5IXYA

Lactate dehydrogenase in complex with hydroxylactam inhibitor compound 31: (2~{s})-5-(2-chlorophenyl)sulfanyl-2-(4-morpholin-4-ylphenyl)-4-oxidanyl-2-thiophen-3-yl-1,3-dihydropyridin-6-one
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cell Active Hydroxylactam Inhibitors of Human Lactate Dehydrogenase with Oral Bioavailability in Mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxireductase/oxireductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
total genus 117
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5ixyA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5ixyA02
4TRJA 1FDWA 3ZH2A 1E1LA 4DXHA 1PR3A 1LBEA 3LK7A 4WNIA 4CV3A 3BMQA 1U3WA 1P45A 3GZNB 3ONEA 5JXWA 1ZEJA 5B4UA 2OBNA 3GUCA 1PGNA 1I3NA 1NFQA 3GN1A 1D3AA 2FMUA 2X4GA 3MTJA 1LDGA 4Q3CA 2YW9A 4PN3A 5LCXA 4BV9A 5DCYA 3V2GA 3ZV4A 1AHIA 3L4BC 3VTZA 5JDCA 4M1QA 3FBGA 3WSWA 2A35A 4OO3A 4P38A 3D3EA 3STHA 3IP1A 3AM3A 4W99A 3UICA 2Y99A 1T4DA 5L7WA 1UH5A 1NP3A 2PKQO 1K6IA 4PLYA 5EL0A 4EUFA 5C7IO 1NYTA 3IKTA 3R1IA 1V3VA 2Z1MA 2PZMA 4IM7A 1AHHA 3SC6A 4D79A 4L4SA 4WLFA 1ENZA 2JL1A 3Q11A 1KVSA 3OEWA 3GG2A 4L4RA 3FSRA 2OBYA 1WPQA 3GPIA 3RFVA 5JFOA 1HTBA 1MFZA 5CDSA 1IL0A 2R00A 3F3SA 3WIEA 1OMOA 4JJIA 1WW8A 3A4VA 3AI3A 4BNLA 1EK5A 1ENPA 1VRWA 3IDSA 5CDGA 4K9DA 2EERA 3QIVA 3HB4X 5JAIA 1QYVA 1ZEMA 4Z6KA 3GT0A 4R54A 3RJ5A 4BMNA 4FB5A 2X0IA 4FR5A 3WFIA 3MJ4A 4RF4A 2Q3EA 5HWSA 2H6EA 3UW3A 2CDAA 2J6IA 4URFA 4ZQGA 5TF4A 1EUDA 4R3WA 5EJ2A 1WLYA 3IOYA 3BTSA 4PG5A 4D43A 4S1VA 3C7DB 2P68A 4IZIA 3VVCA 1PS9A 1UP7A 2IYOA 3LLVA 4WCFB 2PKQP 1FDSA 5J23A 1Q7BA 3LU1A 3WLEA 3CXRA 1WAMA 3B1JA 3ZU2A 5A9SB 4A10A 2VWQA 4YACA 1ISFA 2W4QA 2O50A 1BXKA 1NPYA 4DPMA 2DFVA 2Z5LA 3NDJA 2VYVA 3ZI0A 4CMJA 1ML3A 1WMBA 1Z73A 4I9HA 2AQHA 3TRIA 1D4FA 3FBTA 5G4LA 1O8CA 3CEAA 3TOZA 4EYEA 1HT0A 4MVJM 1PU2A 3QVSA 3KBOA 4RPGA 4LCEA 2ZATA 2CY0A 3FNFA 4Y98A 2CFCA 3W6ZA 5EQFA 4A73A 5I7FA 1EE2A 4OOFA 1GR0A 2PTGA 4HY3A 1E5LA 2BLLA 1H6DA 2NADA 3OIFA 2EEZA 1HZZA 2NVUA 1XGKA 1P1FA 4GSLA 4S3MA 1I0ZA 1LNQA 2WD8A 4FD3A 4A27A 4BO3A 2PD6A 1XA0A 3I52A 4JQCA 2CVZA 4IMRA 2Y0EA 4FFMA 4ZQHA 2RH4A 1YL7A 3WGZA 4FBGA 2GUGA 4IDAA 4BQRA 5F1PA 1MB4A 1NQTA 3FPCA 1E5QA 4FSHA 1OBFO 3WGQA 4NK5A 3U3XA 2X23A 3ZWBA 5CHEA 3LC1O 2E4AA 3IJRA 3L4SO 1JKJA 3UUWA 1HDXA 3TJRA 4RLHA 4Z0PA 3S8MA 1JQBA 1LI4A 4JLWA 4A5OA 4PG6A 1MG0A 5KVQA 3W8FA 4D3FA 5B4VA 1ZNQO 2BRUA 1L1FA 1O94A 2QRJA 4QFCA 4WGGA 4YJGA 2OHXA 3E8XA 3Q2IA 2AG5A 5HRUA 5G0VA 5DT9A 3WMXA 1ZK2A 3ZV3A 2NACA 5BNTA 5JPIA 3RUAA 1H93A 3GAFA 3R0IA 4FFOA 2DU8A 4XB1A 5HS6A 3JQAA 4J49A 1GCUA 3DBRA 4CLRB 5C5IA 4CMAA 3KSUA 1T1RA 4IZHA 4N5LA 4PIVA 5JYEA 4HKTA 3DZKA 2X1HA 1ZUD1 1Y5MA 1R16A 1UDBA 5H83A 2WMDA 2EJVA 3LSYA 2VNSA 1QYXA 3PGJA 3JQ9A 1NPDA 3DAGA 2RH8A 4HFRA 1BDMA 1ZIDA 3ASVA 5KJCA 4BNYA 3H6KA 2X0RA 4I5DA 3GK3A 3N58A 5JYDA 1Z74A 1U5CA 2P9CA 5F3RA 3ITKA 1JVBA 3X2FA 3ZNQA 3D4NA 5C37A 3TFOA 1J0XO 4CM8B 1AGNA 2RHCA 1NFFA 1RKXA 4AJ2A 4J43A 3OIGA 1IULA 2J3JA 3UN1A 1IZ0A 4GGOA 4E2WA 1RYDA 1CETA 4H7PA 3JQDA 3E03A 1LC3A 4FGSA 3M6IA 4YBZA 4OMUA 4XKJA 1YO6A 1ZCJA 1PQPA 1LEHA 2VHYA 3EVNA 5F1KA 4HFNA 3HFGA 3AOEC 3M1LA 1O89A 3KRTA 4EDFA 4NBVA 2PZKA 4MPDA 2YUTA 2Q2VA 3FPLA 5ENVA 3U5TA 4CMIA 3PHHA 1P31A 1EEHA 1IHYA 5AXCA 5BQFA 3H9EO 2FPPA 3QWFA 5COQA 2YV2A 3ZV5A 2VWHA 2HKIA 2HMTA 3Q0EA 2A92A 1YL6A 1R0LA 3TDKA 4CUZA 1ONOA 4K1LA 3PJGA 3F47A 4KMSA 4IDFA 3PHJA 3MTGA 1GYRA 4BB6A 1Z75A 3ZU5A 2YHIA 3QVOA 2EKLA 4UULA 1ZXLA 2D3TA 3JSAA 2NU8A 1O95A 1PTJA 1HSOA 4ZN6A 3GZ4A 4MVJP 1I2CA 1T2CA 1WWKA 1ENYA 1YXMA 4I9NA 1GU7A 3OMLA 3F6YA 2O7QA 1VLLA 3L0DA 1NWCA 3RFTA 4ALNA 3KVOA 4J0FA 3NT4A 4R9RA 2F1KA 1N8KA 4XGIA 3BTOA 1HDGO 2GCGA 1NBOA 4WK6A 4LGVA 3LT2A 1UJMA 2JFFA 2ZKLA 3WGYA 1Y81A 2VT3A 3V1TC 3PXXA 2BKAA 1EFKA 1NHWA 2P9GA 4OIMA 4YDRA 4CR6A 4E3ZA 2X5OA 4OXKA 3RUHA 4FFNA 4CV0A 1U4SA 3PRJA 2HRBA 4HV4A 5G0TA 2HJSA 1W8DA 3DHEA 3MOGA 1PJQA 2C59A 2ZB3A 3PZRA 5DBIA 1I30A 3C24A 1HDYA 4G65A 3UVEA 3G0OA 2VCYA 3WYEA 1R0SA 3GUYA 4M54A 4BO9A 1V3UA 4IS3A 2EP5A 3WB9A 1Q7GA 1JN0A 4MVJA 1T4BA 3KXDA 2VUSA 4J2OA 3IC5A 3PJFA 4IDEA 2YDXA 2X22A 4K28A 5B12A 4RF5A 1Y8RB 4HNGA 3WLFA 2C5AA 3MJCA 1PIWA 3K8ZA 4MOWA 4TKLA 3UCFA 3DBLB 1AXGA 2P91A 2GGSA 3FTNA 4BNFA 2C07A 4IXTA 4YRDA 4XJTA 1DC6A 4W6ZA 3GGOA 1HE5A 4PLPA 4B7XA 4CM1A 1P1RA 1NQOA 5TX7A 2DQ4A 3FI9A 1YBAA 3LVFO 3PFWO 4GPD1 3ZZNA 4CLRA 4NNJA 3FD8A 1E3WA 3PHIA 4E30A 4HWKA 4B3HA 3KSZO 2FP4A 3JQGA 1E3EA 5HM8A 5GZ6A 3JV7A 3EC7A 1P9LA 2VN8A 3G49A 2P4HX 1EZ4A 5B37A 1GZ3A 3T4XA 2ZTLA 1BMDA 3ZNOA 1MLDA 4W9NA 3VAZA 3G3EA 3ROMA 1OI7A 4WCDA 3JTMA 3OIDA 1KC1A 3K92A 5F21A 4DIOA 5KJ6A 4JXKA 5GMOA 5BNFA 3ZWCA 4CM8A 4PLGA 4I5EA 3ANLA 3L07A 1ADFA 1PGQA 3A28A 1QP8A 3OQ1A 4Y9DA 5AXBA 1YB1A 1P1HA 2Y1GA 4JJGA 4EUEA 5THQA 2JCYA 4KOAA 2BGMA 4DPLA 4Q3NA 4QQRA 5MDHA 3NJ4A 1N5DA 2O3RA 1C1DB 1LU9A 2HU2A 3O26A 3PHLA 2HSDA 4YT2A 1T1SA 4FPXA 2FPGA 5A3JA 5KVVA 4XQEA 4B7UA 1KEPA 3RBVA 3PVZA 1WZIA 1H6BA 4CMKA 5THKA 2Q4BA 3RC9A 3DZIA 3ICCA 2YV3A 4M55A 4NPCA 5BT9A 3ZHBA 1E3LA 1YL5A 4R5MA 4YJDA 2D1YA 4KTTE 4R1TA 4YTEA 4A26A 2EV9A 1T2AA 3AY7A 1GQQA 3I5MA 5IZ4A 2HRZA 5L9AA 5IXSA 4FDAA 3AUAA 5JC8A 5KKCA 2CVOA 1GYQA 3VZPA 4DVJA 4K26A 3ZW8A 3ONFA 2V65A 3N7UA 4XZ3A 5A5FA 4YWJA 2OZPA 3NRCA 3B6ZA 4GL4A 2WJPA 4GI2A 2I76A 2OMEA 3GVHA 3AW9A 4J4BA 5I9MA 4OXNA 3JQFA 3KYDB 1ADBA 1B15A 4O63O 1PZEA 2Q1SA 1D1TA 2EKPA 1UR5A 1H6AA 2NM0A 3QWBA 4J6FA 4R01A 5FFFA 1ZMOA 3ZWVA 3WGIA 2CDCA 2HMSA 2IZZA 4II3A 3AM4A 4YXFA 1NASA 1K5HA 5EN4A 3FR8A 4AJJA 3EK2A 5AYVA 4CMEC 3VDRA 4BNIA 2O4UX 2VWPA 2DTXA 3GEDA 3O9ZA 2AXQA 1LLQA 3M1AA 1QRRA 3B20A 3RQSA 3VZQA 3KZVA 4D41A 3CKYA 3OECA 1TT5B 1NPTO 3SBOA 3EMKA 4HNHA 4XQGA 3H65A 5A1TA 3WIDA 2B37A 4BNKA 1LDMA 3L9XA 5B4TA 2LDBA 1YS4A 4EJ0A 1RM3A 4J2HA 1SZJG 5L53A 4Q3BA 1CJCA 3AJRA 3UOGA 4BNMA 1WDMA 1DBVO 1KY5A 2UUOA 4ND4A 3QY9A 3DBHA 3VDQA 3NTOA 1IUKA 1TI7A 4PG7A 3H3FA 4GGPA 4BNJA 1VL8A 1UZMA 2JAPA 1CRWG 2CVQA 4IINA 4OOEA 1CF2O 3TL3A 4D3DA 3ZGYA 1QXSA 3GG9A 1OC4A 3H2SA 1HKUA 4EJ6A 4JBGA 3OICA 3BMNA 4L9RA 1ISIA 1GAEO 1T2DA 2RCYA 4DGSA 5JLAA 1DIRA 1X0VA 5EQDA 1IYZA 1V0JA 3V2HA 4DTIA 5FEUA 1DIHA 1KEWA 4K6FA 1M6WA 4CL3A 3W4JA 4FS3A 3DTYA 1U28A 5TGDA 3ZU4A 5ICSA 1W4ZA 3RASA 4ZQFA 4CPDA 2YYYA 3ETEA 3WTCA 4N7RA 3ZCXA 3BHIA 2Y93A 4BKOA 4QFDA 5HA5A 2NU7A 3HJAA 1QV6A 1R4NB 1DXYA 4FJ1A 5G0SA 3INGA 3WG9A 3LT1A 4J1SA 3F4BA 4LSMA 5T6BA 3C8MA 1XSEA 3UFXA 4DREA 1H94A 1K2WA 1HDOA 2C5EA 1U2DA 4NJMB 3H8VA 1DC5A 1YDEA 3MWEB 1EE9A 3F1LA 5ER6A 1HSZA 1Z6ZA 2Q99A 4RJTA 4RV9A 1I24A 2PGDA 5JAQA 3NV9A 3C7AA 4GVXA 3VTFA 3DFUA 4PLHA 3WNQA 3T7EA 4BNXA 3DO5A 4P4GA 4Z3DA 2R00C 1B16A 4FFRA 4NFYA 4EGFA 3E82A 3U4CA 1I36A 2G17A 2X6TA 4Q9NA 3P2YA 3JD1A 1PJLA 4CM9D 2GDZA 4EUHA 2I3AA 3BA1A 2ZJ1A 5CFZA 3ENKA 1GY8A 1SEVA 5B1YA 2GASA 4Z3KA 4P8RA 3IS3A 2X9NA 3T7CA 3HDJA 1ZVMA 2X8LA 4TRMA 1IE3A 3GY0A 3P5SA 4AJHA 3FRJA 1SMKA 2ZCVA 2DT5A 1P1JA 1X7GA 4B3IA 2DBVO 5L51A 2ZTUA 4JROA 3OJLA 4E5YA 4Z9FA 1Y5RA 1JAXA 1ZXBA 4PLFA 4OKIA 2VT2A 4CLOA 4CM7A 4PGFA 4HFJA 5G4KB 3ONDA 4AJLA 3UKOA 4TRNA 3I1JA 1F8GA 1X7HA 2QW8A 3GFGA 3NJ8A 1W73A 4R41A 2CDBA 2I3GA 4AJOA 5F5LA 3LC2O 2PA3A 3DZBA 1MG5A 5ADHA 1R15A 2P2SA 3RSHA 1HDZA 4QO7A 2QYSA 2AE1A 2AMFA 2YHUA 3DONA 3C1AA 3O8QB 4BO8A 1HEUA 3CINA 4JCOA 3AU8A 1ARZA 1N1EA 1SPXA 3JQ7A 4J90A 4BL5A 3DEYX 4ZQBA 1EBFA 3CH6A 2JHFA 1VM6A 2O3TA 3BTVA 3NTQA 5TJ9A 3TNLA 4CM9A 2PGLA 1PEDA 1XYGA 5TT1A 1ENOA 3SC4A 1PSDA 3W4IA 4AJNA 2XXJA 4OJNA 2GZ3A 3BMCA 5DBGA 4TVOA 4DLAA 2A94A 3D64A 3BMCB 4FQ8A 2ZQZA 2ZQYA 1ONNA 1X15A 3G79A 3KOUA 4BUCA 8LDHA 1MXFA 3FHLA 1SC6A 2CMDA 4OL9A 3RCBA 3TOXA 1YGYA 4INAA 3JCZA 4E2XA 4NU6A 1MGOA 3NKLA 1LA2A 2Q49A 1ZH8A 4BNTA 4CUJA 4DLLA 3UH1A 4C7JA 4JGBA 3DHYA 3GGPA 3R3JA 3H5RA 3ZHYA 5K9ZA 3H2ZA 4UEJA 3D5TA 4E32A 1C0KA 1GQ2A 1R66A 3H5AA 3KUXA 3O03A 2Q1TA 3HDQA 3Q9UA 4D0SA 1ZO8A 2UYYA 4RQUA 4BS9A 2F00A 2Z1NA 4G5HA 3L9WA 4IDBA 1DHTA 3EVTA 1BXZA 3MEQA 4BNHA 1DAOA 1E3IA 4RDIA 1C0LA 3S55A 3OSUA 1E3JA 4FJ2A 2GLXA 1DFGA 5U1PA 1Y9EA 3HE3A 3QLJA 5L40A 2V6FA 4RVFA 2SCUA 1YB5A 5DF1A 1HLPA 1D7OA 2BD0A 4I8XA 1G0OA 1F14A 4XEHA 3PDUA 5JS6A 2EP7A 4BMSA 1P1KA 5TLSA 4RCVA 1J6UA 1LSJA 2E49A 3GFBA 4KTVE 2Y0DA 1A5ZA 4IGFA 5IZCC 1OFGA 2X5KO 4ZRNA 4HP8A 2O2YA 2EF1A 3KB6A 5F5NA 3DBLA 4XA8A 3JQAB 4CMCA 2J3HA 2QRKA 2G82A 4KQWA 5TNXA 2ZTMA 1C1XB 1A27A 1EK6A 1QYDA 4R68A 5ILOA 1ZSVA 5EERA 2VZ8A 4XDYA 2NSDA 5CPBA 3JQGB 2W2KA 3C7CB 4RVGA 2YZ7A 4MIYA 4OGWA 3RROA 1LSSA 1HYHA 2E82A 3MJEA 3H4VA 3PYMA 4BGEA 3JQCA 3WGHA 3JD2A 3SEFA 2PWZA 2Y1EA 3UGKA 2IYPA 4IQ0A 1KYQA 5I7VA 3AOEA 2HK8A 3GVPA 1TLTA 3V5NA 1XU9A 4CLOB 1JAYA 4FOOA 4NI5A 2C82A 4XYGA 3C1OA 3OJEA 5IAAA 1ZMTA 2C2YA 1WXDA 1ADGA 4TMFA 1YBVA 3EZLA 3FNGA 5JO0A 4RZHA 3EHEA 3DL2A 1I3KA 3MWDB 1PZHA 3LLSA 3FF4A 4E5NA 1H6CA 3I9NA 1XR3A 2P4QA 1YJQA 4R69A 1JTVA 4U6SA 4WLEA 4E6PA 1OZAA 1FK8A 2FRDA 3GNQA 4NFSA 4XDZA 1H0KA 3MZ0A 3TQHA 5COBA 2GN8A 1WMAA 2FR8A 4YT8A 1FMCA 4DL9A 2YQ5A 1VKOA 4AJKA 4E21A 1KS9A 3U4HA 4ROSA 1I5RA 3HFSA 1QKIA 4QX6A 1FDTA 2ZB4A 4J0EA 3DBRB 3DR3A 1ONPA 2OORA 1R37A 2GF2A 3QVWA 1GUYA 1R6DA 3PWZA 4CM3A 1LUAA 2PD3A 3NDRA 2WDZA 4C7KA 1NAIA 3F9IA 1I8TA 4KDFA 2DBRA 1NHGA 1X13A 2VYVD 5ICMA 1YQGA 1QLJA 2O3SA 4L74A 4PZEA 1Z45A 3ASUA 3DQPA 3PYLA 4PRKA 3NT2A 5COAA 2WYUA 3ST7A 4XYBA 4ZVVA 1D1SA 4WKGA 1PQWA 3PWSA 4ALIA 1E3SA 1YDWA 4LVCA 1V3TA 5C3MA 2WE7A 3QWIA 4KQXA 1EMDA 4PG8A 1JDJA 1ADCA 4BOYA 5LC1A 5JSFA 2B83A 4DA9A 2XOXA 1CERA 3ZDFA 2OO5A 1DLIA 1UXJA 5I7EA 4W7IA 4ESOA 2D8AA 4D0RA 1IZ9A 3CZMA 4MVJF 2NVBA 5TJHA 4MP8A 1M75A 1Z7EA 1NVGA 4YAEA 3D3WA 3DBVO 1ZJZA 3Q1LA 3BMOA 1ZK0A 1BXGB 4PRLA 3BYZA 3KLPX 3SX2A 5H81A 1P0FA 2IZ0A 3OBBA 1DPGA 1GZ6A 2E37A 4YJFA 3SLKA 4E33A 1F0YA 3RU7A 1NX6A 4JBHA 1VSVA 1MA0A 3K96A 1DC4A 2Y1DA 2X7HA 2NWQA 3PQFA 2EW8A 1SOVA 4L8VA 2EIHA 4Z0TA 1A9ZA 2O23A 4J9VA 2PZJA 3WR5A 3WSVA 5DP1A 1YOVB 2C0CA 3E9QA 3FN4A 4NBUA 4B4OA 2DUUA 2BGKA 5K6AA 5KCZA 3TWOA 4JN6B 1BWSA 4IIVA 1A9YA 1PJ3A 1DLJA 4E5KA 3F1KA 4YRAA 3UCEA 3TZ6A 3GEMA 4H16A 3AY6A 3PHGA 3U4IA 4BVAA 5K6AC 3RBZA 1HWYA 2VZ9A 1ID1A 1LLCA 3I9KA 2TMDA 2BI7A 3WGGA 1B26A 4FJ0A 1NQ5A 3QA9A 3PJDA 3OETA 4AL4A 2O48X 4YT4A 1V9LA 3JD4A 1Y6JA 4LVUA 1NR7A 3NT5A 4CV1A 5JO9A 2PD4A 4TZKA 3K9QO 1WDLA 2BHLA 1Y9AA 2X9GA 5ITWA 4CLXA 3FWNA 4IIUA 4YAIA 2OXIA 3HQ4O 3ROKA 1H2HA 4J9UE 2RHRA 2V6GA 2VZ0A 4G81A 5KOIA 1HE4A 1PJSA 1DIGA 1P3DA 5DOZA 4UUPA 4CQMD 1UXGA 5JDIC 4E12A 1IOLA 3PP8A 1NXQA 2Y0CA 1A72A 1KOLA 1SOWA 1YQXA 4PVCA 3RWBA 1I3LA 4E0BA 3DDNA 1PJTA 2ZYDA 5A9RA 2Q2WA 2I65A 2C7GA 3AI2A 4JX8A 2ZB7A 1K6JA 1HXHA 2EKQA 4U0JA 4DMLA 4B7CA 4DLBA 1HE3A 1U3UA 5JDIA 2P5UA 5EPOA 2ZTVA 3DOJA 3G1TA 1M66A 4H15A 4PLWA 2FR1A 3LYLA 3PEFA 3QWHA 3O4RA 3AUUA 2D5AA 4LW8A 4AG3A 5KTKA 3ADOA 3DB2A 4FC6A 4ZU3A 1B8VA 3IAHA 5JC1A 4CQMA 4M86A 1Q0QA 2GR9A 3OA0A 3Q3CA 2Q1WA 3MJSA 4RPHA 4BNNA 4DBVO 1A71A 3CIFA 4TVBA 4B79A 3OFSA 2PH5A 2VHWA 1ZSNA 1DJQA 1NFRA 3T4EA 3ANMA 3TPCA 5TC4A 2LDXA 3VPXA 2ZK7A 3BTUA 2D2IA 5CG1A 1C14A 3VZSA 4FW8A 2YJZA 3AFMA 1E7YA 5KJ1A 3L6OO 2O7SA 2QQ5A 2YFQA 1ISJA 2I99A 4PLZA 4W4TA 1Z82A 1JKIA 4NH4A 4B8WA 3FR7A 1IY8A 2CF5A 4ILKA 1QYCA 1L7DA 3BMQB 2BI8A 2DTEA 8ADHA 3RIHA 4Y6SA 2VUUA 3AUSA 1PZGA 5L3ZA 2NV6A 2UV8A 2O4CA 2WE8A 3V1YA 4LRSB 3FCOA 4NJMA 2BELA 3WS7A 4NBTA 2DLDA 3BMOB 1LDEA 1DB3A 4WLVA 4GX2A 4J3FA 3W8DA 4E2ZA 3HN7A 4IJVA 3RAJA 4E31A 3HG7A 3HWRA 4YR9A 4ZGWA 2WWRA 3IIEA 4A03A 1GADO 5GZ3A 1U8FO 5CG2A 2I66A 4LMPA 5G0WA 1Z7BA 1XLTA 4YA6A 3OF2A 4DIBA 2GN6A 1KERA 4OM8A 4BKUA 3UHAA 1XELA 4AICA 4MVJE 4ND1A 2X5JO 1ZFNA 3I4CA 5IN5A 4D46A 5TS3A 5C7LO 4LISA 3TZCA 1U9JA 1MUUA 3KEQA 3PFFA 1V8BA 1HLDA 1DHRA 1DFHA 1WZEA 1N9GB 2B4TO 4UREA 3OP4A 1PX0A 4GX5A 4GBJA 3VHRA 4CR8A 4NU5A 3NYWA 3P19A 2IEBA 4CM4B 1KVTA 2IZ1A 3U49A 4I5GA 4YT5A 3JQBC 5DCWA 2X0JA 4K6CA 3VPSA 4CQLA 3R6DA 2VHVA 4PVDA 4O6VA 1Y1PA 5T5QA 9LDBA 2GYYA 3B70A 4WCFC 4CODB 2WYWA 4DBZA 4B4VA 3DZJA 1LSUA 2FR0A 4KDEA 1JU9A 1DAPA 1E1MA 5L7YA 4QECA 3PIIA 3E5RA 3GAZA 4FN4A 5GY7A 3ZWMA 1I10A 3CSDA 2XF8A 3GHHA 1BGVA 1TT5A 3WOHA 1AUPA 2Q45A 1LQUA 5TSDA 4BGIA 3NEPX 2DPHA 1ISHA 1QR6A 3ZWXA 4WCFA 4YB8A 1U1IA 4J4TA 4L0QA 4MKXA 1CEQA 3ZNPA 4CMHA 1HRDA 3AFNA 3HADA 1B3BA 1B8PA 2DC1A 3H9JA 3OHSX 4CMEA 5A04A 4E4YA 1C0IA 4IQGA 1P1IA 1RM0A 1JKFA 1UZLA 4U5QA 5CDUA 3V1UA 1DRUA 3LT4A 4XJSA 3WQQA 4R3NA 1QYWA 4XYMA 5IDXA 2HLPA 2Y1OA 1EVZA 4BKRA 3VZRA 4OHUA 1VSUA 4QSMA 3JD3A 4CMGA 1YKFA 4CM6A 2NTJA 4L4XA 5KNLA 3GEGA 4NDNE 3DZHA 3ROPA 4GAEA 1BHSA 2NTNA 4GMGA 2FPIA 3KYCA 2HJRA 4MDHA 1U3TA 4CLEA 3PGXA 4MIOA 2JKVA 4GKVA 5JAZA 4R5HA 1NR1A 4JP2A 3A1NA 4L75A 1PJ2A 1YB4A 2B35A 2EGHA 3HHPA 4TQGA 3W6UA 4GLOA 2NU6A 3BXXA 3TSCA 4CQMB 4CLHA 3LF1A 1T25A 1R4MA 1H5QA 2IDZA 3LZ6A 4WEOA 3TZHA 3GDFA 2NLOA 3I9OA 4OAQA 5BNIA 4DQVA 3ON5A 3WBBA 1P44A 2AEFA 1N1GA 2JD2A 3PZBA 4N5MA 4XB2A 2NU9A 2QYTA 3QV1A 3W1VA 3JYPA 1HDRA 2W98A 4D45A 4KUEA 5JDCC 3H3JA 2ET6A 3ULKA 4H3VA 1ZW1A 4XIYA 1EVJA 1HYGA 1H9AA 3GH3A 2J5RA 1UDCA 4Q3EA 4XYEA 4RF2A 1PL6A 1KY4A 3D1LA 4RPLA 4ALMA 1SB9A 1XWFA 4WLOA 1H2BA 4KZPA 1K0UA 2GZ1A 2VHXA 1Q2XA 1Q0HA 4ND3A 1KETA 2WTBA 2NQTA 1TEHA 1Y8RA 4OQZA 2W90A 3JQ6A 3EDMA 4WASA 1PJ4A 2VTDA 4IDGA 2Z95A 3S2EA 4M89A 3GMDA 4YCAA 1U3VA 1Q0LA 3WDSA 3IQDB 4TROA 1GCOA 1KEUA 2V7PA 4WLNA 1LRJA 5H82A 4HADA 2P5YA 2B36A 3AK4A 4YAJA 2J3KA 3PPIA 4Q3AA 1O0SA 5JCJA 2QHXA 1UDAA 5ITVA 1XEAA 4IPTA 4RGBA 2QIOA 1GUFA 4BO6A 1ZSYA 4RPJA 2UVDA 4F6LA 2WD7A 1F8FA 4R16A 4DC0A 1DSSG 3VH1A 4CM4A 4RZIA 2OGUA 2WD7B 3CTMA 5TT0A 3I6IA 4WLUA 1PL8A 3KETA 4LCJA 3WXBA 4GX1A 3WICA 4J1TA 2HK9A 1A7AA 9LDTA 5JMWA 1RPNA 2AE2A 2D59A 2P9EA 3DC2A 4XRGA 1JW9B 1RJWA 5A05A 4IJKA 4RORA 1KVRA 2FN7A 3I9LA 4NQZA 5FI5A 2PGJA 4R9SA 2CD9A 3HN2A 4PFJA 4JJFA 5I8ZA 2C2XA 2NUAA 2PY6A 3QWAA 4JP3A 4BB5A 1GYPA 3B1KA 4J7XA 4XRRA 2FSSA 1KC3A 3JYOA 2GZ2A 1AXEA 2JD1A 4NJOA 4BMVA 4XD2A 3JQEA 2OFPA 3ZN2A 4AJPA 5T8KC 5A9SA 1E92A 1B7GO 1AE1A 3H7AA 3W4KA 2ZJ0A 1CQJA 1GPDG 3OJFA 3UXYA 3HDYA 3JD0A 4G2NA 1DJNA 3N74A 4QT0A 2Q4EA 3RI3A 1YQDA 2YQ4A 4FOSA 1Q1NA 2YHIB 3NTRA 4I9UA 5L95A 4A7PA 2ZCUA 2WYVA 1GV0A 1PR9A 3EGOA 4NIMA 5T8KA 4U6QA 1H9BA 1JLLA 1E7MA 1YVEI 4U0KA 3KHUA 3K30A 3QHAA 3ZWWA 4Q3DA 4O59O 1QG6A 5IFLA 1BVRA 1IB6A 2W8ZA 4MJLA 2QZZA 1NQAO 1SO8A 4UUOA 3JQ8A 1I3MA 4AJ4A 4LRTB 3HSKA 3JQ8B 3K2EA 2Q50A 1HE2A 2NVUB 1P0CA 4NK4A 2GD1O 4EEZA 4J1NA 1E6EA 1GFSA 1PWZA 3H9QA 2Q1UA 4CUKA 3GOHA 2VRBA 4Y8VA 3NGLA 5L4LA 1K6XA 3V8BA 3FWZA 1XKQA 3WTBA 2TMGA 4NR0A 2UDPA 2AHRA 4JNKA 1G6KA 2DAPA 3TF5A 1EQUA 4LK3A 4UEKA 1MC5A 1DRVA 1Q7CA 4BO5A 1TT7A 1CQIA 3X2EA 3OM9A 3LDHA 1LXCA 3CE6A 3DFZA 5DDIP 4IUYA 2JFGA 2V6MA 4N5NA 5ILGA 3AWDA 3D5QA 4IS2A 5A03A 3F5QA 4WOKA 3PIDA 1LJ8A 4J4HA 3FNHA 5MGBA 5A5EA 3QVXA 1B8UA 2VWGA 1C0PA 4DPKA 4MO2A 5A9TA 3H9UA 3DXFA 4ITUA 4JIGA 1MV8A 1PGJA 1JVSA 3HNPA 1PWXA 1X14A 2BFMA 2PFGA 4QO8A 2JJYA 1E3WB 1A7KA 2D4AA 1YH3A 4EEXA 3LQFA 2O3QA 4O0LA 4AVYA 5IG2A 3QW2A 1XQ1A 2FY8A 2Y05A 2OP0A 2HAEA 5LDHA 4GLLA 4HX5A 2W2KB 5IZCA 5JNLA 2AQKA 3M2TA 1G0NA 4J16A 3K73O 4XCVA 3KTDA 4MP6A 4PZCA 4AJIA 3CMMA 3VPFA 1E77A 1T24A 5I9LA 3C85A 3DTTA 3QVTA 4YJHA 3GVIA 3GDOA 2QRLA 3MOIA 4F45A 1UP4A 3NAQA 2FOIA 1MX3A 2CNBA 3DHNA 4OSOA 4ZHSA 5IDWA 1ZJYA 3RUFA 1TVEA 5KIAA 1U8XX 3DZFA 3RKUA 1DFIA 4W82A 2UUPA 1UAGA 3DAFA 3L4BA 3WFJA 3M2PA 4UVDA 4R1UA 1IPEA 1I32A 2G76A 4UVGA 4WJZA 3SJ7A 3GZNA 1DEHA 1EVYA 3WNVA 4BNUA 2AQ8A 1LX6A 2I5PO 3GHYA 1X1TA 3I6QA 2DPGA 2X86A 2BH9A 1WNTA 4Y6RA 5KKAA 1TXGA 1MP0A 1BDBA 3WQRA 1BXGA 3DOOA 4QXMA 4PLVA 1GTMA 1VI2A 2POQX 1LQTA 3ZU3A 4YAKA 2BFAA 3IUSA 4GX0A 4IJWA 1JA9A 4PLCA 1NAHA 1BW9A 3SVTA 2DM6A 3COSA 4IJUA 2Q46A 2CSUA 1K3TA 3CUKA 1EDOA 2OP1A 4IMPA 3S2GA 1T2EA 3D0OA 1XDWA 4U7WA 4DUPA 1F17A 5IDQA 3OQBA 1XCBA 4CL8A 1EUCA 4YQYA 1BVUA 1DIAA 1R12A 3ADPA 2E48A 3GRPA 3KYDA 4GH5A 1M6HA 4Z9YA 5BSEA 3JYLA 3JYNA 3F4LA 3RD5A 3MCVA 1UUFA 4YAGA 4LSWA 2ILTA 4JK3A 1PJCA 5LDGA 3DOCA 3ANNA 5K0ZA 2O3UA 5TQVA 4ZQEA 3DZGA 3RUEA 4UVHA 5ER9A 5L45A 2R6JA 2C54A 4NBRA 2OUIA 2B5VA 1RM5A 4UAGA 3VKUA 4QEDA 4MVJH 4ZA2A 3W8EA 5A06A 3LT0A 1DC3A 4J91A 4ZD6A 4IDCA 1U4OA 3TZKA 5AXAA 4F3YA 1VPDA 5JY1A 1PGOA 4UVIA 1HF3A 1LRLA 3RU9A 4DMMA 4J7UA 5IDYA 3MJVA 3ZV6A 2IE0A 5IN4A 3E9NA 5JAMA 3CZRA 3C1TA 3ABIA 2DBQA 5BSHA 4DYVA 4BNVA 3WMWA 2PZLA 4Z0HO 4QUKA 1PGPA 3QP9A 1LDBA 5JCXA 3KYBA 1KBZA 1J49A 3DBHB 4N18A 4WEQA 1M76A 4B3JA 3DMTA 1O6ZA 3I83A 1M2WA 1FF9A 3I9MA 3VVBA 3ETDA 4D3SA 1RWBA 1NNUA 3L6DA 1VJ0A 4PG4A 3S1LA 3QQPA 4W9NC 4AJEA 3EW7A 2RIRA 3HB5X 1KVQA 3E1KA 1GZ4A 1LDYA 1SAYA 3IUPA 1GDHA 3KYCB 5ENDA 3ZNNA 4CM5A 2YFHA 3VC7A 4CV2A 4DC1A 3WYCA 3BIOA 4E13A 5A02A 4EI2A 1E6WA 3RFXA 3DMTC 5AOVA 3BMNB 2VOEA 3DWFA 2I6TA 2R2GA 3E48A 3U09A 2G1UA 4CQLB 1CDOA 4BKPA 1KIFA 4RDHA 3VPHA 4WECA 3RC2A 2BF7A 1YE3A 1PS0A 3G1UA 1R4MB 3VH3A 2VYND 2J5KA 3NDIA 2VNAA 3F46A 2HQ1A 2IRWA 5CDTA 2W2LD 3WWZA 1BRMA 4NZ9A 1PL7A 4I08A 7MDHA 5EMHA 2VOJA 3O38A 1XG5A 2VRCD 4L76A 4O5OA 4E2YA 4P4LA 1ZK1A 2HMUA 2QZ9A 1ZK3A 5DNAA 1D8AA 3GNSA 4YVFA 4Y67A 1U5AA 3I23A 5FF9A 1QV7A 4TWRA 4XX0A 4ZJUA 3JYQA 3UCXA 2Y1FA 4FC7A 4R1SA 5CPFA 1C1DA 2HMWA 5FI3A 3VPGA 4XIJA 1E6UA 1W6UA 2I9PA 1C3VA 4AFNA 1EUZA 1HL3A 3A06A 4GSKA 4AJ1A 3ZW9A 3HUDA 4DQUA 3TZQA 1P77A 2CUKA 5DP2A 5T67A 3D7LA 1DO8A 5HBRA 2X58A 2A4KA 2NNLD 4OKNA 3R3SA 2JCVA 4GMFA 3RUIA 2O2SA 2JHGA 3I3OA 5KJFA 4BKQA 4IGEA 2FHSA 1T2FA 3PQDA 3QRWA 4KUGA 4B4WA 4CMBA 2GN4A 1QMGA 4UUMA 4KWHA 4E5MA 1YONA 1GEEA 4RVDA 3WX0A 3UAGA 1C1XA 4KUHA 3EZYA 2HCTA 5C7OO 3DMYA 1GV1A 2I67A 4BIIA 1HZJA 4I5FA 1UZNA 1ISGA 3GPDG 1FDVA 5I7SA 5JMPA 1ULSA 1ZKMA 3WJAA 4EZBA 3BHJA 3L77A 1ORRA 1VC2A 4Z9XA 3E9MA 1B14A 4BNGA 4HFMA 3ENNA 4RVSA 3K2BA 3RVDA 1CIVA 5G2OA 2DVMA 1BSVA 3KEOA 1VJ1A 1XU7A 2GN9A 1HDCA 4P22A 4RPKA 2Y68A 1N7HA 1IPFA 4XWYA 4NG5A 3IP3A 2YY7A 4MINA 5G0UA 2G0TA 2QG4A 5G4KA 1J4AA 5AXDA 4WUVA 5BR7A 2W2LA 4MP3A 3KV3O 6LDHA 2CZCA 3L6EA 4BGUA 4EW6A 2JCXA 4MIEA 3WQSB 1E1KA 4YRBA 1QSGA 4P4NA 3O8QA 3EAGA 3ICPA 4F6CA 3JQ7B 4BO4A 3P7MA 4XGKA 4RQTA 1CYDA 4TSKA 3EYWA 1PQUA 1KVUA 1MXHA 4WE3A 5DN9A 5IF3A 4FIZA 4XGNA 4GKBA 3INTA 4GWGA 5CEFA 1YBMA 1I2ZA 3RBXA 3WWYA 1KEVA 2Y1CA 2ZIZA 3BZUA 3D4OA 2VQ3A 1N9GA 3GLQA 1A4IA 2GO1A 3ORFA 3B1FA 2CF6A 2EJWA 3I4FA 4MKZA 2XAAA 4CJXA 4Q39A 4BGVA 3E18A 5I8WA 5CEJA 4YEDA 2DFDA 3VH2A 3NX4A 3PK0A 5GZ1A 1I01A 1R0KA 3GRKA 4E5PA 3WGOA 3QSGA 4B4UA 6ADHA 1SBYA 4BNZA 4NMHA 4M87A 3VKVA 1F12A 1EBUA 5L4SA 2DTDA 4GVLA 4KWIA 2C20A 3RKRA 3PLRA 3IMFA 5DCUA 4EBFA 3KSDO 3JQ9C 1I33A 3JQBA 3K31A 3AM5A 3OEYA 4II2A 1ZBQA 2PLAA 2PNFA 3A9WA 1R4NA 2H63A 1YRLA 2B4QA 2A9FA 1EDZA 2AW5A 2WM3A 3NUGA 3SLGA 4ZRMA 2BGLA 3AY3A 2H1SA 1P33A 1NWHA 1E7QA 3QJ5A 1T26A 4UVEA 5JE8A 3U0BA 3GVXA 2AA3A 4A2CA 1LDNA 4HUJA 4YJFB 1ISMA 5DBFA 3KLMX 3IJPA 2H5LA 2FZWA 4YPOA 4YJGB 1O5IA 3E5MA 3PJEA 1M67A 3I9JA 2B5WA 3HZZA 3SXPA 3WGTA 1NM5A 2EXXA 3A14A 3AUTA 2HDHA 5EINA 1U2GA 2PR2A 3IL2A 1V35A 3AOGA 3OJOA 3TL2A 4NBWA 5AVOA 4B8ZA 3D4PA 3GNTA 2G5CA 1DDOA 1VKNA 7ADHA 2BFPA 4FCCA 3KM0A 5A4DA 2GRAA 1NVMB 1YWGO 1E1NA 3BAZA 4LMRA 3H9GA 1GPJA 3RC7A 1ULUA 2IXBA 4HXYA 3KO8A 4GWKA 4ONEA 3WJ7A 4L73A 3BHMA 1UP6A 1L7EA 5U9CA 1PJBA 4ND5A 2O3JA 1LC0A 1VE9A 2PK3A 1JWBB 1I2BA 1LSOA 5BSFA 4KP7A 2VUTA 2DBZA 4ND2A 3ETGA 1G1AA 2VTEA 1K89A 4XR9A 4BO7A 4EJMA 1P74A 2J5QA 4WPGA 3PDJA 2AG8A 5HTOA 3GGGA 3OA2A 1LRKA 2ZYGA 1WVGA 4D7AA 3GDGA 2GSDA 4CLDA 1DIBA 2DUWA 4RL6A 2B69A 1IHXA 4DQXA 3S2IA 5KVSA 2B4RO 5TIIA 1RYEA 2XPCA 4YYZA 2OL4A 5L7TA 1E7SA 3INRA 1U7TA 1E7WA 5DOVA 4BQPA 1MC4A 1FXSA 5CAEA 1N92A 5HS4A 1Y7TA 1GD1O 3E6AA 2IODA 1O9BA 2IEDA 2EG9A 3GC6A 3MJTA 4CMIB 4FFPA 1GQYA 1UXKA 1WDKA 4BV8A 4XR4A 5BSGA 2WEKA 3K5PA 4I1IA 5U4QA 1QORA 3RC1A 2AEJA 1SCUA 4CR7A 2Y67A 1NVTA 3G17A 4BO1A 4IXWA 4N54A 2AQIA 1UXHA 1MFPA 1X0XA 2RBEA 2YDYA 2ZYAA 3AI1A 2JD0A 2NQ8A 4D44A 3GA0A 3ZWPA 2GNAA 4RO0A 1XQ6A 1UAYA 1SNYA 1GL3A 3U4DA 3RUDA 3PYXA 2GPTA 4X54A 1E0DA 1BTOA 5JBIA 1LTHR 1VL6A 5F1OA 1FJHA 2Q2QA 3K6JA 2X9VA 3NGXA 4NHEA 4OYRA 5TRTA 3JQAD 4BO2A 3VOSA 5JW6A 1TA4A 4Y6PA 2NTVA 4MKRA 5L4NA 2Y66A 2FWMX 5AQ1A 3D3WB 3Q9NA 2J3IA 1S6YA 1W0CA 5JY6A 4QTZA 2PKRA 5EESA 3WYBA 4XYLA 4IY1A 1XIVA 5IXYA 4MVJI 1OAAA 3PLNA 3TN7A 1N2SA 4RVHA 2D5CA 4FFLA 1OC2A 1SB8A 1RM4A 4MVJG 3LF2A 4ALJA 1GEGA 2UAGA 3H5NA 1EVIA 4F46A 5ES3A 3CMCO 3SJUA 2JFHA 5DULA 4R4JA 1U7HA 4ALKA 4U8GA 2HO5A 1X1EA 3ZWAA 1BW9B 4D42A 1F06A 2D0IA 3S2FA 5FWNA 3WBFA 4YQZA 2VRCA 1X7DA 2XXBA 3ZHXA 1A4UA 1YOVA 3ITDA 4R1NA 4ID9A 3OJ0A 4M49A 4HBGA 4R51A 3U9LA 1BG6A 4DYDA 2RAFA 5KVCA 3GQVA 5CDYA 4IBOA 2BMAA 1JWAB 3DAPA 4TRRA 1WP4A 3UF0A 3VH4A 3PI7A 4RLSA 5FYDA 3P2OA 4DIFA 3ZWNA 2HUNA 4PCVA 1HETA 5IJZA 1GUZA 5I9NA 3PQEA 3AU9A 1E7RA 1ZK4A 1EQ2A 1PZFA 4OSPA 4A0SA 4YJHB 1PS8A 2DKNA 4W7HA 2J8ZA 3CPSA 4OH1A 4J7CA 2E6UX 3F5SA 3EUWA 3JQFC 4PZDA 3HDHA 2OOSA 3FNEA 2X0NA 2AEMA 1CWUA 3C3XA 3GR6A 3TFQA 2IXAA 1VL0A 3LC7O 1EFLA 1QLHA 4RF3A 3GF4A 4FGWA 3IKVA 1DRWA 4BNWA 1DOHA 4UEOA 1LLUA 1B0AA 2V6BA 4OXYA 4DRYA 1VJTA 4NFHA 3GMSA 3ZWOA 3PTZA 2BFOA 1LLDA 1B3RA 3OH8A 2FSVA 4C4OA 3GVCA 1XHLA 4PLTA 4DWVA 4IDDA 1YJ8A 5KJEA 5KWEA 4XQ9A 1N7GA 4IQ8A 2EWMA 2C7VA 2HK7A 2PH3A 1HYEA 4RVUA 4TZTA 1AN9A 5JCJD 2NVWA 4LN1A 3ZHZA 4UUNA 2YV1A 4WNCA 1SEPA 3RJ9A 3Q2KA 2PV7A 3OQ6A 4BO0A 2C29D 3QE3A 3V2UA 2VYNA 1J5PA 2ZB8A 4J1QA 1Y8QA 2QX7A 4XQCA 3FTPA 2VHZA 3Q6IA 4EITA 1S7CA 3EY4A 2EGGA 1Y8QB 4GQAA 2GERA 5DZSA 2EHDA 5T57A 3U62A 4BHTA 5CEEA 2B0JA 4OQYA 4JBIA 1OOEA 4ALLA 2WSBA 3GN2A 4O1MA 1TB4A 1V6AA 3ZWYA 4MVJD 5A3VA 4ZICA 5T64A 4WOJA 2H9IA 2JAHA 1NTOA 5CP8A 2FZEA 3PWKA 2HMVA 3RUCA 1B2LA 3ROQA 4M8SA 1FDUA 1ZZEA 5EIOA 1UXIA 4TKMA 2EW2A
chains in the Genus database with same CATH superfamily
2XTJA 3HL0A 4TRJA 3ZH2A 2IVZA 2XKAA 1S9DA 2JEYA 1TK9A 4NZOA 2JGDA 4ZCLA 1LBEA 3LK7A 4ANFA 4DXHA 3BMQA 1ZBDA 2ZYSA 4A6XA 1KZGB 5B4UA 1J1UA 4DANA 3D4IA 5I6DA 2HBRA 1I3NA 1NFQA 3WL5A 1D3AA 4Q3LA 4C3UA 1H2EA 2X4GA 3DW3X 5HBGA 1RRGA 4DDVA 5LCXA 4UU7A 1J7KA 4BJ1A 1AHIA 3LS2A 4M1QA 5CVTA 1NYRA 5JFTA 4RKYA 1CHDA 1I4LD 4ZHQB 1FJXA 1E58A 3DF9A 3D3EA 3CVXA 1VJGA 4A1OA 4ZHQA 3AM3A 3LIIA 4QDTA 4W99A 3VU9A 3NHYA 4F4FA 1NP3A 1L5OA 4M22A 1ICEA 4LOIA 3IKTA 1DINA 4LYJA 1FFGA 1KI1A 3R1IA 3M9XA 4YXWA 4U7DA 1Q91A 1JR3E 3LCCA 2JJ2D 1RQ2A 1YZKA 1VIVA 2PSSA 5AOCA 4DSZA 5CLFA 5MGNA 2JL1A 3EXIB 4V1CB 1MVNA 2KBEA 2RHMA 3OEWA 1VPWA 4L8FA 2ZZMA 4BWVA 1G3IA 5AKHA 2YX1A 2OBYA 4BLWA 1E9DA 4FLMA 2CFSA 1TADA 5BNZA 1HTBA 5JAUA 1I1OA 1E2IA 3DE0X 1UF9A 1T0JB 3R3XA 5E9WA 4C1BA 5CDSA 1WW8A 4I3GA 1VYVA 4QHTA 1ESMA 3ZHOA 3ZDDA 1Y5LA 4G2TA 5GPBA 2OGZA 2OXEA 1EUQA 1ENPA 2ECPA 3IDSA 4K9DA 3QIVA 5EJIA 3ZCUA 4NOLA 3UT5B 4L9SA 1ZEMA 1GUBA 1Q11A 2C1EA 4UOQA 3K4QA 5HCIA 1DO2A 3RHZA 1WRBA 1GNTA 3PEWA 4OBEA 1DDIA 2D5IA 3DDUA 4M7RA 2B4YA 2L0XA 4RF4A 1UJBA 2R8EA 4W8GA 2H6EA 3KLBA 2CDAA 3Q9LA 4URFA 1E8MA 1VPEA 1WG8A 2XUJA 4JUAA 1CY1A 2Y1XA 4FYIA 3IVMA 3BTSA 1N2OA 1BXRB 1T1EA 4F93B 4JLAA 1K27A 2P68A 4XX1A 3MSCA 4IZIA 4EFLA 5AP9A 1PS9A 4L57A 1NUPA 1OAOA 2FETA 2PKQP 5BW4A 5AICA 5DN6D 3Q87B 2GBCA 1VG0B 3B1JA 3RODA 3WLJA 1R5JA 4WZBA 3M89A 1D2RA 2Z2ZA 2ZYRA 4A10A 4E5SA 5A9SB 5BV7A 2Q5LA 1KORA 3GJ7A 3JALA 2PIAA 3JWGA 2C2WA 2J7PD 1ISFA 1EGVB 2O50A 4ZDJA 1YJBA 4DPMA 3QVUA 1C81A 1L8AA 2DFVA 4D9EA 4NPHA 5HKLA 2QP9X 3MGBA 1E3QA 4X1KB 5AIBA 5J4LA 1VIMA 1YD7A 5K0SA 1VI6A 1C8KA 1H69A 3OHMA 1QC5B 4Z3OA 1XALA 4YDHB 3C6QA 1FX0B 3HBFA 4PAOA 3SXUB 1D4FA 1L8LA 4HGQA 3CEAA 2BJWA 4EYEA 1XCOA 2EHJA 2PT7A 4MVJM 1SRQA 3D0KA 3ZJVA 1G20A 4QATA 1U0BB 3J80A 2BC9A 5JXIA 4JSYA 1VYTA 1Z56C 4Y98A 5EQFA 4HNAA 4R2KA 4QUAA 1GR0A 1UMDB 5JSQA 2O0HA 4U7HA 4B4DA 3GFTA 4HY3A 1IONA 1JG1A 1H6DA 1U4NA 4JJ8A 4EKIA 3OIFA 2XXAB 1HZZA 2NVUA 1XGKA 2QVGA 2X14A 3G2KA 1G4AE 1LNQA 2X2EA 2YJGA 1N57A 2WD8A 4K6HA 2FUEA 4JVOA 5H3HA 2F3TA 5KTSA 2D1QA 1IBSA 3IGFA 521PA 3NMUF 4BLQA 2G77B 4CKWB 5TPZA 2E4YA 4FFMA 3ZCTA 3K6SA 3VPAA 3OIYA 2C7QA 1YL7A 2FJ0A 3O2QB 4FBGA 3REQB 1SBQA 3ABZA 3TKLA 3THOA 2AUNA 5B53A 2PBRA 3EMDA 3N0TA 5BN5B 4ZAYA 4EHLA 3WGQA 4DAEA 1DU4A 3ZWBA 1TPYA 5CHEA 3LC1O 2E4AA 3IJRA 3NIDB 1NUSA 1HPLA 1AQ6A 1F7UA 3RTDA 2VJKA 3TJRA 4GP7A 2BW0A 3RG8A 2YBEA 2GTHA 1EFVA 1LBHA 3OU7A 4JKOA 5F78A 3BA6A 4RLHA 4Z0PA 3TLBA 1NQUA 3F9RA 3Q5DA 1LI4A 2VJPA 1DEAA 4PG6A 1R6BX 3S2UA 3W8FA 4WBNF 2PS0A 3FETA 1L1FA 3MWDA 5TV2A 4BMXA 2QRJA 2VDQB 1N33B 4IW3B 4QFCA 4B4KA 1N4AA 1DAFA 3PE3A 3LY8A 5H02A 2DQSA 3NLLA 2AF3C 2GTPA 2R5WA 3JZAA 3RIGA 3T7RA 1A5SB 3QPAA 3WMXA 1V1JA 5A6SA 3H8SA 2VQSA 4RTKA 3VU9B 4JS0A 4R7TA 1H93A 5B7PA 3R0IA 3EZXA 4G4SO 3DVRX 4DE5A 4RAOA 5FB3A 3SP1A 2XE6A 2C98A 1VMDA 4RTSA 1OH6A 4ICIA 3N2EA 1BX0A 1CUUA 4GP6A 3TZBA 2ZIGA 1UEIA 4XB6B 4XFKA 5HMLA 4ES6A 3KSUA 5IUJC 4WFJA 4IZHA 4BMZA 3HKCA 4N5LA 1I4TD 2ARKA 1ZHFA 1WB4A 4HKTA 1PFUA 1R0ZA 1Z37A 3ROXA 3HKDA 2PGXA 2QMQA 2GLUA 3C3BA 4PZ0A 5JD6A 2VDOB 1G5RA 2HRCA 2VNSA 3PCTA 4DT1A 3LX6A 1RXWA 1YK0A 3DAGA 1Q3KA 2RH8A 2CK3A 2ZRHA 3NTXA 4D3XA 2XRFA 3HBNA 4NBNA 4ZOCA 3H6KA 3HR7A 4O2LA 1H2XA 1K0FA 3C0KA 4I5DA 2HNAA 1V8ZA 2X2OA 3N58A 5JYDA 1Z74A 3NDBB 3VVMA 4EJSB 1T10A 4FZJA 4BFLA 4ZALA 1J0XO 4CM8B 2JIPA 3EISA 1LZKA 5HFNA 3ZVMA 2FTKE 4AJ2A 4MUGA 1Z33A 1I7NA 1A8IA 2GESA 1CXZA 2Q0QA 2WTAA 5AQEA 1VHTA 2RB5A 4GGOA 3K1AA 1JP7A 5KEIA 1RYDA 3K1AB 1LC3A 4FGSA 3M6IA 5A7FA 3JAWB 4F84A 3G89A 4N8DA 1YO6A 2GTIA 3ET5A 4XVRA 3LDAA 1ZCJA 4TKVA 4F91B 4Y2QA 4ESVA 4RMNA 1TF2A 2QAGB 3EVNA 4I46A 4F4IA 5BYKA 3AOEC 1NSYA 1O89A 1EVKA 1U2GC 4RK6A 4EW3A 8MHTA 3NH9A 2YUTA 3B48A 3FUUA 1DWPA 3FPLA 2KSQA 4CMIA 1ZGJA 4ZREA 2E5LB 3L0CA 5BORA 1P2SA 1CSEE 3PHHA 3SZLA 4DIMA 4EYQA 4ZVSA 4B2YA 5IJ0B 2BMDA 1AJEA 3Q41A 4KO1S 3LHIA 4MQ4A 4B40A 2EL9A 1P19A 4S12A 3AMVA 5FWDA 3TDKA 3IOMA 4PONA 4J94A 3PJGA 4MB0A 3F47A 5FADA 4KMSA 5HIIA 2EDAA 1K7YA 3MTGA 3A36A 2QTBA 2IUFA 2KBFA 2YHIA 3QVOA 1YZVA 4DSUA 1ZN2A 1EU1A 4D9CA 3SHFA 2I1QA 1O4VA 3RFUA 3VR6D 2L19A 2D3TA 3I05A 4C7XA 2O7VA 1N6RA 1OXKB 1A97A 3GZ4A 4XJVA 1WUTA 1V2GA 1G16A 1WWKA 2J09A 3HVKA 2HRDA 2IYSA 3FNQA 2FNAA 3NHLA 4I9NA 5K3AA 4MJ7A 1TQ6A 5ALHA 1QNLA 2O7QA 2Y1KA 3F6YA 4ALNA 3F96A 1XVIA 5G3ZA 3K0FB 1PR1A 4J0FA 2AK3A 2JW5A 4P36A 2Q8NA 4OM7A 3ZZMA 2OB1A 3BTOA 2Q3JA 3S70A 1RYFA 4LGVA 1UJMA 1NF9A 3RWMB 1RHJA 3GLIB 1Y81A 1JEQA 4NFLA 4G9GA 5DV9A 3V1TC 2ID8A 1QTRA 3C5WP 4CCWA 2PUBA 3TBFA 1P7VA 3SBDA 4ZOLF 2LRHA 2P9GA 2CWDA 4YDRA 4ZO8A 4CR6A 4E3ZA 1A8HA 1D03A 1RCTE 2YIMA 2AZDA 3H5VA 3N0RA 2HA4A 4JGGA 4LJYA 4GDMA 5BW8A 1N2HA 1TMKA 2C0QA 4G8JA 1Q57A 5G0TA 3DHEA 4D4HA 1Z18A 2WF6A 2X7XA 1CDDA 1NDHA 4Y2SA 3ZIUA 3KQVA 3IEPA 4IXNA 1HDYA 4G65A 4PFSA 3V9AA 2VPQA 2FN8A 2VCYA 1R0SA 1TUGA 1TYCA 2EBWA 3PEUA 4MITA 3GUZA 4BO9A 4PC3A 5LWHA 4GOKA 4PC1A 2EDCA 2VSYA 3CB2A 4MUAA 1JN0A 2ZEJA 1Q84A 1XYYA 4DS3A 2MSLA 4G0MA 4A6PA 3KXDA 4X1IA 4WZAB 1AGXA 3G1WA 4Y9SA 4F1KA 3VR1A 4CKEB 5K3EA 4ESHA 3PJFA 4KYTA 1N1MA 2X22A 4QFMA 3S6JA 2C4WA 5B12A 1EZ1A 3ZZ0A 4E7PA 1FW8A 1J33A 4O2RA 1Y8RB 4ZZ1A 4KGZA 1UJ2A 4JKIA 4ARIA 3A05A 4KLCA 2YN2A 4NRDA 4LZAA 3LX4A 3MJCA 3TSZA 9GPBA 3KU1A 4TKLA 1E99A 2GGSA 3FTNA 3MRVA 4URHA 4RK1A 4YRDA 3G7UA 4NYIQ 2H4XA 4ENVA 1DC6A 1KFBB 2NUPB 4PLPA 2C5SA 2RHDA 3L1KA 2HSGA 2YN4A 3OPXA 3BD7A 3FI9A 2LE0A 4LYYA 2DR0A 4CLRA 5INTA 3FD8A 3PHIA 2PXCA 2Z3WA 3PDIA 4M7WA 4QLAA 4HEQA 2IH4A 3K2QA 3N28A 3GNLA 5GZ6A 2JBAB 4IIGA 5HUQA 2P4HX 1H2FA 3PC2A 4MUXA 2GSWA 1TL7C 2HJWA 1GPKA 1N6OA 5DM2A 1E0SA 5D51S 4KQCA 4IR7A 3TAUA 4C4XA 1Z2OX 2V3WA 2VA8A 3G3EA 1OI7A 1IRXA 3BL8A 4YMSA 2W6CX 1PHPA 4P35A 1BGXT 1NW9B 4MWOA 4I1UA 3K92A 5BV1A 1GITA 4LJ5A 4XI9A 3FGZA 2QRVB 4Q00A 1XJ0A 4JXKA 4OMDA 4DIOA 3NETA 3TCXB 5CA0A 1OLOA 3L07A 3OQ1A 1ADFA 5E0KB 3A28A 2X19A 4IFEA 1EX6A 1N3LA 1YB1A 3NIBA 4PGAA 2Y1GA 1TQDA 2HO4A 2IYYA 1K88A 3ISJA 2GILA 2JCYA 3L0IB 5BQ5A 1NUUA 2XBUA 4Q3NA 5MDHA 3NJ4A 4AY5A 3TTSA 3ND6A 4X66B 5AHRA 1QZ3A 3QPCA 3PHLA 3V80A 4YT2A 2PGOA 4FPXA 1K5PA 5KVVA 2BFFB 4KR3A 3V8QA 4KR9A 2HTFA 4ZCMA 5BOSA 2F59A 1OUMA 1QPGA 5IP5A 1HR0B 2W7TA 2Q4BA 1IIRA 3OF5A 2WF7A 3CZQA 1JSZA 1NUTA 1RHQA 2AJDA 2YV3A 3S3TA 1UKAA 1O1YA 4NPCA 2FEWB 2EGUA 3PNKA 2BT4A 1E3LA 2RGCA 1O4WA 3KQTA 4RIGA 2GD0A 5D8DA 5TGZA 1L5HA 1MIOA 4D3ZA 4KTTE 1Z4MA 2ILVA 3ZTWA 4A26A 2QBYB 5A2GA 5IYZA 4GXQA 1N25A 2DOKA 1DKPA 1GQQA 2XYGA 5FBHA 4ZYVA 5BMVF 1YQQA 3T1VA 5BV0A 3AUAA 2NMVA 2H54A 2JA2A 3F90A 2IUYA 3PL1A 4PCAA 2PXAA 2CXNA 1GYQA 3G7NA 4DVJA 1U1DA 3DTNA 4UAVA 4AQYB 3ONFA 4HH3C 3R8FA 5TMPA 4R40A 3N86A 4GL4A 1OPXA 1M1UA 1ZJ6A 2IDKA 4PHGA 4PIMA 3RANA 4BVHA 4F0JA 3CLRC 2ZYVX 4JUFA 3FPEA 3TR0A 5I4KA 1A2QA 1Y6RA 3NOQA 4EHDA 2IHYA 4O25A 1GTSA 1WOMA 2QTMA 2WV9A 3L43A 3OTWA 1SIWA 4G1BA 3VSBA 1SZDA 2JFVA 5BN4A 1ADBA 3HM9A 3ABQB 1PZEA 1L3CA 1Z39A 3K0FA 1GKIA 3MTAA 1D1TA 4EJ6A 4U3JB 1H6AA 3BF8A 4J6FA 4R01A 4RHTA 1ZMOA 4EKNB 1UJCA 3WGIA 3JW8A 4R1OA 2HMSA 3AM4A 2BR5A 2EJCA 1NASA 3A6KA 3TFWA 3O4JA 5EN4A 3NONA 5AYVA 4TS3A 2YICA 1T9GR 4BNIA 3HFRA 1QYIA 1VB5A 3JVEA 2AXQA 1NURA 1KNXA 3M1AA 3MUFA 1QIKA 1U80A 3B20A 5HKOA 2OCLA 1NJFA 2EFJA 4Q5IA 3HFJA 5K3DA 4D41A 3CKYA 2WJJA 2GS9A 5CH3A 4RIEA 4HPXB 2Q3HA 3H65A 4BQIA 2NYVA 5A1TA 2BHTA 1UKEA 3IQHX 3IVGA 5KNDA 4BNKA 3WZMA 3L9XA 3PNOA 3PIRA 3TI7A 2R87A 3WGJA 5TVKA 1K6EA 4CKBB 1O96B 2Q5OA 4Q3BA 4FYWA 4D9JA 1XMSA 1CJCA 4YAOA 1WCYA 2AOXA 3STYA 3LQ1A 4WI1A 5KYXB 3OO0A 2I7DA 3VR2A 4O8CA 3AKZA 3VDQA 4RDCA 3VNRA 2XODA 3CG4A 2O8EB 5IKMA 1IUKA 3A6EA 5ADWA 1KBOA 4UHDA 5EXXA 1EWKA 4GGPA 3EWAA 4W8OA 3B6EA 2CVQA 3OOEA 4OOEA 3SIRA 3CVJA 4CF5A 1V8PA 4L78A 5K4GA 3AR6A 2FUG1 3FDIA 5IBQA 2PAFA 5C8YB 2WZDA 3GG9A 3PKJA 3ZDCA 4KR6A 4RELA 2VATA 3AUKA 4WDRA 1WUKS 4RHYA 1CS0B 4DDMA 3OICA 3OOSA 1OLXB 4NYIR 4CGZA 2BJVA 4GUDA 5AKLA 2I8LA 3HGQA 4H08A 3SCZA 5EXTA 2I3DA 4QZVA 3CURA 5MN5A 2CMFA 5FEUA 3GJ4A 1DIHA 1IOVA 1TMOA 4K6FA 1VYUA 5YASA 5IUNC 1ZGHA 3C43A 4RGVA 2BEWA 3V8MA 4A8JB 5FA8A 3RS3A 3K71B 3MCZA 2OY0A 4R8KA 2JIZA 1W4ZA 1WXXA 4H18A 1W19A 4HQLA 4D74A 3RASA 1RWNA 2WJVA 4CPDA 5BVHB 4X6UA 3WTCA 4N7RA 3LPCA 4J2TA 4OG2A 3IMGA 3QSYA 5I4IA 1RFLA 2CYBA 2OOKA 4B43A 4QFDA 4CHGA 3H5LA 5BYJA 3FVVA 1JDSA 3HJAA 1W0KA 2F3RA 3L7LA 5JMOA 1DXYA 4CNBA 3LPMA 3DM5A 3LT1A 3ZG6A 3AF5A 3X1XA 4UHFA 2OV8A 1YVRA 1XXHE 2I80A 3F4BA 5T6BA 3M83A 2FDCA 3UFXA 4DREA 5JG7A 2BVNA 1ST3A 5BO5A 1DAIA 4K9MA 4TTJA 1T6XA 2C5EA 2PQ6A 3L8DA 3FMIA 4TS9A 5KMGB 2R4UA 2YBDA 4M1ZA 4TXJA 1DC5A 1P5JA 3UYLA 4FFWA 3MWEB 3F1LA 4P0PB 4YLYA 1Y42X 5ER6A 4DY4A 1HSZA 1R6XA 2Z8YA 3ONWA 4H7EA 3JXEA 4L6CA 2X8JB 4BP3A 1RQPA 5I4CA 2A33A 2JAWA 4DCSA 1HMPA 1XZ8A 2P1RA 4LHWA 3ENVA 3VO8A 4ARSA 2CNDA 1AC5A 4OPMA 3OZCA 3NHWA 3V8VA 2HWXA 4FFRA 4PBRA 4EGFA 3Q7QA 3Q15C 4TVKA 1IPHA 2AVDA 3LRXA 4PYLA 2MR5A 2SKEA 4HAOA 1C30B 2P90A 4R1QA 3C6YA 2C5FA 3P2IA 4LDRA 1DS6A 4C4RA 3I62A 2HHLA 4CM9D 4IDPA 5FWYB 3VGJA 4EUHA 2FB9A 2I3AA 2WVJA 3BA1A 3R40A 1LX7A 1PSWA 2ZYUX 4QL3A 5IK2A 2V59A 3BIJA 3OFND 1X1BA 1ZU4A 3IS3A 4B44A 4ZCPA 2HW8A 3HDJA 3JZDA 1C8BA 1X6VA 3VXKA 2XRYA 2BHSA 3SQWA 3P5SA 1G20E 4AJHA 3W1WA 4OAPA 5E2AA 1XKLA 3B7PA 3I6BA 3G0HA 3E7PA 1KE1A 3UY4A 1RRVA 3A9TA 1OH7A 4NYJQ 2DBVO 5L51A 3ZZ1A 2ZRCA 3TPZA 2K2QB 2FEKA 4C04A 5I9IA 1JAXA 2L82A 3HCAA 1CQPA 1ZXBA 3NXKA 1A9XB 3Q3GE 2VT2A 1DOZA 2FZCA 4HTFB 4JJ4A 3SBXA 4CLOA 4ZO4A 4K9OA 5K1ZA 4HTFA 1A9XA 4HFJA 1L5MA 2BP7B 2Q9CA 2YXLA 3MLAA 3I1JA 4Y3UA 1S3GA 2AT1A 3BDAA 4KX3A 4N8EA 1A2OA 2JFQA 2QS9A 4GQIA 4NYJR 2CDBA 1KIAA 2I3GA 4R41A 1U6KA 3MAAC 3KYIB 1UKCA 3DPIA 3H4MA 4YGYA 3GW8A 1AKNA 4LRQA 1KFCB 2G1JA 5IJAA 4MAFA 1PL0A 3RSHA 1P9NA 2G09A 2PUTA 2YINC 3CY6A 4QGHA 3DZCA 1G60A 2AE1A 2C3UA 2R8YA 2YHUA 4MI1A 1EXVA 4Y0AA 3DBIA 1HEUA 2YWRA 3MM4A 3PQ4A 4JCOA 2GAIA 2XMZA 3MHPA 5GINE 2UKDA 3UJAA 5E6RB 2H4JA 3QYAA 4HEJA 2D2VA 1NJGA 4R8MA 2WMOB 1RHMA 3NTQA 1FTWA 5T3YA 4JL5A 1XYGA 2FDRA 5B1HA 5KAMA 5TT1A 2YASA 5TMDA 3W4IA 4FE3A 4EHHA 3WL7A 1G2PA 1CJUC 2NZUG 4LXIA 1U7WA 1Z4LA 1IXZA 1F4PA 1H2YA 2XDAA 3I04A 3QPBA 4DHEA 2JLWA 2NUTB 16PKA 4HNVA 4DA6A 2I0FA 2QVLA 4FQ8A 2A78A 1L5SA 1ONNA 2ZQYA 3G79A 5JECA 3DHVA 1L4YA 5B2FA 4MR9A 8LDHA 1MXFA 3FHLA 1ZMXA 4OL9A 4PAGA 4KH0A 3R75A 1GGFA 4INAA 4E2XA 3UQZA 4IXMA 4EI9A 3F5DA 3H2IA 2R6HA 4CXMA 5FV7A 1TJNA 5E2BA 1QHFA 1VLJA 2I6QA 2J32A 2CNKA 3VYTB 1KAQA 4NE9A 4CUJA 2GK4A 4UNIA 5DGTA 3KAJA 4JGBA 3DHYA 5CNIA 3ZHYA 3IIIA 4N03A 4NAUA 1G2QA 3H2ZA 5K9ZA 3ILHA 4E32A 4CIXA 1YZYA 1XMQB 1KSGA 5CB4B 1CYEA 3M6FA 2RD2A 3KUXA 1AS3A 3VO9A 1JLKA 3IBCA 4FNGA 3UWPA 3Q9UA 4CKWA 5IFKA 4BS9A 1D5WA 2QMHA 2Z1NA 3O8NA 3MGAA 3UAWA 3L9WA 1DAOA 1X9IA 1PKEA 3CH7A 5LOVA 3S55A 2GF9A 2FW9A 1WMFA 3BEDA 3S0JA 4FJ2A 2HCBA 1T29A 2GLXA 2Q21A 1Z5UA 2JCGA 5L40A 1O5OA 4KIJA 4WOBA 4FOPA 4D56A 4RVFA 3RGWS 2JLZA 2EF0A 3GCZA 1YB5A 2C3PA 2MYNA 4IRUB 2IPAB 2BD0A 3BHNA 2ZB2A 4I8XA 4GE0A 3IPYA 2JLRA 3MGCA 4IYRA 4BO7A 3UB2A 2BMFA 1WSWA 3SMVA 3FDFA 4B6PA 5JS6A 1JQ5A 5DRYA 1FBNA 1LTQA 4A2QA 1X1SA 4BMSA 5A1JA 2X1VA 3U6BA 3EFEA 1CZKA 4KTVE 4D2IA 2V0CA 3OPYA 1X1QA 2JI4A 2Y0DA 3GFSA 4JU8A 5BUCA 1WA5A 3SYMA 3WL3A 5IZCC 2YH2A 4CEHA 3Q7TA 4D6YA 2BM8A 4ZRDA 2O2YA 2EF1A 4XM1A 3BOSA 1RRFA 1U0FA 2VHCA 4YRQA 4XA8A 3JQAB 2PZFA 3E22A 2BFDA 3FMVA 1WPXA 3CNHA 1J8MF 3W9UA 2ECOA 4MUNA 4OFZA 4KQWA 1UEJA 1ULAA 5IVKA 4R68A 2OZVA 2PRJA 1OGIA 4DM3A 3T0FA 2C2OA 1Y3AA 9ABPA 1NL3A 4IXDA 3C7CB 4RVGA 4DBZA 1CBUA 4DT1B 3W6NA 3ABSB 1LSSA 5F33A 3C7KA 3KD2A 4M1EA 5AW6A 2AOWA 3MJEA 4HUTA 3B6MA 4RSHA 1C8LA 3WGHA 3LECA 1X8LA 3CHYA 1JQKA 1WP9A 2ORED 3O8OA 4FE4A 5CXSA 2PWZA 2Y1EA 4IQ0A 4UZFA 1E2KA 2QZPA 4ZU6X 4Z4GA 1VCOA 2UXDB 2B7LA 2IA5A 4WKNA 3TLGB 5I7VA 3AOEA 2HK8A 2QD2A 3B3JA 4W63A 3NH6A 2XUQA 4IDQA 3QJYA 4MYCA 3WHKA 2GFIA 1GKUB 1X8KA 1NSTA 2JLCA 3OJEA 2AN9A 3WLTA 4EPTA 5GVSA 1D9ZA 2P79A 4G5XA 5FUBA 1EP3B 4PO3X 5JO0A 3FUVA 3DL2A 2A5LA 1RIFA 2MSKA 3LY9A 2DQKA 3MWDB 3LLSA 4PW0A 5CJ2A 3BL6A 2J4FA 5C5DA 1L7BA 3AEQA 3BXPA 2VYCA 4N0EA 1UC9A 4HTAA 1ECPA 2F55A 2FPGB 1YJQA 1YTLA 4E6PA 2CHQA 3GNQA 2R751 2MSNA 4QJ4A 3ETCA 1NUQA 4KIGA 3SHOA 5COBA 2FR8A 3WAGA 4N40A 1T34A 1VHDA 1II8A 4B48A 3SC2B 1V8FA 3VU0A 3UXEA 3IE1A 3WIOA 2VP0A 2QTCA 3P0FA 5T4BA 2WR8A 4AKTA 5D00A 1BWPA 5EKUA 4DZTA 4ACAA 1ZA1A 2C2KA 1A88A 1XZEA 2OORA 1R37A 3U7EB 2GF2A 5AKKA 5GGXA 4Z0NA 5CNJA 5CCEA 5JATA 5IAGA 3NDRA 2WDZA 4OP2A 1Y48E 4NWIA 1XROA 3F9IA 3FPFA 4Q47A 5B3JC 4L02A 2RGDA 1KSJA 1G4HA 1F3OA 1PG0A 2ZUUA 1FU7A 3KEGA 2DBRA 5L3QB 2H0AA 3HV0A 1YQGA 2BGGA 4U9IS 2ZE5A 1AXRA 1Z45A 4LYDA 1R0WA 2RFLA 1B41A 4FGZA 3EUFA 3NT2A 4M3NA 1G8AA 4ASUA 4CFSA 6REQA 3NOOA 3IDFA 1BMTA 3Q7IA 2ZPAA 2WYUA 3N7AA 1L7QA 4ZVVA 4A0GA 4GPEA 5IARA 2W71A 2WU8A 1T2VA 4OB7A 2B82A 3T7KA 1QCCA 3LGXA 1V3TA 3MQ2A 4QU8A 1OYYA 2WE7A 5IAEA 3T8YA 3GROA 2P8JA 2GXQA 4PPGA 3O0DA 1RXVA 2B1RA 4BOYA 3ETLA 5LC1A 2AG6A 2B83A 3LQQA 5JSFA 4MRSA 1XTJA 2M9MA 4MUYA 5AW1A 4ZCRA 5CD1A 3CW8X 4G6ZA 2PKEA 3VPBA 3UWMA 4R2IA 1IZ9A 3CZMA 5TJHA 2JKZA 2EW1A 1M75A 1GG9A 1Q95A 3M5PA 3OE4A 3Q8XB 4LPKA 3PPVA 4YRNA 1NQVA 2WZQA 5JQGB 3Q1LA 1YZTA 4QT4A 1T9ZA 4JU9A 4Q9AA 5K3BA 2R8PA 4BNDA 1L4KA 3R9IA 1G5PA 1WR8A 3GA7A 4EQ6A 3KSAC 2YWEA 3SX2A 1MB2A 2Z2IA 3SLKA 3ZZUA 1KXJA 4E33A 3U5ZB 1P5FA 3AO0B 1MIOB 3F3MA 3GZJA 2RHJA 1WVMA 3BCUA 1CD5A 3K96A 1H8HA 1DC4A 2Y1DA 4DLKA 5HM6A 4RA6B 3BQMB 5CB8A 3QI7A 3NNSA 4L8VA 4Z0TA 1A9ZA 2I4OA 2O23A 4BFYA 3STUA 1BJRE 1I94B 1W75A 1YOVB 2C0CA 4B4OA 2DUUA 4EG0A 5K6AA 4UU8A 4QVKA 4GMDA 1XN4A 3E4DA 4JN6B 4WZZA 3R74A 3GWZA 1LCIA 1BWSA 2NQ2C 3PUHA 1JXOA 3X3HA 1NBMD 4R9UC 2P2ZA 1FSZA 1Y1TA 2IHBA 1KP3A 2D7CA 1BE8A 3G6WA 5BWMA 1Q0ZA 4YRAA 1DPFA 3UCEA 3TZ6A 3GEMA 1PV4A 1GSHA 2VTKA 2WKPA 3U4IA 1YMUA 3UGQA 1LF5A 3GLHB 5THXA 4U2FA 1JEEA 1XBTA 3GT7A 2IS4A 4ZPXA 2ZRKA 4Q1DA 5CFOA 3K0BA 5TY0A 2VZ9A 5JNVA 1L3BA 4X6YA 2NTEA 3PQ6A 5JVDB 5JNTA 3WGGA 2NZ2A 4MS4A 4G63A 2W6ZA 3MUNA 4DA7A 2XNCA 1USKA 3OETA 4IHAA 2QX6A 4OXXA 4JT4A 1TQ8A 1Y6JA 1NR7A 1BROA 2FFJA 2FWAA 1KKUA 2H4WA 5LU8A 4DNXA 5BR1A 4NX2A 1J2JA 3R4CA 2BHLA 4GD3Q 3UTCA 2A3NA 4TPKA 1CIJA 2IHTA 3TL6A 4U2DA 1YZNA 1BDJA 3UXHA 1X7YB 1H2HA 1TM3E 4J9UE 2H8GA 4OQLA 5KNCH 2VP3A 3Q5GA 3BVPA 1UPXA 5GONF 3PENA 1TTHA 4Y9RA 4OBBA 2B34A 4IFIA 1DIGA 2ACWA 2JI8A 2FLVA 4JYCA 1JSLA 2ACVA 2B7BA 4KNWA 1VG1A 4WGFA 4ZXPA 4ARZB 2PJDA 4CQMD 5JSUA 4MVWA 1QANA 1IOLA 3NANA 5F7ZA 3PP8A 2X1LA 4MULA 2OR3A 1PVOA 1WW3A 3LXRA 4G36A 4HMOA 4TWIA 1J2RA 1SOWA 2REQA 1V4BA 2XAUA 4GF5A 4DA0A 3PRKE 5ALUA 3UUEA 3DDHA 1RJDA 1UBLS 5A9RA 4D8XA 3B1VA 3EVGA 2Q2WA 2X9LA 3PXAA 5M7EA 1DJOA 1MRNA 1U63A 1K6JA 1T0UA 2Z2YA 3X1DA 1OHHA 1RZUA 1TJ5A 1DKRA 5AK5A 1HXHA 2EKQA 5D84A 4A0FA 1VHQA 3DH0A 4B7CA 4DMLA 4ZMSA 1GCAA 2LCQA 1ZOPA 1YR9A 2ZDQA 4U8HA 3PEFA 1SU7A 1W0JD 4BPRA 4Y0VA 3AUUA 1EFUA 5D3ZA 4Y2HA 1M7BA 4Q4AA 4PZLA 1U1FA 5B58T 1QU3A 1U7ZA 1B8VA 1G7SA 5EIHA 4LZOA 3UK7A 5JC1A 1TDJA 3FTEA 2WU3A 1ORHA 3OA0A 5BXYA 3B51X 1RTTA 2VDMB 4QYSA 1N0IA 2BFNA 3CIFA 4TVBA 4KE6A 5AW3A 3VV3A 1VI5A 3OFSA 5IT9A 1M7HA 4D25A 4DSTA 2R7NA 3BXFA 3TPCA 1SCQA 3ANMA 4DZZA 4E14A 2FG5A 4NVRA 5AR1A 1MGPA 2ZI4A 3BTUA 3ONVA 5LQAA 4AY3A 2PRSA 2YJZA 3AFMA 1E7YA 3BJRA 4L3WA 3L6OO 3ZKWA 2O7SA 2QQ5A 2YFQA 3MC1A 4PLZA 1JFVA 2X0KA 1Z82A 4PPFA 3BRCA 5KS2A 4LJ4A 1KEEA 2BFCB 4BBPA 2B2XA 1V39A 1NNLA 4UDOA 5K20A 3W5CA 2H11A 3FR7A 1G5IA 2CMHA 1RWWA 1PUIA 1EH5A 1ZH0A 1MA3A 1YAHA 2CF5A 2Y27A 1QYCA 3BMQB 3BK1A 4D97A 3TZLA 4EHAA 1MJGA 4G1VA 2NV6A 2ZRFA 1BKDR 2XE4A 3O2JA 4GI1A 3V1YA 3NZEA 3LV8A 4LRSB 4GE3A 2ZS9A 3WS7A 2HLHA 4NBTA 1JHYA 1XQVA 1RPTA 3EGXB 4X9XA 1USGA 1XFAA 1C7RA 4WLVA 4GX2A 4J3FA 3W8DA 1USIA 4FK8A 2XNJA 1TRKA 2D00A 2VI5A 1U1CA 5AM5A 2Z58A 3LGAA 1M73E 2GZHA 2HA0A 4EI8A 3RIXA 4N47A 2KX7A 4ZGWA 2WWRA 3IIEA 4KHZA 5JARA 2OFOA 5GZ3A 1J5EB 1KSHA 1KKLA 2Q4DA 5G0WA 1Z7BA 5EVJA 3K09A 3PC8A 4LJAA 3IVCA 4RHFA 5I48A 4KE9A 1KERA 4JBLA 2H7XA 1GLVA 2PHZA 3TIIA 1U0NA 3UHAA 4AICA 4ZVRA 4ND1A 1KHTA 2X5JO 5E9QA 1U04A 3ROFA 5LP6F 4FDMA 4LA4A 4MKHA 2DT8A 4P2BA 5LZ2A 3KEQA 3HCRA 1Y6FA 1IHUA 3PFFA 3G8CA 2JEZA 1PJRA 1WDTA 1AGPA 2B4TO 3OP4A 3OOJA 4PGHA 4BZQA 2Z2JA 3EH1A 3F74A 3I2JA 4GX5A 1RACA 3P19A 1KVTA 4X3OA 4Y2TA 1NXWA 5DCWA 1NE7A 4DWJA 3C3MA 3CUVA 4DR5B 1HNZB 3VPSA 2JGLA 4ZYUA 2VHVA 4LZWA 4O6VA 3ICQB 4PQRA 2GYYA 4W5OA 1A82A 3AGQA 1NOIA 3K4PA 4X91A 4KDEA 2JJMA 1YS7A 1JU9A 3P0RA 1E1MA 4QECA 1F51E 1VP9A 3OFVA 3E5RA 3OY7A 5EMNA 1C50A 4FN4A 2QTRA 4YMUA 4RVNA 1WKCA 2FJUA 3Q7SA 2CLSA 4HQFA 2J3QA 4HDQB 1I9GA 3FOAA 2IZ7A 2VDWB 2Q45A 1US8A 1QJCA 2M1XA 3BKXA 4TL8A 4MA0A 4MB2A 4TL6A 3ZWXA 1AZTA 4YB8A 1YNOA 3CZ4A 1S9HA 4HYYA 3AVTA 4B6SA 4CMHA 1HRDA 3HADA 4BFTA 3KR9A 1B3BA 1B8PA 3SI7A 4CMEA 3OHSX 3LLCA 4LXGA 4DM4A 4IQGA 1ZNYA 5CDUA 2IOFK 2IV3A 3K70B 3IT1A 3I5UA 4HSEA 5FNVB 4XYMA 5LJIA 3RRJA 4DEYA 2HLPA 1EVZA 2ZBRA 4HZUB 3M7IA 4MROA 1T9GS 3VZRA 4B71A 1E1YA 3UPTA 4M1MA 2GBPA 4QSMA 3KT8A 1KJZA 1VL1A 1EPUA 1YKFA 4CM6A 2HR1A 2NTJA 4L4XA 4X20A 3G88A 3TQIA 5J1SB 2B6HA 5KNLA 4C2UA 1BE6A 4E1VA 4IICA 3LO5A 4NDNE 5IAKA 2W6NA 4CTOA 4H3KB 3CRVA 4EKYA 2FPIA 5J4HA 4DRZA 4EW2A 1G42A 4V2IA 1BE1A 2OESA 3KSRA 3LXUX 2HOQA 3TTYA 4AF7A 3QE9Y 1G9TA 2QW0X 3AUFA 4HGPA 3F6BX 1M34B 4L75A 1Y37A 3W6UA 2H1CA 4FFSA 2P7HA 1B74A 4R0NA 1Y4SA 2J0QA 1J70A 1U81A 1Z5GA 3D8BA 3I92A 5FPQA 5GONB 1GDTA 1NJ1A 2NLOA 3GDFA 4Q37A 3T94A 4EVQA 1T5BA 3NM5A 4ZT2A 1O03A 2O14A 2FKNA 5BNIA 3FPHA 4DQVA 2AFHA 1KMHA 4JQYA 3WBBA 1AKWA 1N1GA 4MV1A 3CJTA 2GXUA 3ITNA 1P5HA 1C7FA 4AS3A 2CCJA 3W1VA 4ECEA 3JYPA 1HDRA 1UBSB 2W98A 4A2WA 2WWIA 3H3JA 2ET6A 5JDCC 2DKFA 6CHYA 1QIFA 4H3VA 1ZW1A 3ZXYA 1M1YA 1P2FA 1EVJA 1MABA 3A7EA 3CRQA 4MV9A 4M1KA 2GHQA 3A37A 2J5RA 3FX2A 4J03A 4KI0A 4PC2A 4IIDA 4RAQA 2CVPA 3N39C 3KT6A 2JASA 4J0QA 1EFCA 1PL6A 3L1IA 3AUXA 1KY4A 5AKGA 3NWPA 1SB9A 1XWFA 5CLGA 5DIFA 2XCQA 3R3ZA 1YRHA 4MRMA 4DM7A 3HXOA 1Z8FA 3SX0A 1Q2XA 2I22A 3HJGA 1T5DX 2WTBA 2H08A 1ST2A 1J8VA 1RW4A 1JILA 3MINA 6Q21A 1P8AA 2I4TA 4N5DA 4IDGA 4M38A 2RAPA 5A6SB 3S2EA 1SC9A 1UC4B 4F7WA 4UCWA 2GZRA 1DAGA 1POXA 2JFUA 4B2IA 3IUYA 4TROA 3DEJA 4JELA 5LQCA 1CZLA 4RJIA 2RJ3A 4JA2A 1SFRA 2ZVDA 3AK4A 3QTLA 2J3KA 2MMGA 3DFIA 1SC1A 3PPIA 3KPYA 2G36A 1UDAA 5ITVA 1QGYA 2L17A 1GO2A 3WMEA 1Q1EA 3L4KA 4CIDA 2IUTA 1DBSA 4YC7A 2GVZC 4F6LA 1XXHA 5CLHA 1F8FA 4R16A 3TJZA 4G8CA 2FW7A 5KNDD 3CTMA 1EESA 4Q9IA 4IVNA 3PJRA 3RNLA 3KETA 2HIMA 4LCJA 1NOKA 4UCXA 4GX1A 1SQFA 4N49A 5LP6A 2ZRJA 2HK9A 2HT6A 4FYHA 4XPZA 3UG7A 4BQFA 3PA6A 3NU1A 3CRW1 3H2KA 3T5MA 5LZ4A 1S2DA 2D59A 2OKCA 2P9EA 5IHPA 1SK8A 1JW9B 1V71A 4GZMA 1X1DA 2IFTA 2FN7A 2DPMA 3FA2A 3GGDA 1MO4A 4HAYA 1QBKC 4R9SA 2CD9A 5IX8A 3HN2A 4GPIB 4PFJA 3BGWA 3QF7A 5KBYA 1SC3A 1Z17A 2IYNA 4HDAA 3EASA 1XL0A 1D7AA 3QWAA 1H4VB 2A57A 4O33A 4JP3A 4BB5A 5ALYA 1OVMA 2E18A 4MW9A 3MA0A 1N2EA 3H9CA 4J7XA 5AI0A 2GZ2A 4MSUA 2VDNB 4DLVA 4KW7A 1EB8A 4XD2A 2VJMB 5DSTA 2FZGA 2GEBA 4CCAA 5TS2A 4DDWA 4BNDB 5KNBH 1B00A 3UGTA 2DPXA 4WN3A 1E92A 1O7JA 3N76A 4B4VA 2H2IA 5LA6F 1GL9B 1B7GO 1VRCA 5ALTA 5ARDA 3W4KA 5AI6A 3U7HB 1CQJA 1GPDG 3Q98A 3WE7A 1EDBA 2H2WA 4D9HA 1ABFA 1M2KA 1SD1A 1K7EB 1EFPA 2CXQA 5AJUA 3F4KA 1GRRA 2Q4EA 1ZUHA 2YQ4A 2FFQA 1Q1NA 2YHIB 4I9UA 1XVVA 3N5CA 3ZK7A 1EK2A 1GV0A 1OROA 1O0BA 4Q1FA 5T8KA 4LZZA 2J41A 3G2IA 1A8SA 1R9JA 2VYFA 2O0JA 3N8NA 3HXKA 2CXSA 1XHEA 2LR0A 3A0UA 3DEAA 4JLOA 4BQQA