1VJRA

Crystal structure of 4-nitrophenylphosphatase (tm1742) from thermotoga maritima at 2.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
261
Chain Sequence
HHVLDKIELFILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLRNMGVDVPDDAVVTSGEITAEHMLKRFGRCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLGFDKTLTYERLKKACILLRKGKFYIATHPDINCPSKEGPVPDAGSIMAAIEASTGRKPDLIAGKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVKLGKNAGIVSILVLTGETTPEDLERAETKPDFVFKNLGELAKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-nitrophenylphosphatase
publication title Crystal structure of 4-nitrophenylphosphatase (TM1742) from Thermotoga maritima at 2.40 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 93
structure length 261
sequence length 261
ec nomenclature ec 3.1.3.41: 4-nitrophenylphosphatase.
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1vjrA02
4CE6A 3HLTA 1XVIA 1YS9A 5AW0A 3EF0A 2G06A 3VAYA 3L5KA 4G63A 2FEAA 1Z4KA 3I6BA 5AM0A 3UMGA 4NAVA 4YIKA 2HI0A 5AVUA 3ZVLA 4RETA 5AESA 5IT4A 5AKIA 3EWIA 2OYCA 3DNPA 4PNHA 1Z4QA 2ODAA 5ALMA 3L8FA 3I28A 3WK6A 1ZD5A 2D2VA 2IOHA 5ALLA 1T5TA 2R8ZA 3MN1A 4UASA 1RKVA 2G08A 2MU1A 4XPZA 5AIAA 1PW5A 1QQ7A 4F71A 2WF6A 5AHXA 1XPJA 3QGMA 1L8OA 2WF9A 3KDPA 3ZX4A 4BX2A 1TE2A 2HX1A 5AM2A 3WKBA 3NIWA 2CFSA 4BNDA 2O9JA 1LTQA 1Q92A 2FI1A 3DV9A 3KOOA 3ESRA 4BKMA 1YV9A 2R8YA 5AVVA 2I54A 5ALHA 2WF8A 5AM4A 2JAUA 4MUMA 3WK4A 2RB5A 4ZEVA 1F5SA 4O8CA 2EATA 4HGQA 5AI8A 2FUEA 2ZG6A 2CFTA 4OHFA 5ALRA 5ALKA 2G1AA 4Y3UA 1RQNA 4F72A 3FGOA 3QXGA 1X42A 2C8KA 3PCTA 4UW9A 3B8EA 5ALOA 3AR7A 5AKXA 3OTQA 3WGUA 1QH9A 5ALUA 2ZBFA 3SF0A 4YGYA 3ZWDA 4HGOA 4L6AA 3OCZA 3NUQA 3QNMA 1VFPA 5ALTA 4IG4A 4HGPA 2YFYA 1WZCA 4KN8A 2HEGA 3W5AA 1ZD3A 2YJ6A 5IS2A 2YMMA 2G07A 2GMWA 4C4SA 4UMDA 2ZBDA 1Z88A 3QX7A 2Q4TA 3IB6A 2GO7A 5AM3A 3QU2A 3I76A 2AH5A 1JUDA 4FFDA 3FPBA 5AICA 4UM7A 5AKLA 5AK6A 2AGVA 2I55A 5AVWA 4QQFA 4Y2PA 2FUCA 1RRCA 5AKJA 2B30A 4CF4A 3CZ4A 1ZS9A 3A1EA 2BDUA 4JB3A 3N8GA 1RLTA 4GXTA 4QJBA 2YJ3A 3SKYA 4Y2VA 3ET4A 2G0AA 2W4MA 1U2TA 3OCWA 5ALDA 5AVYA 2W43A 2X4DA 2P69A 1NF2A 2YJ5A 3U7HB 2HCFA 2CFRA 1ZOLA 2W11A 2YJ4A 3KBBA 2GHQA 1SU4A 1J8DA 2P9JA 2ZOSA 3E84A 3ONNA 3U19A 3WKEA 2C9MA 2BDEA 4BX3A 2IOFA 3E81A 1XP5A 5AW5A 1TJ4A 3EF1A 5AVTA 1U02A 2ZBGA 3AR5A 5AIBA 3QUQA 5A3SA 3WK7A 3L8EA 3P96A 2HDOA 1IWOA 3U7EB 4UU0A 2C8LA 1U7OA 3N07A 4EELA 3W5DA 2YN4A 4KX5A 3W5BA 1N8NA 1Z4NA 1Q91A 3N28A 3PDWA 3W5CA 2QYHA 2C4NA 1J97A 3QUBA 5ALVA 5AW7A 3KD3A 2RBKA 5IT0A 2YBDA 1L8LA 2OA0A 4Y2XA 2PQ0A 2JGAA 4GIBA 3IJ5A 1N9KA 1ZRNA 1MH9A 2I7DA 2R8XA 1YJ5A 3B9BA 2EARA 4UATA 2YMPA 4KX3A 3OCXA 5ALNA 1RLMA 5AVXA 3ZU6A 3N1UA 3L1UA 4HYTA 3QLEA 2HHLA 1U2SA 1U7PA 5AKHA 3FM9A 2QLTA 4BNDB 2HSZA 2IOFK 3L1VA 3L7YA 3U26A 4L57A 5AW8A 5ALXA 2C88A 2AMYA 4DWOA 1QQ5A 3QYPA 5JJBA 3ZUPA 3OCVA 3ZTYA 1EK1A 4XE5A 1Z4OA 4HGRA 3AR4A 3MMZA 4EENA 1CR6A 3SMVA 1RLOA 2WFAA 3R09A 3HYCA 3R9KA 2HF7A 5ALWA 3DAOA 3SD7A 5ALJA 4UMFA 4Y2JA 3F9RA 2VKQA 4OD0A 4Y2SA 3NALA 1YMQA 2JAWA 1L7PA 3UM9A 5AK5A 3ZTWA 4EX7A 5AVSA 5AKZA 4AP9A 3ZVNA 4BEWA 1RDFA 1YNSA 3L0CA 1Y8AA 1RPZA 2Q4RA 1TJ5A 3ESQA 3ET5A 4DCCA 3QU9A 1L6RA 3OPXA 4BYGA 3K1ZA 1ZRMA 3IRUA 3ZX5A 2YMQA 1Z5UA 4Y2YA 2IA5A 2I34A 4BBJA 5AW3A 3UMBA 3SKXA 2FDRA 3WK5A 4C4TA 1S8OA 4KNWA 2JAOA 4OCZA 4DFDA 3I1YA 4UM5A 3NASA 1YDFA 5AI9A 1O03A 2FPUA 2AUTA 2O2XA 3M9LA 3BWVA 4RESA 3WKDA 5AI5A 1QYIA 4BEVA 1SWVA 3QUCA 4NV0A 3MC1A 3U7FB 4NWIA 2NYVA 2ZXEA 4XOUA 3WK9A 5AW2A 3FVVA 4FE3A 2HF2A 4CF5A 3N5KA 4NFLA 3D6JA 5ALPA 4CNQA 2OBBA 3R4CA 1ZJJA 2FPWA 1Z4LA 5A3RA 1RKQA 3NANA 4B6JA 3WGVA 5AVRA 4Y2QA 4YH1A 1S2OA 4IFTA 5E0OA 5ALZA 1RQLA 3AR3A 1TJ3A 5AK4A 1QQ6A 1FEZA 2EAUA 5ALIA 4EEKA 2DQSA 2FPRA 4HGNA 1L7NA 3J7TA 3QU4A 2HOQA 4MWOA 5AM5A 1LVHA 4YCNA 1RMYA 2GFHA 2G09A 2WF5A 2I33A 4NABA 5ALEA 3L8HA 4L6CA 4UAVA 2FPXA 3A1DA 4UMEA 4BX0A 4KYTA 1ZD4A 3ZW7A 2OM6A 2B1QA 4Y2UA 4Y2TA 4E88A 2RARA 4JDPA 5AVQA 4UAUA 3QUTA 2G80A 3FPSA 5AK3A 2GHTA 1NNLA 2P11A 1CQZA 2B8EA 3UMCA 3EPRA 5ALFA 5AKEA 1Z4JA 3U13A 4EZEA 1TA0A 5AKYA 4AS3A 5AW6A 1WPGA 3FZQA 2PR7A 2Q5EA 2BY4A 5A3QA 2ZBEA 3QU7A 3E58A 2FPSA 3AR2A 5AKKA 1WR8A 3A3YA 4XQ0A 4I9FA 1Z4IA 4Y2RA 4ZEXA 1ZD2P 1RMTA 3WK8A 2CN1A 4OFZA 5T41A 4HAIA 3OCYA 1L7OA 2B1RA 1T9ZA 5FP0A 1EK2A 5AW4A 5ALYA 5AKGA 2RAVA 5AI4A 4DW8A 4KNVA 4H1WA 2R8EA 1VJ5A 1AQ6A 4CF3A 1RC8A 1O08A 3L8GA 1Z4MA 4UU1A 1K1EA 5AW1A 1T5SA 5AW9A 3ZI4A 4J2TA 2B8JA 3RF6A 3A1CA 4J03A 3KZXA 3S6JA 4FYPA 2B82A 4C4RA 4YCMA 2WM8A 3B9RA 1L7MA 3ED5A 2I6XA 3M1YA 4I9GA 1SWWA 4G9BA 1RKUA 2WHEA 4ZEWA 3L0YA 3ZVMA 3NRJA 1KYTA 1NRWA 2YY6A 3L0BA 4EX6A 1RMQA 3OCUA 1Z4PX 4UARA 5AVZA 4YIHA 3QU5A 3AR6A 3BA6A 3PGLA 3SLRA 2NO4A 3SHQA 5ALGA 5AM1A 3WKAA 1Z5GA 2MSNA 3PGVA 3MPOA 2PKEA 3AR8A 3NAMA 5AI6A 2WF7A 3KC2A 3E8MA 1VJRA 2JARA 5ALSA 4YCLA 3ZWKA 3RFUA 3GYGA 3DDHA 3AR9A 5ALQA 2HO4A 3U7GA 1WVIA 5AI0A 3TLMA 2B0CA 2P27A 2YMLA 4AS2A 3CNHA 2NO5A 3WKCA 2IYEA 4UMVA
chains in the Genus database with same CATH superfamily
1SXHA 1LZKA 1YC2A 1UDWA 5IRCD 3GLGA 3BB4A 4UOEA 4J76A 2C57A 4YRSA 2IYYA 4OKSA 1ISPA 2MR6A 3VAYA 2EJVA 4G0XA 1WUTA 3HP1A 4WY5A 3LWNA 3V3KA 3DMRA 5T8KC 1A95A 1PYDA 2WNIA 4R8KA 5J2UB 4RTRA 4OY3A 5JDCA 1RXUA 2BDTA 1T36A 2NTVA 1IJBA 1E9VA 2PAAA 5HILA 3IBYA 3BHMA 4EITA 4YV7A 4NENB 4K6MA 3OUZA 5AKIA 4YS6A 3LUGA 1RZRD 2WVAA 2X9GA 1X1EA 5LLDA 1C9JA 1NW9B 4TTIA 2PKWA 2R6HA 4OGFA 4D6PA 4Z4GA 3QBVA 4IGAA 1Z4QA 4JGBA 4JBIA 1JH9A 2OV3A 4DB4A 1JEAA 4A15A 2H4FA 3ZI7A 2QGNA 4G1CA 3QHQA 4UEOA 1RE1A 4C7OA 2R8ZA 5C7LO 2WWWA 4X1KA 2PL5A 4LYEA 2DUUA 3A4VA 3X3HA 1VG9B 3H6KA 2W2OA 1CIPA 3I8OA 3PQ3A 4HWTA 4IOMA 3JATB 4BBAA 1V16A 3CKYA 4RGQA 3X1DA 1DKUA 4BCCA 3VO1A 1GZDA 2YV3A 1GPKA 4H1HA 3EVGA 3ILHA 3PXXA 4QUEA 3JYQA 4HQ6A 1KQNA 1HYGA 2FZGA 3G8CA 1R5JA 2BFMA 3C5VA 5CG1A 3BF8A 2VBFA 5EE0A 4NBLA 2Y3IA 1DIHA 1HETA 2H1HA 4Y9SA 1QZZA 1LLQA 3HYSA 4BNDA 1L5NA 16PKA 3HYNA 1MG5A 2H51A 4IQGA 1EG7A 2ZCVA 3O8LA 4FHDA 3BIXA 5BMOA 2NT4A 1OFTA 3CB4A 1WY5A 3RWBA 3DO8A 1P5JA 3RFCA 1IMJA 3VJRA 4NMLA 4YP7A 2BUCA 4KR2A 2BGWA 1H05A 4ILEA 3I9FA 3OHMA 2H0QA 4X7BA 5DE3A 4CYMA 2AWNA 5AVKA 4QPZA 1L4HA 4KN9S 1P29A 4U0KA 5FA6A 1LI4A 2IHYA 1JWBB 3KT6A 3QG5A 3MQ2A 5HKLA 3V4LA 2GXUA 4R2KA 1GPBA 1H2HA 3AP1A 4MYTA 5IJAA 1TM3E 4R84A 5HMLA 3NAQA 4MIYA 3DC7A 3JVDA 4KV7A 5ARDA 3QVJA 3UJPA 3TLCA 2AE1A 3AVUA 3LCCA 1R6TA 2YKGA 2RD2A 3DZJA 4KOAA 5E2BA 2Y66A 4YDSA 4TRMA 3WHIA 3I9OA 3TGLA 4A8HA 3CF0A 2B1JA 5AHRA 4RSHA 3ZWDA 4EYGA 5FD8A 4MHTA 1D07A 1JBEA 2A59A 2HU5A 5K0EA 1MAHA 4PBTA 3UKJA 2O2EA 3HMKA 2BIFA 2HRQA 3WSWA 5B2FA 3S2ZA 5ADWA 2GZAA 1E69A 3N2EA 5JD3A 4AMVA 5CCXA 4OLHA 1K0FA 3V8PA 2FSHA 4BNWA 4CNBA 4QODA 1MRNA 4FW8A 4WGFA 5I4IA 2HWWA 2X4LA 1G17A 5BUZA 4L2IB 4ND6A 1T2DA 2AIRA 4A0HA 2DP4E 4AZVA 1XKTA 1BXGB 2X0NA 3Q3IA 4PC6A 4TLMB 5EHGA 5LBIA 4MUHA 3LUDA 2WYIA 1ZJZA 4URUR 1SG9A 1ZI6A 3HL4A 2QSJA 3M4NA 3RS0A 1RXYA 4I3HA 3AVXA 2C58A 1WHSA 3TH5A 3RFVA 2F48A 2IZ7A 1H9BA 1Z8NA 2H3EA 3E48A 1E2BA 2Q2NA 3MJFA 3VPCA 4TXMA 3SLKA 4EYKA 1Q1EA 2AI2A 1MBZA 1LB1B 5LIPA 1O89A 2I2BA 3Q1LA 2Q4EA 4KDRA 2H8GA 2WTAA 2HJ9A 4JUBA 5AK6A 4C30A 3RUDA 4AO6A 3JXEA 4BPBA 1JU3A 3LECA 2ZIXA 3JASA 1EX7A 4IHKA 3CZ4A 3RH0A 1OH8A 4N4AA 2IS1A 3IUQA 2OGZA 3WZMA 1K4MA 1VOTA 3O8NA 1RI3A 1YQEA 2RH4A 3KKLA 1PNQA 5JCJA 3PJDA 1GL9B 1UT8A 3W04A 7MDHA 3FJYA 1Z13A 2GYUA 3OHPA 3L6EA 6NULA 2VUUA 4UUNA 1SKAA 2QL5A 1V8OA 1S2GA 4KQWA 2X9LA 4MO9A 1NBMA 3H2IA 4XB1A 2YJ4A 4IJMA 1NBOA 3LFTA 5KNDH 1EMDA 3CR7A 3E84A 1DQYA 3PV0A 4RVCA 4ZI7B 2CXPA 2JCSA 3P2JA 1L7BA 3F8TA 3MTDA 1W5EA 1WO8A 4Y30A 3R8CA 2E4VA 1T4MA 5JI3E 1EI9A 2BTQA 4F6LA 4B46A 1W5TA 2PS0A 2AG1A 2VNSA 3L8EA 3NRCA 1CCWA 3P96A 2F1JA 3PUZA 5EUQB 1DCTA 2ZVPX 3BK7A 3MTGA 4O4LF 4UU0A 5LNK1 5HOQA 1EQAA 1U7OA 1KOLA 1R6DA 1EKXA 3T5DA 4ESVA 1JMYA 3NIFB 4ILKA 4WFJA 4MQLA 2C2KA 5EIBD 4WJKB 4UOZA 3W5CA 2XEDA 3UJDA 1FS5A 2JJ2A 2JHCA 4M3NA 1ZQ9A 2IITA 2RBKA 4JLMA 5BN4B 1LF0A 4P84A 1AKYA 3GFTA 3K6RA 3L4KA 1Z18A 3DAGA 3RVDA 1BXZA 4IWXA 5CRIA 2P5TB 3GZ4A 1QS0A 4KBYA 3GGDA 1PT7A 3ZCVA 2OA0A 4PGHA 2BAGA 4WOJA 3H2GA 1DO2A 4K6CA 5LZ9A 3BMQB 4PHTA 3GVIA 3QFFA 3ZV7A 2XCSB 4YONB 3QLVC 5JS7A 1RZVA 2B98A 1JG7A 2PA0A 2QTAA 1U8UA 4PY2A 2GNPA 4TUYB 3B9BA 4EYQA 4XD2A 2C7RA 1WXGA 4JX9A 1VIDA 5DYYA 2WICA 2YMPA 4DC9A 4U7DA 3H4TA 2VCHA 5CW1A 5KSWB 3EZ2A 1NHWA 5A5FA 1RBYA 5E9QA 1GLGA 2FFBA 1JG2A 4JAVC 4BQEA 2Z6QA 3L8ZA 1FXUA 3T9EA 5JYBA 1W47A 2VCYA 3IP3A 3WJAA 3PXGA 3SVTA 1VMKA 3I0ZA 4R1UA 4ZT3A 3GHYA 5J5AA 5FTWA 2NZ8A 5LP6F 3I2KA 5BV7A 3V1KA 1QIFA 3H2HA 4FR5A 4FE4A 3OP1A 4G4IA 5CNIA 1NXQA 1ZMXA 3D64A 5I9LA 3TAUA 2YWRA 4ZU1X 3V7WA 3L7YA 4LWZA 2VHYA 3ESXA 5IM5A 3S2IA 4BVHA 5JNSA 3G8DA 1ML4A 1CF2O 3DS8A 2GILA 4FB5A 4UVIA 3OLXA 5G1OA 3DWEX 3BKXA 4BDSA 3ILYA 3QYPA 3PQ6A 8AT1A 1TTPB 5B7PA 1NLYA 1P80A 4JR0A 1KY2A 3KPVA 1W4AA 4A92A 5E1OA 5FWAA 2LP4Y 2V9ZA 1RYDA 1OXVA 4HCJA 4II7A 3ZWVA 3JD2A 1GUAA 4RGYA 4YCJA 3PR2B 1SCJA 5IEBA 4DT1B 3EY9A 1CR6A 3TXXA 3WBFA 3Q12A 2QUKA 5G40A 1SKUA 1ZIDA 3DOUA 3R6TA 3VU8A 2FX5A 1KJWA 4A03A 3GA0A 5J1TB 4BO9A 1ZG3A 1AS0A 1GPJA 2HD4A 2NXEA 3OLQA 4MKHA 4H4CA 4L22A 2IUFA 1EK6A 4H0FA 2YIJA 3O94A 4P8RA 4N1AA 2CNWA 3RADC 1E1LA 3A6GA 1Q0LA 1ZA1A 3WO1A 1E4VA 3UM9A 1W7AA 2P0YA 1CEYA 2B6HA 2WD7B 4HXGA 1M76A 1Q7EA 2NGRA 5AHOA 3CX4A 4AY4A 4EHDA 4GLJA 3ZTWA 1YL7A 2AG6A 4MJ3A 2EFDB 4R2IA 3T9CA 2F8SA 4RV5A 5AKZA 4UHKA 1H23A 2Q8QA 5IZCC 3GLIA 3ZVNA 5ERXA 3RKUA 4JEIA 3FAKA 4X97A 1ULTA 4P7BA 3ZQ4A 1M33A 2H1CA 1JZQA 3NU1A 1Z6PA 3K8YA 5AJVB 1ECJA 3IX7A 4MUJA 4PPQA 3RHSA 1ECCA 5A5EA 3VKGA 2NTJA 3OMWA 4E5UA 1VL1A 3U37A 2IX3A 1A9YA 1DRVA 1UC5B 4PCAA 4QU8A 3VZCA 1H1LB 5I3CA 5IXJA 4GW3A 4EHKA 3H5AA 3BGIA 1SRRA 5D84A 2D2EA 1XDWA 4V0KA 5KAPA 4JY7A 1U3FA 4QGAA 5A4JA 5ITWA 3HNRA 2HY7A 2IPAB 4K05A 4PYNA 1URPA 1ZDMA 4ZZ2A 4B8YA 1WCWA 4PM4A 1RQGA 3GFSA 4S2UA 4CFYA 1RPJA 5AI9A 1Z5VA 2WLSA 3M1AA 4LNUA 2AC7A 2XNKA 1EAYA 4GI7A 4J6EA 4NYJQ 2GBLC 4ARVA 3MYRA 1O8CA 2D2FA 3GLFB 4TRJA 4M6WB 1RJFA 1HBJA 4UD6A 1R0WA 1Z73A 4YXWA 1YR1A 2JJ1A 4C9BA 4XRGA 1TZJA 5T8KA 2ZAOA 2JFQA 4FOSA 2FMTA 4EKNB 1KEWA 3A05A 2PUWA 3BOSA 1MORA 2PRSA 3DBLA 4OO3A 4DWWA 3B2NA 4Z86A 3HLKA 2XZTA 3R7LA 2D0PB 5KX5A 1G3IA 5DWVA 3VO2A 3JR3A 2Z5VA 3G2KA 4NFLA 4M88A 1GSIA 1FFEA 1KTVA 3CO5A 4PZEA 5DHFA 3RGGA 1ZICA 3R4CA 4H6WA 4JHLA 1DRUA 4OHBA 1YCDA 2C94A 2ZYRA 3H9QA 5CAEA 5IAGA 4RD6A 1K63A 3WGVA 1UQTA 2GERA 3E18A 3ROTA 1T13A 2GB4A 4R16A 1LI7A 3ZIAD 2RSLA 2LCQA 1HT2E 3E5RA 2K6GA 2PMDA 4JBNA 1OAOC 4KDFA 2HF9A 3QMMA 5KAMA 2VP0A 3VJMA 2DBVO 5E6UB 4F56A 3O92A 4ZYXA 2WQ7A 2JJ8A 4X7RA 3ZBQA 1HQYE 1AZWA 1ZM2A 1XQVA 5ALIA 1SVSA 1T3ZA 4HGNA 2GNOA 1G1MA 1QRDA 2BGTA 1UMKA 1VBMA 1HFWA 4DMMA 1K2WA 5J5VA 3SFVA 4BL5A 2ODTX 2XBLA 3DOEA 5BQOA 2AQHA 1N2CA 2B0JA 3K5PA 4V3BA 3TQFA 3UW3A 3DUWA 5BQ3A 3BRSA 1PQPA 1J8YF 2GPBA 2JFZA 5JG7A 1H8HD 3K5HA 2VG8A 1E7QA 5JQGB 1Q7GA 4Z9AA 1XPOA 4IICA 3GRRA 3WLNA 4CEJB 2UXDB 2O8CA 1JI0A 1P1HA 3MINB 4M9QA 4BNXA 1E9AA 2EFYA 2PH3A 4W82A 4O4LB 4ZAYA 3FKJA 3A70A 2IHVA 3LPNA 3Q11A 1PG2A 4PFSA 3O4VA 1ISIA 3H9GA 3Q3CA 1E1RA 1NNLA 3WOHA 1P1JA 2QENA 3EIXA 4QXPA 5ALFA 3IXMA 1LSJA 4QG3A 1FYEA 1HDEA 4XTCS 1N2OA 5EXXA 3KT0A 1N34B 1XDBA 4DCTA 3G1TA 1OWPA 4HXFB 4MQEB 1QRTA 1KZYC 4ED9A 4JBGA 4ARIA 3I72A 5FPQA 4KH0A 4M9ZA 3QVSA 4W1PA 5CU7A 5GJCA 3K8ZA 1I0IA 3TVYA 3ZKAA 4LW8A 4MQ5A 5IEJA 2AKAB 4N6OA 1JTEA 3DTVA 3RDPA 3WLQA 2EEZA 4PG8A 1CJKC 3NTQA 1QHIA 2V7QA 2HNAA 2B1RA 3EEYA 4RIFA 3DD5A 3F5QA 1QH1A 3NOQA 1U0SY 3P4UA 1V5FA 4TSFD 3ASZA 3RSSA 2GD0A 4FB4A 5AI4A 2RHHA 3ZY6A 1XTZA 3HJNA 2XD9A 4KE9A 3UT6A 3VR0A 3KPYA 2VNAA 2CJYA 2P9ZA 3H7AA 3IBGA 4C7BA 3UCXA 4BASA 1JPNA 3HR7A 2O3UA 4X65B 3T3EA 3JQ7A 3L8GA 1LPSA 3IT1A 1K1EA 3OWOA 4Y8VA 5LP6B 1O96B 1CLUA 3G2OA 4LDPA 3HVRA 4AKSA 4JB2A 4QOFA 3W3AH 4AKTA 4CM9D 3TG8A 1Z07A 2WWXA 3VTFA 2X0IA 3H83A 2D7DA 4J03A 1TD1A 3AHDA 2B82A 1KI3A 4Q66C 3CRW1 4ZHQF 2IHTA 2VUIB 4H7DA 4N9WA 2AR0A 3B9RA 2NXWA 3JAWB 2I6XA 4EZIA 4CQLA 5L3QB 5B2ZA 1TAGA 4ROTA 1NMEA 3ZGYA 5CITA 2IYNA 3LA6A 5FI1B 3B1WA 1I2AA 2BFCA 2QRQA 4DCNA 1E3WB 1UFOA 4RYLA 1V6CA 1U3WA 2GHRA 3C3MA 3MT9A 4J29A 1EFHA 1TCCA 2HF8A 3B12A 4GQBA 4NK4A 3W79A 5A2GA 5CEFA 3G23A 4I1PA 4XDYA 2FFQA 4CEHB 5HZHA 4RK4A 3ZZUA 4XFJA 3G7NA 3MD9A 1WV0A 4X5OA 3EGWA 4KP7A 3GGGA 5LDGA 4EUHA 4EQ6A 1T9AA 1ZL0A 2FKNA 4CMHA 5JRDS 4WK4B 5M7EA 4TZ6A 3IPYA 3H84A 1VHWA 3VKFA 2QJOA 1E96A 2Q4BA 5DOVA 3T1TA 4IMRA 3SEZA 1GUDA 2RFLA 1F5NA 4JXKA 5BR1A 5JXGA 2IYUA 2P9FA 1I2ZA 3IR6A 4ZIRA 3IQIX 2DC1A 4GP7A 3PSAA 3GLUA 5FAXA 3IMKA 3FXAA 4TN5A 5JRJA 5K5EA 3HU5A 1N3IA 3ZHZA 4XD7D 1I1QB 1CFJA 3WNQA 1RADA 5LBTA 4R9SA 3R76A 1N36B 4PR0A 1KFEB 2WPDD 1DFGA 2VZ8A 2EJBA 1SOWA 1WOMA 2HQRA 2QG6A 1O0SA 2YWEA 3PC3A 4O02B 3RC7A 4BKQA 2D3TA 1ZZEA 4ALMA 4EA9A 4NFHA 1TU3A 3AFMA 4IF4A 5AW0A 4XX0B 4G5HA 5A3VA 4G09A 4C4YA 1QGAA 1M2NA 4S35A 4LOJA 5PNTA 1UJNA 2FEAA 2DU8A 2LW7A 1ESZA 2ETXA 4UCXA 2FLVA 2GYYA 4U63A 2B34A 3KHTA 1Z6AA 3KAQA 3MT0A 3UFXB 1XZBA 2IGTA 5K6TA 4IZOA 3EMKA 3V34A 1KA9H 1UKEA 4P80A 3VGJA 4Z1MA 4AN4A 4F6RA 4X0EA 4L9WA 1SD1A 2VH1A 3PFHA 1IY2A 3AM3A 3LBYA 4RDHA 1LV7A 5ULLA 5DCYA 4M46A 4GGOA 1KH3A 2XWJI 1ISJA 5ENZA 5C53B 1K8ZB 2ODAA 3IAFA 4CVNA 4KGVA 1PSZA 4XVHA 3RI3A 3K0FA 1DU4A 2X14A 2VWGA 3L8FA 4DQDA 1AQNA 3T0GA 4AQ7A 5DW3A 3P45A 3AX6A 5DN6D 2EW1A 2NO0A 2OXFA 2VK4A 1EVZA 3K8QA 2FPMA 4ZVUA 2A92A 2LIPA 3C7KA 3I73A 4X63A 4EDFA 5WRFA 1NMSA 3SQNA 2ON6A 2D5BA 2WF6A 4J0EA 1NY6A 4UCQA 4V03A 1BX0A 1L5FA 4G5OA 3VO8A 2AYXA 5CBPA 5BR8B 4IDCA 4QLOA 4DA8A 3G0GA 1DC6A 2BV3A 4ITUA 4GBJA 3HC7A 2GBFA 5LMUB 1YFZA 2EHJA 4GMKA 1HKHA 2B2XA 3G88A 2JIQA 3OETA 4GXRA 4EY6A 3I2FA 1FXWA 1H22A 1LBTA 5JLJA 1ZONA 3UANA 4DTIA 1VKRA 2WIJA 1AY0A 4GG1A 4WACA 4CKBA 4E6EA 3FCEA 1YR6A 2WZDA 4RL4A 2IUYA 2Z95A 2RHLA 2FLKA 4G0MA 5KKAA 3S99A 2V7TA 5TV2A 5D86A 2X2FA 1FIUA 1LK5A 1XHFA 4EB3A 3FCSB 1F5SA 2V6FA 2UUCB 3OQPA 2EZ8A 5ERGB 3ITNA 4U7PB 2QN6A 7GPBA 5HF6A 3TG2A 1G9XA 2ZS9A 3IS3A 2H1FA 4YMUA 2VYVA 2M6KA 1VPLA 3W90A 4B4KA 1CF4A 2V3WA 4RHXA 1SK9A 3ZU4A 3VR3D 3AR7A 3FDZA 4PRKA 3PWSA 2QB5A 4D9HA 1REQB 4DANA 4Z54A 4JDUA 3F1LA 1MABA 4IH4A 4F3TA 4ADSG 3AHHA 4I1RA 4H7IA 5CEEA 4KLAA 1Q0TA 3JTMA 3OSZA 1GZUA 2C9CA 2Y68A 3JD0A 3QNMA 3WYGA 2HXSA 1L4EA 1LA2A 2BR3A 1F2UA 5IZCA 3GCWA 4EW6A 1WZCA 1EXWA 1TCVA 2H18A 3B1XA 5TPWA 2VTKA 1QIHA 3TW8B 3W5AA 2QROA 3EFBA 3SDZA 1XFDA 4OSEA 3VR6H 1ZN7A 4EBBA 4HT3B 1YIDA 3DP7A 2ZROA 2FWBA 5BSTA 4PIVA 4HNAA 2CBXA 3F3SA 2ZR8A 1KKMA 1MUUA 3CNNA 2YQ5A 3U80A 3KTDA 3ZUGA 2PS1A 3IQGX 4P53A 1W1IA 4WEOA 4OHXA 5FCDA 3T7JA 1CJCA 3UGTA 5ICGA 4XYMA 1NQXA 1OU4A 2PJDA 4GI1A 4G0WA 1JUDA 3DBHA 3FPBA 3WDMA 3GLQA 2QHXA 4B3SB 2FOIA 4URFA 4TLLB 5AKLA 3WIDA 1SUIA 2JHAA 2I55A 4K9KA 1QRSA 3LI2A 3PNQA 4LMPA 5IJ0B 4RPLA 2HEIA 4I81A 1FDVA 1T1EA 3NVMB 2YWGA 3LC0A 2AZDA 4GP9A 1QB7A 3BWEA 2DCMA 4NC9A 5INTA 5TEWA 2XVXA 1SKYE 1NJ8A 4AFNA 4B4WA 1QCYA 2FJPA 1E7SA 1GNQA 4GBGA 2CMGA 2GBLA 2OMKA 2VP4A 3CX6A 3I6QA 2OXTA 5AVYA 3KQOA 4FFMA 5FEUA 4TN1A 5IX8A 4ZTZB 1B6RA 3K1JA 1A9RA 2X4DA 1NVFA 4L9SA 2AN9A 2PVCA 1KI9A 2L18A 4EA8A 1JKIA 3IBTA 2YV4A 2XB2A 5CR9A 4PVCA 1UXJA 3HCRA 1JG4A 4YV1A 4QDKA 2K7ZA 5FBKA 4OLBA 2WU1A 4HG2A 4ZHQB 1FTWA 3UENA 2AQIA 2NPFA 3S28A 3CVWA 2OO7A 2C1EA 4M0LA 3DZFA 4R2LA 1MAAA 2BHNA 3EOZA 2YINC 4IJKA 2R8OA 2Q1WA 2GF0A 1GTJ1 1OZ0A 2GETA 2QZZA 3IP8A 3O8BA 1PDOA 2NV0A 2ZRIA 4NIMA 3WR5A 1ANKA 4D96A 2OE2A 4X3PA 3URMA 3R3WA 2KLHA 3L6RA 1L1QA 1Z4NA 5YASA 5CB8A 2FG5A 4ND2A 2WDZA 3DBRB 2J3HA 3O2SB 4K1XA 3CURA 3LYHA 1E2PA 4Y18A 3ZZTA 4LBYA 4KR3A 3ISVA 3KD3A 1SMKA 1SUBA 1BO6A 3V7UA 1E9EA 4RSGA 1NUAA 1QOPB 3K9LA 3MCUA 5BN1A 3R7SA 1EJ0A 4IFEA 2OHOA 4M7OA 5KI6A 2AYYA 2DFVA 2AX3A 2BTOA 3PDCA 3CZRA 4HDAA 2P2CA 4BWFB 5FLYA 5LZ2A 5TDHA 3ANNA 4CUJA 5G0VA 4Z4CA 2IS4A 1HDOA 3VYTB 3QXSA 4HFNA 1OUMA 2H52A 1BU5A 1HKUA 5F23A 1V1JA 4O2AF 3SFZA 2FQYA 3EUAA 4IJUA 4BNHA 4BFVA 1S4QA 4M0EA 4K88A 3RS4A 1DMRA 1TMGE 1BHJA 2JHPA 4X61A 3RU3A 1FYFA 1FRQA 5G53C 3MOGA 1NP3A 3VHQA 3CH5A 4OQEA 1NHGA 5D8DA 1M34A 1U7PA 3JYOA 2P75A 1VJ1A 3TNDA 3B1JA 2UV8A 2QM0A 3WNDA 1X2BA 1EQUA 4TMKA 2ZUSA 2OHVA 2VDNB 3GMIA 4JJ6A 5KB3A 2VQ6A 2C88A 1C30A 2H92A 2EKQA 1TT5A 3NM5A 2IVFA 1Y81A 3ESYA 4M1QA 3C8DA 4R6WA 3AB3A 1D5CA 1CUHA 2HQOA 1FFWA 2FK7A 4UEKA 3VNBA 2XMZA 3GFQA 3ZWPA 2EDAA 4EGSA 4O3MA 1T15A 4CCAA 2P3QA 2XD4A 2RAFA 5JQWA 2QVGA 5LMCA 4RPJA 2PXXA 4ZV7A 3M5DA 1TCAA 4PX5A 5JBQA 4EI2A 3ESDA 1M8KA 1SCIA 1JR2A 3GT4A 3I9KA 3UH1A 1C0IA 3PFNA 1QORA 3LPLA 5LP1A 3MAJA 2HADA 1RLOA 4OATA 4RKQA 4D42A 4MR8A 1DLJA 4DM7A 2HSEA 3EA0A 3RT1A 3A2NA 4DSAA 3PE6A 3RG8A 2H9AA 3I04M 4J9VA 3A1UA 2CDCA 4WOKA 1KS9A 3OTGA 3RV4A 2XJ4A 3VVBA 1Z29A 3I5MA 3UAYA 3HA2A 4KIGA 1LPNA 3C6ZA 4UHCA 5ARCA 2P6PA 1NATA 3KP1A 1OWLA 1ZUNA 3EVCA 3OPYB 4J43A 3DV0B 1G8SA 2J85A 3FZYA 4I4IA 1SC3A 4BE9A 1K86A 2YUTA 1COWD 1LDNA 3G9QA 1A8SA 1KDTA 3OECA 5JARA 5IDYA 4QICA 2R2AA 3ACDA 5EG5A 3SK0A 3C3DA 1WCXA 3ZH2A 4MZXA 5HZGA 2YQ4A 3EGIA 2AJDA 3LQ1A 3OY2A 5KNCD 3NATA 4LJKA 4P4LA 1YVPA 2IHZA 1XJWA 2XDWA 4C3UA 2X3FA 5G3ZA 5K0ZA 3D0RA 1RWVA 3AM4A 1MB2A 3PNPA 4MRRA 3SHFA 1JSZA 3QU9A 5TJ9A 4UM9B 2BM1A 4X6YA 2F3QA 4IDFA 1QFMA 2GA9A 3D02A 2ZUTA 2HT6A 4B79A 3FOWA 4BMPB 4OGGA 5ADVA 4EMUA 4FK8A 1YUBA 5LQUA 1MJGA 3HM2A 5KUTA 4FSXA 5CEJA 2WJ6A 521PA 2IHUA 5AW3A 2WAYA 1BJRE 3J81k 3FOEC 5HFNA 3OJ0A 4ZEMA 1IPFA 1IN4A 3H2SA 3WK5A 3FLEA 1NBIA 3GJZA 1FL9A 3FMIA 2QRKA 1FLDA 3WYEA 3KR2A 3H65A 1YDMA 1XKLA 3ROXA 2JDID 4HWGA 1ZVQA 2G40A 1MPXA 4B84A 3CX3A 5TE9A 4DIKA 1NIJA 2FP3A 3ANSA 1J24A 1UBOS 4RMJA 5IH3A 5TARA 4IFBA 3TCNA 1SQ5A 3DD1A 1P9OA 3N2KA 4I9NA 3UWPA 3IFSA 1Q17A 4FC6A 2WVHA 1E9BA 1IU9A 1RJEA 2GAOA 3INYA 3LSYA 2EYUA 1PFVA 4Q7EA 1VTKA 2R751 4RFVA 1E79A 2RDMA 1KI4A 2GEBA 4B3BA 4KYIB 4BN5A 3R0ZA 3F97A 2VLIA 1ORIA 4EG0A 1SVNA 2E4ZA 4FSHA 1JEYB 4X8MA 1P5HA 5IC5A 4N18A 1WUIS 6GPBA 3Q7PA 2N1BA 2G82A 4XUDA 2XQJA 1NLMA 1VL2A 3KEGA 1LQTA 3UGKA 4R0MA 3NANA 1JEOA 1T5DX 2P91A 2EX0A 1JDNA 1G2QA 1LVUA 3DFUA 2OBYA 1XMOB 2B4RO 3T5MA 4YH1A 1R4ZA 1WSBA 2E18A 2DFDA 3D2CA 3V00A 3CW9A 3AR3A 5CLQA 3CE6A 4H6PA 2WD8A 5HXAA 1GGFA 3Q10A 4IQ0A 5KSYA 2HK7A 5DM0A 1B4DA 4BQNA 3SXUA 1QVZA 3OFNA 1U0HC 2Q5FA 4MGZR 4QBKA 1RAEA 2AC2A 5T5QA 1WA5A 4LWQA 3WTBA 5HZMA 4B0PA 5B7GA 1RMYA 2I3GA 1QH8B 2WF5A 4LHVA 4DAEA 4Z4EA 2O8BA 2VNIA 3JY6A 4LF4B 2GOYA 1TGYA 2QDKA 5BUCA 5L3SB 1VC2A 4GOLD 1QOQB 4JIGA 1HT0A 3L1IA 4UUAA 5JAOA 1KFCB 3LQFA 1KAEA 2FZ5A 2QVZX 1TJYA 3PNLA 1K5PA 2ZSBA 3D3JA 2B1QA 2WFLB 2WY2D 1UMCA 1Z56C 2FF5A 1SVIA 4B4DA 1GNLA 4HLDA 4LBZA 1R88A 1VA4A 2FPLA 2V59A 2COUA 2D2XA 2R6R1 1EWQA 2Z08A 3LLVA 3M7IA 4HC4A 5EQJB 5AYVA 2QL9A 4AZTA 1BYUA 4FBLA 2QZSA 1OC2A 4O4JF 4FQ8A 2AC4A 4Q7JB 5CVUA 3WSVA 3V4FA 5JBIA 1WP4A 2DBZA 3PX2A 1HE1C 1N2GA 2EZUA 4U9UA 1F2TB 1KJJA 2EJWA 5EP2A 1ZIOA 1WR8A 1LX7A 3K32A 2PGDA 3DKIA 4B3MB 4XYLA 3SS7X 1QPBA 1ZD2P 4RJIA 1AZSC 2CUTA 4MDYA 1SZDA 2EFEB 1WPQA 1N8KA 2M6RA 1RWQA 5DLDA 4JYBA 3HUEA 5JTUA 2XA9A 2BGRA 2WU4A 3HGMA 1L4GA 4O2AB 3TN7A 1UBRS 4PLTA 4GE3A 4P0QB 2C3PA 3IBCA 1F0NA 1E3IA 1R3UA 4LHZA 4CF3A 4QDUA 5GJBA 3DMYA 5J4VA 4RO0A 1W35A 1TD9A 2AUMA 3A0UA 2XUKA 1HM5A 3SC4A 1Z4MA 2PBRA 3UF0A 3IAEA 2O8FB 4UU1A 3QX3A 3FPEA 1Y5LA 5TVKA 5ILOA 1H5NA 1G4AE 1XRRA 4E0BA 4XYBA 5LQRA 1T8YA 2GPYA 2ODEA 1FFDA 2GZ2A 3H7IA 5LZ7A 3T06B 3WFIA 3NHFA 3WC4A 1H9AA 2QJFA 2Z2IA 2B8JA 4ENTA 3ROMA 4KODA 2XQVA 3LNCA 2RK4A 1EXNA 1GDHA 5CYOA 5EVCA 1HEUA 5TR9A 3SICE 3TR5A 4BNYA 1IWPB 4ZK6A 4ON9A 1QIGA 1X38A 2IW1A 3V8RA 1DPGA 4DG9A 2RGCA 2WU0A 3Q9NA 4H15A 1PL0A 2G9RA 4GYWA 3MF4A 3TBKA 4IHJF 3H4IA 3P9SA 1ND5A 1IY1A 2Z1MA 1XUOA 5K2MA 2CYBA 3RVPA 3T4EA 4LOKA 3TTWA 5I7RA 1O6ZA 4PGAA 1IG3A 2B78A 4YUAA 3D3WA 4MIKA 1HFJA 1TQHA 4MYDA 4PX9A 3KQNA 1VJDA 1NRWA 4MB2A 5K51A 2PUDA 2GBIA 1R8JA 1E3SA 3G79A 3R23A 1YZYA 1IB0A 5FNZA 2ID8A 2R4UA 3ABRB 1J8FA 2DH5A 2NO4A 5FFNA 3SHQA 3MHPA 4FGJA 4NOJA 2DXIA 1UINA 3R8XA 2L17A 1BJTA 2YZNA 4RTNA 5DBHX 2DY1A 3O73A 5BVGB 4IMIB 4KAAA 4I1OA 2PKEA 4PHHA 5DYWA 3WNBA 3X2FA 1C80A 4OPMA 4QUBA 4C0BA 3ZLVA 3HZZA 2H7XA 1P5RA 2JLRA 2VO1A 1VKJA 5DT2A 5DK6A 1YC5A 3D8TA 4I50F 1KI6B 4XGNA 4BBPA 3A37A 3QTLA 1JQJC 3FI0A 5JTTA 5CNJA 4J0FA 1N32B 1V9SA 2EHDA 2B2CA 1YDGA 2G9UA 2QE7A 4X8HA 3K6SA 4FS3A 2NUAA 2QW0X 4GX5A 5KU7A 5BV8A 2R68A 3AEZA 4JLSA 4LGYA 4E14A 4YYEA 3WWDA 1FW8A 5EQDA 3QMVA 1VMDA 1D5WA 3VU9A 4EG6A 2ZSIA 3OD5A 4KR6A 1TXGA 3AERB 3HABA 4Z49A 4A8PA 4CKYA 1PEYA 3FJOA 4PLHA 1IQRA 2D1RA 1HEIA 3UUWA 1OXXK 4BCDA 2ZUFA 5BW5A 3EF0A 1RFGE 3AF3A 3C15C 3I1FA 3R6GA 2H1LA 3ENNA 3UYKA 1WF3A 2HJGA 3WHPA 1WB9A 3DXXA 3GGPA 3FB1A 5KYXB 1TO1E 3GXOA 3B3AA 4JROA 4KI7A 3EG5A 3K71B 1CZNA 3H8WA 2J6HA 1DG1G 1GQYA 1V2HE 4XDZA 3ZDFA 2B61A 4UE3S 3THXA 2DLCX 3NWPA 3PZBA 1LPOA 5F2NA 2JGJA 2BEWA 3VTAA 2CD9A 2Z2YA 3ANYB 4IKPA 3VKWA 3TDKA 4ACAA 1GNPA 2FMUA 1MC1A 1V1MB 3JQAA 3SSOA 3PE4A 2HA0A 2GN2A 4PNHA 4Y98A 3TSCA 4X62B 2Z3VA 1UAAA 1S2NA 5JS2A 3U3RA 3PYMA 1Y34E 2HA6A 2DAPA 2Q4DA 3B5JA 4LDAA 4X90A 1T5TA 2UKDA 3CPHA 1BS9A 4MUNA 5LXTA 5KYTA 3VDNB 3WQRA 2MU1A 3AY7A 3ZLUA 3JAKB 4JQZA 4LYAA 2JK0A 2PGLA 3UK1A 1E1DA 4PR3A 1O57A 2F9FA 3A9SA 3ZQJA 1PDWA 2FQQA 1X9HA 2ZWMA 3QW4B 3COYA 4CT4B 4ER0A 3TLAA 4NCKA 5CGZA 1PWXA 1FY2A 4M87A 1EM8A 2A14A 2HPVA 3G1WA 5JATA 1CR4A 1JJBA 2J5QA 3DDUA 3RVSA 4G1FA 2A5YB 3NIWA 4CI0B 1KNXA 3SQWA 4RELA 1NZDA 1Q92A 1MZPA 2XHEA 4WHMA 2PU5A 1DAFA 2ZI6A 2YWBA 3KOOA 2QYTA 3NBXX 4YRFA 2UU9B 3DLHA 1P62B 1Q14A 1OXSC 1R4MA 1QTQA 4CQMA 5C1DA 4JYMA 1U8AA 5HF8A 1DBVO 3IP5A 3UBMA 4DMUB 3V2UA 5I8WA 1MJFA 1OSNA 3GFRA 3ZWOA 1Y6ZA 5H3LA 1WMEA 3NONA 3VKVA 3W77A 2RB5A 2SECE 4H2DA 3F8WA 4PO3X 4YP9A 2ZIUB 4BMXA 4F2GA 4IH9A 1TUGA 3DDZX 3L0ZA 4HL6A 2VR1A 1AB6A 4V1CB 1TYAE 2XYHA 2GPTA 1PKXA 4O2RA 4YNBA 3HBLA 3WMRA 3C6XA 4Y3UA 4F72A 3E4DA 5FHRA 4I99A 1JSCA 1KYZA 4IDHA 1US8A 2C8KA 3OZBA 4TRNA 1AD2A 2GEUA 4NEGA 2IYOA 4H77A 2P5SA 1N4DA 1QH9A 3KKZA 4JH0A 2O5EA 1DQSA 2ZYGA 3JZIA 3DFFA 3OFJA 2FCAA 5BV0A 3EXHB 1N2HA 3RFTA 2IKQA 3K96A 3DL2A 4R0NA 4AP5A 1PLJA 1ZJWA 1CB0A 5TQ0A 3QV2A 1VMAA 4ZO8A 4Y6PA 4DV0B 2ZSJA 1XXHA 3BXPA 1G2OA 3L40A 2A1TR 2TMKA 3PQCA 4OQXA 1CJUC 1RYNA 1ADFA 3FSGA 4BDTA 2XTMA 1ZC3A 1VL0A 1KMIY 1T9GR 2W2TA 4O4JB 3D4LA 4PIPA 4LECA 4TS3A 5CJ2A 4PICA 3AHIA 5ESRA 5C1IA 5BPHA 4W5QA 2ONCA 3MT7A 1GUBA 3NOVA 4GNRA 1L8AA 1Y48E 2RBEA 4E5SA 3EZ6A 5EQTA 3WWYA 1C7QA 3IVRA 3C8MA 4NBWA 3K70C 2Q3LA 1KQ3A 2OC9A 3GLSA 4DKXA 5CFMA 1H65A 1KBZA 5JV5A 3O8DA 3OQ1A 3BGOS 3BTOA 4OYLA 4KQFA 3NJ4A 2CXTA 3JQ9C 5F5LA 3REOA 1Z2NX 2E3JA 2EP7A 2CF5A 2GN0A 4BS9A 1Q0QA 1BWQA 5CA1F 4JWKA 4WRRA 2N75A 4FHEA 5AICA 4RAOA 2R3SA 4AJ1A 1TTHA 4FS8A 4I55A 3TMKA 1RYEA 2JRCA 1HQKA 1TEHA 3G1UA 4ZAXA 3VPDA 3WL3A 4O2BB 1TK2A 1B0AA 1P4HA 3KZMA 4HN9A 4I5GA 4Q9JA 3N0VA 4DQVA 3ZJ5A 1LBEA 2FH5B 1Q5PA 3FNHA 4UDOA 2C5BA 4X93A 1V5WA 4DIEA 2X22A 4IOKA 1SULA 2JF0A 2NVUA 3DOIA 4AG5A 4QVIA 3QK7A 1ZXBA 5ALDA 3AZPA 4HUJA 2ZATA 1JR3E 4LFCB 3BJEA 4PVDA 2QRGA 2IS6A 1KEEB 1GZ3A 1NJ6A 1J90A 2HSWA 2OHIA 1JH8A 3TGPA 1RYBA 3IUYA 4TL8A 1QMGA 3RS3A 2P9JA 5L53A 2I7TA 2P1ZA 1UJBA 1OLXA 2QX9A 3NWJA 4LJAA 1E6MA 4REOA 2ZPAA 3S2UA 1E1YA 3RSZA 4X00A 3VV2A 1U9JA 4FI3F 5JCZA 3FMFA 3LQ4A 3IVGA 4IHJB 1L7QA 2O8DA 4IIXA 2WK1A 1V11A 3E7PA 3ZK9A 5H7XA 3JWGA 2RHMA 3PPVA 2B36A 4ZICA 5LPNA 5JCOC 4AJLA 3A3OA 4I2NA 4D57A 3QH4A 4MPJA 5IFKA 1BROA 1XAGA 2PSEA 2DFPA 1QO7A 1IZZA 1C9EA 4DF3A 2LV8A 2R2GA 4YT8A 1G8KA 4DA9A 3W5BA 4FNMA 4PEVA 5TMPA 2OZKA 4FKBA 2QYHA 3I6IA 4D8UA 1V1RB 2ZRCA 3NM6B 4XM1A 2UZ4A 1JJIA 1U1FA 1P2BA 3FGZA 4Q3NA 4DC1A 1YK1A 2B4QA 4EUEA 3ERCA 1JYEA 1YQWA 1Z8FA 3ZBTA 4EGCB 6AT1A 3NBMA 1RCFA 4RFLA 1E8DA 4I50B 5HJ2A 3G7UA 1JB9A 3T5AA 2JIMA 1JHDA 3T52A 3KQVA 1ZIYA 3P1JA 4Q4CA 3SYKA 1OBHA 4A2WA 4I6GA 2GZHA 3UWKA 2A9VA 3DT9A 3IUSA 3DE2X 3SS9X 2DEUA 4DIBA 1BMFA 4MAFA 1RD4A 3FTDA 4JXZA 1RLMA 1K3FA 3OH8A 2NVOA 4BU1A 1W8DA 4FEAA 1YF3A 3G2IA 2GCIA 1P9LA 1F20A 3FKQA 2HHLA 1W9MA 1NUPA 4ZODA 3B1KA 3SN6A 2VYFA 4OU4A 1XGKA 4NZPA 4UBJA 2B7BA 4ZMSA 2YW2A 4LSWA 1RQXA 2IDJA 1DOAA 2WJ4A 1PRYA 1VHLA 3E2IA 4POOA 3EUWA 3Q88A 2OZLB 4MV1A 3RTDA 3A1FA 3TIVA 4B7XA 4D44A 5JADA 3C43A 3B48A 3NT4A 4EHJA 1YWGO 4UNSA 4DDVA 1UXOA 2I4OA 2B5VA 2YXEA 3EC2A 3HEMA 4KFUA 1KMMA 4XAQA 4CEIB 3UJHA 3ZGXA 4KBFA 3NPAA 4YREA 4DWOA 2XVAA 1OYWA 2JZNA 1WXHA 4TLBA 2F1KA 2M1ZA 5ENDA 5JMPA 1S01A 2PGAA 1ZRHA 4NHOA 4ZOLF 3CC8A 1BIFA 2QRZA 3F67A 1JHYA 4EECA 1TK3A 3GRAA 3NW9A 3OT5A 4GPEA 1G8GA 1IQPA 2XNSA 4RJJA 4BNKA 2KJQA 1YIAA 2WT4A 4I1YA 3MYYA 4GM4A 1WHTB 1QO0A 2RHCA 3OZEA 3HJAA 4KUHA 5BWCA 2XUDA 1CUCA 1ID1A 1XI2A 1Y7HA 3CZ5A 3QSGA 3M6IA 1JA9A 4C0XA 4BB5A 3I52A 1EVJA 3R09A 4ZRDA 3IL2A 1V8ZA 2G70A 4QTUB 5LQKA 4OYRA 4PAWA 1YB5A 2Y4NA 5HJ5A 4QQRA 5K8CA 1EX1A 1H0HA 3WYFA 1A8QA 2O7SA 1GLVA 1PS8A 1J2EA 4GYYA 2QMUA 4IY1A 4ZGBA 4JT4A 5K3DA 1TT7A 2JAWA 2ZYWX 4BZPA 1XEFA 3FW1A 3ODPA 3RG2A 4XSGA 4YMTA 1P18A 4IINA 3WLMA 4EK9A 3PTAA 2OFPA 2P79A 3KUUA 1VB3A 3SU8A 4TROA 1A98A 1VJTA 2R84A 4ALKA 1WZ2A 3AG5A 2CXRA 4HK4A 3H5OA 1ONSA 3WGOA 4GWLA 4W8OA 4PQRA 5C8YB 4LE2A 1TQ4A 3FPGA 3PT9A 4QUDA 7ABPA 3VMMA 5JYDA 1KVRA 4KLCA 5JZ9A 3K2IA 4KQ2A 1C8VB 3TNFA 1YBVA 1W0JA 1QHHB 4DNFA 4IIBA 3TL6A 2I66A 4NPAA 4F12A 5JAHA 3QX8A 7ADHA 2PPVA 1ZXLA 1J9GA 4WECA 1B6GA 3U5ZB 3BD7A 3QUSA 1N1EA 4H9GA 4EF4A 4HXYA 3FPCA 1P91A 1PJTA 3H9EO 4ENVA 5E4TA 3BMCB 2LDBA 2JGMA 1KMQA 1NRJB 1W5FA 3FNRA 3O2JA 3CNEA 4FZ5A 3WP0A 1MOPA 3LHDA 5F3DA 1UCFA 4LTMA 4YLEA 5CVEA 2NU7B 1KH1A 1U2QA 1YS6A 2ANCA 1EFCA 1U9ZA 4N8SA 4ZVPA 5DM4A 1DXQA 3BCHA 2WAXA 2Q5HA 3K16A 4I4LA 4EJMA 2FN8A 2XOEA 1CDEA 3AT1A 2H2DA 5BQ5A 1W96A 2IYRA 3D43A 5AXDA 3ZJUA 4QGGA 1GXSA 2NZXA 1U2GC 2B37A 3H9UA 5LOVF 3G9ZA 4G24A 2Z4RA 5A62A 4RD2A 5DWDA 3UJ7A 4FOOA 2IOYA 1UEIA 3FVTA 4WCFC 2NSHA 2V6JA 1E6WA 5HA5A 3G89A 3LC7O 4MITA 2E9SA 2J09A 2G9QA 4D9EA 1AE1A 2HF2A 2Z8YM 1VSBA 2NXJA 1SVOA 5CA1B 2C4VA 2R6AA 2XSZA 2C96A 4M0UA 1NUUA 4PZZA 4QSHA 2QMOA 4DLAA 3EPHA 4JXJA 1KKLA 3LA8A 3E9YA 3O83A 2R1VB 5CG2A 1HOXA 4HNQA 1XA0A 5C4GB 4PTZA 5HBRA 2BGKA 3P9PA 4B3CA 2FYTA 3CNBA 2QLFA 5H1YA 2OESA 3DZBA 1KAMA 1VLZA 2ATVA 3LT0A 3R5TA 4B82A 3OPYI 4KKXB 3E53A 2D5AA 1NDUA 3NT5A 4JI6B 1U99A 2Y1WA 2X5OA 4IFTA 4YLYA 5BRAA 3NH6A 2Q50A 3DMNA 4Q9AA 1U0GA 1EWYA 4IDDA 1O94D 2B99A 3GJYA 5EXSA 3PI6A 3I3SR 3KDAA 1K3TA 2GCOA 4CV2A 4BQIA 3P2YA 2IBTA 4HF7A 4WNAB 3FYSA 3LSTA 4L3OA 1I4OA 3CW2A 3DC2A 4LDQA 4M0MA 4NE7A 4BATA 4C04A 1JLLA 5KTPA 1ZCZA 4IGIA 3VNSA 4ERNA 2QMZA 3L41A 4FPXA 1VDZA 3N7TA 4JD5A 4DS3A 5IVKA 1S1MA 5K8IA 2W58A 2XMDA 2YHBA 1DMSA 3QWAA 2DX7A 3P97A 1XK7A 4UAVA 1WSWA 3RB8A 4JJEA 3T5GA 1KMNA 1SD2A 1PGQA 1IEXA 3H13A 2PUEA 1Y6FA 1CR2A 2H2AA 1E66A 3NP7A 1D7OA 3QV1A 1CIVA 3LYUA 2ONJA 4JDPA 5AUQA 3OX4A 4UFNA 1D4FA 4R41A 4X1YB 5I7UA 4DMKA 4LWOA 4RC9A 2I1QA 3UMCA 1BU8A 1GZ4A 4EUNA 1ZWLA 3TL3A 2W00A 4ANFA 3VDMA 3LXMA 4NYMR 2AQ8A 5K0GA 1IQ0A 3FZQA 5F64A 3VNAA 2JIZA 1ES9A 2XHZA 3AYZB 4RKFA 1RPTA 5FTNA 2ZIEA 4IVNA 2Y6VA 4J2HA 4QSMA 3PHJA 3CY6A 3CMMA 1XJCA 3LDAA 3N53A 5HIMA 1Z83A 2CLEB 2GM5A 1T0HB 3ZGVA 5LQDA 1JDTA 3VOBA 4HDKA 1FB5A 3K9NA 4EHAA 1R8YA 3GGOA 3E27A 5B57C 4MRNA 1L7OA 5JU6A 4LZLA 4BRUA 3R9XA 2AL7A 4RF5A 4QECA 2VYQA 5KMGB 2C77A 4LDJA 1OZFA 5EERA 3PHGA 3DLAA 3OC6A 2ZUDA 4DYDA 4H1WA 5A4DA 5DISB 3HWWA 2BGIA 3DXFA 2QJWA 5KYVA 1GYRA 2OAGA 4ZPJA 4B3XA 1BXKA 3HUUA 4NU5A 4WXMA 5D7BA 4J91A 4QHYA 2L69A 1HFEL 3KJQA 1ZM9A 3U4QA 3A4TA 4RVOA 4P9NA 2V1XA 4Q0MA 5KNCH 1AQIA 3OOJA 1WTCA 3KSZO 5AW9A 4EMSA 3ZE6A 4CMGA 2RI0A 3EQ9A 1TECE 4UEWA 4XIIA 5I6DA 2QTMA 4HDRA 3EJ6A 4BFTA 1JAXA 3JQ9A 4Q37A 4WKOA 3A2LA 2YXPX 3EXIA 4TL7A 4UZEA 5K0TA 1NKSA 2FR0A 4XX1A 3ZCUA 1VSTA 2XX3A 5J4LA 3DLPX 4TXJA 3AJAA 1QHGA 4ZOLB 2ZCUA 2GTHA 1LBQA 4FN4A 1KYYA 1SURA 4PHFA 3IUPA 4JLNA 5CB0A 3AP2A 4LXIA 2OCDA 1XDSA 3E7FA 3QYAA 4MPDA 3WBKA 4LN1A 1RMQA 1KL7A 4M1KA 2RHGB 3HCCA 4R3NA 1K08A 1E2QA 1YRHA 2OAP1 2W9XA 4QAJA 4J0IA 2OVFA 2C2XA 5JAZA 4FCWA 4MMYB 13PKA 4WZZA 5ALGA 5AM1A 2B8NA 4IHAA 2VF2A 4PSKA 2IE0A 1FRZA 4HN2A 1A7KA 4YRRA 1XDZA 3PNSA 4TWJA 4M89A 3WNZA 3TTYA 2PPLA 2XCQA 3P9KA 5IAEA 3TRKA 1VJRA 5C18A 1U11A 3Q7EA 2B2NA 3T3PB 3BRCA 2Q46A 1YZQA 3CXRA 4CM7A 4M2LA 3WYCA 4DXHA 1A5SB 3WG9A 3USZA 1UBGA 2PYIA 4PLCA 3UMRA 5JCOA 1GFZA 2FX3A 3C48A 3E3NA 1NXPA 2C9ZA 5E38A 3FCXA 1YA4A 1ULAA 2GPSA 4DE5A 2B0CA 3L92A 4KPUA 1N0WA 2YMLA 3O9VA 1F12A 1A4IA 3RVOA 4OAOA 2OENG 2W6JD 4CMCA 1RI2A 2HWUA 3L7CA 5DTRA 4UMVA 2C42A 5CIQA 1XYGA 3P5BA 4QXAA 2XWSA 5B2EA 5LZ5A 4BP1A 1IY9A 1MEOA 2ACKA 1KKUA 3AHCA 1UEJA 3WRXC 3DXYA 4YJ2F 2X86A 2VDMB 1E6KA 2GYWA 3OBIA 4CMIA 4BP8A 3BTVA 1OQAA 1U1EA 2D13A 5ITZA 2RMKA 3K9GA 3L77A 3SHWA 5B36A 5AESA 5IT4A 5DBFA 3MERA 2M32A 1SXQA 2C61A 2O3QA 4L0DA 1FF9A 4EPVA 1TVEA 3MJVA 1M54A 4GYKA 2H3HA 4XUEA 4B09A 1J39A 4HSEA 2PKQO 3QVGB 4ZU3A 4YQEA 3W6ZA 5LOVB 4IQFA 2FJUA 1NFRA 1DC8A 2Z09A 2EGGA 3KQQA 5F7ZA 3ROGA 4Y6LA 3T1HB 3WGLA 2Z3ZA 1PWYE 2EZ9A 4BBZA 2PLAA 5F3WB 4HWPA 2OV1A 4CCYA 2VQDA 1N8SA 4QUGA 3ZGOA 4ETNA 2H85A 3DZCA 1E1RD 5AOCA 2QUIA 4JVSB 1I6WA 3FFWA 1M2FA 1W88A 5ICFA 3RR2A 4DGSA 1BDIA 1R9MA 4CL2A 4JP3A 1L8OA 3HFJA 1XMXA 4B3DA 1IDOA 1U6KA 2LXNA 2HX1A 3PQ2A 3GA7A 4AZ0A 4R8SA 9GPBA 2CFSA 2OCBA 2Z43A 3A1WA 3O4RA 1AGNA 3W7VA 3GAAA 1E1CB 3WVNA 3TLYA 2E4UA 4CF7A 1UZNA 1ZW1A 2J9GA 2R6DA 5L6LB 4YHHB 1DHRA 4A0QA 2QPLA 3EQ8A 1XMPA 3D0KA 4YAWA 3TLZA 1T2AA 4UXHA 3UPDA 1AN9A 3TRDA 5A9SB 3LX5A 1FC0A 5ALHA 1OWMA 4JI1B 3GI1A 1OF1A 3FFXA 3NKLA 4PGGA 3N05A 4TLAA 2ZB2A 4O8CA 4M22A 4ID9A 2FPIA 3G68A 3HGQA 3LT1A 3PFIA 4KQHA 4L0QA 2HK8A 1P1CA 3P9IA 1KDZA 5EHZA 4NX2A 2UZ1A 2ZG6A 3A27A 3CLKA 5ECDA 1V39A 2ZYUX 2AZMA 3O1HB 5KTRA 3PCTA 5K0NA 1E2DA 1WNTA 4ER5A 4H31A 2ATCA 2PANA 2JGLA 4JR2A 5AKXA 4YAGA 3A6FA 4IKEA 1JDUA 1HG1A 3Q87B 1XZ8A 4LV6A 3ZZ0A 5LD2C 2ZBFA 2GEJA 4IJ5A 1MLDA 3ER6A 4GMHA 4J7UA 2WIAA 3NUZA 5HGXA 4CDGA 3JSXA 3ORYA 4J3FA 1H3NA 2V65A 4YCDA 1P74A 2FPKA 4ENRA 2Y0DA 1N2SA 4AL4A 2ZJOA 3ADKA 4BLTA 4H0NA 2EZ4A 1XLVA 2CUKA 3AM5A 2QRHA 4RCVA 2I6GA 3MCVA 4IMJB 4N5IX 3MMSA 4V2UA 5F5NA 1KEUA 2NUPB 1BRTA 1XTIA 2HQBA 2D59A 2BYTA 4Y6GB 3I9LA 3P0EA 2Z83A 3BCUA 5D00A 4JBXA 4ZQGA 5FWYB 3SNKA 3UHOA 3V97A 3ZHOA 4B75A 4KR7A 4QGHA 3JZMA 4EL5A 1L5GB 4RSMA 4DMLA 1G7TA 4C3OB 3JQPA 2FW6A 4DREA 2IDKA 3L93A 4RIGA 5D5HA 3IB6A 3E05A 4QYIA 4DY6A 5I7EA 4G8BA 2RIRA 5E6SB 3I76A 1XD2B 1PD1A 5FNVB 3FMGA 4L72A 4CL8A 4JLVA 4K3UA 2XW6A 4RTPA 4GE0A 2ZBQA 1UKYA 2XNJA 4Y2PA 1RRCA 1TW2A 1GQOA 1G5PA 1XQ9A 4B76A 1GYQA 1IHXA 2DCUA 1N5OX 4Q7MB 1U2GA 1QVAA 5LQMA 3V1YA 4FFNA 4B7ZA 2FWIA 1WXIA 3CXUA 3GPCA 2OSVA 4LJYA 2HRCA 4ND8B 2IH2A 3NUGA 1M9NA 4MRMB 2H2GA 5KTYA 4B81A 4WCFA 2RKWA 3TMYA 4DJEC 1LQ2A 3V8QA 3IT3A 3PTLA 3QFHA 2W6MA 4KV9A 1OGJA 4L4ZA 1ZOLA 4OQFA 2PRZA 4HAXA 1GGHA 2XA1A 4MDHA 5DBGA 4V1CI 3L6UA 4G9EA 4GT1A 1J8DA 4MYCA 5F2KA 1PZHA 1JTFA 2ZTMA 1KWGA 3U4MA 3DCIA 1DDOA 1UBJS 2WTBA 1XP5A 3N2IA 4IL5A 5AH0A 3PUXA 3R0QA 5JZBA 4XWAA 1UKVY 2XOKD 2W6ZA 5DRTA 1NUHA 3W3ZB 1A7UA 3DHYA 4RM3A 3VR4D 2RGUA 3PG5A 3N2GB 2XTJA 4BJ3A 1MOZA 2XUAA 1PF7E 3GNTA 1T3TA 3AI2A 3GLGB 1QTRA 1TFRA 2VTDA 3DEZA 3IAHA 4A8TA 1BJKA 3BZBA 3AKZA 3CKLA 4I46A 5D1HA 1IG0A 2NUTA 2PKQP 4ZD6A 3M6WA 3JRXA 2XCRB 3AY6A 5JS8A 2WQZA 4ZZ1A 1XPUA 1GT91 2EZTA 5MN5A 3SWWA 3W78A 3RLIA 4D1YA 2BKLA 1WDMA 1A27A 1S8AA 2GJ4A 4TL6A 5BYAA 1WX1A 3K0EA 1B1AA 1T36B 1A9SA 2ECKA 3GCGA 5EPOA 2LD4A 3PGMA 1VIAA 2Y0BA 4BNNA 2F8MA 3WTCA 2CSUA 2OFWA 2I03A 2OHGA 3DBOB 3FUUA 3RS7A 1DZIA 4AYXA 3NMUF 5EIAA 5T64A 1BS1A 5BW8A 3SM9A 5EY5B 3BE5A 4FFWA 1J00A 4QIHA 3PQ4A 2Z5LA 1AF4A 2PT5A 2VPXA 1F7UA 5FXMA 4B3HA 1TCBA 1OC4A 1ZRNA 1DWQA 5H0IA 3WQQA 2PLRA 4C7OB 1MV5A 3JD3A 1K7EB 4X1KB 1WLYA 2WWGA 1MO5A 1V16B 5AVXA 1L0BA 1HMPA 3DBVO 4HTFA 1XTBA 1P75A 3QI7A 2ROQA 2W2NA 4J8PA 3SYTA 1YZ3A 2GNAA 3L2OB 2OK7A 1FW6A 4HQNA 5DBOA 5EXPA 2ATXA 1FUYB 1NDHA 4HH3C 1NJ5A 5KPDA 1JFRA 1AHNA 3ZXYA 4A2CA 3KKQA 4TMZA 1TAHA 3JQRA 2HSZA 4BNDB 4RPHA 2OXIA 2DUMA 1DC5A 2RKOA 4IV5A 3WGNA 5LUAA 3U26A 5CH5A 1JSXA 1JKJA 2QQGA 3F6RA 3V9PA 3ETEA 3IQZA 3N8HA 2A0FA 4B6SA 3VV3A 5BURA 1IXRC 1G8JA 1PNOA 2HTEA 3B89A 4E46A 5JD4A 4DR3B 1A9XB 3ASVA 4PLZA 3I61A 3KQWA 2EDCA 2IVZA 4INPA 3SJ7A 3EY4A 2X1LA 1I8TA 3JVIA 1L7DA 1PIWA 3SZMA 5B6IA 1HL3A 2ZRBA 1EEXB 2LWIA 3IP1A 2EVWX 2NZWA 4MV6A 4WJLA 1KJZA 1NP7A 1YJQA 4MW5A 5BNFA 2H1VA 1CPYA 1ODSA 3SMVA 2AFRA 2GASA 3R9KA 4B31A 3W6PA 3H9BA 1XZNA 3TSYA 3PL5A 3QQ5A 4FLEA 1XTJA 4REMA 2O8VA 5MN6A 3TS1A 4LZAA 2G1KA 3IEUA 1X1QA 2A84A 2I1LA 1DJOA 2ZVQX 4MCHA 5DGHA 4BGEA 3EVBA 5J1SB 1EDZA 3DFMA 4PCUA 1P19A 2WJWA 2V5UA 4KEAA 1Q0UA 4FVTA 1LLCA 3NKFA 4QRIA 2DWQA 3BH6A 1WWKA 2GZDA 2XBUA 1I7DA 1TPZA 1AXRA 4A27A 1I10A 2WBLC 3OY7A 4NCJA 2UUPA 4N41A 3NNDA 2RG7A 1V25A 1UP4A 2Y1LA 4RHCA 2CVQA 4CTJA 3BXGA 3F90A 3RTCA 1IRXA 1WHSB 4MQBA 4BO5A 3DEFA 4JFRA 3MUNA 1AGRA 1L8XA 3KIPA 5KX5F 3EGCA 2OPHA 3OTWA 4Q00A 3ZE1B 1W4BA 3IPLA 2Z1NA 1E5TA 1L6RA 3OOSA 1K88A 4IDOA 4BEBA 2FK8A 1OY1A 3PXUA 3F74A 5ITVA 2ZIXB 3JASB 2FQ1A 2C7QA 2XR1A 3QFRA 2FP4B 3GUHA 2HIGA 1PFYA 3IEKA 1CJVC 1JB1A 3LVQE 5ENVA 3O8CA 2H06A 3INRA 2OFFA 4PYMA 4ZCTA 1SXPA 4M9XA 1F8XA 2R7LA 5JXWA 4GOOD 3QBJA 4BZZA 5MDHA 3VR5A 3ZLJA 4UM5A 3UXHA 3MGGA 1EEHA 4EPXA 5SZKB 4NI5A 5L40A 1WG8A 5FTKA 2EG9A 3PXCX 2VJBA 2O2ZA 5AI5A 5HTKA 4MWTA 4LGCA 1MQAA 3IC5A 3I9V6 3W9YA 3WRXA 1NBHA 4B4VA 1LWOA 4D46A 1YJ8A 4OA8A 4D9GA 2RHRA 1WD7A 4FMBB 4XOUA 3EISA 1K06A 3S2FA 2BTQB 2G67A 5F2EA 1G7CA 1PX0A 2OGTA 4BTVA 1BDBA 4TWIA 3UJBA 1S9HA 1JEEA 4MUBA 4MQFA 4MS4A 3WLPA 4RJTA 5EEHA 1S3FA 1WB5A 1YZLA 1Z4LA 2FPWA 5JR3A 1GNRA 2IDZA 5HKKD 3TD2A 3HCOA 1KQPA 2BFEA 3A1NA 5ESDA 4FD3A 1YMUA 5TGTA 3WQSB 4D4GA 3OMXA 5GOZA 4AC9A 2E87A 3O26A 5L7TA 1YOBA 2VQSA 2JGEA 2OKGA 4OHCA 4IUBS 5AK4A 4BV2A 1H0SA 2HLDA 2C9DA 3ETNA 3V55A 1QS0B 4U2CA 4MRSA 1ONBA 3LCJA 3S7ZA 2QW1A 3BSYA 2R7MA 1RWKA 3BEDA 4EG1A 5E2AA 3ELBA 4LMBA 5ADUS 4KO8A 1NI5A 4FDUA 1NYQA 3DGFC 1KARA 4L1KA 5GP1A 3VPGA 5I9NA 2W98A 3RBZA 4PZPA 2I9PA 3GQVA 4XQEA 4OHYA 1FU8A 2C03A 1KXJA 3IVXA 1XMQB 5EP4A 3GUYA 2VP2A 3HJRA 2XNHA 4JYAB 4KSBA 1IVNA 2JVKA 4R81A 1D2MA 1U0TA 4BJ5A 4XH9B 3VR2D 3ZDCA 3B7GA 3D8BA 1MZVA 3EULA 2LVBA 4YAFA 4PFJA 1DL5A 3S8MA 4HFMA 4MW9A 1Z4JA 1U9IC 1JSRA 4M86A 2ST1A 1U5AA 3EOBI 4R2JA 3WFJA 4BLVA 4CM3A 4FCCA 2BEUA 3CCBA 3TTUA 2DQZA 1DP4A 1PLKA 1XU7A 3GFBA 1A9OA 3RTEA 1XLUA 1NBWB 1X7XA 1XZHA 5AKKA 3DOCA 5IHXA 1CE8A 4HEA1 4XARA 2BFFA 3BXEA 3V2HA 5FULA 2CNOA 2EIHA 1KI1A 1M5UA 2PAFA 2C8VA 4OFZA 1A0OA 3QVVA 4K0RA 3OCYA 4JI8B 2CB0A 4GHWA 1R6XA 4RMIA 3DF9A 4BFWA 3QY0A 2YN2A 1RRMA 4M54A 5A1JA 1QIMA 5LZ8A 2ZQZA 3PEUA 3R0IA 2Y67A 2CLLB 1F8YA 3ICCA 3GJRA 2OOSA 3LTEA 1ZKDA 3CTMA 1JDBB 4TLDA 2R0QC 1N0IA 2QVXX 1QE3A 5ICMA 3H9CA 2O2SA 2JBAA 2G25A 1T4GA 3D7LA 4CETA 2Q6OA 4MAMA 4MVWA 1HGXA 3TLEA 3E5MA 2D1TA 4GO1A 5IBPA 3T8YA 4Q21A 3VH3A 4B8WA 2DR2A 4GX1A 3LT2A 1P33A 2QF7A 2YCBA 3B78A 1AMUA 4FR2A 3THWA 3C4VA 3DE1X 1QYXA 2F64A 1PUJA 2C5LA 1VYTA 1M1UA 4HHEA 4N3BA 3HXMA 3KZXA 2XTNA 4LC1A 4RMHA 4ECAA 1HYHA 2H1IA 2WSMA 3H1FA 4QO8A 4RZUA 3CPJB 3FHTA 1PT9A 5DHUA 5BNWA 3HWSA 2RGXA 3FWZA 2VPTA 2X2EA 1N6KA 2PMCA 4RZXA 1YONA 3TAHA 1NXVA 3MFQA 3HV0A 3B51X 4URYR 2GM4A 1S02A 4P81A 3EVNA 2VRWA 1EFRA 1ZLXA 3GLKA 5EUCA 2AMLA 4RJLA 3SIPA 3RYIA 2Q9UA 1ZMTA 2CV1A 2H7YA 1KYTA 3R6DA 4YHBA 3L0BA 4BQQA 3CLRD 5FOUA 4HX2A 1Z62A 4Q6BA 1Q7BA 5EKXA 1SPXA 2I4NA 5DT9A 4CRWB 4MROA 1JTVA 2C1ZA 4BLSA 3FSRA 4DJDC 4AIIA 4N47A 2G1UA 3K0AA 1V4VA 3PU6A 1GG5A 3WGJA 4J7AA 3ZHVA 4RTQA 4UDNA 1KOJA 2F43A 5BR4A 1K5HA 1NR7A 1SOMA 5B7NA 3OZRA 3AR8A 3NAMA 1IBRA 1K75A 1ZNZA 2C82A 4Q1EA 4LXUA 4PRZA 4UBIA 4Y7DA 1DNPA 2PIDA 4KN5A 1SM4A 2W2LD 3ZWKA 3NWBA 4KPFC 2IXTA 5IKMA 3QEBZ 1T4DA 3M34A 1G64A 4EHFA 1JJFA 1WVIA 5JSKA 2ZJZA 5I3ZA 2OV6A 3OF3A 1KSFX 1ZK0A 4HWKA 4HZIA 5AI0A 2C3UA 5EJIA 2ZFUA 2UYCA 3G2JA 3UXYA 1I2MA 2ZAMA 3BXHA 4WZAE 4EW1A 5EHQA 5BV2P 2A2ZA 3TKLA 3GLFA 1M5RA 1XZMA 5EUMA 1VHTA 1FFCA 3E4CA 3P0IA 1U3UA 5I4CA 2Z6UA 3FFBA 3WY9A 4P7FA 4DUGA 3BFPA 2Q8NA 1BEUB 1M6EX 1LPPA 3DBLB 5DXAA 2J5KA 2Y9PB 3G9XA 4HB4A 2J6CA 1KBOA 5KX5B 4PU0A 2ZP1A 1P1BA 3ZH9B 2Q3DA 1VGRA 1Z4KA 5U1PA 3TVTA 5F1YA 1JIXA 2HI0A 4XSVA 1YU9A 1FXWF 3BJRA 5CAEB 4R71A 3GVPA 1ZD8A 2F67A 1CHNA 1A8IA 5EMKA 2NACA 4PSUA 4RZQA 1K9SA 2N47A 2XITA 5CW2A 5FX2A 2XZOA 3VZQA 5C2JB 4N0DA 2AXPA 3UMYA 1JKFA 5J3JA 3HRKA 2B35A 4FP9A 4NV1A 4HS4A 4DSNA 2FW1A 2EKDA 4PBRA 3UCFA 2GFIA 5AK0A 3O9ZA 5ALMA 4OMCA 4CG0A 2DG2A 4LOHA 3U62A 1Q21A 1E9CA 4FOLA 5K3FB 2MSEB 1JN0A 3KJZA 2RK6A 3H4MA 2QWXA 3JQ6A 3PFWO 1JNXX 3OAAA 1I4LD 3IDFA 3PUJA 5HHTA 4CIYA 3AC0A 3BXFA 3FDIA 4RDCA 1PW5A 4L28A 1N2CB 1ZUHA 4TV9A 2IHNA 3QXHA 5BNZA 1OU0A 3FJ1A 4NQRA 2CCGA 3QGMA 5JC8A 3AL3A 4GH5A 2ZRFA 4F7DA 4CCWA 2O8CB 2SKCA 1GLNA 2WAMA 4DG5A 2X0JA 5G0TA 3KCNA 4F2WA 3ABQB 3ZHXA 1IOWA 1JLKA 4DA6A 1W29A 3OZ7A 1YB2A 2IYXA 5AOBA 3C24A 4QM6A 1BMQA 1FRNA 4MVJI 1FTGA 1SHTX 3DV9A 3CB2A 3Q9LA 2EQ5A 4CR7A 1TI7A 2IY9A 1GOTA 3LNTA 1ZY2A 3QF4A 3SR4A 4EPRA 3EA4A 2X1VA 1YXMA 3LZCA 3OM1A 4NZYA 4Q9HA 1H8EA 4IIJA 2O2JA 1UFKA 2JAUA 2Z0MA 3WK4A 1MO6A 4YUZA 1IUKA 2VNKA 1OIVA 3INTA 3FTPA 2AF4C 1Q16A 4RIHA 2VQEB 1NF3A 3H42B 1SIBE 2CFTA 4EVRA 1QYRA 1RQNA 3C6MA 3L01A 2OAQ1 3DTVB 4D4IA 4WK2B 1X42A 3WWOA 3OURA 4GUDA 4C0WA 1IZYA 2CNNA 2V6BA 4GZLA 3EZLA 1FSPA 1QH1B 1SXIA 4MVXA 4PAOA 2TMGA 5E7QA 3V2GA 2PWZA 4A0FA 4Q4HA 4BMSA 2YVAA 2ZJ4A 4ZO9A 2B1IA 3SC6A 1RAAA 1J06A 2XE8A 4UCFA 2CHVA 1JAIA 3IBSA 5CIWA 3I09A 4BRZA 3BMOA 1N6HA 4O4HA 1N7HA 3OE4A 4RMGA 2P9TA 5FUBA 2XCLA 2C5HA 1QGOA 2FN3A 2HEGA 1D0SA 4PONA 4ZRNA 4HLNA 1A9PA 2ZUBA 2NO9A 1MEEA 5SZHB 2MYNA 2DBRA 3QP9A 4A6EA 1HNXB 2D0OB 5TT1A 3BDVA 2Z98A 4BVLA 4W5WA 2GT1A 4KO1S 3DPIA 1RYZA 3MGBA 4LQDA 4NMWA 2BOVA 3M3HA 4NZOA 2QAJA 5GOTA 1JE0A 1WAMA 3GLTA 3BPSA 2WJHA 2VP9A 1QWSA 3ZNOA 2EBFX 1M2HA 4PYLA 2Q6VA 3WP1B 4D56A 5H3HA 1YULA 3LKZA 2BFCB 3P2MA 4FFDA 1PN3A 4AF7A 5JYCA 5AVWA 1RYHA 1TQ8A 3RYHA 4M38A 1E1MA 1CUXA 4WJZA 5EJFA 1AKNA 2GAIA 4KYUA 1A9QA 1E0JA 1GILA 3A1EA 2GN9A 3IIKA 3OWXA 3KDSE 4NHEA 2XTZA 2ZSAA 1GZ7A 1OKKA 1WE2A 2JJQA 2LCFA 2VAXA 2CLMB 1YVDA 2CD7A 3OI7A 1UP7A 4QJBA 2CCJA 1U7XA 4GM0A 1MQ8B 4IDPA 4JLAA 4QFCA 4EQ6B 3FRIA 4UXIA 3FYUB 4FFSA 4KAXA 5BSHA 2R5FA 2FPGA 3PYXA 4XTRA 1VPVA 2W2MA 5KKCA 4EGQA 2YJ5A 4OI1A 3SJAA 4ZIRB 4P33A 1NVKA 2JGFA 3DH0A 3I2YX 4JGGA 2Q5IA 3CSSA 3FKSA 2ORED 3IP7A 1ISFA 2Q3FA 2QQ5A 4HB3A 2N42A 5IJXA 3UO8B 3U3XA 5C8VA 2ET6A 3ACCA 2IYQA 3VSDA 4U2BA 5AW5A 1F4VA 2OXEA 2UXBB 1M2OA 3ZJ4A 5ED0A 3IGFA 6LDHA 1VE7A 1FZTA 1MD9A 3KO8A 1Y4ZA 1NSFA 4NESA 2CK3A 1P9WA 1W2HA 2AXEA 2CBZA 4YP5A 1UBMS 2OCIA 4BV3A 2JZOA 1KEKA 1DXHA 1M8FA 3PNVA 3HSSA 3OE7D 3WE7A 5A04A 1BHQ1 2O2DA 2GKGA 1SCNE 3N28A 4DIFA 1E6UA 5E6RA 2C4NA 3R41A 4L0MA 4NE9A 2FVXA 3G2MA 4OEHA 3UOWA 4RTJA 2JGDB 1G4HA 1XJQA 1Y1PA 2QTVA 3M82A 3UFXA 2ANBA 4I6EA 2QRNA 4NYIR 4AURA 1B14A 2W6PA 3HCAA 2V97A 4O1MA 3CTPA 4F6RB 3GP3A 3NP9A 4FYHA 1MVOA 1X13A 1E20A 2HFKA 1FDTA 2P0EA 3R2JA 1SEVA 1M6HA 4Y2XA 2EU8A 2PQ0A 2VRCD 1B26A 3K30A 3IIMA 2GVNA 3K0FB 3X1YA 1CWUA 4QYTA 1T0BA 4PC2A 2YC4C 5EHXA 2W4IA 4G86A 1ENOA 1S2IA 1Y4SA 5CT9A 5HUJA 3WJ1A 4OK6A 4UATA 4EF5A 1Y3HA 4BKUA 2VCEA 1NURA 2Q1YA 1AVTA 3WLHA 1B2LA 2JC3A 2QTGA 3TF5A 2WJVA 1I7LA 1U9IA 2G0TA 5JROA 4UREA 5CBPB 2XGGA 3LO8A 4CQMD 3NYQA 4W9NC 5D5PA 4Z3KA 4K9PA 3R74A 1ZEJA 2Z2KA 3CNOA 2D4HA 2J5XA 3T41A 3EXG1 1QB8A 2XCUA 4G2NA 1PNTA 4LSMA 1UL1X 2ADMA 3IKTA 3OPQA 1ZL2A 4DLNA 3RIXA 3IHKA 2XV1A 4HGYA 2Q0XA 4L57A 4CKBB 4Z9BA 1XTVA 4QEDA 4ZRMA 1XU9A 2AMYA 1A1SA 2RONA 4DLYA 2O59A 1P7ZA 2O57A 3CLTD 4H18A 4LV8B 3OA0A 3FUWA 5JJBA 2V7PA 2RGGA 3A8TA 3ILXA 1X3SA 1SG6A 2D0IA 3ZWBA 1CQJA 4WVLA 1RU3A 2WAOA 3W2FA 5BV1A 4R3UC 1MMFB 1BG6A 1PGJA 3IHTA 3AY0A 1ETUA 2EJTA 3AP3A 3F3MA 3MMZA 5DU2A 4EENA 3ZDXB 1XRSB 5K9ZA 1C4OA 3H18A 3VHLB 4WL0A 1YL5A 2V03A 3QEMA 1FDSA 4CLHA 4CLOA 1Z68A 1Q0HA 3FDZB 2HO5A 4YT2A 2VEDA 4WZ6A 1KZ6A 4BTLA 3GEIA 2FQXA 1MABB 3LOPA 1FVFA 3IMCA 3P8ZA 1IUOA 1NV8A 2FB9A 5ALJA 5AVOA 2HKIA 2E0IA 4NU0A 2ZM5A 4JI7B 3FCOA 3GOQA 3M6XA 4FJ0A 2HUNA 1DBSA 3YASA 5IASA 3F78A 1WKVA 3VAZA 3ZWMA 1JBQA 5C8XA 1PEAA 5TPWB 4YCBA 2PQ2A 1WQ3A 3QTTA 2BFDA 1OXUA 3TW8A 3DEKA 4O5AA 3OA2A 2XMPA 3VVCA 4C3VA 1R12A 3CFYA 4DHWA 5K0FA 5BXYA 4HNAB 2IUUA 1XDUA 2ZRGA 5DYIA 2C2OA 3WDKA 3C3JA 4CZ2A 5TPZA 2ONYA 2I91A 1Y6QA 3ZR4B 1ABEA 2DR3A 2HHJA 4BO0A 3IPRA 4BFLA 1O8BA 3KOZA 3EIFA 5LMNB 4R1QA 5HTOA 4Z5XA 1TJ5A 1ZIPA 5CDYA 5ITSA 5G02A 4N5HX 1LGYA 4RV4A 2FSSA 2ZBUA 1T2NA 3O4JA 2VZ0A 1WZEA 1X7ZA 1WNFA 2L82A 4N0EA 4FUQA 1U9CA 1HYBA 1KP9A 3B13B 3ZX5A 5I8PA 3H5TA 4LRYA 4TT3A 2PT7A 5D01A 1YIOA 4I9UA 2H2WA 3LVBA 5FPHA 4JIMA 2FDRA 5EXEA 4D0LB 5H4GA 4CKWA 2MINA 4C4TA 4KNWA 5ESXA 1IHOA 1YBMA 4L7QA 4GSYA 3A6EA 4FOTA 4EJFA 2I4MA 3ND8A 3NI2A 3QPVA 3AQ4A 5KCZA 2Z56A 5EIWA 4YXFA 3NBAA 4HR7A 4AMGA 3T3OA 1LDMA 1QYCA 2OB2A 4P34A 4BVBA 3G2PA 4Q16A 2ZWVA 4KPGA 3MC1A 3SBXA 5HJ7A 3Q8LA 4MB6A 4AROA 2VF7A 1IVSA 5HF5A 1I7SB 2I71A 3PP8A 4EG7A 2H4WA 1U2RA 3ENWA 4O33A 1IM2A 1QC5A 1S7GA 2Q7OE 3O84A 5JQGF 4TTRA 1WXFA 1O4VA 2QD1A 2QM8A 3D6JA 3FZGA 1PFWA 4PAGA 3L7MA 2W6CX 5FRDA 1U6JA 3KXIA 4C7KA 2JHGA 4U2EA 1N5MA 2O3SA 3FRHA 3CS3A 4NJEA 1NYTA 3SZUA 1B15A 5J2TB 3QPWA 3ZLTA 1H1DA 5DTMA 1Q1ZA 1DWPA 3KLOA 3DBRA 4Q3BA 1JDSA 2GI4A 5E1BA 4KMSA 1UFVA 3C5CA 3KV3O 2E49A 4OLAA 3HDHA 2P1RA 3LGSA 4PZUA 4MW1A 1A04A 2ODQA 2EP5A 1DEKA 1SCQA 3L7BA 4PPGA 2GRAA 2RGWA 3G2LA 3O3OB 4W7IA 2BZSA 4OAPA 1QDEA 3ETLA 1ZMBA 5F77A 4E1VA 1S3IA 5DFAA 5F9FA 3HO6A 1L7NA 2C9YA 1YDHA 1Z0IA