1VJRA

Crystal structure of 4-nitrophenylphosphatase (tm1742) from thermotoga maritima at 2.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
261
Chain Sequence
b'HHVLDKIELFILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLRNMGVDVPDDAVVTSGEITAEHMLKRFGRCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYERLKKACILLRKGKFYIATHPDINCPSKEGPVPDAGSIMAAIEASTGRKPDLIAGKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVKLGKNAGIVSILVLTGETTPEDLERAETKPDFVFKNLGELAKAVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-nitrophenylphosphatase
publication title Crystal structure of 4-nitrophenylphosphatase (TM1742) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 93
structure length 261
sequence length 261
ec nomenclature ec 3.1.3.41: 4-nitrophenylphosphatase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA02
2Q4RA 2WF7A 3GYGA 4OCZA 3UMCA 4BBJA 4CNQA 4GXTA 4FYPA 3OTQA 1LVHA 5AM4A 3A1DA 1O08A 3M9LA 3OCWA 1TJ5A 5AM0A 2YN4A 4KNVA 1TJ3A 4FE3A 4UASA 3KBBA 1L7OA 2FUCA 3PGLA 3UMBA 5AI9A 1Q91A 3KC2A 5ALZA 3QU9A 2P11A 3HYCA 3KD3A 4DFDA 1YS9A 4UMVA 3UM9A 3WKAA 2NYVA 5ALWA 2YBDA 3N28A 5ALTA 1U2SA 5AKJA 5AKZA 2ZXEA 3A1CA 3MC1A 3QXGA 2O2XA 3AR3A 3FPBA 2WF8A 3WKEA 4HYTA 3ZW7A 4DW8A 1RDFA 4NV0A 3TLMA 2FPRA 1XVIA 2CFTA 2CFSA 1U2TA 2HI0A 4H1WA 1ZS9A 2G0AA 3ZU6A 3L0BA 3ZVNA 2Q5EA 3SMVA 3AR4A 2WFAA 1RQLA 3J7TA 4XOUA 5ALXA 5ALMA 4C4TA 2YMQA 1CQZA 3QYPA 1Z4LA 1ZRMA 2RB5A 2X4DA 1YNSA 4BX3A 5ALGA 1NNLA 2W11A 2ZBFA 2FDRA 5AKEA 1QH9A 2JAUA 2JAWA 3L8EA 5AW3A 3VAYA 5IT4A 4F71A 5E0OA 1Z4OA 2C4NA 2HF2A 5ALKA 3U19A 4CF4A 1L6RA 4OD0A 5A3QA 2HO4A 2FPUA 4YGYA 1WR8A 1Z4JA 4I9GA 2JGAA 3L7YA 3IRUA 1L8LA 1PW5A 2ZBDA 1RPZA 2I54A 5ALIA 5AW7A 2GHQA 4YH1A 5AW8A 2FPWA 2WF5A 3QU4A 4RETA 3WGUA 4HGQA 1WPGA 5A3RA 1K1EA 1JUDA 5ALUA 2YMPA 2PQ0A 2W43A 4G63A 3SKXA 3W5AA 4ZEXA 2W4MA 3U26A 2JAOA 1J97A 2GHTA 5AW4A 2AUTA 3B9RA 3EWIA 3IJ5A 5AESA 2R8ZA 2B30A 5AM3A 4HGOA 4EELA 3DV9A 1Z4MA 4NFLA 1ZD4A 2WHEA 3ESRA 4BX0A 1U7OA 2JARA 4HGPA 3NANA 3SF0A 1Z4KA 4YIKA 2PR7A 4BX2A 4BNDB 2EARA 4Y2JA 3ZTYA 2D2VA 4Y2UA 1RLOA 4J2TA 2O9JA 2I55A 4I9FA 1S8OA 4BYGA 1RKQA 1EK1A 3SLRA 3N1UA 2HOQA 3QUBA 2G1AA 2AH5A 4C4SA 4L6CA 5AVYA 1T9ZA 4CE6A 5AVWA 3W5BA 3NASA 3S6JA 2ZG6A 2GO7A 3ZWKA 4AP9A 4KX3A 5ALJA 3WKCA 3U7GA 2WF6A 5AW2A 3W5DA 4KYTA 1VFPA 4UU0A 1RRCA 5JJBA 3U13A 5AVUA 3QU5A 1U7PA 1RLTA 5ALFA 4HAIA 4E88A 5AM2A 1L7MA 1Z4PX 3R09A 4UM5A 4PNHA 2HEGA 2EATA 2R8YA 2AGVA 4UM7A 5A3SA 3FZQA 4ZEVA 5AVXA 2YJ5A 1FEZA 1Z5GA 5ALSA 3AR7A 1L7NA 5ALNA 5AICA 1YDFA 4NABA 2G07A 4AS3A 1ZJJA 4GIBA 5ALPA 3MN1A 2YFYA 3PDWA 2G08A 1ZRNA 5ALLA 2QLTA 1VJRA 5AKXA 2B8EA 3OCYA 3U7FB 3SHQA 3ZX4A 4FFDA 2PKEA 3QUCA 4Y2TA 3ET5A 5AKGA 2HDOA 4QQFA 4UATA 1SWVA 3FGOA 3DNPA 5ALVA 1L7PA 3SKYA 1AQ6A 4DCCA 4Y3UA 2I6XA 3PCTA 4EEKA 3P96A 5AI6A 1EK2A 3AR8A 4UAUA 2I33A 1Z4QA 4AS2A 2RARA 2P9JA 4HGNA 4XE5A 5AK4A 5AVSA 3IB6A 5AIBA 1RMQA 4KX5A 3SD7A 1X42A 5ALDA 2BY4A 5AW1A 4IFTA 4JDPA 3BWVA 5ALOA 2B82A 1NF2A 4YCNA 4Y2VA 1YMQA 3A1EA 3FVVA 5AVZA 4YCMA 3QNMA 5AVQA 5AK6A 1KYTA 5AK5A 1Z5UA 5ALYA 2FUEA 3HLTA 1WZCA 2YJ6A 3QX7A 2QYHA 2NO4A 3K1ZA 3L1VA 3EF0A 1VJ5A 3MPOA 4UU1A 3OCVA 2HHLA 3NRJA 1Q92A 1S2OA 4CF5A 5ALRA 1NRWA 5AKLA 4XQ0A 3W5CA 2VKQA 4JB3A 4OFZA 1XPJA 2ODAA 2ZBEA 3FPSA 3L8GA 2C88A 1Z4NA 4Y2SA 2WF9A 2HX1A 3RFUA 2MU1A 4IG4A 4NWIA 4BNDA 4KN8A 2CFRA 3B9BA 2FEAA 2HCFA 3KZXA 3L1UA 2YMLA 3M1YA 2NO5A 3WK9A 2IYEA 3ZVLA 3ZTWA 2R8XA 3QUQA 4UAVA 2YMMA 5ALEA 1QQ6A 1TJ4A 3E84A 1RMYA 2OBBA 4HGRA 1SWWA 3NALA 4ZEWA 2GMWA 3ED5A 1MH9A 2IOFK 2B8JA 2P69A 2YY6A 2FPXA 4B6JA 1QQ5A 2HSZA 4Y2QA 3ZI4A 5AW6A 1YV9A 3ET4A 2IOHA 1RKVA 3NUQA 1RC8A 4UW9A 5T41A 1QQ7A 4XPZA 4Y2RA 4J03A 2WM8A 3WKDA 1F5SA 3A3YA 1XP5A 2C9MA 3CZ4A 3N5KA 4C4RA 2GFHA 4UMFA 3N07A 3NIWA 4L6AA 3I1YA 2IA5A 4MWOA 4UARA 2DQSA 2RAVA 1QYIA 1Z88A 3L8FA 1O03A 5AKHA 5AM1A 1IWOA 3I6BA 2C8KA 1N9KA 3RF6A 5AW0A 1TA0A 3OCXA 2CN1A 5AVVA 2FI1A 2YJ4A 4UMDA 3WK5A 3OCUA 4DWOA 5AI5A 4EZEA 2OYCA 5IS2A 5AI8A 3WK4A 4EENA 5ALQA 2Q4TA 4KNWA 2EAUA 5AI0A 3R9KA 3E58A 1U02A 4QJBA 2ZOSA 5AK3A 3BA6A 5AW9A 1RMTA 4EX7A 5IT0A 5AM5A 3PGVA 3ONNA 5AVTA 2IOFA 3U7HB 2YJ3A 4NAVA 3EPRA 2C8LA 3DAOA 3KDPA 1L8OA 2B1QA 3I76A 3L8HA 3NAMA 1RLMA 1YJ5A 4BEVA 4EX6A 4Y2XA 3QGMA 4BKMA 5AIAA 3ZX5A 1Y8AA 4Y2YA 2BDUA 4CF3A 5AW5A 3U7EB 1ZD3A 1CR6A 1ZD5A 3EF1A 1J8DA 4F72A 3UMGA 2BDEA 3B8EA 3ZUPA 5AKIA 4BEWA 4YIHA 1LTQA 3WKBA 3L0CA 1N8NA 5AVRA 1WVIA 3WK6A 3AR5A 5AKYA 4L57A 2B0CA 5FP0A 1TE2A 4YCLA 3OPXA 3R4CA 2P27A 3OCZA 4G9BA 2AMYA 2HF7A 1RQNA 1T5TA 4MUMA 3AR6A 1ZOLA 5ALHA 2I7DA 5AKKA 5AHXA 3F9RA 2G06A 3D6JA 2OM6A 1Z4IA 2R8EA 3E81A 4O8CA 2I34A 3AR9A 3QUTA 3WK8A 1ZD2P 2FPSA 4Y2PA 3ZWDA 3ZVMA 2G80A 2MSNA 2B1RA 3FM9A 3N8GA 3CNHA 1RKUA 4RESA 3ESQA 3WK7A 3KOOA 2OA0A 3L0YA 3QLEA 4OHFA 3L5KA 5AI4A 2ZBGA 3DDHA 3QU2A 4UMEA 1SU4A 3QU7A 2G09A 3I28A 1T5SA 3WGVA 3MMZA 2RBKA 3E8MA 3AR2A
chains in the Genus database with same CATH superfamily
3F90A 3NUZA 4FSHA 4CL0A 2NXEA 2HXSA 2GHRA 4GRAA 2Z2IA 2GYWA 5CRIA 2ENUA 4J2OA 3QX9A 4PRYA 4WKOA 1SEVA 2ERXA 5AK0A 1PGNA 1HFWA 4UKDA 4MGHA 3A1DA 3EULA 3HN6A 3AK4A 5F2EA 1I24A 3V48A 2Y9MB 4RF3A 2JRLA 1XU4A 2MTBA 4HNSA 3ND7A 5E4FA 4QOSA 2GYYA 2Z58A 4DIKA 2HA3A 3KC2A 3TE6A 4BQFA 1HXHA 3QW4B 1T8TA 1SXIA 1ONNA 1KU0A 1USWA 2ZVPX 5CIQA 3QTTA 4ZU6X 4CLXA 1XZGA 3E5NA 2AC4A 3KEOA 5FTKA 4C5CA 1ELOA 2NYVA 1DKOA 2GB4A 5DHRA 5I4CA 2FMTA 4PW0A 4E5NA 3JZMA 3L49A 1DKPA 1QQBA 1NI5A 2VAVA 5FFNA 3ZTTA 4C7VA 2IH5A 3MTBA 1Y6FA 2MSCB 2P0EA 1SOAA 3OEWA 3ZW7A 3FDFA 1GHTA 4NJEB 5K3FA 4DCNA 1DX6A 1CVLA 1SVIA 4H3KB 2JK1A 4IVNA 1HE1C 1N6PA 3ESYA 3HC7A 5FOVA 2VNAA 4LTDA 3GRYA 2VEDA 3DXZA 4WCDA 3PF9A 3GJ0A 4UEJA 4DY6A 2HMWA 3T1YB 1A2QA 5HF8A 2FG5A 2ZJ2A 3CWZA 2NZVG 5ERXA 4INZA 1KK0A 1STOA 3RTGA 3ZDAA 5BV1A 1TF7A 5E7MA 4EFKA 2P2SA 5K01A 5D5HA 3P2KA 2QPAA 1X1SA 4KO1S 2ZRNA 4S3MA 3LQYA 3M6UA 1PEKE 2BKXA 2Q2VA 3JR3A 4WKGA 4Y7DA 3WA6A 4KRFA 4LZAA 2O8DA 4RFSB 1J8MF 4EYSA 1MIHA 1DFHA 1SUFA 2CKDA 2KMLA 2O57A 3PHCA 4NENB 5A7GA 3I6ZA 4MPTA 3CLTC 2AOUA 1NNLA 1YJBA 3EW9A 4OF4A 4RSMA 3S99A 4JEUA 1U5BA 1ZOIA 1KOGA 2PLAA 5JROA 1UC4B 2C2BA 3LVFO 1P9NA 2QX4A 4CM4A 2QTNA 3DXYA 3HJGA 4BE7B 4IZHA 2ID4A 2OC9A 1TJNA 2QRLA 1QFMA 3L8MA 4UTZA 4MRMB 4I9UA 1BRTA 4FN5A 1A9XA 1AKYA 1BWRA 1I7DA 3H5VA 2VBGA 5KHAA 2SCUB 5THQA 3V6LA 3VPBA 4FEAA 3DE5X 5THXA 2CC2A 1JQAA 2AK2A 2AXQA 3PE6A 1F17A 2EEZA 2G5TA 3TGLA 3N74A 2D1SA 4UXJA 3RTEA 1RVV1 2C94A 2V7PA 2IKQA 2VR1A 3IRUA 1RJDA 4JT4A 2UXDB 1TB4A 3ZIAD 3IGFA 4JXJA 4N01A 3WLMA 1A5BB 1FQWA 4PIMA 1P4GA 3ZV3A 3IV9A 3BMNA 8ATCA 1X8KA 1RI5A 3QMMA 3SJ7A 1GZVA 3EDMA 3MSCA 5KQPA 2CLDX 2ODNA 3D4IA 4I3HA 3A36A 4EI7A 2VJMB 4CTKA 4LF6B 2D4AA 2ZRDA 3FA2A 4OP1A 2PJUA 3IIJA 2E37A 3S44A 3JSXA 1OT3A 1AU9A 2C57A 3FLEA 3MWJA 2V5VA 3URKA 3L06A 4C7OB 2W2LD 4ETWA 4G4SO 4L0MA 1WUKS 4B7UA 2EFHB 3D0OA 4E03A 2O2ZA 3D2CA 2Z4RA 3G2LA 1KYXA 1VQ1A 4QUAA 4OQNA 5MFZA 3O8LA 4D02A 1I13A 5ARBA 4HN9A 3U9TA 3QVGA 4QODA 5C3MA 1Y34E 4D9GA 4JP1A 1O6CA 2EQBA 3HRHA 2I71A 1XLVA 4ZCPA 3FFWA 1FFCA 5HR5A 3RVPA 2FWMX 2FZEA 5FA6A 1SXQA 1H9BA 2PZBA 4IXDA 3PIRA 5LQSA 1I4TD 1TQ8A 3PQ3A 2RHHA 3PYMA 3ZEAA 1U1GA 3C3KA 4N0QA 3KYCB 1Q83A 1OFGA 1ZIDA 3OLCX 3VKGA 3GLHA 2MMCA 3JCZA 2IXGA 1S8OA 3D7KA 3PBKA 4XVHA 2ZRJA 4RDCA 1I7NA 4KXMA 4KE7A 4GBMA 4PAQA 4X1YB 3N75A 4F11A 2W8ZA 5IC6A 3UQZA 3Q8KA 1VPDA 2XCIA 3A6LA 4HZUA 2ATIA 2H1WA 4C1BA 2XB8A 2D6FA 1FYWA 4KC0A 4OB8A 1XSEA 4AP9A 1KH2A 1M0TA 1OXTA 1EUDA 1TKCA 2X58A 2KLHA 3JWIA 5JW6A 2PHZA 4N3NA 1QFYA 2PRZA 1ISGA 2QUHA 5DYYA 5LDGA 4YLGA 1Q0UA 4MDHA 4JI0B 4YA6A 2E4AA 2X6QA 3U13A 1M0SA 3D02A 4D92A 2WC1A 2BTEA 2LXNA 3E9ZA 4G8DA 4X1KA 1JP7A 3X0DA 3L0ZA 4MKHA 4ZV4A 2DUUA 1C1YA 1CEQA 3E8XA 3INRA 2C0CA 3PQDA 4PPFA 3SIWA 4B7CA 4D4MA 4E2XA 3HVKA 4EW6A 4ZEVA 2OHXA 3E4DA 2WTUA 2QTZA 4QUKA 2ZSUA 2N47A 1XA3A 1XIVA 2Z83A 2RCNA 3NJ8A 4NFSA 2A78A 3BT7A 3LQKA 1SOMA 4JR2A 5GY7A 5IAOA 4XWYA 4JQOA 1HNWB 4EK9A 4MQFA 2FQ1A 3HA7A 4YJGB 5J4KA 2I6FA 1HX7A 3RVBA 1QO7A 4EG6A 3BIJA 1DBPA 4LPSA 2DZDA 3EBPA 2IV7A 2HQBA 3PUVA 4YI5A 2OYRA 2RGRA 5JISA 4AKTA 1T8PA 1YQGA 1CW2B 2G7ZA 3D8RA 1W0KD 4QG7A 4KRXA 2JLSA 3CVYA 3CZQA 1IYZA 2VT2A 1JU3A 2PA0A 2ZJ6A 3BXGA 3CRQA 2ZTUA 3HYLA 1FFXB 5TT1A 2M9MA 1R3UA 3AETB 4PZDA 3RT9A 2VPXA 4M99A 4BKUA 4BMNA 4EHBA 2BR3A 3DP9A 1E96A 3LUJA 1FMFA 2IEYA 3VGJA 2RI1A 3JYNA 1EA7A 3O9VA 3ROGA 4EHHA 3KVRA 1BXZA 1SFRA 4EKDA 3UMMA 3PG5A 1O3YA 1OLSB 1VL1A 4RMJA 5C4GB 2PV0A 4BO6A 1CKEA 3G1WA 2AN5A 4MQEA 4Z0NA 4IW3B 2NU6B 3DBVO 4ITUA 5KOYA 1KQ3A 1EK2A 2VTDA 1TTPB 3FNIA 4KMSA 4A16A 3ZE0B 1P19A 1MEJA 1JTEA 1SBQA 1TEHA 1ULTA 2OPBA 4WZBB 4B6QA 4Z1OA 2P9JA 4R54A 3VJRA 1U7UA 4CM8A 3IB6A 3NAGA 4IIEA 2XE4A 2YRXA 1I2MA 4ESOA 1GWNA 4Q1VA 1Z0IA 3R1IA 1MG0A 3ZIDA 2EKLA 1ZICA 1DDGA 3H5OA 3LYHA 3ANYB 2D00A 2QZZA 2GZ2A 4FKBA 4UE2A 5BUSA 3NR2A 3ESBA 5JNUA 1UP6A 2WMDA 1ZFNA 1ZCZA 4LZOA 3HXMA 1NP3A 1YZHA 1UJ6A 3UMVA 1ADGA 2F1HA 2NTVA 1PL0A 3UAWA 2IP4A 3Q8LA 1URPA 1VFNA 4UM9D 2FRDA 4OQEA 2WIKA 1U3FA 1MIOB 2VJBA 2QQ5A 5FOUA 5DGXA 4XYLA 4X90A 2EZUA 1MU0A 1R18A 1UPAA 5BQ3A 3JD1A 3MLEA 3L7DA 4MV7A 4V3CA 1JKXA 4QPZA 3TTVA 2PSDA 4MV0A 3HXQA 2GESA 2ZK7A 2CLHB 2JFYA 3UJPA 4YDQA 3ZIAA 1EVZA 4DB4A 1JEAA 5B55A 3QSGA 3DBRB 4UD6A 4GXQA 4JR1A 3M6AA 2R7NA 3CPEA 4BNHA 4QBTA 3T15A 1JRLA 2OHIA 2UVPA 3GUUA 4YJ3B 3RYIB 3D4OA 5CLFA 1QHNA 3PNOA 5HKBA 2BP7B 1BDIA 5HOQA 1YHZA 3KEGA 4D42A 4HNGA 5A6SB 3TD6A 1NJ5A 4V24A 1NM5A 1U4NA 3KJEA 1AS0A 1ZVJA 2IZZA 3DKPA 3GJ3A 4XTRA 1A98A 1HE3A 4JCOA 2G28A 2XKBA 3DC2A 4YP7A 3DAFA 4G1FA 2VDQB 1UJ5A 1DAIA 3K4HA 3WRYA 5D01A 1GPNA 2W2LA 4KO4S 4QUHA 4YONB 4E1VA 1BS1A 1JW9B 2N3ZA 2QE7A 2XLCA 6REQA 4ZANA 5CTJA 4AYWA 4TMVA 4W82A 4IGEA 1SU7A 2HSWA 1VP3A 1RYYA 1XWIA 2C7RA 5BSGA 2ZBEA 1D6NA 2O50A 4Y2SA 4I5GA 3HEAA 4MCIA 4RKEA 3SLGA 4YXFA 1WE2A 3CRMA 3FGNA 621PA 1Q7RA 2AB0A 3AHEA 3DZIA 2RHCA 3LBNA 4OBBA 3KZXA 3WMWA 5K8IA 1PWEA 1RZVA 3V1UA 1DT3A 2YMLA 4DPMA 4EL0A 3PB3A 4JVSB 3QV2A 1SB8A 2NXWA 2EW1A 2B92A 5DYIA 2R8XA 5C4MA 1P0MA 1XJ0A 4NBNA 4ZMRA 1BVHA 1S3SA 4TZ6A 4JLBA 3Q11A 1DIHA 4KVZA 3IXQA 2GWHA 2XZPA 1IZYA 2AFHE 4HQOA 5P21A 1NW4A 3ENKA 1GUDA 4U2EA 2J3JA 3VKVA 2JAXA 2DTXA 3CONA 3TM4A 2DJ5A 3LOUA 1DQZA 4M86A 1PUIA 5K9ZA 4Q6WA 5D00A 1GZ3A 4WBNA 1BNCA 2OQIA 2ZI9A 1FFDA 3GEEA 5M3BA 5CA0A 4DC9A 2RKBA 5EQDA 4EP1A 2J5KA 4OXYA 1U4OA 3D1VA 4URWR 3KIPA 1RAAA 5JY6A 2H1FA 2AI1A 4GZ3A 1GFIA 4DMRA 3PYXA 4WDQA 1QNFA 3R7BA 3NUQA 2XZDA 2AG1A 1ZD8A 1RCTE 1QQ7A 2JCYA 4L27A 5F7ZA 2X2OA 4P8RA 2QAGC 3LNTA 5AJUA 3EQ9A 3E3NA 1C3OB 5TMBA 3WKDA 5EP4A 4Z7JA 1FX0A 5E1MA 4EFMA 2JIPA 2XNDD 4FVTA 4CKXA 2GLTA 3I64A 4MUKA 3O90A 1V5GA 2O2GA 4I8XA 4LPKA 5FQOA 3GQVA 5T67A 3RT1A 3ST7A 5GONF 3UWKA 4EB6B 5BWBA 1HRDA 3EXHA 4OQDA 1ZR2A 2P6MA 1R8JA 2R1TA 4CM7A 1B41A 1PJ3A 1Z07A 5LLDA 2PNFA 2CXOA 3SJAA 3I62A 3BERA 1UBTS 2Q2OA 2IZOA 3CM0A 1JMYA 2QUAA 4G37A 2QRPA 3R0VA 2WG0A 3HM2A 1N9KA 2H54A 4CTNA 5C32A 2X0IA 3OZSA 1PF7E 3KL2A 4L9SA 2B35A 3ZGVA 3BF7A 5IF9A 3A2KA 1CX9B 3VYSB 4HWKA 4MOWA 1QWOA 1QJCA 1CR2A 1TKAA 3GIWA 2FUG1 5DNEA 5FBHA 4PSUA 4YAOA 2QXUA 4JLWA 3ERCA 1FYXA 1CQPA 2DPXA 4X85A 4CEHB 4F3CA 3DGEC 4JX9A 3CR7A 5KTRA 2J3KA 4R2JA 4EZEA 3GLUA 5E2AA 1QRRA 1EXDA 1TTHA 4H6PA 4MVJD 2ASEA 5BR4A 2C03A 2H16A 3OT5A 2IHNA 2Q4TA 2GI4A 2YOFA 3K2QA 4HQ0A 2Y71A 3LA6A 4CEJB 4YT4A 2A7QA 4D3ZA 3VJLA 2ZM6B 4XLLA 1V47A 3RUDA 1F6BA 1JL3A 1ISFA 1EFKA 1E2DA 5AJZA 2DHEA 4YPOA 1P91A 1GG8A 1ULHA 4P83A 4LX8A 4R1UA 1QFZA 2B1QA 3ZQJA 2BZGA 3V1LA 2A0YA 4WJKB 1G42A 1RLMA 3H2IA 5K8CA 1H0HA 3GDFA 1G5QA 1CHNA 2NO0A 4OQFA 3JQDA 3EMBA 1GPAA 4YC7A 2A5GA 1DC3A 3LHSA 3U31A 5JRZA 2RJOA 2FPOA 2I7VA 2OFWA 3ORSA 4H3SA 4BLTA 2XYQA 4GFDA 2VT7A 2XQVA 1U3DA 1XI2A 4ES6A 4M1OA 2EKBA 3ZNPA 4DCVA 5JTUA 1ZHFA 4RPHA 5DT9A 1SBHA 2PV7A 2Q1WA 3AVQA 3EFHA 2QVCA 2GBPA 4BAZA 2AF3C 3OJOA 4CKCB 2YVLA 4KMOA 5JAIA 1M1YE 4R6WA 1XK6A 5FNVB 1NNEA 4HJXA 3A31A 3G7NA 2XZTA 4GZMA 1YIAA 2P2LA 5CFRA 1U8YA 4U1RA 4NXMB 3E9DA 4HWRA 4ZYWA 4YQFA 4J3NA 3HBMA 4DUYB 4CG0A 4DMGA 5BORA 5HF6A 1MNQA 1VKZA 3HG7A 5M7EA 3VU8A 4HNUA 1JVSA 4C3UA 4EY8A 1JAHA 5JNWA 4K6GA 5ALHA 3I2KA 4PPNA 4GDFA 4YJKA 5AKKA 4GI3A 2A9KA 1WPXA 1TNDA 3U2QA 4DSOA 4H2DA 1H1DA 1Q1ZA 1K86A 3CUUA 4Y7CA 3Q1LA 3O83A 1OV4A 1ZKDA 5DNDA 4B43A 2IUSA 2VH5R 3UV6A 5C81A 4RMNA 2FW9A 4D8WA 1H1LA 5EKDA 3ABIA 1X3SA 1ZDMA 2E87A 1FDUA 4N49A 5GJVC 3VR2D 1DC4A 4ABYA 3ASUA 3N8KA 4LHSA 1R6BX 3VH4A 2HR1A 3NVDA 2HLNA 5CLLA 4MWCA 4AP5A 4N4AA 1DJMA 1K8YB 3H83A 3B3JA 3DDHA 5M34A 3HN7A 2EW2A 4C0JA 2DLNA 1YQQA 3W5VA 3WGMA 2FDCA 2A57A 1YR8A 1NJSA 2P6NA 3C1TA 3G0GA 3KZVA 3OTQA 4NCJA 1J24A 4CZ2A 3TIIA 1ZNZA 2WF7A 5A3JA 1GYQA 1SQ5A 2HRQA 2QM3A 4HWPA 2YRFA 3KAPA 5IVDA 2HXGA 3IS3A 4M8IA 2NUPA 4OB6A 4RHYA 3ZHZA 1RHMA 3HE3A 3QEBZ 2DPYA 2AEEA 3PPYA 4B5LA 2J3LA 1E79D 1E4OA 1MPXA 1OJLA 3IULA 2ZB7A 4W1QA 3T1VA 2O1EA 2CUZA 4HMOA 4ITRC 3KLPX 4KWEA 4ZHQB 1K7FB 4LDNA 3A9RA 3SCZA 3TZEA 1ZLXA 2IU6A 3GP3A 4TRJA 3PGLA 2QGFA 1J5EB 3NWOA 4G4JA 4K1XA 5TQVA 2C96A 3BD6A 5FDFA 4BO3A 1MABB 3C98A 1OFUA 4FMBB 1N5OX 5B12A 2D3WA 5DDIP 3H2SA 4BVGA 3UTDA 4OXKA 3OCJA 5KCZA 2ZS8A 3MC1A 3KSAC 1U11A 2C9BA 3O5AA 1KY3A 4DCGA 1YTLA 1QU2A 4B40A 3LX6A 2O5VA 1S3GA 3CKMA 4ZEOA 4I4IA 4PRKA 4Q4DA 1II0A 4QPJC 4R51A 3Q5GA 5EWJA 2ZUVA 1T8YA 3K72B 3M2TA 2C0QA 5TS2A 5AOAA 1TVEA 1IOVA 3O2NA 2F3TA 1YE8A 5DO9A 3FDIA 3ZOZA 3WAKA 1UJ4A 1RXEA 1SCJA 2VRCA 3W2HA 5LJLA 4K86A 4L07A 2Q3MA 4N65A 1LA2A 3LBYA 3KPUA 3L0OA 3KAKA 3O8QB 5BMVA 3L5OA 4V3BA 1P74A 1UXHA 3CG4A 2VT6A 4RPIA 3SR3A 3T7CA 3V4ZA 3NM6B 3M6XA 2Q2QA 2QI9C 2PRYA 1KEEB 2H4JA 3T5CA 2AUNA 1AKUA 4MRAA 4ZCIA 5ALGA 4YYEA 4WVLA 2G82A 1P1KA 4RV4A 3E22A 4QLAA 1QYCA 1RM4A 1JSCA 1ZISA 2H1IA 2PGIA 2OHJA 4LKOA 1U8TA 5AKEA 4JXXA 3PLNA 4A2CA 1P5HA 1Z6QA 1K2VN 1TLTA 1PTKA 1UOPA 2AIRA 1IWPB 1Z25A 4BC0A 3RVMA 4DM3A 4JYZA 2XDYA 2Q29A 3B2NA 3EGWA 5CU7A 1W96A 4YAIA 3BCUA 4WLVA 5CEFA 1X70A 4W63A 2GCIA 3CRRA 3AZQA 4OY3A 4ZV7A 3PC8C 3FVRA 4U7WA 3BWDD 3GW8A 4ZAFA 3I0MA 4PQRA 3TAHA 2C5FA 5A5EA 1WF6A 3CLUD 1IM5A 1HDRA 2W2PA 2WV7A 1YDWA 1JE1A 3BFVA 3H11B 5TJ9A 1W0JD 4KJZA 5F64A 1W7AA 5IAKA 1YC5A 1J09A 1AIPA 2AEJA 2OXRA 2ZULA 3K2EA 1JQ5A 2GXAA 3HK2A 3BAFA 5BOSA 4K05A 1D0VA 3OSZA 3HP7A 3TOCA 3I5XA 3U5ZB 3B1XA 1FNCA 1YRQA 2PT6A 3HCEA 2ZI6A 4NV1A 1VL0A 4KLCA 3H2YA 4N40A 2VRWA 5HIMA 3TLCA 2W6JD 1YHNA 3DBOB 4PO3X 4XCXA 1Y5MA 4DWJA 2K7FA 1BCSB 1MRSA 1D7OA 3B1FA 2BGLA 1UUFA 1VTKA 1A2OA 2IUYA 3E7DA 3HUUA 2Z8XA 4K9LA 1YJXA 3A1SA 3DWFA 4UPVA 3JW8A 4YMSA 1RWNA 1C7JA 4ZK6A 5IKXA 2VZ0A 2BVNA 4OBEA 4OHPA 4QGAA 1SXJE 3D3EA 5I47A 5IUJC 1RXUA 1E9DA 1YF3A 1D4OA 3HGTA 4ROSA 5AVOA 5AXCA 1ZN9A 2VPYA 1FTNA 4MJ3A 4FFLA 4JQCA 1Z6AA 3TBKA 1OHHD 3LXXA 1JTVA 1ZW6A 2Q2WA 3ZHTA 2BFDB 2PZKA 3AVOA 4TMTA 1SIOA 1GGVA 1X92A 3BOSA 4ZGBA 4HUJA 1PEAA 1VBKA 5C4IA 1NBHA 3LCUA 5NLLA 4TKUA 2F6RA 2Y2UA 1WB5A 3QOWA 4LSZA 4RKWA 2EW8A 1C14A 1O5OA 1XRMA 2F3UA 3GMDA 3CNLA 3Q41A 4GX5A 4IL5A 5EIAA 3EK2A 5SYMA 4CT5A 3U44B 2Q6IA 3FFTA 1S4QA 4DIDA 4QRHA 3PJRA 1II8B 3GXOA 2JFUA 1T1RA 4LRTB 3AFOA 2WKRA 3BE5A 5EHGA 5BSVA 1F51E 3L7MA 1CRWG 3LFUA 3CVWA 3TD9A 1L2TA 2NZJA 2OHHA 2RHOA 4H7EA 3SVLA 2G8NA 3WLJA 3W3AH 3RANA 3AB3A 4I6GA 4MI3A 1KMMA 3IR5A 3KK0A 1MO5A 2HREA 3HKBB 4BFYA 1TT5A 2CV1A 3DDOA 4DPKA 2JFXA 3LRPA 3MAJA 4ETIA 1M75A 5E4YA 1VGQA 2KM1A 3R74A 3N2GA 1DBWA 3EGEA 3OU6A 1MDFA 2YZNA 3FBWA 3OIWA 4G65A 1DZIA 2HTFA 4O4JA 3VR2A 2F43A 5JDIA 4KX3A 2PKXA 1EGAA 2XMPA 4FC6A 3RRBA 3MM4A 3FDZA 3ZWOA 4XI9A 2JFFA 4OV6B 3ADPA 1L9XA 1ZW1A 3RV3A 4DCTA 2R751 4TKVB 3DMHA 4JUIA 2NYUA 4XM2A 1E3LA 1EG7A 3LY8A 1L7QA 3PWSA 4OXNA 4UNQA 1UZLA 1UWKA 1BA2A 3NRCA 5IVKA 3VX4A 1H22A 4BASA 4R1QA 4GO1A 1E18A 4LMAA 4MUAA 4V2UA 5ALFA 3R8XA 1NE2A 1PIWA 3OM8A 1N6KA 1OBHA 2DFDA 2VP9A 3I5UA 2VWHA 3NBQA 4BGEA 4QC2A 4NCAA 3OFKA 2HEGA 2K87A 2R8YA 2IXBA 4IDEA 4HFNA 1E79A 1XMSA 3LT2A 3DTYA 1DDOA 4TV8B 5SV2A 5DCWA 3D7RA 3VU3A 1F12A 1T36A 4HB0A 1JB1A 4ED9A 5I8WA 1YFJA 3PEYA 2WYVA 5E95A 1H2HA 4U9IS 5AICA 3COYA 4CMGA 4WX2B 4LF9B 4NNPA 2P9BA 1BU8A 3GNQA 3Q7TA 4U7DA 1T9GS 4R2IA 5C34B 1J90A 4HB4A 1C4KA 3HDYA 1UPXA 3OT1B 4Q1DA 1GGMA 3MN1A 3NTQA 1A8UA 1G8GA 3GZTB 5JZMA 3H1BA 2G08A 2NSHA 3OFND 2JGLA 1V6AA 2XECA 2XB9A 3FUTA 2H8KA 3VR4D 4M60A 3W9YA 4JBNA 1N33B 4EYQA 2CUNA 3AOGA 3OOHA 3ORFA 5DGIA 1LNSA 1VRCA 4B46A 3KUDA 1XZ8A 4AWXA 1UOQA 2CCJA 2ZSHA 4MI9A 2C4VA 4MV9A 4DYDA 2A58A 3C3CA 4XDZA 5J58A 4YEDA 1SOVA 4JC4A 1ECGA 4UQOA 3TDNA 1WAMA 2P3LA 1HNZB 4OXIA 5BSFA 4X61A 1X7GA 4JR0A 1W581 4OHUA 1ST2A 1LD3A 3EWAA 3GVIA 3FLMA 4YAJA 5JAHA 4RTKA 1TUBA 4CCYB 4ZQCB 5HIJA 1KQOA 3QE3A 4V0QA 1SIBE 4DKXA 1UBJS 2QG6A 3K9QO 5C7IO 4UAJA 2JH3A 1P3DA 2IYSA 4HXGA 2IHJA 4KBFA 2AI3A 2H1VA 4FIDA 2GZSA 1S2MA 2CXQA 2X0RA 3QEJA 5FFMA 3SD7A 3ZDQA 3ZE8A 1A50B 3R3ZA 4NBKA 4R0NA 4Q9HA 1HFEL 4ZYYA 3ZJVA 3A2NA 1ZNXA 3PX3A 5JLAA 3VPSA 2B4RO 3R20A 3WGGA 4EECA 1KP2A 4I4TB 4XOIA 3DOOA 3K9NA 2X1MA 3RSSA 1JG6A 2VWQA 1IOWA 2JFHA 5H83A 5HIIA 2F2TA 1CP3A 2PL5A 2X41A 3BWVA 1QPGA 3CEHA 4JJ6A 4KE8A 4TLEA 2JFOA 5AT1A 3RC9A 5MFPA 1L4KA 1ZU4A 3DB2A 3EVGA 1NF2A 2X6TA 4EJSA 5BURA 2H57A 1Z5NA 2CXUA 4LG1A 4AKGA 5KNCD 3HPRA 4GM0A 3SZUA 1U8AA 3GGPA 5K6TA 2IP2A 1QS0A 3IEUA 1W0JA 4G0PA 5FULA 2Y67A 5KC9A 3KV3O 1A88A 1XB2A 3SS8A 3G5TA 2FJPA 4N3CA 1EFVA 3FYUA 1BJTA 4H6VA 3ZHQA 3JYQA 2WZBA 1M8JA 5EJGA 5KDDA 2W0SA 1QHEA 1XD2B 1NLZA 5DX8A 3RH0A 3T8YA 1G38A 1JJ7A 1XTJA 2P9EA 3ASZA 2W6JA 1I0IA 1YU6A 3N8NA 1E94E 2Q3HA 2GJKA 2IYYA 3QPVA 4Q4JA 3R9WA 3WXBA 4OREX 3KWMA 3K1ZA 1HKUA 4TOIA 5HTOA 2PMKA 3MWFA 3INYA 3FUWA 3NNNA 4TMFA 3NHYA 3BJRA 2PS9A 4HTFA 2BW0A 3EH2A 1X7WB 3FTDA 4K2AA 4KWIA 4ZVKA 4DQDA 2L18A 1MAWA 3H04A 3TQIA 5JYCA 5D5PA 4MYCA 3OCVA 4GVPA 4R2XA 3NRJA 5KYUA 4HH1A 1I94B 2P35A 3ENNA 3PD0A 5LLSA 2E4YA 4PG5A 1U1DA 4UVIA 4L4ZA 2X5KO 4LRSB 1Q3TA 2V55B 3Q3CA 1W4RA 4O5AA 3VHLB 3MCTA 1ONPA 1NW8A 3HCNA 4RMGA 5F7JA 5J23A 4UCQA 2UDPA 2XXAA 1JT2A 1VLVA 3EOZA 1PDOA 1XPJA 2Z57A 2ODAA 2X15A 4TX1A 3T9BA 4ECEA 1N2CA 2J0VA 4W5WA 1EJ0A 4E3WA 2AN9A 3ADBA 3H4MA 4IV0A 3V97A 1ZMXA 5JRJA 4ZU1X 5L4NA 5CCEA 4P86A 3PUXA 5LC1A 3TOSA 4JVMA 4A0QA 3QELA 4YFYA 5IWAB 2OV1A 4JJ7A 2GN4A 5AJTA 1JPVA 5KX5F 3IL2A 5ALEA 1NZFA 1ZVQA 1EVKA 4D9FA 1ADYA 5FOQA 1NN0A 3UKOA 1QTRA 3F3MA 3IT2A 2Z98A 4EVQA 1MC5A 3NVAA 3F98A 4FI3F 1RJ9A 4Q1BA 1HYGA 4HDQB 2BGIA 4MQMA 4PXSA 3TN7A 2B8JA 2VDNB 2P69A 1XA4A 1H2RS 3HHEA 3VUEA 1R9GA 2J09A 2JH8A 4OGLA 4XJVA 3T52A 2WMNB 2QVZX 3OQBA 4Y2QA 3DZBA 1O5TA 1QKJA 4ZRNA 2CJWB 4YRBA 1TM1E 3AUJB 1FW8A 3FX2A 1TCAA 2HK6A 2V7QD 2PVSA 3DNFA 4KLRA 2A14A 4NBRA 4XPZA 4ENRA 3ADCA 4Q3LA 2WIFA 2O19A 5LQDA 3SS9X 1NLFA 1Z8FA 2P3SA 1ZI6A 2NVUA 4LQDA 1M1YB 4JSTA 3TRHA 1FMLA 1GAEO 1TVMA 2NUBA 4K03A 1SZJG 3VZPA 2P79A 3O0DA 5JALA 4AFNA 5JD4A 2BEUA 1TYBE 1LI5A 4F6RB 2FFRA 1DT5A 1MX9A 1JDVA 1ECJA 2CL7X 3DHYA 4MITA 4KZKA 1TZKA 4OAPA 3C6ZA 3L92A 4U2FA 3L41A 1OXBB 4PEVA 4LYJA 1JR6A 2IHBA 2DUJA 2HA2A 2OEPA 3BTSA 5MGNA 3BEDA 2XCQA 3VR4A 2R65A 3O2JA 3JAWB 1N0IA 2JZOA 3QYJA 4YWHA 1SHUX 5I9NA 2RAUA 3K71B 3DV0B 1XCJA 5F77A 4I14A 5ITSA 5BYKA 1JQDA 2EAUA 4UUOA 4PYLA 3L7NA 2SECE 4QJBA 5EUBA 4ZT2A 3L6CA 1LBQA 5C8YA 4B82A 4A0SA 4LCEA 5I6DA 1NDHA 1JLKA 1KAOA 3HA5A 1GNVA 5AYVA 4C43A 2FWAA 2PGAA 1KDTA 1JHZA 3SHWA 3UH1A 5KWVA 3TLEA 3I76A 1E1MA 4IOMA 2YWRA 1CVRA 1FBTA 1PL6A 2V7VA 5GV8A 4YRPA 4NH4A 3IMKA 5FV4A 5AUNB 2PLFA 2J7KA 2XNSA 3X1WA 2BDUA 1GFSA 4JY7A 4ND8A 4MB6A 1ZD3A 3ER8A 4WACA 1GZ4A 4IDDA 1ZD5A 2BFPA 3ZJYA 2FHSA 1DQRA 4GM4A 4OJMX 2BHTA 3C3WA 4JU8A 4L4RA 3UMGA 1I5OA 2PBLA 4KLNA 1R6DA 1LWNA 1EXNA 1Y89A 3KB8A 5FAXA 5FLYA 2P41A 4GPAA 3ID6C 3EZFA 3M2PA 2A9FA 4Q15A 1RPTA 1XZEA 4OI2A 1KZ1A 4OLJA 3WK6A 1MC4A 2CSUA 2NO9A 2NZWA 4W9RA 2NN3C 1PR6A 4KTVE 4PBTA 2BFEB 3ZWXA 4BV9A 1QIDA 1NOIA 5KNCA 1CZOA 3T3NA 4O4LF 2G71A 1GTJ1 2SKEA 3K8ZA 3MRXA 4YCLA 1R9MA 1D6JA 2FW8A 4MGIR 2FFJA 4R68A 5A5DA 1CERA 3HCFA 3OCZA 3UJ3X 3A04A 1Y7HA 4TROA 4GMXA 1Z45A 3PKIA 3GMTA 4NPCA 1T5TA 4MDFA 4D45A 2OBMA 2QLBA 1KOFA 1NN3A 4ALMA 4ARCA 3U62A 3K5WA 4LI0A 1C41A 1KETA 1OOEA 3BRQA 5FORA 4ZTZB 1OTHA 2JGDB 3G2IA 2BOVA 2SHKA 3VO8A 1QG4A 2FRVA 4G86A 5KWEA 1CQIB 2RC5A 3MWLA 4JJGA 4OVKA 2FMIA 4UEQA 4M36A 3LKZA 4MR9B 2MSNA 2ATVA 2VOEA 2ZPUA 1G7TA 1G5TA 3Q0TA 3R8FA 1E0AA 3SQLA 4X0EA 5K4HA 5JVDB 2A1TS 4L15A 5HILA 4JC5A 3G8CA 4LQCA 1OYYA 1AF7A 1MQSA 1ZH6A 3QE2A 1PSDA 1E2JA 1N7GA 3IUSA 4RD0A 5FL3A 1UC5B 2DHRA 4ID9A 2CL6X 4WY8A 3WISA 1FPQA 3HSYA 3PPXA 5HP4A 2X0JA 4PFQA 1J33A 2JNWA 1L3CA 2G88A 3BXEA 3BMOB 2W8BB 3CLRD 3R7NA 4EB8A 1SKAA 2G83A 4M38A 4TWZA 5J1SB 5E0KB 1DRJA 5EXPA 1E20A 4HDMB 3B7GA 4JI2B 3EAGA 1MX5A 1CJSA 2Q4EA 4FFBA 1GT91 3FNEA 5ITZB 1BROA 3L77A 2Z6UA 2UZ3A 3GC6A 1TJ5A 3OP1A 3BWBA 4J4HA 4TTJA 2C4HA 5FI3A 1C8BA 1F8GA 2L19A 3ILXA 3KBBA 2FUCA 3B6MA 3HVUA 4FTWA 1TK2A 5DCLA 1BE8A 4NCIA 1CQJA 1PFYA 3A32A 4QULA 3R40A 1RFGE 5ERYA 4AM8A 2DX7A 3LLVA 4J91A 1JKJA 3STWA 3EZGA 4YRTA 3HYCA 3PEVA 5IDXA 1ZUNB 2PRIA 4RTMA 2O7SA 2VDWB 3IRVA 1HG0A 1ZGZA 2CNNA 4XLTA 4OMDA 4M1ZA 3C0KA 3ETDA 4QHSA 4DIMA 2FPPA 2X0FA 2JGJA 3JRNA 3QXGA 2P62A 2OLKA 2PUGA 2R68A 1ZHHA 3ZHUA 2WSSA 2POCA 2HCRA 1XTTA 4XRGA 4E5SA 4FFWA 3GP8A 3OTWA 1DDIA 1MO2A 3LMKA 4US1R 5EXSA 2WUWE 4Z4HA 1MT0A 4ML3A 3WRXA 3RUCA 3TLMA 4S1WA 1E5VA 1O4WA 1WQ1R 1N7HA 1NDQA 1GCGA 2JIOA 3E6AA 4RFLA 3JVVA 3DLTA 1H1TA 1NVWQ 1A9RA 4M7OA 2V7QA 4L02A 4HH3C 1TIPA 4ONEA 4JLMA 4BZPA 1E2FA 1G5PA 1RQ7A 4DR3B 1A4RA 1EP3B 1NF9A 1NONA 3AEZA 3HV2A 3SC2A 1W46A 4NJEA 5FR2A 1OQAA 4OYLA 4AN4A 1H2AS 1AURA 3P52A 2AV6A 1QHHA 2BI8A 4XGIA 3WV4A 3EUWA 2O52A 2PZJA 1OI2A 4WK6A 4DG8A 1XMQB 4DIFA 1EZZA 4YUVA 2ZT7A 5HS4A 3M6FA 1F2TA 1P7VA 4IGIA 4O3FA 3IO3A 1MB0A 5JQGF 1CZNA 2IYLD 1TPZA 4TVBA 2B1IA 4UHEA 1EM8B 3EIXA 3RADC 1YFKA 4NP6A 2ZVJA 1P9WA 4LTMA 2JAWA 1M1XB 2PSJA 1BFUA 3JY6A 3MVEA 1EEHA 4HQ6A 3V8PA 1JVBA 4PZLA 5CT4A 4GOOD 3V7WA 1W5BA 2FW0A 4DM7A 1ZZEA 1YACA 1GRCA 4DCSA 2DU8A 2QD1A 4CV2A 4TWIA 4Y9RA 4XZ3A 3H0KA 1SVUA 3FWYA 4LKRA 4RH3A 5FFFA 5IHXA 1FSPA 4L4SA 2Y1FA 3BQMB 4XYBA 3LHFA 3TL3A 5FPKA 4F9FA 1JJBA 2QX7A 2ZJ4A 2AR0A 3QQPA 2PANA 1FU8A 5C1PA 3F96A 3O4HA 4AT1A 2I4IA 2PDAA 1TAGA 4BMZA 2HRDA 4RU1A 3ECCA 5TPWA 3WQSB 3C2QA 5LZ4A 2IITA 4HBZA 2WOOA 4WGFA 5TF0A 3PS9A 3TJRA 1P7PA 2RH9B 4L50A 1KJNA 3CT4A 4BE9A 5AW7A 2C58A 3MT0A 4N5LA 1QCYA 4LYEA 1T13A 4O4HF 3RUFA 3UFBA 3QFRA 1AMUA 2BM8A 3TUIC 1F6DA 2YZ7A 5TDHA 3VSEA 1TPYA 4NECA 5EJ7A 1K1EA 1M9NA 5C5CA 1RYNA 1XE3A 1TM7E 1Z17A 2AN1A 2I3BA 4FYHA 1HQDA 2XUJA 3CTMA 1JXMA 2W43A 3N2KB 4G63A 1GCIA 4J0KA 1MAVA 3KQPA 2HNBA 2R6AA 1ESEA 4NKRA 3C97A 4N82A 1RQGA 3VZDA 5HJEA 1BVUA 4OBXA 4E30A 1BMQA 5HG0A 5TF4A 3RT7A 1U0SY 3EWIA 1WX1A 4BQRA 4CIXA 3VI3B 1RJEA 1J99A 3P5BA 2JFZA 3A0RB 1ZIXA 2HEIA 2D5LA 4NNJA 1JZSA 2VJMA 4OAOA 1TMKA 1NTOA 2YV2A 1WB9A 4CV3A 1NYRA 6GPBA 3H1FA 4J2HA 1NA5A 3NANA 4B45A 1AE1A 1MP0A 3JU3A 4C7OA 4RK5A 1LLDA 2HSJA 4BGIA 4LVOA 1MR3F 3DEFA 4JWKA 4BNDB 2EARA 3KNZA 4JLJA 1D5WA 1XDUA 2DCMA 4NK4A 3VYVA 1DO8A 3MQ4A 2DERA 1IN7A 1EG2A 2BFBB 3WLIA 1QONA 3V2GA 1ZSNA 4PQGA 3RKUA 5E6UA 3RJZA 4G0QA 1ZNWA 3SLRA 3WV5A 1WW8A 3JZAA 5FBWB 4FOOA 5BUQA 3EVNA 3CH4B 5LLTA 1UDBA 3PXUA 5EJAA 1OWPA 5JDCA 4DB2A 4PLGA 4DRXB 4J3JA 5AVYA 4YDRA 4CIVA 4YR7A 4EUFA 3UN1A 4B2YA 1A69A 4MINA 5B5SA 5TE9A 3ZJTA 2GO7A 3VSDA 1SHKA 3NHPA 5J2UB 4OHWA 5LFAA 3GRUA 1UODA 3NP7A 1UBLS 1UWVA 1P9OA 3PQ2A 1DPGA 1KI1A 2X9LA 3F47A 2FPIB 4UU0A 2F67A 3S8YA 1TKBA 5CXUA 1KQFA 3HA2A 1J2UA 1IQRA 1U7PA 3EBOA 3FH0A 4KVFA 1V8PA 3KUUA 5C8VA 2O2IA 2FF7A 2VHWA 2VSOA 5LDDC 1L7MA 4CXMA 2LR0A 3TX6A 2C3MA 4EY3A 1GUYA 1G8JA 1MOZA 2DBZA 2SBTA 3G85A 1FFYA 1WBBA 1RI1A 5BWLA 4LC1A 4IIJF 2XD4A 1Z56C 4BWYA 4HYYA 4EWLA 2DJIA 3EFOB 1JWLA 1V8ZA 1AMOA 4AJKA 4X94A 2BGKA 2IPLA 3KTOA 3BHIA 3RRNA 3KR1A 1GUAA 1N2IA 3K0FA 4HF7A 4YUXA 1SG0A 1XMOB 3K6SA 4K9SA 4G1BA 4UTXA 2G5CA 3ZNQA 2G72A 4JMPA 3UT0A 1JNXX 1RKXA 1BA3A 2AD1A 2AN3A 2B8EA 4GICA 3T3EA 2XHZA 4LS3A 2V9PA 4BU0A 1TA9A 5EHNA 5HCUA 1U4SA 2A6PA 1ZXBA 4P2GA 4P08A 1UQTA 1F4VA 4G9GA 1AXEA 1VB5A 3LUFA 1EUQA 2EZ8A 4FMCB 3NDPA 4EQZA 2R2GA 3RBZA 2BSQA 4RMIA 4WLFA 1EUCA 1LJLA 1IZ0A 1RU3A 1Z2CA 2J3EA 3AVVA 3MMSA 1E3WB 1I14A 5DTRA 1F48A 3FGOA 2WBLC 3Q3HA 1X19A 3H13A 1JMVA 1XAIA 2XUOA 4UBIA 3HFGA 3L4BC 5CCDA 2IVZA 3SKYA 3U4HA 2I2WA 2QTFA 3L2OB 1E1YA 2GQ0A 2ENWA 3B7PA 3A10A 2M6RA 4JJZA 2OXCA 4Y9UA 3MGCA 3V8QA 3VHXA 3ZWNA 5AI6A 1SIUA 3LUPA 4D81A 2V59A 2FWBA 3ESZA 1NKSA 1W47A 3PC3A 5D3MB 4DV1B 1GQYA 1D07A 1VL2A 3GAAA 4ZREA 2JIQA 1VKRA 1VKJA 2K6GA 4Z4IA 2JBHA 2AQIA 1WUTA 5I4KA 4OH1A 5DT2A 1FXWF 1K92A 1T1IA 1U2DC 1ZVKA 1TYDE 1YZLA 3AHDA 3L43A 3L7JA 4KX5A 2GXQA 3PUHA 4REMA 3GJ6A 4U7PB 4WFKA 2WIDA 2VYND 5CXXA 3BHMA 3NEPX 3ZNNA 1K3FA 1YRAA 4EGQA 3CVXA 2P1RA 5AW1A 5LL6P 3ENWA 5LBUA 4OK6A 2VPTA 4KK3A 3BUSA 3AHFA 1LW6E 4WZBA 1A8QA 2UYHA 1DUIA 1KEWA 3DYBA 2ZRHA 2I1LA 1WLSA 1O94D 4CQMD 2GBCA 4F1WA 4MUJA 3VOSA 1Q0PA 1YZUA 2ECQA 1QFXA 2C84A 4GH5A 2GILA 5E6RB 5AVZA 1YI8A 4A15A 1NC3A 4FOPA 4WN9A 2JL1A 2QAJA 3EZLA 3K0EA 1Y5RA 3HMKA 2DTDA 3HU3A 4BQEA 4X92A 2V98A 4N47A 3FVWA 1A9OA 1LFDB 5ALYA 2DR3A 1GUFA 5BSUA 4CGYA 5K3OA 1HORA 3NHBA 5E7IA 1FDWA 1C0EA 1L5RA 1MW8X 3GVCA 2PS0A 4ER5A 1GAJA 1ZJ4A 3CUKA 2ZYVX 4A8JA 3HFJA 2RE8A 3KJGA 4JA2A 4OUDA 3ZCPA 1Q44A 3P4YA 3H2BA 4LHWA 1DUSA 5LXTA 4K6CA 3ZW9A 3H3FA 5JNSA 1PTJA 2B4QA 2D2FA 1YOBA 2YHUA 3PWZA 1QDEA 3RVQA 1B23P 5ALRA 1VYTA 2E89A 1F2VA 2Z5LA 5IJXA 4IJKA 4PX2A 5BV0A 1B14A 3AT1A 4KJXA 4DE5A 3HB7A 5FUVA 5FUXA 1WUIS 3GRKA 1CS4C 1XMIA 1G21E 2GRAA 3L8GA 3GFVA 2C88A 1Z4NA 2XH8A 3JQPA 1U90A 4HQNA 4Q0MA 4WY2A 1KO5A 2CFRA 3VTAA 1KARA 2F8SA 3VC1A 4L5AA 3C85A 1T9GR 3T5AA 1CIJA 2QWXA 1IZ9A 3QENA 3HS3A 4RIHA 5E9JA 5EL0A 5ENZA 3M3DA 4O25A 1GZ6A 3R0QA 4WKNA 4Y1RA 1X2EA 1LLFA 2ZP1A 2BKLA 1F2DA 5CDFE 3VPHA 1YL6A 2FKNA 2CDCA 2H11A 2YMMA 3P20A 2XTZA 1Z75A 2C4TA 2JLZA 4KYUA 3TXXA 1SURA 3QOFA 3REFA 2W2NA 2HMYB 1JI3A 3RIXA 4HUQB 3A1UA 2GFIA 1E66A 2Q62A 3MAAC 4C08A 2OC4A 4ZJUA 2FP4A 5AHKA 4WXPA 1LX6A 5BV8A 4A0FA 1N9ZA 3OF3A 4DCOA 2IVFA 3VV2A 1NV8A 2AOTA 4DS3A 3L6UA 3ETHA 3UT5B 4V0LA 3CZCA 3DOHA 2W58A 2GF2A 2Q5HA 3ZHOA 1Z34A 2IPOA 3ET4A 4CR6A 5FA5A 3LHDA 4ZO7A 5CDYA 5AW2A 2PUEA 3EZXA 4I4NA 2UUOA 2MR5A 5EOVA 1G6KA 1XX6A 2FUNB 1I4LD 2QMUA 3LL4A 4GZ6A 2QN6A 3ZZNA 1DJLA 3UA3A 1JALA 2GXSA 2O8NA 2O8EA 4GQIA 3T1QA 3NGMA 5IUKC 3AY6A 3PDIA 4I1SA 4OQ4A 5D87A 1QZ3A 4IWYA 4DQKA 3O4IA 4UARA 3BCRA 3WMFA 2RHDA 1IBMB 2B6NA 2HWKA 4IG9A 4YBZA 1J56A 4JX8A 1I0ZA 2HMSA 1DKMA 3LM8A 5DHUA 5IBCA 5ESXA 5U4XA 5KUTA 3G2KA 3AVYA 5DN9A 3FKSD 3T1OA 3DEHA 1MB4A 1WB6A 2P3OA 1OPXA 3H18A 2ZSFA 3IXMA 1TL7C 3AKYA 2PG3A 2QRVB 2QTTA 3B20A 3LUHA 2H07A 4OHBA 4AY4A 3THYB 3H4TA 3ZGOA 4B3XA 5KX5B 1T24A 3CQ9A 5K3SA 1IG0A 1RC1A 2WIGA 1UBFA 3LECA 4QU5A 4XEUA 3RNOA 4KFSA 3RW9A 1D8TA 4MO2A 1D2HA 3QE4A 4CG3A 2Y99A 5FWYA 5HUJA 1ORRA 2UZIR 4QDOA 4CCAA 2PYZA 4UQPA 3F5MA 1J9GA 3BEOA 4EX7A 1PS0A 2QRQA 3UAVA 3F2IA 4ZZIA 3CCFA 4KV7A 4EJMA 1KXJA 2IOFA 5IWCA 1KO4A 4QXRA 3FMIA 3Q1KA 1WY5A 4G5YA 4JLKA 3UAYA 5KTPA 3E3OA 3U7HB 1M6WA 1DTWA 4IIUA 4GU5A 4TTRA 4TXMA 1IJEA 1K4YA 4GX0A 5EP2A 4BN0A 3WGZA 2N1MA 4KK4A 1OAKA 1QHSA 1Q77A 1PLJA 3FHOA 2PNJA 5DNVA 1JYEA 1N3YA 2Q8QA 1PFUA 4P4LA 4A6PA 3X1ZA 4CLRB 5DXAA 4PO9A 1JECA 9LDTA 3HKCB 3MTDA 4J4TA 4EUNA 1PKEA 2QORA 4WNYA 3CLSC 3CUEF 2ON6A 2X4LA 3G0CA 1CLEA 2H2DA 4IF4A 4RWEA 5I5GA 4D99A 3IVGA 3ESCA 2VYNA 4YNBA 3CR8A 2R6R1 4QYMA 4RJ2A 4B80A 1YCGA 1XJWA 2P9CA 3PUYA 1J0AA 2W2XA 4E32A 1WXXA 4PTYA 4NBUA 2IY8A 4JOQA 4WA7A 3LUAA 4XFKA 4ZICA 1GRNA 3CH6A 2AHOA 4P7JA 2C2YA 4R7GA 3V6MA 1DAPA 1RJGA 4PSCA 4HNQA 1BFDA 1O94A 4XRRA 4CQMA 2V0GA 2CLMB 3IOBA 1EU1A 2VPQA 5ER9A 3GDWA 1TE2A 2Y2VA 3DUFA 4X93A 3SLKA 2GLXA 1IVNA 1YR1A 4P2BA 1THGA 2VUIB 4P33A 4EKEA 1JN0A 4G9BA 5H9WA 3AFMA 1FP4A 2W00A 3DTTA 1QV9A 3KB6A 4UNNA 3I5MA 3JQBC 1ES9A 3QHPA 1Z22A 2CWWA 2NU9A 3J7AC 4BZQA 1KZ9A 1JPNA 1DAMA 1FZQA 3U5TA 4FGJA 5JNRA 4BAUA 3DBIA 2EQ5A 5JVDF 2C2HA 1C80A 3H99A 4C6RA 3AR9A 4H9GA 5FADA 3TEJA 3PENA 2V7BA 4M9UA 2C92A 2ZR9A 5CCBA 1L1QA 1W2WB 4FHGA 4NDZA 1V3VA 3N2LA 4HDOB 1GM5A 4L4XA 2NNLD 3Q2OA 4IIHA 2UUAB 4MA4A 3NPAA 4MYTA 2RGEA 4B8YA 3THWA 2SKCA 1XXHE 4WQMA 1QSGA 3S2YA 4LW8A 2Q3FA 5DM70 3NW9A 5HRUA 3R7LA 2HRBA 1IJKA 3EPPA 3CSSA 4INPA 2G09A 3OLZA 4EDFA 3N58A 3T41A 1Z7BA 5LP6B 1KRHA 2BCGY 2AC2A 5EQTA 1YE3A 1YRLA 2X77A 4DCPA 2BTQB 4FYPA 5T64A 3MUOA 4ZKDA 3TBHA 1WTAA 3EWNA 1HQKA 1WSDA 3LAWA 3IUQA 1W5AA 4W1PA 2W22A 4FILA 3QSYA 4QPDA 1BN7A 3X3HA 2Y92A 1UFKA 5JS6A 1IC6A 1NJFA 2EBUA 4Z99A 4O8ZA 3RYCA 4DLPA 4Q01A 3CX4A 3ADOA 4CU5A 4CLOB 5D3QA 2OZVA 4IJMA 3ZDRA 3U7RA 3MTGA 4N6NA 4GEGA 1IXYA 3C4QA 2M6SA 3RK0A 4O6VA 3UA4A 4Q5IA 5B1EA 2V6IA 4MS3A 4GMKA 4IWXA 2BR4A 3MBOA 1XWFA 5AKZA 4EGFA 4IFEA 4Q48A 2MWMA 2P68A 3OO0A 5FPHA 4KXQA 2ZWOA 3T5TA 5KQGA 1G8SA 1NF8A 2J7PA 5A2QA 3LZCA 5B2FA 1U2GC 3H8VA 3KKNA 4MDYA 5GPBA 5LVAA 1G9XA 4HH4A 2IX9A 2P9FA 3PGJA 6YASA 2IH2A 1U8EA 3I09A 1NAHA 3O8OB 1WULS 3LWNA 1V6CA 4ZC1A 5YASA 3ZU2A 2Y8EA 4FEEA 3UICA 1LVGA 2PXCA 5F98A 1BE1A 2YYSA 1EFHA 1A77A 4ZQHA 4G8BA 4LBWA 4DILA 4MV5A 4O2BF 4TQGA 3TJMA 1ND5A 3SMQA 2ZWPA 5K8VA 3ZLVA 5ECDA 5KJFA 1NZDA 4PLZA 5D86A 2O1XA 2VSYA 1L7RA 1UMKA 1AOXA 1X15A 2DQKA 2PLWA 3FB4A 1JJFA 3FPFA 4I46A 4HADA 4A6DA 4ZI7A 1H8HD 5HGXA 5CB4B 3UHPA 1OXXK 1QBGA 1ZRMA 2CD7A 4ALKA 1FU7A 2ZAGA 4HCJA 4OA5A 3GLSA 1ISHA 2DTEA 3D8SA 4GXNA 4OQLA 4UTRA 1ISIA 1F60A 4BTVA 3PK0A 2VTBB 3BILA 4PRLA 2ATCA 2XRZA 3NHUA 1YJ8A 4RLQA 3N0RA 5JQWA 3GLKA 4HG2A 5BRNA 2R2AA 5CT5A 2JCXA 3H9GA 4KQJA 4F86A 4RQUA 5TQJA 2B4KA 4O63O 1R6XA 3WRVA 4BN5A 2R6GA 4R1OA 2BM1A 3RRMA 5BN5B 1FTYA 3VH3A 3OKPA 4BJ3A 3BGIA 2Z2JA 2HZBA 3OUTA 3IAS1 1PD0A 5G0UA 2PO7A 2WUEA 1I32A 3FGPA 3HJRA 3WLFA 4C0QC 2FPUA 4F5EA 3S2UA 2HK7A 3GZNA 4OQQA 4I1VA 1HT0A 4GRIA 3R6WA 5CNJA 1OA0A 3DJYA 5ADHA 1XZHA 3K1YA 5I51A 3KOMA 2VPWA 1XEAA 1YZNA 2ZCJA 3L6OO 3GEMA 3IKVA 2EKPA 1V6SA 1IB6A 5FWDA 3RYTC 2A1TR 2X9QA 2H59A 4JS0A 2LD4A 1XZBA 3TLBA 4G67A 1T8RA 3RUHA 2BHNA 2WIJA 1QIIA 3BL6A 3KPWA 4G81A 5DP2A 3SF8B 5KSOA 3VHXB 4HGQA 2FHPA 3ZCUA 5G0VA 2YYYA 2ZDGA 4ZYVA 3M5WA 4GI7A 2GASA 4DLNA 4EH1A 1XZPA 1JBQA 1T5HX 2O6HA 3I4CA 3EZ7A 2QI9F 3W5AA 3LA8A 3P0EA 4LNUA 3EXIB 3D3QA 2HDNB 3PRJA 4B3HA 4F2PA 1MC1A 2XCLA 1AKVA 1U7ZA 4DV3B 4MMYB 3WLTA 2OWDA 4NZNA 1W36B 1UMCB 2CMKA 3PWKA 3L82B 4K87A 5G1NA 5ESRA 2XDAA 3PJFA 3TRJA 4BL5A 3U3DA 4CKWA 5IMBA 3N70A 1Y3FE 3DL7A 3T0FA 3VSCA 1JS1X 4CKZA 2PCLA 4DC0A 4DIEA 4EI9A 4FW8A 3FOEC 4X95A 4I50A 2ILVA 1BVRA 2FSSA 3A6GA 2WUVA 5EQFA 3V2HA 4G56A 3CVJA 3W5UA 4TTPA 3G0IA 2D3TA 3DTNA 2NQ8A 1KJYA 3IP7A 4EKGA 4YRSA 1G9SA 3U4GA 5JS2A 5JBNA 2BMEA 2JI8A 1EK1A 2GGSA 4L3VA 4L6IA 4LYYA 4LFAB 1EX7A 1AQUA 1UBKS 2GYUA 2VYVD 4KXUA 3ZG6A 1P4RA 1SRQA 2FFHA 2M32A 1L5VA 3EE6A 2AH5A 4MGZR 5DKFA 3CZAA 4Z0HO 2ADFA 1PGJA 4RD2A 2V3VA 4A0RA 2QU7A 4CV0A 4J7CA 1DOZA 3GEBA 4P4GA 4E11A 4K26A 1GZ7A 2UVDA 2FZLA 4Y6LA 1E2QA 4P5DA 4YDSA 5CTAA 5ALJA 2A5FA 2C83A 1CP2A 1WETA 1HL3A 2ZSDA 4WLNA 2PMEA 3UB2A 2D2EA 4RD3A 5H0IA 4EBBA 1XFAA 2OE2A 5BP7A 3W5DA 2VYCA 4Q9LA 1ZK4A 2VDJA 4JUCA 4RA6B 3I32A 4Q9JA 3EB9A 1UIMA 1YFZA 5LQUA 1OX4B 5TS3A 1VLMA 3P2YA 3M6IA 5TR9A 1JZTA 1NN5A 4DIOA 4TLBA 3CB2A 3FRIA 3KTFA 4MAMA 3R09A 1A97A 2PEZA 4ZIRB 4FT4A 1BJKA 3PSHA 4QXAA 1QVWA 1W5TA 3L0DA 1PK8A 5CP8A 3ZD7A 1F7UA 1LVUA 2GN2A 4YUWA 2RMKA 1PJCA 2Q7OE 1T4MA 2PM8A 3AR7A 3P9PA 2OK7A 4HYEA 5GZ1A 3EDOA 3PZBA 4Q9AA 4RY2A 1X86B 5DF1A 1PK9A 4C7KA 1HOXA 3AEUB 2P90A 3G7UA 3Q40A 4QXMA 2DLDA 3IP9A 1QO0D 1QZZA 1VMAA 2PEYA 2QQEA 2W4QA 3GOQA 3ZR4B 4EDHA 4WBNB 5ALPA 5B4UA 4RIIA 4ZO8A 5IBRA 1WDTA 3HUTA 1D6MA 4PINA 3PDWA 1FFSA 2A35A 5GP1A 1Y7LA 3N3BC 3FAKA 3L01A 1E6WA 3A4IA 3PT9A 4ZV9A 3AESB 4GS5A 4WFQA 3U7FB 1D4AA 1F3LA 4B75A 5EJ5A 3Q3JB 1FDRA 2J8ZA 3MJFA 4IFIA 4ISCA 4MUXA 3LZ6A 3UHFA 5JJCA 4J0QA 4C6TB 3R2JA 2UXBB 5CAEB 4Y2TA 3ET5A 3OT1A 4KQ2A 4GP9A 5G4KB 3LBAA 2VHJA 1V25A 5KVCA 2J41A 4EY5A 3WL3A 3PDCA 3OQ6A 2XZOA 5JU6A 5C80A 3G9QA 3C8HA 3F4KA 4U7HA 3ROZA 1XF9A 1XZDA 3ICWA 2G1KA 1MJNA 4E07A 3T5MA 3RR2A 4YT2A 4P4TA 1G21B 4MVJH 1N2HA 4CDGA 2XE6A 5IH7A 2WWTA 4S0XA 3R7WA 4H31A 3W8NA 4E0BA 3WJAA 1N5MA 1K98A 2GZ3A 4L73A 4MKFA 5EMNA 3RF7A 3GA0A 4XE5A 4GL4A 4N7RA 3RS0A 2QSYA 4LJ5A 3TZHA 3CLVA 3RUIA 5A4DA 4QREA 4ZDJA 4K6KA 2X76A 3VU0A 1M6YA 5KNDA 2JLXA 4C3VA 3QTBA 4CCYA 3K9GA 4AUKA 1HZZC 5M5BA 3EGVA 4HEJA 4OO3A 1SVLA 4JXZA 2QUZA 1CRZA 3VVBA 4G09A 2C4KA 2DHDA 3P0JA 4G5XA 3RS3A 1ADJA 1IY9A 1X87A 1ECLA 1UDAA 1YB5A 3UGKA 1IB0A 4DL9A 2XZLA 1N32B 4URYR 3SX0A 5LIPA 3KLOA 4Q4LA 1PR4A 2I7XA 1TK3A 1KI6B 2PKQO 2PZ8A 2ZS7A 2ZWIA 3P9QA 4KE6A 1IBCA 3S8MA 2BI7A 4I4TA 3QYFA 4ZCQA 5LSAA 3HLKA 5LYJB 3H5RA 5CT6A 1P5ZB 1E6CA 1K08A 1V16A 3MUEA 3OM0A 1JU9A 2V03A 4KUEA 3UC9A 1CF4A 3WGKA 2E4ZA 1GPH1 4J0HA 3HZZA 3Q85A 1TECE 3DULA 2FDXA 4AULA 4ZVSA 2Q6LA 1JHUA 4U0KA 1VMIA 4YB8A 1RRPA 2QG9A 4CKBA 3IA7A 1K75A 2APJA 3DB1A 3GAZA 4I1IA 2D1YA 1RWMA 2R48A 3ZWWA 1DX9A 2PSEA 2X19A 2OPHA 3W6NA 3RVKA 5B30A 2HH9A 3CKYA 4MIOA 2O07A 4KPEC 4XJTA 4JV5B 2HHLA 1QGUB 1VSBA 1YAJA 1ZGCA 3KJZA 3EIQA 4B85A 3TNDA 3UFXA 1G55A 2PFGA 4II3A 2BEKA 4L5CA 4F6LA 2P7HA 2PA3A 1K9SA 5DJ5A 2RONA 4QFBA 1A27A 2JGKA 3PQEA 1C9JA 4CDMA 2WWHA 3C8MA 2WWIA 2JAHA 4C5AA 4EW2A 3ZY3A 1TKRA 3FWKA 1A5AB 4X3PA 4KN8A 2I7TA 3UBTA 1TRKA 1E7WA 3HYRA 5JO9A 3WWPA 5JCPA 2Q5CA 1QHGA 2IT1A 4KI0A 3TZQA 2QM0A 3HBNA 4L8LA 3WL4A 2Q1SA 4WNAB 1WNFA 1NBOA 2XVXA 4OLFA 4QM6A 2FLWA 1CE8B 1SPBS 2NTJA 2VYVA 4AF7A 4B3TB 3M3HA 1L5YA 3KCNA 1DRKA 3HWRA 1KKMA 2CNKA 4HNVA 1L4NA 5JZ9A 3WFZA 4I6JA 2HLDD 4CEIA 3BGVA 3AVTA 3GNTA 4AMYA 1GFWA 3E0XA 5J40A 3WLRA 5HJ7A 4RTJA 2DPMA 1UK8A 3ZIUA 3QPCA 2A67A 2ZE8A 1U0HC 1IONA 1ZN7A 2R6ZA 3G0BA 4GD3Q 1RSZA 1EFPB 1QQ5A 3AFIA 2XA1A 4ZD6A 2HIGA 1DIGA 2Z9CA 3C74A 4KGXA 3QLUC 1KEPA 1JXOA 2GZ1A 3JARB 1KIFA 3FCOA 4MQ5A 5GM2A 5REQB 4UW9A 1BGWA 5T4BA 1F5NA 3LTEA 1YRBA 2FQWA 1VIYA 2R62A 3OOEA 4NYJQ 4XGRA 5CK4A 2A0UA 4DAEA 1N75A 1VSQA 4PWYA 2JB9A 3UHOA 4AQ7A 2Y1XA 3RRYA 4ZAYA 3LE8A 2FRXA 3N07A 4ETNA 3F6EX 3KHKA 2X23A 4P53A 1XPRA 3L0PA 1LK5A 3AQ4A 2Y1LA 4LFCB 3VC3A 1C0LA 2IDMA 1B8PA 1EX6A 4PG6A 2YIVX 2FR1A 2WE8A 1JDUA 4MMZB 5LBTA 4FDVA 5AM1A 3S2SA 5BSWA 2Z3ZA 4JYCA 2H1SA 4ETMA 2VS1A 3COJA 2CJXA 4MGKR 1QO0A 2QTGA 2Q6OA 3C3DA 5AW0A 1UPBA 1L8QA 5HQ3B 1SC4A 4GSLA 4RJKA 2C7QA 4ISBA 3TW8A 5JADA 2V7XA 1CQXA 3OICA 1O95D 2QX9A 1QCDA 3AY0A 2J31A 4EYOA 1C30A 3GZJA 1QAQA 1IOZA 2OCGA 3BFKA 4P54A 4URFA 3U81A 4AMUA 4NULA 4RCYA 3R8CA 3UWMA 3UQYS 3ZV6A 4A36A 3K0AA 3V80A 4DBLE 4E5DA 3D8NA 1YUNA 5ALQA 4PWZA 3ZXUB 1RRVA 4IHJA 5F1KA 2AZDA 1XXHB 1QYDA 2B69A 1A9YA 3GT3A 4PYRA 1HRKA 4MVCA 1J1ZA 4KE9A 4PZZA 5LOVA 2HBZA 1HOTA 1R3DA 4IH1A 2WINI 1W6RA 3R75A 3D6FA 3SE7A 1GRQA 1QRAA 4EG7A 4JJAA 3L7LA 1NI3A 3EPRA 4MROA 2UZ1B 1FFBA 3UJBA 5ED0A 3L6DA 3DV0A 4EABA 4LMBA 1V39A 4G0NA 4G5QA 2FU5C 2YZGA 1YJ5A 2WD7B 4LY6A 1A7UA 3IPYA 3RSFA 4M21A 1U2EA 5E8JA 2XGGA 3M6VA 2RIPA 1K8RA 1QIHA 3HKDB 4RK7A 1TF2A 4O0LA 4UNIA 1Y8AA 3BS4A 3L6EA 1FL9A 4JROA 4J1TC 1Q50A 1EVYA 3NHLA 1MEOA 1QNLA 4QTYA 1P7ZA 2INGX 4R2WA 5MN4A 2GKSA 2BZ1A 1RVDA 3T94A 5HKAA 3H5LA 1BWSA 1Y42X 1L4FA 3DCIA 1P3JA 2F3QA 3C5VA 5AXDA 4RFVA 3K0SA 3LO8A 4NX2A 2KSQA 3UB3A 3SY8A 4DM4A 2VBCA 1P2SA 3L0CA 2AOVA 4TMXA 3V1YA 4DNFA 5GJCA 5AVRA 1MQ8B 5CHYA 4DN6A 3T95A 3TAUA 2HFKA 2H18A 4G23A 2PX2A 2B1GA 2I2XB 1E69A 2I2DA 4WI1A 3L8CA 1MJGM 2O5EA 1R10A 3GCXA 3JWEA 3AERB 4P98A 4CIWA 2XV1A 1BEEA 1VA5A 3L9WA 1TTQB 3UK0A 3IAEA 4UTOA 4HR7A 3VPXA 1OFUX 3RYHA 1C9EA 2CNDA 4M0CA 4RK0A 2CMDA 2G06A 1U8CB 3A2MA 1QH8A 1LX7A 1R16A 5CIYA 3ZBUA 2RGCA 1COZA 3R3XA 3KQOA 4H3HB 1A4IA 4JLAA 4EVSA 4MJXA 1RWWA 3LSYA 4E12A 2D5BA 1SRRA 1VSUA 1Z29A 3BGWA 4LZNA 1XEWX 3SPXA 4RESA 2HWWA 2QPTA 3BXHA 4ZCLA 3UY4A 4B4VA 1PCXA 2AMVA 1YIOA 4AYXA 4BEJA 3MZ0A 1K6EA 1KMHB 3GMSA 1A76A 3LLCA 5JCZA 1Z63A 2WWYA 1KMNA 2XDQA 4ZJPA 1V3UA 3PD1A 1S89A 2CHUA 2XWQA 2NYAA 1Z5WA 5EXTA 3WLHA 3AJAA 4LE1A 3RU7A 3E8MA 1M2JA 2ZYTX 4TXHA 1PGPA 4OL9A 4NYJR 1HQYE 1FS5A 5ER6A 1GNRA 5AHRA 5ECYA 1VE7A 1ZOSA 4NV3A 2WAYA 2HPHA 2OO7A 1TEZA 5FIUA 2CVQA 4YRGA 2QR5A 1D0IA 3DL0A 4B7ZA 2BEJA 3AP1A 4LYHA 4Z2YA 1S8AA 2PJDA 4E2YA 5BW4A 1EHIA 1KAEA 2AG6A 1I5EA 2NV6A 1L7OA 2O3JA 3ROTA 4B3RB 5I7FA 3RU2A 2XVAA 4C01A 4N0MA 1GCAA 2A4KA 1XP8A 3K4QA 5AI9A 3JAKB 1T4DA 2R5FA 4AO8A 2VHEA 2P2NA 2H51A 1V45E 2P11A 4J29A 3E7PA 2C3OA 3IQIX 2H63A 4HPWA 4FDLA 2YBDA 3UMRA 1EZ4A 4OUKX 3EUAA 5F3WB 5CFLA 3PFHA 1LV7A 3EIHA 4DEYA 1N6NA 3AUKA 4OGGA 2F48A 3IJPA 5FHQA 1R12A 5CVDA 3NTUA 4UAGA 4FOLA 1U9IA 2PZFA 2DPLA 4NV0A 5FWAA 3FNQA 2BKEA 3B3QA 1ICIA 4XCVA 1U9YA 2VDWA 1SBIA 3CX6A 1UMBA 4H1WA 3OQPA 3G0HA 3ANTA 2I29A 2GM9A 2IIQA 3A37A 1IQUA 2OCXA 3G0DA 3VR4H 2OHOA 1IQPA 3AR4A 1GG2A 3KWJA 4C9BA 1KHTA 1XZCA 2HBRA 5C51B 4OGFA 4P0PB 2AZTA 1U9JA 2DQZA 3ODGA 3GLHE 1ZUIA 2JHGA 2J6IA 2GPJA 2ZWVA 1GOTA 1VI2A 1Z0JA 4M0MA 4KXNA 3KZMA 3TSAA 4PLFA 4UTPA 1FRZA 3W2TA 2DHCA 3BWCA 1DB3A 1DELA 1WLYA 4W1RA 3TSOA 5HJ5A 3UTCA 5G41A 5IDYA 2DKOA 4B83A 2C1EA 2CXSA 3FROA 3EQ7A 5LDHA 3F46A 3DD5A 4J1QA 4K3UA 3L05A 4OJTA 4D0SA 2YIJA 4MYUA 1V11A 3I2GA 4U2BA 4HWSA 4LJSA 2FK8A 3CUVA 1YOVB 4J0DA 2ZXFA 4I8IA 2C4NA 4BWGA 2QLLA 5JO0A 1O95A 2YIMA 2UYQA 3C5WP 2X86A 3NC0C 4RE5A 2C9CA 3EF3A 4JUFA 1OA1A 3TVYA 4RSRA 3DFKA 1QK4A 4XCQA 1Y8ZA 2JRCA 1EM8A 1X1TA 3VVLA 5B6JA 5B7QA 4OXQA 5CLJA 5A4AA 1J20A 4H35A 1V41E 5EG5A 4D5EA 3N2NA 3PC6A 4Q39A 2AG0A 2BGMA 1ZBDA 2BZ0A 4RVOA 1RM5A 1R50A 3NOXA 2P0YA 1W29A 5F3RA 3TDMA 5KTYA 1RQ2A 3W6PA 1K5GA 4G1MB 3H17A 2XHEA 1CY1A 2VRBA 4O2BB 3WSVA 3PIDA 2VATA 4HDSA 3TRKA 4YAKA 3TRIA 3WVNA 5KNCH 2P9TA 2CDNA 1U0LA 2FFAA 4RETA 1F0KA 1GY8A 2ZJ1A 3BKWA 3QA9A 3FI0A 2G40A 1SZCA 4FSXA 4AZVA 3PEWA 2CSXA 1Z74A 3PQ4A 1TI7A 1YT5A 4KMMA 2W2KA 1KU6A 6NULA 5H3HA 1W5SA 3WIBA 1PT5A 3ABOB 4WERA 4B3SB 1WXQA 2PX5A 1M8FA 3D6TB 2G4LA 2I7CA 1D9ZA 1T0HB 3OFJA 2Q49A 4X97A 1BU5A 1C1HA 3O7WA 1YS1X 1PQUA 3IB3A 1FUUA 1B16A 3EWSA 4H1HA 5L6MB 2DQ4A 3LUCA 4RA9B 2ZRMA 1TUGA 1Q11A 1UF9A 3IQWA 3MB5A 4XUDA 1OH8A 1ZI8A 1PR3A 4KXWA 2EZ4A 3N2KA 4QNRA 5CK5A 4LIPD 1WSWA 1FIUA 3NQ41 4H7DA 1FE8A 1WCIA 3PHLA 1ABEA 4WESB 1JJAA 2XODA 4YHHB 1UBGA 2EQAA 3A4MA 2Q7DA 3ZPXA 5KYWA 1TZJA 1PBNA 1XEXA 1KBZA 5DXJA 1E64A 4JBLA 5JEEA 3FPKA 5K3BA 3TEFA 4NICA 3UF0A 5LMCA 2VUHB 3O3MB 4MLZA 1ZUWA 3LO5A 4LF5B 2ZBVA 3NATA 5ECGC 1ZESA 3TK1A 1NHWA 4PC6A 2KS6A 2O3QA 3UATA 4CCWA 1SCKA 1WHSB 2YL2A 1L7XA 3CEMA 2GARA 4IDAA 3FYDA 4DIBA 5C1DA 4CQJA 4F3TA 4CCSA 4AF6A 3EQ2A 1VL8A 3EN0A 4YBRA 5JI3E 2IYUA 1HG1A 2O54A 1H2WA 2BMFA 2WNSA 1OF1A 1IN5A 3B48A 3G9UA 1RWKA 2GD6A 1LDMA 1T34A 1A8PA 2V45A 3CKLA 3QBJA 3WKCA 4E15A 1S02A 5DHTA 2GEKA 4YTEA 3TR5A 2Y1GA 4BMOB 1T10A 2WP0A 3KSDO 1G3IA 1JBEA 1C9MA 4B8WA 1RAHA 1ZQ1A 4ZWNA 2ONCA 1Q14A 3ELBA 4JQYA 3HUFA 2Y1CA 2G5GX 4TQUS 3EG9B 4XVCA 4JEIA 1GCUA 1RLTA 2Z5VA 3GZ4A 3IX7A 4YJ2B 3TLXA 3HXTA 4E88A 4FDUA 3OU7A 3PFGA 4RV9A 4BO5A 2KPOA 5J2UA 2Q7XA 4B3IA 4YO8A 1MJFA 1NPTO 2Q0QA 3DYIA 5CVEA 4Z7NB 1USVA 4O2AF 4S2UA 1PVOA 4DY4A 4EW1A 3HDJA 2V6GA 2XQIA 2PJRA 2ZBRA 3F5QA 5ALSA 4M0DA 4TWBA 1T9BA 3JWPA 3NNSA 1EUYA 5DP1A 4PQFA 1HDGO 2NYRA 4PQEA 5CNMA 3AVUA 3S2FA 4NABA 2G07A 3I8SA 5EJ4A 1FSFA 3JQ8B 4ROTA 1PJAA 1CQWA 2A0WA 4RCZA 1P6QA 5BQOA 3ZLJA 3IP6A 5BSTA 4BFVA 5JH7B 3R3HA 2R25B 3QMPA 2QZ9A 3EXG2 4P4UA 2PU7A 4ZXPA 3OOYA 3K09C 3PGXA 1V5IA 3PVZA 3LY7A 1WD5A 2H08A 4FT2A 2DH5A 2IUFA 3CFYA 2HIMA 3EFOA 3O8NA 4GOND 5A5GA 4V0MA 3LPNA 3ZX4A 1ND6A 3WRWA 2UZ0A 3TOVA 1L5MA 4FFDA 4I81A 3NHFA 1XZLA 1N6IA 4R9RA 1MJHA 5C7YA 2VDVE 1YS6A 1A82A 2MR6A 2WWFA 1FQOA 3MXOA 3AOEC 2EGHA 4QYIB 5AKGA 3ZGYA 1U7HA 2O0KA 1NJ6A 3EDCA 4AJ2A 1JH9A 5FUQA 4KREA 4B6EA 3B9PA 1GP2A 1N2XA 1VSTA 1FK8A 2FV8A 2XGSA 3OH8A 4GQBA 5L4SA 3TLZA 5EE0A 4AZWA 1K06A 1F4LA 1QIMA 4AC9A 2A94A 1JHPA 5ANRB 3INGA 3PCTA 4B2LA 1W34A 4QBIA 3EVBA 1J25A 4NPHA 3QXCA 3A3KA 3RF6A 4IJWA 4GL2A 1SVSA 1RWVA 1T35A 3TKAA 1PRYA 3MJDA 1LGYA 4KQ9A 5AK4A 5DTJA 4O4IB 3WZLA 1IVSA 1O6FA 3DEJA 3A7EA 3E8SA 2I3DA 1NE7A 3ZZUA 4LAFA 4P4NA 3PTAA 3RS8A 3CMMA 2XBMA 4BVLA 2QQFA 5I7HA 2MSLA 2RGUA 4JIGA 4PU0A 1GPYA 4B9AA 1L5HB 2E21A 1DS6A 3BYZA 5LNK1 5KAPA 2QLFA 4GSYA 2J3QA 4LV5B 1U1IA 4PZCA 5J63A 3HCOA 3NCTA 4YROA 4BNXA 5H9VA 1SNYA 2B82A 3M5CA 4YAFA 3W6OA 4BVBA 4YCNA 3I30X 1M6EX 3B53X 3P8ZA 5T4HA 5A62A 2X0NA 2DUNA 4ZO4A 3JQ7B 5FYDA 3UWOA 5D5QA 4URHA 1Z47A 5DOZA 3GIDA 3F6CA 3CZMA 5EY5B 3A1WA 5JJKA 3DHNA 3F6PA 1C7ZA 2VHZA 4K9OA 5AVQA 3GLIA 2C1ZA 2FSGA 3Q12A 1FRQA 2F4VB 2R7KA 1JFSA 1GGHA 2GAIA 2NZYA 2JIZD 3T3HA 4ZQIA 3DLAA 4KQFA 5ICFA 4JI3B 4BV8A 1FFGA 3OZVA 4IDPA 2ETXA 2VJPA 3JPYA 3NHKA 3R9IA 1JILA 3C45A 3JD0A 4UFNA 5DTIA 1UJCA 3LYAA 1XC7A 4BFZA 4LDRA 2J6BA 1X2BA 1NG9A 1QP7A 4MRPA 2CK3D 5INTA 3OAAA 3NBYC 2ZB3A 1EINA 1UBMS 5IC5A 2C3UA 3GT7A 4CF5A 1W85B 1L4LA 1S2LA 3I2FA 3O2QB 1ZJ5A 4FNGA 4LWPA 1NRWA 4M1SA 5JAUA 5KOHB 1FQKA 3ER9A 3RWOA 1EIZA 1OAOA 2G70A 1MG5A 4YV0A 5JJIA 4JQSA 2AZ4A 2C7VA 3AF0A 3NP9A 1K5DA 2YWEA 4CTOA 2OP1A 3E27A 4U8HA 4JELA 1RJWA 3OURA 1KZHA 3BC1A 1MXHA 1OX5A 1P7YA 3CTPA 5BMVF 5GIPE 4ZT3A 5KYYA 4ARSA 4MK4A 2CE2X 4BNNA 1EE1A 1KFJB 1OFVA 2B9VA 1DG3A 4RPJA 1T0BA 2YNMC 2IYEA 3LPMA 3GLQA 3RS4A 5I9IA 2WZQA 2I6GA 2VN8A 2VNSA 3W90A 4P4SA 4XIIA 1N2BA 5EVJA 3U7JA 4NMHA 3WADA 1YSCA 3MMPA 2VAPA 1CHDA 1N1DA 4QOHA 5F21A 2D2XA 3TQTA 1QO9A 4N3BA 1O6GA 5JY1A 1ZPDA 4IOLA 4IIVA 4NESA 1CWUA 1LTKA 4Q4AA 4UULA 1UBCA 3EGOA 4DG5A 5J2TA 1LS1A