5IXYA

Lactate dehydrogenase in complex with hydroxylactam inhibitor compound 31: (2~{s})-5-(2-chlorophenyl)sulfanyl-2-(4-morpholin-4-ylphenyl)-4-oxidanyl-2-thiophen-3-yl-1,3-dihydropyridin-6-one
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cell Active Hydroxylactam Inhibitors of Human Lactate Dehydrogenase with Oral Bioavailability in Mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxireductase/oxireductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
total genus 117
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5ixyA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5ixyA02
4DL9A 1GD1O 3F47A 2GN9A 4WKGA 3H9GA 4DQVA 1H9BA 4KTTE 3H9JA 1LXCA 4EZBA 3ZV3A 1XIVA 3Q6IA 2EP7A 4CQMB 1ZFNA 3PP8A 1ZCJA 3B20A 1FK8A 3UICA 1ORRA 1PJ3A 1UJMA 4ONEA 2D0IA 4A10A 1Z45A 3T7EA 4XIJA 5CP8A 1P1HA 3C1TA 3PLRA 4X54A 2V65A 3GK3A 4BV9A 2HDHA 1DPGA 4ZQBA 5K0ZA 3OH8A 5B1YA 2HMTA 1J5PA 4ALNA 3KYCA 4MVJF 4BO7A 2PD6A 2Q1UA 1GDHA 4R16A 3TDKA 3WDSA 3WGZA 1PX0A 2DUWA 1QMGA 4XEHA 4BNXA 2XXBA 4EJ6A 4B4VA 3RKUA 2J3KA 1CIVA 4NBUA 2YQ5A 4Q3NA 3EMKA 1XCBA 3I3OA 3I83A 5KKCA 4FS3A 4OM8A 1YKFA 5AVOA 4KUGA 1PR3A 3RUEA 4B8WA 4M86A 2JKVA 1HKUA 3DOCA 4IQ8A 1B3RA 1LU9A 3D5QA 3K96A 3SX2A 2VTEA 2EJVA 1JU9A 1AE1A 2O7SA 3QJ5A 4IDBA 4J0FA 4YQYA 1JLLA 1ZK4A 2GASA 4XQEA 1Q1NA 3D7LA 2NNLD 5BSHA 3BXXA 4E32A 1RPNA 4BO8A 3E6AA 5JPIA 3PHHA 4NNJA 3ZHXA 3QWBA 1MFZA 2QRJA 3TZHA 3QVSA 5EINA 4LK3A 1E0DA 5B37A 2PD3A 1ML3A 2Q1TA 3WMXA 3B1FA 1M6WA 3RQSA 4E12A 1I32A 1S6YA 3E1KA 2PZMA 3SLGA 3SXPA 3JD4A 1OMOA 3HUDA 1B26A 3GA0A 4ZICA 1L7DA 3GZNB 1LTHR 3GY0A 3C1OA 4WLUA 3ZN2A 4N54A 4IS3A 5TIIA 5IN4A 4LMPA 4R5HA 4WECA 4DLLA 2NU7A 4ZVVA 4NU6A 2NV6A 2Z1NA 4GQAA 1V3VA 2EHDA 3U4DA 5L45A 3K2BA 3JCZA 2JL1A 3ZNOA 3BHMA 1LLCA 5HS4A 1IE3A 2BD0A 2CVOA 5HWSA 2X0RA 3GMDA 3ICPA 3I5MA 1SBYA 4GVXA 2GCGA 5F5NA 4XJSA 1DAOA 1SB9A 1YVEI 5IDQA 2OFPA 1DLIA 5AYVA 4ZHSA 3N58A 5A9RA 3INGA 4DC1A 1WWKA 4FDAA 4HKTA 1GADO 1NX6A 1ONOA 1Z73A 4MPDA 3OIDA 3OEYA 4KTVE 5ADHA 4CM9A 4HUJA 3ZNNA 3GG2A 3PDUA 2PD4A 3FRJA 4FBGA 4DPLA 1DC4A 1R15A 1PZHA 2WTBA 1LDNA 4NBRA 4U8GA 3PYMA 4ZQHA 1UP6A 1ULSA 3MJCA 4MIYA 1WDKA 1HL3A 1AHHA 3PQFA 4B3HA 4D42A 3U9LA 4FOOA 2PKQP 2B5WA 2Q2WA 3HDHA 4BS9A 3CUKA 2LDXA 2UV8A 3KUXA 4H7PA 3E03A 1YL6A 4IQGA 1BXKA 3K5PA 3PGJA 2I67A 4IUYA 4YCAA 4MKRA 3WFIA 3OJEA 2RHCA 3TZ6A 4OXNA 1R6DA 4BNVA 1R0LA 1JW9B 2WWRA 3FF4A 4CM8B 2CF6A 2Z95A 4URFA 5CDYA 3KETA 4RLHA 3JQ7A 1ZUD1 5TX7A 4EUFA 5JYDA 2D5AA 1ZMTA 2RIRA 1V35A 4I9NA 4CLHA 4YJHA 2X22A 3MOGA 4I9UA 5EN4A 4CQMD 4XDYA 1WLYA 3BA1A 1DFGA 1VRWA 3OA0A 3EVTA 2EW8A 1N1EA 2DFVA 3ORFA 4FR5A 3FR7A 1A72A 1EFLA 3TZQA 2W4QA 4WCFB 2TMDA 2ZIZA 2Q1SA 4LCJA 1O95A 1EDOA 2IZ1A 3FNHA 4E2ZA 1P1JA 2X6TA 3GRKA 3D3WB 3G3EA 3KYDA 3ONEA 2WYUA 2RAFA 1HEUA 1XELA 1JQBA 4ZRMA 3BMQB 2P4HX 4S3MA 3F1LA 4D3FA 5KOIA 4E5YA 2QG4A 3INRA 3CIFA 3DOJA 4RPKA 3ANLA 3ANNA 1NPTO 1LA2A 4II2A 3E5MA 1DXYA 4PLCA 1J6UA 2CVZA 5KNLA 1I3MA 1KVRA 3ZWBA 4FGSA 5G4KB 5L51A 4J90A 1B14A 2HQ1A 3GAFA 1GY8A 2C54A 3GVHA 1LNQA 5LDGA 3RUHA 3FN4A 4ILKA 2CNBA 1FMCA 2O3SA 4NBVA 4D0SA 5I7FA 1M67A 4NH4A 4L8VA 1CETA 5IZCC 5F1OA 2CY0A 2ZQYA 1V9LA 4YB8A 4IBOA 2ZKLA 3WJAA 4D0RA 5TS3A 1HZZA 4CODB 1H93A 3JQEA 4L73A 3G0OA 3E82A 4QUKA 4TROA 5A06A 1DO8A 3RFVA 2QZ9A 1B3BA 5GZ1A 4WJZA 3WQQA 3BMOB 3DBLA 2PWZA 4DBVO 3IUPA 4IIVA 3NT5A 1R4NA 3D4PA 4GX2A 3RSHA 1NVMB 4LN1A 3RBVA 4XR9A 3HHPA 1T25A 3VTZA 1H0KA 4PZDA 1KVQA 3LSYA 4OH1A 1MUUA 3PFWO 1GU7A 4OOFA 1OOEA 4BNNA 5C7OO 1LQTA 3C85A 1J0XO 2JJYA 2BFOA 3IS3A 4FGWA 1HDOA 3NGLA 2GERA 4CV1A 3FHLA 3OEWA 1BDMA 1EK6A 3I9NA 3PYLA 3VAZA 2E6UX 3ZWVA 4NK5A 1FDVA 4OGWA 2BGKA 3EVNA 3P19A 4D7AA 3F5QA 5A02A 3WOHA 3VZRA 1MXFA 2ZCUA 2AG5A 3ZHYA 2X9VA 2I5PO 4EEXA 3U3XA 4MKZA 2A4KA 1G0NA 2IXAA 3QVTA 1X7DA 4J9VA 1Z74A 1DIHA 2C2YA 3RC9A 1ISJA 1ADCA 5T5QA 4C4OA 1HXHA 1IOLA 1P31A 2DPGA 3C7AA 3Q3CA 4J7CA 4B4WA 5C3MA 4JJFA 1SAYA 3HZZA 3CMCO 4JIGA 4LVCA 1EZ4A 4YAKA 5JDIC 1Y81A 2W2KA 2H9IA 1U1IA 5KVVA 4TSKA 5ES3A 5DP2A 1B7GO 2H1SA 5EERA 4D43A 3Q9NA 3V5NA 4ZQFA 2D4AA 3DEYX 3JQ9A 4PN3A 1LRJA 1NAHA 5A9SA 1ZEJA 3F4LA 3N7UA 1FXSA 3RC2A 1ZSYA 2G5CA 2Y99A 1K6JA 4G81A 5JY1A 3WTCA 4INAA 5L3ZA 2B69A 4IS2A 5G0SA 4OMUA 3A06A 3C3XA 1GEGA 1LI4A 1PGPA 3QWIA 4UVIA 3JQCA 1ADBA 1YOVA 1UH5A 4M54A 4YRAA 3VKVA 2C29D 3S2FA 1U9JA 4U6SA 1X1TA 3SC6A 3HQ4O 3OM9A 4D3DA 5IXYA 5ILGA 3ZHZA 3U09A 1K5HA 4WASA 2V6GA 2VRCA 3PEFA 2C2XA 3KYDB 2HO5A 3E18A 4EBFA 4BGVA 4J7UA 1JN0A 5JY6A 3VVBA 2C07A 2X4GA 5CDUA 5JNLA 1ENOA 3ZWCA 2VCYA 3WGIA 1TXGA 3NEPX 4KOAA 1YL5A 1PJ2A 2PGDA 3RU7A 3O03A 3FWNA 2ZB7A 1CF2O 4PRKA 3CPSA 4BO9A 3STHA 3UN1A 4W4TA 1Q0LA 3I9MA 4EGFA 4NDNE 1E77A 2I6TA 2UUOA 2PY6A 4OXKA 3NJ8A 1HE3A 4AFNA 2DLDA 3W4KA 3DHEA 3IKTA 4LSMA 3WG9A 2EV9A 4DTIA 2BI7A 1Y1PA 5CHEA 1LDBA 1DLJA 5G4KA 9LDBA 4KWIA 3HB5X 1I33A 3O26A 1T24A 4PLWA 2C7GA 2H63A 5THQA 5CG1A 4UEOA 1VI2A 4DQXA 4R41A 4CLDA 1FDSA 2BELA 2H5LA 1T2AA 1XU9A 4BL5A 4H15A 2DTXA 1DSSG 3DBVO 3QE3A 4RZHA 4CM1A 3H5NA 5GZ3A 1MX3A 1LSJA 3ZU4A 4Z9YA 4GLLA 5L9AA 3DZFA 2VWHA 3LT2A 4WPGA 4BUCA 2D5CA 1IHYA 4DGSA 2OO5A 4R01A 1ENZA 4MJLA 3R3SA 2ZYDA 4F6CA 3OQ1A 3ZZNA 4MOWA 4WGGA 3AM3A 4E33A 2YJZA 4B3JA 2FWMX 3B70A 3UCEA 2J8ZA 4IDDA 4M89A 4PGFA 3ZV4A 1VSUA 3AOEC 4W9NA 4FFNA 4HXYA 1CEQA 2VYVD 1DC5A 1N7HA 1F8FA 4XKJA 4R3NA 4CUJA 4FB5A 5EESA 3UUWA 1YO6A 1HZJA 2QHXA 4PLYA 1HSOA 1UXIA 4F6LA 1Y8QA 3FCOA 2Q99A 1ZK3A 2O2SA 1PJSA 5LC1A 4IIUA 3OP4A 2HK9A 5A9TA 3PJEA 3MOIA 3FNFA 1CDOA 4CV2A 1I24A 4ALMA 3LT4A 4FC6A 5GZ6A 4HADA 3V1TC 4LRTB 1D4FA 3AWDA 4I5GA 3UXYA 4GBJA 1A4IA 2Y1GA 4QQRA 4UUOA 1YRLA 1ARZA 2I3AA 1Z7BA 1GYQA 1LDGA 1EEHA 5DNAA 3EUWA 1YQXA 3KSZO 4CJXA 1XSEA 2J3HA 1AHIA 4MP8A 5KJ6A 3BZUA 4WNIA 4JXKA 5CPFA 5DCUA 1RKXA 4II3A 4XQCA 4RVHA 1R66A 2J6IA 2AA3A 4DA9A 4E5PA 1DRUA 2VRCD 1QSGA 2DBQA 2VZ0A 1BHSA 1OI7A 3FD8A 4XZ3A 4AVYA 2YDYA 1VL0A 4CM7A 3INTA 3PVZA 4OOEA 4XYGA 3QVXA 1DIAA 3JQFA 4OHUA 1I2BA 3PHIA 1Z7EA 1E5QA 5I9LA 4PVCA 4ND5A 3TWOA 1U4SA 4R1TA 4QECA 1DEHA 4YPOA 2UUPA 2VNAA 3U0BA 5COBA 3BMQA 3GQVA 2ZB3A 3ZWPA 4Z6KA 4Q3BA 1B2LA 2B37A 1RYEA 4FFOA 1PZEA 3GVPA 2C59A 5JCJA 4LCEA 3UCFA 3PXXA 4PFJA 1QRRA 4HP8A 1HE2A 4DYDA 4YAJA 2NVUB 4WCFA 4WCDA 1MC4A 2EW2A 2HLPA 4GSKA 1QLJA 4RF5A 1E3SA 4BNYA 4PCVA 4XYEA 3HB4X 3UF0A 1LC3A 4D41A 1GZ3A 3HADA 4IJUA 1BWSA 2Y93A 2IZZA 1KEVA 5THKA 3HDYA 4LSWA 3H2ZA 3JQ7B 1KBZA 4IGEA 4Z9FA 3GFGA 3LT0A 5HBRA 5ITVA 3GZ4A 4CMJA 4TMFA 4BB5A 1EUZA 2I76A 4GKVA 5FI5A 3RROA 3R1IA 3DBRB 2VHYA 1BDBA 4DIOA 5K6AA 1UXJA 3RASA 4HBGA 3VOSA 4WOKA 1AUPA 4DQUA 4YVFA 4K6FA 4XR4A 3GDOA 2QIOA 3F46A 3I4FA 2C20A 1NFQA 1UAGA 1HYEA 3I1JA 2FP4A 2R2GA 2CUKA 2VT3A 4Q3CA 3VC7A 2XXJA 3V2GA 1H2HA 4AJ1A 1QYDA 2UVDA 4IDGA 4DLAA 3H9EO 1GYPA 3SC4A 4OKIA 5A5FA 1VL6A 4ZQGA 1WNTA 3HFSA 1NQTA 2YFQA 4ZA2A 4RJTA 3ITDA 2GN8A 3A14A 4FW8A 3DWFA 2O3TA 3KHUA 4ND4A 3ZWMA 3G1UA 4AICA 3ZH2A 1NPDA 3PJFA 4K26A 4Q3EA 2I99A 2A9FA 4MP6A 1CYDA 3FBGA 4XQGA 2QQ5A 4YYZA 3F3SA 1JWBB 1ZK2A 2OOSA 3KZVA 4KQXA 4AJEA 4E6PA 4PG4A 4MVJM 3TFOA 1YDWA 5KVSA 1OFGA 1I5RA 3FTPA 1KYQA 3V1YA 3ZV5A 5L7WA 1A7KA 3NGXA 2Y67A 4PG8A 3DAGA 4BV8A 1KVUA 1LSOA 3IJRA 1KS9A 5BQFA 3UW3A 4BNZA 2GPTA 4AL4A 2DAPA 2B4TO 2GGSA 2NU9A 3DR3A 5L7TA 4UVEA 2AQHA 4R54A 2BGLA 3AI3A 4IM7A 1P3DA 3V1UA 3JQGA 1M66A 5T64A 8LDHA 1QYCA 4QFDA 2BFPA 3ULKA 2VUSA 4Y9DA 2Z1MA 2CZCA 2W2LD 5GMOA 2NACA 1J4AA 4BO2A 5JCXA 3TL3A 1E6UA 4K1LA 5HA5A 1GCUA 4GKBA 3CXRA 3WXBA 3GUYA 1LUAA 3GHHA 1E7RA 2VT2A 4O1MA 1C0PA 1QG6A 3I9JA 5T6BA 1CJCA 1GYRA 2GUGA 2OBNA 4IMRA 4M87A 2RH8A 4XGKA 3WS7A 3ZWNA 5I7VA 2YW9A 3VH4A 3QHAA 1IB6A 2HJSA 3DXFA 4EI2A 1PGNA 5IXSA 5KJFA 4U0JA 3GEMA 1F17A 2J3JA 1EK5A 3GDGA 5COQA 5H83A 5FF9A 4CMKA 4KDFA 1B8UA 5IFLA 1T26A 2IDZA 1HLPA 4WLOA 4BKOA 4DIBA 4PLPA 3TZCA 3PZBA 1RYDA 3QY9A 3EHEA 3O8QA 2GLXA 1YOVB 1ADGA 1E1LA 2EKPA 3WTBA 3VPGA 1PS8A 2OGUA 1DB3A 1ISMA 4XRRA 1XWFA 1MC5A 1T1RA 4GMFA 4H16A 3DZKA 1U8XX 1TA4A 2Q2VA 2YV1A 4ITUA 3JQ9C 4JCOA 2B4QA 4L75A 2W2LA 2PK3A 5A9SB 4L76A 3H5AA 1HTBA 1TI7A 3IOYA 2VHXA 1NFFA 1GPDG 2P91A 4IXTA 4WNCA 5TGDA 3K92A 1Y7TA 4WLVA 3SJ7A 1B0AA 3VDQA 3WFJA 4YAIA 3L6DA 3VTFA 4YTEA 4HX5A 1EUCA 4QO7A 5DN9A 3IDSA 4MINA 4CMHA 3L9WA 4GWKA 1P74A 1E3WA 1MGOA 3LF2A 5TRTA 3ADOA 4IDAA 1E6WA 4CR8A 3GN2A 3GAZA 2OUIA 3TNLA 1EQ2A 3GEDA 1WMBA 1F0YA 1WZEA 4NG5A 4GPD1 3OMLA 3PFFA 4PZEA 3GG9A 3ONDA 4FCCA 1R0SA 1PU2A 2CD9A 5CPBA 3BAZA 1NWHA 3CKYA 4OL9A 4HFJA 5DOVA 3RC1A 2GO1A 3CMMA 1Q7CA 2Y1CA 4FD3A 4FJ0A 3BMCB 1DIBA 3DZBA 4F46A 1XG5A 3JQAB 2E37A 4A03A 4CLRA 3IKVA 3MEQA 2E4AA 1GFSA 4RPLA 3UKOA 4CV0A 2AXQA 3K6JA 4J7XA 5IDWA 2SCUA 4KDEA 3ENKA 2NTNA 1Q0QA 4JJIA 5DOZA 3I6QA 4M49A 1LLUA 4XQ9A 3KTDA 3S1LA 2HUNA 5L95A 3JYQA 1EE9A 1IYZA 4EUHA 5EL0A 2HMVA 4RZIA 2GN6A 1I36A 4MKXA 3S2EA 2A35A 3RI3A 3GFBA 3WGHA 5HRUA 3R6DA 4EJMA 3RJ5A 1Y9EA 3MWDB 4M1QA 4GX0A 4A73A 3KEOA 2VYND 4Y6RA 2JFGA 1BSVA 5CEFA 1VM6A 1PQUA 3BTSA 1U3UA 5ENDA 1HDRA 3D64A 4CMBA 2JCXA 3DHYA 1VKOA 2NADA 1UR5A 5EQFA 1YBMA 4W82A 1E7YA 3VDRA 1TLTA 1A9ZA 1H6BA 3QLJA 2WEKA 3KO8A 2ZTUA 4J1QA 5BNIA 3C7DB 2NVWA 3Q9UA 2GR9A 1HYHA 1Z6ZA 4OAQA 3HDQA 3BTOA 2G17A 1VC2A 3LU1A 5F1KA 1PGQA 4RGBA 5JE8A 3JTMA 4PG6A 5L4SA 4I5FA 1GEEA 5HTOA 1R12A 2QRLA 2WD7B 1N9GB 4O6VA 4IMPA 5T8KA 1E3JA 4P4GA 1KY5A 3VH2A 3JQBC 3LC1O 5KVQA 3PPIA 1PEDA 2F00A 1GQQA 2ET6A 1BW9A 3VZPA 4ZN6A 4L4XA 1I30A 5CAEA 4BO1A 3JQBA 1I10A 4YR9A 4IINA 1MV8A 4ZD6A 5T8KC 3CSDA 1WXDA 1O0SA 4YEDA 4MP3A 5I9NA 5ILOA 4QFCA 3WNQA 1FDTA 3EDMA 4RQTA 2VUUA 3K9QO 4G5HA 3GRPA 5IZ4A 3OSUA 3GR6A 4CM5A 2FZWA 3NTOA 3DMTC 1HDGO 3GNSA 4JJGA 1QP8A 1YJQA 1FF9A 2O4CA 1EVIA 3LDHA 3AI1A 3MTJA 4GLOA 5JAMA 3I4CA 4BKPA 3PHLA 2JCVA 2X86A 2YDXA 1I3NA 1PJQA 1W4ZA 2LDBA 5JSFA 3HJAA 3GMSA 3M6IA 5IAAA 1D1TA 4AJLA 2P4QA 3GEGA 4F3YA 3LK7A 5JYEA 5DF1A 4L4RA 2HK8A 3PI7A 4ESOA 5BNTA 1EE2A 4FFLA 1LQUA 4IDFA 4B7CA 4OSOA 1OC4A 1K89A 1ISIA 3JD1A 1I0ZA 5F5LA 1G0OA 2CSUA 3TN7A 2AQKA 4UUNA 3I9LA 4PVDA 2IEBA 3CTMA 2OMEA 4JX8A 4CM4A 3P2OA 3JQAA 4NIMA 4CLRB 3WGQA 5EIOA 1NVGA 2POQX 2YQ4A 5A3VA 1PSDA 5EPOA 5TT0A 2D2IA 3CZMA 4BNHA 3GDFA 4XX0A 1Z75A 2WYWA 2PZJA 3IJPA 3O4RA 5AXCA 3RUDA 2ILTA 4YJHB 2OL4A 1JA9A 3FPCA 2AHRA 1XEAA 1MG5A 4NJMB 2BMAA 3K8ZA 3MJVA 3PIIA 1JWAB 3L4BC 4AJPA 1KC1A 2DKNA 1RJWA 3G1TA 2CVQA 1QYVA 2Y1DA 4P38A 4CLOA 3QVWA 3NUGA 4E5MA 1BMDA 2X8LA 5A04A 2FR1A 5HS6A 2O3RA 1PL8A 3ZWOA 4WLEA 3KSDO 4CR6A 5JDCA 3WLEA 1P9LA 2VOJA 2VWGA 4RF3A 1VJTA 3WICA 3COSA 4ZJUA 3MWEB 3GNQA 1U3TA 4ALLA 3ICCA 4ND2A 1NAIA 1LRLA 5L4NA 4JN6B 2WE7A 4BB6A 4E31A 4OQYA 3PJGA 3A4VA 3X2EA 2Y68A 4PLTA 1EVYA 3W8EA 4LVUA 5T57A 2JHFA 3F5SA 4RF4A 2W8ZA 4EW6A 2OP1A 4QTZA 3BMNA 4ZRNA 3DBHA 3AOGA 5F3RA 3P2YA 4CPDA 2GYYA 1M6HA 3BIOA 4BNFA 1PZGA 4XYLA 1N92A 2BHLA 3AFNA 1ADFA 4NU5A 3NDIA 3IQDB 4NQZA 3LT1A 4Y6PA 2V6FA 4BNMA 1I8TA 3E8XA 2Q1WA 3HWRA 1T4DA 2E48A 2ZTMA 3K73O 2R6JA 2WM3A 1NXQA 4CV3A 2PA3A 4CM3A 5KIAA 1A27A 5G0TA 5C37A 1NASA 1EBFA 2H6EA 3H9QA 2UYYA 1NVTA 1DDOA 5AQ1A 2WYVA 3W8DA 4E4YA 4J4BA 2JD2A 3F9IA 2O7QA 3KYCB 3BMNB 1NP3A 1KY4A 4UEKA 4YACA 2P5YA 1M76A 1U28A 1A5ZA 1WDMA 4HNHA 4BQRA 1UP4A 4E5NA 3RBXA 1B8PA 3ROKA 3C8MA 1EVJA 1DJNA 5F1PA 3NAQA 1E3LA 4MDHA 5EMHA 1DJQA 4P8RA 4OJNA 1TEHA 3GVXA 5BNFA 5LCXA 4KMSA 1QV7A 2IZ0A 4DXHA 1U7TA 3OJLA 3DBRA 5G0UA 4CQLB 4Y98A 1YBVA 5BSFA 3AOEA 2B36A 4KZPA 4W9NC 2IXBA 2Y0DA 1ZKMA 3TL2A 3Q2KA 4OSPA 1BVUA 5ICMA 1E7WA 2G0TA 2NTJA 3RC7A 2FSSA 1P33A 3DAPA 1N5DA 4UAGA 1GV0A 3DB2A 4TRNA 3VPFA 3OETA 4PLHA 5KJEA 1P1FA 4B4OA 3C1AA 1QLHA 1SMKA 3EZLA 2FR8A 3O8QB 3QIVA 7ADHA 3KXDA 2DU8A 4NBTA 2D1YA 2PKQO 4RORA 3PGXA 4KQWA 3EGOA 5BR7A 1VL8A 3EAGA 3TJRA 1W0CA 1HLDA 1MB4A 1A7AA 2O4UX 4BNKA 1I3KA 3VZSA 5B4UA 3TZKA 2ZQZA 4CMIB 4Z3KA 3HFGA 1PIWA 1X14A 4EDFA 5DCWA 4YAGA 1P0FA 3N74A 4GX5A 5ER9A 4IJWA 1XU7A 1KETA 2WJPA 2GRAA 2JD0A 5BSEA 1PQWA 1C1DA 1SNYA 1C1XB 3HE3A 1DRVA 3DC2A 5G2OA 1L1FA 2FPIA 1YQGA 1YS4A 3LVFO 3UHAA 4CQLA 2NSDA 2BI8A 1C0LA 4PLZA 2DBZA 1OBFO 2X5KO 4BGEA 1WP4A 2DBRA 4J49A 2UAGA 1JVBA 3O9ZA 5TC4A 3NV9A 1HDXA 1MFPA 3NX4A 1YGYA 4GI2A 4IZIA 4PG7A 2WE8A 1E6EA 2O48X 3ETDA 3JQGB 4XA8A 1X7HA 4XIYA 4B7XA 2ZB8A 2BF7A 1E1NA 3TOXA 3DONA 4W6ZA 3V2UA 3UVEA 3RBZA 3PDJA 2PV7A 4DIFA 2VZ9A 2TMGA 4N7RA 2YZ7A 5DP1A 3U62A 1IY8A 1KC3A 4UVDA 1YBAA 5AXDA 3IIEA 3WGGA 4J2OA 1YB1A 2X23A 1P1IA 3H9UA 4TRRA 2I3GA 2CF5A 5AXAA 4EUEA 1GZ4A 3OF2A 3AM5A 2WSBA 1NQ5A 3ITKA 1DOHA 5JAIA 4BNLA 5JC1A 1KEWA 5I8ZA 1BVRA 5IJZA 1PS0A 2X9NA 4CUZA 1NFRA 4Q3DA 3G17A 4YRBA 3IP3A 4GX1A 1XR3A 4FOSA 1KEPA 1RM3A 1VSVA 2PH5A 4YJFB 5JS6A 3C7CB 1UZNA 3T7CA 2HCTA 3GF4A 4RVDA 5DDIP 1TT5B 1TT5A 1MP0A 4NK4A 4TRMA 1NBOA 1R4NB 1UZLA 4R4JA 3LQFA 1R37A 4L74A 4HV4A 3OECA 4CLEA 1CQIA 2B4RO 4BNIA 4O59O 1MXHA 1HYGA 1NHGA 2C7VA 4J2HA 4JBGA 3OICA 4XJTA 2ZJ1A 3QWAA 1ZK0A 5HM8A 1YE3A 2VRBA 1YQDA 2DT5A 2VWPA 3D5TA 4XD2A 3D3EA 6LDHA 2V7PA 5JAQA 1H9AA 2DUUA 1R4MB 4YDRA 4TQGA 1ISGA 3UCXA 5DULA 3VPSA 2BLLA 3E9NA 1PQPA 4CMCA 1IULA 1ZIDA 3W6ZA 5A3JA 3Q11A 3U49A 3AJRA 2AEFA 4U6QA 1NQAO 4CLOB 2BFMA 5JAZA 2A94A 1E92A 3K30A 3ANMA 4BMVA 3FWZA 3RU9A 4E2YA 1UXKA 5KTKA 4A27A 5JMPA 4NI5A 4QT0A 1T4BA 4FQ8A 1I01A 4P4LA 4YWJA 3VH1A 1GUZA 2P5UA 4MVJA 4MIEA 2YHUA 1NR1A 4CM9D 3B1JA 4KP7A 3TFQA 2EG9A 2Y05A 3QWFA 3B1KA 3RUCA 1YH3A 3T4EA 4JNKA 1C0KA 4BO6A 2VHVA 3GPIA 1OAAA 2FMUA 5U1PA 1PGJA 2O50A 2Y66A 3JD3A 5CDGA 1LDYA 1SB8A 3QQPA 2OXIA 4BO5A 5ENVA 4CMIA 1N9GA 3MJ4A 4E30A 5GY7A 1ZZEA 4Y6SA 1ZVMA 3K2EA 3NT4A 2YY7A 5BSGA 4C7JA 2J5KA 2PKRA 2P9CA 3H2SA 2QYSA 2JCYA 4E3ZA 1F8GA 2P9GA 2X1HA 4D44A 4KUEA 4XYMA 4FFPA 2C5AA 3Q0EA 1GAEO 3G49A 4RPHA 5F21A 1GUFA 2GZ3A 3L9XA 3RUFA 3VKUA 4M55A 1HDCA 2JFHA 3DZGA 1P0CA 4A5OA 2AMFA 3MCVA 4BNTA 4YJGB 4J1SA 5MDHA 1AXGA 3OBBA 3WSVA 1ZH8A 3DOOA 3RAJA 1X7GA 1FJHA 1PJCA 2GN4A 1B15A 3U5TA 3GT0A 2VNSA 5JXWA 3WQRA 1ZNQO 3H6KA 3CEAA 3VZQA 1O8CA 4WEOA 4AJNA 5G0VA 2E82A 3WSWA 4B4UA 4U7WA 2PTGA 4EEZA 4HNGA 2PZLA 2Z5LA 4D45A 2ZB4A 4QEDA 4S1VA 1K2WA 4ZQEA 1KVSA 4HFRA 4JLWA 3VHRA 1ZEMA 5JLAA 3WR5A 1ZJZA 4R68A 4AG3A 5TQVA 1Y8QB 1BW9B 3ZNPA 3NT2A 4HWKA 3P5SA 2O23A 1ZXBA 1A4UA 1XQ6A 1EQUA 2PH3A 1PJBA 2WD7A 3IUSA 5CEJA 4MVJE 1H6AA 1HRDA 3R3JA 4PLFA 4CMEA 5KCZA 1YONA 3QW2A 3C24A 4PRLA 1O9BA 2VOEA 4HFNA 2NU8A 5I8WA 1W73A 3S2GA 2Y1EA 3FNGA 3H5RA 4FFMA 3TF5A 4ALKA 4YT8A 1PWXA 4R9RA 3U4HA 1PTJA 3CH6A 2NU6A 3ZW9A 1ZO8A 3W8FA 3DHNA 3RD5A 4NMHA 4RVUA 1M2WA 4YBZA 4I9HA 4RQUA 3FPLA 3L6OO 1QYWA 2C5EA 1EUDA 1P77A 4TRJA 1V0JA 2Y0EA 1KIFA 1CRWG 3MJSA 4XGNA 3GGOA 5IF3A 1HDYA 4CMEC 4YT2A 1WVGA 1PR9A 4AJIA 3PYXA 1GPJA 3HNPA 3GOHA 3L77A 4I08A 1AN9A 1SZJG 1DIGA 1YJ8A 3ZCXA 4BNWA 2ZTLA 3DO5A 4YRDA 4YAEA 4YA6A 3U4CA 5JDIA 1XYGA 4GGOA 2IE0A 3FNEA 3VH3A 3AU9A 3NRCA 4ZU3A 3RKRA 4BMSA 4CM6A 4LW8A 3EY4A 3D0OA 3MJTA 3LC7O 3W4IA 3CINA 1DC6A 5JCJD 1D8AA 3QVOA 2GDZA 4MVJH 5FEUA 3P7MA 1BGVA 4U5QA 5AXBA 4WLFA 3WB9A 2E49A 4DVJA 3KV3O 2DM6A 1IPEA 4BO3A 4J16A 4BNUA 1F12A 4N5NA 3GUCA 5CDTA 3AY6A 3D4OA 4IQ0A 4WOJA 3F6YA 5DBIA 1ISFA 3WLFA 2QZZA 2P9EA 1B16A 2XPCA 4JGBA 1W8DA 2NQ8A 5DT9A 2OBYA 3M1AA 4BNJA 4A7PA 3TSCA 2HMSA 4RV9A 4CM4B 1QORA 2PLAA 5U9CA 1WPQA 3D1LA 4K9DA 2XF8A 2B0JA 3PWZA 1XDWA 2IYPA 3BMOA 4DUPA 1BTOA 5JFOA 5L53A 3PHGA 1U7HA 1GR0A 4I8XA 4R1NA 4ALJA 1RWBA 3M2PA 1XLTA 4BKRA 1RM5A 2HMUA 2X0IA 2EWMA 4PIVA 4Z0HO 3RUAA 5KJ1A 3H8VA 1PJLA 3F1KA 1ZBQA 3KB6A 1UDBA 2BFAA 4WEQA 3RWBA 3LZ6A 1Y5MA 3PWKA 5A03A 4XYBA 3KM0A 4IDCA 2J3IA 5BT9A 2JAHA 4TKLA 1JTVA 1NQOA 3DDNA 3JQDA 5IDYA 1T2CA 2VTDA 2X58A 2R00A 3M2TA 4DMLA 1CERA 1DIRA 1H94A 4Z0TA 4FSHA 2FSVA 1IHXA 2GF2A 4TVOA 1Y8RB 3DZIA 3I9OA 5JO9A 4R1UA 1E3EA 4YQZA 3TQHA 1S7CA 5JMWA 3WGOA 2DTDA 1FDWA 1BXGA 4XCVA 4ND1A 4BO0A 4J91A 4WE3A 5KVCA 4RDIA 1U4OA 4BGUA 1GQYA 3EYWA 1LSUA 4UVHA 1NWCA 1BXZA 3GNTA 2AEJA 4G2NA 1GTMA 1VPDA 4GL4A 3AY7A 3JQ8A 4NFSA 4H3VA 4E0BA 3SEFA 4Z0PA 1PGOA 1VJ1A 3UH1A 5L40A 1MLDA 3LYLA 3DAFA 2XAAA 4J4TA 3PK0A 3NJ4A 3ETEA 4AJ4A 4RLSA 2QYTA 3VPXA 4O0LA 4J1NA 3TPCA 1Q2XA 2HK7A 2O2YA 3OFSA 1U5AA 2NM0A 2EIHA 3DFZA 1X0XA 4J4HA 3ABIA 4R51A 4CR7A 1K6XA 5C7LO 3L4SO 3JD2A 3AUSA 2EGHA 2W90A 4GVLA 4DYVA 4NHEA 4EITA 2OZPA 2P68A 3QP9A 5A5EA 1O6ZA 4ID9A 4BQPA 3GZNA 1P1RA 2FOIA 4RF2A 4Y8VA 1QV6A 1T2DA 2PNFA 4LRSB 4ND3A 3ZWWA 5I7EA 2IRWA 4YJGA 5JC8A 2QW8A 1D1SA 4MO2A 3ZU3A 2J5QA 3UAGA 4NJMA 4QSMA 2O3JA 4DBZA 3F4BA 3OJ0A 1JVSA 4BOYA 3B6ZA 3D4NA 4B3IA 1ENYA 1PZFA 1SEVA 1EVZA 3A28A 1A71A 2X0NA 4PLVA 2YV3A 4UULA 2YYYA 5H82A 3ZU2A 1LRKA 3IMFA 2Q3EA 3DMYA 1WAMA 1E7QA 4MIOA 4PZCA 1R16A 4AJKA 3ROQA 1Y6JA 5KJCA 1OZAA 4E2WA 2NWQA 4L9RA 1F06A 4J3FA 4J1TA 2AE2A 4LISA 2X5JO 4MVJP 5JDCC 2AEMA 4MVJI 3FI9A 1NTOA 1BXGB 1A9YA 1P1KA 3KLPX 1U5CA 3JQFC 3JSAA 2AE1A 3NTRA 4BO4A 2Q46A 2X7HA 5U4QA 1Q7GA 2ZJ0A 5DBFA 3ZDFA 3RUIA 4B7UA 3GN1A 3MZ0A 1KEUA 1X0VA 4IDEA 3CZRA 1H6DA 1X13A 2BGMA 1SCUA 3GH3A 2EF1A 7MDHA 1HF3A 1GL3A 1H6CA 3EW7A 1YWGO 3ROMA 2VQ3A 2NLOA 5AOVA 4N18A 3I52A 4YXFA 3IL2A 1AGNA 4OQZA 4RVFA 2D3TA 3NDRA 3OQ6A 2I9PA 2EXXA 4RO0A 2X0JA 4P22A 1E1MA 5I7SA 4ROSA 3LLVA 1XKQA 5LDHA 2VN8A 1YB4A 2J5RA 1CQJA 3GGGA 4BGIA 3K31A 3GPDG 2X5OA 1JKJA 2EERA 2WDZA 1JKFA 2CFCA 1V3UA 3NYWA 1RM0A 1VJ0A 1VKNA 1J49A 2VWQA 3I23A 4W7IA 1LLQA 2FN7A 3WWZA 3NDJA 1WMAA 3A1NA 1O89A 5ICSA 1U2DA 2EKQA 5IZCA 1XGKA 4AJHA 3Q2IA 4M8SA 2YUTA 4XDZA 3ST7A 2I65A 3DQPA 3WGTA 2DQ4A 1UUFA 3EK2A 3E5RA 1VE9A 3JYOA 4WK6A 1YXMA 3T4XA 4KWHA 3V8BA 1LEHA 2NTVA 3ZV6A 1C3VA 2FPGA 4FFRA 4D79A 3I9KA 4IXWA 3ZGYA 4QX6A 3UGKA 2FHSA 1IL0A 4J6FA 4TVBA 4O63O 3WMWA 1C14A 3S2IA 2DFDA 1T2FA 3DL2A 5COAA 4LGVA 4BKQA 3GLQA 4WUVA 2R00C 4CUKA 2EEZA 1P45A 4GH5A 2PFGA 2YHIB 1QXSA 1Y9AA 2Q45A 1X1EA 3LC2O 4IZHA 5DZSA 4JP2A 3KRTA 4AJJA 4JP3A 2CDAA 4CQMA 2AQIA 3PWSA 2B5VA 3WNVA 4CLXA 3AY3A 2I66A 1XQ1A 3DZJA 3FSRA 3OHSX 4HY3A 1M75A 5B4TA 3KLMX 5TT1A 2QRKA 2Y1OA 3WYCA 4NZ9A 4BNGA 3UFXA 1IZ0A 5FWNA 2A92A 2HAEA 3DFUA 3HSKA 1UAYA 4E13A 2FR0A 3ASVA 3SJUA 3AM4A 2PZKA 3ZWAA 2IYOA 2VHWA 3O38A 4NBWA 3SBOA 1E7SA 4PLGA 4IJVA 2DBVO 3IP1A 3PQDA 3OJFA 1E7MA 3RIHA 3ZU5A 3MJEA 3RJ9A 2RHRA 1U3VA 3BHIA 5ITWA 5K6AC 4W7HA 4TZTA 3QV1A 5G4LA 2C82A 2G82A 1DHTA 1QR6A 3QSGA 3GC6A 1I3LA 1WDLA 5TNXA 2D8AA 2WMDA 1O94A 3RFXA 1E3WB 1TT7A 5TJ9A 1JAYA 3ZWXA 3W6UA 1Y8RA 4BHTA 2PGJA 2EP5A 2P2SA 3OJOA 3DBHB 3PHJA 4GMGA 3DBLB 1NPYA 3A9WA 2DPHA 1RM4A 5H81A 4E5KA 2F1KA 1ZSNA 4NFHA 3U4IA 1GZ6A 4DLBA 4TZKA 4Q39A 2EKLA 5T67A 3KBOA 1LLDA 1GCOA 4XWYA 2RBEA 4GWGA 3ZI0A 3TOZA 3ZNQA 4R3WA 1H2BA 4IJKA 2W2KB 4KUHA 3WIDA 4W99A 1Z82A 4QO8A 1F14A 1DFIA 3AUTA 3CE6A 3RFTA 1XHLA 1PL7A 4I5DA 2EGGA 3GVCA 3L4BA 2O3QA 4YJDA 2O3UA 2JFFA 3JQAD 3DZHA 4I5EA 4R1SA 1YB5A 4XGIA 4LMRA 3E48A 4B8ZA 1EFKA 3E9MA 3H3JA 4E2XA 5MGBA 3LF1A 1Y5RA 1LBEA 4DWVA 1DAPA 5CG2A 1V6AA 4C7KA 1JKIA 4G65A 4HFMA 1HWYA 2JAPA 4ZGWA 4DRYA 1T1SA 1KOLA 4WCFC 3QA9A 3AUAA 5TLSA 5A05A 1ZMOA 3QWHA 1NR7A 4XB1A 5EQDA 1SC6A 1H5QA 1DRWA 2NVUA 2CDCA 4TWRA 5L7YA 2FRDA 1ZW1A 2GZ2A 1K0UA 2GNAA 4D46A 2EJWA 3W4JA 5CDSA 3WBBA 1YL7A 1BRMA 1D3AA 1PJTA 1ULUA 5TF4A 4Q9NA 3WYEA 5DCYA 3M1LA 1B8VA 1ONNA 1I2CA 3L07A 1ZXLA 5JBIA 1UZMA 3ONFA 4WLNA 1UP7A 1V3TA 3LLSA 1QYXA 3R0IA 1SOVA 4Y67A 4OYRA 3ASUA 1T2EA 3AU8A 4IPTA 5EJ2A 5CEEA 4CMGA 2ZYGA 2YFHA 4FC7A 4IY1A 1LDMA 1IUKA 1KERA 4RVSA 4FN4A 4CM8A 2Q50A 2JD1A 1DBVO 2CMDA 1IZ9A 3DMTA 5FFFA 4DMMA 1QKIA 2V6BA 1UDAA 1IPFA 1HETA 3WGYA 2BRUA 3WWYA 3GGPA 2OHXA 3L0DA 4RDHA 1GV1A 1WW8A 4R69A 4Q3AA 1SEPA 1KVTA 1ZK1A 5JW6A 4JQCA 2XOXA 4OO3A 3OA2A 1N8KA 2W98A 4GGPA 1K6IA 3AUUA 1U8FO 4UVGA 1SOWA 4UUMA 5ER6A 3OIGA 4L0QA 5JO0A 4O5OA 3WQSB 3JQ6A 2UDPA 3E9QA 4J0EA 2Q4BA 2JHGA 5FYDA 1NYTA 3EC7A 3DTTA 3ZWYA 4MVJD 4JBIA 3D3WA 2NQTA 4JK3A 4YJFA 1X15A 3KSUA 2HRBA 3BHJA 1GQ2A 1N7GA 1UXGA 3ADPA 2HRZA 1WZIA 4J9UE 2CDBA 4NPCA 3HG7A 4R5MA 4CL3A 1GUYA 1HE4A 1ONPA 1U2GA 2HMWA 1U3WA 1UDCA 3V2HA 9LDTA 4UEJA 1FDUA 3NKLA 1E1KA 3AFMA 2D59A 3JV7A 4A0SA 1UXHA 2FPPA 3L6EA 1AXEA 1PS9A 2GD1O 1O5IA 4YT5A 1NNUA 4J43A 2OP0A 4BIIA 8ADHA 3FBTA 4FPXA 3AW9A 5TJHA 1W6UA 3ZHBA 5G0WA 4NR0A 4FJ1A 1SPXA 3IC5A 3H3FA 2Y1FA 3FTNA 4I1IA 1VLLA 2VZ8A 4R9SA 4AJ2A 5A4DA 3GHYA 3PZRA 3PLNA 1LJ8A 1JDJA 2RH4A 2ZK7A 4BMNA 4IGFA 1DC3A 2G76A 1R0KA 3ROPA 3WX0A 5L4LA 2DTEA 2NUAA 2DVMA 3WJ7A 1L7EA 4JROA 1C0IA 4RCVA 3HDJA 1LC0A 5A1TA 1E5LA 1DFHA 4BKUA 2C0CA 4RVGA 3DTYA 3JD0A 1NHWA 1OC2A 2YV2A 5J23A 5DBGA 4NFYA 2DC1A 1LDEA 1C1DB 1HSZA 1V8BA 3H4VA 4XB2A 1LSSA 3I6IA 2GSDA 2VYNA 5C5IA 4OIMA 3TRIA 1HDZA 5B4VA 3KVOA 4A2CA 3KYBA 4E21A 1MG0A 1EMDA 3BTUA 2Y0CA 4EJ0A 1XA0A 2GZ1A 3S8MA 5KWEA 3KEQA 4DPMA 2HSDA 3PTZA 4F45A 3MTGA 1CWUA 1P44A 3BYZA 4QXMA 1TVEA 2BKAA 3ENNA 1E3IA 4L4SA 3WIEA 2PGLA 2FY8A 1K3TA 1PJ4A 4MVJG 2OORA 3OQBA 3RVDA 2VUTA 1D7OA 4K28A 1N2SA 1Q0HA 2B83A 1MA0A 2ZYAA 2HKIA 2QX7A 4Z9XA 4OXYA 5B12A 2FZEA 3WYBA 1YDEA 4OKNA 3UOGA 4K6CA 2HU2A 3ETGA 5I9MA 3VVCA 1DHRA 1G6KA 3W1VA 5IG2A 2BH9A 3QRWA 3JYLA 2HJRA 1JAXA 2IEDA 3ZW8A 1ISHA 3EZYA 4JBHA 3Q1LA 3VPHA 4TKMA 4CL8A 4AJOA 2ZCVA 4EYEA 1R4MA 3ON5A 3X2FA 1PWZA 4RPGA 3JYNA 3PIDA 2Q2QA 3SLKA 1ZSVA 4D3SA 3JYPA 1ENPA 4UREA 3NTQA 2IODA 2YHIA 3H7AA 3IAHA 6ADHA 4N5LA 5TSDA 5FI3A 4XRGA 1C1XA 4RPJA 2WD8A 2V6MA 1EDZA 1N1GA 2Q4EA 3PQEA 1ID1A 1G1AA 3JQ8B 1HE5A 5KKAA 3G79A 3S55A 4B79A 2NVBA 2VHZA 1LX6A 1SO8A 3PRJA 1PL6A 3HN2A 1I2ZA 4YT4A 3HN7A 1EBUA 2ZATA 5C7IO 2X9GA 5IN5A 1NM5A 3BMCA 3BTVA 4DPKA 1Q7BA 5CFZA 2G1UA 1BG6A 1TB4A 4Z3DA 4CMAA 4A26A 2RCYA 4DC0A 4GSLA 3KOUA 3OIFA 4BVAA 3H65A 2ZTVA 4N5MA 3AI2A 4FJ2A 2AG8A 4NJOA 4RL6A 3PJDA 5K9ZA 3SVTA 2B35A 4PG5A 2Q49A 4ALIA 3RCBA 1HT0A 2AW5A 1ZJYA 2VYVA 4GAEA 4U0KA 4DREA 4P4NA 5IDXA 2PR2A 3GVIA 3WBFA 3AK4A 3FR8A 4UUPA 2AQ8A 4FIZA
chains in the Genus database with same CATH superfamily
1CV2A 2AW3A 1YDHA 2B2NA 3F47A 4K5QA 3VU9A 4WKGA 3W9SA 4UBMA 2VH2A 2NYVA 1NVKA 3IVCA 3TOCA 4Q01A 4BNDA 1OWLA 2FEXA 4DQVA 1TVKA 1UFVA 1E2JA 3BMXA 1Q83A 4KTTE 3KKKA 1JECA 1XIVA 2ZUVA 3Q6IA 5DW0A 3RO7A 4C6HA 1GNPA 2FN3A 3UIEA 2D00A 1PJ3A 1O5OA 1ZD5A 2D0IA 4F92B 2E4WA 2UKDA 1EFVA 2D2FA 4X54A 5IHPA 1FCJA 2IQ5A 1RKQA 4PZPA 7MHTA 4L3OA 4R0VA 1M2GA 1JLLB 4HR7A 4YJ2F 1PNVA 3HUEA 1W0JA 2H16A 1KZHA 2QBYB 5CYOA 3FGZA 2WTEA 4QM6A 2C04A 2FW9A 3SMQA 4KYIB 4R3UC 4EHLA 4B6QA 3WDSA 3WGZA 4B31A 3UM9A 1E69A 1QFXA 3THXA 2DFKB 2JRCA 2DUWA 2RFLA 1UBRS 3E05A 1ZCZA 2C3OA 3DF9A 3GV0A 4XEHA 4BNXA 1FZTA 4G1CA 1P4AA 3ETJA 2J3KA 4O4HF 4OH7A 4PCLA 2ZSBA 4WL0A 3RKUA 3TI9A 1MW9X 4Q3NA 1KDOA 6NULA 1RABA 1F9EA 3I83A 2ABWA 4Y6OA 1K63A 4OM8A 1AKNA 1PR3A 3L0OA 3C3EA 4B8WA 2J32A 4M86A 4D1YA 4G0WA 2QR5A 1HC7A 4JVSB 3BB1A 3DCIA 5EFOA 3SYLA 1Z5GA 1QE3A 2EJVA 5AVKA 1MOSA 3I39X 1EM8B 2D1FA 4HNAB 2XX3A 4QHYA 3WK4A 3BERA 3OE1A 1AHNA 2NNLD 5BSHA 2R6R1 3BXXA 5JH7F 3E70C 2O0MA 3E6AA 3PHHA 1ZI8A 2NTEA 4NNJA 5AIAA 1NVVQ 5JPIA 3O9VA 3ZHXA 2BMWA 4DJ5X 4E4RA 4Z4EA 3TZHA 1R8SA 3HKDB 3IR6A 1JFFB 3I0MA 1K0FA 1S1MA 2OCGA 4LYYA 4ZP1A 3UJPA 4B7ZA 1FUIA 2OCBA 3B1FA 4MB0A 1R8JA 1CUWA 3HSSA 1S6YA 3RJZA 13PKA 4TM8A 2PZMA 3T41A 3U4QB 2CT8A 3SXPA 4PHTA 2GKSA 3SZ3A 2HRCA 2I29A 4YP1A 2XUZA 2E5LB 5KSZA 3OLCX 4GS5A 3KE9A 4MUEA 1AQUA 4N54A 1IVSA 1EFRA 1AX9A 4R5HA 4WECA 3VNRA 4YASA 4B6OA 4ZIRB 1YB2A 1ZD8A 4W6QA 4YJKA 1R6VA 2QVZX 2JS7A 2B7CA 4LBZA 2EHDA 2O1XA 5E8RA 3B3QA 2ZRKA 2Q5HA 1GL9B 3BE4A 3K2BA 1JU4A 3GBSA 1M34A 2G9UA 5KMGB 3I5MA 1EWRA 4BVLA 2BAGA 1KQPA 3O1JC 4L2IB 1B41A 5F5NA 4J0CA 1UC5B 4CI0B 4QICA 2F3PA 4EGQA 2KSQA 2GCEA 5KNCH 1DBWA 1RW4A 3JWEA 1G4AE 3F6CA 4MAFA 2Z9CA 5TEWA 5K03A 1D03A 1DU4A 4LHWA 3GCZA 3GFPA 3A3KA 2V96A 1N75A 1GARA 5A9RA 5K09A 1E8MA 1WWKA 1JJFA 3CTPA 7GPBA 2IHTA 3D6MA 4HKTA 1ONOA 4L51A 4MPDA 4YLEA 3OIDA 3OEYA 3IAXA 4CM9A 3O2NA 4AZTA 3U56A 4CTOA 2VAMA 4UHJA 4JJ7A 2C8JA 2R5NA 4Q00A 3A3OA 1R5NA 2FMTA 4X6XA 4EF5A 4F2HA 1KEEA 1QANA 1UPAA 2DUJA 1R15A 2GUWA 4P82A 2JLWA 3FDIA 4ZAWA 3WGMA 3PYMA 5JCOC 5EPUA 1HL3A 1K7CA 3E84A 3GL9A 3OQIB 4FOOA 4TYMA 2B25A 2JLSA 2B5WA 2PKQP 2Q2WA 3QNWA 6REQA 2HFKA 1KZ6A 1OJLA 2GYWA 3CUKA 3EDYA 3KUXA 4G36A 1J1UA 1FDIA 4ITRC 3F4KA 2BGUA 4K9KA 4P1ZA 3PGJA 5AD1A 3RSZA 2D8MA 4DKJA 3OJEA 4DJEC 2RHCA 3TZ6A 3A6LA 1R6DA 4Q6BA 2N75A 4EYQA 1YI1A 4F45A 5HKOA 1E99A 2ZS9A 3BX1A 4RIGA 5FIUA 2P9JA 2Z1DA 1JIQA 2PFSA 2YFYA 3MRTA 1SUSA 1UT6A 1HQDA 4QBFA 3U3JA 5CDYA 2FLVA 1XZQA 2RGBA 3ELDA 3JQ7A 5EYPA 2JVIA 4D4MA 5TX7A 2YVLA 2Q7OE 1MOPA 4KRFA 1ZUIA 5HRCA 2BCEA 3VR2D 2Y2UA 3DLPX 1V45E 5EN4A 1KJNA 3G8AA 3IVAA 5EIBC 1GDDA 1U0NA 3BA1A 2Q1YA 2QPTA 1DFGA 1WCV1 4DJJA 3LO8A 1M1YA 4OBBA 1Z4PX 4YO7A 4KQ1A 3OA0A 3EVTA 2C7PA 3OQMA 2X14A 1L5GB 4JLSA 3RS4A 4ASUA 4E14A 1XJQA 2FFRA 1QPBA 5BNWA 4WCFB 4QAJA 3WK7A 1Y6RA 4PZZA 4G0MA 2QN6A 1Z22A 2IYXA 1XTSA 4EYGA 1H2XA 3FNHA 1P1JA 4PEVA 1BMFD 3UJCA 3C16C 3LYUA 3MSCA 3ONEA 3QKRA 3AZQA 4FMBB 1JQBA 2I2CA 2JGEA 4ZRMA 3BMQB 1JPJA 2O7NA 4DNOA 5AHOA 1JALA 2LKDA 1NI4B 4TMWA 1TZ2A 2QG4A 4AMGA 2G88A 1BVYF 3IOEA 4BE9A 2C98A 2GJ9A 3CIFA 2PRZA 3UAVA 4F2DA 4BAGA 3BGWA 4WKOA 2FUG6 4D25A 1WPGA 1O3YA 4LQCA 1MAHA 3LK6A 4NL4H 4LXHA 5CX4A 5FTNA 3E5MA 2QPLA 5JI2E 2B5OA 2P2DA 3C87A 4W1RA 1PEAA 5EP2A 4FGSA 5G4KB 3SU8A 1XQVA 3GAFA 2C54A 4KPGA 4W9RA 4BWFB 5JRJA 5AVQA 1SXJB 5JS6A 4CKWB 3RUHA 3FN4A 1X94A 4DCOA 4HQFA 2CNBA 4ILKA 1RHKA 4OB8A 3UG6A 1CJSA 3ETHA 1U7UA 4NH4A 4RY0A 5JS7A 2CY0A 3GJ6A 4FHZA 3RT1A 3WJAA 1Z13A 4AAYA 1H85A 2MDTA 2UZAA 4D0RA 1CZRA 1CTQA 4FYPA 3JQEA 4X66B 1K7YA 1JIKA 4P3NA 5EIHA 1XRPA 4PICA 5A06A 1Z0FA 1NUHA 4GI7A 1MH1A 1OTHA 4DUGA 2COEA 4WJZA 2MSLA 5F77A 4G4SP 3RG8A 5AVWA 3DBLA 1X6VA 2PWZA 4DV5B 4OQXA 3JQQA 2JLQA 2OMKA 3HJUA 1R4NA 3D4PA 3RSHA 2Y77A 4DCTA 3WAGA 1XLUA 4LN1A 4N0DA 2Y92A 4XR9A 3HHPA 4G26A 3IVGA 2ZB2A 4GOJA 3LSYA 5K20A 1J8MF 1MUUA 4EQ6A 4RPCA 5KTPA 2VYCA 5KWIA 2CLOB 5EPEA 1GU7A 1XMJA 4WXEA 5HJ2A 3F3KA 3NJRA 5KX5A 3C8HA 4BNNA 2NXJA 2Y8EA 2E4XA 1WG8A 1VJ5A 3NIFB 1TQ8A 1TGVA 1MCZA 2QLFA 3LBNA 4NEGA 3NGLA 4B6PA 2ZZNA 1GPWB 2GERA 2WOJA 2RD2A 3FHLA 4NLLA 3K1AB 3J80A 3CISA 4IQ4A 5EJ5A 3BRSA 2E6UX 1SXHA 1BN7A 4NK5A 4OGWA 3EXG2 4ZOBA 2C9YA 3SHOA 1ODCA 1T13A 1YIOA 3F5QA 3WOHA 5A02A 4XWWA 3ZJUA 1MXFA 2ZCUA 1W49A 3O3NB 3M83A 3TRJA 4IDQA 4TV8A 5ARBA 2NW6A 3KLOA 2FX2A 3U3XA 1RP1A 4EG4A 3REFA 3RIMA 4IJ6A 4L72A 1E62A 4K6MA 3QKTA 1P75A 3QVTA 3TGWA 1VJGA 3OZTA 4RHFA 3TR0A 3X43A 3FOEC 1ISJA 1ADCA 1D6NA 2ZT8A 3QIAA 4EO9A 1HG0A 1V4VA 2DPGA 3C7AA 1P7ZA 3G2NA 1IHDA 3NWJA 3KBBA 3HZZA 5JZSA 2FQQA 2IH4A 2AT1A 3D7RA 4DDVA 1DTEA 1S8OA 2WT4A 2R85A 1J24A 4Y18A 4YAKA 4G84A 4M8KA 3LIPA 4A0FA 1R10A 2W7TA 1GG8A 2PGOA 4TSKA 3E2MA 2PUHA 1CVIA 1B7GO 3FZQA 1Y5IA 5DLDA 1SD2A 3Q9NA 2DYKA 2F43B 2D1QA 3R4VA 4JEIA 4PV7A 4Y2PA 4ZQFA 3ZBPA 3I30X 4TS4A 4C4XA 2XLCA 1ZEJA 1MORA 1OZHA 5DM70 1DEXA 3M0EA 3RC2A 2GXSA 4XPZA 2GNPA 3L7CA 4H9GA 4INAA 1O9HA 3BSYA 4ARVA 5BMVF 1FIUA 5G0SA 1Q16A 3A06A 5BQ5A 3C3XA 3V8PA 1GEGA 3IKLA 4YS6A 3VOBA 1V6SA 4GMXA 1QJCA 4S24A 4BLPA 2FRXA 4ITVA 5HMMA 4QXPA 1X8XA 3LMKA 1UBHS 3K8OE 5JWHA 4ZCLA 3RSOA 1UH5A 4YRAA 3VKVA 4F4UA 2HIMA 2QSJA 1DX9A 2CVHA 3ROFA 4BE7B 3OM9A 4JXJA 1JJVA 1JSZA 3FJOA 3OZWA 3CUYA 3NC4A 3PPWA 4GOOD 4YRFA 2VRCA 3P9RA 4DE5A 1P0IA 5CX1B 3L4EA 3PA6A 4BGVA 2V5VA 1ZM7A 5D3ZA 2PQ0A 3PUHA 4J7UA 4LI0A 5D5HA 1JN0A 5JY6A 3LUJA 3MCTA 2XVYA 4LFAB 1ZUHA 2C07A 2VXOA 5JZVA 3FYUA 1AKQA 4R83A 2VCYA 1CQJB 1T36B 2P9BA 3W5IA 3NPAA 5AR1A 3ED1A 4D3YA 3VKGA 4LNHA 1YL5A 3IE2A 3QPUA 3W5CA 2QTWB 3LD9A 3FWNA 3BULA 3V32A 3SQLA 2ACWA 3CPSA 2LTAA 4U3JB 2IYQA 3T35A 1Q0LA 2JLUA 3VNSA 2AFRA 1U65A 3KTAA 2PY6A 4EF6A 2HEIA 3NJ8A 3FA2A 3GUVA 4MV0A 3AEXA 2OBMA 4P3KA 1IOVA 3MAGA 2DLDA 5JNVA 2ZT6A 4LSMA 3A6FA 5IVIA 1N33B 4NOMA 1UBSB 2UYQA 2XZTA 3BREA 1LVGA 4KWIA 3GCGA 3HB5X 1U8EA 2EW1A 4PLWA 2H63A 5CG1A 4H1WA 1TFUA 1VI2A 1WPXA 2BELA 2H5LA 2IX9A 3A04A 4H15A 1DSSG 3QE3A 4HTFA 3H5NA 5AKEA 1MX3A 2FPOA 3R0XA 3ND9A 4F85A 3ISVA 4RD1A 1EAYA 2BV3A 4WPGA 2D5CA 1IHYA 1KI8A 1Y1SA 2JIDA 2QRUA 3C1UA 1A2KC 1ENZA 2B4AA 4G4JA 4R01A 4WDRA 4WZBE 5E2BA 3KUCA 4F6CA 3RFCA 4WGGA 1OB5A 3OU2A 2F9MA 3AM3A 3ZY5A 4HDSA 1Y7LA 4E33A 4DV7B 1SVWA 3UCEA 4HH3C 4P3XA 2HIHA 1CY6A 4IDDA 4IYRA 3VR2A 3ZV4A 4IG9A 2JJ1A 3QU2A 4FFNA 4GUDA 3C39A 3VO9A 4OMCA 4HXYA 5TGZA 1DC5A 1PZNA 4XKJA 1TA0A 4CUJA 5JT1A 3Q3HA 4LUCA 1F6WA 2Z08A 1T4MA 1YO6A 2ZJ2A 1NG1A 5CVJA 3ZXSA 1XOIA 3KQSA 2B9VA 4GRDA 1ZMXA 1RYFA 4TMYA 2H1CA 1UXIA 2HLDD 2WMOB 2OA0A 3FCOA 1XLTC 1XD2A 3PQ6A 4IEFB 4QUBA 3UEOA 4BECA 1B4DA 2X40A 3A9VA 4AD8A 1PJSA 2QMHA 3S2YA 4KPEC 5KNDA 4GE0A 1XA3A 3VKHA 4EFDA 3CPJB 4BQNA 4EP1A 5EC8A 4KITB 3FNFA 1X8JA 2I22A 4ZO7A 4MEAA 3FSEA 1I24A 3EGDA 2ROQA 2VSOA 1OTXA 3AEUA 3LT4A 2QR3A 2ERYA 4XFKA 4OP1A 1V11A 3V9PA 1KYTA 1D4FA 1WPRA 3AWDA 1PDWA 1AQYA 4OQDA 4GBJA 1JDPA 1N2ZA 1CSEE 1J70A 1OIVA 4KXNA 2HM7A 2YN4A 3OQNA 2HDWA 1LDGA 1R2QA 3WRWA 4CHGA 2B34A 2XCUA 5DTRA 1T5HX 5DNAA 3T06B 4HDRA 3A6PC 2J9XB 4MV9A 1KDPA 2VJCA 4BCBA 5KJ6A 3AHFA 2W70A 4CN8A 1IJEA 1QTIA 2AUMA 1AKEA 5CPFA 1RKXA 1SJ9A 2CE2X 3R0JA 2V8OA 4RVHA 4G4IA 4DA9A 1CY4A 5JD5A 4Y7DA 2ATEA 3FD8A 5TF0A 4AVYA 2NPIA 1A50B 1VL0A 4P86A 2HU5A 4ZO6A 3RK0A 1VB3A 4OOEA 2AGVA 1U0GA 4L57A 2R6HA 4OHUA 5DHUA 1BHQ1 4GQBA 1C80A 1YDMA 4MTCA 4CT5A 1JA1A 1X7ZA 3UWSA 5K99A 3BDVA 3TWOA 4H6PA 4QECA 5CT8A 2RJ3A 1AS3A 2FHPA 4PZLA 4YPOA 3ZV7A 2YV4A 1K8YB 3SC3A 5AOCA 2C03A 4BC0A 4X0EA 4Y3UA 2CUZA 1RC0A 1RP7A 2B37A 1SU8A 3A27A 4FFOA 1PZEA 1EZZA 2C59A 4JD5A 2PNJA 3VMMA 2AN1A 1DG1G 3FWPA 3NOVA 2NAPA 1ZRNA 2EX4A 3FUWA 5LIPA 3RJMA 1ECFA 1RMQA 3K2QA 5D3MB 5IM5A 1QRRA 4HP8A 2FLKA 1ZINA 1M73E 4YAJA 2N0SA 2NVUB 1V41E 4TLDA 1CQXA 3BIJA 4K6OA 2Y27A 4G24A 1DBPA 4DLVA 5LYJB 2BP7B 3BWXA 3S3TA 2OLKA 4BN4A 1I1OA 2VP6A 4M99A 4TKVB 4PCVA 4XDGA 1J2EA 3PFNA 3HB4X 3R7AA 1TJYA 2WF7A 4A8JC 4D41A 4YCCA 1CEEA 2DF8A 1FS4A 2WTUA 4L22A 4MLDA 2O8BB 3X3HA 4B45A 5J58A 5JNWA 1EP2B 1PLKA 2R8BA 5MF6A 2A5DA 2D5BA 4G4SO 2R6DA 1OY1A 4I2VA 4LSWA 4EMUA 3H2ZA 5BYAA 4Z9FA 1MBZA 4I99A 4Z4FA 5BYJA 4OGFA 3I73A 3VR6D 2HJGA 1Q0TA 4GVPA 2P3SA 5D00A 5FI5A 4HVAA 3D8BA 5HFNA 2PRIA 5JSUA 2WG1A 2J7PA 3KTAB 3USES 1CUXA 3GLKA 3DBRB 5K6AA 4IEEA 3RASA 2G70A 3C0KA 1K8RA 1JHZA 3GRAA 3N2LA 3W34A 1P6QA 3DXXA 5KSPA 5I47A 2RIPA 1AV7A 2IHVA 4MS3B 5LA6A 5DYNA 5EWLB 3O75A 4PYNA 2FP4A 4IIYA 1FSPA 3HGTA 1NKSA 2BEUB 4DR6B 2I7CA 2IY8A 3NEJA 1XDSA 3VC7A 4RHCA 4CU5A 5HQ3B 5A4AA 1KMHB 3GOQA 3U44A 4BFVA 4OJYA 2Z6AA 5CXUA 1C9NA 2CSXA 1NVXQ 4NPAA 3UTDA 3UPDA 4BMCA 4RHXA 1RHMA 3DD5A 1S4QA 5CAEB 5A5FA 5IXJA 2XKKA 3FNRA 5EHIA 2FFJA 2R7NA 4JENA 4OYHA 4DDHA 4EG1A 1G8YA 2GJKA 4AQYB 3K6RA 2YFQA 4ZA2A 3OKFA 1TU3A 4QXAA 1MZPA 3QG1A 1ODTC 3ZHOA 4DXAA 1FQWA 4AECA 4NG4A 3E22B 4P98A 1CCWA 2BN4A 3EDCA 3WI7A 2WM8A 2O3TA 2BZGA 2Q0XA 4GPBA 1FDOA 3KHUA 5HBGA 4ND4A 4X3OA 3FNBA 3IEMA 4AICA 1XPUA 4PO1A 1UAAA 2A1TS 3D59A 2GFQA 3CX4A 1U8AA 5JAUA 4BDSA 1KARA 1Q0SA 2F1JA 2DJIA 1CYDA 2R1TB 3NVMB 2QQ5A 5LZ8A 2BOVA 4HNUA 5DN6D 2O5EA 3K9CA 3VYSB 3CLHA 1HR0B 1ZK2A 2OOSA 1QTRA 3KZVA 4B8YA 4ECEA 1JR6A 4MRPA 3A1DA 3KNZA 3DLBA 4NATA 4D9GA 2QGZA 4YRMA 3NEAA 3FRHA 5E38A 5ALVA 5BY2A 1GAJA 2XXAB 3PXEA 2Y67A 3HKCA 1VMEA 2WD9A 1V71A 3QFFA 1XF9A 3OZDA 4PSKA 2B0CA 1SQSA 3QI7A 2F43A 4LTMA 1KZ9A 5FFMA 3CE9A 3ZTYA 1VLQA 3AB8A 3DXZA 3UWKA 4ZV4A 2ZRQA 2IUEA 4UVEA 4EB0A 1US8A 5BP7A 4MWBA 3UOAB 1V1MB 1RSZA 4KQKA 2VFAA 5KYGA 1IEQA 1Z4LA 4YCJA 4MDEA 1GIAA 3HPRA 3TTUA 1TEZA 4TOIA 2QL9A 3EUEA 2VUSA 4J3NA 1BO6A 2ZP1A 4DRZA 2O8CB 2Z1MA 3FX2A 3IT1A 1Q77A 1NUSA 4UOQA 5FUMA 5AIBA 1Y89A 4G0PA 4MS4B 4TPKA 5HA5A 3P26A 3OOHA 4GKBA 3GUYA 3H1EA 3SJZA 1BKSB 3IPXA 2VT2A 4QYMA 3I9JA 1ORTA 3U4MA 1QOPB 1VXRA 3EXFB 3VBCA 3QJGA 2OBBA 1ZGCA 3VH4A 1JKXA 3QHAA 2HJSA 1P72A 2IL1A 4TWIA 5ESDA 2WHXA 3Q7TA 5CB4A 2BSXA 1PGNA 5KJFA 2HJ9A 5H83A 4QODA 3ZOZA 2NVOA 5LQNA 1HOXA 1MB0A 4KDFA 4PQYA 4UTNA 1T26A 1DQPA 2JFPA 2MYNA 3HLTA 4WLOA 3UV6A 3HWX1 1K8QA 2CL6X 2W0MA 3TW4A 1CUGA 2XD9A 2IXEA 3GRZA 2ZSHA 1CJBA 1S2OA 2QDKA 1EFHA 2R1UA 1DDIA 2WTMA 2XQVA 3GJXC 3REQA 2XVXA 5TMPA 1ZRHA 1E1LA 1T9ZA 4RH3A 3WTBA 4BWGA 3SQNA 1P9OA 1ISMA 4F5WA 1ZL2A 2ZUEA 4ZI3A 4MKGA 2MHCA 2Z8ZA 1LF0A 4H16A 1KK1A 3OZVA 3GFOA 3KC2A 1Z39A 1FFGA 4D8VA 4BFZA 5J4HA 2V45A 4YRCA 3EQ2A 3O1IC 1M1NB 2JAWA 4JB0A 4JHXA 5A9SB 3PC3A 3OKAA 4RTLA 1HTBA 1GGKA 1TI7A 3IOYA 3E5NA 2V7WA 4UBOA 3JQPA 1FNDA 1U6KA 2C5FA 3PFHA 4BJ1A 3ZH9B 3ADDA 4E94A 1JAIA 3EGWA 1C7EA 3H17A 3B85A 4ZO9A 2VJKA 4QG7A 3P9IA 2HA6A 9ABPA 4IYJA 3K92A 2ACKA 2O07A 1Y7TA 4WLVA 2Z04A 4YAIA 1UBMS 2FUKA 2QROA 3QXHA 4AZ3A 3VTFA 4YTEA 5BWCA 5EHZA 2R47A 4EVSA 1EUCA 2FFHA 2VSQA 5FBZA 3KUKA 1S8NA 4ZVTA 3TQRA 2HWYA 3L9WA 4CMHA 1D6JA 2WZDA 2X8AA 2F3UA 3ADOA 4IDAA 1G5PA 3FHOA 3EIUA 1NBAA 3URMA 5BR8B 4KFSA 1XMQB 1CK4A 3TNLA 5AKYA 1PWEA 3HXTA 3OLXA 3GEDA 5BW6B 4QXRA 3KQVA 4KQ6A 1YI0A 2DXIA 1QCZA 4GPD1 2PL9A 2ZYTX 3OMLA 1WCXA 2J5BA 5HX7A 5AJTA 2BMVA 5JRZA 1PU2A 1Z63A 1NJ5A 1NWHA 2G77B 3CKYA 4AKTA 4K0KB 1BFUA 1NONA 1PI3A 2RKOA 2A9KA 3GPLA 1RCFA 1FYEA 3BMCB 4KE9A 3DZBA 1NJGA 4XUDA 4XUEA 2OXTA 4F46A 3JQAB 3D02A 3EPKA 1CKEA 3IKVA 3JPWA 1QIGA 3MEQA 2E4AA 3TAUA 3DR5A 4OLAA 4RPLA 3UKOA 2PZEA 1FEZA 1XB2A 1UWCA 5J4LA 2ZJ6A 1RXEA 1GLGA 1ZAYA 2YRWA 2H4JA 1SHTX 3E15A 2QG9A 4H1HA 4F71A 4UAUA 1UEIA 1J7KA 5KQRA 4PC2A 1IBSA 1SHZA 3B60A 1R0BA 1ZJ4A 4RZIA 4J29A 5CU7A 2QP3A 3DWIA 1I36A 4EY3A 3S8EA 2V7QA 2CNNA 1DTWB 1P39A 4W5RA 1C3JA 2W6QA 1NLUA 2GTPA 3R6DA 2ECKA 3WGHA 4DTCA 4JYMA 1CS4C 3V55A 3WC4A 3SM9A 3KZNA 3OPYA 2AJBA 2C31A 1G6Q1 2G4CA 4GX0A 4C76A 2VYND 2OEPA 4Y6RA 3WLIA 4Q9AA 4WVFA 2OM2A 4LNAA 1PQUA 4L02A 4B84A 4ENRA 4WY5A 1XAJA 1YZYA 2RK4A 4FLEA 4JASB 4LFBB 4Q93A 1F8UA 2AUNA 2Z09A 2JLAA 3LGAA 1T2UA 2X6QA 5HGJA 4CMBA 5K0BA 3DHYA 3KZOA 3HKEB 1KFEB 3LZDA 3VXKA 4LYDA 4EB6A 1KL7A 1UR5A 4WK0B 5EQFA 5EWMA 2LNDA 3RHTA 2O0KA 1Z28A 2XI4A 2ZTUA 3ZCRA 1W87A 4HG2A 4UNNA 3C7DB 3AIKA 1NMZA 2NVWA 2IVFA 5G3YA 4QOFA 3EE6A 3HDQA 5F1KA 4RGBA 3JTMA 1E9AA 4PG6A 4IIDA 1AXRA 3K0FA 5HMLA 1E4EA 1U7OA 4MA4A 4DDMA 1XWWA 3OOYA 4O6VA 5T8KA 5DM0A 4MGHA 4Q7QA 3GLUA 1QHXA 4QL3A 1N9ZA 1M83A 2F00A 3AXTA 4FYVA 5IC6A 1NOIA 2ET6A 2C61A 1CE8B 1Y5NA 3SFZA 4KMMA 5CAEA 3L1UA 1P4SA 4YRKA 5J9FA 1M5TA 4AN0A 5K3BA 4P08A 1MV8A 3QKSB 5CXXA 5E1OA 1JHMA 3O84A 5T8KC 2GJ8A 2YQZA 1JV2B 4HGNA 1T3GA 4OXRA 5GAJA 3I5XA 4ZC1A 2GWHA 5KMGA 5DXAA 4YMIA 5ILOA 2VDPB 3FPBA 4QFCA 4PANA 2XRMA 2VUUA 4I1VA 2PX4A 1UC4B 3K9QO 5CJPA 1COWD 2J48A 5HIMA 5IZ4A 1QO0D 4U2EA 1VMIA 3T7IA 3BM5A 1U2PA 3GR6A 3QE2A 2AUTA 3NTOA 4CF7A 3F67A 4WXPA 2GNOA 4JJGA 4L28A 1D2CA 4R8RA 6ABPA 3DO8A 2O4CA 1A82A 3LA6A 1PDOA 4OJTA 1XPRA 1DZIA 1OA1A 1E20A 3QBTA 5JAMA 3SKVA 3PDIB 2JCVA 4NXMB 3C6MA 4DSUA 1NM5C 3IBGA 3CW9A 3KFXA 3WGVA 3CS3A 1W4ZA 4CTMA 2LDBA 3M70A 2ZUSA 3UQYS 3HJAA 5EMKA 4YWHA 3K8YA 5IAAA 2DG2A 1FOEB 1F4LA 2RJOA 4QEKA 3QPBA 5C1OA 1XRJA 1J00A 1WNFA 3FMPB 2IYRA 1M6VB 5JYEA 1IB0A 2IIQA 4ESOA 5FLXA 5BNTA 3SZMA 1Z29A 2GK3A 3S6JA 1AH2A 4DSOA 4UD2A 2C95A 2C83A 1CUIA 3P45A 1AUOA 4JB3A 4BLOA 2JPDA 1J39A 5CJJA 1OC4A 2FSFA 4D0LB 5F5LA 4I4IA 3TKAA 5D5QA 4DR5B 2AQKA 2ZPAA 5SZHB 4C7VA 3IQGX 2IEBA 5BSKA 4X65B 2QNIA 4CM4A 3QX7A 3JQAA 2BW0A 1QZTA 1P9RA 4PR3A 5EIOA 3UYLA 2POQX 1VGRA 2APJA 1V5FA 2YQ4A 5TMBA 3WK8A 2E21A 4RQAA 1C30A 5EPOA 5TT0A 1UODA 3RVJA 3USZA 1QS0A 1TMYA 1WQ4A 1G21E 2A0XA 2F67A 1U7DA 4XX0A 1JDTA 1Z75A 2QRMA 2WYWA 3E9EA 2PZJA 1B8OA 2I3BA 2GEVA 3EGXB 3IJPA 4N12A 4O29A 4QXQA 4WBNB 1D1PA 1N5RA 3KUUA 4L5CA 1MG5A 2ZUUA 3PIIA 4IAOA 2DKNA 2YWRA 1RS0A 4QYSA 3VTKA 4WD3A 1CBUA 5EMMA 5JANA 3EF3A 2WYHA 3VM6A 3IBFA 4DADA 5HQTA 3A1TA 3CONA 4TTTS 5K0CA 2PMWB 1QDEA 2FOLA 4F38A 4R2LA 3QVWA 4E5MA 4FNAA 4UOZA 2X8LA 3PFKA 2ACVA 1VHTA 3UC9A 4HDRB 1U1EA 1ZCBA 3E9ZA 1VTKA 2MJLA 5CYFA 4CR6A 4ER6A 3UHJA 1P9LA 2VOJA 2RH9B 3BT7A 4MW7A 4DW8A 2HXSA 1L9XA 1IXZA 3MWEB 3GNQA 1L7MA 1FU7A 1U98A 2OT3B 3PTLA 2KHZA 4KI0A 4ND2A 4RXUA 3EQ7A 2X2PA 4GO1A 2R8OA 4OQYA 2VJLA 3JAKA 5EMLA 4E31A 3WRYC 5E1DA 2QP4A 3GPBA 3X2EA 2Y68A 4BVKA 4IR7A 3N2GB 1VHJA 5AUQA 4QPDA 2J0EA 1L7AA 1Z37A 3W8EA 4EY7A 2KQUA 2NU9B 5LLTA 1ESEA 1RT9A 5IM4F 5CLIA 4C04A 4RF4A 5LA6F 2HQOA 2PMKA 5E7IA 5H9WA 4ATNA 1WETA 1O87A 3MJFA 1M2OB 1MF7A 1M2KA 3EWSA 3A1SA 4WESB 1CQWA 2GYYA 4PWZA 1C0EA 4H35A 1N92A 2BHLA 2VO1A 4MSUA 4NU5A 2WJYA 1TPYA 1XWIA 4NQZA 1GU0A 4RHYA 1F0PA 3U7JA 4BNMA 4EG5A 4QZVA 1JG4A 3E8XA 2P67A 5MGNA 5EUMA 4N48A 1JFLA 2Q1WA 3EXHB 1PW7A 2E48A 2GFHA 3HWRA 4U2DA 5I7AA 1CJMA 5FBKA 3QPAA 1QYRA 2WM3A 3ILSA 2PCLA 2PA3A 4C4PA 3UAWA 3H42B 1A27A 1AS0A 4DCGA 1ES9A 1BRTA 1Q3KA 1Y3IA 2BMDA 3PT9A 4KVAA 3OAAD 2H6EA 3GEIA 3H9QA 2UYYA 1NVTA 4FOPA 1W30A 2JAUA 3RDPA 2WYVA 3FFAA 4GM0A 3L8YA 3O73A 4JP5A 4IIEA 3K09A 1FFWA 1U0SY 4J4BA 2OCDA 2JD2A 4FFSA 3G59A 2W2MA 3NWOA 2QRHA 3JATB 4FE3A 2O7QA 4KXYA 5LZ4A 3B9PA 2QSZA 4TUYF 3KWMA 1KY4A 2FEKA 3OU6A 5CB8A 4JC0A 4J3FA 5JATA 1M76A 2I2FA 4YC7A 1EIZA 1U28A 3MRVA 3ODGA 2VPPA 1C7JA 3THOA 1WDMA 1DQNA 1SHLA 4HDQB 3AHJA 3PQ3A 3C8MA 4BPRA 2X1VA 2GN0A 1DJNA 4A0QA 3VR5H 4NOLA 4DARA 1OH8A 4NICA 1RI1A 4Y0NA 2Q41A 4YNBA 3ZKAA 2JGNA 1H3FA 3JWHA 1M8GA 3L7AA 3ADCA 4B76A 3GVXA 1Z25A 2NAFA 2P1RA 4KDCA 3AHIA 3U3KA 4UXHA 4EG3A 1DO2A 3TI7A 4QGFA 4NAVA 3A4MA 2P7HA 4NV0A 4U7JA 4R9NA 4Y98A 4QLOA 2VC2B 4KZPA 2HNAA 3BH0A 2W0SA 3K0CA 3U5ZB 4OSPA 4PBRA 2G0TA 1UFOA 1RQPA 4W9MC 3MF4A 1QHSA 5G53C 3L02A 3UWMA 2O8EB 2ZUCA 4UAGA 2WAMA 1F1JA 1SVNA 2XUHA 5TEVA 1QFZA 2ZRCA 3SX4A 2C9BA 2N47A 5CNKA 3OETA 5A0FA 3VPFA 4ECAA 3VO8A 3TMAA 1XUOA 4BFXA 4W1PA 3GLIB 1I6WA 3O8QB 6AT1A 7ADHA 3KXDA 5DE3A 3D8TA 3ES9A 4RORA 4CKCB 4JI0B 5BR7A 1NXXA 3ZD6A 1UQRA 1T8PA 3TJRA 4OHMA 3U48A 2TS1A 2O2XA 4M0FA 3CKLA 2O4UX 4FHEA 2RH5A 5FUVA 1I3KA 2XE7A 1U9YA 3F90A 4U7TB 2KB0A 2XA9A 3LYHA 1G3UA 1JR2A 1ESDA 2Q9CA 2CXNA 1A8IA 2VHCA 2VJMA 1ZLYA 3YASA 1Z4NA 3AF4A 1FVOA 3KAJA 3UT6A 4JJAA 5HXAA 1XU7A 2QAJA 5A71A 2GRAA 1PQWA 4M9QA 3LV8A 3S0JA 3LQRA 1SNYA 2C1EA 3DC2A 3FUCA 4Z1MD 2PS9A 3D54D 5AW8A 2JGRA 1WQ3A 4CQLA 1UBUS 2NSDA 4PHHA 2AB0A 4Q1DA 1OBFO 3RU3A 3FFBA 2R7KA 2FPLA 3PFCA 4FKMA 1VYHA 3TDMA 1GT91 1JLMA 3HJTA 3NV9A 1YK0A 3B1XA 3RV3A 4TQAA 3W9BA 4EI8A 2HA0A 5C8VA 1F5NA 3NX4A 3BD9A 3NOOA 3OPNA 2D1RA 4GI2A 3CF4A 1FNMA 4IZIA 3M34A 4QU9A 5BRNA 2O48X 4QGAA 3JQGB 2PEYA 1SU4A 3Q8LA 4Z5XA 4XWAA 1ZR4A 1EX6A 1UPXA 4PGMA 1Y1LA 2ZB8A 1N3LA 1YR7A 2AMLA 2ZBRA 4GXRA 4OU5A 4OF4A 2VEDA 3TOXA 4W6ZA 5P21A 2ODBA 3V2UA 2Y1KA 3SFTA 3PDJA 1FP4A 3HV0A 4B9EA 2TMGA 5BQOA 1L5ZA 4UDNA 3RRXA 1A97A 1KC3A 2O6LA 5IBQA 3IIEA 2WF6A 1NUPA 4RTMA 4E1VA 3VNUA 2G4VA 4K46A 1BDHA 3CN9A 3D2LA 1E2KA 3ZBQA 5CIQA 3R0VA 1V8DA 4HLNA 5AXAA 4EUEA 1CU1A 1EX9A 2BFEA 3ZHCA 1TKRA 4GQIA 2OV4A 4LSZA 2WSBA 3GAMA 1NQ5A 4QJ4A 1BS1A 1DOHA 4U2CA 4QKQA 1BS2A 1N6RA 3KSBC 3K70B 4BNLA 1K1EA 5I8ZA 1PS0A 4L8WB 4CUZA 1NFRA 4TQ9A 3G17A 1XVIA 4M83A 5DT2A 2QTNA 4II7A 3RRYA 1GITA 1VIMA 3JWPA 4RFSA 4YJFB 1SXPA 4I7EA 1UZNA 1DJMA 4KIUA 5HRAA 1IHPA 1TF2A 2JGKA 5DDIP 1TT5B 1TT5A 4KQ9A 4HLUA 3V4FA 1E4EB 1MP0A 2XUGA 1R4NB 4EY6A 4MEBA 3RYIB 1R37A 3OX4A 3N53A 1YZ3A 4CLEA 1SH7A 2P11A 4K9RA 2ECOA 1YQWA 3AKYA 5CH5A 3D0RA 1BGXT 3RNLA 4AF8A 3C5CA 3TS1A 4B3DA 5FPSA 4BNIA 1MXHA 2WV9A 1NHGA 2J4DA 3L1JA 2C7VA 1SR8A 5EP4A 4UOEA 4O2BA 2B6NA 4OB7A 3OICA 1N0IA 2ZJ1A 3LCUA 3QWAA 3BIXA 4ME6A 2CLSA 4D99A 2DT5A 5FPKA 3D5TA 5AVZA 2EZ8A 3QPCA 2IIPA 5K0GA 1WBDA 3FYSA 3FXAA 3G0CA 3HKEA 3OY7A 4YP7A 5JAQA 3A32A 4M0DA 3A1FA 1ISGA 1KEKA 2YZGA 2XB8A 2CBXA 2JEYA 2PMEA 2NV2B 4DA8A 2ZIUB 3CGGA 1PK9A 1HNNA 4K2HA 3LTNC 1NZJA 4LYAA 4BTEA 4LOAA 2AEFA 4CGZA 1Z08A 4CLOB 2BFMA 5JAZA 1SVLA 1L2TA 4CF5A 1H0HA 2C96A 1C9KA 2OV2A 3LY9A 1E92A 5KZMB 1V11B 3RODA 1QTQA 1C4WA 5FTJA 4E2YA 1UXKA 1PHRA 1W59A 4NAHA 5KTKA 3SCZA 4EX7A 3B9RA 1SELA 1HLGA 4A27A 2NPFA 4XTCS 2PTHA 4JR2A 4BQEA 1T4BA 1Q12A 3TO5A 1MIOA 2RHDA 1PG2A 3DM5A 4HRVA 4IICA 1E9FA 2CHVA 4C2BA 4DV4B 4QDJA 1NR1A 2RB5A 4KP7A 4RKFA 3QWFA 1JIVA 2AI3A 4MA5A 3T4EA 3UJ8A 4QTYA 1SFRA 3C3YA 3DKPA 4G09A 1CUCA 2Z9BA 1JRLA 3KHKA 4E5VA 3H4MA 1HH4A 3F3MA 1WUTA 3NCHA 1PGJA 2O50A 2NSJA 3JD3A 4HH0A 3FLAA 3SP1A 1JYFA 5IULC 2XCRB 5CXQA 2NNWB 3BQNB 3HCFA 3QQPA 5AW2A 4UMDA 5K0TA 4BO5A 4P3YA 1KNQA 2LW7A 1N9GA 2FMKA 1DKQA 1I7DA 3IQWA 3Q5GA 3KUDA 1KJWA 3FMGA 3GELA 4N5IX 4RKYA 4X6LA 3I3SR 5A4IS 1IK6A 2JLBA 2M32A 2VNHA 3K0EA 3PBKA 2YY7A 3WKAA 1OXVA 2RGXA 3MNFA 5CBPA 1TDJA 1K2VN 2IYEA 2P9CA 4CKCA 1L3IA 2P69A 3K16A 4D44A 5B2EA 521PA 3S2ZA 1JI3A 1ZM9A 5LIRA 3OCJA 4BEJA 3WYDA 1U9CA 2IPXA 2GZ3A 1S2GA 2JFQA 3L9XA 4DV3B 3N7AA 2WF5A 2R96A 3VKUA 1HDCA 3HM2A 4M0PA 3COWA 5I7UA 4J1SA 1P3Y1 1WCIB 1SBIA 5MDHA 3T9BA 3OBBA 5C8YA 3WSVA 3ZI4A 4J16C 1K7XB 3G23A 1WV0A 1FJHA 1BE8A 4X20A 1UKBA 2ZXFA 2GN4A 4KOEC 5C34B 1N1DA 3GT0A 3WL8A 1G20B 1II8B 2P3OA 4Y1GA 3HY4A 2IWRA 5JXWA 3ZK9A 2FGJA 3WLJA 1WHTB 4CF6A 4CG0A 5AW6A 1O8CA 4WA8A 2YJ5A 1LPOA 5G0VA 2CE7A 2XE8A 5AKXA 1SVIA 1JA0A 2WAOA 4G8BA 3DE0X 5JVDF 5K0NA 1J20A 3HCPA 2ZB4A 1IQRA 3IBYA 4S1VA 3WQBA 4D6XA 1E9VA 4MCHA 4AG3A 1KRWA 4YAFA 3ZNPA 1J90A 4IFTA 2WTNA 2O23A 1YZNA 2QQFA 1ZXBA 4I55B 3WLOA 2BFNA 3MHPA 1EQUA 2IPLA 4MYCA 2VBIA 4RHEA 3WRYA 1X92A 4MVJE 4PLFA 3VO1A 1LZKA 3MJDA 4CMEA 5KCZA 2H1OA 2VHUA 1QB7A 3HZRA 1KIMA 4JI1B 1B73A 2JH3A 4DLTA 2QLNA 4ARAA 4Q4HA 2OCYC 4QG3A 4ZXFA 1EFPB 2OAEA 4NS1A 2ZJ7A 5GJVC 3TLZA 1QF6A 4HFNA 2I2WA 4C22A