5IXYA

Lactate dehydrogenase in complex with hydroxylactam inhibitor compound 31: (2~{s})-5-(2-chlorophenyl)sulfanyl-2-(4-morpholin-4-ylphenyl)-4-oxidanyl-2-thiophen-3-yl-1,3-dihydropyridin-6-one
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
331
structure length
331
Chain Sequence
b'ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Cell Active Hydroxylactam Inhibitors of Human Lactate Dehydrogenase with Oral Bioavailability in Mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxireductase/oxireductase inhibitor
total genus 117
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5ixyA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5ixyA02
3GUYA 1MXHA 2J5QA 2HK7A 4GVLA 5I7FA 1FXSA 2AXQA 1P9LA 2EP7A 2X9VA 2WD8A 3IIEA 4UVIA 3UOGA 2O3RA 2BI8A 3ASVA 5ITWA 1GUFA 1SOWA 3G17A 5T64A 4BO7A 2I9PA 1MV8A 4K26A 3RWBA 3NDRA 1PJ4A 2NWQA 2IXAA 1O95A 4YJDA 3RSHA 1EFLA 3H3JA 3W1VA 1NVTA 5U1PA 4N5LA 4YJFA 3U4CA 2NQ8A 3T4EA 1M76A 2OL4A 1KBZA 2FSVA 4K6FA 1FDWA 1SB8A 3ZHZA 3IKVA 4PFJA 2Q1SA 1JAYA 1PS0A 1W8DA 1LSJA 3PYMA 4WE3A 3STHA 1DOHA 3FD8A 3GZNB 3HFGA 3GVPA 4IJVA 3WIDA 3WSWA 2YYYA 2O3QA 1Q7BA 1YGYA 4IMRA 3WGYA 4QQRA 1U2DA 1YOVA 2V6FA 3JQ7A 4IXTA 4QO8A 1BXZA 3MEQA 3C1TA 3E8XA 4TZKA 4UULA 3QVWA 1RJWA 4NFYA 4CV3A 1ONPA 4W6ZA 3LLVA 4XCVA 1IE3A 1NFQA 3DQPA 1WW8A 5IDWA 5DBFA 1HYEA 1F8FA 1TT7A 3BXXA 1GUYA 4F45A 5B1YA 3EVNA 4EEZA 1JKIA 4WLOA 1F12A 5U9CA 1JDJA 4BUCA 2B4RO 1VKNA 1HYHA 3FWNA 5CFZA 2B37A 3QE3A 4AG3A 3JCZA 3WYCA 3TF5A 1X0XA 1YB5A 1SZJG 4IS3A 4JROA 4WOKA 3MTJA 1TLTA 1ZEJA 4FPXA 1E6EA 4CMCA 5MGBA 2AEFA 1PJSA 4ZQEA 3VKVA 4OO3A 3HG7A 2BFOA 2VWGA 4M1QA 1PQWA 2X5OA 2FRDA 3KM0A 1P1RA 3U49A 3VHRA 4ALIA 1NQTA 1DC5A 2VOJA 4FFOA 1BMDA 4RZHA 2VUTA 4KDEA 1XYGA 1P44A 3DAFA 1MFZA 3H9EO 3RI3A 4JN6B 1R4MA 5DP2A 3LT4A 3H4VA 4YEDA 3JYOA 2UYYA 4ZICA 3GG9A 4NBWA 1DFGA 4H3VA 3ONDA 1KEWA 1ZK4A 4GMGA 5EJ2A 3WG9A 1H2HA 1DSSG 1X15A 4MKZA 2NQTA 3JQAB 2GASA 2DPGA 4FIZA 4XX0A 3VTZA 4J1SA 2O23A 2PGLA 5KJ1A 1N7HA 4CJXA 4P4GA 4BGEA 4HX5A 1E7MA 3GQVA 3VDRA 4UUPA 1YL6A 5HRUA 1HDXA 1ZXLA 5IN5A 3DBHB 2HCTA 3JQDA 4J4BA 1CF2O 3L6OO 3WXBA 4E30A 4AJEA 1LX6A 3DR3A 4W7HA 3U0BA 3AY7A 1MXFA 3UFXA 1K5HA 1PGOA 4MJLA 3ABIA 4O5OA 3NT4A 4HWKA 1GD1O 5JNLA 2NU6A 4A2CA 4BO6A 3BZUA 2PA3A 1P1HA 3ZHBA 3ONEA 4WNIA 4EITA 4XYGA 2UUOA 4NQZA 3DMTA 4DWVA 4CM3A 4S3MA 3GFGA 1IZ9A 1A4IA 1PGPA 3FNHA 4E13A 1ISHA 3JD4A 2HAEA 2IRWA 1D4FA 2OO5A 1GUZA 1LRKA 3NKLA 1NWHA 9LDBA 5H82A 3WBFA 5K0ZA 3GGPA 3ITDA 5EPOA 2A9FA 4H16A 5EN4A 4R9RA 3C3XA 3RUAA 3F6YA 3ZI0A 4YT2A 1DJNA 3FPCA 2O4CA 4KUEA 5C7IO 3GVXA 1OZAA 4YJFB 2VQ3A 5K6AC 4MVJP 2B5VA 2F00A 2FR1A 1U5CA 3U5TA 2EJVA 3JQAD 4BO3A 4OXYA 3D3EA 4CR6A 4GH5A 1S6YA 1YOVB 4IZHA 3JQ7B 2EKPA 4ND2A 1Z74A 1XQ1A 4BMSA 3ANMA 4EUFA 1YBVA 3TDKA 2X7HA 4UREA 1CETA 3FWZA 1WNTA 1GU7A 4NI5A 1DIAA 2GDZA 3WFJA 2G76A 5B37A 3RVDA 3WX0A 4HY3A 3DAPA 4MVJF 1JVSA 1LC0A 2DBZA 3AM3A 3K92A 5B4UA 4Y6SA 3JV7A 3B1JA 1Y9AA 4WCFC 2Q1WA 2HKIA 1EUZA 1HKUA 4CM8A 5DBGA 5HTOA 2ZTUA 4GWKA 1DIRA 3U4HA 2VWPA 4DXHA 2X86A 4QFDA 1EQ2A 3B70A 2C2XA 1RYDA 2HJRA 3KZVA 1U1IA 2RCYA 3L0DA 1GCUA 4GGOA 4E2WA 1NP3A 1EDOA 1ZFNA 1ZNQO 3PXXA 5KTKA 2EG9A 5IDQA 4R1UA 1YH3A 1GZ3A 1BG6A 3BHJA 4D7AA 1NAHA 3H7AA 3FPLA 1R4MB 4U0KA 3WGGA 2HMWA 2DU8A 1XIVA 3LQFA 3GFBA 3KO8A 4MOWA 1JWAB 1TI7A 2PGJA 2JCYA 3CIFA 3VPHA 2E82A 1XGKA 5TJHA 1B15A 1FDTA 1X7HA 4GQAA 3C85A 1ONNA 4RPGA 3RFVA 2H5LA 3PJGA 2WDZA 1B2LA 3AUSA 4BKQA 3GF4A 3RU9A 1I2ZA 3V1TC 4MIOA 4I08A 4IGFA 4HFMA 4BV8A 5KCZA 3GK3A 4IDDA 2NLOA 1LLQA 4DBVO 5C3MA 2X0RA 4G5HA 4N54A 4CQLA 4TMFA 3DMYA 4E5KA 4ZN6A 1C3VA 1D3AA 2ZKLA 2AEJA 1ULSA 3U62A 3CUKA 2HDHA 1DIHA 3JYNA 2YHIA 2J3JA 4WASA 3WMXA 2BGMA 3MCVA 4O1MA 3L6DA 2Q4BA 4FFPA 3ZW9A 4MO2A 3HN7A 3D64A 4Y67A 5FI3A 2XPCA 3LT0A 1KERA 2QIOA 2WEKA 4NMHA 3ZNNA 4EI2A 3WOHA 3HJAA 1A27A 1V8BA 5EIOA 2PH3A 3OP4A 4L8VA 2D1YA 1XCBA 3PIIA 2XF8A 1B7GO 2LDBA 3DZHA 2W90A 1DAOA 2O3JA 1MX3A 1ZEMA 5I7EA 3K6JA 1IPEA 3V5NA 2GGSA 3U4DA 3WGHA 3MTGA 1T2EA 3PQFA 1OI7A 4GI2A 4A0SA 4HADA 3LC2O 1M6WA 4YJHA 1PJLA 4IDEA 1E1LA 3FBGA 2Q3EA 3B1FA 2JCVA 4YCAA 3RUCA 2Y1FA 5F1OA 3V2HA 3QY9A 1GPDG 2YV1A 4UEOA 6ADHA 2RHRA 4PVCA 4CLXA 2DLDA 3RC1A 1N5DA 1J49A 5K9ZA 3V2GA 5G0WA 3O9ZA 1HE2A 3U3XA 3OA0A 3ZHYA 4RVDA 4BHTA 3OETA 2WMDA 3WNQA 3INTA 1PJQA 4FJ0A 1NQ5A 1DLJA 1ZSYA 4B4WA 4OOEA 3KBOA 3WDSA 1PQPA 1PZGA 3TZKA 2DUWA 1KVRA 3QWHA 3LF1A 1XHLA 2Y1DA 5K6AA 1KEUA 2EW8A 2ZYAA 5ER9A 4CM8B 4AJOA 1E3LA 2DVMA 1WAMA 3L9XA 4BNTA 4YB8A 2A92A 3M1AA 4AJ4A 1P1IA 4FGSA 5T5QA 2Y1EA 3DHYA 1EK5A 1BTOA 4BB6A 2DTEA 1KVQA 4CLRA 3HHPA 1NAIA 3ZNQA 1U8XX 3TWOA 2VN8A 4II2A 4MDHA 5L45A 4LK3A 2FWMX 4I8XA 2X0NA 3TZCA 4BNKA 4EEXA 4PG6A 2IZ1A 2DQ4A 3SJ7A 5DBIA 3VPSA 4BNUA 4N5NA 4FDAA 5CPFA 2GF2A 4OMUA 4RLHA 3HDQA 2PKQO 3OFSA 4RGBA 4OHUA 3QVSA 3FI9A 3F47A 3PEFA 4QECA 1YONA 4WCFA 4AVYA 4R3NA 3TFOA 1R12A 3D4NA 1CJCA 2QYSA 4NK4A 3Q2IA 2X0JA 2J6IA 5CDUA 1CEQA 2EJWA 4YT5A 4KOAA 5JLAA 2BFAA 2B4TO 2IYPA 1QSGA 1QV6A 3S8MA 1I8TA 4GX0A 3W4JA 4MP8A 1E7YA 4CQLB 1LDGA 4I5FA 1V35A 3DHNA 2PZMA 4CUJA 4FC7A 1DB3A 2YV3A 4PGFA 4O0LA 1ZJZA 1MC5A 1YQDA 2AG5A 1EZ4A 4ND4A 2Q2QA 2BKAA 4P38A 2YHIB 3K31A 3CEAA 2E49A 1Y9EA 4L9RA 5ICSA 2O2SA 1TA4A 3GDFA 4I9NA 3EMKA 1EUDA 3I1JA 2NSDA 2NU9A 3WTCA 5KIAA 3DO5A 1E6UA 2C5EA 4CLEA 3F5SA 2DUUA 1Z7BA 3NX4A 3TN7A 2BGKA 5ENDA 4RORA 3KV3O 4OJNA 4UUOA 5JDCC 1KC3A 4MVJE 5LDGA 5FWNA 4ND3A 5GMOA 2WM3A 4QFCA 5B12A 1BWSA 1UDCA 2RH8A 3ASUA 4J3FA 4DYVA 2HRZA 2NUAA 3PZBA 5F5NA 1LEHA 2BFPA 1PWXA 4CR8A 4BGIA 4D44A 4C7JA 1G0OA 1YDWA 4L74A 4YJHB 1X7DA 1CRWG 3EW7A 1HLDA 4E33A 3PIDA 4TKMA 1R0SA 5TF4A 1ZMTA 3GUCA 2D0IA 4FCCA 3K9QO 3JQCA 5LC1A 3TL2A 1PS8A 5U4QA 7ADHA 3CINA 5JO9A 1LSSA 1Q0HA 1MG5A 2I99A 2JHFA 4KUHA 1A7AA 4CODB 5BR7A 2DKNA 4PLWA 4PG5A 1ZXBA 3W4KA 1DIGA 4Z9FA 3KEOA 2Y0CA 4ALNA 3PWKA 4ZQBA 2VUUA 2O50A 3ENKA 5CEFA 1R66A 3H2ZA 1E7QA 3PHLA 4F3YA 1UAGA 1AXEA 3LU1A 3AM5A 1HE4A 3W8DA 3RUHA 1C14A 5JPIA 4E21A 4BKRA 5IZ4A 4ITUA 1E1NA 1Q0QA 3KUXA 4PLGA 1HF3A 1NR7A 1P33A 2YQ4A 3KRTA 2AHRA 4ILKA 2P9CA 3PFWO 1ZO8A 4JBIA 3D4OA 1SNYA 1ULUA 2G17A 4FSHA 4LRSB 1IB6A 3I52A 4OH1A 4F6CA 1QP8A 3E9QA 1I5RA 1Y5RA 2D8AA 2J3HA 3DONA 2X9GA 4CLRB 4CMKA 4JBGA 4GBJA 3VVCA 2GYYA 1YB1A 1NASA 2VRBA 4NHEA 5G4LA 1WWKA 2B5WA 4PLVA 3VPXA 4CMEC 1EQUA 5JFOA 4FD3A 2DBRA 4IQGA 4FOOA 1J4AA 3KYBA 3KSDO 1KVTA 1UXJA 2IZ0A 4PLZA 4GPD1 1F0YA 2Q2VA 1T1SA 4E5YA 2PZKA 5TLSA 3S1LA 3TNLA 1JKFA 5FI5A 4P4LA 3E6AA 3WGIA 4JP3A 3F1LA 3NGXA 5A04A 1U7TA 1WZEA 3IJRA 5I9NA 4WCFB 1KETA 2IYOA 1IL0A 4RF4A 4UVHA 3I9LA 2NV6A 3MJEA 4EDFA 2SCUA 3Q0EA 1U3TA 3G3EA 3IOYA 5HBRA 1HXHA 4LSMA 5DN9A 4XB1A 3P7MA 3B1KA 3BMCA 4LVUA 4U8GA 4E2XA 3JQBA 2EKQA 3EHEA 4HNGA 1W73A 3ROMA 3OIGA 4A10A 4L0QA 2JAHA 3EDMA 2HMVA 2ZATA 3DC2A 4LISA 3RFTA 3QWAA 1R0LA 3QVOA 4ZU3A 1UUFA 3WIEA 2B35A 4N7RA 3ZU3A 4NDNE 1BGVA 4BNGA 3JQGB 3KXDA 1EBFA 2OFPA 1N2SA 3ZV6A 8ADHA 2IZZA 3R0IA 3ZU5A 4A03A 3RQSA 1X7GA 4NH4A 3EUWA 3GOHA 2POQX 4RVHA 4NFHA 1E77A 1GYRA 2Q2WA 3TZ6A 1TB4A 3AUUA 3WJ7A 3GN1A 3D7LA 3ZWYA 3OQ6A 4XA8A 1NYTA 4BO9A 2Y05A 3GAZA 1NFFA 1A9YA 1UZLA 2VHWA 1GQQA 2B36A 2OORA 4EUEA 1T2AA 4YQYA 2ZK7A 2FPPA 3X2FA 5A05A 3RUDA 3HUDA 4IS2A 5KNLA 4ZVVA 1P45A 3KTDA 4BNJA 4JP2A 4TRMA 3V1YA 2NTNA 1HL3A 4HFNA 1PJTA 4D3DA 4DPLA 4WLVA 1P74A 3PGXA 5L51A 1EVIA 4DQVA 4RV9A 4XGKA 1IUKA 4YAEA 5JE8A 5JDCA 2C0CA 2CVZA 5JC8A 1KOLA 1O89A 4JLWA 3OF2A 4ZQHA 2P9EA 3FNFA 3TZHA 3B20A 1DRVA 3D5QA 5CP8A 1B8VA 3PLRA 3IAHA 1G0NA 3UH1A 2C59A 4ALMA 1P3DA 2ZB7A 1Q1NA 2JD1A 3LDHA 1LQUA 5COBA 4D45A 4D43A 1PS9A 1H94A 3NTRA 3WYEA 4ZGWA 1F8GA 3AY3A 1NM5A 1QXSA 3WLEA 3PGJA 3ETGA 3KLMX 1ADFA 5DCYA 3I5MA 2Q49A 4U0JA 2AG8A 4AICA 1K6IA 5KVVA 1V6AA 1Q7CA 1DHRA 2PR2A 4XYLA 3PWZA 3I3OA 4QEDA 1WPQA 2BMAA 4PLCA 4RZIA 4RF3A 2CDCA 3OH8A 2G1UA 1Z6ZA 4Z0TA 3DHEA 3NUGA 3OJEA 3GAFA 4KWIA 3E18A 3AK4A 2O48X 4WNCA 3DXFA 1LI4A 2EF1A 2Q46A 1CWUA 4UVGA 4PZCA 1C1XA 2CMDA 5ES3A 3ADPA 2GSDA 4UVDA 3SC6A 1I32A 3H9JA 3HE3A 1UXHA 3EAGA 2VZ9A 5AQ1A 1ZSVA 5A9TA 3RD5A 4CLOA 1YJQA 1FDSA 5T6BA 3QSGA 4XIYA 2DTXA 3KLPX 3S2GA 1C0LA 3WICA 1L7EA 2NVBA 3HN2A 4ND1A 2X5KO 3VPFA 3ZWCA 1SBYA 2ZQYA 4XGNA 5IXSA 5AOVA 1TT5A 4PLPA 4B8WA 4FJ1A 4BO4A 4XJSA 3BMCB 3WQRA 1LDBA 2HK9A 3VZPA 2NADA 1K6XA 1YO6A 1EEHA 3DTTA 3I9MA 4WKGA 1I2BA 3FRJA 4AJKA 1KVUA 2O7QA 1PU2A 1RM3A 1YS4A 2VZ8A 1PEDA 1QYVA 2QRJA 3PQDA 3WBBA 5KJFA 2ZTVA 3RJ5A 4J90A 2GPTA 3I6IA 3KSUA 2FZWA 3WGQA 2GLXA 5CPBA 3IP3A 2FR0A 1C0KA 4LRTB 4O6VA 1CQJA 4E2YA 1IY8A 4BNWA 3GY0A 5EMHA 5KJCA 1LDNA 2FPIA 2BF7A 4Z9XA 1E7WA 2JL1A 3VH4A 2ET6A 2Y93A 4DLBA 1MC4A 3W8FA 1ZCJA 4IJUA 3SXPA 5IXYA 4Z0HO 3K8ZA 2RIRA 2WYUA 4B8ZA 3MOIA 4HP8A 4O63O 1U4OA 1NHWA 1PR9A 5F1PA 3UHAA 1I3MA 2C7GA 2PY6A 5DNAA 1B14A 4J1QA 4JJFA 3DBVO 4GKVA 4R51A 2C54A 3D1LA 2X8LA 3BA1A 4JNKA 1A71A 3S2EA 1NR1A 4KDFA 2X23A 4B3HA 4CM4B 1LJ8A 1UJMA 5EERA 1O0SA 5EQDA 1L1FA 3O26A 3UUWA 3H5RA 1Y8RA 1MB4A 2PZJA 1LDYA 2VHXA 4W7IA 1UR5A 2HK8A 3DEYX 3BYZA 3OHSX 1QKIA 2CFCA 3IC5A 4OXNA 3DWFA 1QMGA 3K73O 2DFDA 2GO1A 4R1NA 4ZA2A 2CVOA 3MJ4A 2P91A 2DM6A 2R2GA 1EFKA 3QLJA 2J3IA 3D4PA 2IXBA 2A35A 3PPIA 1VSVA 3AUAA 4RPLA 1VL8A 5EESA 4AFNA 3FTNA 3ITKA 3W8EA 3EGOA 4ZD6A 3I23A 3ICCA 4KMSA 3A9WA 3GR6A 1DC4A 2CSUA 2PTGA 2HRBA 3I83A 5A5FA 4WGGA 2I76A 2E4AA 3PRJA 3NT2A 2XXJA 5H83A 2W2KA 1KY4A 4DBZA 1PGJA 2Z1MA 5GZ1A 3SVTA 1JWBB 2PD4A 5A9SA 3HSKA 3GHYA 5ENVA 1NNUA 5BSFA 3ETDA 3ZWXA 1YVEI 4GVXA 2P2SA 4OGWA 3I4CA 4PG4A 1UZMA 3NTOA 1GV0A 1M67A 3BTUA 1ZSNA 2WD7A 2OP1A 4U7WA 2Y0EA 3C7AA 5G0SA 1IYZA 1VSUA 3CMCO 4HKTA 4DLLA 1C1XB 2JAPA 2CY0A 3GN2A 3JYPA 3QP9A 3TQHA 2E6UX 3AI2A 4WECA 2EV9A 1YKFA 4CLOB 1J0XO 2J8ZA 1GYQA 3WR5A 3H6KA 4YJGA 1XWFA 3ICPA 5DCWA 1WDLA 1PZHA 1ZK0A 4XYEA 1TT5B 3GGGA 3WGZA 1O9BA 1N7GA 2PFGA 5HS6A 2AQ8A 3ZU4A 1UXGA 2V7PA 1EBUA 3GA0A 1XLTA 2A94A 2DFVA 5JAQA 4YT4A 1UP6A 4LN1A 3T7CA 5A06A 3I4FA 4Q3AA 2VYNA 4D42A 2HUNA 5CAEA 2QQ5A 4EGFA 4RO0A 2ZIZA 1AHIA 1GY8A 5F1KA 2I65A 3JYLA 4B4UA 1U3UA 4DUPA 3LC7O 2QZ9A 4WPGA 3OQBA 2VNAA 1DPGA 4Q9NA 3P5SA 1E7RA 2OP0A 5IN4A 3ZWWA 5HS4A 1T4BA 2YFHA 4BOYA 3OA2A 4JCOA 4AJLA 5TRTA 4FB5A 1ADCA 3N74A 5TS3A 4INAA 5L7TA 5H81A 4P22A 3HDYA 2QG4A 1R15A 3L4SO 3ZU2A 4C7KA 5DULA 4RPJA 4EYEA 1SAYA 4W82A 4X54A 4YTEA 4MKXA 3PHGA 5COAA 5JC1A 1AUPA 1PL7A 2PGDA 2YJZA 3GDOA 3INRA 3GEMA 2BFMA 5JYDA 2ZYGA 5TT0A 4OKNA 4E4YA 3AM4A 1WMAA 1XU9A 4M87A 4Q39A 3U4IA 2WJPA 4J6FA 4UUMA 3G1UA 2VT3A 4WLNA 5JO0A 1HDCA 2ZB3A 2AEMA 2VZ0A 1I36A 1LUAA 1GL3A 1BHSA 1LRJA 1P0FA 2DPHA 2Y1OA 3DFUA 4JX8A 5CHEA 4CLHA 5CEJA 5I8WA 1I30A 1Y8RB 3C7CB 1EE9A 1OBFO 3UN1A 5TQVA 2D4AA 3PYXA 3RUFA 3FSRA 3CH6A 5JY6A 1C0PA 2IDZA 2VTDA 1U2GA 4WEQA 3LF2A 2P9GA 5A9RA 4MVJI 4IBOA 5BNFA 4DMLA 5G4KA 5T67A 3D3WA 4F6LA 4HNHA 1Y6JA 1P1KA 3VTFA 1VJTA 4Z0PA 2OBNA 4D3SA 3IDSA 4NU5A 3EY4A 1O8CA 3DZGA 2VRCA 3GC6A 4XQEA 3K2EA 2JKVA 3UCFA 2HMTA 3GDGA 3PHHA 4BO8A 4EJ6A 1B3BA 1XG5A 4MP3A 1IOLA 1PTJA 4B7CA 4IM7A 4R1SA 4IJWA 4EBFA 1LLCA 4FGWA 3QWIA 4QO7A 4BVAA 5A4DA 2W2KB 3VVBA 3PZRA 4QUKA 5COQA 4AJIA 4BKPA 4NZ9A 1P31A 1Q0LA 5A9SB 3AU8A 5JAIA 2CDAA 2VYVA 4TVOA 1P77A 3NJ8A 4K9DA 2DT5A 4D3FA 1Q7GA 2CF6A 1JLLA 3WLFA 4AL4A 3IUPA 4ROSA 1E3SA 2NACA 2O3UA 2WD7B 4TRNA 1N9GA 4B7XA 1GZ4A 4PLTA 1ISJA 1HZJA 2CF5A 1FDUA 2YW9A 3EC7A 3WTBA 1KC1A 1E7SA 4H15A 1R6DA 4NR0A 3V8BA 1E5QA 1P0CA 4CMAA 4YPOA 2OBYA 1BXKA 4YJGB 1NPDA 1PJ3A 1F17A 1YE3A 2A4KA 3H65A 5DCUA 2O4UX 4RVUA 5I9LA 2GERA 3DOCA 2JCXA 4XWYA 4Y6RA 4E2ZA 1J5PA 3L6EA 3GT0A 1OMOA 3U09A 4PCVA 2ZJ0A 3K2BA 3PJFA 1N1EA 2VHVA 4E12A 1UAYA 4QTZA 4BKOA 1K0UA 3K96A 2HJSA 3PDJA 1PJBA 3GVCA 4R69A 2YY7A 4OQYA 5JXWA 4YAIA 4KTTE 3E9MA 3UICA 4U5QA 1HYGA 5JAZA 3Q1LA 1I24A 4A7PA 5BNTA 2RAFA 3HB4X 3LT1A 5A1TA 4FFMA 1PJ2A 3ETEA 1DEHA 3TJRA 3ZWVA 5BSEA 3BIOA 1ADGA 4KQXA 1VL0A 3HADA 1YQXA 2NTVA 5DOZA 4CUKA 1ENYA 1MUUA 2J5KA 4CMBA 2W8ZA 2WYVA 4FW8A 4E0BA 4LW8A 4R16A 2YV2A 2FP4A 1JA9A 3BMOA 3CPSA 3JTMA 4UEKA 5GY7A 5L95A 3GHHA 3W4IA 1TVEA 2V6GA 2QX7A 3Q11A 3H5NA 1PZFA 1NQAO 4J2HA 2VNSA 4XYMA 3DFZA 3PTZA 4YRDA 3DOJA 4J2OA 3DBRA 4Y98A 4BNZA 4M55A 3B6ZA 3ON5A 3I9OA 4CV0A 4M86A 1WLYA 5KJ6A 4DC0A 3TPCA 1I3LA 3ZHXA 3ORFA 3COSA 3JD0A 4XDZA 2G82A 1H5QA 2AE2A 2O7SA 3TOXA 4XYBA 1WMBA 3WSVA 1H0KA 3CZRA 5C7OO 3ANNA 1KIFA 2VUSA 4OYRA 3R3JA 5BNIA 1N1GA 4URFA 4W4TA 1LBEA 3F4LA 4L4SA 4TRJA 2H63A 1PWZA 1U28A 4MIYA 1D1TA 1NBOA 5L3ZA 1Y7TA 3H8VA 3AFMA 1O94A 4W99A 3D3WB 5G4KB 2VYND 4DRYA 3DZFA 2D3TA 3M2PA 1LRLA 2X5JO 3ZW8A 3E82A 1UP7A 3JQ9C 1I33A 1DJQA 1AGNA 5KWEA 3HB5X 2NVUA 3AOGA 5L40A 4ZRMA 5KOIA 1D8AA 4MVJM 2P4HX 3OJ0A 3C1AA 3F4BA 2FPGA 2P4QA 2VCYA 3ZWBA 4K6CA 4PLYA 2HMSA 3HQ4O 1YRLA 4JJGA 1LA2A 1NQOA 4IQ8A 3ONFA 4TZTA 5LDHA 3E03A 4NJOA 4IPTA 3Q3CA 3L4BC 2O3TA 4P4NA 1PIWA 2JFGA 3C1OA 3H9QA 2BH9A 1YDEA 2NNLD 1N9GB 1V3VA 4WLFA 2TMDA 2EERA 2G0TA 4XR4A 2PZLA 4YAJA 4R54A 2EEZA 1DAPA 2BHLA 4Q3DA 2C5AA 3W6UA 3OMLA 1Z73A 4XB2A 2BRUA 2PK3A 7MDHA 4L73A 5TGDA 1T24A 1R37A 4I9HA 4B7UA 4ALKA 1K3TA 4R4JA 4QX6A 1GQYA 3MZ0A 2FHSA 3Q9NA 4IJKA 1M2WA 4OXKA 3KYCA 4L4XA 4TSKA 2VRCD 1RWBA 4N5MA 4W9NC 4E6PA 3AOEC 3C24A 1CIVA 4ID9A 2PKQP 1JTVA 1B26A 1X0VA 2QRLA 1BVUA 3NJ4A 1B8PA 1YQGA 4BQPA 4O59O 5KKCA 4CR7A 1DDOA 4IDFA 4WJZA 3JQ6A 2VYVD 1WP4A 3SEFA 4FFRA 1DFIA 1FF9A 4J0EA 3BMOB 3CSDA 4K28A 4B4OA 4DREA 3V2UA 1U4SA 5JAMA 1H6CA 4ZRNA 1HLPA 5F21A 4YA6A 3JYQA 2NU8A 3SLGA 4D79A 4YRBA 5T57A 1E3WA 1P1FA 1I2CA 3SC4A 1ZK2A 2B69A 1YL7A 4YACA 5BQFA 1BXGA 1V9LA 3DBRB 3I6QA 2P68A 4JK3A 3SBOA 2PNFA 1PQUA 1AN9A 3QHAA 4IDAA 1ID1A 1HT0A 3ROQA 1N8KA 3FBTA 5AXCA 3K30A 1VKOA 4GAEA 2C7VA 5ILOA 3IS3A 5CDSA 3HZZA 3LLSA 1T26A 2ZB8A 3O4RA 3WS7A 2I66A 4D46A 4L75A 1ZH8A 3A4VA 1YB4A 3BMQA 4IQ0A 2X6TA 5TJ9A 4CMGA 2FR8A 2NM0A 3IL2A 1QYCA 1QORA 1QYDA 3KETA 5IG2A 2B4QA 3BTVA 4CV2A 4BNNA 2D5AA 1UDBA 3TFQA 4A5OA 2ZB4A 3RUEA 3NTQA 9LDTA 1Y1PA 1I10A 3BMNA 4RDIA 4IUYA 1VI2A 1OOEA 1D7OA 5FF9A 4BNLA 3ZDFA 3S2FA 5ICMA 2P5YA 1HZZA 1FJHA 3HDHA 1XKQA 5IDYA 4XEHA 2NVUB 3ZWPA 4DA9A 5HWSA 3GPIA 2H1SA 4R9SA 2FY8A 2OXIA 4NBUA 2CNBA 2GN6A 5DF1A 5DP1A 4QT0A 1RM5A 2GN4A 1YXMA 2GD1O 4BNMA 5B4VA 4JQCA 3M6IA 3KHUA 2BELA 4ZHSA 2AE1A 3TL3A 3VH3A 2JD2A 4GX2A 3ZZNA 3BHMA 4R3WA 2IE0A 1U9JA 1YWGO 3I9JA 2EP5A 3AU9A 3VZRA 1LU9A 5FYDA 4I5DA 3QWBA 2GZ3A 3Q6IA 4PVDA 4E3ZA 1EVZA 3UW3A 1HDOA 3IQDB 3OJLA 4A73A 4TKLA 3OJFA 3FR8A 4CMIA 2D2IA 1GAEO 1U7HA 1GDHA 4RQUA 1Z75A 4Z3KA 5IAAA 1DC6A 4LVCA 5TT1A 1NWCA 1VLLA 1WDKA 1T1RA 3OIFA 4A26A 4CM6A 1R16A 3CKYA 1E5LA 3QQPA 3R3SA 5KKAA 5EL0A 1MGOA 3LC1O 4GSKA 3ZWOA 4RVSA 3SJUA 1O5IA 1KEVA 1NHGA 3UCXA 4MVJH 4CM5A 1PGQA 2D5CA 3L4BA 1E3IA 3RKRA 2GCGA 3TOZA 1YBMA 4J9VA 1J6UA 3H5AA 4LCEA 1ISMA 1KYQA 1TEHA 2C07A 2D59A 3P19A 1NVMB 2Y67A 3ZWAA 4AJHA 3WQQA 5IFLA 3OEWA 1V3UA 3HDJA 4BNVA 1Y81A 4PIVA 5ADHA 4MINA 4B4VA 3GRPA 4DIOA 4RJTA 1GPJA 2RHCA 4ONEA 3NEPX 4MPDA 4NG5A 4IXWA 1E1MA 2GUGA 1GR0A 2Z5LA 1SPXA 5L4SA 3DZKA 3NDJA 2W2LA 4FJ2A 1VPDA 2I67A 1E3WB 1HE5A 1ZZEA 4YWJA 3ROPA 5HM8A 2RH4A 3GG2A 4OL9A 3BHIA 3WJAA 1BXGB 4EZBA 5CDGA 5CEEA 5T8KC 1CERA 1M75A 5IJZA 3L77A 4LCJA 2QW8A 4DGSA 5CG2A 4KZPA 4PN3A 2E48A 4W9NA 4BB5A 3A06A 2QRKA 2YUTA 2ILTA 3AOEA 4XRRA 3ULKA 4PG8A 2VT2A 2I3GA 5JY1A 3PFFA 2B83A 1ARZA 1A72A 1ZBQA 1EVYA 4XQCA 4CMEA 1MG0A 2C20A 3BMQB 1KEPA 4M54A 4GKBA 3I9KA 4DL9A 1X1EA 4BMNA 3TRIA 2W4QA 3FHLA 4IIVA 2FSSA 3G0OA 1ZUD1 3QV1A 1HWYA 1H6DA 3NGLA 4I9UA 3UXYA 1F06A 2WE8A 3BMNB 1QYWA 3KVOA 1E3JA 1EVJA 4HFRA 4R1TA 2EW2A 1NTOA 4KUGA 2AQIA 3BAZA 3WYBA 3AJRA 3GLQA 1DRWA 1T2DA 1G6KA 2ZQZA 3F3SA 4JIGA 3IP1A 3W6ZA 3H3FA 4RF5A 1XEAA 3A1NA 4YBZA 3O8QA 4J9UE 3D5TA 1B3RA 3MJSA 4YQZA 4RCVA 2AA3A 4CV1A 3PWSA 1HSZA 3LZ6A 1AXGA 4FQ8A 5EQFA 1SEPA 3ZCXA 1LNQA 1OFGA 1QLHA 4Z9YA 5L53A 3JSAA 1PL8A 3E1KA 3SX2A 3AW9A 5JDIC 3PJEA 4M49A 3X2EA 2DBVO 4LMRA 2CUKA 1QRRA 1WVGA 2BD0A 4J4TA 3PLNA 5A3JA 3QWFA 3GGOA 1E3EA 1X14A 3NV9A 2I6TA 4K1LA 2EIHA 4FBGA 4NJMA 4RPKA 4QSMA 3EZYA 1AE1A 3AI3A 4XIJA 1B0AA 4C4OA 3BTSA 3PK0A 2YDXA 4CMIB 1I01A 5J23A 1BSVA 1Y5MA 4IMPA 4MP6A 1QR6A 3JD3A 2DC1A 5G0TA 4KTVE 1H6BA 4GLLA 1W0CA 3H9UA 5DT9A 4CL8A 2NTJA 4R5MA 1B8UA 3RASA 1U3VA 4P8RA 1MP0A 4WLEA 2JFHA 2GR9A 4KP7A 3RBVA 2Y1CA 3GZ4A 4WUVA 1H9BA 4OAQA 4B3JA 4YYZA 4OKIA 4WEOA 3LYLA 4AJ1A 4HBGA 4JBHA 4NIMA 4RQTA 5JSFA 4FFLA 2TMGA 1NFRA 1UXIA 2Y66A 4IDBA 3VZSA 5A5EA 4TVBA 1IHYA 4PLHA 5TIIA 4RPHA 2E37A 1A5ZA 3PYLA 4BS9A 2Q50A 3NDIA 2X58A 4BO5A 3CMMA 5JCJD 3GEGA 5AXDA 1EUCA 3G1TA 1VJ0A 3GPDG 4XR9A 4B3IA 2YFQA 3EZLA 2BGLA 3A14A 1Z82A 3PVZA 4WK6A 4L76A 1T25A 1E1KA 4N18A 4CM9A 5BSHA 2NU7A 2R6JA 3QRWA 5A3VA 3C8MA 4IINA 4BV9A 3RUIA 1HDRA 1MFPA 4J7CA 1HDYA 4LMPA 4HUJA 2EXXA 4NU6A 3CZMA 3CE6A 4XD2A 4NBTA 2I5PO 1SO8A 1VJ1A 4GL4A 2XXBA 3DB2A 5L4LA 4U6QA 2OUIA 5L9AA 5KJEA 4BL5A 4LGVA 3RFXA 2V6BA 3PI7A 1C1DA 2C82A 2IODA 3JQEA 1VM6A 4IDGA 5I9MA 2RBEA 5EINA 2UV8A 2X9NA 2Z1NA 1WZIA 4PZEA 2J3KA 5BT9A 2HQ1A 3S2IA 4XDYA 4Q3NA 1VE9A 4NBRA 3H9GA 5CDYA 2G5CA 3OECA 1Z45A 4PRLA 1N92A 1UDAA 4WCDA 4BNIA 2CVQA 2EKLA 4UVEA 1F14A 2XOXA 4E5NA 1K6JA 3GVIA 3EK2A 4ZQFA 4KWHA 2PWZA 3Q9UA 1H93A 4Y8VA 4NK5A 4YVFA 5DDIP 5T8KA 3DZIA 4J1TA 4L4RA 4DIFA 4J43A 3N58A 1GTMA 5ER6A 3ZNPA 4J0FA 5MDHA 1EDZA 3ZGYA 2J5RA 3FNEA 1V3TA 3ZN2A 1LTHR 3O8QB 4YAKA 4YR9A 3WGOA 1LLDA 4RVGA 1YL5A 1PR3A 5GZ6A 2W2LD 4IIUA 4I1IA 3CTMA 1HDZA 2PH5A 3RCBA 1Q2XA 2PV7A 1PJCA 2IEDA 4FC6A 4I5EA 3VH2A 2WTBA 2ZYDA 4OIMA 1U8FO 4Z3DA 5F3RA 3WB9A 5JS6A 4E5PA 2ZTMA 1DC3A 1DO8A 2DAPA 2ZCVA 2V6MA 1O6ZA 4NFSA 2C29D 3DAGA 2WYWA 3TSCA 1IZ0A 4ALLA 3L07A 3NAQA 1GQ2A 4NJMB 4GLOA 4D0SA 5L4NA 4BO2A 1IHXA 3ZV4A 1GYPA 4BGVA 1JAXA 1XQ6A 3GVHA 1NX6A 4IY1A 5FFFA 2Q45A 3LVFO 4ZJUA 4YRAA 2OZPA 8LDHA 1OAAA 1A9ZA 4DIBA 2CD9A 2X22A 4OM8A 3GMDA 1BRMA 1OC4A 4IZIA 4FS3A 3JQ8A 4ND5A 2YDYA 2YZ7A 1VRWA 4DTIA 2O3SA 4HXYA 4G81A 3VPGA 3RBXA 4YDRA 1WXDA 1HTBA 1BDMA 1KY5A 4FOSA 4A27A 4DVJA 2AQKA 1VL6A 3KSZO 4CQMA 5JDIA 3OICA 4NBVA 5TX7A 4HFJA 1DHTA 1PZEA 1HSOA 4GX1A 1XDWA 4Y6PA 5TNXA 3RC9A 1YJ8A 2VHZA 4PZDA 2HO5A 3UGKA 1V0JA 1Z7EA 5TC4A 1ENZA 1JKJA 1XR3A 1RM4A 4BKUA 1KVSA 3GNTA 4M8SA 1PGNA 3MWDB 2ZCUA 4AJ2A 1ZIDA 2HMUA 1D1SA 4MVJA 3RBZA 2GZ2A 4E5MA 4RL6A 4UEJA 2JHGA 1SCUA 4D0RA 2WE7A 1LC3A 3DL2A 5BSGA 3U9LA 1LQTA 4Q3EA 4OOFA 4EJ0A 3L9WA 3F46A 3V1UA 1SB9A 2V65A 4J4HA 4BNXA 2PD3A 4BGUA 3OEYA 4XRGA 3AUTA 6LDHA 2OHXA 4FFNA 1H9AA 3DBLA 3OJOA 1E6WA 1M66A 4CM7A 4XJTA 2JFFA 2OMEA 1T2CA 1I3NA 4R41A 3LSYA 2AMFA 3RIHA 5GZ3A 1C1DB 1XU7A 3G49A 3JQFC 4JGBA 1SOVA 1UH5A 3ENNA 1ZKMA 4PRKA 4CUZA 2YQ5A 4LSWA 5TSDA 3Q2KA 4GSLA 4XKJA 4OSPA 2PD6A 2I3AA 5AXAA 2NVWA 4QXMA 4PG7A 5C7LO 3ZNOA 2QZZA 1ZVMA 5IZCC 5I8ZA 3ZV5A 3EYWA 2UUPA 1NXQA 1DLIA 4D41A 1JW9B 3RJ9A 5JBIA 3FCOA 3NT5A 3VOSA 3A28A 3E5MA 3P2OA 4TWRA 5C5IA 1BVRA 4KQWA 3UAGA 4CMJA 1JU9A 4GWGA 3AI1A 4MKRA 3KOUA 2JD0A 5AVOA 1BW9A 2Q1UA 3JQBC 4I5GA 3GRKA 3PHJA 4XZ3A 3R6DA 1SC6A 4CM1A 5AYVA 3SLKA 1FK8A 3VC7A 1K2WA 4CM9D 3GEDA 2R00C 1LDMA 4BO0A 3M1LA 1E92A 4J91A 1HRDA 5F5LA 3LT2A 3UVEA 3KYDA 2OGUA 5JYEA 2X1HA 1SEVA 1MLDA 1GEEA 4RDHA 1ML3A 2VWQA 1GFSA 3RC2A 4DYDA 1Y8QA 4AJJA 3QJ5A 4AJPA 4DPMA 5ITVA 4EJMA 3WFIA 1ZK3A 1NPTO 1LLUA 2PKRA 1TXGA 1W4ZA 2Q1TA 1FMCA 2VHYA 3JD2A 3ROKA 3VZQA 5L7WA 3OSUA 3ZWMA 1DFHA 3DOOA 2ZJ1A 3VDQA 1ZMOA 5I7SA 5JCXA 3DDNA 2EWMA 1LSUA 3WNVA 1ORRA 2GRAA 2W98A 3RKUA 3PHIA 1AHHA 1XA0A 1MA0A 1ISGA 3QVXA 1ZJYA 3GNQA 4FR5A 3E9NA 3MJVA 4J7UA 3JQ8B 3WWYA 2P5UA 4Y9DA 2BLLA 3WWZA 3IKTA 4BNHA 4CQMB 3JQGA 4Q3CA 4BO1A 4U6SA 4YAGA 1ISIA 3T4XA 5L7YA 2HU2A 4E31A 3VKUA 2PLAA 3JD1A 4BQRA 2FZEA 1QLJA 4GX5A 3FF4A 3FTPA 2EGHA 4DPKA 1JQBA 2B0JA 3F9IA 4EW6A 3MJTA 1LXCA 3F1KA 1DRUA 4JXKA 5IDXA 2FN7A 1IULA 1DBVO 3KB6A 5G0VA 3ADOA 4BNYA 1C0IA 5A03A 3DZBA 1SMKA 1U5AA 3AY6A 2DBQA 1X1TA 5I7VA 1CYDA 3MOGA 3UCEA 4Z6KA 3ANLA 4IGEA 3PP8A 4M89A 1XELA 3GNSA 5DOVA 4H7PA 1EMDA 4NPCA 1PL6A 1X13A 4UAGA 5LCXA 2Q99A 3DBLB 1QV7A 1GV1A 3IJPA 4MVJG 4WLUA 1HETA 1JN0A 4XQGA 3QIVA 2VTEA 1HDGO 2Y68A 1LDEA 1NVGA 1CDOA 3HFSA 3GH3A 1BDBA 1U3WA 5JW6A 3OBBA 3T7EA 4J49A 5IF3A 1UXKA 4GGPA 4Q3BA 1H2BA 1R4NA 2IEBA 5KVCA 5A02A 3WMWA 5C37A 2F1KA 3FR7A 5KVQA 1JVBA 1S7CA 1B16A 1HEUA 2DTDA 2Y0DA 5THQA 2EGGA 3RU7A 2GN8A 4CQMD 1L7DA 5ILGA 3BTOA 1NPYA 4UUNA 3ST7A 1XSEA 2Q4EA 3H2SA 2YHUA 1I0ZA 3UF0A 3UKOA 5G2OA 1PSDA 4R5HA 1LSOA 4BMVA 4WOJA 3MWEB 2BI7A 1QYXA 2UVDA 3HWRA 3NRCA 1GEGA 1BW9B 2AQHA 1E0DA 1UZNA 4MVJD 1A7KA 4NNJA 4YT8A 3JQFA 4II3A 1GCOA 2AW5A 4ALJA 3GZNA 2JJYA 4RLSA 3C7DB 1T4DA 2VWHA 1ONOA 2WSBA 4DLAA 1YBAA 5G0UA 2GNAA 5FEUA 4XQ9A 1FDVA 3TZQA 1GADO 3KYDB 1HE3A 2O2YA 5KVSA 5DZSA 1QG6A 3N7UA 3HNPA 1Y8QB 5IZCA 1RPNA 3RC7A 1I3KA 4DQXA 4GMFA 4J1NA 3ZWNA 3LK7A 4DC1A 4CLDA 2C2YA 1DIBA 2Y1GA 3RAJA 3WGTA 3KEQA 4HV4A 3IUSA 1ENOA 2X0IA 4G2NA 1GZ6A 5CG1A 2H6EA 2GZ1A 2ZTLA 3ZV3A 1DXYA 3O03A 3M2TA 1EE2A 2CDBA 4IDCA 4BNFA 2CZCA 3VAZA 3AWDA 4FN4A 5THKA 1UP4A 4J16A 4TRRA 1PX0A 3FNGA 3MJCA 2QHXA 3QA9A 3CXRA 1P1JA 4TROA 4MIEA 1RYEA 2R00A 3QW2A 4BIIA 5JMWA 4OQZA 4B79A 4ESOA 2HSDA 3F5QA 3O38A 1K89A 2VOEA 3VH1A 2UAGA 1RKXA 2EHDA 2GN9A 4F46A 2QYTA 3D0OA 3P2YA 4DQUA 3R1IA 5JCJA 3OQ1A 1ZW1A 2FOIA 4JJIA 1ENPA 1OC2A 3I9NA 5CDTA 3E48A 3PJDA 3NYWA 4RF2A 1W6UA 4CMHA 3DZJA 1RM0A 1IPFA 2Y99A 4TQGA 3AFNA 5HA5A 5JMPA 3DMTC 4J7XA 3S55A 4XGIA 4CPDA 1CQIA 3QVTA 4DMMA 3IMFA 4G65A 3JQAA 4OSOA 2X4GA 1G1AA 1VC2A 4RVFA 5B4TA 3JQ9A 3GMSA 1EK6A 4E32A 2FMUA 3G79A 4R01A 3E5RA 4CL3A 1ISFA 1H6AA 1R0KA 3EVTA 3ZH2A 1ADBA 4CM4A 4AJNA 2WWRA 2LDXA 3DBHA 1KS9A 1WDMA 4EUHA 2H9IA 3FN4A 5AXBA 3K5PA 4S1VA 1T2FA 3RROA 1M6HA 3DTYA 1A4UA 3KYCB 4YXFA 3OIDA 3PQEA 2OOSA 2XAAA 2Z95A 3INGA 3OM9A 1R4NB 3WQSB 3PDUA 4PLFA 2HLPA 1ZK1A 2UDPA 4ZQGA 4R68A
chains in the Genus database with same CATH superfamily
1KI6A 4BX8A 2HK7A 1QHYA 2ZG6A 1FXSA 3S0JA 1IZ8A 1BEEA 1XZFA 1Z0IA 5BN5B 2X9VA 1NW8A 2Q4DA 2QTWB 2F3SA 3QEJA 4LF4B 4V0QA 1KI9A 4D92A 1CE8A 3ZKWA 1EM6A 3PXCX 2D2EA 3PD0A 4YJDA 5KBYA 4RKFA 3H3JA 3P45A 1NVTA 1R6UA 3SBEA 4MTCA 3FYTA 3L6BA 3LQ1A 2OAEA 3KQTA 1MAWA 1NOIA 2NQ8A 4K6FA 1LBIA 5AVWA 5DEIA 3D9QX 4KQKA 2DERA 2QTHA 2Q1SA 1JAYA 1PS0A 1W8DA 1KMHB 2HWKA 2QR5A 1JHQA 2R79A 4MO9A 1DOHA 3HFGA 3LAWA 3IDOA 2VJDA 3WSWA 2YYYA 5FUWA 4OGKA 1O97D 1Q7BA 4GXQA 4RENA 4EO7A 1P5RA 4QQRA 2WIGA 1WIWA 1PEKE 1ZBDA 1MW8X 3MEQA 3TIGA 3DV0B 3C1TA 2KSQA 3HGTA 3NOQA 3M4YA 2JIOA 4UTZA 4B09A 1AKEA 5BR7A 5JEEA 3W5CA 4UULA 1AURA 2FEXA 1N6IA 4YRMA 4CKEB 1KYVA 2H5IA 3JW8A 5DBFA 3IBCA 3RG8A 2BKUA 4EB6B 2J3QA 2ONZA 1F8FA 1TT7A 3BXXA 3L0YA 3NI2A 2GVDC 1KJIA 5F52A 3VC3A 2PMWB 5B1YA 3WKCA 3TG8A 1JKIA 1KAEA 3MWLA 5GADl 3AKCA 1VIMA 1K2VN 1VMEA 2V9ZA 5FORA 3UA4A 2V3WA 1U0GA 1VP9A 3AHEA 5MN6A 2Z5GA 4HYQA 1VKNA 5TQ2B 1JIXA 2R65A 1HYHA 3P0HA 3ZXUB 4TKVA 4ETIA 2IA5A 4AG3A 4W63A 4DADA 3TF5A 5IVKA 3DPUA 4LF6B 1CS4C 4B7AA 2GETA 3K5WA 3PQ3A 5IANA 4LECA 1Q3TA 2LUOA 3RG2A 1TLTA 1ZEJA 5FAXA 1QZ3A 2O8VA 4ZYUA 3C8UA 1RNLA 4QM7A 2A7XA 4CT4B 1DINA 1X1AA 3RF7A 1RAEA 3CA8A 3LZDA 4M8NE 4EKYA 5HCNA 1YJ5A 2OT3B 4G0OA 4QTYA 4R2KA 2VWGA 2HSGA 1S2MA 4CEJB 3FKSD 3G89A 5CFLA 3L5KA 2P3QA 1KR2A 4ALIA 1BKYA 5BSRA 1BCSB 3R40A 1NQTA 5DHFA 1G64A 1KI7A 1VGVA 1BMDA 3LG2A 3MRTA 1YIAA 1ZKDA 3F3MA 1VJCA 2WF8A 2XQKA 4R1MA 1H2EA 3FCXA 3W6PA 3HKDB 4ZT6A 4Q66C 3H4VA 4YEDA 4MJ3A 3DD1A 1A97A 3H5TA 4L6IA 1UJ5A 4GMXA 1VB3A 3SHOA 4F8EA 1WUYA 2Q6TA 3TCKA 1V5FA 4X3OA 4Y2TA 5EJ2A 4BVLA 1DSSG 1X15A 3BE6A 2ZSFA 1RAFA 3QFRA 5K01A 4MKZA 1ZITA 1QGDA 2GASA 3MJFA 4PCLA 4KO8A 4AMVA 4A8PA 1YB7A 2QUJA 3I5AA 1F8UA 3DJYA 5HKLA 5LJIA 2XCTB 4ZTZB 10MHA 1SCNE 3ZJVA 4BYMA 5KJ1A 1AGYA 3R5XA 2IH4A 5ALMA 3PDIB 1A1VA 4BGEA 3OKPA 2W83A 4HX5A 4XASA 5L3QB 3K9FC 5ALNA 1OA0A 2GPNA 3HXTA 3P2KA 1FQJA 1HDXA 5IN5A 1DCKA 3DBHB 5AKXA 3LWDA 1N3IA 1HTWA 3ZTYA 3HYSA 3L6OO 3I2GA 3JZFA 2XEDA 1LX6A 1EWVA 2ZUBA 4L8FA 1QQBA 3UFXA 2EVWX 4I4TA 1IATA 2QN7A 3NT4A 1GD1O 1PK8A 1PW7A 3K8QA 1R5NA 4JB8A 2GQ0A 3A4TA 3N2KA 4C0HA 3Q3VA 4XJVA 5IYZB 4CQLB 3ONEA 5FQNA 3EGXB 1VYUA 2FU5C 2XUAA 4PZ0A 1OTYA 4WNIA 3E9EA 4JB3A 4XYGA 3TKAA 4GBGA 4NQZA 1MEOA 3H0CA 4JC5A 5J5CA 1MABA 4W1SA 3Q7RA 4DWVA 1T43A 1YRWA 1A4IA 3FNHA 2PPVA 1ECCA 1DO0A 3GA5A 2DPLA 2HAEA 4HZUB 4MEJA 2IRWA 5EHGA 2JIBA 1SVIA 1QUFA 1MRSA 2OO5A 3OM1A 3NM4A 2QM7A 3D3KA 5AJXA 1HI9A 1BH6A 5TGZA 4V2UA 3BSFA 1I7PA 1I1OA 3H11B 4JITA 2B1JA 4PM4A 4DCVA 3RUAA 2FG6C 1ZU4A 4WJLA 1KJZA 5AVSA 1YD7A 4FEYA 1TNDA 1OZAA 1ZM2A 2HM7A 2JASA 3PHCA 1HORA 5FWXB 1L4MA 4E1VA 3BWXA 4RULA 1VRCA 5K6AC 3RTGA 3AEZA 4FFWA 4RJKA 3CQ9A 3LD9A 3A6PC 1GZVA 4LFBB 2ZVQX 1AB5A 3MF4A 4L5IA 4BO3A 4HZIA 1SXHA 1DAHA 4GH5A 1KZ6A 1PTKA 1YOVB 4IZHA 4WXRA 3OX1A 5AJVB 1PUIA 1H2WA 3FFTA 1FLVA 4MGKR 4EPWA 4XM2A 1JAIA 4BXOA 2GCNA 3JS5A 2AVDA 4ND2A 4PQFA 4QUIA 5CCEA 1JDUA 3EG9B 1LPPA 2ZT6A 2ZZKA 2X7HA 3TDKA 1X1BA 5B6PA 1CUBA 3K0AA 3UMRA 2O1EA 4E5UA 3Q0IA 5DHRA 4OUKX 4N39A 3WFJA 2O2DA 1USVA 3K0CC 5B37A 3C8HA 3LA6A 5D6NA 1YC2A 1UKAA 3RVDA 3ERCA 2CE7A 3FZNA 2JHPA 5AJHA 1JVSA 1Y9AA 3NYRA 2I4TA 2HKIA 3EWIA 1AU9A 1VSQA 4DBLE 4DUGD 2CNOA 5HTOA 4FKBA 3B5IA 3GNLA 1G5RA 3HJNA 4QNNA 1DIRA 4ETMA 2MWMA 4AF8A 5DK6A 5B64A 2F67A 2VWPA 1EIZA 4QFDA 1FXUA 2BTQB 1KAQA 1AZWA 1RYDA 2J9RA 2HJRA 3UAZA 1XBTA 4GGOA 4E2WA 1AV6A 4HTAA 3RSCA 4P4UA 1SKQA 5KTKA 2JIPA 3QVMA 2A1IA 2PRIA 4TLEA 2EG9A 3I58A 4R1UA 2R7AA 3CLSD 4KLRA 1EFCA 1E94E 4UCWA 1N4DA 3BHJA 1KDOA 2E1PA 2W6JD 3D8TA 3QOXA 5F73A 4EVQA 5HW0A 5EZ6B 1RJDA 4JLPA 1R4MB 2GWRA 4U0KA 3WGGA 2HMWA 3X1WA 1YOBA 4DNFA 5CCXA 4YHHB 3GFBA 1AK9A 3OU7A 3R77A 3TZEA 3LRTA 4ZFNA 2VKQA 3E81A 3WV5A 5IH3A 1TMKA 1COZA 4GQAA 4ZVUA 1HT3A 1ONNA 1XO1A 2H5LA 3RFVA 3DKRA 3O8OA 3PJGA 1B2LA 1FTYA 2I87A 1QTRA 3AO0B 3G2KA 4R1QA 1PYOA 3HBFA 3KKQA 5AI4A 2W2PA 2C4KA 1VLMA 4BBJA 2PUEA 2LCIA 2DY1A 4NAHA 4ISBA 2IHTA 2QLNA 3QIAA 4HFMA 1OLUA 1A2OA 3M4XA 3N5KA 4BV8A 1CQZA 3L8MA 4IDDA 5ALWA 2NLOA 1L5GB 3PXEA 2R4UA 3T3MB 4AO6A 4N54A 4X8MA 3UPDA 4YXWD 5HZHA 2QZ4A 1FYWA 1C7ZA 1CRQA 1MVOA 2C77A 3KJIA 3CUEF 2YJTD 2COEA 3ICVA 4NH0A 4DA0A 2UZ0A 3UJHA 4YCDA 3U62A 3VSDA 2HDHA 1BX0A 1DIHA 2GWHA 2ZUWA 3EB9A 3QPCA 5IEBA 3OBIA 1K68A 2WF9A 4OGFA 4N47A 4C5BA 4TTRA 1L8XA 2BGMA 2GCOA 2QZSA 3MCVA 2Q4BA 3I9V1 2OYCA 1G5PA 4MO2A 1NU6A 2RBKA 2YZGA 3D64A 2X0EA 3X1MA 4L9WA 2UKDA 4PU0A 2ECPA 3FGOA 5FI3A 1GDTA 1KERA 4Y2QA 4MJXA 3W9BA 2PYZA 4KREA 3FMFA 4Q9DA 4CXMA 2XE8A 4BQQA 3V34A 2JI4A 2HCRA 3LPNA 5LOVA 1V8BA 3C6YA 3KU1A 2O8FA 4HWOA 3TGWA 3C98A 1O1YA 2ID7A 3RJZA 3QKSA 3HMKA 1P4RA 1ZOOA 3DZHA 1IHPA 4FP9A 3SIRA 3ZU6A 1DAOA 1TJ4A 1TKRA 1VE6A 1ZEMA 5M3BA 4BFUA 4JLAA 4D9KA 3U4DA 4ZPJA 1QTIA 3EZGA 4MUFA 2SHKA 5GINE 1TIBA 1OI7A 1LKZA 3PQFA 4D6PA 5IJ9B 4F7DA 1Z88A 2D1FA 3DEZA 4LDRA 1M6WA 1P19A 4YJHA 1E1LA 3G2MA 3I8SA 2OXEA 3RHTA 2Q3EA 4RCZA 2QSYA 1EFVA 3B1FA 3LFHA 5FUBA 2JCVA 4YCAA 4YASA 5EEGA 1XZQA 3KVNA 4D82A 1FFYA 4O1IA 1GPDG 1G291 2UUCB 2JANA 2QY6A 4PYKA 4YMTA 2A88A 3H4TA 3TQIA 4CW7A 4IV8A 2OD2A 2XY4A 4EW3A 2DLDA 2PQMA 2WIDA 3BFVA 3RREA 1EWYA 5K9ZA 3V2GA 1F6DA 5F78A 1KI3A 4O8ZA 3QLUC 5G0WA 3O9ZA 5B7GA 1P2DA 3OA0A 4II7A 1RSZA 3KXIA 3OETA 1EDDA 2WWGA 2E55A 3HYTA 3WK5A 1SHLA 4BNDA 1X19A 2C7QA 3INTA 4LNHA 2RGAA 4MWZA 4OMFG 2XMZA 3HZOA 3CEMA 1QS0A 3B1VA 1YASA 1YCFA 1ZSYA 4OOEA 5EOVA 2AK2A 3A0RB 3CZAA 1S8FA 2WABA 4DMKA 2PL5A 2B7BA 1FIUA 3CF6R 3MELA 4N41A 4NLLA 1AQLA 4XWTA 5E4YA 1U0FA 5A4AA 5IX8A 1JR4A 1OI4A 5JS1A 2HX1A 1RHRA 3IELA 3IT3A 1R64A 1T4CB 3LF1A 3SOZA 1XLUA 3ZDXB 2Y1DA 3KEGA 3E4DA 3NPAA 2EW8A 4KFTA 4PEVA 3SR4A 4CM8B 1E9RA 4LQLA 3TW8B 1YU9A 2EWWA 2F3TA 2WHEA 2PEYA 3L8DA 1NSFA 4BNTA 2B6NA 4B6GA 2A92A 2BLNA 4TKZA 5EWLB 1YR1A 3C87A 5EXDA 4K9PA 5E9AA 1EFRA 4MYRA 3LUHA 3ELYA 2GEKA 2B34A 3FFWA 4PSCA 4B4KA 1MH1A 4AKTA 1H0RA 1JMVA 1NAIA 3EWSA 2XXAB 2FDRA 3NIBA 2BEWB 3CZPA 3SNHA 1O9HA 3PVCA 3OX3A 5K2MA 5JWOA 1AKQA 1P4JA 4F4IA 4EEXA 2ZXUA 1ESMA 3S99A 2IZ1A 3IH5A 1I13A 3A9UA 1TLLA 1NBHA 5CPFA 1D2CA 5IKXA 3TH5A 1WDTA 2PX0A 2GF2A 4OMUA 4FS8A 1R3UA 2QN6A 3F47A 3PEFA 4G8JA 4PAGA 4ARZB 4CF7A 1N9ZA 3D4NA 4KU4A 3M3HA 5I3ZA 4NK4A 3Q2IA 1GA6A 4Q4HA 4S0ZA 2WQ7A 1UBUS 1CEQA 2EJWA 2EJBA 4YT5A 2BFAA 4DT1B 2ZGVA 2QG9A 4CIVA 4DQKA 3S8MA 5KO2A 4MP8A 1P18A 2JJ8A 1QH1B 1HMYA 3ICOA 1EXWA 1J9ZA 1XMPA 2AF3C 3Q85A 3I34X 3LV8A 3QJGA 4FC7A 1DB3A 1UPXA 4KXWA 3REQB 1CHNA 2VF2A 4PGFA 3L7IA 5AW8A 1C4KA 1YQDA 4L15A 5CLGA 4DWJA 4FFDA 1EZ4A 3AVWA 4FHZA 2CV2A 1NONA 2GDJA 4BJHB 2O2EA 3K31A 3LP6A 3HACA 1ATZA 3KE8A 3LLCA 4JKOA 4Q3LA 4WKOA 1WBBA 2O2SA 4FZ3A 4MW6A 3GDFA 2PNJA 2ADOA 4AF6A 2XCRB 3F3YA 2XCOA 4QYXA 2BCGY 2WU4A 2AN5A 1FLNA 3BEDA 2NU9A 4X7PA 5A3QA 4Y0VA 2BZGA 2C5EA 4LNUA 4U8HA 4HEHA 1WOMA 2DUJA 4OTZA 3SK0A 3NX4A 5DM60 1AGRA 3W90A 2BGKA 4TSRA 4UUOA 4OJNA 1M73E 3ZJYA 3GLFA 2XCSB 5KS2A 2ZWAA 3PUJA 4QFCA 2QBYB 1M7GA 4KW7A 1UDCA 4D5GA 1QHNA 2P9ZA 4PYIA 4IJQA 1NW6A 3ZEAA 2HHCA 1LEHA 3RVLA 4A92A 4CR8A 3SX4A 3PNYA 4YJ2B 4ZVSA 3AKDA 2Q9AA 4QLOA 1Z36A 1XQVA 5BYBA 4R8LA 2Z5VA 1RABA 1YDWA 2ZAOA 3NTVA 5KOJA 3RVNA 5KC8A 3EW7A 3AB3A 3NHKA 4LYJA 5HFJA 3H2JA 4V2IA 4TKMA 1GKLA 2O14A 5TF4A 1CZNA 3KFXA 4EUNA 3DG9A 5EJ7A 5LC1A 3L43A 1UFOA 4CIAA 3TE6A 5JRDS 2F1HA 1PS8A 5K8CA 1ZI9A 3FPJA 5U4QA 7ADHA 5JO9A 4MRRA 4EGSA 4TLMB 4H7IA 3MTEA 3UWPA 2ZWPA 2B99A 1BWRA 4I6JA 2IY9A 2I99A 3DZCA 4CG1A 3IILA 4F84A 4F96A 2X3FA 4PXYA 2QVGA 3MXOA 3G5MA 1ZXBA 4PLWA 5AI9A 4Z9FA 4BU0A 1LLFA 2JAXA 2YIVX 2PAAA 2ZDGA 1U4NA 3N2YA 4PTYA 4TYPA 3UJBA 2HJHA 2Y0CA 4IL5A 2WY2D 4AG5A 4QGFA 1AO0A 3TXAA 4Z0NA 5E4TA 2O50A 4MUEA 4LJ6A 3STUA 4ZJZA 2O8NA 2P9HA 5ALTA 1BKSB 1OYOA 3C4QA 1ZI6A 3FYUC 3LU1A 4TV9B 4MUXA 4QGSA 3RUHA 1C9DB 2AXEA 1SVMA 2XBUA 2VS1A 1RBYA 2AG6A 5JPIA 4E21A 2OMKA 3KAPA 2HMYB 1GPWB 5IZ4A 1JQEA 3LBNA 3IE0A 3KUXA 4Q1EA 4Y0NA 1DE0A 2CXXA 2VNIA 4PLGA 4X41A 4EK9A 1F60A 1Z4JA 5AKJA 2TECE 4ILKA 1SUSA 1BGXT 1ZCBA 1RKBA 2DPYA 2OV8A 1NYRA 3D4OA 2FZVA 5BV8A 1SNYA 1KJQA 1BU5A 1BD4A 5T3UA 3HYLA 2PEZA 3EIHA 4ENQA 5JU6A 1INLA 1XTPA 2X9GA 4CMKA 5I3CA 7REQA 4JBGA 2FUG1 2GYYA 3BZWA 2GBPA 1PFWA 2HEGA 3L4JA 3RNOA 3MMXA 3OPMA 4AIIA 3DH0A 4EKNB 1ZA1A 1N2XA 4PLVA 4G4SO 4JT9A 5ADWA 5JFOA 2O8DA 4FD3A 2DHCA 1T1JA 5E7MA 4H0FA 1T0PA 2QTFA 2RHHA 3KSDO 3KYBA 1T3TA 1UXJA 2IFTA 4PLZA 4GPD1 3TE7A 1BMFD 1PCXA 2PZKA 3ZHSA 3S1LA 2YTZA 2OK8A 1JKFA 4PFSA 3E3OA 3TNLA 4F06A 4P4LA 1L6IA 3WGIA 2P41A 2YVKA 4JP3A 5A04A 3NGXA 1Y1KE 5K0CA 5CGQB 4WT7A 2G70A 3NCTA 4WCFB 2VATA 3GV0A 5H59A 4RF4A 4UVHA 5KWSA 4Z4IA 1G59A 4G1UC 4X62B 3MJEA 5JATA 1UT5A 2XJ9A 4PY2A 3ER6A 1WB9A 1N77A 1FUIA 4I7EA 3ZUGA 3IOYA 2IU6A 4RTNA 1RCUA 2HPZA 5JRZA 4XB1A 1YF3A 4GRDA 1F3LA 3JQBA 4UBNA 2BDUA 1KJJA 1TF5A 1W73A 4Q05A 4LZPA 4FFBB 2HMVA 2NSHA 2Z4TA 1SBTA 4WJKB 3J7AC 1ZM4A 4D96A 1P2VA 1R0LA 4REOA 1CYEA 1QZZA 1GSHA 1XU4A 1UKYA 1A96A 3QEKA 4AY2A 3VX3A 3PEEA 1UUFA 4PYQA 3VO9A 2BMFA 3AW8A 3K6KA 2O7NA 1U1CA 1YCGA 4TXLA 4HVLA 3SSNA 1EP3B 4NDNE 3DQQA 3LXMA 4XB6B 1GTRA 1EUDB 2ZVPX 2KWIA 4HLDA 4N7BA 1EBFA 3WLNA 1RHJA 5E6RB 1XXLA 4L51A 8ADHA 1G7CA 2IZZA 1Q0SA 2LW7A 3R0IA 1RI3A 2LP4Y 3DDWA 3G6WA 2D6FA 3UV3A 4NH4A 3EUWA 3WNZA 4MRMA 2P69A 3C6MA 2POQX 1VYVA 2PZAA 4XM1A 3THRA 2XGSA 3ZY3A 1GYRA 4I36A 5AW5A 5JZOA 3Q8MA 4E2FA 2WU0A 2RHTA 2ZI4A 1H42A 2YWBA 1A69A 3CB4A 5DASA 4XA8A 4DKXA 1JXOA 1ZRNA 3U60B 3HEBA 3WV4A 2H5JA 2V6JA 1LF5A 3TEJA 4L2IB 2P4UA 5DKFA 1QHXA 3GAZA 3GLKA 1GQQA 4EOGA 2WFAA 2YWHA 1RC1A 3D4IA 2B36A 2G71A 4TLLB 4X44A 1BOOA 4HWTA 4KI0A 4YS6A 4B3DA 4YQYA 3I0MA 1G6Q1 4XQ0A 2KS6A 5AUPB 2F2TA 3RUDA 4IS2A 3BT7A 1ZI8A 3OFVA 2HRCA 2FPMA 1RLTA 4ZCTA 1NNLA 2ACVA 1P45A 1FRNA 1B42A 1T6BY 3G7UA 3T52A 3GLHE 2HC9A 4C76A 4IFIA 5JNSA 2NTNA 4QHSA 3VMMA 3EZ9A 3JVUA 3FG9A 4LSGA 4ZO9A 5KDDA 2D3WA 3HY6A 4WLVA 2KYRA 4ZDWA 3KB8A 1P4AA 4RV9A 3RVMA 1AN0A 2CVZA 4ZJYA 3LHKA 2O59A 1SZPA 2YCLA 3HP7A 5BUQA 5JC8A 3LDFA 4IEFB 1NLYA 3N70A 3FNFA 3VBEA 1V11B 2N46A 3NHWA 4ZPXA 1MO6A 1S2GA 1B8VA 1H5UA 2GRJA 3HCRA 2CVPA 4L8LA 2ZIXB 2C59A 3IAEA 3UH1A 2ZB7A 4WRRA 5EKXA 3RS9A 4ALMA 4B84A 4BTLA 5BV0A 2HNKA 3DAYA 1RMTA 5COBA 1ORIA 1OXKB 3NTRA 1RYHA 1AO3A 4ITRC 3WYEA 3AY3A 3BCRA 2QP3A 3GARA 3HRHA 3E0XA 1I2AA 1DEAA 3WLEA 1W8IA 3PGJA 5DM0A 4ARUA 1L3IA 2IU4A 1ZPDA 1ULHA 5KVVA 3AJDA 1BDIA 1QU2A 1IBSA 1V6AA 2FF5A 2IYSA 2W6JA 4OHMA 1DHRA 2HB6A 2PR2A 3U7QB 4XYLA 5IKPA 5DTRA 3PWZA 2VDMB 2CUNA 3BKXA 4LYEA 1P1CA 4QEDA 4Y18A 3RV3A 2QSJA 4C5CA 4DMHA 1DX9A 4V1CB 2JA2A 4XFKA 2FUCA 3AH8A 4LBZA 3LQ4A 5FOSA 1PFYA 5ALVA 1Z37A 1TZBA 1S2OA 3L7BA 1DQZA 3VAAA 2BEJA 1L5ZA 1BJRE 2F1JA 1OI3A 3OJEA 5HWSA 5C5EA 2WNHA 3AK4A 5KNDH 3DXFA 2DSTA 1ZD3A 2H4HA 2VJNA 4CF3A 4X94A 1YULA 1CWUA 4PZCA 1C1XA 1EDBA 5ES3A 4DZZA 3OMWA 4UVDA 3R76A 3SC6A 3ANSA 5KB3A 3CZ9A 3EAGA 2VZ9A 1ZSVA 1RRMA 1MAVA 2PRYA 3RD5A 3RVRA 4CLOA 1Q74A 2V54A 4PZUA 1FSZA 3Q8KA 5B1HA 3KLPX 5E9JA 4YXWA 4DB4A 1YFKA 2SCUB 4K86A 4ND1A 3VPFA 3IESA 1SBYA 4XGNA 5BQXA 4L4ZA 1CTQA 1E9FA 1U3FA 4GW3A 3U7QA 2I7DA 5EJ8A 1YNSA 5IAKA 4LZAA 3HFRA 1H5NA 1LVUA 3FZYA 4QRDA 2Q8NA 4MAAA 3ZVKA 1VHDA 1B8NA 3L8ZA 4WX2B 2NADA 3WQRA 1GTZA 1U9IA 1A8UA 4WKGA 1SKYE 3CN9A 4ASUD 4EB3A 5CT6A 2O7QA 1JEAA 1Y8CA 1PU2A 3SIPA 1YS4A 2DGDA 3GBPA 4RACA 3WWCA 4Y7CA 5JOQA 3FHOA 4B2LA 1QYVA 3D6MA 4RM2A 1N4AA 3PQDA 4BBAA 5KJFA 2ZTVA 3SJBA 3HCEA 4GP9A 3X1YA 1VG8A 3ZVNA 1MJ5A 1QGAA 1KFKB 1X92A 2GPTA 1TYBE 3B6IA 2FZWA 2PKWA 4OHCA 4ZKDA 3CVUA 1OX5A 2RD2A 3PRHA 2QX4A 3IP3A 1LI7A 3MM4A 1C0KA 1DOAA 2IX9A 4LRTB 3E2PA 4M8KA 4K8OA 1XVAA 3ZDRA 1IY8A 3ECAA 2AJCA 4KJXA 5LXTA 1U2GC 1ETHA 2ZIVB 2RGNA 2ATXA 4FKZA 2BF7A 3KNZA 4HRYA 4Z9XA 2P2NA 1YTUA 5KAPA 5ERYA 1MC4A 1WW2A 2FJPA 3E15A 3FZGA 3GT3A 3G5LA 4DM4A 2ZIEA 1V6CA 3SXPA 4Z0HO 4HP8A 1E9CA 1JQ5A 1IK6A 1NBMA 1XDBA 2ORVA 3KKLA 3MTIA 1OQAA 2ENUA 4B9AA 4EKGA 3HRKA 3J81A 3QX3A 3TZKA 3DLIA 2PTHA 3L0ZA 4A36A 4PHHA 5E2AA 1B14A 2Z6VA 1RYZA 5J2UB 3FMIA 2LKDA 1Q20A 1O6BA 3W9SA 1CY1A 1Z0FA 1K6MA 2I4LA 1T3LA 1Z39A 1PTJC 4OQEA 4N82A 4RA9B 4F3KA 2OBFA 5A6SB 3IMEA 2O8BB 3DUFB 1A71A 3AIMA 1NR1A 1II0A 4B3HA 2ZRPA 1H2XA 4B47A 3LVRE 5EERA 4DIKA 1YRAA 4U6NA 1F5SA 3CKMA 2I7VA 3R9IA 4NCIA 3IV7A 5ICCA 3OFJA 1J39A 1MB4A 1QCYA 2PZJA 2YICA 4L8WB 4Y0AA 1E0SA 1LDYA 1Z6YA 3ZJ4A 1E2MA 4W7IA 1UR5A 2GZSA 2HK8A 3MSXA 3RJTA 1DKLA 3EIEA 1E0JA 1FOEB 5ITZB 1USGA 2NG1A 3IC5A 4OXNA 1YFJA 2DFDA 2GARA 4OQLA 4X63A 2FSFA 2AYZA 4ZA2A 1A76A 1TUEA 5B58T 2P91A 4DDTA 5I48A 5C53B 1EESA 2OPBA 3RRFA 4RPLA 2V7WA 2A35A 5EESA 5KYYB 3DDSA 1ACMA 4QDUA 5LNK1 1Q1EA 2J0SA 3PITA 1EP1B 2JGDA 1KYZA 3EGOA 4UBIA 3W8EA 1J8YF 4P0PB 2C9MA 2J07A 3A9WA 1U0JA 3GR6A 4MW1A 3U7RA 2CSUA 4F9EA 2FV8A 2HRBA 2C3OA 3WC4A 1CZUA 3I2IA 1GU0A 1OFUX 2XQFA 4IWYA 2A5LA 3DHVA 3PRJA 3WGUA 5A2GA 4NX2A 1CUHA 1KMCA 3CR3C 3HBAA 2P79A 1POWA 2W2KA 1KY4A 3IULA 4DBZA 1N8NA 3SVZA 5GZ1A 3S2YA 3JATA 3PUXA 2C2WA 1HLFA 4XIFA 2ANCA 2C3PA 5ENVA 5BSFA 3ETDA 3ZWXA 5K8JB 3LLUA 1GAXA 2ZR7A 2VXYA 4UC0A 5DLYA 3U2QA 2FGKA 4CFZA 1ECJA 3F97A 2G6TA 1C41A 1GV0A 3EVAA 3FVWA 1VECA 1ZSNA 1PT6A 1JGTA 2Z4RA 3FTCA 1ZD1A 2OO7A 1SBNE 2VXBA 3D6HA 3FGNA 3R0QA 4AZSA 5L8VA 1JHVA 1Q16A 5HIMA 3VR5A 1IYZA 1VSUA 2GESA 2VAPA 3CMCO 3L7NA 1GNLA 5FBRB 4DE5A 4JBYA 1WB5A 4O4LF 2QEQA 5CT4A 3QP9A 5FUXA 1W36D 1WE2A 4Y2RA 2A9VA 3KQNA 4HAZA 2XB4A 3G02A 3IFSA 1C4WA 2G36A 4Q1VA 3CPJB 4UZFA 1QV9A 3N2GA 3K1JA 2H59A 1W5TA 2BFBA 2MHCA 3LDGA 1ZK0A 2GF0A 3IGFA 4CHTA 1D6NA 2WBLC 5JCOA 2Y8EA 2CL0X 4E1AA 1TT5B 3P0RA 5HS6A 4KMOA 4LHYA 1TO6A 3SEQA 4QVKA 1E3MA 4MS3B 4DGQA 2G3YA 4B3SB 4BMPB 1T8PA 4NV1A 5L6MB 1PBNA 4FINA 1UJ2A 4OBEA 2Q3DA 3EMBA 3S5JA 1NSTA 5JAQA 4U2GA 4YT4A 1UP6A 2J9YB 3PX2A 3I45A 4XLLA 3HKBA 3I4FA 3T7CA 5BN3B 4OD0A 5KINB 2VYNA 4HWRA 4DYVA 3SYTA 3KVYA 3IE1A 1X7WB 2ZIZA 1SVSA 3FDJA 2FZ5A 3I1YA 3PV0A 4LY9A 3ZBUA 4YUAA 2J31A 3DE5X 4M22A 3LSTA 2B1QA 1Q1BA 2QZ9A 5HOEA 1W48A 3CNNA 4Q9NA 3P5SA 1A77A 1E7RA 4HVCA 5IULC 4KNYA 3E22B 1UBFA 1PR6A 2RGXA 3OZWA 2YFHA 4A23A 5SZIA 5K0SA 3ZDDA 3NVKI 5D84A 4FB5A 1ZCAA 1ADCA 5CDSA 1X2EA 5JMOA 5H81A 4P22A 3AEXA 2QG4A 1UPTA 1R15A 3EXIA 1Y3CE 3GGDA 5DULA 4C7KA 3A1FA 1SAYA 1O94C 3UB3A 1C3OA 1YS2X 2WJWA 1CR0A 4PQGA 2PGDA 4BFXA 4EYGA 3EXG1 3GDOA 3P9NA 3RW9A 4EG6A 4AURA 2BFMA 2ZYGA 1RWQA 1WMAA 3SHTA 4M87A 3FWPA 4J6FA 5IAGA 2Q5QA 3G68A 4EYKA 2VPZA 3RODA 3MILA 2CL5A 1NDQA 2XKAA 2ZANA 3H2KA 4IMIB 1Z22A 1KOGA 1QF6A 2JLBA 2Y1OA 1LRJA 3GZJA 2P0AA 4K0KB 1DAFA 3RK1A 4MGIR 2C9BA 2G40A 3TLMA 3N0TA 1EE9A 1Y9DA 3R7SA 1J23A 3A1SA 4GQBA 1CDZA 4P2GA 2O1WA 4C89A 1YA4A 2IDZA 5BR1A 1G5TA 4BGDA 1N2GA 4GOLD 3G0DA 2MT9A 5JVDF 4WEQA 4LDAA 5GVRA 1CQXA 2A3NA 4XWAA 3EBPA 4MVJI 1M0SA 1S8NA 1WXEA 4IBOA 5A3SA 3VR6H 5JANA 1QFXA 1UPAA 2II6A 2WHYA 3D3WA 3IRUA 1PD1A 1HE1C 1U80A 3QG1A 4HNHA 2OXCA 1PAUA 5BUCA 1VDMA 5TVGA 2WWVD 1VIYA 3IV9A 3CNQS 1A9TA 3EY4A 1O8CA 1E1CB 1H69A 3JASA 4XQEA 2REOA 3UCFA 4BO8A 1PFGA 2JZOA 1NP6A 4RTOA 4BX9A 2PS9A 5T4BA 4ARVA 3ZDCA 1XG5A 1NY5A 5JNRA 2GSWA 2F9FA 2FLVA 5AJTA 3W1EA 1KQ3A 2BRUC 1R9MA 3LQQA 4R1SA 3CNOA 3IAUA 1UZUA 1XRJA 1RQ2A 2J08A 1RWWA 1GJRA 2GD0A 1LLCA 3U7EB 2PKXA 4QO7A 5E8RA 1XCMA 4BKPA 1WZCA 2WKRA 3HCBA 4NZ9A 4QUBA 4KFSA 4X61A 4B3CA 1I5EA 1GPUA 3AU8A 3HI4A 5JAIA 2CDAA 4NE7A 2O19A 4RL4A 5AVRA 1YZKA 4DF3A 3B36A 1Q7GA 4GM4A 3F0TA 4JI5B 2VDWA 1JLLA 2PZBA 3QPAA 1P61B 4FLFA 4AL4A 13PKA 3IUPA 4U7TB 4ROSA 2ZBQA 2OXTA 1XVIA 1Y3FE 1P2TA 1PT7A 3PR3A 4JUCA 2GM9A 1FDOA 5K3BA 1WD5A 4IFTA 4W8GA 3R7BA 4B7XA 1ISJA 2ZSEA 4AKGA 2CF5A 4OHXA 3MTQA 2JLWA 2ZPAA 1L7AA 2C42A 4YQFA 5IUJC 1ZGAA 1LPNA 1NRJB 2XQIA 2YN4A 1I1QB 2JLSA 1G21E 3EC7A 4RSHA 3CTPA 2DY0A 2YWEA 3V8BA 1EJ6A 4CMAA 1E58A 1FXWF 1Y4AE 2H3EA 4ME6A 1M34E 4R7GA 4ZI5A 3MG9A 3E7FA 5H9WA 4IH9A 1U0BB 3ZIDA 2R8ZA 4RVUA 1PEAA 1QKKA 1W4BA 1B00A 2MINB 4FMPA 2GERA 4P4TA 3KQKA 5BSMA 4Y6RA 4XWYA 2W6NA 4N40A 2GHIA 5BMOA 2GK6A 3L6EA 3DYIA 5MN5A 2TRSB 4BUJA 3U09A 4PCVA 5AW7A 1QHSA 3K2BA 4FYKA 4OHBA 1N1EA 4XSHA 5AJZA 4C05A 5BYKA 3Q7PA 2WJZB 4BKOA 4HNQA 3K96A 2ABWA 3IEPA 3C5CA 3PDJA 4UARA 3OT1B 2V9PA 3W7VA 5E9WA 1BDJA 5BOSA 3DF7A 4Y6GB 5ERGB 4YAIA 3HJGA 2PL1A 1D5CA 4U5QA 1JSLA 4A7PA 3TUZC 5AM3A 3QVJA 1VLHA 3D4LA 4XDHA 4MCJA 1DEHA 2EHJA 2R97A 1LVHA 3DMDA 2IEAA 5DLPA 3IOBA 2AWOA 5IABA 4MK4A 3AERA 5G3YA 1XZDA 5KTMA 5J43A 2FEAA 5KNLA 3VGJA 2I80A 2XW6A 1ENYA 2F7SA 1P80A 1AMUA 4QHYA 2W8ZA 1JFSA 5DH9A 4FW8A 1ZGGA 4C88A 2YV2A 4FYHA 2FP4A 1DPFA 1JA9A 3BMOA 3K20A 1II8B 3GEIA 4LXGA 3GHHA 4YJ3F 5B30A 5KNBA 2P0YA 2WW8A 4HAYA 5L3SB 2V6GA 2OZLA 1JEDA 5K8LA 2QX7A 3HBJA 5BW4A 2XGOA 1G8PA 1NQAO 1P3Y1 1PZFA 2AUMA 4XYMA 4DLUA 4EMBA 3FWHA 2J30A 4YRDA 5JV5A 4EIWA 3K32A 3ZCTA 1XKTA 3DOJA 4GHWA 4DJAA 1K98A 5LQAA 1R9NA 5AW2A 1N2CA 4G1VA 2GHTA 1HZZC 1AF4A 3QY0A 1KQOA 2SECE 1NF8A 5ARCA 3B6ZA 1FFBA 1Z9BA 1W2HA 5IBCA 1TK3A 3FYSA 4TPKA 4BTEA 2GFHA 3ZHXA 1WCIA 2C2GA 2CLOB 3MFYA 3W0LB 2GM3A 2AFIB 3K1ZA 4R7TA 3NO4A 4R84A 4XYBA 4LIPD 1WMBA 2J6CA 5C7OO 2FA9A 1D0SA 2D1QA 5K0FA 2VUSA 1V8FA 1DQPA 3R3JA 4BZQA 4F38A 1AMOA 3MGGA 1XKXA 3VNAA 3DLHA 3R6LA 4L4SA 5AVKA 1U28A 5AW4A 3OQMA 1V5EA 3GFRA 3ROZA 2ACEA 3A2MA 3CISA 1NBOA 1SXJB 5J58A 2OY0A 1YZQA 1JDZA 1XZKA 2GLUA 4IWXA 1G6OA 4G5OA 5IHXA 2H51A 3DZFA 1NATA 1XYVA 1ZYUA 2D3TA 2WSYB 1LRLA 1VCOA 3E23A 4FMCF 4WMLA 4EHNA 2QM8A 4DQLA 1NGSA 3LW7A 3JQ9C 3O82A 4D8TA 4K9MA 1AGNA 3HB5X 2NVUA 3R2JA 4BY9E 5CIWA 1AV7A 1MB3A 2IK8A 3U3ZA 5KOIA 4OU5A 2VAXA 2B3DA 3TVYA 2JFUA 1VTKA 3ZWBA 2A6PA 4G63A 3G8BA 5U4XA 1XK6A 1D2HA 4IIEA 3A1EA 2P1RA 3FVTA 4WBXC 1Z3CA 4KQ1A 1ODIA 3TTYA 1XP5A 3V8PA 1FFCA 2FLKA 2JGEA 4IQ8A 5ALDA 1GL7A 2C1ZA 2Z8YA 1U0RA 4UHKA 1VKRA 2AMYA 3E03A 5CUQA 1HT1E 2XUIA 4IPTA 3Q3CA 1QIEA 2HFJA 1N25A 2J9ZB 4UFNA 5K8UA 3VUFA 1DV2A 1MEEA 3PDCA 1PIWA 1RYYA 2ZIGA 2D5IA 3C1OA 3QOWA 4E5SA 4RXUA 4RTJA 2QRQA 3OIVA 5FNVA 3BBLA 4RABA 1XVLA 2EERA 5CA0B 1DKNA 4UBJA 3S27A 1JU3A 3FHCB 3QHQA 4RADA 5EQJB 4I5IA 3AR2A 5EE0A 1DAPA 4Q3DA 5EXSA 2C5AA 3W6UA 3X3HA 1Z73A 3KJNA 1FFGA 1WR8A 3ML1A 3M5CA 4URHA 5HQJA 4ZYVA 3SWWA 2AC7A 7MDHA 1E3TA 5TGDA 1QMPA 4I9HA 2BBTA 4LF8B 3GMIA 1SXJD 3FH0A 1ZGBA 4G0QA 2AL7A 3OU2A 3R4CA 5E6SA 4BX3A 3AFIA 4UE3S 2OV1A 4DCCA 3O5AA 3VJMA 1PT9A 3TL6A 1Q12A 3BGIA 3IA2A 3QMVA 4QGHA 5CH8A 2O2JA 5EJAA 3NHRA 1S0UA 3V8QA 3QKRB 4N5MA 2D1TA 1ABFA 3SZ3A 2JCBA 1G8SA 1O77A 1WF6A 3AOEC 3UKJA 4OQ4A 4B83A 4CL2A 1E98A 1CIVA 2VDNB 1TZCA 2D0DA 2PKQP 3KYIB 4MMZB 4MR7A 4X8LA 1L5NA 2AFVA 1L9XA 1X0VA 3LQKA 5IHPA 2FZKA 3CLKA 5AMXA 5LBIA 1BVUA 3V8VA 3VO2A 4AUKA 5LYJF 2PUGA 2JBAB 3NJ4A 3BD9A 5ALKA 1GVHA 1R5OA 4ZVQA 2FOXA 1D9XA 1CVLA 2ZW9A 4CR7A 3D8NA 1GOTA 4WJZA 3CM0A 2AR7A 4DANA 4JQZA 2WJ4A 4UU7A 1DFIA 4TVKA 3PI6A 3CSDA 5D3MA 5A0FA 3A3OA 2Q6KA 4B4OA 4LVNA 3EPPA 4BJ3A 1Z2DA 1U4SA 3BC1A 5SY6A 1DJLA 2FMIA 2KHZA 5F21A 4YRBA 2YHBA 4EA7A 3AF6A 4PWYA 2QL9A 4QUAA 5CB4A 2B69A 4N03A 4DCGA 1YL7A 3K1AA 1TMOA 4OJYA 5DI3A 4TMYA 2WUFA 1V9LA 1XZJA 3Q5EA 4JK3A 1ZJJA 2QLTA 4W5TA 1JQJC 4OHOA 3UHJA 2CJPA 4N7MA 4TV8B 1Y1TA 1TVCA 4IDAA 1IU9A 3FBTA 3H0KA 3M6LA 3L49A 3HC7A 4LJYA 4BJ6A 4BMYA 1QRTA 1VKOA 4EYOA 3OZIA 4D6XA 3RU3A 2VQEB 5KTNA 4HLCA 1Z34A 5IJAA 4BMCA 4DV2B 3FX2A 1FBNA 2HH9A 4IQ0A 3V7WA 3AVUA 1OROA 3LUFA 2C9OA 3EDQA 3HM9A 4ZOAA 1NBAA 5I47A 3B9RA 3KETA 2W71A 1JTEA 2EFEB 2J4CA 3AONB 2V1UA 3PSAA 4CV2A 1FPMA 3B3AA 3DMRA 4BBZA 4IYJA 1L6RA 5EP3A 3IVGA 2ZB4A 2NU9B 3OX2A 2ISSD 2OC9A 4JUAA 5IPFA 1TVMA