKIA 2W6JA 2ADOA 1BYIA 4JFAA 4XQ9A 5CP8A 1XA3A 4YY3B 2XTNA 5EP1A 1I7QB 2H4ZA 4PZ9A 2VDRB 3NVMB 3Q8WA 4ZEMA 1FRFS 1GYQA 2D4AA 4ESEA 2CVPA 1A8QA 3IC5A 1ZJWA 2R1VA 2ZSEA 4G0WA 4IQGA 4GPAA 1V5FA 3E7PA 2OMKA 2RFLA 3P4XA 4RENA 4CNQA 1HE1C 2H29A 3NETA 2GCGA 4DRXA 4UATA 3TVTA 2GLTA 2R6R1 2YC2C 5LZ9A 3DYBA 5AKLA 3AINA 2P69A 1ZEMA 4Q6WA 1LJ8A 1W1UA 2PFKA 3LECA 4JT9A 1DDGA 1KL7A 3IEPA 3WAKA 4FW9A 3HXMA 2QTFA 1N2BA 4U2KA 4KX3A 2AF4C 2CV2A 1HC7A 1N2CA 4F7DA 1UQTA 5LMZA 2IH5A 2G9RA 3H5NA 4UUAA 5GIPE 3MOSA 4WX2B 1FP4B 5DZSA 4EW3A 1I6WA 2CUZA 2R8OA 1ORIA 4W1SA 3VPCA 1CJSA 2G9ZA 1SBQA 1E6KA 1Z62A 2XMBA 3IPRA 3LUKA 3KETA 4EQZA 3ILVA 3IMEA 4O2BF 2I0FA 3THSA 4EW1A 2IELA 4QGGA 3GBPA 2GZAA 1QBKC 2YMPA 1ZR2A 1ODCA 1RPAA 2MHCA 4DCSA 1T4CB 2PCJA 1ISGA 1JRLA 3DBRA 2MMGA 1VGQA 2HHJA 3FJOA 3KUUA 4D4JA 2ZXEA 3ZU2A 3OSZA 1PT7A 4I50A 1GNVA 5EXXA 4K9MA 4NU6A 3HKDA 4BRSA 2BRUC 2EZTA 3A1NA 1TECE 3NLLA 4MGZR 1KMNA 3UAWA 3L0IB 2JGEA 2TMYA 2C92A 3AV3A 3E53A 2O14A 3ER9A 1CQJA 1Y98A 2YHAA 3U3RA 2AQKA 2H85A 3G5TA 5LUAA 4CMHA 3AHDA 4MARA 4H17A 4DSNA 2W6PA 2DPYA 4I2VA 3OQBA 2UV8A 1W36D 1NTRA 4GI3A 2V8BA 4RPIA 4I3HA 3KQLA 1V2HE 2O2HA 3A32A 3IQZA 1Q0RA 3JVVA 3L8FA 3LW7A 4R1NA 1MFZA 2A3NA 1G17A 2NSJA 2RG7A 5DXAA 2VJLA 4YRDA 2ZIXB 4DT1A 2F1IA 4U7DA 3MLEA 1J9ZA 4HTAA 1E5DA 2HAEA 2VP5A 4UDOA 1P29A 1R12A 1W9MA 4MUKA 1F3LA 3FPSA 5EWJB 4AG5A 1L5KA 4BLTA 1YRYE 4C88A 4Z53A 4ARIA 1FNDA 1SC9A 3Q41A 1G2QA 3DUWA 1CV2A 1E9VA 3I83A 2BFEB 1V1MB 3EIUA 1M0SA 2D1FA 2IIQA 4TLDA 4F21A 5DM1A 2V58A 3IAS1 3OC0A 4N5LA 1IY0A 5FYDA 3PE6A 3SQXA 5B6PA 1L4NA 1Q14A 2LIPA 2DQKA 4OH7A 1T25A 1QIFA 4GGOA 1RKQA 2ZTHA 3Q5GA 2RC6A 2PWPA 3AVOA 1WCIB 2AUNA 1OKKD 4QYIB 4DCPA 4KHPB 3O2SB 3LFTA 5K3DA 3EPPA 2WKRA 1NU8A 4P84A 1Z0UA 3D4PA 5FJJA 3HV2A 2HR1A 2RIRA 3JZDA 5G1NA 4BNYA 1U1GA 2O57A 4TWZA 2ZRBA 4L76A 4EGFA 1EX7A 4KFSA 5CB4F 1WPGA 2ZJ7A 5DTMA 1ZLYA 1DCFA 4D8TA 2M6LA 3UMCA 3DTVA 3TDKA 4II3A 4YNBA 1ZI8A 2PFGA 4UE6A 6GPBA 4QRDA 2ANBA 1EB8A 2EJBA 2NNWB 3ROQA 3ESQA 5BSFA 1T8RA 1Z29A 2A5JA 1QP0A 5ARBA 3FNEA 4IWXA 2VSQA 1K88A 5FFNA 2GHIA 2PD6A 1H2AS 1VJRA 1LNQA 2IHKA 3I76A 2NU8A 3VU0A 1HDZA 5TQ2A 3GLTA 2X3UA 1HL7A 4IWNA 3ZJUA 2VEOA 1WCYA 2JLVA 1G21B 3IOBA 3K9FC 2HF8A 5JVDA 3I9V1 3KU4A 1SB9A 4DLBA 5B64A 4MS1A 621PA 1P2VA 5DI9A 5JD6A 1U7DA 2C4NA 4XIYA 1NONA 2OV2A 4DR7B 3BWVA 2B61A 1HT1E 3W5VA 4B6GA 3VA7A 2DQYA 3DQPA 3WIDA 4OBEA 3SYNA 4FYYA 5GP1A 1XE3A 5J2TB 1JTFA 4FMDB 3AHEA 1XJ0A 3QUAA 2W11A 3TD6A 1XMOB 2GCOA 3DL0A 2P2DA 2UZAA 3MTGA 4MINA 1KKLA 4B3XA 3FFTA 3E23A 3IBYA 2L42A 3BK1A 4Q3NA 3UK0A 4D4KA 4RZUA 3S7ZA 2JH8A 1Y6FA 3BD6A 3HO6A 3LCUA 5DOZA 3FPEA 3JQ6A 2O6LA 1KVQA 4RTKA 2K4MA 4WHMA 3OUTA 2O3UA 3RKSA 4OHYA 1J1UA 5BXQC 1WG8A 3EXIA 4KOEC 2ZBDA 3CIFA 3DBLA 4L6CA 4NH4A 2LCQA 4PLGA 3U7JA 2XQVA 4F6CA 5FWYB 3COWA 1ZM7A 4UU7A 5L3SA 2HLNA 4OIMA 4DA4A 5ALMA 3TB4A 3WKDA 3AVXA 1JFVA 4PYOA 5B5SA 4TKUB 5LOVA 4R2JA 3BAFA 1OAAA 4HRXA 2H3HA 4HZGA 1FMLA 1XLTC 4HAOA 9MHTA 5JXIA 4PXAA 3K0CC 1N3IA 4HQ6A 1XR3A 1KJZA 2VJMB 4L5YA 1R4MA 1I4OA 2C1EA 3KO8A 4MVWA 3UMJA 1WRBA 2N1BA 4MW4A 5TF4A 1HNZB 4GXTA 1MX1A 2B7CA 4Q4AA 2GD0A 1JDBB 1LKZA 4QUGA 2I2DA 4QIHA 2WP0A 5AK0A 1EEHA 3AR5A 1NVVQ 1KETA 3TDNA 2FZGA 5JVDF 3TE7A 2BIFA 2VRNA 5C7IO 2QTRA 1I1OA 3RC9A 3T5GA 1AQJA 1F8XA 1F6BA 1SULA 2C2HA 4PIMA 2C83A 1PWYE 3Q6MA 1X7ZB 2Y4OA 4URUR 1GKYA 2RC5A 3WK6A 3ADCA 2QTBA 1OOEA 3Q85A 3IVMA 3HFGA 1FEZA 2BUBA 4UMEA 4TYYA 2O8EB 1NNEA 2J0QA 2SNIE 3AFIA 3ESXA 3U7QB 1JFTA 2OC9A 4GWKA 3IP9A 3CC8A 4LVNA 4TLEA 4B2LA 4OV6B 2GM4A 1E5QA 2VAMA 2F3RA 1IDN1 1SK8A 2OG2A 1QDUA 3IH5A 1E98A 1NZJA 2Z4SA 4P31A 1YE8A 3ZE2B 1E69A 2NU9A 1PL8A 4N6GA 4OLHA 1ESMA 1D7AA 2R0QC 2HXGA 2RH5A 4CTKA 3EA0A 1XZFA 2C5LA 1K3FA 3H9UA 2FUEA 1QYDA 1WEHA 3QSGA 4IDBA 4L75A 1KMHA 1ZITA 4J1QA 4R2IA 2FWRA 4LMBA 5SZKB 3A0UA 2YIMA 2O23A 2YN2A 4CTMA 1EFRA 3AF5A 3KFLA 4I6EA 1GCOA 4TVBA 4YR7A 1O97D 1TD1A 2V3VA 4ACBA 3TPFA 5F9FA 1IXKA 5LMNB 3RASA 5KKNB 3QEBZ 1CS0A 5CA1F 5LPNA 3L7IA 3JQFA 2ERCA 3FGPA 1MO4A 1GN8A 4G0QA 3M3PA 2PH3A 2PX0A 2BH2A 4WLOA 2E4AA 1M1NA 4Q18A 1G6KA 5HNKA 1W4LA 2QPOA 2WNHA 4A15A 1KVRA 3VPFA 3UQYS 2RG1A 4MGKR 5DLQC 5EE9A 2WB2A 3FOAA 4NAHA 2ORVA 3TL3A 4Y1EA 2FE4A 2H1FA 1JEEA 4KUEA 4DLXA 4OGKA 3HYRA 3TQCA 3K1YA 2RK6A 5CH3A 3KWFA 3UKDA 4MQEA 1IUOA 4NE9A 3HU1A 4XSGA 3STUA 4CIDA 2WAMA 3VZPA 1OV6A 3DVAA 5E8RA 3ZDRA 4N01A 5FKJA 2CWDA 3W2TA 2XAUA 2H7YA 3H9QA 4L8FA 2HMYB 3R75A 2XHZA 4KKVA 3B2NA 1Q57A 2Q45A 4J29A 2F8TA 3TFQA 3KTAA 1FIUA 5FPSA 2QYOA 3BK2A 1K7EB 2H54A 1LD3A 4RJ2A 5LL6P 3GJ6A 4HF7A 3THXA 1PHPA 1CE8A 1AN9A 1S01A 2B82A 2CK3D 2IKSA 3DZJA 4RQUA 4U2CA 3C5EA 5BVGB 5IZ4A 1JQEA 4RK1A 3K8YA 4Z86A 2ECKA 2GTPA 4WZZA 4Q7MB 2BSQA 5DGHA 4UFNA 4MB6A 3WYCA 4FFBB 4PZAA 3MIZA 3HYCA 3VR2D 1V3UA 5JTTA 4NFSA 5CHYA 2ZI4A 1FQOA 2J3HA 4Y6SA 1WDMA 2DR2A 3USCS 1Z6TA 1OZ0A 4QFBA 4AQDA 2WE7A 5A03A 4MHOA 5AR1A 3VH2A 1A5AB 5K0FA 1UMBA 4Y6QA 2GFQA 3IHKA 4LGMA 3UTCA 2TMKA 4KMOA 4DJDC 4HO1X 3F67A 3OZTA 3SHWA 1EVLA 2OGZA 5J9FA 5EUMA 5E6RA 3Q0IA 3KU1A 4TTQA 1F6WA 3JD3A 5HE9A 4QTXA 2JC3A 3AFMA 3P0HA 4RXTA 4WL0A 2MYNA 1VYUA 3BXFA 1C3OB 1NFFA 4BWFB 1NJ1A 1MEOA 3CNOA 1EMDA 3DW1X 4O02B 2JI8A 2RDMA 4WD3A 3ZCPA 4FX5A 2EKDA 1JN0A 1RJGA 2QRHA 2W6JD 2WA2A 4I4TB 1RAHA 4Q3BA 4Y6RA 1VP3A 2OTCA 1IOZA 3E7XA 1CR0A 2BTOA 3OLQA 2R86A 1CUZA 3MA0A 1CVIA 1KS9A 3EF0A 3K6JA 4BO6A 1OFGA 2G82A 1AQLA 3VNAA 5HZHA 3MWKA 3CIOA 1ZI6A 4DNQA 1DBPA 2PLFA 4FYHA 3UUFA 1UUFA 3S1LA 1DTSA 3IQEA 4YAWA 4ER7A 4US2R 2GCNA 1S5PA 4FU0A 5D1HA 1VSTA 1U2TA 2FRDA 2OCGA 2JAQA 3O3OB 1GARA 1J07A 1A4IA 3GGGA 4HAZA 1KGDA 2M6KA 2MOKA 2NAPA 3N2KA 4OM8A 1KHTA 2QY9A 3GA7A 4OXQA 1NL3A 4HJXA 5DBEX 3I2FA 3INNA 2IZ5A 3SF8B 1W5EA 2JLZA 4ZTUB 2YYYA 1KERA 2PL5A 1P4RA 4K9KA 4P4SB 3GVXA 1DCMA 1IXSB 4JHXA 3ZNNA 1RLTA 3UMBA 1KFBB 3V8EA 1OTHA 4HUTA 2GKGA 2IY8A 2PQ0A 3EAGA 2JDID 4HH0A 4MWTA 4OI4A 3G5AA 3L02A 3MRSA 2NZ2A 5FLYA 5HBGA 2G9VA 3DEKA 3U4CA 1HDXA 4ERNA 3W5HA 1TADA 1AK9A 3VC2A 1B3RA 1KZYC 5AVKA 2EDAA 2XCRB 1XZJA 2CLIB 2XF8A 1UWCA 4BFSA 4JENA 2O8CB 5KYXB 1E7WA 3KHKA 3EMVA 2AK3A 2RAVA 3PHJA 1K86A 2GVZC 4BO0A 2XKKA 3PRYA 2ZUBA 2GERA 1NRWA 4Q4JA 4RD4A 2VNSA 4BFZA 5IUJC 4J3FA 3JATB 1SBYA 2D7DA 3L0ZA 2XE6A 5IAJA 2C94A 4R1UA 3KSDO 1D0VA 3PTLA 1AO0A 5DNVA 4ZREA 2W6QA 4BAGA 5HJEA 2VATA 1U9CA 1N5JA 2ZYVX 1YMQA 3K20A 4PAOA 2D0PB 3WLNA 3H84A 1C7QA 1CR1A 5HZMA 4X54A 1DQRA 2GRAA 3BH0A 2BTQB 4JLJA 2BUAA 5CVCA 3L9WA 4FGLA 2O5EA 5KBYA 3D7RA 5ICFA 1J2TA 2BYTA 3B7PA 3ML1A 5TY0A 5DSTA 4PNEA 4YRNA 1I1HA 1OX6A 1P0FA 4B43A 1E1DA 1YQTA 2DUMA 4EJ2A 1KDTA 3FFAA 1YHNA 1N6NA 1BSVA 1Y37A 3JVUA 1XVAA 3A1SA 1GLGA 4WLUA 2Q4EA 1N0HA 1XALA 2JL1A 5ALKA 2AJLI 3AKCA 3HRHA 3WQBA 5JPCA 2JW5A 1NKSA 2RONA 4GLFA