5IXYA

Lactate dehydrogenase in complex with hydroxylactam inhibitor compound 31: (2~{s})-5-(2-chlorophenyl)sulfanyl-2-(4-morpholin-4-ylphenyl)-4-oxidanyl-2-thiophen-3-yl-1,3-dihydropyridin-6-one
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Cell Active Hydroxylactam Inhibitors of Human Lactate Dehydrogenase with Oral Bioavailability in Mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxireductase/oxireductase inhibitor
total genus 117
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5ixyA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5ixyA02
3KVOA 1E77A 2IODA 3PWSA 4J1TA 3CMCO 1NQ5A 3WGHA 3BYZA 2OMEA 4DPLA 5TQVA 3IDSA 3S1LA 1WZIA 2GO1A 2P5YA 3PK0A 2RHCA 2C2XA 1LLCA 3WXBA 1U8XX 2DAPA 4R3NA 2OUIA 1E7QA 2I9PA 1IPEA 1Q0LA 3U4CA 3AUTA 2NU9A 2YYYA 1E7WA 1DIHA 4FIZA 1OAAA 1IZ0A 3DDNA 1QYXA 3DBRB 3NJ8A 4M86A 1EBFA 2JD0A 4U7WA 3PQFA 3AUSA 2BGLA 3DR3A 2WMDA 2C7GA 3MJTA 4AFNA 3LVFO 4UAGA 4YJGA 4WOKA 3GZNA 4KQWA 3ENKA 4NH4A 2RHRA 5KJCA 3VKVA 3UF0A 3Q6IA 4AJEA 4XDZA 3JQBC 3RC9A 2WJPA 2HMVA 3EVTA 1DLJA 3GDFA 4UVGA 3E48A 4FOOA 5H82A 4B79A 4JXKA 2VHZA 2JCYA 5DDIP 1XDWA 4URFA 3GEDA 1KY4A 3EZYA 3JCZA 4YDRA 2E82A 1ZK0A 5I7FA 1U3WA 3JQ8B 4UVDA 2CF5A 4PCVA 4NIMA 4CPDA 4CV1A 4RVGA 1HEUA 2ZCVA 1BGVA 5BSHA 3TZKA 4BNNA 5ICMA 1OC4A 4HADA 3TFOA 1X15A 4HP8A 2JHFA 4IGEA 3FN4A 2NLOA 3MTGA 5DP1A 5HBRA 3GR6A 3E5MA 3RVDA 4KP7A 4IXWA 5I7EA 3PJDA 2GDZA 1KEWA 2XOXA 3WJAA 1QRRA 3GNTA 1PZEA 4OL9A 2R2GA 3P2OA 1E92A 4RF4A 4YVFA 5KJFA 2ZB4A 4YJDA 3DFUA 4HNHA 4DBZA 3TNLA 4D3FA 1NNUA 1VJ1A 1D8AA 3DONA 1L7EA 3MJVA 3WWYA 1DXYA 3IJRA 2J3IA 3U4IA 1U7TA 3LLSA 5MGBA 2P2SA 1J5PA 3AW9A 3ZW9A 2G76A 3AI2A 1HZZA 1LLUA 3KLPX 1UJMA 1R15A 2YV1A 3PIDA 4HXYA 4JJFA 2BF7A 1YONA 3FSRA 2FZWA 3COSA 3HDQA 3QSGA 2O7SA 1HLPA 4CQLB 4RPHA 2YHIA 1XCBA 3MJSA 1VJTA 3BMQB 4K26A 1I30A 4IJUA 3NAQA 2PKQP 1G0OA 2VUUA 2NVUA 5T5QA 3TPCA 4AJJA 5C5IA 3NDJA 2AE1A 4OH1A 2Y67A 1C0PA 2A4KA 2X9NA 1E1LA 1HE3A 1UP6A 1WDLA 3WQRA 3RAJA 3V1UA 1B8UA 4DYDA 2VQ3A 4TZKA 4MP8A 1LC0A 4MVJE 4GMFA 1BW9A 1ISJA 3WYCA 4AJ2A 3ZGYA 4K9DA 1T2CA 2VZ0A 4BV9A 3WIDA 1NQTA 1N1EA 3IUPA 2WYWA 5JMPA 5L3ZA 4AJNA 1JVBA 5AOVA 3GNQA 1H9AA 3ENNA 2H5LA 5G4KA 4CM8B 2I3AA 3NTRA 4R9RA 3LSYA 2NU8A 4CMEA 4B4VA 4BS9A 1NR1A 1PJCA 4MVJG 3PLNA 1HYEA 2X0RA 2E37A 4WE3A 1NAHA 1RYDA 3GUYA 2AMFA 4O6VA 1K6JA 2ZTUA 5JYEA 1EE9A 1Z82A 4Y6RA 5ADHA 3UXYA 4Y8VA 5GZ3A 2I99A 3F3SA 2ZQZA 4BMSA 1PJQA 1X1EA 1GZ3A 4E30A 1XU7A 3WB9A 3ONDA 4RVSA 1P33A 1WW8A 3H5AA 5JDCC 1KVRA 3H2ZA 4BMVA 3A28A 1A4UA 1C1DA 1EE2A 1SB8A 3ULKA 1QLJA 4BUCA 3GC6A 2O3UA 3H9GA 1MXFA 3ORFA 3JD1A 4GSKA 2GCGA 4INAA 4WLNA 5CPFA 4KWHA 4BNKA 1TT5A 3CZRA 4Y9DA 4YJFA 2CFCA 5CDTA 4LISA 3OETA 4J3FA 2GD1O 1HKUA 3KSDO 4MP3A 2OP1A 2J5RA 3GPDG 5IDXA 3KHUA 5A9SB 4K6FA 5B4TA 5DULA 1UDAA 3LF1A 3KOUA 1O89A 3BTVA 4U0JA 1HDOA 1SNYA 1VM6A 3IMFA 4BNTA 4O63O 4BNYA 1PGOA 2CY0A 2Q49A 1O0SA 3T7CA 4BO1A 1RM0A 3O03A 3MJCA 4BB6A 4BO4A 1EK6A 3ZNOA 1CRWG 4WNCA 4ROSA 1I8TA 1EFKA 4AJ4A 5G2OA 3AU9A 1XELA 4UVEA 4R1TA 4XB2A 4FQ8A 4ZQEA 4BO7A 5BNTA 4E5PA 3WGIA 3PDJA 4NJMB 4I1IA 1GDHA 5TSDA 4ZJUA 4FOSA 1E3SA 1ZFNA 3DBVO 3ZWWA 5C7OO 3QV1A 5JAZA 3NRCA 1SOVA 3HFGA 4CQMA 5EERA 2YDYA 2YHUA 1E3LA 3A14A 1S7CA 2G5CA 4I08A 2TMDA 1SBYA 4TRRA 2WD7A 1P31A 3PZBA 4B4UA 1O94A 4GPD1 1W6UA 4BNXA 3HN7A 3PHJA 4NU6A 4GX1A 1SZJG 3OM9A 2OBYA 5I9MA 3EUWA 2HK8A 3I5MA 2GYYA 5DCWA 4AJKA 1T4BA 3AM3A 5JYDA 2PH5A 2PZMA 1MB4A 3OMLA 1PWZA 5DOZA 4DPKA 1E6UA 3ETEA 1I5RA 3CTMA 3JQAB 2X1HA 5L40A 1VC2A 4RLSA 4Q9NA 4YPOA 2VUSA 1DHRA 3GMDA 3GPIA 3EAGA 1N7HA 5EL0A 2WSBA 1JLLA 1XKQA 2HQ1A 3OP4A 5FI3A 2C20A 2WE8A 2HMSA 1UH5A 4YR9A 1HE4A 3WWZA 1QORA 3B6ZA 3PWKA 4Y6PA 3HB4X 4YBZA 4BO8A 4CM8A 1SO8A 3GMSA 1W73A 4IZIA 4TVBA 4LSWA 3EDMA 5U9CA 4EEZA 5G0UA 1DRUA 5ILOA 1SB9A 3UICA 7ADHA 5JY1A 2D59A 3C7AA 1A9YA 3GF4A 4FD3A 1D1TA 4D43A 3VZQA 2GASA 3KYDB 3ZV4A 1F06A 3CE6A 2X5OA 3UCEA 3TZQA 4DRYA 3DXFA 4IJWA 3KBOA 4RDIA 2ZJ0A 5FYDA 3GVIA 1ID1A 3F5QA 5IAAA 4ESOA 1LLQA 3JQFA 4CL8A 1VKNA 1U3VA 1WVGA 1ZK3A 4NFHA 3OIGA 4RPJA 1XYGA 1H6CA 3LDHA 2FSSA 2ILTA 1BHSA 4CL3A 1FDSA 8LDHA 1NVTA 4Y6SA 3ETDA 1FK8A 1R4MA 1RM5A 1T2AA 4YYZA 1YB1A 2CMDA 1XG5A 2IZZA 1NM5A 3L6DA 1ENYA 2XPCA 5A9SA 4M87A 3HQ4O 1QMGA 4RVHA 4BKUA 3DZHA 3ICCA 3WGYA 3KM0A 2HU2A 2Z95A 4QX6A 3A06A 1RJWA 3D4NA 4A0SA 4DQVA 2G17A 2BFPA 1LUAA 1I10A 2I6TA 2DVMA 4GWGA 3DHYA 3QW2A 3ZV5A 3E6AA 4ZQGA 4RDHA 1DFHA 2W2KB 1CQIA 4PLPA 3C7CB 4XYEA 4Z9YA 1VPDA 3KYBA 4XIYA 3VTFA 4LK3A 3X2EA 1PGQA 2GN8A 3HDYA 4GKVA 3JQAD 3OSUA 1P9LA 1FF9A 2ZKLA 4QFCA 4BO9A 4OGWA 3WLEA 3DOCA 2OHXA 1NPYA 5JAQA 4JN6B 2DBVO 1BWSA 3H4VA 4R51A 1G1AA 2NQ8A 1MGOA 3F6YA 1B2LA 4XA8A 5T64A 3DZFA 2OP0A 5DBFA 2AG5A 3EGOA 2QZ9A 1KVSA 3G0OA 4RORA 4D42A 1BG6A 2IEBA 4BNGA 3L9WA 5HM8A 1UDBA 4NBRA 3K5PA 5I8WA 1KBZA 3OQ1A 3Q2IA 1PJBA 3DBHA 3DOJA 3HADA 3ASVA 1ZSYA 1LSUA 2A9FA 1YGYA 1NWCA 3VZRA 5HTOA 1FDTA 3E18A 1F14A 4MVJD 3G17A 3WMXA 3Q1LA 1GV1A 1N9GB 3OHSX 1EVIA 3WGGA 1I24A 5L7YA 4DC1A 5G0WA 3ZI0A 2TMGA 4XRGA 6LDHA 1KYQA 1EUCA 1YL7A 3W8EA 4U0KA 4CMJA 1EVYA 3OH8A 2JJYA 3BTUA 3A4VA 2D1YA 2FY8A 1UP4A 1T4DA 3SJUA 3L07A 4ZQHA 1LDBA 1SMKA 1XHLA 2GZ3A 2PNFA 3I9NA 3QVOA 1PZHA 3PQDA 1HDGO 1BXZA 4YRBA 4RPKA 1DC3A 3M1AA 1RYEA 2I76A 2Q45A 4QTZA 3GUCA 2Q4BA 2GN9A 4Z3DA 4I9HA 4I5GA 4CM4B 3AM4A 5KTKA 1F12A 3TN7A 1RM4A 5JAMA 1RPNA 1DRWA 4WCFB 1IY8A 2OFPA 2HK7A 1D4FA 1LSOA 3WBBA 1B8VA 1MXHA 3ZWCA 1IB6A 3CXRA 1ENOA 3ANNA 1I3LA 1M2WA 3E9NA 3V1YA 1LJ8A 4UEKA 4WLVA 5TX7A 1XWFA 3K6JA 4B7XA 2GSDA 1N2SA 2O23A 3DMTC 4DWVA 3LYLA 5T57A 2AE2A 1G6KA 3ANMA 2AEMA 3QVTA 2QRLA 4DC0A 4CR6A 4H15A 3ZN2A 1LC3A 1K5HA 2QW8A 2WYUA 4II2A 4N5NA 3CINA 1W8DA 4OQZA 1CF2O 3U9LA 5A5FA 1EUDA 3F4BA 4GAEA 5FWNA 5DBGA 1O95A 4CR8A 5CEFA 1PTJA 1UXJA 1HETA 1T2DA 2GF2A 1ZSVA 3AOEC 2RAFA 2B5WA 4CMBA 2AG8A 5L51A 3DC2A 4S3MA 3ZNQA 1DLIA 4Z0TA 1PX0A 2YW9A 3P5SA 3TZHA 3VC7A 5GZ1A 4B4WA 2DU8A 4Q3BA 4TQGA 5KVVA 1P45A 4CV2A 1LXCA 2O3JA 4BNIA 5CDGA 2Y99A 1ADGA 4D41A 3ZHXA 2G0TA 4FCCA 3H8VA 5CDUA 4BNJA 4EW6A 1DAOA 1EQ2A 2C2YA 3JD3A 5CG1A 4UEJA 1KERA 1T1SA 2SCUA 4WLFA 3S2EA 4Q3AA 3X2FA 4AJIA 3GDGA 4BO6A 3GZNB 3W4KA 2Q3EA 4KMSA 2ZK7A 3C1OA 1DOHA 4LRTB 3ZWAA 5BR7A 1M6WA 2FMUA 3RUDA 1KVTA 2O3SA 3KYCA 3W8DA 1R12A 3OF2A 3HSKA 3JQ9C 2PKQO 1E7RA 2DM6A 5C37A 4HFMA 4WK6A 3PJFA 2PKRA 3B1FA 5A05A 2DFVA 2P4QA 3IOYA 5A1TA 2B36A 3PFWO 1PIWA 3EW7A 3U5TA 4A5OA 4WOJA 4BNFA 1E7MA 2PD4A 1LA2A 1TI7A 1XA0A 2OL4A 4XKJA 4AICA 3C3XA 2EHDA 4BNWA 5AQ1A 1YBAA 1GQYA 4MVJH 2D5AA 4CM9A 5KJEA 5COAA 4AJOA 2V6FA 4IBOA 4KZPA 3ZDFA 1BVUA 1NPTO 4L9RA 3DHNA 5JXWA 5A4DA 3Q9UA 3UCFA 3ZZNA 4YT5A 4JROA 2Y68A 3H5RA 3N7UA 4MPDA 3BMOA 1Y8RA 4NNJA 5L7TA 2CSUA 4XCVA 3Q9NA 2EXXA 2VT2A 2IE0A 1EFLA 5TRTA 3RBZA 4ND5A 3D4PA 1JDJA 3T4XA 3WQQA 4ND2A 3WFIA 2H6EA 3GFGA 1IHYA 1QXSA 4I5DA 3OA2A 2OXIA 3D3EA 3GNSA 1U9JA 4UREA 1VKOA 2ZJ1A 1E1KA 2DC1A 5F5LA 5F1PA 1Q7BA 2GN6A 4IDCA 3WGZA 5DZSA 3PZRA 4QUKA 3IKVA 3PP8A 1BSVA 2FWMX 3EK2A 3GG9A 3RUIA 1H2BA 5A3VA 1VSVA 4J91A 4BO3A 5ER6A 5EESA 4GSLA 4PG4A 2HKIA 5GZ6A 2X7HA 2YHIB 3FWZA 2AEJA 1NQAO 4BL5A 2YUTA 2BGMA 2Y0DA 2NVUB 4W99A 2Y0CA 3I9KA 3GHHA 2VHVA 3EVNA 5I7VA 1B3RA 2HRBA 2GUGA 1ADBA 1P77A 2BD0A 4TWRA 1NFRA 3RKRA 1I32A 1B0AA 1YBMA 4ZRNA 1BVRA 2X0NA 1BW9B 2AQHA 1B3BA 3FWNA 1MFPA 2VZ8A 2Q99A 1H6AA 2UUOA 3PRJA 5ENVA 3VKUA 2ZTVA 4IMPA 1SCUA 4MP6A 1PJ4A 3ZWYA 1EQUA 5L4SA 1G0NA 4P38A 4IINA 1PJ3A 3E8XA 5G4KB 3ROPA 3V5NA 3RWBA 2E49A 1DPGA 1U5CA 3UH1A 1U3UA 3KUXA 5IXSA 4NJOA 2P5UA 3M2TA 3G1UA 3G49A 4J0FA 3RASA 1P1KA 3VPSA 4E0BA 2VRCA 1XGKA 3DAGA 1NFFA 1UAYA 4XJTA 2AHRA 2I65A 4J2OA 1T26A 2UDPA 1Y9AA 4ZU3A 3KLMX 4EJMA 1HDYA 2Q1SA 4IM7A 4PLTA 2H63A 4XYLA 1LSSA 1ZNQO 5IDWA 3BMNA 4NMHA 5KNLA 1DIAA 4D46A 4GKBA 1C1DB 2YV3A 1EDOA 3QWAA 1YQGA 4J49A 4M54A 3DAFA 1MUUA 2JFFA 3QWHA 2A94A 1DO8A 4BQPA 1PJTA 1TT5B 2QYSA 4YJFB 1E3JA 4EUHA 3ZNNA 4YACA 2I66A 4NBUA 1WP4A 1Y1PA 3VH2A 2Y1DA 4CLHA 3O38A 4L73A 4ZQBA 4WKGA 4L76A 2GZ2A 5H81A 4ALJA 4PIVA 4CLRA 2IDZA 3QWFA 1A9ZA 4J4TA 3W8FA 1AGNA 4ITUA 2Q46A 3FNEA 4ALLA 2RIRA 2FPIA 4I8XA 1PGPA 5TS3A 1NPDA 2B4TO 1GY8A 1UXIA 3PGXA 3SC4A 2EGGA 1MV8A 2IEDA 2W98A 3VVCA 3MTJA 1J0XO 1E3WA 4ND4A 5TC4A 4YEDA 4NU5A 2PR2A 3WS7A 4E2ZA 1ISMA 1UZLA 5IZCC 3KRTA 1C14A 4LVCA 4C4OA 3QLJA 1EDZA 5FF9A 3PHLA 2DBQA 3SLKA 5FEUA 2Q2VA 4D3SA 3U09A 3F1LA 1CYDA 2EF1A 2WEKA 2Y1FA 2BLLA 4ONEA 4BKRA 5B12A 1P74A 1F17A 3GDOA 1Z7EA 4MVJM 3ZU4A 4DIBA 4CQMB 1Z6ZA 1ISHA 2B69A 1KIFA 1F8GA 2YY7A 3ASUA 3KTDA 5GMOA 1NASA 1X7DA 4QSMA 1H9BA 1P1JA 1UP7A 4OJNA 3AK4A 4E33A 2WD7B 1WPQA 4FJ0A 1GEEA 2ZYDA 4YTEA 4KDEA 3KO8A 2HLPA 2R00A 3NEPX 5JDIA 1O5IA 3V8BA 1IL0A 4LCJA 1YOVB 3WBFA 4OKIA 4ALKA 4CM5A 4QECA 2P9CA 3UCXA 1GR0A 3R0IA 2B0JA 3LQFA 4E32A 4UULA 1C1XA 4PZDA 5L53A 3L4BA 4XIJA 1B14A 5TNXA 2W90A 4PLZA 1I33A 4CJXA 4J16A 4R54A 1H0KA 3AY7A 1ZSNA 2PFGA 2B4RO 1HRDA 4FBGA 3HN2A 1HDCA 5JPIA 4ZN6A 3WR5A 1L7DA 3DZIA 1GAEO 2Q1TA 5JW6A 2O3TA 1ZMTA 2FPPA 2UVDA 3GQVA 1PR9A 4JNKA 1U4OA 4FFPA 2JCXA 4TRJA 2CVOA 2QG4A 3U62A 4E2WA 1CQJA 5T8KC 5BNIA 3ZCXA 4LN1A 3HDJA 1C0LA 1DC6A 4B8WA 4DMLA 4P4LA 1ZKMA 1PEDA 2DT5A 2HRZA 1IZ9A 2O2SA 3GRPA 4J7UA 3UN1A 1P1HA 3RUCA 2DTXA 1XQ6A 3OIFA 2WWRA 4Z6KA 4UUPA 2EEZA 5FFFA 3RUFA 5I9NA 3K2EA 1E5QA 4CV0A 4IPTA 1QSGA 1DFIA 2IXAA 1JU9A 4RLHA 4ZRMA 3WMWA 1EK5A 5A3JA 5EIOA 4PLWA 2CZCA 3WGQA 4BMNA 3JQDA 3S2IA 2C7VA 3JYLA 3CZMA 2P4HX 4LMRA 1WXDA 1IULA 4CQMD 3DZGA 2Q50A 4OXNA 2HMTA 3HJAA 1Y81A 4RGBA 5I8ZA 4PZEA 3IP3A 3AI3A 1R4MB 2OO5A 4YAEA 4TSKA 1QYDA 5EJ2A 2LDXA 5A02A 2D5CA 1K2WA 1X13A 3ZNPA 2C29D 4AJLA 2HUNA 2V6MA 4Z3KA 2EKLA 2E4AA 2PD3A 3LC2O 3I9OA 5HRUA 3L6OO 4GBJA 3BMCA 2ZB3A 2O48X 4JJGA 4RVDA 4MJLA 5IJZA 4KWIA 4JQCA 3JQGA 2CDAA 4R5MA 4RPLA 4OXYA 5JE8A 1EVJA 4Q3EA 4DGSA 4BV8A 1K6XA 3EMKA 4J7XA 1KOLA 1BMDA 3F5SA 1R0KA 1PGJA 4GMGA 1R66A 2VWHA 1QYVA 1SPXA 2D2IA 4J43A 4L4RA 3HZZA 3W4IA 5ES3A 5K6AC 4IQ0A 5A9TA 4II3A 4O59O 1XU9A 4D44A 2A92A 2NTJA 3LT1A 4FW8A 4NFSA 1N8KA 3QP9A 3GVXA 4RVFA 4GI2A 4A03A 5JAIA 1ULUA 2W4QA 3CKYA 3I83A 4G2NA 4KUEA 4R41A 5CDYA 1HZJA 5AXBA 4F45A 1HYHA 2EV9A 1M6HA 4Q3DA 1U4SA 4HFRA 3UHAA 1VJ0A 1YKFA 4IS3A 1LU9A 1ZBQA 5HS4A 1U5AA 4UUNA 5F1OA 2NU6A 1VL8A 4BKPA 2GERA 3DBLA 5FI5A 4MDHA 1KS9A 1ADCA 4YAKA 3EZLA 4YCAA 1T25A 4R16A 1UDCA 2ZYGA 3GFBA 4J7CA 3NUGA 1P3DA 1YOVA 2VOEA 4YJHA 4F3YA 5JS6A 1Y8QB 1VRWA 4J9UE 3DBHB 1WNTA 2EJVA 4LRSB 2PA3A 5I9LA 4XQGA 2EKQA 2C0CA 1O8CA 4PFJA 3F1KA 5CFZA 4NG5A 4M1QA 1GZ6A 2BHLA 3MEQA 3E9MA 4YA6A 3RBXA 9LDTA 1XR3A 2HDHA 2WYVA 4R01A 1YE3A 5KIAA 4DTIA 5K0ZA 2AEFA 4IJVA 3BHJA 1X0XA 1E3EA 3OJFA 1YRLA 2PLAA 3DWFA 3I6QA 3LT2A 1IPFA 5JO0A 1QYWA 3RFXA 3RKUA 4BHTA 4MIOA 4PRKA 4WEOA 3INTA 3NV9A 4RCVA 2YFHA 4EI2A 3WGOA 3AJRA 1BRMA 3AU8A 3RSHA 2GLXA 1R0LA 5EINA 3VTZA 3G1TA 4NBVA 1P44A 5L4LA 3EYWA 2IXBA 3SVTA 4R3WA 1V3VA 1TVEA 1UUFA 2WM3A 3JQBA 1BXGA 1AXEA 3MWDB 1CERA 5DBIA 2FR0A 2OOSA 1ZXBA 2WD8A 3TOZA 2H1SA 4WLOA 4DPMA 2J5KA 4E2XA 4RQTA 1PQUA 1ZK2A 1JKJA 1JKFA 3I6IA 3SXPA 5IG2A 4GQAA 3UKOA 1FDWA 1P1RA 2VZ9A 3WX0A 1B26A 2VWQA 3LK7A 1DIGA 3OQ6A 4XWYA 4CMKA 4TZTA 5U1PA 1MC5A 1KVUA 3GVCA 2PWZA 5F21A 2DUWA 2ZATA 1GU7A 4HBGA 4IY1A 2XXBA 3GK3A 2X0IA 4FN4A 3UFXA 1GYQA 1U1IA 4DQXA 3RC2A 1QLHA 1IE3A 1KVQA 2QHXA 3ZWNA 3RFVA 5IFLA 1P0FA 1O9BA 4PRLA 3W1VA 4FPXA 2DFDA 7MDHA 1LDYA 4MVJI 2Y93A 1I2ZA 1GUYA 1PQWA 1LDEA 1DSSG 4NZ9A 4E2YA 1LLDA 3VVBA 4ILKA 1VL0A 1JA9A 2ZB7A 5DCUA 3SJ7A 4UVHA 1WDKA 1MX3A 1JWAB 2E48A 3ST7A 2C5EA 1PL7A 3D4OA 4E4YA 5G4LA 2CNBA 1YH3A 3I9MA 4R68A 4W9NC 2B83A 5ITVA 3ZWBA 4IDGA 4LVUA 2NM0A 2V65A 3ANLA 4RL6A 4J9VA 3WYEA 3DHEA 3W4JA 5EN4A 2DTEA 2PTGA 3ZV3A 4GLOA 1E6WA 3K96A 3KYCB 4W4TA 1R4NA 1WLYA 4WCFC 1HSOA 1SAYA 1BXKA 4IIUA 4Q3CA 4RZIA 4BKOA 3JQ7B 3WNQA 4IDAA 2RCYA 2VT3A 1LRKA 2RH4A 2YQ5A 2ZCUA 3L9XA 3TOXA 1KETA 3QY9A 1J49A 4GX5A 1LSJA 3SEFA 1GUZA 2FR8A 3RUAA 2VYVA 5JMWA 1YJ8A 4Z9FA 1A4IA 4PG5A 1Q1NA 3I4CA 1JTVA 1XIVA 2ZIZA 5ICSA 3ONEA 4KTTE 4U5QA 4DLLA 2JCVA 1BDBA 1LRJA 1Y8QA 3D5QA 3FPLA 3R3SA 4IQ8A 4BO5A 4GL4A 2VHWA 5CG2A 5HWSA 3VDQA 2PZLA 3LU1A 4WEQA 3DTTA 3CSDA 3BMOB 1Y8RB 3DZBA 5BT9A 3IUSA 4E5KA 2NWQA 1NP3A 3O4RA 4L8VA 1XQ1A 2PGDA 1E7YA 1R0SA 3NGXA 4JBHA 3FTPA 3P19A 5JDCA 3E82A 3PTZA 5DP2A 4RF5A 1ZEJA 3HNPA 1Z73A 3H9JA 1NHWA 1HDXA 2X6TA 3NGLA 2V6BA 3GAZA 2CUKA 2NACA 1TXGA 3IQDB 3MZ0A 4J90A 4CUJA 1RKXA 1ZIDA 2CDBA 2W2LD 5A9RA 4ZA2A 1V9LA 2VCYA 1BTOA 2FOIA 1GEGA 1DFGA 4R1UA 1GFSA 4B3HA 3IP1A 2NUAA 3OFSA 3I9LA 3C1AA 2YFQA 2QIOA 1PJSA 4L4SA 1ZJZA 1ADFA 1NWHA 1YDWA 4XRRA 5B37A 4FC7A 4IZHA 5A5EA 1ISIA 4D7AA 3INRA 2WE7A 2UV8A 1KC3A 1UZNA 4UEOA 2XXJA 1VE9A 3A1NA 4D45A 4E13A 1BDMA 5JSFA 1Q7CA 4QT0A 3RJ9A 2JL1A 2NNLD 3O8QA 4BNZA 1X14A 5L9AA 2NU7A 3PEFA 3KB6A 1TEHA 4B7UA 1YO6A 4WNIA 2PK3A 4H3VA 1AE1A 2X9GA 4N7RA 3C85A 2DPHA 2ZB8A 1FDUA 3NT2A 4E5YA 3H5NA 1YL6A 1ZEMA 4A26A 2W2LA 5C3MA 5J23A 3AUAA 3FHLA 1AN9A 1NR7A 4NFYA 4MKXA 1I01A 4CM9D 2JHGA 1Z7BA 3ROMA 4E31A 3ROKA 1HTBA 1PJ2A 1XLTA 4EBFA 4PLGA 5CPBA 5C7IO 1GD1O 2PZJA 4XR9A 3BMNB 4FGWA 3U4HA 5JC8A 3ZWVA 3K73O 1DAPA 3PWZA 1HWYA 3ZWOA 3RD5A 1U8FO 3CPSA 1JAXA 1ML3A 3DEYX 2HJRA 1T24A 1T1RA 1ZJYA 3H9QA 4XQCA 2QQ5A 2C07A 4ND1A 4DA9A 2I3GA 2DUUA 4D0SA 5L4NA 1LEHA 4W82A 1L1FA 2QYTA 2O3QA 3DZKA 2DBZA 4WJZA 2YDXA 1HYGA 3QWBA 2PZKA 4NK5A 1DC5A 1MFZA 4XYMA 2UUPA 4TKMA 4M89A 4CLRB 4M8SA 4R9SA 3JQ7A 2X4GA 4JCOA 3GVPA 5T67A 1GL3A 4PLVA 2EW8A 3DAPA 3VPHA 4EGFA 1U7HA 3D0OA 4HWKA 6ADHA 4CLXA 5IF3A 5CHEA 3F47A 3RI3A 1E3WB 1HL3A 3BAZA 4CMIA 1H93A 2EP5A 5THKA 1SOWA 5ER9A 9LDBA 4H7PA 1QKIA 4J6FA 4QO7A 2V6GA 5EQFA 3MCVA 4DL9A 4E5MA 3ON5A 3ICPA 3WTBA 3ZV6A 4A27A 4E12A 4YAIA 4R1SA 4CMEC 5EPOA 1Z75A 1OOEA 3M6IA 4NBWA 1WAMA 2Q1WA 3V1TC 3PHHA 4N54A 2QRKA 3QIVA 2PGLA 3JSAA 4TVOA 4DREA 1U3TA 3IC5A 4I5EA 5G0SA 2GNAA 2P9GA 4BGUA 3K8ZA 4BKQA 4GX0A 4EZBA 4BO0A 2F1KA 2RH8A 3FF4A 4TRMA 1EUZA 3LT4A 5CEJA 2HMWA 4QXMA 1XSEA 1RWBA 4IQGA 1HXHA 1NXQA 4WASA 5MDHA 3I1JA 2POQX 1F8FA 3EHEA 3H2SA 3K92A 1HE2A 8ADHA 2VRCD 5I7SA 4JJIA 1YVEI 3CMMA 1H94A 4DUPA 4DMMA 3M1LA 1C1XB 5DT9A 1Y9EA 1C3VA 3PXXA 3HG7A 4MIEA 4AL4A 5A03A 1GYRA 3PYLA 3TWOA 3NTOA 3ONFA 3K31A 3GT0A 2VOJA 1W0CA 1P1FA 5G0VA 2EW2A 2BH9A 3DFZA 1LRLA 1AHHA 3Q11A 4UUOA 3Q3CA 1GCUA 2C5AA 4TMFA 4BNHA 3FPCA 4F46A 3CEAA 3QVXA 1PU2A 4OOEA 2AXQA 3PFFA 4WCDA 4UVIA 5U4QA 2AQIA 4FC6A 4DXHA 3JD0A 4PLFA 5B4UA 1U2GA 2Y05A 4PG7A 1JWBB 4K28A 1WDMA 1DIBA 3VPFA 2R6JA 2P9EA 4F6LA 4U6QA 4YWJA 4E21A 4L4XA 2O7QA 4B4OA 3WIEA 4PVCA 3BHMA 3QE3A 4CV3A 1AXGA 1HDRA 4WGGA 2BGKA 4OAQA 1B8PA 3M2PA 1YQDA 5A06A 3OEYA 3Q0EA 2EP7A 1EMDA 1VL6A 1ZW1A 1JKIA 5TJHA 3K9QO 3RU9A 4RVUA 3U49A 1PL8A 2JD2A 1MG5A 2Q4EA 4IGFA 3ROQA 1GUFA 3ZWPA 1ZO8A 2GGSA 1KY5A 3AY6A 3I4FA 3W6ZA 4GVLA 5F3RA 3RJ5A 1GTMA 1DRVA 2BMAA 2Z5LA 3TF5A 1V6AA 3GEMA 4L0QA 1EEHA 1MLDA 3D3WA 2Y1CA 3C7DB 4GGPA 3DO5A 1D3AA 3C8MA 1GV0A 4G81A 4RPGA 4YQYA 5AVOA 2GR9A 3H9EO 4O0LA 2YZ7A 4P4NA 3RIHA 4B7CA 4PG8A 1QV7A 4UUMA 4EJ6A 1GQ2A 2B4QA 1DC4A 4O1MA 1CJCA 1I3KA 1WWKA 1MC4A 3SLGA 2VNSA 3C1TA 1LBEA 4DLBA 1GPJA 3BMCB 1YB5A 3Q2KA 4BGVA 4HX5A 2FZEA 2Y1GA 3JQGB 1DEHA 2J5QA 3K30A 2J6IA 3T4EA 3WTCA 3ZWMA 4AJHA 1CETA 3FNHA 1PS8A 5DOVA 3JQ6A 1HSZA 3MJEA 1A71A 5CAEA 5JCJD 5IZ4A 2ZQYA 2QX7A 4TROA 4AJ1A 1NBOA 3GAFA 1Q7GA 4OSOA 1ZH8A 5L7WA 4U8GA 1JAYA 3D7LA 1X7HA 2XAAA 1LDNA 4N18A 3OECA 4XJSA 4P22A 1PZGA 1KEPA 5TT1A 4CMCA 4E5NA 2NQTA 2X5KO 3JYNA 3NYWA 3DMTA 2X22A 5B4VA 3INGA 1U2DA 4Z0HO 5IN5A 1E6EA 3QA9A 1KC1A 3ADOA 3NJ4A 3QJ5A 4M55A 1H2HA 2C59A 3U4DA 3DBLB 3JQFC 3JYQA 4OQYA 1N1GA 2EGHA 4CLOA 1QV6A 4CMGA 4MO2A 4J1SA 3AY3A 2PGJA 3QHAA 2FPGA 2HSDA 3FBTA 3NX4A 4YJHB 1I0ZA 4FFMA 4A73A 3LZ6A 5KCZA 5EQDA 3AOEA 3H9UA 2X8LA 1J4AA 4LCEA 3GG2A 4H16A 2O2YA 1NVMB 3BIOA 3TSCA 3STHA 4BNLA 3IAHA 3FBGA 2ET6A 1Z74A 2C54A 1HT0A 4YT8A 1F0YA 3OBBA 2NTNA 4NPCA 4Y98A 5JCJA 4DBVO 2X86A 5COQA 2NSDA 1V0JA 1Q0HA 5TGDA 4F6CA 1NFQA 1FDVA 4XEHA 4D3DA 3GA0A 5IN4A 1GCOA 1Y7TA 5HS6A 1V3UA 2QRJA 3FNFA 3O9ZA 3S2FA 1GADO 3BTSA 1I2CA 5THQA 2VNAA 2NV6A 3H6KA 2ZTLA 1VI2A 1K3TA 1K6IA 3P7MA 3PPIA 2GPTA 4IJKA 2JAHA 1YS4A 2JAPA 3GH3A 4GGOA 4J4BA 4B3IA 3KEOA 4BNMA 2PY6A 1QYCA 3HHPA 2XF8A 4N5LA 4CODB 4FJ1A 5JBIA 5AXCA 3JQ9A 3BZUA 4CMHA 1BXGB 3NT4A 4P4GA 4W7IA 2OZPA 3LF2A 1N5DA 3IKTA 3LC1O 2P68A 3PJGA 1K0UA 3RUEA 3JQEA 1X7GA 1LTHR 3FR7A 2J3KA 3D1LA 3AOGA 4J0EA 4MINA 5KKAA 2IYOA 3RROA 3MWEB 1E1MA 1WMBA 3C24A 3F9IA 3TJRA 3NT5A 3U3XA 1N7GA 2BRUA 3BHIA 5BNFA 1ULSA 2VN8A 3D64A 3GGPA 3V2UA 3ZWXA 5KWEA 1EVZA 1UAGA 5KVQA 3PIIA 3SC6A 4IDDA 4RV9A 2H9IA 3GRKA 4BNVA 2X58A 3JQCA 2Y1OA 1ZZEA 3FI9A 1PGNA 2O4CA 1C0KA 2O50A 3HUDA 4BVAA 5CEEA 4LGVA 1A27A 4KOAA 3VH3A 1T2EA 1TLTA 1DHTA 2C82A 4DYVA 3U0BA 4EYEA 2CVQA 5AXAA 4NK4A 4YT4A 1ONNA 4OIMA 4PLYA 4J1NA 2DPGA 4ND3A 4OHUA 4PG6A 2X9VA 2DKNA 5DN9A 4ID9A 5JLAA 1M67A 1I2BA 3LLVA 2EERA 2HJSA 2RBEA 3P2YA 3AWDA 3FR8A 1DIRA 2YQ4A 3DBRA 3L6EA 3RFTA 3WOHA 1CDOA 1YQXA 1RM3A 4JGBA 1C0IA 1HDZA 3KEQA 2VYND 1OMOA 4KQXA 1ZXLA 3TDKA 3HE3A 4PGFA 1DB3A 3G3EA 3NDRA 3GLQA 4HKTA 4MVJF 4R5HA 3ZU5A 4CUZA 3BXXA 5COBA 2GN4A 3QVWA 4CMAA 3ZU2A 3TL2A 3PLRA 3WSVA 3PYMA 3GGOA 1R4NB 1W4ZA 4IDFA 4RO0A 1CWUA 1R37A 4A7PA 4CM7A 1JN0A 4FDAA 5L95A 2VWPA 5KOIA 3BA1A 3JQ8A 4R69A 4D0RA 1SEVA 4ZQFA 4CM6A 2EG9A 4BIIA 5B1YA 4XGNA 4JK3A 4OKNA 4IUYA 2I67A 1LDMA 3AUUA 1D7OA 3IIEA 3KETA 1UZMA 4YT2A 3FNGA 3PGJA 5KKCA 1DJQA 4EUEA 4IS2A 1AHIA 3WNVA 4XGIA 4Z0PA 2BFAA 4Z9XA 1X0VA 4B8ZA 3I9JA 2BFMA 3ZH2A 2Q2WA 2VYNA 1DDOA 4MKZA 4GH5A 3OQBA 4GX2A 5JFOA 1P1IA 4BOYA 3ITDA 4Y67A 4XDYA 3K2BA 1D1SA 4CLDA 1E7SA 2G82A 1E0DA 4JP2A 3RC7A 3AM5A 2EKPA 3CH6A 1B15A 4ZD6A 1A72A 4AVYA 2Q2QA 3JTMA 2NVBA 4BGIA 4CQLA 1M76A 4EUFA 3T7EA 3BMQA 4OOFA 1LDGA 2EJWA 4KUHA 4NR0A 1ZMOA 3V2HA 5BSFA 4NHEA 1PSDA 2X23A 4DLAA 2F00A 2FSVA 2CF6A 3QWIA 3GN2A 1UR5A 4NBTA 3GGGA 2HAEA 4G5HA 3CIFA 4XB1A 4M49A 1OZAA 3CUKA 2D0IA 1ARZA 4XYBA 1Y6JA 2ZTMA 3H3FA 5ITWA 1I3NA 2AQKA 3W6UA 1R6DA 2DLDA 3O26A 2E6UX 2CD9A 4RF3A 1ONPA 3WGTA 3JYOA 4BO2A 3PJEA 3EC7A 3KSZO 3B70A 2BI8A 2BELA 5IZCA 3UW3A 3RCBA 2AQ8A 1YJQA 4FFLA 2NTVA 4TRNA 3A9WA 3R6DA 1DBVO 2J8ZA 2FHSA 3O8QB 5TF4A 2PD6A 4G65A 3NDIA 1MP0A 1PJLA 2FP4A 2Y66A 3D5TA 4ZVVA 5DNAA 1QR6A 4PN3A 3DZJA 3ITKA 3PHGA 3ZHYA 1SC6A 3ZU3A 4DVJA 3S55A 3KSUA 3OJEA 1V3TA 3QVSA 3WJ7A 2Z1MA 4XR4A 4L74A 4XQ9A 3VDRA 1YWGO 5L45A 3OICA 2VYVD 1M66A 4IMRA 2O4UX 1E3IA 2BKAA 2Z1NA 3L4SO 1MG0A 3NTQA 4PLHA 2VHYA 1ONOA 5CP8A 1T2FA 1A7AA 2WDZA 1GZ4A 3GHYA 4MIYA 5IDQA 1PS0A 4O5OA 4S1VA 4BB5A 1GPDG 2PH3A 1ENPA 4J2HA 1GYPA 2ZYAA 4FR5A 1I36A 4Q39A 1QP8A 2UAGA 3E9QA 3H7AA 4FJ2A 5F5NA 2VTEA 3PYXA 1E1NA 5HA5A 4LMPA 5KVCA 3RU7A 4BNUA 1PQPA 4C7JA 4C7KA 3OJ0A 4I9UA 3RQSA 3TFQA 2HMUA 4DIFA 1KEUA 4R4JA 4WPGA 4ALNA 2J3HA 3L0DA 3PHIA 3HDHA 4E6PA 4MOWA 1PWXA 3KV3O 1QG6A 5JO9A 4FB5A 1I3MA 4CUKA 1Y5RA 1ORRA 2GRAA 1PZFA 3GN1A 1YDEA 4QEDA 2NADA 2Y0EA 3ZW8A 4MKRA 1NYTA 4NJMA 5T8KA 2D3TA 1ISGA 5TT0A 3LC7O 4CMIB 3IJPA 1LX6A 4D79A 1OFGA 4JBGA 5AXDA 1H5QA 2EIHA 3RC1A 3FRJA 4FFNA 4OMUA 3OIDA 5ILGA 1S6YA 4JP3A 3F46A 3MOGA 4CR7A 5KJ6A 4FFOA 3TZCA 1N92A 5BSEA 3VOSA 3S8MA 2IRWA 5BQFA 4IDBA 2B35A 3VZPA 3WG9A 4XQEA 1KEVA 5JNLA 1HE5A 1U28A 2JFGA 2OORA 1IOLA 4GWKA 4OO3A 2AW5A 1LQTA 2I5PO 1K89A 4HUJA 2JKVA 4JX8A 4DIOA 3MJ4A 2CDCA 3HB5X 3KZVA 4A10A 4FSHA 3DMYA 3H3JA 2OGUA 4J4HA 4NDNE 4FS3A 2VUTA 2Y1EA 4YRDA 1XEAA 2P91A 1UXKA 3DTYA 1WZEA 1MA0A 2CVZA 3BTOA 3JQAA 1Q2XA 1A5ZA 1J6UA 4JLWA 3AI1A 4K6CA 5CDSA 3UOGA 4ALMA 3LT0A 5TIIA 1B7GO 1H6BA 3WQSB 3I3OA 1EBUA 3E5RA 4B3JA 3DL2A 2B5VA 3HWRA 2JD1A 5BSGA 1VLLA 2D8AA 3ADPA 2IZ1A 4XD2A 4YB8A 3VAZA 4ZHSA 5KVSA 2VRBA 4YAJA 3FTNA 4GVXA 3DQPA 4XZ3A 4CLEA 1NTOA 3R1IA 5K6AA 1NHGA 1ENZA 1OC2A 3AFMA 4MVJP 3SX2A 5T6BA 4PVDA 4NQZA 2VWGA 4FGSA 5A04A 4CM3A 4DQUA 3B1KA 3KYDA 3WDSA 4AG3A 4ZGWA 5JCXA 2DBRA 5LDHA 1PL6A 1OBFO 3DB2A 3NKLA 3QQPA 4MVJA 4ALIA 3OJOA 4JBIA 1NQOA 3H65A 4TKLA 1M75A 2A35A 2O3RA 4WECA 1TA4A 4E3ZA 3I23A 3IL2A 4XYGA 3QRWA 3WICA 4CM1A 5AYVA 2DTDA 4PLCA 3VHRA 3ZHBA 4BQRA 1PS9A 4JIGA 5JY6A 4KDFA 2X0JA 2BI7A 3VPXA 1VSUA 2BFOA 1ISFA 2R00C 2EWMA 5IDYA 3VPGA 4HY3A 5LCXA 4EJ0A 3UVEA 5JDIC 3FD8A 5LDGA 3WSWA 3HFSA 4YAGA 1YXMA 3D3WB 1FJHA 3VH4A 4NI5A 4YQZA 2IYPA 3G79A 4QFDA 3VH1A 4PZCA 3L4BC 4EITA 3ETGA 1CIVA 3IS3A 1AUPA 4KUGA 2FN7A 4R1NA 5GY7A 5G0TA 3PDUA 4IDEA 3L77A 3MOIA 2G1UA 1V8BA 4XX0A 2YV2A 1JW9B 4IIVA 2J3JA 4RQUA 4U6SA 1TB4A 1EZ4A 2W2KA 1PR3A 2VHXA 1UXHA 1R16A 3JD4A 1YL5A 4I9NA 4YJGB 1IUKA 3B1JA 2YJZA 1ZVMA 1IHXA 3F4LA 4QO8A 2NVWA 2D4AA 3RBVA 4ZICA 1V35A 5JC1A 1A7KA 1JVSA 3PQEA 2W8ZA 3GZ4A 4OYRA 4Q3NA 5EMHA 4LW8A 1ZUD1 3TL3A 4J1QA 4EDFA 1ZK4A 2IZ0A 3TZ6A 3R3JA 5KJ1A 3VZSA 4LSMA 3I52A 4XGKA 1Q0QA 4L75A 4KTVE 3TRIA 3S2GA 1ZK1A 4HV4A 3OA0A 3GVHA 1DJNA 2HK9A 2UYYA 4BGEA 1E5LA 3ABIA 2VTDA 2FR1A 1HLDA 3FCOA 5IXYA 1TT7A 4HFJA 4IXTA 1JQBA 1NAIA 5TJ9A 4OSPA 3AFNA 4P8RA 1IYZA 4X54A 1P0CA 2WTBA 4K1LA 4AJPA 2QZZA 4CLOB 2GZ1A 4W6ZA 3GY0A 3JD2A 3WFJA 1YB4A 5K9ZA 3DOOA 1N9GA 1Y5MA 2Q1UA 3JYPA 5LC1A 4RJTA 1WMAA 4RF2A 2FRDA 4WLEA 3KXDA 3OEWA 4OXKA 1SEPA 3WYBA 4I5FA 1LQUA 1HF3A 4RZHA 3PI7A 3PVZA 1GQQA 4N5MA 3RUHA 5ENDA 4WUVA 5C7LO 3B20A 4FFRA 4W9NA 4WLUA 2DQ4A 1UXGA 1NX6A 3EY4A 3N58A 1Z45A 1ZCJA 1FXSA 2LDBA 4CM4A 2X5JO 4GLLA 3UGKA 5H83A 1NVGA 3UAGA 1YBVA 2HCTA 2AA3A 3E03A 4WCFA 3WLFA 5DF1A 5F1KA 4OM8A 3TQHA 3N74A 3SBOA 4YXFA 4HFNA 1O6ZA 4A2CA 3GOHA 3GEGA 2HO5A 1LI4A 1CEQA 1X1TA 1FMCA 4HNGA 2PV7A 1OI7A 3JV7A 3E1KA 4W7HA 2V7PA 4YRAA 4QQRA 3OJLA 1B16A 2JFHA 5DCYA 3V2GA 3ZHZA 5TLSA 1H6DA 4EEXA 1LNQA 2OBNA 3UUWA 2B37A
chains in the Genus database with same CATH superfamily
4IIJB 2JJMA 3KVOA 4DY6A 4IDPA 3M3DA 1F48A 2AMLA 1QB7A 1L1EA 1TQ2A 4OG2A 1N8SA 1Z83A 1Y4UA 4QVIA 3HEBA 5E6SB 1HR0B 2RGNA 2FFAA 2WWTA 1RLMA 1CQPA 2P5YA 3BB4A 3G6KA 1JPNA 3C6QA 2L19A 5ALFA 4AKTA 1I9CA 4MARA 4QYIA 3ZHRA 5ALZA 1CXZA 3CNQS 1KZGB 1VPTA 1JLMA 1Y82A 3WXBA 3O73A 3FHOA 1N33B 4CIBA 4JI4B 2QB5A 1E7QA 2I9PA 3BXPA 4NDZA 1GAWA 1Q0LA 4N48A 1TPYA 5DISB 3HXMA 1T5TA 1ZN8A 5ALNA 5EJ6A 2Q9BA 4H0FA 4UPVA 5DX1A 4B73A 5KQPA 1AM4D 1W48A 2PRSA 3FYTA 1QYXA 4M86A 1L3BA 1EBFA 2NZWA 3FUUA 4LC9A 2BGLA 4QM6A 3DDHA 2J0UB 5HDQA 3V7FA 3OCYA 3GZNA 3X44A 4KQWA 3ETNA 2Q28A 2ZW9A 3EVEA 3ENKA 3JXEA 1OY1A 2RHRA 3T1QA 5BWOA 2AVDA 3VKVA 2RBGA 1TTHA 3KXKA 4LY9A 1L5NA 4XDZA 3R74A 4CRWB 5AW6A 4A36A 1M2HA 5HUQA 2HMVA 2A57A 4LXQA 4UVGA 1ZGJA 3E48A 3DT9A 1ZLXA 4U02A 5EXPA 4DUZB 1NRIA 2JCYA 2FSUA 1LS6A 2IDJA 1ZUNB 3GEDA 4ZPXA 1KY4A 1HE1C 4X1YB 3WDKA 5C8XA 2ESRA 3JCZA 1HTTA 1II0A 3EH2A 2E82A 3MT8A 4MRVA 3L7IA 1T8SA 2J3DA 1U3WA 2VAMA 3HVJA 3WWPA 4GBMA 2CF5A 2QJOA 4UVDA 4MWSA 4PM4A 3UY4A 4ES6A 1R6AA 1XMOB 3LDFA 1LZLA 2G9ZA 4BNNA 4Z4CA 5ICMA 2GUWA 4F4CA 3LBFA 1XTRA 1U9IA 1YVDA 2R44A 2KW5A 4GNKA 4D4LA 4DJTA 5LWHA 1F38A 5AW3A 2GPSA 3E5MA 2ECOA 3NKVA 3QKWA 1FTGA 2CXSA 5EIAA 3A2NA 1CJUC 3DHWC 3UB3A 2BGNA 3FF1A 4WXRA 4COOA 1KI8A 1PZEA 2R2GA 5HRCA 4MCAA 3P2OA 4RF4A 3PJRA 1GG5A 5KJFA 2ZB4A 3LY5A 2XNDD 1O8BA 1ONBA 1X8LA 2V45A 3O82A 2A9QA 4LNHA 3WL8A 1D8AA 3DONA 1A76A 3MJVA 4K03A 3O9MA 3ROXA 3WWYA 1XPRA 4KJXA 2QMZA 3KKNA 3PNPA 3T7JA 2RAPA 2J3IA 2J45A 5DHAA 4ASUD 2JI8A 4DA8A 2QM7A 5MGBA 1W1IA 3AW9A 1F6WA 2HK6A 4KLCA 3HS3A 2VP5A 1KYWA 2K2WA 1A5AB 1LLUA 3S5UA 1PG5A 3KLPX 4Q3KA 4ZKEA 1FS6A 1I4DD 2WHPA 4B8YA 5MF6A 3FSRA 2FZWA 3COSA 3GJSA 4YRRA 3KPVA 4ZO9A 2O7SA 1A9TA 5IHXA 4YLGA 1LJLA 3QLEA 1L5LA 5SZHB 2YHIA 4CQLB 2GXAA 3LBAA 1QHYA 3MS7A 4FP9A 4YECA 4V39A 1IN1A 1FDIA 2WU1A 1JEDA 3ED5A 4URVR 1YFJA 1G0OA 3FPSA 5T5QA 2NVUA 4O2BF 2WRZA 4WQMA 1LVGA 1H2WA 3NDJA 5C5IA 3D6UA 3HKDA 4XCQA 3KE8A 2WU3A 1C0PA 3MINB 4DUGA 2VPXA 1HE3A 1WDLA 3WQRA 4MB6A 2GXQA 2P0YA 3UATA 3V1UA 4HT3B 1B8UA 1R6XA 3LCMA 1OA0A 1QHEA 3SDZA 4MP8A 3EXHA 3IQIX 2XCQA 1BW9A 1ISJA 3AZQA 3H1FA 3HV2A 4GMFA 4UMVA 3ZGYA 2BEJA 3TGWA 2OWEA 2HO4A 2QZJA 3LBIA 2J46A 2X0KA 1N1EA 2AG6A 3FJYA 1RJFA 3ETCA 3IUPA 2R8XA 1FQJA 3AC0A 3PT5A 3PT9A 4LX0A 4EF4A 1Y63A 4F84A 1JNXX 1EX9A 1GSOA 3ENNA 4EA6A 4ITRC 1GQRA 3CRNA 3MFYA 3IE1A 4M9ZA 4GC9A 2AOVA 3BOSA 3KU4A 2OBLA 3QPWA 4L8FA 4BS9A 4CMEA 1G7CA 2XE6A 2CXNA 3I8SA 3NEYA 4AECA 3PLNA 2X0RA 2E37A 3HZHA 2DSNA 4CF3A 1QZZA 4O6VA 2GZRA 1KO8A 1UWKA 1XHFA 1JYEA 2J48A 4R8MA 2YL2A 3ANSA 4BY9E 4F11A 5JYCA 4Y8VA 5GZ3A 5JXJA 3F3SA 4BMSA 4N76A 4OK5A 2Q3DA 4Z4HA 2C7BA 4DSAA 1O3YA 5MFZA 1RACA 4CYMA 1TZBA 4BFTA 4P35A 4X24A 1NC3A 1E2QA 3L43A 1G5HA 1CZOA 3H5AA 5TQJA 3H2ZA 4C03A 4ON9A 4EY3A 1PYDA 2JA2A 3DW1X 4BQQA 4BUCA 1RXUA 4C0WA 2OY0A 3LUHA 1W1WA 4INAA 4AU1A 2Z8YM 4RMNA 4GBED 1TCCA 3SR0A 4YJFA 2R8ZA 3CZRA 3HP4A 3MWLA 3Q12A 1W6RA 2IEGA 5C35A 2CJPA 2ZCJA 2GD1O 4WN9B 1XRPA 1A9RA 4DCSA 3PQ2A 4HGQA 5EE5B 1NA5A 5EHXA 4P7GA 2WJ3A 4C3ZA 3ENZA 4B80A 5B4TA 3GLHB 1PWHA 3LF1A 3BUSA 5IABA 5IWCA 1HDOA 3PDCA 3VR4H 4N3BA 4DMCA 4ZT7A 2O8DA 3EEIA 3N75A 3B6EA 2ATEA 7YASA 5JRJA 1UMDA 2PMFA 3I04A 4TTQA 5A71A 1EK6A 4EGJA 1Y8ZA 1DO2A 1XJQA 1IMJA 3OCXA 3AU9A 3P20A 4OVKA 1XELA 2CLEB 4UVEA 5A0FA 2G9NA 2VBFA 1Z34A 1BFKA 2UUBB 1YV9A 1FW8A 4G56A 4TMTA 3IE2A 3GBPA 3U4AA 1GDHA 4RZ2A 5TSDA 6CHYA 4ZJUA 2Q4OA 1WB4A 4FOSA 3ZZTA 1K97A 1W36B 3C5VA 4I5IA 5JAZA 3K5WA 1PZMA 3NRCA 2G70A 3ZE2B 2A33A 1PDOA 5G3ZA 1OH5A 2FXVA 4O02B 3U40A 5AW7A 1TTPB 1MC8A 2VPTA 2YHUA 3AWIA 1NBMD 5ECGC 4F1WA 4FE4A 4JT4A 2XF2A 1S3SA 4G1MB 4RZSA 4Y1EA 3A11A 2NO7A 2JNWA 5K7SA 2R7MA 3TJZA 4KR9A 1CR0A 3IGFA 4O2BB 5H16A 1O94A 4AP6A 4DSNA 4O4JB 1EZ1A 5JG7A 2Q3BA 3O0DA 1W6UA 3L1VA 3HN7A 1YTUA 4EYSA 2FDXA 4JI8B 4XOUA 2OBXA 4X7PA 5GJBA 5I9MA 3E3AA 1RLJA 3FG9A 3L0SA 4LXYA 4QDTA 4JI6B 1RRVA 1UMCB 2MYPA 4CNQA 5FBKA 4HDRA 2OC9A 4G0ZA 3AM3A 4ZTZB 3O94A 4R2XA 2BMFA 1UQUA 1XMSA 4TTJA 3PR1A 2XCOA 2WKSA 4M38A 3RANA 1MTZA 3TZLA 4EFDA 5KQGA 2VJBA 2FK8A 1T3SA 1GGVA 2QRZA 3Q3HA 2QT1A 2QEQA 1D6SA 4HXFB 3ETEA 4O2AF 3TCKA 1A4RA 4WA7A 1GAXA 4G9GA 2VC2B 5CITA 1PVVA 3U9SA 4M7WA 1Z6YA 3L0PA 4LDZA 5E1MA 5KOJB 2V5VA 3S6JA 1G3QA 3R7DA 1JHRA 5L6LB 3GMDA 3GPIA 5BW8A 3EAGA 2IS6A 2VT7A 5HZHA 1WXHA 2HQ1A 4TM7A 2WJWA 5TMDA 3CKMA 4ZZIA 3OP4A 5FI3A 4A4DA 1A98A 1CDDA 1RSZA 2WE8A 3CLHA 4KVGA 4HLQB 1YTLA 3URKA 3ECCA 1UH5A 3IEMA 3MRXA 4YR9A 3T7SA 1IN5A 1NVDA 2CJWA 3FX2A 1K7EB 2X4IA 3RDPA 3RHZA 3SWWA 4G5FA 2CCGA 1DBWA 4BO8A 2O8VA 5T41A 1SO8A 1P2DA 1W73A 2UVQA 2ZSHA 4IZIA 4AQ7A 1ZD5A 5U9CA 2JJ8A 1QGAA 1SB9A 1A8UA 3UICA 3M49A 3BWVA 5LBTA 7ADHA 5J4YA 5F3WB 1DNPA 1PG0A 4I50F 1ZVKA 2X8AA 4FD3A 2CHEA 4GS5A 4MYDA 3VZQA 2GASA 4OBBA 3EIOA 4Q6BA 3GU3A 2GCEA 2EKZA 1F06A 1KA9H 3KQVA 4DBLC 1V41E 4IJWA 1K7FB 2C92A 4KR0A 2UYHA 2OMKA 4DW8A 2PAFA 2RONA 3GVIA 3IJ5A 1DQZA 4YLYA 1JLRA 5IAAA 1BE1A 5FPYA 1JZSA 3JQFA 2LCQA 1MTOA 2Q3MA 5IKPA 4GI7A 1U3VA 1WEKA 5TXGA 2G25A 2PVPA 1O97D 3Q5EA 4NFHA 3ZGOA 3TCNA 3KWMA 4BPBA 2XJ4A 1NV9A 2GA9A 1D2GA 1BHSA 2MSLA 2R68A 1QGUB 3T35A 2V8BA 2AOUB 3A1EA 1T2AA 3OTIA 4GXQA 4YYZA 4YQFA 2ZSUA 4B3MB 3DJFA 5C5DA 1NM5A 2W2QA 2GLTA 3L6DA 4Q7EA 5K3SA 1M2FA 1ENYA 1Q5PA 4U2DA 4M87A 1T1JA 4FEYA 1KKUA 3SJCA 2VJLA 4JBWA 4JLPA 1V1JA 1KNQA 2PR7A 2HU2A 2QF7A 3A06A 5AI8A 2Z56A 1Q0ZA 1Z47A 1DDGA 3W6PA 2YOHA 1LUAA 5IT4A 1YBHA 4HDKB 4IEEA 4G8DA 4ISBA 1Z5WA 1BXRB 3FGOA 1X7YB 1QHNA 5J40A 4N3NA 4RMIA 2AEEA 2B2NA 2H4HA 1CQIA 4PLPA 4I4NA 4Z9YA 4NMMA 3KYBA 4KE8A 4XIYA 4XUDA 1H22A 2YNMC 1F6BA 5BV2P 3PFGA 3EOZA 3R2JA 3JQAD 1N2JA 1QHHB 3W2EA 4JYMA 1MF7A 2X4DA 1FF9A 1MNQA 2MINB 4HAUA 3E8SA 4U2BA 3DP7A 3C3AA 4OGWA 2OLJA 2OHXA 3DOCA 3AKDA 1EG2A 4HPJB 5JAQA 3GEHA 1BWSA 1JDZA 1R0CA 1Q0UA 2ZSIA 1WDTA 3H4VA 3OF3A 4QJBA 4IJMA 4PAGA 1KH3A 1XTZA 1G1AA 2JHCA 2NQ8A 1U8ZA 3NBMA 2IV2X 4Z0NA 3D1JA 3P9PA 3PE4A 1NF8A 4I9GA 4JJZA 1M0SA 3ILXA 2G71A 2VDUE 3W2IA 4Y6LA 5T64A 4YRFA 3K9GA 1RBYA 4O2BA 4P3NA 2QZ9A 3T7KA 2UVPA 2ZM6B 3TQCA 2HX1A 5DASA 1XRQA 1EZZA 4ZAZA 1BG6A 1V5WA 3KL4A 4JQOA 4QDXA 2D7CA 4JJ8A 5HM8A 2WR8A 3B8HA 3Q2IA 3OQ1A 3USZA 3ISVA 4RYLA 3K0SA 2FG6C 2VA9A 4NOLA 1Q15A 1MHPA 2G83A 1ZD2P 2NUPA 3Q85A 5ED0A 4BN4A 2W6JD 5LKAA 1JMYA 2H06A 4RYDA 4JUIA 4KREA 1IQRA 1I1OA 1FSZA 5HTOA 3OZXA 1FDTA 1JG6A 1F14A 5DMHA 2ZJYA 1NJ1A 3K0BA 1CSEE 3RW9A 4D6YA 1QPGA 3IJEB 3RK4A 4LDAA 5CM9C 2ONJA 5L3SA 4Q7QA 1POXA 1RCTE 2XZOA 3A6DA 2QSJA 4WKBA 3SKYA 1XNRB 1S4MA 4JLNA 4QOEA 1XFDA 5L7YA 2C1EA 4XRGA 1SUAA 6LDHA 1KYQA 1EUCA 3DZDA 5LQSA 3W8EA 1IIRA 4AZVA 5HQTA 5LNK6 3OEEA 2A9JA 1SHLA 1EVYA 1XVIA 2G3YA 2LKCA 3DVAB 3OH8A 2JJYA 4I50B 2G08A 3O95A 3KFXA 2HBQA 1U7WA 2FY8A 4K9MA 5AVWA 1LDBA 1XZFA 1WEHA 2GZ3A 2WWWA 3F74A 1E5TA 3OOYA 4HPWA 4CIDA 1CUJA 1PQ4A 2JFUA 5DTJA 4PTLA 1Y9JA 4M83A 5E95A 4AT1A 4AUEA 2YWGA 4URHA 4QTZA 4LIPD 4TQAA 1FLAA 5AOAA 1PYGA 3BE4A 3FJOA 4DAOA 2Q0XA 4I5GA 4KI7A 3SHWA 5TPWA 4U2GA 3T12A 1G59A 2HRCA 1F12A 3C8HA 1XVLA 1PUIA 4H6XA 2PUVA 4J8PA 4NENA 1DRWA 3OCWA 1T8UA 5CA0B 2TSYB 4DA4A 4MW7A 1CJKC 1Z4OA 4G07A 4X94A 1LSOA 2HV9A 1P60A 3HHEA 4ZVQA 1ZUWA 1MXHA 2Z09A 4X84A 3CXRA 3T0IA 1S4QA 1ENOA 3PXAA 1V25A 2JGDB 3WLLA 1E5VA 3E7XA 4KXQA 1EM8A 4UEKA 2QVXX 1FE8A 4Q1EA 2WM2A 4I1SA 1ILEA 4B7XA 1UKCA 1XB2A 2O23A 3BK1A 3DMTC 3LDUA 2EU8A 2ZROA 4M98A 5EUMA 1S89A 2XUGA 4JZYA 1WLSA 1YK0A 2FZ5A 4K5QA 3ZN2A 2A1TR 4EA7A 2GN1A 2FEPA 1VMKA 2QW8A 2WYUA 3M6MD 1PT8A 4RHXA 5AKYA 3VZDA 1YRHA 1Z8HA 2UZ0A 3W2HA 5A5FA 1I7SB 1IZYA 1LGYA 1G3RA 2J09A 4MIKA 1C3JA 1Y4SA 3F4BA 2CHUA 5DXJA 2HFJA 3FNBA 3A3KA 1K9SA 3MVEA 4RDCA 1PFKA 5DBGA 5TARA 3SI7A 5BMVB 1UXJA 3HXOA 1VG1A 2Q5HA 1M5UA 2JHPA 2ZAMA 3LVBA 3M6AA 3ZH9B 2RAFA 5EHGA 5LZ5A 2CT8A 1C3XA 1ECCA 2H48A 4HEA1 4P5EA 3KCQA 1DLIA 4Z0TA 3ZOKA 1SXQA 3DMNA 1NL3A 2IPLA 5F12A 2P1ZA 4QUAA 4Z49A 2HCBA 2ZB2A 5CLFA 2NO4A 2I0FA 1LXCA 1OVMA 1VCMA 2FUKA 2NU9B 5KBYA 1ADGA 1EA7A 1X7YA 3I6YA 4D41A 3U16A 3SF8B 3VZCA 4XAQA 4F93B 7ABPA 1COWD 1K5GA 1CKEA 1W0JA 2G0NA 4U7GA 3TS1A 4RJKA 3ZG6A 1L7XA 4EW6A 3GLGE 5GP1A 5F7OA 1TJ4A 2SCUA 2YWFA 4MQ4A 4WLFA 3UFBA 4RTJA 1LCIA 2Q3EA 1N8NA 1ESDA 3V3TA 5FEMA 3C1OA 5BR7A 4QXPA 1M6WA 1XZDA 4YWHA 3QXXA 3N5KA 3IAS6 3GI1A 1OWOA 3RRMA 4XFKA 4LOLA 3W8DA 4MA0A 1RI2A 4UDXX 3OG9A 1E7RA 4NMWA 3BCSA 3VBCA 5C37A 1JEAA 2O5VA 2PKRA 2RGWA 5A05A 2HXSA 1NBIA 2VHTA 4XM0A 1RTKA 2DFVA 5DGDA 5A1TA 3PFWO 3U5TA 2ENWA 4JJ6A 3NQ41 2NZYA 5JSZA 3W04A 1TI7A 2OL4A 2WP8J 4GP7A 4AWXA 1YFLA 1Y3IA 4RUKA 3OZUA 3Q40A 2EHDA 4O2AA 3RVMA 4HLDA 4M1EA 1QHXA 1DUSA 1XEWX 3BKWA 4MVJH 1E8MA 3VNVA 2D5AA 1JHXA 1B76A 4LE2A 4ZVTA 3OU2A 5KJEA 4DG8A 4LXUA 3FCEA 5B3KA 2GEVA 3EXIA 4PFSA 4IBOA 1QBGA 1HKHA 4KZPA 5AMXA 4E15A 1G5TA 1IBRA 2P2NA 2XODA 1BVUA 1NPTO 4V0OA 3PEYA 2MYUA 3TOCA 1YI0A 3LGAA 4CF5A 2VJDA 2HA5A 5A4DA 4WADA 4JROA 3H5RA 5JH7B 4I3GA 1GRQA 2CHFA 1KE2A 3Q9NA 2VXCA 1T5HX 3QOFA 1Z17A 2VT2A 5MN4A 1EFLA 1TZKA 3JX9A 1JDNA 1UBJS 1Z28A 5AI5A 3D4PA 3WQQA 4AIIA 3GBSA 3ZD8A 3FZEA 4UNIA 1E20A 2NVOA 3TLKA 4LJAA 2D1SA 3VHLB 3I5AA 2GMWA 1IOWA 1QC5A 1PSZA 1U9JA 2PRYA 1E6CA 3GNSA 4FXOA 2JARA 4JL8A 4M46A 2BJHA 3GELA 1XYYA 4I50A 5F5LA 2ZYWX 4EUNA 3T3HA 2GN6A 4IDCA 3WGZA 3CJTA 4BLSA 3ZXSA 4D2IA 4TLEA 5FFMA 4IJ5A 3PP8A 4CG0A 5HM6A 2PGOA 2Z0MA 3ACDA 3ROZA 1NJ5A 2HL6A 3HJTA 3UXMA 3DMFA 3KBBA 1VSVA 5A3VA 3CG0A 3W5VA 4EQ6A 2WUWE 3PWTA 4ZK2A 1ETUA 3OFKA 2FZVA 3KUUA 2HB6A 2QRPA 1XMJA 5GZ6A 1KQPA 2X7HA 3FWZA 4NAUA 5TEWA 2AEJA 4BMZA 4HVCA 5AH0A 3U37A 4K9OA 3ESRA 1BFDA 4OXRA 2I1VB 4R2MA 4BL5A 1CUBA 2CLDX 2VJMA 2XB4A 2Y0DA 4BBZA 2AN4A 2AJDA 4N39A 4W99A 3DNFA 3A1WA 3W5DA 2Y9PB 3AF6A 2JS7A 4JBNA 1KYVA 1B3RA 3WLIA 5I7VA 5HKLA 2NYVA 4FD2A 3NS7A 2IV3A 1CC1S 2UKDA 1DX6A 2JIPA 5DV9A 2W42A 2QRVB 3I76A 4OH7A 4L0CA 3NR2A 4YMVA 1B3BA 1FUEA 2Q99A 3PRJA 3VKUA 4C6HA 1TJ3A 1X7ZA 1Y1QA 4J3NA 4PO1A 4IMPA 3QNUA 4EJ2A 2IU4A 3FW1A 3STYA 2MOKA 3A4NA 1TJPB 3HYNA 2FRXA 1XF9A 4P38A 4JOSA 1PJ3A 1I0LA 1ZRNA 5HHTA 2YYAA 2JFXA 5D87A 4KNWA 3B8EA 2Z4TA 3UMMA 4UM5A 2NU8B 3UH1A 1FTQA 4H7KA 1EJBA 3NH9A 4L5JA 4OHPA 4J29A 4L27A 3ESQA 2BFNA 3M83A 5LQCA 5KOHB 2BP7B 5EOVA 2XVZA 2VHEA 3DAGA 4XJTA 5I7OA 3SQDA 1ZONA 2I65A 3ONVA 4J2OA 1T26A 1JS1X 2WFLA 3CXUA 3ROPA 4NCBA 2Q1SA 4IM7A 1GPKA 3H1TA 1ZNQO 2GILA 5IDWA 1ZN7A 2IFTA 3ZDRA 4D96A 1ZAKA 3V8PA 1KK2A 5KAMA 5KNLA 3OTOB 2QI9F 2ZI9A 3HJFA 3CZCA 4YAOA 1OB2A 1EDOA 4JVMA 1KO1A 1MABA 4M54A 4Q9IA 1UJ6A 3E1GA 1ID8A 2CUNA 2QENA 4MWTA 4X1KB 4BEVA 3ESXA 1TEXA 4BQPA 1PJTA 2JIOA 5SZKB 4B2PA 2Z4RA 1RXWA 2PSSA 3ZNNA 2I66A 3ORHA 3UMGA 2HHHB 1N3IA 4NU8X 1QGOA 3ICVA 2Y1DA 3C3CA 1PR2A 2XKJE 4UKDA 4WERA 4CLHA 3W7AA 5B3JC 2QORA 4G4GA 4ZQBA 3WGLA 3HCPA 1ZM2A 4XVRA 2H85A 2GZ2A 3C3DA 4DANA 2O52A 2BR3A 2NXEA 3BRWA 3F73A 4JLVA 1KJIA 1Y7HA 5FFNA 3ZE8A 3ME5A 4G6ZA 1A9ZA 1F5NA 2QTGA 3W8FA 1WVIA 3N5CA 4RV5A 4I8XA 3RODA 1EGHA 4JV5B 1NPDA 2ZWAA 4KIUA 3ITEA 1VA4A 2JGNA 5A62A 2R6GA 4BFVA 2QMUA 2CZGA 1MV8A 2DH5A 3G59A 3VVCA 3WLMA 3ZVNA 2GN2A 4NU5A 1KDOA 5EKUA 4E2ZA 4LDQA 1UZLA 2IKSA 3N8HA 5IZCC 1OLXA 4LVCA 2FZGA 4Q1AA 1SH7A 3MBIA 4UHFA 5THXA 4BJ5A 3V4RA 1L5RA 3IDQA 3QKUA 1EDZA 4DUGD 2QJFA 3PHLA 3MNFA 4LRWA 4ROTA 1DOZA 1PCXA 1QJ4A 2OO3A 4BNDA 4HX2A 1H1LB 1RAIA 4JP8A 1CYDA 5JAOA 5AJZA 1RP1A 1DAKA 1TKRA 4IHJF 3ZYCA 3DMDA 5I9TA 5BRJA 1FYVA 1BYUA 2PX2A 3GDOA 2AK3A 2VTBB 3ZU4A 4R8KA 4ER7A 1SG9A 3EC1A 4CQMB 4WK2B 1B23P 3TXXA 2XWQA 1MZPA 1BMQA 1F8GA 1LB1B 5GMOA 2O2XA 2N9UA 3F3YA 1THZA 1D4OA 1G20A 1UP7A 1J99A 4BVHA 1AKRA 1W4RA 4DV3B 2WD7B 2GKOA 1TQDA 4NYIQ 4EKGA 2BI4A 4FJ0A 4I4TB 1Z35A 2ATCA 2ZYDA 3N8NA 3DE4X 4M9XA 2PRKA 4R2HA 1Z07A 4KDEA 9LDTA 2BMWA 2QUIA 4IDQA 5JU6A 2BGRA 1MRSA 1QFYA 5CNMA 1KEZA 3W5BA 3WBFA 5JIBA 1IEWA 3BBPA 2P9CA 2VLBA 3A1SA 3UB2A 2VF8A 2ZOSA 4WJLA 5TS2A 2B0JA 2A0KA 2IPNA 1GGNA 4M22A 1Z4KA 4LYAA 2Q5FA 3ZLBA 3B51X 4FEAA 4NZNA 4XIJA 5C3UA 3CCBA 4RIFA 4R84A 5LM3A 2DOKA 1EHCA 1NP6A 1P7ZA 3DW3X 4WKOA 2H54A 1XHEA 3H2BA 1ZOOA 4OHOA 4R54A 3SZLA 4CT4B 1H0KA 3AY7A 1ZSNA 5JBQA 5JR3A 4DARA 2B4RO 1HRDA 5CXUA 3HN2A 1VYVA 1OXSC 4GYWA 1L7MA 3I9V6 1TLFA 4ZO6A 1KY2A 1L7DA 2QTVB 3LRPA 3MGBA 3ZJTA 1Z5PA 3K5IA 1A04A 1C8LA 1ECLA 1ZPDA 3T3GA 5LJIA 1NXPA 3LP5A 3WVNA 4D4MA 3OAAD 5B1EA 2HGSA 3UV7A 1UPXA 3HLYA 3GRUA 4ZYUA 5C8DA 4TRJA 3GPBA 1ECFA 1Y1RA 4WXMA 1VE5A 3R0VA 4R1LA 3ZY2A 3HI6A 2FPUA 1LX7A 2E55A 2VXOA 3E70C 5FPHA 4DMLA 1G21E 4J3JA 2F8MA 4P4LA 4DB4A 3S7ZA 2P9HA 3SEQA 2DT5A 4J7UA 1IZ9A 1ORDA 3PQ6A 4N0DA 3RUCA 2PUFA 2ID4A 1XQ6A 3O2JA 3F8SA 1WIWA 3OIUA 2ZJ4A 5F2OA 3KSAC 3FUCA 2BP7A 2HREA 3OZVA 4WHMA 3HM9A 3MAJA 4H6PA 2D54A 5FO1A 3A58B 2HZBA 3RUFA 1KP2A 1E5QA 4IPTA 4JLKA 1QSGA 3WB0A 1DFIA 1KMMA 5LB4A 1U28C 2V5UA 1EK5A 3WMWA 2OORC 3U39A 3TKAA 4H1WA 1CVIA 1DRJA 1FUKA 2O2CA 3DDCA 3QPAA 2OZEA 4IYRA 1UIMA 1VE3A 3WGQA 2GX6A 5IFKA 3FTEA 1Z56C 3KOMA 1Z33A 4K40A 4AKGA 3D6AA 3AG6A 1WW2A 1OAOC 2P4HX 1XXHB 1WXDA 2YC4C 4C3VA 1Q22A 4HQRA 2Q50A 5JZBA 2HMTA 2COEA 2H7CA 3LHKA 4FYWA 4RGBA 3SYKA 4PZEA 3D0RA 2ZI3A 4L16A 3CF0A 2EJCA 1R4MB 5MFPA 2PIDA 2CEKA 4KR7A 1P2UA 3EDRA 5H9VA 4AY3A 4D9BA 1O94D 1OR8A 3AHCA 3ZNPA 4EF5A 2C29D 5BR8B 5LVAA 4IVRA 6Q21A 4LPKA 3R9IA 4Z3KA 4G85A 2E4AA 3VJKA 4UFPA 1AC5A 4HCJA 3ZIUA 1JEQA 1M2OB 1QHGA 1YKGA 2FN9A 3HB9A 3BEOA 3LVQE 3WK9A 1J90A 1GPUA 3KR9A 3L6OO 1RLTA 1UT8A 4GBJA 2ZIXA 5IVHA 4JJGA 1MJGA 3BB3A 3MG9A 3DDUA 4KWIA 2OILA 2PQ6A 4LRQA 3G9QA 4ZHQB 4B81A 1NXOA 4P4UA 4RPLA 1U99A 2V0CA 3PD1A 3IH5A 4KDRA 2FZLA 4Q3EA 1DWPA 4R05A 5F3DA 3QNMA 4LHWA 1NJ6A 5E3JA 3SOZA 3N0XA 1KOLA 2IYYA 4BZWA 4F7DA 3M81A 1QYVA 3RHFA 4J43A 4OF4A 3HDTA 1FNMA 1UDRA 2DHCA 3HZZA 3JWGA 3NIFB 4OHMA 4IQ0A 4V3CA 3W4IA 5GADl 3CNBA 5A9TA 3PQ8A 2ODPA 3Q0IA 2A92A 5YASA 4J0DA 4FW8A 4UMDA 1RAAA 3K5HA 1N8KA 1FS4A 1SXGA 3QP9A 5F33A 1NDUA 2QVLA 3A9SA 4DSZA 3C5WP 4U39A 2I33A 1W5FA 3OLXA 4BVBA 3R6LA 4G2NA 3I83A 4KUEA 1FX0A 4CKXA 2EV9A 4B5KA 3O0TA 4L9SA 1U4SA 2DWCA 4J0CA 4IGIA 4KOEC 1YKFA 1ZBQA 1L7BA 3INYA 1RHQA 1U5AA 4W9RA 4KQKA 4MULA 4G8BA 4BX8A 3M4NA 2GERA 1QIIA 3ZCSA 4ZOAA 4DXDA 3DBLA 1JIKA 4OMDA 4MDHA 5KYWA 1KS9A 3C98A 2D7JA 2R8PA 5JZMA 3ILSA 5JASA 2PS0A 2OXFA 3AINA 4TSFA 3TBKA 2P41A 2HNAA 2BEWB 2Y4OA 1HNWB 2FPMA 5B7GA 2PA0A 1RWNA 3DBHB 4EF6A 4LRSB 4QTUB 2F1HA 2A9RA 2EKQA 2C0CA 2VPIA 4O3FA 2P9JA 3DCJA 3PE3A 1QOPB 2WF6A 2RHHA 1NTRA 1CE8A 1Q0PA 4HWRA 3RRNA 3E9MA 3ZZMA 1XR3A 2HDHA 4EG6A 2OK8A 3H5IA 1RBQA 3WWOA 5KIAA 4DTIA 3MHTA 1GKLA 4G0PA 4G4SP 3IP8A 4RELA 1Y4DE 3ZE6A 2R79A 1KGSA 1KP3A 2FZ4A 1YRLA 3QKRA 1RCFA 3N1UA 3SMQA 1AKMA 1IPFA 1GA6A 2OYSA 5GOTA 3RKUA 3FWKA 4POOA 4PRKA 5CT9A 3NV9A 2Q3LA 3PPYA 3RSHA 1CUVA 1V96A 2WFMA 4FWIB 1OJLA 4OFBA 4F5YA 3HCWA 1NMXA 4PQYA 3VTZA 1R0LA 4BX3A 1P44A 1TVKB 5L4LA 2C2HA 2NV0A 3E7PA 4G1FA 5LQRA 2G09A 2J30A 1BOFA 1U80A 4K9SA 4R8RA 1P2GA 3S81A 1MB0A 1I1QB 3QPBA 3SYRA 1NT4A 5IC5A 1Q44A 1CERA 5FO0A 3OZAA 2OOSA 3TOZA 1KFJB 4OKSA 4OXXA 4FYXA 2M1ZA 2UZ1A 3IA2A 3STWA 4GQAA 5K09A 3A1TA 3UKOA 5E6RB 2PUTA 4RABA 1P1RA 1PNTA 4OYYA 1Y3DE 3GEBA 4KRYA 1SCKA 1B26A 4C7OB 1ZD4A 4PR0A 2FETA 3OQ6A 1SZPA 4CMKA 3L8YA 5IX8A 3C6ZA 1AK9A 1FP4A 3HA5A 4GQIA 4LHYA 4ENPA 2F59A 3TMKA 1FYWA 5AW1A 1N0VC 1UCFA 5BUZA 5JARA 2QLJA 3KJFA 4MSUA 4YO8A 3WA7A 1GYQA 2EL9A 3OFVA 1QLHA 1MORA 1R3DA 1Z7WA 2PZGA 3LX5A 4JLJA 5E7MA 4B3CA 2BW0A 1OXBB 3ZWNA 4L3OA 3RFVA 3ZBPA 1P0FA 2FW8A 3QVMA 2DHQA 1O9BA 1WRBA 3FTFA 4PRLA 4JDUA 3HEMA 1OBVA 2DFDA 4PXSA 2V0GA 4QYMA 4DMUB 7MDHA 3D3JA 1C41A 5B1DA 1LDYA 2X2PA 2IVFA 4DSOA 2Y93A 3RVOA 5B7PA 4X66B 3C16C 4DNPA 1GUYA 3ZTWA 3CLRD 1PQWA 4ZVPA 1HL7A 5DWVA 2HHLA 1KPHA 4NZ9A 1E9RA 1M2OA 3DDZX 3IR5A 1DMRA 2MYTA 2RAUA 4E2YA 1JHQA 5E38A 1H2XA 4IHJA 2WKRA 3RRYA 1BHO1 1JA9A 3USES 5DCUA 5ALVA 1YJBA 2RKOA 5AI0A 4YHHB 3AF1A 1P1BA 3UTCA 4UD2A 4MCIA 1CZKA 5G4LA 3U7JA 2ODTX 2CNBA 4QULA 1Z39A 3RNLA 1Q0TA 1U0BB 3I9MA 4NCHA 4W9NC 3NGMA 3ZWBA 1T43A 1UJCA 4IDGA 4LVUA 2V65A 1AXRA 1UM8A 3H7IA 3QYPA 4S12A 1X92A 4HQFA 3WYEA 4C20A 2YMMA 4DV1B 3KHSA 2Z2KA 4PZZA 5EN4A 2RGYA 2X14A 2QXTA 1UMBB 3OEED 1C7QA 2C9BA 2I7CA 1CFZA 2HF8A 3KYCB 4WCFC 5IJXA 1HSOA 3SVLA 1C4OA 3K09C 2R66A 3IDZA 4A6PA 2IVZA 4Q3CA 4PSVA 4QOGA 2QKYA 4RZIA 4JD5A 2R6CA 4RHCA 2NN3C 1L8OA 2Q07A 3P0JA 3EFOB 4IDAA 4BBJA 1LRKA 4N03A 2YQ5A 3GJ4A 4GXTA 3TOXA 1Z6QA 2G72A 1J49A 4A9AA 1YDMA 3S29A 3L8MA 3HPQA 3RUAA 1V6SA 2BISA 1CCWA 1YJ8A 2BKLA 1A4IA 2DUNA 4PG5A 4ZT2A 2G06A 2VR1A 1ITZA 3I92A 2QPAA 2H31A 4OJTA 2VDWA 4U5QA 1LRJA 3D5QA 2QMOA 3DE7X 1CDZA 3CLSC 4IQ8A 2IYTA 2H1OA 1FTSA 1H0SA 3ICOA 3D31A 1G8PA 1DL5A 1XWWA 2PZLA 4WEQA 5AVXA 4PXYA 4J1TC 1RJGA 4CG3A 3CSDA 1U7OA 1Y8RB 3BMOB 3DZBA 1GT6A 4WNYA 3U4QB 2QRQA 3IFSA 1IAVA 2ODAA 3FDXA 3IUSA 3QBVA 4E5KA 1NP3A 3ZX4A 1IXSB 3I39X 2XV1A 2LP4Y 2MDTA 1T9BA 3TDNA 4OQEA 2Z43A 1REQB 3P19A 3OUZA 3PTZA 3LWBA 3H2GA 4TLDA 1EH5A 3IUQA 4YGXB 4ER0A 1KFCB 4PONA 3RTBA 4CHTA 4DLPA 1L4LA 1RBZA 1Z73A 3H9JA 4N7MA 4M21A 1NHWA 4OQMA 3UT5B 1HDXA 4L22A 3B6MA 5EIEA 4ZT5A 2CUKA 4A8PA 5KX5F 3IQDB 3HYCA 3X3HA 2QS9A 5A9RA 1ADYA 2CDBA 2W2LD 4PQRA 7REQA 3FYUB 2ZRBA 1AF7A 4OFWA 4LRXA 5L3QA 1WB6A 1GEGA 4QPJC 2HU8A 1V8DA 2GJ8A 1DFGA 3B2EA 2OHOA 3IP1A 1EFVA 3OFSA 1XC7A 2FX3A 1DI0A 3E9YA 1DXQA 1OX4A 5E9WA 3UOAB 4EYKA 3U7FB 3EEQA 4AULA 2YIMA 1URPA 4C1BA 2YXPX 3HEAA 3U60B 2FG7C 1YKSA 3DPUA 3FXAA 3R6TA 4IWYA 3JASB 4L5AA 4I8DA 4QBGB 4QG7A 4BFUA 5CFQA 1OXUA 4NZYA 4O4HB 3UWMA 2ATIA 1W0JD 1CU1A 2OK7A 4LJ5A 2LPMA 4XRRA 5E6RA 5A5EA 3KZCA 5D1HA 4BWFB 1CS4C 1O9GA 1GLGA 3INRA 3TLGA 2QNRA 5FHRA 4O4LB 3KAPA 5T7BA 3NOVA 1J21A 1N7IA 2DRIA 2XXJA 4Y2QA 2GHTA 3THSA 1BDMA 1A7JA 1ORIA 1FTYA 2JL1A 3GP5A 4GGMX 4UJ3A 4F1KA 3Q9LA 3ZJ4A 4EPTA 4KVAA 1KKLA 5FWYB 4H3VA 3O93A 1UANA 1Q7TA 1E62A 2OD2A 4YIHA 1TUEA 3ZWKA 1VZ2A 2DPHA 2ZB8A 1B8NA 4BIMA 4HUTA 3WAGA 1GAJA 2RIPA 3ZGVA 2JLAA 3AFHA 1EUQA 1M1YA 3CO5A 4A26A 3UC9A 2ID7A 4X71A 2BKEA 3G2OA 3OKFA 3UUGA 1E60A 3FHLA 8GPBA 2G7ZA 3NIDB 4CCYB 1D04A 1SUPA 1UBNA 1HDIA 1NN1A 2VF2A 3IAEA 4MS3B 3ROMA 2JZNA 3AEUA 5B3LA 2ZWIA 1HTBA 1LBHA 1PJ2A 3DEIA 1EPUA 1Y5IA 2IL1A 2W8BA 4PLGA 2F43B 3OCJA 5BY2A 1PJZA 1BKDR 3BMNB 1KYZA 2MJLA 3CRVA 4YS6A 3U44B 5ERGB 2UZ3A 4FGWA 1Z6AA 4Q0MA 1H42A 1LVUA 2BFFA 3KKOA 2G0AA 4UOQA 5JC8A 1Y89A 1DAPA 4L51A 1VRVA 1HZZC 3ZWOA 1E1YA 1CVRA 2B25A 4JUBA 3RD5A 3CPSA 4R40A 3EXEA 3PCTA 3NASA 1K6EA 1L7VC 1T5IA 5HYVA 3ECSA 2XOKA 5HZKA 2QJWA 1PV2A 5K2OA 1RI3A 3QPVA 1G5QA 4N40A 5DI3B 3M34A 4Q4HA 4ND1A 3QMVA 2H2WA 4C2UA 1GL6A 4D0SA 4OQPA 1IY0A 2R7KA 3HGQA 2CE2X 1L1FA 3SZUA 2QYTA 4GLFA 4DV4B 3ZKWB 3BCRA 3LA6A 4RZ3A 2DBZA 1J5XA 4DV7B 4UDOA 3C7KA 2YDXA 1CTQA 2PZKA 1PVOA 1MFZA 4LWOA 1XEFA 1GTZA 1ICEA 5DGTA 4YMGA 3P2EA 2ZBRA 4M8SA 1BQEA 2O1XA 3EGDB 3O4HA 4Q9DA 5T67A 3A37A 4JC8A 2EW8A 2C7QA 4KNYA 5EE3A 2JI4A 1BVHA 2C2BA 3RRFA 4X95A 3IURA 4HEHA 2VF4X 1IVSA 2WB4A 3IALA 3G2MA 3R0QA 1YA6A 5CHEA 3RI3A 3OI7A 2PX0A 3VU9B 4CMIA 4ECEA 2EP5A 5THKA 4ABTA 3W6OA 4WXHA 1Z5ZA 1QR2A 1TAGA 5ALRA 3WLTA 4CXMA 4NHOA 4PBSA 2OCKA 1CW2B 2JLBA 3Q3VA 3MCVA 4LZWA 4MUFA 3A4MA 4PS0A 5JPCA 4WX2B 3WTBA 2IITA 1ODSA 4R0NA 1VKRA 4E12A 3LPCA 5ICCA 3HLTA 1JH9A 4Q9KA 4FE3A 2G36A 4R2KA 1CRQA 1J42A 1I7LA 3AP1A 4F2GA 3AR8A 1MVOA 2Q62A 2P6RA 3CURA 3WGKA 1KDZA 2Z6AA 2Q1WA 3V1TC 4N54A 4C14A 1G19A 3QIVA 1GGMA 1CY6A 2XMGA 1MW8X 3MGAA 4QAQA 1UOEA 1U3TA 1UAAA 3ICQB 2ZUWA 1IHOA 5DNDA 3SC2B 1ZAYA 3OWOA 4BGUA 3CW8X 2V3WA 4KQIA 2AW3A 3D4LA 3EQ9A