5IXYA

Lactate dehydrogenase in complex with hydroxylactam inhibitor compound 31: (2~{s})-5-(2-chlorophenyl)sulfanyl-2-(4-morpholin-4-ylphenyl)-4-oxidanyl-2-thiophen-3-yl-1,3-dihydropyridin-6-one
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cell Active Hydroxylactam Inhibitors of Human Lactate Dehydrogenase with Oral Bioavailability in Mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxireductase/oxireductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
total genus 117
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5ixyA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5ixyA02
4G2NA 4MDHA 1Q0QA 1LJ8A 4J0EA 4E2XA 3LT2A 3G17A 1BRMA 1T25A 4RL6A 5IF3A 3FN4A 1LDBA 3HFGA 2CVOA 2FHSA 2Y1CA 4HKTA 3CIFA 4O63O 5THQA 3ENKA 3WMXA 2BGLA 1WP4A 4Q39A 1B8VA 5A9RA 2RIRA 3AU8A 4E2WA 3ZH2A 3JD3A 3CTMA 1MLDA 3JYPA 4R1UA 3UCFA 1ZEMA 4L76A 2ZCVA 3W1VA 4BKRA 3PK0A 3TZHA 5TLSA 3R3JA 1M76A 4FFNA 4R9SA 4RVUA 5HTOA 1BDMA 4J90A 5ENVA 4PVCA 4DBVO 5I7EA 1SOWA 2ILTA 4FBGA 3PLNA 4IBOA 4I1IA 3N7UA 1VPDA 2I3GA 4CM1A 4K1LA 5JYDA 2Q4EA 1YBVA 2NVUB 1J0XO 4YR9A 4MVJF 4UUOA 3AOEA 4FSHA 4OXYA 4BO8A 4NJOA 3GPDG 1SO8A 2I67A 3UXYA 3WYEA 3W8DA 2DFVA 1H6CA 3QJ5A 5TX7A 3WGOA 1L7DA 5HM8A 3KM0A 3A1NA 3AM5A 4CM3A 4CQMA 1I3MA 1PX0A 5JAQA 2JFFA 1X0XA 1UXJA 1QG6A 3CH6A 2AHRA 2X5KO 3ZZNA 2FY8A 1E3WB 3GH3A 2GN4A 3PVZA 5DF1A 5EQDA 5TSDA 1B8PA 1JVSA 3V5NA 4BKUA 1JN0A 3FRJA 3CZMA 3I83A 4O1MA 3FR7A 2IZ0A 2HMVA 4ZU3A 4D45A 4YXFA 2O50A 1QYCA 5TIIA 3M2PA 3GMDA 3PYLA 3L9XA 2VYNA 2QZ9A 4QUKA 4C7JA 3ZU5A 3RJ9A 1IPFA 4FFLA 4XGKA 1O9BA 5FYDA 4N5NA 1I30A 4OQZA 4W9NC 2H63A 3KETA 4GSLA 4OSPA 1OC2A 4J9VA 4MKXA 3VPFA 1ZK1A 2ZTVA 4JBIA 4XQGA 3IKTA 4E5NA 3B20A 3BTVA 2C20A 4P4LA 3ZWNA 4E33A 2HAEA 1PS9A 4XRRA 2HCTA 1NNUA 3KSZO 1J6UA 2Y1EA 4MOWA 2IZZA 3ITKA 1UDAA 1M6HA 3DHNA 2QG4A 5TF4A 2CNBA 2ZYDA 5A9TA 1T2CA 1TB4A 2HDHA 2Z5LA 3OIDA 3P19A 4BO5A 2AQKA 4FW8A 2HK7A 1DC3A 3U3XA 5DN9A 4E31A 1LSSA 4YVFA 2P91A 1XR3A 4F46A 5IJZA 1WMBA 4RGBA 2O2YA 1BXGA 1GUFA 3EY4A 4YAGA 2CMDA 4A10A 3GNTA 4YEDA 3U9LA 2X9NA 3BYZA 4DTIA 3C7DB 3KTDA 1KEUA 3HSKA 4QX6A 5I7FA 2D1YA 4CM8A 5KJ1A 3JQ9A 1NR7A 1F14A 1QLJA 4WLNA 2HU2A 2IXBA 1PJQA 3DWFA 1WW8A 2G82A 4YYZA 4DPKA 1LDEA 2F1KA 5B4VA 1GYRA 2OO5A 2CF5A 1U3WA 3JQAD 5B1YA 3PHLA 3WQQA 1T24A 3I4CA 5COQA 4HBGA 1V6AA 3GG9A 2DBVO 5A05A 5ILGA 4PG8A 3I9MA 3UICA 2B36A 1ZH8A 2BELA 4F6LA 5A3JA 5KCZA 3HNPA 1R6DA 1Y5RA 1QXSA 3H5NA 3LK7A 2O3RA 1EQ2A 1C1DB 3ITDA 3LVFO 3ROPA 4E13A 1T2DA 5BR7A 2QRJA 3ZDFA 3INRA 4YDRA 4G65A 3DFUA 2AEMA 5G2OA 3GRKA 4NR0A 3X2FA 1DJQA 2X23A 1JWBB 3RKUA 3W4KA 3WGTA 1UDBA 5KJCA 5F5NA 4EUHA 4EYEA 3DBRA 3UCXA 3Q2IA 2XOXA 4GSKA 1U3UA 1V3TA 1ZJZA 5GZ6A 4Q3AA 5L53A 2B83A 2GZ2A 1Z75A 3PYXA 3QWFA 3ZWMA 4U5QA 5EJ2A 4DLLA 3GVCA 3V2HA 1CQIA 3FR8A 1ORRA 5CDSA 4BNZA 1PGOA 1YOVA 4QFCA 1N9GA 1PJTA 1EE9A 1ZCJA 2E37A 1U3VA 4GX5A 4ROSA 2R00C 1U8FO 3RSHA 1NFRA 4II2A 3PZBA 1IZ0A 3TN7A 2TMGA 3L4BC 2H9IA 2EJVA 4CV3A 3OH8A 3QSGA 5DP2A 2VWQA 1QKIA 2YW9A 3E48A 3C7CB 3I23A 3MEQA 4L75A 4YJHA 1YB1A 4MVJH 2XXBA 3U0BA 3HG7A 2C29D 3EUWA 3N74A 4Z0HO 2DKNA 4XJTA 2FP4A 1TEHA 1NPYA 3NTQA 1NVTA 3ROQA 1UH5A 3D3EA 1SNYA 4A2CA 3QVOA 4CMIA 2C82A 4OXNA 1H2HA 4E2ZA 2PFGA 3HZZA 4ID9A 4B79A 4A0SA 4J4HA 3DONA 4JIGA 3QWAA 2Y67A 2HLPA 4ZJUA 1GQYA 2VUUA 3VTZA 3PPIA 4I5DA 4PN3A 1Z73A 3I1JA 4JBGA 3O4RA 3SC6A 3ZV3A 4BNGA 4NNJA 4DREA 1IL0A 1AHHA 2VNAA 1PGPA 4M87A 1WWKA 4AJHA 4E4YA 1ZSYA 1DSSG 5JCJD 5JPIA 1B15A 4CL3A 4DIBA 4Q3EA 2DC1A 2EERA 1F12A 1P1HA 3JYNA 3GY0A 5JC8A 3VC7A 2CD9A 4JJFA 3ZV6A 4YBZA 9LDBA 4TRMA 1DC6A 2WMDA 3LT4A 3OBBA 4L9RA 4HUJA 3VOSA 3WB9A 3ON5A 5LCXA 1VM6A 2I66A 3BMNA 4FJ2A 4Q3BA 1UXIA 4ZQEA 4G81A 4PFJA 4RQUA 1JDJA 3E5RA 4YA6A 4CMIB 3BMCA 4RZIA 3TDKA 1PS0A 1YL7A 5H83A 3BMOA 5A02A 1RWBA 3ROKA 2ET6A 2IE0A 4B3JA 4AJLA 1ZK0A 5KJEA 4BOYA 1DJNA 4XYMA 1CERA 5A4DA 3UW3A 3VKVA 2OBYA 3RFTA 2HMWA 2GERA 3SX2A 3U4DA 4ONEA 5EPOA 1E6WA 2PH5A 4A27A 4W82A 4CQLA 3STHA 3NDRA 3L4BA 4DYDA 3I9NA 3PZRA 4GX0A 4KUHA 1GFSA 4Q9NA 3PJGA 1UZMA 1RM5A 4P22A 1N8KA 2D8AA 3A4VA 3BZUA 1UP7A 2WE8A 5ER6A 3LQFA 3JQ8A 3OJEA 3E9QA 1OBFO 1V35A 3P7MA 1PU2A 4K28A 1ISJA 4BO7A 4NK5A 4DGSA 1GPDG 2Y1OA 4GMFA 5EQFA 4O0LA 4PRLA 3RU7A 3OSUA 5ER9A 4EJ6A 2BGMA 3R0IA 3U5TA 1ADFA 4UVGA 1SMKA 2Q1UA 5B4UA 3M1AA 4GVLA 1IHXA 3I9JA 9LDTA 1QYWA 3BMCB 3MJCA 2YHIB 2WWRA 3LC7O 2J5QA 4PZCA 5TRTA 1ZZEA 1GY8A 3CINA 4MIOA 4B7UA 3GDOA 4WCFC 3K30A 4IJWA 1XQ1A 1I8TA 2GDZA 5JDIA 4BNTA 2QX7A 1R12A 2Q2VA 3O8QB 4BMVA 1MC4A 2PY6A 5H82A 5BSFA 1RM3A 4L73A 4OXKA 3HADA 4IQGA 2IDZA 2CUKA 4NFSA 4BO1A 3K5PA 5IAAA 2JCVA 4CQLB 5DULA 2C0CA 5KJFA 1JAXA 4TRNA 4WECA 3TZCA 5ICMA 2HJRA 3B70A 2Q3EA 1ID1A 4BNLA 4WGGA 1DEHA 4HNGA 4TMFA 1KYQA 4ND5A 4WOKA 4NU6A 3NT4A 4CMHA 5L9AA 1EUZA 2AXQA 1HE3A 4EEXA 1BXKA 5HWSA 3KLPX 3OA2A 1DC4A 3WLFA 1B0AA 1PZFA 1T4BA 3GR6A 1K6XA 2NTVA 2DTDA 1BVUA 1AXEA 1ISFA 4JN6B 4U6SA 2NM0A 1CJCA 1E92A 4F6CA 4J7UA 1I10A 5A9SB 1R4MA 2VRCD 2AQIA 2DM6A 5IDWA 1GADO 2G1UA 3QWHA 2VUSA 2GGSA 2WD7B 4E5PA 3LSYA 3NGLA 3DXFA 4BKPA 5JY6A 4PLHA 3ZHZA 1AUPA 4CMJA 3IJRA 5I7VA 4RPHA 4CV2A 3GG2A 1LLUA 4ZQHA 1PS8A 4C4OA 1HDXA 4IMPA 2R00A 4N7RA 5CDUA 5JDIC 3DMTA 1MC5A 4YAIA 2DAPA 4ALIA 2Q1TA 3BTOA 1E5LA 5CG2A 2X0JA 5CHEA 1EUDA 1G6KA 3T4XA 4GX2A 4OQYA 1A5ZA 4F45A 3VZRA 5BT9A 4CR6A 4M89A 4DWVA 3ADPA 2BFOA 1EBFA 2O3UA 4KTVE 5CPFA 2E6UX 1YL5A 3ETEA 4B8WA 1J5PA 3WTCA 4N5MA 2FSSA 4UULA 1ULSA 4R5HA 4HY3A 3N58A 4RF4A 3JTMA 3GNSA 5K6AC 2WE7A 4AJOA 4RF2A 5ICSA 1H6AA 4B4VA 3U4HA 4KWHA 2FWMX 1P3DA 4UAGA 4BVAA 3ZWVA 4MKZA 2X0IA 1K5HA 2A35A 5CAEA 1GCUA 1IPEA 3WWYA 2X22A 2IEBA 5K0ZA 5DBGA 2WD8A 2AE1A 3E03A 1B7GO 2Q50A 3M1LA 3M2TA 3VH1A 1RYEA 4RLHA 4YB8A 1MP0A 5L95A 3E6AA 4LW8A 1MX3A 3ETGA 3BA1A 4GGPA 4IUYA 2EKLA 4CM5A 5ITVA 3QV1A 1G0NA 4E21A 3HDJA 2YFHA 4ALLA 4IPTA 2HUNA 3LT0A 3PHHA 2W2KA 4WJZA 5AVOA 4CLRA 1B14A 1W73A 3IC5A 4XX0A 1JLLA 3AW9A 4J3FA 4RDIA 2ZJ1A 1NVGA 2EV9A 5B12A 4INAA 2HK8A 3OMLA 3VAZA 2YHUA 1PL7A 1R16A 2CFCA 4EBFA 2QZZA 3QE3A 1A27A 1EVYA 3BXXA 4BNUA 2DBRA 4BO3A 2BFMA 1ARZA 2NVBA 3IUSA 1NYTA 4CMCA 1WDLA 4XB2A 2DQ4A 3NT2A 1A7KA 4JXKA 4UEOA 2DT5A 1DHRA 4PRKA 3TQHA 1GZ6A 1X1TA 1XWFA 4MVJI 1EQUA 1PSDA 1LXCA 4N18A 5AQ1A 1GUZA 3UCEA 3ANLA 4BB5A 3QA9A 4MVJM 5KVCA 4EGFA 5B37A 3SJ7A 1F06A 2IODA 4A03A 3GMSA 4CUKA 1YBMA 1H93A 5HS4A 2VQ3A 4D0RA 4DXHA 2VRBA 5F21A 3EMKA 5JC1A 1ZEJA 4CPDA 2GN8A 3KRTA 3TRIA 1P1FA 1NQOA 1R0LA 3WDSA 2B69A 3MWEB 3K6JA 3OHSX 3WQSB 4OIMA 2YJZA 1GTMA 3TZ6A 5BNTA 1GEGA 3WSVA 3RIHA 5C7LO 3DL2A 4WEOA 3GFBA 2SCUA 6ADHA 4E2YA 4MKRA 2HKIA 2Y1GA 5IDYA 3GEDA 4BL5A 3C24A 4XQCA 1MG0A 1Y81A 2DLDA 4D79A 1Z74A 3CMMA 2ZYGA 3QWBA 1HDGO 3R1IA 1YB5A 1VL8A 1DRVA 4CLOA 2IEDA 4Z9YA 5JE8A 1FDVA 3PHGA 3QY9A 4PLFA 1ZK4A 1UP4A 2JFHA 1HWYA 1V3VA 2NNLD 2HO5A 3DZJA 1I2CA 4GKVA 3H3JA 3AUTA 3Q9UA 4AG3A 5T8KC 3SXPA 4RQTA 2ZB7A 4J1TA 4CV0A 3K8ZA 4DYVA 1LA2A 5F1KA 3CZRA 1QV7A 3OP4A 3QVSA 3DOCA 2D59A 1LTHR 3PJEA 4BMNA 2YV2A 3HJAA 5HBRA 4GPD1 4AJ1A 3EAGA 1T26A 4K26A 3UOGA 3TZQA 2DUWA 5CPBA 2GNAA 3H8VA 3D0OA 3RCBA 4DMMA 3OF2A 3K96A 1I2BA 5JLAA 4IJUA 4PLGA 3PYMA 1HSOA 1B26A 4H7PA 4RORA 2OL4A 3M6IA 1PJ3A 4D41A 3WGZA 2UVDA 3ZWYA 5EL0A 1K6JA 2VWGA 4XDYA 1X13A 3ONDA 2DBZA 1PJLA 1Z45A 2HRZA 3FWNA 2YQ5A 2BMAA 1A9YA 3BHMA 3TWOA 2OOSA 3UF0A 1XKQA 2FPGA 1NPDA 2X1HA 2P4HX 3KO8A 3JV7A 4XYBA 1O95A 4BO6A 1VRWA 1DOHA 1PJCA 3RC7A 1IZ9A 4CMBA 5L45A 2W90A 3K73O 4X54A 4BNYA 2ZTLA 3L9WA 2QW8A 1E7WA 1P31A 3KHUA 4FJ1A 4PLPA 5T5QA 2Y68A 5TGDA 1V9LA 1Z7BA 1PR9A 3GK3A 4GAEA 1CRWG 4XR4A 1ONPA 1AXGA 3PQEA 2Y05A 3C85A 4TWRA 2NU7A 3E5MA 3F4LA 3S2GA 2QRKA 4CM6A 2EP5A 3H5RA 1CETA 4FOSA 4RVGA 4YJGB 3WNQA 4AJPA 3OETA 3AM4A 4QO7A 1BXGB 1X14A 4DBZA 3F6YA 1I24A 3H65A 3PQDA 4MIEA 1TA4A 1WXDA 1C0KA 5JXWA 3FBTA 3DBLB 2IYPA 3JYLA 4E5MA 3ROMA 4DLBA 2NU6A 2Q2QA 1HE4A 3K31A 3K2BA 3PJDA 5L4NA 2RHRA 3WBFA 3B1FA 4YT8A 1LBEA 2RH8A 5CFZA 3PLRA 1RJWA 2O4CA 4GKBA 4N5LA 2Q49A 3ANNA 3GUYA 3IOYA 1Q1NA 1DFHA 3VPXA 5CP8A 4ZRMA 1ISHA 1HT0A 2B0JA 2BFPA 3PDUA 4XWYA 3G1TA 4AJNA 3DEYX 1NASA 4B4WA 4KQXA 1OC4A 3EK2A 3OJFA 1Z7EA 2PH3A 2C07A 3I5MA 1H9AA 4MVJD 5HS6A 1BMDA 3RUHA 2PWZA 1LC3A 1DPGA 1QMGA 1YJ8A 4ND2A 3KZVA 2VOEA 4U6QA 1MUUA 2BFAA 3ZWOA 3RQSA 1Q7BA 4NZ9A 1YQGA 1YWGO 2A4KA 2BHLA 4QO8A 1EVZA 3FWZA 3RUFA 4I08A 1DHTA 2NTNA 1HTBA 2NSDA 1Y5MA 3AM3A 4PZEA 4PVDA 3TZKA 1G0OA 1N7GA 3EVNA 2FN7A 3D5QA 4R9RA 4YAKA 5GZ3A 4TZTA 5TNXA 4FFMA 3WFJA 1M6WA 3WLEA 4YRBA 5I9MA 3AJRA 4NIMA 4ALKA 2C2YA 4E0BA 5G0UA 3CEAA 3JQ9C 4Y9DA 3L0DA 2Q99A 3WNVA 3ZHXA 3RC9A 1VI2A 1YL6A 4HFRA 1Y1PA 1WZIA 1HE5A 3O03A 4BHTA 4DPLA 4ZQBA 3OICA 1ENZA 3IUPA 1SB9A 1DO8A 1XSEA 1N9GB 5C5IA 1Y9EA 1N5DA 3DZHA 2UV8A 3QQPA 4XDZA 4YJFA 1DIAA 1F17A 4IJVA 3D5TA 7MDHA 1JWAB 5BNIA 1LDGA 1ENYA 3V1YA 2G76A 4LVCA 5TC4A 4FFOA 1PJ4A 3NEPX 3Q0EA 3KYDA 4ZQGA 1P0CA 5CEEA 1E6EA 2O23A 1HRDA 3I4FA 4D3SA 1E1MA 3E82A 2HJSA 2V7PA 4JK3A 5JAIA 4XIYA 2HK9A 3OECA 1ZMTA 2D2IA 5L7YA 3KUXA 3LU1A 2J3KA 2JAHA 2PTGA 3SLKA 1TT7A 1FDSA 5H81A 3NAQA 3EDMA 1M66A 4NBVA 5KNLA 4WASA 1AHIA 3ICPA 4WLFA 4BB6A 1N92A 4RPLA 3ZWAA 1HLPA 1ZSVA 4R1TA 1KEVA 5L51A 1HSZA 5KVVA 3ZNPA 3MCVA 4DC1A 1TVEA 2YUTA 3DMTC 3F3SA 2YDXA 4XR9A 3WGHA 1LSJA 2P5YA 5C7IO 2YV3A 1W8DA 3FNEA 3DBHA 4EDFA 2OORA 1P0FA 2Q4BA 4FJ0A 3CXRA 5IZCC 1GYQA 1OZAA 4LISA 1E7SA 4IS2A 4IXTA 1GR0A 1O6ZA 3DZIA 4W4TA 3DOJA 2BGKA 4R4JA 4DIFA 2YV1A 1NM5A 2HSDA 3I52A 4PLZA 5FI5A 5LDHA 4WOJA 3H4VA 4IY1A 1GEEA 1X7GA 3RI3A 4NU5A 2P9CA 3VVBA 4BO9A 2X5JO 2X0NA 4FFRA 1FDWA 4UEJA 4BGIA 3GNQA 1LRKA 4Z9XA 2GSDA 4RF5A 1PQUA 4DLAA 3WIDA 4UVDA 4M54A 4UREA 5EERA 4ZGWA 2ZQYA 5JS6A 2ZJ0A 2EWMA 1MFZA 1U4SA 4JP2A 1H5QA 3L07A 3PI7A 1KY5A 1GU7A 5KKAA 1PR3A 1DRUA 1HZJA 2YZ7A 5A3VA 2HMSA 2EXXA 2C2XA 2G0TA 5AOVA 4OL9A 3BTSA 3LLSA 3SC4A 4CR8A 5ENDA 1YOVB 1LDNA 2VYVD 2XAAA 5LC1A 4MVJG 4EZBA 4J1QA 3D4OA 1D3AA 4D46A 1U5AA 4L4RA 4J4TA 2C59A 2A94A 4OHUA 3ZNQA 4U8GA 1XELA 2EKQA 4RPGA 4LCEA 1TXGA 3D4NA 5ILOA 5THKA 3BTUA 3GT0A 1IUKA 2Y0CA 2RAFA 2EGGA 1EBUA 1O94A 3U49A 4IDAA 3WYBA 2X5OA 4IDBA 3ZWXA 2O3SA 4TKLA 1P1IA 2LDBA 1KY4A 3OQ1A 1Q7CA 2E49A 3JSAA 4CMAA 1PJ2A 1NR1A 3JD0A 3D3WB 2PLAA 5GMOA 5JO0A 2ZYAA 1P1RA 5CDTA 2FMUA 4LRTB 5BNFA 4KWIA 4B4OA 3I3OA 3S2FA 3UAGA 4BGUA 2B37A 4K9DA 2PKRA 4QFDA 5TS3A 3Q6IA 1GD1O 3KYBA 2Y66A 4YTEA 5IDXA 3C3XA 4YRDA 3QP9A 1GQ2A 2YDYA 3ZWCA 4ZRNA 4XGNA 2XF8A 4MINA 3I6QA 2PR2A 4CLHA 1OI7A 2I76A 1X7DA 2O7SA 1P1KA 4JGBA 3ZU3A 3JYQA 3G49A 3FPLA 3GVHA 2P5UA 3GAZA 3LC1O 2PGJA 4PG7A 4KQWA 2D5CA 1BW9A 3AY6A 1BGVA 4R1NA 4PG5A 3WWZA 4GGOA 3E9MA 4P4GA 5DCYA 4TROA 3MJTA 4OAQA 1GCOA 5COAA 1PJBA 3T7CA 1E7QA 3NV9A 2EF1A 4L4SA 3AI3A 4ND3A 1S6YA 4D44A 1A72A 3HWRA 1HYHA 2P68A 2QYSA 1QV6A 1VKNA 5DZSA 4IDFA 5TJ9A 3RUDA 4CMKA 1H6DA 3FTNA 1B3BA 1U28A 4LCJA 3D3WA 1RPNA 1SC6A 1UJMA 3NDJA 3JQAA 1KBZA 1Q2XA 4BV8A 4NBWA 1JW9B 1JQBA 3RU9A 3RBVA 1KIFA 3LLVA 1A71A 4YACA 3H5AA 5DOZA 5FI3A 2H5LA 5A9SA 3P2OA 4XD2A 3TSCA 4YWJA 3Q9NA 2P4QA 3G1UA 1NQAO 1R66A 3L6OO 4R54A 1XYGA 2WD7A 3H2SA 3QW2A 5IG2A 1E7MA 1XLTA 3VDQA 1PZGA 1E3IA 3S8MA 4FOOA 2PZMA 4BIIA 3F47A 1U3TA 5I8ZA 3L6EA 2Q2WA 3MJVA 1Q0HA 1IE3A 1K89A 4A5OA 4EUEA 4XGIA 5G4KB 3WTBA 3GUCA 3DR3A 2D5AA 2GZ1A 3A28A 5EINA 1EK6A 4MVJP 1ADGA 1LQUA 3KV3O 1VL6A 2G5CA 1LEHA 4H15A 4II3A 3UUWA 1T4DA 5KVSA 3KSUA 1ENPA 2VHXA 2UUOA 2V6MA 1NTOA 1ZBQA 4Y6PA 2WYUA 3MTGA 1ML3A 1QYDA 3ZU4A 1JKFA 3AY7A 3JYOA 5FF9A 3I6IA 5F5LA 1NPTO 4NG5A 3L6DA 2YHIA 4KOAA 4FCCA 3OJ0A 3DFZA 4J1NA 4MO2A 2Y99A 4H16A 3A9WA 3GGGA 4W7IA 3VPHA 4ZICA 4DC0A 3O8QA 1IOLA 2PD6A 1MXFA 5BQFA 3VVCA 2AEJA 2B35A 1QRRA 3PHIA 2C7GA 2WJPA 4YAEA 5U4QA 1O8CA 4NHEA 3DTYA 3S2EA 4LRSB 1PGQA 1NWCA 2J3JA 3QHAA 4BO2A 1SEVA 2I6TA 2G17A 3ETDA 3FNHA 4GWKA 2EHDA 2AW5A 3GFGA 4IJKA 3TPCA 2EP7A 2YQ4A 4LN1A 4KMSA 3UGKA 4A73A 5FWNA 3H9EO 4PG4A 2O48X 4Z0PA 1AGNA 5G0TA 2VT3A 1WMAA 1DIGA 2CDBA 2VNSA 1YE3A 2UDPA 4LVUA 1GV1A 2AE2A 4BQRA 4DPMA 3VDRA 3U09A 1R4NA 1XG5A 4H3VA 1VL0A 1VJ1A 2W2LD 1ZNQO 4HFJA 4CM9A 3ICCA 1T1SA 1Y8RA 3H2ZA 5U9CA 2GZ3A 3WGGA 3IP3A 1GL3A 1P44A 2VCYA 2GASA 3QVXA 3OFSA 3WBBA 1HKUA 3ZNNA 1E5QA 2POQX 3ASVA 2D4AA 4M8SA 2FOIA 2HRBA 3NX4A 3H9UA 5JAMA 1NAIA 3MOIA 1PQWA 2ZATA 2ZB3A 3X2EA 3CSDA 4IS3A 5A04A 1L7EA 1GQQA 2VZ0A 3IP1A 4JX8A 4L4XA 4RVFA 3W4IA 4CL8A 4QT0A 4IIVA 4B7CA 3W4JA 3GPIA 4AICA 3UN1A 1NHWA 1DDOA 1K6IA 3NJ8A 3BAZA 3CE6A 3L77A 5TQVA 3JQ7A 4OO3A 4WKGA 4N54A 5MDHA 4TSKA 5HA5A 4RDHA 4HFMA 3BMNB 3ADOA 4IGFA 4GLLA 3ST7A 5IFLA 1I2ZA 3VZQA 3DZBA 5J23A 4QSMA 1ONOA 3DDNA 2X4GA 1OFGA 2D0IA 2GR9A 3G3EA 3OQ6A 1ADCA 2WDZA 2J6IA 4CQMD 2GF2A 4K6CA 2FR1A 3TFQA 4ALMA 3GVXA 1DBVO 3GZNA 2JCYA 1Y6JA 4YT4A 2ZK7A 2GCGA 3HFSA 4CLOB 2DU8A 3QLJA 3KB6A 1DLIA 1JAYA 1MV8A 4FGSA 4L8VA 4MIYA 1SB8A 1HYEA 4Z6KA 1BG6A 4GBJA 1UR5A 2AQ8A 3H6KA 4KZPA 3NTOA 5JW6A 3D64A 4I5EA 3W8FA 1BVRA 1E7RA 1T2AA 1SCUA 4UVEA 5JAZA 1GV0A 4XEHA 2AG8A 2VYVA 3Q1LA 4M55A 1ZXLA 1EFKA 4E6PA 3JQ8B 1JA9A 4NFYA 2CDCA 2O3JA 1Y9AA 5T64A 3WGYA 1OAAA 3VKUA 1IYZA 3U4IA 3ORFA 2W2KB 8LDHA 2JD0A 3D4PA 3GGOA 4CLRB 3MJEA 4FPXA 4EW6A 2JL1A 2NVWA 2O4UX 2R2GA 1SAYA 2H6EA 1A4UA 1UAGA 3R6DA 5L7WA 3ZHBA 1LI4A 1Q0LA 1C3VA 3VZSA 5A06A 1X15A 2VN8A 2E48A 1S7CA 3F5SA 4R51A 1VLLA 1IB6A 1C0IA 3V2GA 3BMQA 2J3HA 4XIJA 1KETA 3C1TA 4W6ZA 5EESA 1Y7TA 1KVRA 5JMPA 3JQFC 2ZQZA 1KOLA 1JKJA 2W2LA 2CZCA 3O38A 1ZMOA 3VPSA 3E1KA 4DUPA 1YH3A 4E5YA 2C54A 3ABIA 4R5MA 2AMFA 4IM7A 1HE2A 2CVZA 3C1AA 2VT2A 2WTBA 4TZKA 2CY0A 3GDGA 4R01A 1NBOA 4MPDA 4Z0TA 4JNKA 4Y6SA 5G0VA 1I0ZA 4IDEA 4CLXA 3UVEA 4FS3A 2NADA 5G4LA 4QTZA 4HNHA 5G0WA 1PGNA 3AK4A 2I5PO 1HETA 2PGLA 4CQMB 4R68A 5AYVA 3W6UA 2UYYA 4BNNA 3GEMA 5IXYA 5GY7A 4WUVA 5IDQA 4RJTA 1PJSA 4IQ0A 1E3WA 4JROA 3RROA 4RF3A 3PIDA 1DIHA 2E82A 2NLOA 3OIGA 4WCFA 2VZ8A 5KVQA 2V6BA 3AOGA 2NU9A 4DA9A 4UUMA 4AVYA 1I5RA 1NFFA 1XCBA 2W4QA 5IZCA 1PZEA 3AUSA 3RFXA 2RBEA 2O3QA 5TT0A 4JJIA 3CUKA 5CG1A 1N7HA 3BMQB 3DQPA 5DCUA 1ULUA 3P2YA 4CUJA 4NDNE 4HX5A 1X7HA 1UAYA 1XDWA 1LC0A 4DMLA 4LMPA 4R16A 4U0KA 4CV1A 1JU9A 1O5IA 3ZWPA 2GUGA 2EKPA 3U62A 1R37A 2GLXA 5JBIA 2GN9A 4XJSA 3ZW8A 3OA0A 4AJEA 3B6ZA 1P33A 1ZJYA 3MOGA 4LSMA 1UXKA 2BKAA 4UUNA 4UVHA 5KKCA 1CDOA 2V6FA 1DB3A 2EW8A 2OFPA 2JJYA 3LC2O 4NI5A 3EVTA 5MGBA 4ZHSA 3OEYA 4R69A 1P9LA 4JQCA 1D8AA 1QYXA 3KYCA 4CM4A 2YFQA 5JO9A 2IZ1A 2J5RA 1EFLA 1CWUA 5EN4A 2BI7A 2NTJA 1BTOA 1DC5A 4HWKA 4IZIA 4AL4A 3PJFA 1NVMB 1H2BA 5AXAA 1XA0A 3K2EA 2PNFA 3GOHA 3GHHA 3RWBA 4B4UA 2RHCA 4IQ8A 1YDEA 2WYWA 1H6BA 2RH4A 4I5FA 1HXHA 1KVUA 2C5EA 3CPSA 1ZFNA 5COBA 4GVXA 4L0QA 3NRCA 4P8RA 3DOOA 3ONEA 2B4QA 1YB4A 3D7LA 1FF9A 4WE3A 4BNIA 5JDCA 1ISGA 3NGXA 1NHGA 2DTEA 2I99A 1X0VA 5FEUA 5JY1A 2OHXA 4GH5A 2CDAA 2ZB8A 4FGWA 3T4EA 4ALJA 4WLUA 1EZ4A 1J49A 3GRPA 2PZKA 4B8ZA 1H94A 2EIHA 3AU9A 3PP8A 1PL6A 4M49A 4B7XA 4NBRA 4AJ2A 3VH3A 2OUIA 2DBQA 3EGOA 2J3IA 3NJ4A 1A4IA 4PZDA 1N1EA 3PRJA 3KLMX 2DUUA 4J9UE 4KUGA 3VTFA 3ZHYA 4CMEA 4EITA 4CM7A 3KBOA 4I9HA 3A06A 1KVSA 1W4ZA 1YQDA 1TI7A 4GLOA 2Z1NA 2B4RO 4J7CA 5KIAA 1QSGA 1YQXA 2PKQO 1B8UA 3ZWWA 4FR5A 3COSA 1D1TA 1E6UA 1DIRA 4BMSA 3B1JA 2LDXA 1CYDA 2HMTA 1ZIDA 1EK5A 1Z6ZA 4NBTA 2FZEA 1GZ4A 2NACA 1KC3A 4WLOA 4E3ZA 2BI8A 1NQ5A 1YGYA 3RD5A 1GUYA 4NJMB 3GDFA 3EZYA 1ZKMA 4WNCA 5C7OO 2FPIA 1C0LA 4JBHA 3ZU2A 4BNXA 1QYVA 1RYDA 1WDKA 3HDHA 1MA0A 1P45A 4FN4A 3RC2A 1PTJA 1ZSNA 4JJGA 2I9PA 3EZLA 4FIZA 2FPPA 3QVWA 1EVIA 1YKFA 3DZGA 3QIVA 4HV4A 3GZ4A 5T67A 5T57A 3GN2A 2VTDA 5JYEA 3FHLA 1LX6A 2JCXA 2PV7A 1EUCA 1EVJA 3RUCA 1NQTA 1T2EA 1A9ZA 4ZN6A 4Y98A 1HYGA 1DLJA 3V1UA 1EMDA 1F8FA 4BNFA 3WGQA 4OOEA 5I7SA 4QXMA 4KUEA 1UZNA 3NYWA 1E1NA 1LDMA 1UXHA 2XPCA 3GAFA 3ENNA 6LDHA 5C37A 3SEFA 3F4BA 3HHPA 4RZHA 3RC1A 1SBYA 3RASA 3P5SA 5IXSA 1NWHA 4TVOA 3TFOA 3LYLA 3ZN2A 3FCOA 4HFNA 4AJJA 2X7HA 4EJ0A 5JMWA 3FPCA 4DL9A 1LQTA 3JCZA 5G0SA 4IMRA 1K0UA 1U2DA 4RLSA 1ZXBA 4J2OA 8ADHA 4BNVA 1G1AA 4NJMA 2VYND 5IN4A 4I9UA 3GA0A 1NP3A 4Z9FA 2F00A 3TL2A 3WJ7A 2JKVA 3FI9A 3HB5X 4FC6A 1WLYA 2GD1O 4PLCA 1OOEA 1KEPA 3RJ5A 1GAEO 2Q1WA 3KYDB 1O89A 3INGA 2GN6A 2QHXA 2EW2A 4I5GA 4GI2A 3DHEA 4XKJA 4BNJA 3GGPA 5JNLA 2TMDA 4Z3KA 1M2WA 1UP6A 1QLHA 4OSOA 4BNKA 1LSUA 1VE9A 3JQGB 3OEWA 4CMGA 1Q7GA 4FD3A 3PTZA 4ZD6A 1DAPA 1FK8A 3BMOB 2WSBA 1GYPA 2OZPA 2B5WA 3WYCA 1XEAA 3HE3A 1E1KA 1V3UA 2NQ8A 2Y1FA 4XYGA 4WPGA 3B1KA 3IDSA 3R3SA 1T1RA 4ESOA 3C7AA 2J8ZA 5IZ4A 3S55A 2NVUA 5T8KA 1GPJA 4IZHA 1U2GA 1Y8QA 1WVGA 5BSGA 1EDOA 1IHYA 1NXQA 4WLEA 4YQZA 1V0JA 2A92A 3PXXA 3H3FA 3L4SO 1DXYA 3GF4A 3K9QO 2Q45A 1C1DA 1GDHA 3PEFA 4D42A 4NPCA 3Q3CA 3IJPA 2GRAA 1C0PA 3BHJA 4KDFA 2JHGA 3KVOA 3O9ZA 4YT2A 2JD2A 2A9FA 5DCWA 2DTXA 3WQRA 1TT5A 3Q11A 2EG9A 4ILKA 4D0SA 3ZCXA 4PIVA 4Q3CA 3DBRB 1R15A 3MTJA 3JQGA 4Y67A 4P4NA 1P1JA 1YJQA 4D3FA 1M67A 3H9GA 1RKXA 1MG5A 3ZW9A 1ISMA 1HDRA 1D4FA 4O5OA 3KSDO 2DPHA 2AA3A 2X8LA 5KJ6A 3AFMA 1NAHA 1SOVA 3GLQA 4S3MA 5LDGA 4DIOA 2ZTMA 4OYRA 4TVBA 1OMOA 3QWIA 4GWGA 2PZJA 2VHWA 3I9OA 1YBAA 3PWKA 1LNQA 2HQ1A 4UVIA 4R3WA 1UXGA 4RPKA 3GQVA 5L40A 3FBGA 3WXBA 4D43A 2B5VA 3F5QA 4J7XA 3PIIA 3PGJA 1Y8QB 2V6GA 3GHYA 4ND1A 3DTTA 3JQEA 4W9NA 1HZZA 1VSUA 4YJHB 3GC6A 3DB2A 4B3HA 1YO6A 2Q1SA 2VOJA 3JQBC 3T7EA 5G4KA 3IS3A 4PGFA 4IXWA 3E8XA 1HEUA 1LDYA 1U7HA 4YT5A 3VHRA 3JQDA 2BRUA 4MVJA 1MGOA 3RBXA 1TT5B 4BGVA 2VWPA 5F1PA 5HRUA 1EE2A 1GZ3A 1HLDA 2WYVA 4QECA 3ULKA 1KC1A 5ADHA 3VPGA 2R6JA 1U8XX 4CODB 2ZTUA 2H1SA 4J0FA 5F1OA 3TL3A 3ZGYA 2UAGA 3AUUA 4CM8B 5DT9A 3U4CA 3W6ZA 5I9LA 5TJHA 3SJUA 4DQUA 4BGEA 5BSEA 4ALNA 4XZ3A 1IULA 2BF7A 2NQTA 2CVQA 2NUAA 3AOEC 3EYWA 1HDYA 5AXDA 4FQ8A 4E32A 3PWZA 4QQRA 4XQ9A 2FSVA 4YJFB 3TOXA 4AJ4A 3JQFA 4WLVA 4J6FA 2I3AA 1XU9A 3LF2A 3SBOA 5KTKA 4L74A 3JQ6A 1K2WA 3OJLA 4ZA2A 1QP8A 1WAMA 4XCVA 2X9GA 3RUIA 1JKIA 3AFNA 2V65A 1XIVA 2VHVA 5B4TA 1BW9B 5K9ZA 3RAJA 2PD4A 1PIWA 1U9JA 3V8BA 3ZNOA 3BIOA 1FMCA 3K92A 1B3RA 3PWSA 1Z82A 4XB1A 3HN7A 3ANMA 3DZFA 2PD3A 3KEQA 5KWEA 1R0SA 1I36A 1UDCA 4NBUA 1BSVA 4NQZA 4O6VA 2O2SA 3KOUA 4PLVA 1C1XA 1CIVA 1PWZA 1MB4A 1L1FA 3RUEA 1E3LA 5IN5A 5JCJA 4HXYA 2Y93A 1P77A 5C3MA 1PGJA 3HQ4O 2IXAA 3JQAB 4EJMA 4IDGA 2CF6A 1HDCA 2Z95A 4ZVVA 4CM9D 5A1TA 3TF5A 4J2HA 3UFXA 3WICA 4WK6A 2YYYA 2GPTA 5DP1A 1D7OA 4OJNA 3WMWA 4BNWA 2W8ZA 5ES3A 1E77A 4CMEC 1ZO8A 4EI2A 3FTPA 4D7AA 1WDMA 3DZKA 5JSFA 4JP3A 1WZEA 4Q3DA 1BDBA 3MJSA 2FZWA 1VJTA 3D1LA 3DBHB 5AXCA 3NT5A 1RM4A 4KTTE 3EW7A 3E18A 5AXBA 3JQCA 1ZK3A 1ONNA 4OKIA 1N2SA 2J5KA 3GVPA 4CLDA 3F1LA 3C8MA 3AI1A 4E5KA 4BUCA 4AJKA 5I8WA 1VJ0A 4NK4A 1HDOA 3HB4X 4FFPA 1QORA 4M86A 4YPOA 5CDGA 1LLDA 2EEZA 4NFHA 3WJAA 2PZLA 3WSWA 1U4OA 2PK3A 3FSRA 3OJOA 4BNHA 1XGKA 1LLCA 4PLYA 5L7TA 3ONFA 1DIBA 1DFGA 1C1XB 1I01A 1PEDA 1H9BA 4CR7A 3DAPA 3LDHA 4E30A 3G79A 1XQ6A 3IAHA 1E1LA 1T2FA 2Q46A 4BNMA 5K6AA 3MZ0A 2X86A 2C5AA 5L4LA 3V2UA 3INTA 3DO5A 4GMGA 4TKMA 3RKRA 1E3JA 1I33A 4QEDA 4GX1A 5JCXA 4MJLA 1BHSA 1VC2A 2GO1A 5A5EA 3I9LA 1W6UA 3H9JA 3PDJA 4RO0A 2ZKLA 5GZ1A 3HUDA 4OGWA 2PA3A 1KS9A 2Y0EA 3HN2A 3KEOA 2E4AA 4B3IA 2B4TO 3OQBA 4A26A 3IL2A 2Y0DA 4MP3A 4OH1A 2RCYA 4TRJA 3SLGA 1PL8A 2BLLA 3F1KA 1E0DA 4BO0A 1H0KA 1A7AA 4LGVA 1KERA 3LZ6A 5L3ZA 1YVEI 1C14A 1YXMA 3FNGA 3WG9A 1U5CA 5DBIA 1HF3A 4CUZA 2JD1A 5TT1A 1E3SA 1LSOA 1M75A 4Z3DA 1PZHA 4A7PA 4PLWA 3WOHA 2Z1MA 3DHYA 4FC7A 3HDYA 4ITUA 1UUFA 5F3RA 4RVHA 1R4MB 2FR8A 2OP1A 4Y6RA 3FF4A 3F9IA 2X0RA 3TNLA 3JD1A 4J1SA 2VWHA 4JCOA 3E9NA 1KEWA 2OBNA 1I3KA 3NKLA 3EHEA 3MJ4A 2HMUA 2I65A 1B2LA 1XHLA 5A03A 3MWDB 3IMFA 1EEHA 3ASUA 4BKOA 2O7QA 2JHFA 3QVTA 4YAJA 4OKNA 2OMEA 2X58A 4MP8A 1ENOA 2NV6A 1F0YA 4MP6A 2VHZA 4F3YA 1MXHA 3KXDA 3ZI0A 3QRWA 3WX0A 3PQFA 3LF1A 1VKOA 4LMRA 1CEQA 1LLQA 2OGUA 4O59O 1NFQA 4XA8A 5BSHA 3RUAA 2DVMA 4DVJA 2NWQA 2Y1DA 2VZ9A 2P9GA 1ZW1A 2UUPA 4IDCA 3UKOA 5DBFA 3Q2KA 4J49A 3C1OA 1KVQA 4BS9A 1ZK2A 4HADA 2XXJA 3GN1A 4E12A 2JFGA 2P2SA 4WCFB 4RV9A 4TQGA 3WS7A 4S1VA 4XYEA 4WCDA 4I8XA 5CEJA 3GZNB 4BO4A 1FDTA 2X6TA 3A14A 3IQDB 3DBVO 3RVDA 4PCVA 2JAPA 3V1TC 4AFNA 5FFFA 3EC7A 3TOZA 2OP0A 1YDWA 3O26A 1E3EA 1CF2O 3I9KA 1R0KA 4W99A 2D3TA 1LU9A 3PFWO 2BH9A 1QR6A 3AI2A 4WNIA 3RBZA 5U1PA 1DFIA 1O0SA 3NDIA 3GVIA 3W8EA 4OMUA 1BWSA 3LT1A 4PLTA 2EGHA 3H9QA 4TRRA 5CDYA 5L4SA 4OOFA 1I32A 1JVBA 1V8BA 4YJDA 2NU8A 4AJIA 3ZWBA 7ADHA 3CKYA 4U7WA 4HP8A 4U0JA 4C7KA 1KVTA 4YJGA 4RVSA 3CMCO 3BHIA 3VH4A 4CLEA 2C7VA 2VRCA 1WPQA 5T6BA 4NH4A 3JQBA 3JD4A 4J91A 3DBLA 2IRWA 2P9EA 3F46A 2YY7A 2QIOA 5JFOA 4XYLA 2GYYA 4UUPA 4KP7A 3DAFA 1IY8A 1NX6A 2VHYA 2O3TA 3FNFA 5KOIA 3PHJA 1CQJA 2EJWA 4GQAA 3VH2A 5EIOA 1DAOA 1X1EA 2ZCUA 4RPJA 2FR0A 1FXSA 3AY3A 4DQVA 3IIEA 3NUGA 2AQHA 5DOVA 4Y8VA 4IINA 3DAGA 1D1SA 2OXIA 1K3TA 4P38A 4OM8A 2AG5A 2QYTA 4ND4A 3JD2A 4DQXA 5A5FA 3IKVA 4XQEA 4IGEA 4YQYA 1VSVA 5DNAA 4XRGA 1I3LA 1TLTA 4IDDA 2QRLA 4K6FA 2ZIZA 3WFIA 4BV9A 4EUFA 1R4NB 1ADBA 4PG6A 2W98A 3GEGA 2AEFA 2BD0A 1WNTA 1Y8RB 1FDUA 3OIFA 4DRYA 4G5HA 3VZPA 4LSWA 3NTRA 4FB5A 2DFDA 4BKQA 2PKQP 3H7AA 1ZVMA 4WEQA 1W0CA 3WR5A 3UHAA 4JLWA 4Q3NA 4RVDA 1U7TA 1XU7A 2DPGA 4R1SA 1HDZA 1LRJA 1ISIA 4D3DA 4BQPA 1J4AA 4NMHA 2VTEA 1SZJG 2WM3A 3G0OA 2IYOA 4GL4A 3ZV4A 1YS4A 1HL3A 4R41A 5CEFA 2CSUA 4RCVA 3UH1A 1SPXA 4J4BA 1U1IA 4R3NA 3HDQA 1B16A 1YRLA 1BXZA 3S1LA 2VUTA 2FRDA 4LK3A 4YCAA 1JTVA 2X9VA 3JQ7B 3OM9A 4ZQFA 5JDCC 3WIEA 1YONA 4EEZA 1EDZA 1PWXA 2QQ5A 5I9NA 4IIUA 1AN9A 3AUAA 3DMYA 3SVTA 1N1GA 1LRLA 3PGXA 5EMHA 1I3NA 1P74A 4M1QA 5ITWA 1UZLA 4J16A 3FD8A 4CJXA 3KYCB 4CM4B 1ZUD1 2PGDA 3DC2A 3PFFA 1DRWA 4FDAA 2WEKA 1PQPA 4I9NA 4KDEA 1MFPA 3TJRA 3WGIA 3AWDA 4YRAA 1E7YA 1LUAA 1SEPA 1FJHA 4MVJE 1AE1A 4URFA 5DDIP 2ZB4A 1RM0A 3RFVA 4UEKA 1F8GA 3S2IA 4W7HA 3ZV5A 4J43A
chains in the Genus database with same CATH superfamily
1A7UA 4U63A 1CJKC 2P8JA 3V1MA 4JUDX 3WHKA 4RTJA 1GNTA 4MEBA 4ZO6A 4X97A 821PA 2MSNA 3GJYA 4C6SA 3KPJA 1T25A 1BROA 3FN4A 1JDTA 1H1LB 4QU0A 2RI1A 1GUBA 1SOUA 2LD4A 4I4TB 1H8HD 1YVDA 3W2TA 2Y1CA 2R6FA 1Q1AA 2NU7B 2ZGVA 4P3KA 1AN0A 1HOTA 1BO6A 3WMXA 1Y8ZA 3CONA 1DP4A 4RHTA 2W48A 4EYSA 1B8VA 4ENSA 1R8JA 2KYRA 2ARKA 4PC1A 1XT6A 2RIRA 4O4IF 4XOIA 2E87A 1IBCA 3AU8A 5EHNA 3ZH2A 2O6HA 1PTKA 2AR0A 3DMPA 3W5DA 4RWEA 4ARVA 4CQNA 1Q77A 1A8SA 2R7KA 1GQSA 2A5LA 2ZCVA 1V7ZA 3D4IA 4L76A 3DOUA 2H4YA 2ZI7A 4LWZA 2PUHA 1ZM3A 5B7NA 1M76A 4DY6A 5TLSA 1EUQA 4R9SA 4CQJA 1W0JD 1KDYA 2WSIA 3W2GA 4PVCA 4Q19A 1OPXA 4YJ2A 4Q7MB 3SHWA 2HO4A 4BVHA 1PTJC 2FEWB 2H85A 1W35A 3H04A 3M9WA 1YZYA 1O1YA 5AHKA 2I9KA 4CM1A 1SVMA 2V7UA 2VTKA 2ZJ4A 4K1LA 2UXDB 2OILA 5KI6A 4U1RA 3DXYA 3INNA 3WA7A 1L9KA 2FWBA 3KKPA 4HGNA 4HK4A 3DLIA 3AOEA 4P5PA 3HU3A 3PSAA 2PDAA 1M3SA 3TEFA 3AP1A 3B6EA 4RFVA 3RT9A 4RIIA 1PUJA 2DFVA 3FYDA 2YVAA 1PBNA 5TX7A 3I0MA 2PXCA 1NW4A 2ZDHA 4JBXA 4CQMA 3KKQA 1PX0A 1X0XA 1U6JA 3NHKA 1UXJA 2P9QA 4JXJA 5CLFA 5LVAA 2X5KO 3ETNA 2VJQA 1E3WB 3GH3A 5DF1A 3V5NA 2YR0A 4TYYA 3DFIA 4Q4LA 2D2VA 3KNZA 3UMBA 2ENUA 1FNBA 3ED5A 1JS1X 3LQ4A 1RWXA 2H31A 4PONA 3SSAA 1QH0A 1M5UA 1OYYA 4ZU3A 4ZWNA 3AEQA 4MW1A 3STWA 1J0EA 3Q0TA 3QKSA 1L8LA 5IU6A 1AO0A 3PYLA 1OBCA 1U2RA 2IYUA 5BQOA 4C7JA 3ZU5A 1KA9H 2GMWA 1IPFA 3VR1A 2YYAA 3DJFA 3RG8A 1DKLA 4XGKA 2QD3A 4DLVA 1R0CA 1VFNA 3LVQE 4OQZA 5FAKA 2H63A 2OCXA 3N8KA 2RGBA 4MX8A 4Z8YA 2OV4A 4GSLA 4BX0A 4OSPA 4KR7A 5BV7A 2EAUA 2QMUA 2VP0A 3EEFA 4MKXA 3VPFA 1ZK1A 4PIMA 1ZRHA 4PXYA 3P9PA 3DGEC 4XQGA 1G5IA 1E0SA 3B20A 3BTVA 4E5NA 2Z57A 1YSCA 2R1TA 1P0PA 4C89A 1J97A 1MAVA 2NSHA 4PBSA 5G53C 5HOQA 3RS3A 5FTLA 1EHCA 2C1ZA 1SUIA 3G8DA 1OLSB 4D97A 3NHJA 1UDAA 1M6HA 1W85B 2D06A 5FB3A 3R9WA 1X7XB 5JVDB 4YCMA 3PUKA 4IG4A 4PEVA 1JPVA 5A9TA 1GZSA 1R27A 1PLKA 3HBFA 3L18A 1QLWA 4K8OA 3A4IA 1T8SA 4O1IA 2X1MA 4K9OA 2JLCA 2Z5LA 3MS4A 3SYTA 5F3WB 1AQYA 4BO5A 2AQKA 2YWCA 2HK7A 1DC3A 1P9OA 1U3GA 2P6PA 4ZCLA 4A6PA 3DTNA 4QAJA 1TTTA 8MHTA 5FX2A 4YVFA 4DM7A 4WADA 5CVUA 4F46A 4W5WA 5IJZA 3ZKWA 3LHIA 3JARA 1TZCA 4TLBA 2WU1A 3UTDA 2O2YA 4UJ5A 2O2EA 1D7AA 2PUJA 2G5GX 2CMDA 2XZDA 3C6BA 3KQNA 1OIVA 2LIPA 1US8A 3ENVA 1VMIA 1I7PA 1F5NA 1ZLYA 4RTSA 1Z3IX 4BWVA 2C2WA 1ZWKA 3GCXA 2DWOA 2K7ZA 3Q3EA 4CM8A 2HRQA 4FNGA 3O93A 3SC2B 4D0LB 1QLJA 4WLNA 2GHRA 5HKBA 5LU9A 4ZK2A 1XDUA 4YHHB 1J22A 1WW8A 2EFJA 5AKJA 4CGYA 1RQRA 3QFRA 1LDEA 1G66A 1Q84A 1V3QE 2FPSA 2NUAB 1GO2A 3EF3A 4XUDA 1P17A 2CF5A 1E4OA 4FEEA 4QOIA 1M1NB 3JQAD 2FZKA 3CEMA 1W8IA 4WUTA 2GEVA 4HWTA 1KI2A 2XE4A 3I4CA 1KORA 4ZEWA 2ZRJA 3GG9A 2RG1A 4OQDA 5LUBA 3UBTA 4KC0A 4W5NA 3I9MA 2QLMA 1JLKA 1M2KA 3FVWA 1ZH8A 1B1CA 3BWMA 4Q4DA 4FCTA 3I2FA 5KCZA 1EK0A 1JHZA 5IBPA 4XWTA 2NPFA 3TBHA 2FXIA 3T52A 3MQFA 3A9VA 3SYNA 1QXSA 3VYVA 4EHNA 2FFBA 2WKWA 3ROPA 2OHJA 3BEDA 2QRJA 2P4SA 1UKBA 3EDQA 4C7BA 2PXHA 4YDSA 1K7SN 3SVLA 1KEEA 4GECA 4GXNA 2QVCA 3QF4A 3B9BA 1E79D 4REQA 3OIYA 2RGEA 5J4KA 2ZBEA 3NHRA 5IJ0A 3RKUA 3EXHA 5HQTA 4OP3A 5KJCA 2V7EA 2HA5A 5F5NA 4BCCA 2OFFA 4MYUA 5ALJA 2JDID 4J29A 1H42A 2EZTA 3Q2IA 4N5DA 2QV0A 4OQPA 5LB2A 2RHBA 2TYSB 5JSZB 1UFKA 3OFKA 3W2EA 3HYLA 3CZ9A 3FZNA 5L53A 1RJGA 2XSZA 2Z9BA 2BR5A 3U61B 1R3UA 5BNZA 1QO7A 3FOCA 3SR0A 2OV8A 2OLKA 1W93A 2RGXA 4EFLA 2OCLA 4OY3A 1CQIA 1J56A 3NHWA 2W6ZA 4EHAA 1PGOA 3G5MA 3H5OA 1T2VA 1ZESA 1N9GA 3O8LA 3UPTA 4JXXA 1ZCJA 3UWDA 4BYMA 4KITB 4PPFA 1SK8A 2X4LA 4R6XA 2IEGA 4II2A 3UV3A 3PZBA 4EM6A 1QNFA 2CL5A 3NM6B 1M33A 1PDWA 1SBQA 1ZNZA 3EUFA 4N0QA 1BZYA 2ZI5A 4BJ6A 4ZOAA 2TMGA 2VBFA 2FPXA 3H1GA 4EL0A 2EJVA 4I9FA 4L5CA 1AMUA 1J8VA 2HA7A 3K9NA 5DP2A 2XUFA 2R84A 2GNOA 4MCHA 4YJHA 3GPLA 5F12A 3RIGA 5HG0A 3HWWA 3PXUA 4NPAA 4ZXPA 3EUWA 4YRJA 3U0BA 1CW2B 1UDXA 2ADOA 4H08A 4XJTA 2I4RA 3TPZA 3M4YA 3LDUA 2BFCB 1I2DA 4CDGA 2N1MA 2N47A 3D3EA 4A2CA 1DKNA 2Z2IA 4M8LA 4JKIA 4Y6OA 4KRYA 1EIZA 1H2HA 1G8SA 4TYWA 2UVPB 4KRXA 1DUVG 3SKYA 4B44A 5FDFA 1E98A 1CUCA 1Z7GA 2I1VB 4L3OA 4A0SA 1SBHA 5EZYB 1K8YB 1X74A 1YUBA 4LYHA 4Q66C 3QWAA 5KB3A 4C4TA 4EY4A 3K5HA 4LDQA 4MQLA 3S2SA 1D2HA 1GQYA 2VUUA 5IBQA 3GBPA 3UJNA 2WPDA 3PPIA 4EHJA 5LNK1 2AJ8A 1YIOA 4I5DA 3JR7A 1I5OA 1IVYA 2Q2OA 3SLRA 3ZV3A 4BNGA 3DV0B 2RHGB 1OXBB 3HB7A 1W6RA 2JK0A 3FKJA 1CVRA 1XPJA 2QUHA 1QYRA 3IPCA 1ZSYA 4U39A 4LPSA 1X1RA 1B15A 5BVGA 2V0NA 1J90A 4I0WB 4UZEA 3ZLTA 4DIBA 1F8YA 2XVMA 2EERA 4NE2A 2VDUE 1F6DA 1QF9A 1F12A 5BN4B 5CITA 3GY0A 5JC8A 3IUBA 4Z1OA 1ZG3A 3TI9A 2YJ3A 1TM4E 3L01A 4MGYR 4R6WA 3ZV6A 9LDBA 2I4LA 5CB8A 1IBKB 1GZ7A 4ZVKA 4Q21A 3VOSA 4HUJA 1AS0A 4ZK6A 4PTLA 5LIRA 5EHZA 1RS0A 1P29A 3FDIA 4EELA 4PAQA 2CXUA 1MQ9A 2HCRA 2NXNA 3F49S 3GJ4A 1U9ZA 1UBTS 2ZIGA 2ZYVX 3ZGNA 1TLLA 2PM8A 3LECA 2XT0A 3AHDA 2IZ7A 3TDKA 2I80A 4HPJB 4DCGA 1TMGE 2XZPA 3BMOA 5A02A 5JJLA 1RRVA 2ET6A 4FHDA 2IE0A 4MNTA 2ZSEA 5FH9A 2C7PA 1ZK0A 4WZAA 1DJNA 3T7JA 1KSGA 4K6OA 1N25A 4UNSA 4ZV4A 1OZHA 2ZETA 4KXQA 3UG7A 4WD3A 4XSHA 1JMKC 4AMUA 5BVHA 1XTUA 2OBYA 3ODPA 3S3TA 3FCYA 5HQJA 1P73A 1ZI6A 3HP1A 2W2VA 3IAXA 1T3LA 2ZVPX 3GARA 3LUJA 1BRTA 4W82A 3STHA 2OMKA 1TO2E 5JV5A 2F8TA 1YR6A 3PZRA 3LXUX 4ZYUA 3LXXA 3UB2A 4EKIA 2W8BB 4Q9NA 3QITA 4MR8A 1B23P 3PJGA 1RM5A 2HV8A 3AF5A 2D8AA 3A4VA 3DKVA 4P22A 4TLCA 5BSMA 5C5EA 2HU5A 3H8JA 4OJMX 4P9NA 4HXEB 4M1KA 1X8XA 5ER6A 3LQFA 3RYHB 4D92A 2QG9A 4X00A 2EX4A 2RFLA 4DARA 1AG9A 4PPNA 2J7PA 1BHO1 3N5CA 4M38A 4GMFA 2RGCA 4PRLA 4Q4HA 4QAQA 4DXDA 3DLAA 5BUZA 1G1MA 4NXNB 1ADFA 5AI6A 1SMKA 3BXEA 4OXXA 3M1AA 2QTMA 1IHXA 1JJAA 3D6AA 3I9JA 5JI3E 4PO3X 1QYWA 2EZ8A 2C2GA 2PT7A 1RWWA 2EIXA 3RNLA 4CRWB 5DX1A 5EWLB 4MSUA 1QTNA 1EDDA 2GSWA 2YXEA 4DZZA 1VMAA 1RACA 1ZZEA 2ZYIA 1T6BY 3CINA 3L82B 1FEZA 4HCJA 3K30A 3U3OA 3D7MA 4EENA 1RZRA 5AUOB 2ZJ3A 1ZP6A 4BNTA 2G4VA 3O8QB 4LOLA 3TR6A 4KVGA 3LCCA 1Y4DE 4IHKA 4BMVA 1MC4A 2PY6A 1N3IA 5H82A 1NNEA 1THMA 1DZIA 4L73A 2UYCA 4OXKA 1RI5A 2A1TS 1Y3IA 1LNSA 2I29A 3EZFA 3LBHA 3C3MA 5HUQA 1ST2A 2FGJA 4JEUA 4U02A 3H4MA 1XVVA 2BEJA 3W7AA 2R8YA 5KJFA 3U3KA 1C2TA 1RPAA 3LNCA 3DDZX 4RDCA 5BYBA 3L02A 5IXJA 2HJRA 2QB5A 5LYJF 3INYA 2QT9A 1O0CA 3T3DA 4HDAA 4NG4A 3FMFA 3RABA 1Z68A 4O4LF 1BAPA 1H2XA 2WILA 3T9CA 1WEKA 5BUCA 2H0RA 4ZT4A 3AUKA 4TMFA 1M73E 3MJDA 1KYQA 1I5EA 2QPLA 1TK9A 4RXMA 1H3EA 4YRKA 2C7RA 4NJEA 1H5UA 4M76B 4CMHA 2ZOSA 4ZXFA 4EG1A 1KYWA 4MRMA 3VR5A 4CKYA 3AXTA 1K08A 1JHRA 2I87A 2Q4TA 1XEFA 1DC4A 4JT9A 2ONKA 4TMZA 5E9QA 5GV7A 1OH6A 2AVDA 3ML1A 4WBNA 3IERA 4LNUA 4C07A 2DTDA 1V11B 1AZLA 1E2KA 1M1YB 1ZIXA 3IUEA 1AXEA 3MAJA 4KQGA 4P3YA 3L8EA 4ENQA 3MGAA 2JEOA 3DL0A 3KJNA 2C3OA 3SJZA 3QXCA 4MWOA 1OXUA 1EX7A 1SXGA 2CE7A 2I3ZA 2DM6A 2VRCD 3UFBA 3VZCA 3FOEC 2NGRA 1TIPA 4YJ3A 3LSYA 4BKPA 4CMJA 1AUPA 4WT7A 4ZYXA 2VDOB 3CLRD 1TPZA 3GG2A 4LMBA 3NMUF 1LLUA 3BB4A 1D2MA 4ZQHA 4BECA 3HM9A 4Q9AA 3EC2A 1YACA 4WBNF 2MYPA 1C9DB 3ZI4A 1K63A 2UYHA 4N7RA 5CDUA 5DHPA 2YXDA 5IJ9A 3QLUC 2Q1TA 3HVRA 3T5TA 1XPUA 3IQFA 1JG4A 1E64A 4W8HA 5AHXA 1EUDA 1TM2A 5HILA 4HWOA 5AHWA 5FOQA 3T4XA 3NAZA 4GX2A 5I01A 3L7NA 3IBSA 4RESA 3VZRA 2V58A 3AUJB 5BT9A 6REQB 4XM2A 4RJIA 1LX7A 4KNYA 2JFXA 1EBFA 2O3UA 3ND7A 1N5MA 1XEWY 2M6RA 1RMQA 1EU1A 1MIOB 1YL5A 1NRWA 1XCMA 3PFBA 1G8HA 4B5KA 1J5PA 3M82A 3KJIA 5AKXA 2CKDA 2CUZA 1L1EA 1ULSA 4HQFA 4H7EA 3RIMA 2Q6TA 1PCXA 4HY3A 1Z5ZA 4OHZA 5KDLA 1VE3A 4Y9RA 2XUDA 1A7JA 3ZUPA 4Z3OA 2C61A 1CUBA 1G3QA 3JTMA 3GNSA 2HEGA 3OT4A 5DFAA 3STTA 3TLZA 3WL7A 2OXEA 4ROTA 4AJOA 5HIAA 1F48A 3RAEC 4PV7A 1T5IA 2YY5A 1Z5NA 4WJLA 4X95A 2JAWA 4Z0NA 4BQFA 2FWMX 1C7RA 4MKZA 4UQOA 3ZS9A 2P0EA 3ZWVA 1N3BA 1YZQA 2QKYA 4YJ3B 2A35A 1X7WA 3B12A 4N0MA 3IUNA 4HH3C 1H1DA 1NJSA 2I3DA 2OVBA 3G59A 2D1SA 1BA3A 3KL2A 2D4HA 4YUZA 3PENA 4RJJA 5DHTA 3VH1A 4CTJA 3LBYA 4RLHA 3FWYA 4IWNA 5L95A 1MP0A 1U2TA 2HFJA 3HS3A 4JUAA 3EVGA 4FLMA 1II0A 1ECFA 4LV5B 2Q62A 4KOEC 3OOSA 4CM5A 4ZCSA 1WB9A 2GZRA 4QNMA 4UDYX 1ECJA 2JLXA 1NW7A 3MCTA 1NJ1A 4N0PA 3EMVA 2XEXA 2ODBA 4O2AA 4H1HA 3GFTA 3TNYA 4J3FA 4AI6A 1FLAA 2DFTA 2EV9A 2AJDA 3P9IA 3Q98A 1AS3A 2GH1A 4M22A 4PWZA 4Z86A 2Z6VA 1PL7A 3OQIA 1N8NA 2QZZA 3DFMA 4IGAA 2IOFK 4MITA 1FLNA 2WJJA 4NU8X 3I2YX 4H9GA 3X3HA 4BNUA 4H3HB 4I7EA 4BO3A 1S3IA 2OWDA 1ARZA 3IESA 4Y1FA 4F93B 4MWCA 5K0FA 3VPAA 2DQ4A 1RBQA 3G2KA 4JXKA 3QEBZ 1QTRA 4IVNA 5CJPA 3RS2A 5DVZA 1CUUA 3T5AA 1N1MA 1VB3A 3TQHA 2BDEA 3SMVA 4MO9A 1X1TA 1UBSB 1WSWA 3AFHA 5JAUA 4RVOA 1KIAA 2H5IA 1GUZA 3TLKA 3BQNB 2ZSKA 2N75A 1VI6A 3R2JA 3UCEA 2INGX 4QC2A 4LZZA 1E1RA 1U65A 2R48A 3CLUC 3SJ7A 2AIRA 2EJTA 2IODA 4ZOLB 3GMSA 2BSAA 5EP4A 1YBMA 4ARSA 2ROQA 4NULA 4ABTA 3WGLA 1EFPB 4FFWA 2RHOA 1JR3D 3CH5A 2UZAA 1ECBA 4OL0A 5JC1A 4XWKA 2O5RA 4TYPA 1Z4JA 1Q0RA 4TM7A 1FMFA 1Z12A 3KU1A 1P1FA 3RTBA 1POXA 5DISB 1QP4A 2IS1A 1MORA 1VB5A 3WK9A 4MS1B 3EUEA 1QHYA 2B69A 3MWEB 3R8FA 1FMLA 4CBVA 4OIMA 4ZFNA 1JV2B 3TZ6A 5BNTA 1LPBB 4W6QA 2WVHA 4LXHA 2ZKIA 5FBQB 4L2IA 1O6GA 5THXA 3U7EB 4A2PA 5J4YA 1VMDA 3L6CA 4DLZA 1S7GA 6ADHA 2X2FA 4QUGA 2A5FA 3QLTA 4TWIA 1DRKA 2ATXA 1P2BA 2EYUA 2J9ZB 3GEDA 4XQCA 4DQKA 2DLDA 1Y81A 1C30B 2HF8A 2XUZA 3H05A 3IDOA 3OM0A 3OTHA 3K0AB 3VR0A 2RC5A 3CMMA 3QWBA 3SIXA 1HV8A 1VL8A 3BGIA 3V6LA 1P7CA 4D4HA 2IIBA 4Z9YA 1XZHA 3SDSA 4JZYA 4LBVA 3QY9A 4DJEC 3AVQA 4FFBA 1Y9DA 4IYRA 5CNKA 3IVCA 1OHHD 1E6CA 3U4GA 1I2CA 5GQSA 4LRXA 5KNCA 3AUTA 3LY8A 2O8NA 4HYYA 4R83A 5T8KC 3V3TA 5AW8A 2AUTA 1MC1A 1NXWA 1ZZGA 2CW5A 3QPAA 4LJLA 3NHZA 5DYTA 4ZO9A 5JHGB 1A2KC 5JANA 2WAAA 2V5AA 3FPAA 3UXMA 2J9XB 4ZHQB 1ZUNB 4Y3UA 3GJRA 4OLHA 2QN2A 2EATA 4RM2A 3WC4A 4DLNA 3FCEA 3PJEA 2YV2A 2ZT5A 3HJAA 3JATA 1QQ7A 3O0DA 4Q93A 1N34B 1JIVA 3MB8A 3QKTA 1T26A 2AYYA 4UHJA 2HIGA 5ERXA 5C31A 3TZQA 3UMRA 5CVJA 4IUDS 2DUWA 3GFPA 5JUWA 1RXVA 2GNAA 2J0QA 4UFNA 4PGAA 3WYAA 4C76A 5HDBB 3RHTA 3QVUA 1BGWA 3ZQ6A 4PLGA 1Z4LA 2C2MA 1J8YF 1XKLA 2E4XA 2KSQA 3EQ8A 4H7PA 4R1LA 2DWUA 2J33A 4MR9A 4RORA 2H4FA 3WGZA 1YI1A 5KSYA 3MTBA 1U81A 4G6ZA 3WRXA 3ZX5A 3KKMA 5BUQA 2ALJA 4FBMA 1PJLA 1Z45A 3RODA 1I80A 4BX3A 3NKFA 1E1RD 5IM5A 5LQNA 2VFAA 1EX1A 4WFKA 2OOSA 1HKHA 4FN5A 2FPGA 2GD6A 3OTGA 5ABPA 1XZLA 1SKUA 2CDRA 3CCBA 3JV7A 4L4YA 4XYBA 5L6LB 4WK0B 4BO6A 4ZV9A 2H8GA 4MKGA 3A2KA 5B3AA 3A26A 2O5EA 4DANA 1YS7A 4JQSA 4NZNA 4HNTA 2JFWA 3N0VA 1IZ9A 4N82A 2AMVA 4OHVA 5IC5A 4XIGS 3LQKA 4ZREA 5ESWA 3K73O 4JU9A 3SD7A 4Z4IA 3L9WA 3I30X 2G80A 1Y1KE 2QW8A 2VPZA 4KGVA 1THZA 5LQJA 1PR6A 5IASA 4F4JA 1T91A 1PNOA 5TARA 5TGDA 1PR9A 1U0HC 3EOBI 2SKEA 4G9BA 4UUQA 1ONPA 2EHJA 1ZD5A 3DH0A 3W9UA 1A8IA 3GWGA 5IEJA 3V6MA 4A82A 1U7ZA 4CM6A 2EP5A 3CTPA 3H5RA 1CETA 2B1JA 2ODTX 4FOSA 5AJZA 3VYSB 3WNDA 5AM2A 2QBYA 3AHIA 4I5IA 1I7LA 1U2EA 4LPKA 4YJGB 5DNEA 3G5TA 2HGZA 3KKNA 1X14A 3LGSA 4RSMA 1XKTA 3ESBA 3F9CA 1UIMA 4NYMQ 4QBTA 1T15A 2HU7A 2OT3B 1TA4A 5BP7A 4MGZR 1CG6A 1WOYA 3DBLB 3JYLA 4E5MA 5DCLA 1CC1S 1M7BA 3BH0A 4ZAXA 3ROMA 5JALA 1FP4B 1NT4A 1FSZA 2QYHA 1HE4A 3HNOA 1Y80A 5JEEA 1FLVA 2QW1A 4D8YA 1JFRA 5HRAA 5L4NA 3WBFA 5CW1A 3C70A 1ZUIA 3PLRA 5L3VA 2O4CA 4GKBA 3ADKA 3H83A 1SXPA 3ANNA 4H17A 3T8YA 2X41A 3W2IA 4C0BA 4UNNA 5IAJA 4JVLA 3G02A 3DNFA 1ISHA 1C9KA 1HT0A 2PGAA 3GUHA 4GUDA 1Q0PA 4IFIA 2W4MA 3OE1A 3C3JA 4M37A 4QXOA 3BORA 3OJFA 2PH3A 4MVJD 1EXDA 2QTCA 2F1RA 3CF4G 5E3JA 5BORA 5K8IA 4FW9A 1XMOB 1U4NA 3ZHTA 2GFHA 1A50B 3DFFA 1P60A 2VOEA 3LWZA 3UOAB 2A1TR 1MGPA 2DH5A 3ZCTA 4K87A 4GDMA 1Z0ZA 2C4KA 2RI0A 1YQGA 2A4KA 1CD5A 5JTTA 1N2OA 1EVZA 5JAPA 3R7BA 3OE7D 4G0OA 4I08A 4PZEA 2NTNA 5HSGA 4RD3A 4KBFA 2Y92A 2VCHA 3MAGA 4PVDA 2CHUA 1N7GA 4LHZA 5HMLA 1Q50A 3EVNA 2FN7A 4QGSA 4YAKA 3TGLA 5AKGA 1ZUHA 1Z4PX 5TNXA 1ZYUA 2WU0A 4LSGA 4FFMA 3WFJA 2NXWA 3Q3IA 1UC4B 2OCGA 3AJRA 5I9MA 4DCMA 4MW5A 3KVRA 3CEAA 3JQ9C 5G0UA 1HE1C 1JIXA 1NU8A 5TMDA 3LW8A 1HNWB 4R31A 1JU3A 1Y6QA 4OJTA 2Q99A 2ZANA 1O58A 5E6RB 4YRNA 2B1IA 3RC9A 3SDZA 2YFYA 1SKAA 5H70A 3OOEA 1Y1PA 4HNSA 3O03A 5DT2A 2M6KA 3K32A 1MRZA 3IUPA 4LF5B 1XSEA 3V4LA 2WQ7A 1EG2A 1Y9EA 3ED1A 3SEAA 1KH1A 3HDVA 1FQWA 1WG8A 2R1TB 4IJVA 3MM4A 3K1AB 3WLTA 3BUSA 7MDHA 1JEYB 3TAUA 1JWAB 2FLKA 4BVBA 2R6GA 3QFFA 4UUAA 5JPCA 3MC1A 3V1YA 3H97A 1PJ4A 3NEPX 2ZSUA 4OV6B 1NN1A 2PSDA 4IIJA 3EXAA 4MQBA 4FHZA 5KNDA 3PQCA 5AUQA 2XNKA 4M1WA 3DZ8A 1AGXA 1N2XA 1R2QA 5FWYB 4OFZA 4D3SA 1U0BB 2BFCA 2V7PA 3BIWA 4LDNA 5F9MA 3SIWA 3OECA 1P0IA 4UMFA 4RPCA 1E9CA 4C87A 4WACA 2JJ2A 2QL9A 2NZYA 2OLJA 2D1FA 3KUXA 3LU1A 5DEOA 3O21A 4I8DA 2NPOA 1RC1A 3DKPA 3PT9A 2AWOA 1TT7A 5KMGB 2O8VA 3QVMA 1P72A 5DWVA 2QTLA 3QE4A 2C92A 4C3VA 1T2UA 5J1SB 2P35A 3IAM6 1CHDA 3QTBA 5P21A 3UAXA 1QRDA 1JBEA 4FZRA 2OK8A 4JUFA 4NAUA 4XASA 3LGAA 1NMXA 2HC9A 3V8RA 4Y0NA 4B83A 1J0CA 4YMSA 2XXAB 5KVVA 2CYCA 2WPNA 3MCVA 4KIFA 3RVNA 4DC1A 4B75A 4DXAA 1W581 1VZ2A 3EDCA 3KWLA 3JWHA 4EZIA 1RLOA 3L4EA 5EJAA 4XR9A 3CW2A 1CNMA 2AS0A 2Y2UA 4AZ3A 3L0BA 2GYWA 2O0KA 3F3MA 3QNMA 4NZYA 1QANA 3D6VA 4O29A 1K68A 2HA4A 4KQFA 3DBHA 1HFWA 2OORA 4X1YA 1WF6A 3AKCA 4QOFA 1P0FA 1YGPA 5TMEA 4MW2A 4FJ0A 3CXRA 1IXYA 2X6RA 1GYQA 4PYLA 1OZAA 3BKXA 1X80A 4IIJB 4KSCA 1O6ZA 3DZIA 3FB4A 4JJ7A 3DOJA 4XOUA 4PZ0A 3WK4A 4EBBA 3LTNC 2IUUA 1U0SY 3U1TA 2VJBA 4GYWA 4MS4B 2HSDA 1YZUA 2E0IA 3I52A 4X64B 3C4QA 4EHBA 4LFCB 3L1HA 1Y9ZA 3V8EA 1M74A 5K8VA 3T0IA 3QBJA 3DDSA 3HB9A 3SGLA 2CHQA 1EE1A 3LPMA 3HUFA 1VA5A 5AI9A 2RGGA 2XLBA 3NDPA 4O4JF 4Y2GA 3EBLA 2GSDA 4M83A 2WKSA 4DLAA 2ZVDA 4FZVA 4AURA 3DD5A 2ZJ8A 3HBJA 2NUBA 2ZJ0A 4JP2A 1DKRA 2H2FA 3UB3A 4ISBA 3G8CA 3M49A 3PE4A 4PC3A 5J2UA 4KK3A 5DM1A 4Q16A 1ZA2A 3CN7A 5JS2A 1HZJA 1YS9A 2YZ7A 4XIIA 2XMBA 2DPLA 4LTDA 2GXQA 2OV2A 3EQ7A 1EA7A 2HMSA 1FS6A 4O1HA 3BA6A 4GL2A 3D6FA 4OL9A 4J2TA 3VR6A 4CIBA 1YOVB 4RFSA 2XAAA 3Q2OA 3BIXA 1E61A 1P9NA 1REQA 1LVUA 4H1TA 3D4OA 4NOKA 3K4PA 1D3AA 1EP3B 2WZDA 4D46A 5DIFA 2A94A 2CMHA 4GNRA 4KKVA 3ZNQA 1A77A 3AJDA 2JS7A 3UJHA 2CMFA 1XRJA 3WXMA 4IXMA 5I47A 3ELYA 5BW4A 5THKA 3FM9A 1PWEA 3JU3A 4BATA 1VHQA 2ZROA 1EBUA 4KEAA 1E2LA 3E7FA 3Q1KA 3ZCRA 3WKEA 3WYBA 2X5OA 1I4LD 2N42A 4M0MA 3B2QA 3MS7A 3WRVA 4ZEVA 2JIPA 4PANA 1P1IA 4YP6A 1KY4A 1M6NA 1JG6A 3FH0A 3R5HA 3OPXA 1NULA 5I4CA 3GZJA 1DXOA 3IBCA 4M0LA 1EB8A 5IC4A 5FWXA 3JD0A 3I0ZA 4AY2A 1UMBA 1N2JA 2RI6A 2IWRA 1NF8A 2I8CA 4TM8A 3S44A 3WBKA 2JJ1D 2QK4A 3PA6A 3I3OA 1XZPA 3UAGA 1N75A 4EB3A 4BDSA 5E2BA 1ZOSA 1BC5A 4GPAA 1SC4A 1RJFA 3SZMA 4JJAA 2B37A 2W6JD 3N7AA 5JBQA 3VMMA 3U16A 3DW1X 2RK3A 2OO5C 4QFDA 1XTZA 2PVPA 1UJNA 1GD1O 1M54A 1YFKA 2Y66A 4U2BA 5IDXA 3C3XA 3H1TA 3O2SB 4HGQA 3WYDA 4QDTA 3BF7A 2KQUA 1PLLA 3I6QA 2VPWA 1OI7A 3ZU3A 4E2XA 5TT0A 3FPLA 4PG7A 2P5UA 3N6VA 4KQWA 1UKAA 3AY6A 1WCIB 4NL4H 3DV9A 3NB0A 1N2HA 4GGOA 3E9MA 4PG5A 3THRA 2YWDA 1WETA 4B73A 4YP5A 5KYUB 4MKHA 1RYZA 3OTQA 3G2QA 4OAQA 1GCOA 3K53A 2IQIA 1E7QA 3NATA 2EF1A 2PX8A 4L4SA 4ND3A 1S6YA 2B78A 1JMVA 3KZOA 3MMPA 3HWRA 1AZWA 2BFBA 1V1RA 4GXQA 3SZOA 1PYGA 1U8YA 3FCSB 2IPXA 5IT9A 1EDBA 4KAFA 3UK7A 1WBBA 3RJZA 1W9HA 1C4KA 1XYVA 1WUKS 2QG6A 3RUDA 3ZDDA 3FTNA 1QE5A 1FNSA 1B3BA 3IODA 4DLUA 3T94A 1F2TA 1R4ZA 2AB0A 4X8OA 1HR0B 1U28C 1HK7A 1SC6A 3O8OA 3JQAA 3DHWC 3E7XA 1K75A 3KETA 1JW9B 3AVPA 1X1QA 3RBVA 4HGOA 2AX3A 1SCIA 4A6EA 1L5KA 4Y0VA 3O3MB 1A71A 1OAOA 2O52A 3H5AA 4GRIA 2O0HA 4YACA 3U17A 1JQEA 5FI3A 4JASB 3TMAA 3R5FA 3TSCA 4UEQA 2VDWB 4NU0A 1GFWA 3SX0A 3G1UA 1GNPA 3L6OO 2WD7A 1ZGGA 2FN4A 2J3EA 5SYNA 3ZDXB 2CT8A 3LV8A 4UPDA 4MYCA 1ID8A 5CT5A 1C7ZA 3UAVA 3SK0A 1W2GA 2XA9A 1QZXA 3E22A 1C2YA 3K0FB 2VJAA 4YK7A 4BIIA 5MN6A 3F47A 4HMPA 4PU0A 2ICAA 2VAMA 5B6PA 5IT5A 2CYBA 4C21A 1ZH4A 3PNPA 3AQ4A 3CX8A 1GZVA 5L3RA 4NYJR 1SZCA 3X44A 1R74A 2VBCA 2X15A 1JXOA 5G4KB 4A5OA 3KT6A 5LNK6 2D5AA 2GZ1A 3A28A 2O2ZA 2Q5LA 3BXFA 2PO7A 4MVJP 5EFOA 3UZUA 5EZQA 4YV7A 4K9KA 1LQUA 5IWAB 6REQA 2F17A 1PVVA 4PO8A 2G5CA 2Z58A 1MAAA 2BFBB 2G1JA 2SKCA 5AM1A 4IFBA 3UUWA 5KVSA 2AZXA 3ZDRA 1ENPA 1MIOA 5BV1A 2RBGA 2VHXA 4F12A 2WFAA 1WHTB 1XWWA 2KPOA 3BE6A 4Y6PA 3GI1A 3CF2A 1UBGA 3O1HB 4ZANA 1FVXA 1ML3A 1QYDA 2A30A 3A05A 3A1UA 3AY7A 3JYOA 4FILA 1ORTA 3GLKA 1BDHA 2CL0X 3F6SA 3I39X 3PE3A 3U4AA 3BFKA 5A6SB 2WFZA 1Y4UA 2YOHA 4F38A 3OJ0A 1I7DA 1CY0A 2VBIA 2XHZA 4CKEB 1E94E 2Y99A 1BOOA 2X9LA 1A9PA 3F0TA 3A9WA 2AJLI 2WRZA 4GPIB 4K2HA 2XA2A 4W7IA 4QLBA 1M72A 1QWSA 4J0IA 3D6JA 4KACA 3ZXSA 1TGVA 3AKZA 4RHXA 1VJGA 1EX9A 3FCXA 5CB6A 2CXTA 4J3NA 3QEAZ 1UBRS 4YAEA 1RI2A 1YS2X 4LOAA 2BZSA 3K0CA 3DTYA 4LF6B 3S2EA 4HEA6 4OYHA 1W5TA 1D5WA 1NWCA 2WWVD 5B1SA 2VAVA 2ZXUA 4Z7JA 1SEVA 4NYJQ 3RWOA 1Z0UA 2G17A 3TPCA 3COJA 2AW5A 3GFGA 3U0VA 1GKUB 2EP7A 2YQ4A 1RQ2A 1DKQA 3VDMA 1UMDB 1Z6PA 4JL8A 4WDQA 4P2GA 2Q6LA 1IDOA 3JXEA 1X9GA 1WMAA 4WA7A 1DIGA 2CDBA 3IB3A 3UPDA 4BQRA 1GV1A 3AG5A 1T9GR 1WABA 2W5UA 4D8WA 4CF5A 1XMIA 1KPGA 1XTKA 4LRWA 3IBGA 3P45A 3TQQA 3WK7A 3EDYA 1VJ1A 5MF6A 3C45A 4CIXA 3GLHE 1KSFX 1W5BA 4DV5B 3SFVA 1G7SA 4DRXA 5K01A 1PR0A 3ZK9A 1E2GA 3HXMA 2HUPA 1XCOA 5A4JA 3OD5A 2LKDA 1GL3A 3KDAA 1CF9A 1M1YA 2PU5A 2VCYA 1L7OA 1VYTA 1RQGA 2OM2A 1PG5A 2Z4RA 3DCIA 1XZDA 2C3MA 4Q7LA 4AXBA 5KOJB 5DNVA 1T35A 3Q88A 3IKJA 2NZJA 2R8PA 4ZEXA 2H06A 4HL6A 4I1YA 4AF7A 4DLPA 2XNDA 2JIMA 1G7CA 4X1IB 3MOIA 3MWDA 1PEKE 4EQ6B 1PQWA 1N78A 5BMVA 3LCUA 2C9BA 2Y1WA 5KUTA 4IS3A 4BAZA 1WPRA 1E4EB 1CU1A 1F2DA 4BLQA 2Y8EA 4C0SA 1QGED 1NRJB 4IIVA 5JLJA 5J3JA 1H4TA 4KDRA 1B6GA 5DO9A 2WLSA 3NBXX 2JH3A 5KTOA 1GSIA 4QEZA 1KI9A 3PX3A 3BAZA 3L77A 1DNPA 3JQ7A 1J2YA 4WKGA 5B58T 3K94A 2ZSAA 5HNKA 1RQNA 5F2KA 2J6HA 1RXSA 3MWEA 4RH1A 1L1QA 5GAJA 4FYHA 3U3RA 4JCCA 1KO5A 3UJAA 4R0NA 3D4LA 1C3LA 1Y89A 2BEUA 1G9TA 3OEEA 4AQYB 3V42A 2FB9A 1SXHA 2OUKA 3WZMA 4CTMA 2MINA 4PR3A 3SYMA 1NVUQ 1OFGA 1IEXA 3QEMB 3G3EA 3ETHA 3MF4A 1H8ED 3MW8A 2WDZA 3OPMA 4CQMD 4EGAA 1G63A 2XQIA 2SHKA 4K6CA 1NATA 1P80A 1UFQA 4YJ2F 3TFQA 1H23A 5CFRA 4KX3A 1Q15A 2PWPA 4WZAB 2ZK7A 1M8KA 2GCGA 1IK6A 3VR3D 3FFXA 4D6YA 3KB6A 4FDLA 4FGSA 1KK1A 4B87A 1CY7A 1T0PA 2QY9A 5BVHB 4OLBA 1NX9A 3GELA 1O94D 1SD5A 2H17A 2WHPA 3EZ6A 4FGLA 1N5LA 3H7IA 1CEYA 1RT9A 4HDKA 5I7EA 5EJFA 1QK5A 4PYQA 5EIFA 1IAVA 4I5EA 4BBPA 3K09A 4JY7A 5KWVA 4Y30A 1J42A 4JOBA 1GNRA 2R7AA 4UMVA 4NARA 3SFTA 2CXNA 2H57A 5DTQA 4JQZA 2BHNA 4BLPA 1QC5B 4CIWA 1EKXA 4M55A 1HBJA 2RJNA 4UBOA 3HSYA 2CDCA 4JL5A 3B6KA 2O3JA 1V5FA 2OZVA 3CWQA 3HYNA 5CLLA 5D7NA 3ZU4A 3ER9A 3AR8A 1QBKC 3VKUA 1K3UB 3ORFA 1YRBA 4K46A 3BJEA 5CB4A 1GL7A 2YUIA 3BSWA 5C1BA 2JGRA 5AKZA 3ZVMA 3GGOA 5CFMA 3RIXA 1O5OA 1DJOA 2JL1A 4BFUA 4P2BA 1I2AA 2M6LA 2PGIA 3EXHC 1GSAA 1UAGA 1SXJD 3FNRA 4EOGA 2IH4A 4PC2A 2QMYA 1IN5A 1SU8A 3LH5A 4D02A 2FWRA 3PQ3A 3D6UA 1X15A 4M88A 3CWZA 4KZKA 4RGVA 1UPTA 3R9IA 2JRLA 3KLOA 1IZ7A 3HXKA 1YF3A 2BUAA 4KL8S 1VLLA 5JNWA 2R68A 3A1FA 4YO7A 3BB3A 2O7NA 2HNKA 2J3HA 3LPNA 3V2GA 3SR4A 1NLYA 1VCHA 4CEJA 2ZQZA 2GUWA 4L51A 4PBRA 2FE1A 4X7BA 3HV2A 5B5SA 3CT4A 1JKJA 2W2LA 3KEMA 6AT1A 3V4RA 4JT8A 2JGEA 2C54A 4JBNA 4K81B 5EOVA 5KYXA 2AMFA 4TZKA 5FHQA 3C1AA 2WM8A 2VT2A 2WTBA 2CY0A 1QO0D 5LP6B 4MPDA 4DR1B 3U5TA 3AERB 4JNKA 3P9CA 1AQ6A 4I4NA 5G0VA 4CLXA 3C1UA 5G4LA 5DHRA 1CB7A 4JC8A 3NEYA 2I5PO 3IFSA 1CFZA 1HETA 5KQGA 2NMVA 4R68A 4RQBA 2ZBQA 4BNNA 5IXYA 5GY7A 2QR5A 3QU5A 2PL5A 1T4MA 4I8IA 1E89A 1XRSB 5CM8B 3DAHA 4KFSA 1CR0A 4TKVB 4UCXA 3DE0X 4OHRA 5IT0A 2YJ4A 2JGDB 1ESZA 1JH9A 1FFYA 3H3XA 1INLA 2YHSA 2XWSA 1OBVA 3FPGA 4JT2A 2VIIA 2NLOA 1M2VB 3O8CA 4AK9A 4WCFA 1W19A 3UG6A 5KVQA 4EG4A 1XP5A 2RJ3A 2EU8A 2V6BA 4IO1A 3TRKA 3ODGA 3ZIDA 4D9IA 3FCAA 8OHMA 4NYMR 1KJWA 1X77A 1XK7A 2R96A 4JWTA 3X1MA