5IXYA

Lactate dehydrogenase in complex with hydroxylactam inhibitor compound 31: (2~{s})-5-(2-chlorophenyl)sulfanyl-2-(4-morpholin-4-ylphenyl)-4-oxidanyl-2-thiophen-3-yl-1,3-dihydropyridin-6-one
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxireductase/oxireductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
publication title Cell Active Hydroxylactam Inhibitors of Human Lactate Dehydrogenase with Oral Bioavailability in Mice.
pubmed doi rcsb
source organism Homo sapiens
total genus 117
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5ixyA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5ixyA02
1YOVA 4BGEA 4CLRB 4D45A 4CUZA 1VL8A 4FC6A 4YBZA 3QY9A 3ZWPA 3VH2A 2X8LA 1LJ8A 5A5FA 2NADA 3KO8A 1ULUA 2O2SA 1ISMA 4AG3A 1CRWG 2Q1TA 4IXWA 4E5KA 3NT4A 3UVEA 4R3NA 3PJDA 5A9TA 2FSVA 1N5DA 3G3EA 5U4QA 3DOOA 2AMFA 2FR1A 4GX2A 3WDSA 1VLLA 3F1KA 1MXHA 3JQCA 3JQ8B 1LEHA 5CDYA 2Z95A 1DB3A 3D0OA 2VYVA 1NXQA 3WGZA 2JL1A 1PJBA 2J3JA 1W0CA 4M1QA 2HKIA 4G2NA 2ILTA 2Y0DA 4EEZA 1ZK4A 4GWGA 4NJMA 4HNHA 1Q7GA 1WZIA 1LSUA 4J2HA 5BR7A 2PH3A 3Q6IA 2RBEA 5COBA 1AGNA 3UH1A 2PGLA 1AXEA 4RQTA 4E4YA 5TNXA 5A5EA 4YTEA 4I1IA 3WGGA 3R1IA 3PHHA 4KMSA 5JCJD 1ARZA 4XR9A 4CM5A 3IQDB 5COQA 1I0ZA 1DIGA 3ASVA 3DZHA 1XKQA 1PS9A 3GT0A 3JQ9C 1E7WA 3ROPA 3CH6A 3L6OO 4CM9A 4DIOA 2VHVA 4IGEA 1DLJA 5I7SA 4UEKA 1GDHA 3TOXA 5JCXA 2NQ8A 3Q11A 1ZMOA 1P3DA 3ULKA 1PU2A 4TRNA 2UUPA 1P0FA 1JLLA 1NWHA 3GGPA 3H5AA 3PQEA 4FOOA 2DFVA 4GBJA 3ZDFA 4BGVA 3V5NA 1LDEA 1D1TA 3HN7A 3QLJA 1WMAA 3RASA 3E8XA 4M86A 3NGLA 1LXCA 1Z7BA 1P1FA 4R1SA 2ZQZA 1Y8QB 3LT2A 4FS3A 1ZK1A 3KEQA 4J43A 3VTZA 1LLDA 3O03A 5HWSA 2UUOA 1TXGA 1U3WA 3GPDG 3X2FA 4GVLA 4Q3CA 5DF1A 1LBEA 5GZ1A 4BNYA 4HBGA 4XJSA 1W73A 3VZPA 5C37A 3GN2A 3ZU4A 4E5MA 3A14A 4IDGA 3BIOA 4E3ZA 5JY1A 1HLPA 1WDKA 3I9JA 4FJ2A 5CPFA 5THQA 2Q1WA 2ZKLA 1UZNA 4GQAA 3P7MA 4JGBA 4KUEA 3ZGYA 1IOLA 3D5QA 4YT5A 1WZEA 2JD0A 3S2FA 3WYEA 4KZPA 2X23A 3PGXA 5KKAA 1ADBA 1ZUD1 3PLNA 3WLEA 3I4FA 4K26A 4YJHA 3WX0A 4EJ6A 5LDGA 1DLIA 1E3IA 4OYRA 5B4VA 5IXYA 2DPGA 5JC8A 4XQCA 1FDSA 3TSCA 4RPKA 4BGUA 2VZ9A 3O8QB 3OJFA 1I30A 4AJPA 3KHUA 5T67A 3GG2A 4C4OA 1YWGO 4E12A 2DFDA 4WECA 4BNFA 1GTMA 1R0SA 4O59O 5JCJA 4B4OA 2PZLA 3TQHA 3GGOA 5B37A 2RIRA 4CLRA 5JAQA 4RPGA 4ESOA 1B8VA 2VN8A 1OFGA 2EW2A 3BMCB 2AHRA 4RVFA 1N9GB 4W9NA 1ZSNA 2X5JO 2DTDA 1TB4A 2B36A 1O94A 1R12A 1T26A 1ML3A 2D8AA 1LLUA 1T25A 2YQ5A 5DOZA 5A05A 1V35A 3BA1A 4FCCA 1XDWA 2JKVA 2Q4EA 1LLCA 4RDIA 4WEQA 3AK4A 5B4UA 2P91A 3VHRA 2UVDA 5KTKA 2VHZA 4F46A 1AHHA 3JQ8A 1HZJA 5AXDA 2JAPA 4BQPA 4BNXA 3HADA 2AEFA 3OM9A 4RORA 3ICCA 4WCFB 2ZATA 1QSGA 4IJKA 2NUAA 3F5SA 1K2WA 3ZHXA 1T2EA 3ZH2A 1PR3A 4KDEA 2IZ1A 4DPKA 5CDUA 3NV9A 3QVTA 2GASA 3ICPA 1XLTA 3ZU2A 4UREA 2AQHA 1MFZA 3HB5X 2XAAA 3FTNA 2YQ4A 3HE3A 4DIBA 5DCWA 1UR5A 5IN4A 3S8MA 1LX6A 1EVYA 2Q45A 4FSHA 1CIVA 1EZ4A 1MC4A 1WPQA 1PJCA 3C8MA 3TJRA 3VOSA 2H1SA 3ZHBA 3ZHYA 4LVUA 2BMAA 5JDCC 1X13A 1XA0A 4FFRA 4LVCA 3RBZA 3I6IA 2HDHA 1I3NA 6ADHA 4O6VA 1XR3A 5KWEA 1X0VA 2X9GA 3TNLA 3Q2KA 1LRLA 1M2WA 1Y8RB 1EFKA 3FBTA 4IMRA 5ICMA 4Z9FA 3ZNOA 2O3QA 1O95A 3ETDA 1HYEA 2VNAA 3ZWXA 1V8BA 4IINA 4Y6PA 4C7KA 4XDZA 3ZW9A 3WSWA 4RZIA 1ZSVA 4D3FA 2IDZA 3RU7A 5CFZA 2GRAA 5TS3A 1SCUA 3I23A 1YE3A 4BNZA 3IS3A 3V1UA 2BF7A 3PZBA 3QE3A 4K28A 2Q99A 5JAMA 2W8ZA 1M6HA 1Y81A 3TOZA 1EUZA 2VUSA 1HE2A 1UXIA 5G0VA 5IDYA 3WICA 1Y8QA 4CM1A 4CMEA 3IKTA 1ZNQO 4CMGA 1I3KA 3DQPA 3BTUA 1PEDA 3IOYA 4CR6A 1VKOA 3BZUA 2PR2A 2HK8A 1NQTA 1IYZA 1R66A 1HE3A 2BGLA 1IULA 5ITVA 3S2GA 1EQUA 1LQUA 4WOKA 3DBLB 3HDJA 1U8XX 3TL2A 3RUHA 3W8DA 1UXHA 4PLZA 1RKXA 5JAZA 3P2OA 4XJTA 4BIIA 1DFHA 1HT0A 2PKQO 4ND2A 5AXBA 4DQUA 5JMPA 4BNHA 1K5HA 3RSHA 4GKBA 2NNLD 3JQ7B 3OIDA 1PGPA 3LVFO 1PTJA 1P0CA 1GYRA 2X58A 4FIZA 1MG0A 4NDNE 1JQBA 4BNNA 4R01A 4ND3A 2EWMA 4N7RA 1EEHA 1PQPA 1WP4A 3PP8A 4A10A 1PGJA 2D0IA 3GQVA 1O0SA 2IXBA 4BMNA 2PD4A 2FP4A 4RPLA 3QW2A 1OAAA 1EVJA 3B1FA 3Q0EA 1P1RA 3K9QO 2AQKA 3RFVA 3PYLA 5F1OA 2B35A 2GD1O 3CINA 3BMCA 1N9GA 3JSAA 4N18A 2UYYA 1PL6A 1NASA 1DC5A 1PX0A 2ZK7A 4D42A 3W6UA 3JQFC 2YUTA 3HZZA 4BO1A 4EDFA 1E92A 4W4TA 3LC1O 1HDRA 3F4BA 4RVHA 4WEOA 3JQAB 5JFOA 5JYEA 4A03A 2PZKA 2YV3A 4CMJA 4PG5A 1JTVA 3HSKA 7ADHA 2PLAA 2I76A 5L7TA 2J6IA 3H9JA 3NTRA 1JKJA 1QYVA 1SPXA 2PGDA 4ZQHA 5KKCA 2X4GA 3MTGA 1UUFA 3NGXA 4YACA 3UCFA 5L95A 3I83A 4LMRA 4NK4A 3AOEC 4WCFA 1WXDA 4RQUA 4NBWA 5L40A 2XXBA 4DWVA 4RJTA 2HMUA 4RF2A 5THKA 2FZEA 3F46A 1HDYA 4PG7A 3DOCA 1OI7A 5IDXA 4Z0TA 2Y99A 2BI7A 5CDGA 4UUOA 3OFSA 3WBBA 3RUIA 2PFGA 4LSWA 2PA3A 4XQGA 1T2FA 4OQYA 1B15A 1R6DA 4YJFB 4CL8A 2VHXA 3RBVA 1YRLA 4E2XA 1YO6A 2EF1A 4ALIA 2A35A 5DT9A 2G5CA 3JCZA 2HK7A 2J5KA 1NP3A 4J1TA 1X0XA 3AM3A 1SOVA 3OETA 5L53A 3TF5A 1DO8A 1BRMA 3PXXA 4DQVA 3ZWCA 3GGGA 1EUDA 1YGYA 3GNQA 1NAIA 1Y8RA 1P44A 3M1LA 3ADPA 2J3HA 2X86A 1F8FA 2C82A 2WMDA 2P4HX 3OQ6A 3CZRA 3QHAA 3MEQA 4IJVA 3DBVO 1YVEI 2X9VA 3S55A 4K1LA 4IUYA 4BNJA 4FOSA 1RM5A 4P4LA 2D5CA 3FD8A 2YYYA 3PWKA 3DAFA 2OUIA 3F4LA 2H5LA 3H2ZA 3WGQA 3K6JA 5I9LA 1YXMA 2Q2QA 4JCOA 4D0RA 3EYWA 4B7UA 4BMVA 5KCZA 4K6FA 5KIAA 1F0YA 4ID9A 5T64A 4XKJA 1M76A 3RUEA 1PGNA 5EN4A 1NHWA 1ADFA 4EITA 3R3JA 2ET6A 4H15A 1ADGA 3RU9A 3WGTA 2BLLA 1V6AA 3PEFA 1E6UA 2HRZA 5IXSA 1B2LA 5CG2A 3VPFA 3DBHB 4IM7A 5ENVA 1QKIA 1UDAA 3DZFA 2GZ2A 4ZD6A 1RWBA 3DBLA 3GAZA 4NZ9A 3MJVA 3MJ4A 2WTBA 3QSGA 4YJDA 4J7CA 4JNKA 4JP3A 1XCBA 4Z3DA 5BSHA 5GZ6A 4X54A 4TZKA 3DEYX 4YAKA 3F3SA 2FR0A 1ZZEA 3PHJA 3UXYA 4AFNA 1Z74A 4KWIA 4CUJA 2BI8A 1PL8A 3DFUA 5TQVA 1S6YA 3WYCA 1X7GA 2HMSA 1EDOA 4J2OA 5DZSA 3FSRA 4IXTA 1UXGA 3C1OA 1Q0QA 2ZYGA 3TZQA 5F1PA 4Z9XA 2LDBA 3JQ7A 2EJVA 4CODB 1I2ZA 1NYTA 4PG6A 1GQQA 5HTOA 1ZSYA 2ZTLA 1E7QA 1H9BA 4M8SA 1I01A 5DOVA 1U5CA 3R6DA 1U3TA 1UP6A 3GA0A 4NHEA 4UUMA 1QLJA 4F3YA 1DHTA 4I9UA 2EERA 4H7PA 4L76A 1PGQA 3SJ7A 2ZTVA 1R0KA 4DQXA 2FRDA 1J0XO 1NQOA 4OKIA 3JQDA 5A04A 4CM6A 3GVHA 3D64A 3JQAA 3NJ8A 4ZQBA 1LC3A 2DM6A 1DAOA 3DZKA 4R1UA 1N1GA 3IDSA 4JIGA 2YW9A 1EBUA 4I9HA 3IIEA 3F6YA 4TZTA 5ICSA 4UVGA 4AJ2A 1HE4A 4RVUA 3UAGA 4CQMB 1BW9B 2QZ9A 2SCUA 1PL7A 1Y9EA 1Z7EA 3BAZA 3FN4A 4FJ0A 3V1TC 2OBNA 2ZYDA 2C5EA 4IY1A 2J8ZA 4HX5A 2IZZA 4OJNA 1YQXA 4ALJA 3PVZA 4EUEA 3BHIA 1E1LA 5CDSA 3Q2IA 3UHAA 5ILOA 1CYDA 2Y68A 3DC2A 4C7JA 5HBRA 4ZGWA 2QYSA 1P74A 1OMOA 4Y9DA 3JYPA 2X0IA 1QMGA 3L6EA 4YJFA 1JDJA 1FDWA 4PN3A 2V6MA 3QVWA 4FW8A 4XEHA 5A4DA 1NPTO 4W99A 3RUAA 3D1LA 2R00C 3SEFA 4J1SA 2D59A 1LLQA 3D4OA 4DVJA 5IZCC 3S2EA 2LDXA 2NVWA 1L1FA 3HDQA 4A26A 4YT8A 5CEEA 1QRRA 5C5IA 9LDTA 2P5YA 3UOGA 4GKVA 5JDIC 2VZ8A 3U9LA 1ZBQA 1X7HA 3JQBC 3DHYA 1U28A 2EEZA 3VTFA 2HMTA 4NJOA 1F8GA 4BOYA 1PGOA 2QW8A 4PLTA 4OM8A 1UZMA 4OSPA 2YV1A 4NR0A 4ND4A 1NFQA 3LC7O 4JBIA 3GMSA 5JPIA 4OXYA 2OGUA 1IZ9A 4CQMD 4B8WA 2DBRA 3FPCA 2DUWA 2EP5A 3PQDA 3JD0A 3WTCA 4OAQA 2VTDA 1E1KA 4CUKA 3DHNA 4EEXA 1BDBA 2VWHA 5FYDA 5KVVA 2I65A 3JQ9A 3WXBA 2EXXA 7MDHA 2AG5A 4WK6A 1BMDA 1NTOA 2HMVA 3OQ1A 3WJAA 3LLVA 4Q39A 4UVDA 2Y1CA 1VI2A 4B8ZA 4D0SA 2IXAA 2DTEA 2X0NA 1NR7A 2X9NA 1E1MA 2UV8A 4OSOA 4YYZA 2GDZA 4HKTA 4AJIA 3DZBA 1FJHA 2GERA 3F1LA 1EE2A 4G5HA 4UUNA 1CQJA 1GU7A 4PZDA 3E1KA 3L9XA 3GEDA 3W6ZA 3RUFA 1VL6A 2GGSA 3TZ6A 1DIHA 4YXFA 3LZ6A 2ZQYA 3ZV5A 3AI1A 4B79A 3EMKA 5U1PA 1P1IA 4DPMA 4NG5A 3L07A 2YDXA 4R16A 1ENYA 1GYPA 1T4BA 2EW8A 3CIFA 1A5ZA 4UUPA 3A1NA 1UP7A 3ZU5A 3GEGA 4F6LA 3EY4A 2V65A 3OICA 5H83A 1Q2XA 4CMAA 3U4HA 4BNWA 4CMKA 4WASA 5TRTA 4BNKA 1C0IA 2FWMX 5I7VA 2WYWA 5GY7A 4AJKA 4DL9A 2NU6A 4LRSB 4PCVA 1PQWA 3WTBA 3B1JA 1R4NB 5LCXA 3G49A 3HFGA 1B14A 1U5AA 1PZEA 3GK3A 2NACA 4J49A 3NTQA 1ONOA 3Q9UA 4ILKA 4WNIA 3V1YA 1WNTA 2QHXA 3GUCA 3Q3CA 4PZCA 4E13A 4NFSA 4ZJUA 5CEFA 3FR8A 3GY0A 4GSLA 3L4SO 3VDQA 4YAJA 1K6XA 3DMTA 4U5QA 4WOJA 5AVOA 5TLSA 4AJ4A 3AM5A 4CQMA 4J4TA 1BW9A 4CM4B 4LCJA 1ZW1A 3GC6A 3K2BA 4KQXA 3RJ9A 4EUFA 4OMUA 3GOHA 1XHLA 3AI3A 3EAGA 4QECA 4DMMA 3I3OA 3WJ7A 1ZFNA 1G0NA 1MP0A 2H9IA 4J4HA 3RCBA 4CV3A 3JV7A 1NHGA 4E5YA 1C0PA 4L4SA 1PJTA 2NQTA 1PJSA 2X1HA 3D3WB 3NDJA 2PH5A 1DC4A 3SC4A 1I3LA 3CUKA 2QQ5A 4PZEA 2G17A 5MDHA 4DLBA 3OH8A 3K30A 4MOWA 1X7DA 2D2IA 2NU7A 1HL3A 2BFAA 4P4NA 3AU8A 4M49A 2FMUA 3AFNA 4E2YA 1ZXBA 4DYVA 1ZK0A 3GFGA 4CLDA 3KOUA 4URFA 4EBFA 3ENKA 1A71A 4YRDA 1MGOA 3HUDA 3GVPA 2D1YA 1I10A 4PLGA 2GR9A 1ISFA 4RPHA 3EK2A 4QO8A 2NU9A 2P2SA 2BH9A 5EINA 4GSKA 1BXKA 4Y6RA 3TRIA 4IQ8A 4GGOA 3NJ4A 2ZB7A 3CE6A 3F9IA 4YT4A 2O4CA 4M55A 8LDHA 3O4RA 1ORRA 1T2CA 4BV9A 3QWBA 1U9JA 1ZCJA 4ND1A 1UP4A 3FWNA 3ANNA 5EESA 5BSEA 1OC2A 1XQ1A 1QV7A 4BNIA 4BO5A 5FWNA 4UVIA 1KYQA 4W7HA 5JDCA 3MCVA 1O89A 3ZI0A 5F5LA 3MTJA 3MJEA 3I9OA 1ZXLA 3W4IA 4AJHA 4PLWA 3QV1A 4RO0A 4BNVA 3K31A 1HDOA 3E5MA 3RC7A 2H63A 3ON5A 2IYOA 4NQZA 5K0ZA 1ZO8A 3I52A 1R15A 1IPFA 1GUZA 3KETA 5IN5A 5DN9A 2WJPA 4A73A 4CV0A 3U4IA 5KJFA 2DVMA 3AFMA 3RUDA 4MPDA 2PTGA 3K96A 5FF9A 1KIFA 4JBHA 2O3UA 4EGFA 1E0DA 4OHUA 4HFMA 4Y8VA 3LF1A 1G6KA 1T2AA 3PFFA 3D3EA 2WE8A 2AXQA 4JJFA 2ZB4A 4IJUA 3CKYA 2CDCA 1C1XB 4XB2A 1EK5A 3EW7A 4HY3A 3MJTA 2CSUA 3OJEA 4XRRA 4CLEA 4AJLA 2AE2A 1CERA 4RZHA 4MVJD 4ALLA 4BO9A 3V2GA 1BTOA 1EQ2A 3DXFA 3LQFA 3OF2A 1YB1A 4LK3A 5DBGA 3ZU3A 3FNHA 2V6FA 3PJEA 4PRKA 1EK6A 4XCVA 4UVHA 1JAYA 3WBFA 4BV8A 1R4NA 3CTMA 3PRJA 1NVMB 3JQGB 1YQGA 5I9MA 4WNCA 3ZNNA 1ZKMA 4OQZA 3FNFA 4OH1A 3CPSA 1U1IA 3CMCO 5FI5A 1IUKA 3ZWMA 4NIMA 3WGIA 3KLMX 3F47A 1DOHA 3GDFA 3ZNPA 3H4VA 4CMBA 1T24A 3IMFA 4FFLA 4E6PA 4RV9A 2VHYA 2CDAA 4KTVE 2QRKA 3HFSA 4CM4A 1LQTA 1Y5RA 3GPIA 4D3SA 2QX7A 4TRJA 1RM4A 4XRGA 3DHEA 1PJ2A 4MO2A 3SJUA 4RPJA 4R51A 4II2A 1M6WA 3EZLA 2E37A 1E5QA 3JQFA 1GZ4A 4JBGA 4CLOB 2A4KA 1YH3A 3D3WA 4O5OA 1UJMA 3ORFA 4PLYA 3ZN2A 5KJ6A 5F5NA 2BGMA 1U2GA 2P9GA 3BHJA 2OP1A 2PD3A 3GN1A 3ST7A 4CR7A 1UDCA 4I08A 5A03A 1LUAA 4MP6A 2V6BA 1DHRA 1IB6A 1FF9A 3FTPA 3FBGA 1YJ8A 1IZ0A 2QRJA 1CEQA 2G76A 3AOEA 1ULSA 4RDHA 2GZ3A 4YT2A 1DFIA 1RM0A 3M2TA 1YDWA 1RM3A 3E6AA 4WE3A 1CWUA 4UULA 3ANMA 4MVJH 5A3VA 2AE1A 2HJRA 2F00A 5T57A 3U09A 1U4OA 4U0KA 4ZICA 2A94A 2QYTA 2FPIA 3W8FA 1GAEO 1XIVA 3D7LA 3H2SA 4YDRA 4DGSA 2I67A 2EKLA 4CV1A 1F14A 4NBTA 3D5TA 4IDCA 1TLTA 3KXDA 1H0KA 1HWYA 1BXGB 1EBFA 4GVXA 2CY0A 4IS2A 8ADHA 1HDXA 5BT9A 3A06A 3LU1A 1CJCA 2Y0CA 4TWRA 3W8EA 1VSUA 5BNTA 1X1EA 1HDZA 2YJZA 4P38A 1GPJA 1I3MA 1H6BA 3DTTA 5ES3A 4B3HA 1I36A 1LDNA 2JCXA 4A7PA 1P1HA 4INAA 3INRA 3H5NA 3JD3A 2W2KB 4U7WA 1QP8A 2TMGA 2ZJ1A 4JP2A 4GLLA 1N2SA 3UN1A 4Y98A 4IDBA 1KC1A 3I5MA 3TPCA 4D44A 2CD9A 1JKIA 2DPHA 3H7AA 4J6FA 1V0JA 5KVSA 1FDUA 3M2PA 1FXSA 2IRWA 4I8XA 4S3MA 2RH4A 3QP9A 4A27A 1I24A 3WIEA 3IP3A 1U4SA 1HE5A 1GD1O 3HQ4O 3BHMA 1WDLA 3FI9A 3L0DA 2J3KA 1C1XA 1B26A 3JTMA 1KERA 3DO5A 5COAA 4B3JA 3I9LA 2G82A 2C07A 3I9NA 2JFFA 4A5OA 4XX0A 4YR9A 3RBXA 3OIGA 3WR5A 4OIMA 4QFCA 1BHSA 3WNVA 1H2BA 3QIVA 1Y7TA 2Y0EA 4XR4A 2FR8A 2XXJA 3KYCB 2Z1MA 3H9EO 4IQGA 1O6ZA 4QT0A 5CHEA 1E5LA 1JWAB 2VQ3A 3WWZA 4I9NA 1QYDA 2RHCA 3BTOA 1B8PA 1Q0LA 3QWHA 4XIYA 1N1EA 4F6CA 4II3A 3JQGA 4FDAA 4Z6KA 2W90A 2OHXA 2ZB3A 2EGHA 1BWSA 4RVDA 5I9NA 3KLPX 1SEPA 4IS3A 2HRBA 3FRJA 1O9BA 4PLVA 4MINA 4U8GA 3VZSA 2ZYAA 3HDYA 1IY8A 1DRUA 2E4AA 3NRCA 1KEUA 3RKUA 2GCGA 1C3VA 2QG4A 2ZCUA 1NBOA 1XELA 3JYOA 4XB1A 4ZRMA 3WMXA 2C0CA 4ONEA 2YY7A 4HUJA 3PHIA 4RL6A 4S1VA 5ILGA 2J5QA 4R3WA 1A27A 5C7LO 1FMCA 5HS6A 1S7CA 5I8WA 1NQAO 1B3RA 1H6CA 2NVBA 3P5SA 1YJQA 3PDUA 4Y6SA 3H9UA 2WSBA 2BFMA 1FK8A 5KJ1A 4CLOA 1P1KA 4L73A 4K6CA 3LC2O 4BO4A 4PLHA 4BO7A 3JYLA 5L45A 3A28A 3WFIA 2J5RA 3PI7A 3OJOA 4FGWA 4BKPA 3LT1A 4DC0A 4NBUA 4ZU3A 1JN0A 3WOHA 1PJQA 2O3SA 2OMEA 3IAHA 4NPCA 3DOJA 3SLKA 1A72A 4EW6A 1EFLA 5L9AA 3VVBA 1XYGA 1LSOA 2PV7A 1A9YA 2AQIA 3B70A 2PWZA 2NLOA 1VKNA 5JY6A 4QXMA 4BNUA 1YQDA 3JQEA 3W1VA 4ZQFA 5IF3A 4CR8A 4Q3DA 4WUVA 1HZZA 1I5RA 4HWKA 5JS6A 2I6TA 4H16A 1GV0A 4MKRA 1XSEA 3U3XA 3PYMA 1NPYA 1NVTA 5EQDA 1EDZA 3OP4A 3U5TA 1GV1A 4E30A 3ABIA 4YRBA 1BXGA 2R00A 4R1NA 3AY6A 4ZVVA 1H6DA 5IZCA 4D43A 3L4BC 4QO7A 3H3JA 1V3VA 1NWCA 3T4EA 1KVQA 3CSDA 2PZMA 2Y93A 4QSMA 3WS7A 5JDIA 1B3BA 4CM8B 1X1TA 3JQBA 3VKUA 4IDFA 4LGVA 3SXPA 3IKVA 4DMLA 3QQPA 1I32A 2BD0A 1DRWA 3AI2A 2VYND 1MV8A 2J3IA 2DBVO 1IHXA 2W2KA 5G4KB 4IDAA 4F45A 3KZVA 2IZ0A 3PQFA 4BHTA 1AXGA 2VTEA 1PJLA 1LU9A 3H9QA 4ITUA 4E0BA 2IEDA 5AXCA 1A4UA 1FDVA 2FN7A 3I4CA 1WAMA 4M89A 4TKLA 4CMCA 1KEWA 1QXSA 1KVUA 3VPHA 2X7HA 3A4VA 2OZPA 3DZGA 1WLYA 3GMDA 1DC6A 2PY6A 4J1QA 4CQLB 4J16A 4J91A 1DBVO 4I5GA 4AICA 2BKAA 1D3AA 3PIIA 5L4NA 3TFOA 2WM3A 4O63O 3T4XA 3FNEA 3VH3A 4FGSA 4J1NA 4XZ3A 5AQ1A 2I5PO 4A0SA 1NVGA 3SX2A 5TJ9A 2Q50A 2W4QA 3KYCA 3PLRA 2CZCA 4LCEA 5BNFA 3WQRA 3T7CA 4NFYA 3VH4A 2AEMA 3SLGA 1ZK3A 1SOWA 3ZWNA 1LDBA 5A9RA 3GDOA 5G2OA 3K92A 4GMGA 3PWSA 4YCAA 3ZHZA 2DLDA 5EMHA 3HN2A 5JW6A 1J49A 3PFWO 3C24A 1MFPA 5KJCA 2EG9A 3IJRA 4HNGA 2Q49A 1XEAA 2X0RA 3WFJA 4IZHA 4Q3EA 3WYBA 4W6ZA 4QQRA 3E5RA 2JD2A 5B1YA 2Y1GA 4IGFA 4L4XA 2IODA 2C20A 1PSDA 1YBAA 1B7GO 4YAGA 4XYEA 3MOIA 1BSVA 4FQ8A 4GAEA 4N5LA 2FOIA 1MLDA 1AHIA 3MZ0A 5CAEA 5EIOA 3INGA 3W4KA 5BSFA 1VJ1A 2C2YA 5IJZA 2VOEA 2ZIZA 1D1SA 2OBYA 2VYNA 2CDBA 2OO5A 1PJ4A 2GYYA 3DONA 1HXHA 4EYEA 4GL4A 4GX5A 5L51A 1Y6JA 2EJWA 5TT0A 3OMLA 1P77A 2GF2A 4NH4A 1UDBA 4QFDA 1R4MB 1HYGA 2VWQA 1YB5A 1J5PA 4RF5A 3WSVA 5G4LA 5H81A 1QYXA 4WCFC 1N8KA 4WCDA 1ZJYA 1VE9A 2GN9A 3BTVA 1GR0A 4DUPA 1WDMA 4G65A 1X14A 2PNFA 3ANLA 3KSZO 4GMFA 2I3GA 2Y05A 3I9KA 4FFNA 4Z0PA 9LDBA 4HV4A 1K0UA 4HFRA 3N58A 3H6KA 3TZKA 3PHLA 2GPTA 3AOGA 3KYBA 3RKRA 3RI3A 4BNLA 4DPLA 3GEMA 4AJOA 3K73O 5ER9A 4ROSA 1EVZA 1Z73A 2E48A 4R69A 4XYGA 2Q2VA 4CM8A 4IIUA 5H82A 2D4AA 4KWHA 2NWQA 3ENNA 5B12A 1YDEA 5L7YA 1D4FA 1QV6A 4W7IA 5JLAA 4AJJA 5CPBA 4BB5A 5K6AC 4E5PA 2EGGA 1N7GA 1DAPA 1H6AA 4TKMA 3ADOA 5G4KA 2TMDA 1E1NA 5TGDA 3ZWBA 1YL7A 2QIOA 1LA2A 3VPSA 3C1AA 3NAQA 3UGKA 3AW9A 1E7RA 3QVXA 4MJLA 2AEJA 1QORA 3TL3A 4NFHA 1EVIA 4FFMA 4L4RA 2PK3A 2EP7A 4NU6A 3BMOB 3MJSA 4YRAA 1LDMA 3OIFA 1OBFO 3DB2A 1BXZA 4CJXA 4AJ1A 1SC6A 3HG7A 2D3TA 4CQLA 1P1JA 4J3FA 5JO9A 1UXKA 3LYLA 4FPXA 1GQ2A 4L9RA 3WQQA 5U9CA 3U4DA 4NNJA 5L4SA 4N5NA 4PG4A 1H2HA 4TQGA 3RIHA 4P8RA 3H5RA 3A9WA 3TZCA 1EE9A 1KBZA 4CMIB 3U49A 4MDHA 1KVRA 5I7EA 3GR6A 3KSDO 3HJAA 3W4JA 1YKFA 3ITKA 2HCTA 4NBRA 1MXFA 3CXRA 1JVBA 3O26A 4ZN6A 4FD3A 2FHSA 4PLFA 2XOXA 3OSUA 1I33A 2R2GA 1C1DB 4RLSA 4JJGA 5B4TA 2FZWA 4OXNA 5LDHA 3BXXA 3SBOA 1K6JA 4XA8A 2X6TA 2GLXA 5G0TA 3U4CA 1PZFA 2HLPA 4HADA 3OEYA 1PQUA 3PK0A 4DA9A 1DIAA 2DU8A 1JW9B 1SB9A 5T8KC 5AYVA 2HMWA 1DSSG 1I8TA 2G0TA 4PIVA 3E03A 5T5QA 2EHDA 1K3TA 5IDWA 3DZJA 3GRKA 2EIHA 3TWOA 4XYBA 4FFPA 3WMWA 4Q3NA 2B83A 3C3XA 1VRWA 3LLSA 4YB8A 4CLHA 5CP8A 4HFNA 1LDGA 3GRPA 4GWKA 5DULA 5KOIA 2JAHA 1PR9A 1ZEMA 1NPDA 1FDTA 3GVIA 2AQ8A 2WEKA 3ROQA 5JMWA 1R4MA 2PKQP 5IFLA 3NEPX 1Z6ZA 2Q46A 3G79A 4BMSA 1CF2O 5L3ZA 4FBGA 1MUUA 2FY8A 4GH5A 1PWXA 5EERA 1P9LA 1SZJG 4XDYA 5TIIA 1Q0HA 1ZIDA 3INTA 4HXYA 4Z9YA 1UXJA 4CL3A 3EDMA 3EVNA 4WLOA 4D3DA 4FN4A 1ADCA 3RAJA 1SBYA 4EJMA 3BTSA 1JVSA 3E48A 1SEVA 2YFHA 3L77A 4M54A 3ZWYA 2OORA 1R16A 3UF0A 4ZQEA 1BG6A 4RCVA 3RVDA 2B4TO 1BDMA 1U3UA 2YV2A 4O0LA 1A9ZA 2VCYA 4N5MA 3BYZA 1F12A 2JFGA 2Y1EA 1LSJA 4JQCA 3AM4A 3G0OA 3JYNA 1MA0A 1V3TA 4B4WA 3K8ZA 4IDDA 3T7EA 1DEHA 4RVSA 4PRLA 3LT0A 2GNAA 4E5NA 2B37A 4PVCA 2PZJA 4OOEA 1NFRA 1OOEA 4B7CA 1KS9A 2CUKA 2Z1NA 1LTHR 3R3SA 3V8BA 1M66A 4MVJE 4QX6A 2GN8A 3KEOA 4BKRA 4B4VA 3OEWA 4DYDA 1KY4A 3OQBA 2I99A 4RLHA 5KVQA 2CVQA 3ZV3A 5ITWA 3UICA 3AWDA 4LISA 3VZQA 2CF5A 1I2CA 2O3TA 1G1AA 2CMDA 3BMOA 3KBOA 4L0QA 2VUUA 3GVXA 1I2BA 1GYQA 1E6WA 2HK9A 4XGNA 5FI3A 3QVOA 1E77A 4MP8A 3JYQA 4GX0A 2Y1DA 2Z5LA 3B20A 1UZLA 3FNGA 3MOGA 3P19A 5LC1A 3C7AA 4L8VA 2C7VA 2H6EA 1HDCA 3O9ZA 1ZJZA 4BO0A 3AUSA 3RC1A 3KVOA 3OJ0A 4HP8A 4R41A 5JAIA 3RC2A 4TROA 3BMQB 3OBBA 3ZWVA 4ZRNA 5T6BA 4BKQA 4KUGA 3TN7A 1QR6A 4MVJG 2YHUA 1JAXA 1HTBA 2GN6A 2I3AA 3DZIA 3N7UA 4CMIA 5IG2A 2Y1FA 4U6QA 4WKGA 1ID1A 2BHLA 3M6IA 4EI2A 4OXKA 3JD2A 1VPDA 3HWRA 3AUTA 4UEOA 1GEGA 2O7QA 4I5DA 3FR7A 1C1DA 1Q1NA 1W6UA 2GUGA 4R68A 3DFZA 4J0EA 1HDGO 4HFJA 1E7YA 1PIWA 1YL5A 1GL3A 2FPGA 1R0LA 2E82A 4AJEA 2CF6A 3E9NA 3C85A 3DBRB 1HF3A 2JD1A 3C1TA 3NTOA 2RH8A 4UVEA 4XYLA 1BVUA 3JQ6A 1DFGA 1GCOA 3ZW8A 2DT5A 3NYWA 4L75A 3UFXA 2OL4A 3O38A 3UCEA 4AVYA 4KTTE 3RROA 2IYPA 1E3WB 3VKVA 1DDOA 4MKXA 2AW5A 3PPIA 2FSSA 1DRVA 3GHHA 1M75A 5FFFA 2DC1A 1DJNA 2RCYA 3F5QA 3VPXA 3ZCXA 3IP1A 1AE1A 3L9WA 3FPLA 2VRBA 1V9LA 3FF4A 3HB4X 4JK3A 3RFTA 4IMPA 1SO8A 2HO5A 3HDHA 5TT1A 4K9DA 3QJ5A 3STHA 1ISJA 4ZHSA 3DMTC 2B0JA 3IJPA 4XD2A 3EHEA 5JYDA 3OJLA 4YQZA 4YAEA 4AL4A 3ONDA 4LN1A 1LI4A 5TF4A 1Q7BA 4D46A 4E33A 4LW8A 3H8VA 1W8DA 1XQ6A 3H3FA 3RQSA 3WIDA 2NU8A 5G0SA 2EKPA 1BVRA 4J4BA 5G0WA 3ROMA 1MB4A 2DBQA 3X2EA 2BGKA 1NQ5A 2A9FA 1HEUA 2HAEA 1TT5B 3CMMA 3NUGA 4N54A 3VC7A 5EQFA 4BQRA 2R6JA 5C7IO 5JNLA 4R5MA 2B4QA 2P5UA 5G0UA 2XF8A 2JHFA 3NKLA 3TDKA 3ZV6A 4IIVA 3EGOA 3NDRA 4NI5A 5DCUA 5CDTA 4J0FA 1E3LA 4GPD1 2W2LD 2B69A 2UAGA 1EUCA 4YQYA 1U2DA 1H5QA 1NAHA 4BO8A 2E6UX 1C0LA 4JJIA 3SVTA 1KOLA 1RJWA 4IQ0A 3PHGA 5TC4A 3RWBA 2ZTMA 4MVJA 1YBMA 2O50A 1C14A 4DLAA 5I7FA 5K9ZA 1F17A 1YBVA 2B5WA 2OXIA 5ADHA 4YPOA 4TMFA 4U0JA 2NVUB 4B3IA 1P31A 4BKOA 1YB4A 2NSDA 1GPDG 3I6QA 3L4BA 5HRUA 1HSOA 3RD5A 2Q1SA 1CDOA 3PDJA 4DBVO 3QA9A 3WB9A 1GUYA 5DCYA 4B4UA 1QYCA 1MX3A 4B7XA 4WJZA 2VNSA 1DPGA 1YONA 2V6GA 2ZJ0A 3ETGA 3KUXA 3L6DA 2POQX 4BB6A 1E3EA 4FFOA 4JN6B 3HNPA 5KNLA 2WD7B 3B6ZA 4BNTA 3WWYA 3BMQA 4IZIA 5JO0A 1NNUA 1MG5A 1OC4A 4QTZA 1TI7A 5C7OO 4KOAA 1XWFA 2VZ0A 2HJSA 2JFHA 1HKUA 2YHIB 2BRUA 1Y5MA 1WW8A 1IPEA 3NDIA 3SC6A 3UCXA 4BO3A 3C7CB 1ZH8A 3ONEA 2O3RA 4PVDA 2GSDA 4CMHA 1LC0A 3NT2A 1ENOA 5C3MA 1ZVMA 4OOFA 2O48X 4EUHA 2CFCA 1A4IA 1VL0A 4PFJA 3OA0A 4R5HA 2W98A 2VUTA 2ZCVA 2C2XA 1GADO 4MIOA 5A02A 4YWJA 4BGIA 4CV2A 1WMBA 1ONNA 3KRTA 3DBRA 3FWZA 3AU9A 4LMPA 3VDRA 5IZ4A 4R1TA 5DP1A 4E2WA 5A06A 3VVCA 3K2EA 1IHYA 1HYHA 2W2LA 3RJ5A 2VT2A 1O5IA 4E2ZA 1RYDA 1TVEA 4KUHA 3VPGA 2Q4BA 1L7DA 1E3WA 1U7TA 4J7UA 4MVJI 1B16A 1H94A 1VC2A 1JWBB 4MP3A 4WLVA 1KETA 1IL0A 4NU5A 2X22A 1F06A 1V3UA 2O3JA 4ZA2A 3WGOA 2P68A 2QRLA 2OP0A 3LDHA 3PJGA 2Q3EA 4YJGB 1UAGA 1VJ0A 4GGPA 3WGHA 2QZZA 1LDYA 1GY8A 3H9GA 4JXKA 3MWEB 4BNGA 3E82A 3BMNB 3O8QA 4BL5A 1Y9AA 3D4PA 3GH3A 5IAAA 1VJTA 4WPGA 2X5KO 1ISGA 1GZ6A 4W9NC 1H9AA 3P2YA 1DJQA 3QRWA 3IL2A 4H3VA 3ZV4A 4A2CA 3AUAA 1PZGA 4RF4A 4ALMA 1EMDA 4DXHA 2WYVA 2PD6A 2DAPA 1DIBA 3LK7A 4BS9A 3M1AA 4DRYA 3I1JA 2VT3A 3DWFA 1N92A 2GO1A 4TSKA 2PKRA 1Z75A 1TT5A 2A92A 4GI2A 5J23A 3VH1A 5EL0A 4CM3A 1SMKA 1AN9A 3CEAA 3U0BA 2I66A 2VRCD 2NTJA 3LT4A 5EJ2A 3OHSX 1J4AA 1E3JA 4MVJP 5KJEA 3TFQA 3C7DB 5F3RA 3IUPA 4BKUA 1UH5A 3H65A 2B5VA 1ISHA 2YDYA 1O8CA 3PJFA 3AY7A 4IJWA 1KEVA 4I5FA 1GQYA 4UAGA 1Q7CA 3ETEA 1MC5A 1SB8A 1QYWA 1WWKA 2Y67A 2HUNA 5A9SB 1T4DA 3E9QA 3ONFA 2NVUA 1T1RA 3DL2A 3PWZA 1VSVA 4QEDA 1E6EA 1ZMTA 3DAPA 4NK5A 1BGVA 1KEPA 4Q9NA 4WLEA 1YS4A 5F21A 2WD8A 2B4RO 3AY3A 3GVCA 5HA5A 3ZZNA 4KDFA 5FEUA 1U3VA 3MWDB 4FB5A 1PS0A 1RPNA 4AJNA 3VZRA 4DLLA 4R9SA 5IDQA 4JX8A 3U62A 2GZ1A 5K6AA 6LDHA 4D79A 2Q2WA 2JJYA 1DIRA 3B1KA 4XQEA 1XU7A 3JQAD 3WQSB 5TSDA 2EKQA 2WD7A 5JXWA 5L4LA 4LRTB 4XGKA 2O7SA 4KP7A 4DREA 3E18A 4J90A 3AJRA 3COSA 3QWIA 4PLPA 3UKOA 4Q3BA 2ZB8A 4BUCA 4YA6A 4ALKA 2YZ7A 1PJ3A 1JA9A 1QLHA 1NR1A 4CMEC 2YHIA 2E49A 3LSYA 1M67A 3GF4A 1IE3A 1E7SA 3PYXA 4OGWA 4IBOA 4DIFA 4E32A 2IE0A 2JCYA 2NTNA 4PGFA 4MIEA 1D8AA 4LSMA 2WE7A 1U7HA 2RAFA 5CG1A 2P9CA 1T2DA 2OOSA 3GNSA 3WG9A 2D5AA 4WLUA 2DQ4A 5EPOA 5HM8A 4BVAA 2O2YA 2C7GA 3DDNA 3RC9A 1KC3A 5A1TA 4CPDA 3LF2A 2BFOA 5BSGA 2VRCA 4PG8A 3N74A 1ONPA 1ZEJA 2Y1OA 3IC5A 2C59A 3OA2A 3RFXA 3EVTA 2HU2A 2VWPA 3DTYA 1PWZA 3DAGA 4DTIA 2UDPA 4DC1A 4EJ0A 3D4NA 2RHRA 4YJGA 2CVOA 1JKFA 3GZNB 1LNQA 1TEHA 4I5EA 2WWRA 1XU9A 2ZTUA 1N7HA 3PIDA 3BMNA 5JC1A 3Q1LA 3KTDA 2P4QA 2AG8A 1PZHA 5T8KA 1ENPA 5JSFA 1DC3A 4XGIA 1YL6A 3KM0A 1B8UA 4MIYA 4EZBA 1LRJA 3KYDB 1KY5A 1Y1PA 4RVGA 1Z45A 3NT5A 5MGBA 4FJ1A 2NV6A 3KV3O 2V7PA 3GG9A 2NTVA 1B0AA 2JCVA 2F1KA 1GZ3A 3KSUA 3Q9NA 5DBFA 3GLQA 2DBZA 5DDIP 5ENDA 2YFQA 1YOVB 5L7WA 3WGYA 4E21A 1GUFA 3GFBA 3E9MA 4P4GA 4GX1A 2HSDA 1HLDA 4JROA 3EUWA 4GLOA 5A3JA 2GN4A 5KVCA 1ZK2A 1NX6A 1D7OA 3PTZA 4FC7A 3GAFA 3QWAA 1XGKA 2X5OA 3GNTA 1Z82A 4Q3AA 4IPTA 1NFFA 4P22A 2AA3A 1ISIA 3RUCA 3DMYA 4M87A 4NBVA 4R4JA 3S1LA 2C54A 2EV9A 5A9SA 3GDGA 4NMHA 1W4ZA 4Y67A 2DKNA 2G1UA 2Q1UA 4R54A 1X15A 5GZ3A 5BQFA 3R0IA 3GUYA 1GEEA 4TRMA 1KVTA 3V2HA 4XWYA 1GFSA 4WLNA 3GHYA 4TVOA 2OFPA 1A7AA 4FR5A 4NJMB 5HS4A 1HETA 1ENZA 1K89A 2NM0A 1A7KA 2C5AA 4ZQGA 4QUKA 1R37A 1SNYA 3NX4A 1H93A 1K6IA 2VWGA 5BNIA 3FCOA 1NM5A 3PZRA 1J6UA 1TT7A 4YEDA 3G17A 4O1MA 4PLCA 4TRRA 4DBZA 2XPCA 4R9RA 2CVZA 1U8FO 3OECA 1LRKA 4KQWA 3JD1A 4Z3KA 4OKNA 5DP2A 2P9EA 3V2UA 1P45A 2DTXA 3G1UA 3ASUA 1KVSA 3KB6A 1GCUA 5JBIA 1LSSA 1QG6A 4L74A 5GMOA 3S2IA 5F1KA 4J7XA 2IEBA 1PS8A 3K5PA 5JE8A 1L7EA 2BELA 3EC7A 4RGBA 2WYUA 4J9VA 2O4UX 1OZAA 2I9PA 4BNMA 4D7AA 3DBHA 4IDEA 3DR3A 1E7MA 5DNAA 5AOVA 2VYVD 4OO3A 4J9UE 1TA4A 5AXAA 5I8ZA 4CLXA 3JD4A 1RYEA 4YVFA 1XG5A 1G0OA 4E31A 1T1SA 3PGJA 3ITDA 2Y66A 1E3SA 3G1TA 2HQ1A 4YAIA 1DXYA 3MJCA 3IUSA 2JHGA 4XYMA 5CEJA 2X0JA 4XQ9A 1VM6A 2C29D 4MVJF 5TX7A 3HHPA 4UEJA 5TJHA 1P33A 3VAZA 1CETA 2FPPA 4WGGA 3WLFA 3FHLA 4W82A 4MVJM 1JU9A 4OL9A 1WVGA 3ZWWA 3WNQA 1SAYA 3GZNA 3ROKA 3QVSA 2VOJA 4U6SA 2PGJA 1HRDA 2VHWA 4G81A 3ZWOA 3AUUA 1C0KA 4JLWA 4CM9D 4TVBA 4ALNA 4D41A 2DUUA 3EZYA 4WLFA 4YJHB 3UUWA 4CM7A 3KYDA 4BO6A 2BFPA 1CQIA 4Z0HO 5ER6A 4BO2A 3ZWAA 1UAYA 2CNBA 5DBIA 3GZ4A 2O23A 3QWFA 1AUPA 3ZNQA 3CZMA 2WDZA 4RF3A 4ND5A 3TZHA 3UW3A 1HSZA 4MKZA 3I9MA 4XIJA
chains in the Genus database with same CATH superfamily
3P9SA 2EARA 4G6ZA 4TV8F 3ZLBA 4MS3B 3GJ7A 4D45A 4QOJA 1VL8A 2J33A 4FC6A 3VYVA 3U1BA 1BIFA 3KJFA 4IMIB 3DE5X 2BKEA 4Y2JA 4BVLA 1FFYA 4OQFA 2QI9F 5INTA 3E3OA 4OHVA 4HNVA 2OZEA 1T1IA 1RABA 1NC3A 5KHOC 1NXVA 4A8PA 2Q1TA 5K0FA 3NT4A 1OF1A 5DWQA 3TMYA 3UVEA 1ZR4A 2A9JA 4R3NA 4RM2A 2IUFA 5FLKA 1MQ8B 3PJDA 4UMEA 1NVUQ 1RAAA 3BFXA 5IC6A 1U9CA 2GBIA 4HDMA 4LF6B 3MERA 3NORA 1PDVA 1UBEA 3OPYA 2IH5A 2AMFA 4HD8A 2F1IA 3PKIA 4D9FA 4LYJA 2PUHA 1ZIXA 1LEHA 4B7AA 4URXR 4I4LA 2HLDD 3PUWA 3IIJA 4RS3A 1W0KD 1YR2A 2VYVA 3CJRA 5CB6A 2QE7D 1XMPA 1GKYA 2G67A 1EFPA 1AGXA 3W5AA 1HK7A 2J3JA 1W0CA 3ECCA 1ZISA 5E4YA 5ERGB 2H18A 4D6YA 3J81k 3TQSA 1YBFA 4HS4A 4JI7B 5GVRA 2C0PA 2FMFA 1U0NA 3DNPA 4GWGA 4RS4A 3BE4A 4KAJA 3OFJA 1LSUA 1DEOA 5FPPA 1GT91 1AGNA 2K7ZA 2PGLA 1AXEA 2M1ZA 1CPYA 3DH0A 4E4YA 1R0BA 5JNTA 5CCXA 1U3FA 1EKXA 3GROA 3T7SA 3A6JA 3QFRA 3WGGA 2XA9A 4C3OB 3R1IA 2H7VA 4OX9B 4KMSA 3CY6A 3ML1A 3WWEA 1IG0A 4FU0A 3QEAZ 2NSJA 2V4MA 3EB9A 4L9AA 1PV1A 2WU4A 1CRQA 4JJAA 1OA0A 5IULC 1Y0BA 4MR7A 5KQLA 2BZ0A 1A1VA 3DZHA 3N87A 3ICQB 3JQ9C 3LC0A 1Z0IA 2BFDB 4NP6A 1BNCA 3EVFA 3BEDA 3L6OO 3MRTA 5FUVA 3RS5A 2XUQA 2VBGA 5JSKA 4B33A 3S1SA 4FLEA 4WOPA 2N0SA 5E1MA 1ZOIA 3AF3A 3BRSA 3OFND 3SOZA 3TOXA 1ZJ6A 2H2WA 5FHQA 1E2PA 3Q11A 5FA6A 1TIKA 3NHFA 3AEUA 4F9TA 3UMYA 4LQDA 2B3TA 1YULA 5J9FA 3GGPA 2DFLA 3RFFA 1V8OA 4BGVA 1SCUB 3ELUA 4FOOA 5DKFA 5JHHB 1HE1C 1LDEA 1ZN2A 4IIBA 1ZVKA 1C8VB 3T0FA 3V5NA 3PLAE 1EP2B 4IXNA 3D6TB 5ETJA 2GT1A 5FPTA 5BVHA 5J63A 3RASA 4E1BA 1KI3A 1NJ5A 3EFEA 3E8XA 5I7WA 1M0SA 2J0SA 1LXCA 3B8EA 3UXHA 5J1SB 4DUGD 1VJDA 4DQKA 4R1SA 1JXAA 2RB5A 1E2KA 4JCCA 2CLHB 2VK1A 2JGAA 3KEQA 4XB6B 4BJ1A 4OYHA 4J43A 2VO1A 4UHHA 2ZWOA 3TLJA 4PC7A 1S2OA 3PR1A 3DLBA 3AFOA 4KAXA 4GVLA 2ZSFA 2ZRFA 1LBEA 1WUKS 2GI4A 4M99A 3NCTA 3TQIA 4BNYA 3S8EA 4UD6A 1KJIA 4UBJA 2PNJA 3VZPA 2FPMA 4ARSA 3GN2A 3ZU4A 5C37A 5BWNA 5CA1A 3W5DA 2IIBA 2J3LA 3WB2A 2ICAA 5THQA 1CZNA 1UZNA 2ZYSA 1NI5A 3P7MA 3PUYA 1G8PA 3D5QA 3I45A 2OTCA 5AVRA 2ZUWA 2HJVA 3TNDA 1UK6A 3H1FA 4RKFA 2ZPTX 5KNDH 3TFWA 1J0BA 3PXAA 4AWBA 1ZUD1 2XOKA 3OQJA 3I4FA 4K26A 5LDGA 1DLIA 3DGEC 1U9IA 4FILA 1E3IA 4OYRA 4UBOA 4BB0A 2E21A 5B4VA 1XRNA 4UOQA 1FDSA 4XQCA 1VKJA 3STXA 1DGQA 1V9SA 4BGUA 5K8TA 1R9JA 2GXUA 2PXXA 2YRFA 2AGVA 2VZ9A 5EZYF 3TQRA 3DXXA 5FWDA 1O6BA 3T1HB 2BTQA 3MWYW 3UW1A 2ZVQX 5KINB 3KPUA 3OJFA 3AT1A 1BEEA 1I5EA 3KHUA 2HDNB 4E12A 3L7YA 4P7BA 4UMVA 3W2HA 4QT4A 4L4YA 3H5LA 3O0DA 5JCJA 4B4OA 2B1JA 1QH9A 2V7GA 3SWWA 1FUEA 1X1RA 2QTMA 3GGOA 4KXYA 5IBQA 3SXUA 4CLRA 5JAQA 4PV7A 4M8LA 3K4PA 1OFGA 2EW2A 3R9IA 2AHRA 3JY6A 4RVFA 1FTSA 4W9NA 4EVQA 1V26A 3C4JA 1AQJA 2LD4A 1A9SA 3O2SB 3PJRA 1T26A 3DSRA 1A8PA 3ZH9B 1LLUA 4EW3A 3TI9A 3KZNA 1IZYA 5A05A 3BGOS 4JJ7A 1J09A 3BA1A 1QIKA 2V0GA 3IMEA 2JKVA 3VR5D 2VQFB 1FBNA 4WKCA 1VRCA 2X1LA 3AK4A 3JRNA 3MA0A 4O02B 3D0KA 2F9FA 3VHRA 5DLDA 4B9EA 4O2BB 2ZYTX 2JKYA 2WJVA 4NATA 3PDWA 5IAJA 2VJBA 3ZD8A 1P6QA 2C57A 2YS6A 4BQPA 3AINA 2WF8A 4GHWA 4BNXA 2HYIC 3HADA 1I6LA 2AEFA 1FU8A 3ICCA 4B71A 3DM9B 1ML4A 4EHIA 4EJSB 2QTAA 3HBMA 1JB1A 1WXFA 1AD2A 5BQXA 3LUFA 3VU9B 1XMIA 3IBSA 3NV9A 2II6A 5K4AA 4KO2S 3ICPA 4K88A 2IXEA 4LX8A 4X44A 2GAIA 4WT7A 1E2FA 3TXXA 1EK0A 2XIQA 4BB9A 1N2BA 2P1DA 1CUXA 2Q45A 4MQLA 3AETA 1F3OA 3VDNB 3OHMA 2RCNA 4EAQA 1CS0B 1EZ4A 4WGFA 1PJCA 3DEAA 4QPZA 3ZHBA 4LVUA 4B7ZA 1X13A 1XA0A 1D0IA 1Z5NA 4NEHB 4DWWA 4CDNA 4GQBA 2PMWB 1I3NA 2HEIA 3GFSA 2IU4A 3E5HA 1XR3A 4ID3A 1CT9A 3DCYA 2X9GA 2CB9A 3QVJA 2Y2VA 5D2CA 3TNLA 2PMCA 3Q9SA 3HY6A 1PR1A 4P6VF 4HEA1 5FFNA 2V7WA 5LIPA 1Y33E 4OFWA 2W2VA 1RRCA 3ETDA 5TPZD 1HYEA 1V8BA 1O0BA 2WI8A 1FP4A 5C1BA 3GJ4A 3MCUA 3DV0A 3RU7A 1OFTA 1V4BA 1ODIA 2JC3A 3KSRA 4RZ3A 5JWRA 2NO7A 3SMQA 1NUAA 2IOYA 3W5SA 2R96A 2ZVDA 3LTNC 4KYIB 4EMSA 2BF7A 5JAMA 2IS6A 1DBIA 4DV6B 1KQ3A 4R98A 3TTTA 3FMGA 3TOZA 4HLUA 4M6WB 5MN4A 1ESCA 4D8VA 3LP5A 3WV5A 1JFSA 1D09A 3HKCB 4H2DA 3VR5H 2QD3A 2BC9A 1ZCAA 5G0VA 2A67A 3AFIA 4KK4A 3L0BA 2AG1A 2YVUA 4CM1A 4CMEA 4HN9A 4E5SA 3PKZA 1GTG1 2O8NA 2WSSA 2VR1A 5FI0B 1TADA 1I3KA 3B1XA 3DQPA 3ZE9A 4CMGA 1ORTA 5EJ7A 1Z5WA 5HJEA 5JQWA 2D2VA 2A0UA 4EECA 4MV1A 3IOBA 1YC2A 1XJCA 4O4HA 2XDQA 5K99A 3TGPA 2PR2A 2B4AA 4AS3A 3MXTA 4CTMA 1CYEA 1HE3A 2XLBA 2R25B 3HB9A 4FKMA 1IULA 4XPZA 1MN6A 1H4SA 3S2GA 1EQUA 5LMCA 5DYYA 4WOKA 3PEYA 1E63A 5BMVA 4YMWA 1XHEA 4XWOA 4ZT2A 1JUDA 2VG8A 3P2OA 4XJTA 3R3HA 4XVRA 2ZSHA 2PQ2A 1KO4A 1HT0A 2PKQO 4BVFA 1FMJA 1R4ZA 1VHLA 5JMPA 3KKEA 4DARA 2X13A 5BWCA 4B3TB 1SBQA 2IPNA 1Z0FA 1LV7A 1QHXA 1KXZA 3OIDA 2YCLA 5FBQB 2WG0A 3ASYA 4P93A 2I4NA 4KEAA 1GYRA 2IDKA 4NDNE 3H16A 2KI5A 4KQIA 3IEMA 4HQOA 3LL4A 1PN3A 4EFDA 1I0LA 2IITA 4ZXFA 4D8YA 5H70A 4YRJA 2O8CB 4YDSA 3EG9A 2WJ3A 4M3NA 5EHXA 1PGJA 2ZZKA 1V6SA 2FA9A 4BMNA 3LHDA 2FP4A 2WWTA 2CSXA 2QW1A 1NUPA 3EVBA 4R2XA 1P1RA 5EUMA 2Y3IA 1QHSA 1BWPA 4FLMA 3DC7A 3CINA 3UT5A 1N9GA 4L9SA 3IEVA 2ATIA 1REQA 1PL6A 2AC4A 1ODLA 3K1ZA 2ZK7A 3T95A 3KJNA 3OPNA 2YUTA 3U5ZB 3M5DA 4RVHA 3V1KA 3I64A 5JFOA 5JYEA 4YY3B 4UJ5A 3D0RA 4QJ5A 1E1QA 4GBED 3V7FA 2B7CA 2W6JA 3HKBA 4CMJA 4CFYA 3V9AA 2ZSBA 3D0QA 2PLAA 2I76A 4FDTA 4ZPXA 2BEWB 1PDOA 2J6IA 2CE2X 2XWBF 3NTRA 1QYVA 2HYDA 1GGEA 4I4CA 1UUFA 5IAGA 1SZDA 3R3YA 4O4JA 5BUZA 2IS2A 5F4BA 2ZIVB 3I83A 4JL5A 4LMRA 4HB2A 3AOEC 2YV4A 3IB3A 2QR2A 1WXDA 4LYFA 2GCIA 1KR5A 4RQUA 3WB1A 1K6EA 4R9UC 4V1CB 4RF2A 2G6BA 3KAJA 5EJIA 4ENSA 3EARA 1S9HA 2D1QA 5AUNB 1UOEA 5HXAA 3T06B 3Q85A 1SC4A 3DDUA 2GD6A 3KJIA 4HH3C 2I0FA 3HH8A 2BI7A 4PO9A 1Y7PA 2WPDD 1OGIA 3BRCA 3GW8A 4CT4B 1N0WA 2OVBA 4AQ7A 4LSWA 4WZBB 4LDAA 3VV3A 1U81A 2V5UA 3RU2A 4X7MA 1J5EB 1JG2A 2VHXA 1P1BA 4ALIA 1HG1A 4FE3A 1VJCA 3FZNA 1WXWA 1O7JA 2NOAA 3IEIA 1IONA 2G5CA 3LQQA 5DT9A 3S7ZA 1GDTA 4OI4A 1QG4A 5AK5A 1X0XA 3RAPR 4DLRA 3PX3A 1BRMA 3ER6A 1CZOA 3GGGA 5EWMB 1JG7A 3RHSA 1G21E 2QJOA 3ZWCA 3GNQA 3CR3C 3H84A 1K66A 3M1LA 3O8RA 1T5DX 2RKWA 3CCCA 4UM9D 4EL0A 2JPDA 4HDKA 1GRNA 2WMDA 3EPKA 4V0OA 1BA2A 3MEQA 4KPUB 2RD2A 1KDOA 2EGUA 4M0EA 3BQMB 4IUYA 2XUOA 1RM5A 3BIWA 4ADSG 3GJ6A 3FD8A 3NEAA 2J30A 3D43A 2ACVA 1U9ZA 3DAFA 4JUFA 3V32A 2XF2A 3T7RA 2JG3A 4M98A 1NQWA 1Y1TA 1SY7A 2H5LA 3THRA 5HG0A 1UC5B 3NP7A 3K6JA 4PHTA 3UJNA 2OHOA 4C4PA 5EIXA 4B87A 3FMVA 4D0RA 1L4GA 5HSGA 3EYWA 4UAJA 4ECEA 4FKBA 4K6FA 5KIAA 3ZE1B 1BVYF 3CIOA 4ID9A 2CXHA 3RR2A 1PT8A 2PRKA 3K94A 2BKLA 1NBMD 2WUWE 2JLRA 5EE9A 4EITA 1G291 1JSZA 2UVPA 4QU0A 5HKOA 3RSFA 3THXB 4CZ2A 3GXBA 3V42A 3HGMA 4PNZA 4X1YB 1COWA 1JHDA 3LBAA 3GAAA 3IRVA 3I5XA 3LAWA 1NUSA 5KOHA 1Q7TA 2IY9A 3LYUA 4GZLA 2YXNA 2FMXA 1B2LA 1YUNA 5CG2A 3LPDA 4II7A 3CRRA 1VP3A 4IM7A 1OI3A 2D54A 4PTYA 3DZFA 4Y18A 3CVVA 4H27A 5JBNA 2GZ2A 4HC4A 1U9YA 2P9QA 4Q47A 1PT5A 3DBLA 3TOVA 4QC2A 2QGFA 2I9KA 2FP3A 3LCUA 3QSGA 1RZ3A 1NJSA 1CZHA 1M1ZA 4X54A 4TZKA 3K2IA 1VPVA 1IDN1 2C3UA 3F3SA 3RYFA 3PHJA 3I5AA 1AQYA 4YJ2B 3T1OA 1MOZA 4CUJA 3DFUA 3KT6A 2FLVA 3UPTA 3SPXA 2WSYB 4POOA 4J2OA 3FSRA 5TS2A 4ZKEA 4PYRA 3AHFA 5DIZA 1T35A 1ZIOA 1ZM2A 1P0PA 2EJVA 4ZO9A 3CX4A 2Q41A 1I2ZA 3OZGA 4CODB 5LP6F 1B00A 1GPMA 1PE0A 4ARCA 1AHNA 1JDPA 2Q5EA 2WMNB 1U1CA 3DBOB 1QRDA 3IP6A 4M8SA 2XRZA 3LK6A 5DOVA 1DQPA 1T9DA 1UP6A 1YR7A 3H1EA 2PVPA 4L3WA 2V7QD 1QDUA 3MQ4A 3OEEA 3X43A 4CQJA 3OSZA 3TSOA 1DHTA 2JIDA 2ZYVX 4ITRC 4CN8A 2B1RA 3D7KA 1TO1E 2YHBA 3RVNA 4D0NA 1R0KA 5DM0A 3RSSA 3ZYZA 1J0XO 1C4OA 2GPYA 9ATCA 5DTQA 3BFVA 4OKIA 2XBUA 4QVIA 5AVXA 4CM6A 3QFCA 1JWLA 3PQ6A 5LB2A 3JQAA 1GL9B 2VAVA 5C32A 1SUDA 4C0HA 5CIYA 2RHOA 3WK9A 1DAOA 3DZKA 3EZFA 4LJ6A 3UENA 4R1UA 3IDSA 3MLEA 1NKSA 3R40A 1LPPA 3ZCRA 3PC4A 4KNVA 4FYWA 4OXRA 1X8XA 1HNNA 4DYVA 3OTHA 4PFKA 1VL5A 4F2HA 4FCVA 5EIAA 3QELB 4ZK6A 2QZ9A 4ARUA 1QF6A 2SCUA 1NNSA 1Y9EA 2V45A 3V1TC 3G88A 5FBRB 2ZYDA 4BEJA 2PPVA 1JSCA 1U98A 3A9CA 3DJYA 4MS1A 1CX9B 2IZZA 4GLJA 2WIGA 3DKIA 4LFAB 2DPLA 3T5BA 2REQA 1Q84A 4OXIA 4URYR 4D4GA 3HCOA 4EUEA 3BHIA 4L3VA 3RAGA 5CDSA 4HNAB 1SUCA 2QVYX 1WXIA 3F7TA 1P6XA 2Y68A 3OEHD 4LF8B 3HR7A 3Q7IA 4X8OA 4Y2HA 4AX8A 5HBRA 1P4RA 2C7BA 2QYSA 1FX1A 1E9DA 1ZOPA 4WXRA 1CEEA 3MN1A 4GUAA 3ICWA 3C6BA 2WU1A 3ET4A 3G7SA 1A8HA 1YNOA 1NXTA 1A95A 4W99A 4BQIA 5A4DA 5AW4A 5TMDA 4XTRA 3GGDA 5FA5A 3SEFA 1JT2A 1D2MA 1RXCA 1QH1A 3C16C 4MUBA 3EIXA 3EXFB 3Q1KA 5IZCC 2WWFA 4FQ5A 5ALOA 3BA6A 1O5TA 1Y8CA 4BXOA 3QVLA 1UXOA 4ZOLF 4GKVA 5JDIC 1PR6A 5LXTF 3U9LA 4J0DA 1ACLA 1GCIA 1ZU5A 3JQBC 4GOKA 2Q1XA 5CDFA 1Z4IA 2CVPA 2EEZA 4FGLA 5DN6A 2FZVA 1F8GA 2OCKA 3KCNA 4MICA 3EWSA 3WI7A 2J7PD 4ER0A 1N0IA 3DFIA 1TM4E 1R0YA 5E7IA 1UF9A 4KW7A 5CXQA 3LA6A 5FUBA 3QFFA 4JBIA 3GMSA 3A3PA 3BFPA 3RTGA 2W4MA 4L5CA 1X8LA 2IGTA 3T3EA 3AVWA 2C3PA 3AP1A 3FPCA 1QLWA 4D96A 2H0RA 1YDGA 3GUZA 3KVRA 3X1YA 1L4BA 4NCIA 1B43A 2VTDA 4OAQA 1NJ1A 2QUBA 4K40A 2NUPA 3WJ1A 1GAWA 1Y63A 4R0VA 7MDHA 3M3HA 3N2KB 3M4XA 1EE1A 4L0MA 2AG5A 4LWQA 4Z4IA 1XZMA 2A9QA 2O2DA 2IYAA 3IP5A 3OQ1A 2F3SA 3F7NA 1I4TD 4NBSA 1ZMXA 2QM7A 1WSWA 4PZ9A 2W2QA 4DM7A 2MMGA 1VI2A 2CLFB 1EP1B 1YS1X 1UEXC 3EXHC 3IT1A 1KJJA 1NG1A 2DTEA 5I7AA 3V2IA 5J3JA 2WABA 3IUYA 4OSOA 4YLEA 4F6RB 1X1DA 3BK2A 4MQ4A 1QCYA 2GDZA 3AP3A 1NVVQ 4Q1BA 1FA9A 2BEKA 5AHWA 3HGQA 5JIBA 5EQTA 3F1LA 4B4DA 4QM7A 5FV7A 3E1KA 1EJ2A 3AILA 3JWGA 3AR5A 1TJ4A 1UM8A 4E7OA 5AWFC 1J25A 2FZ5A 2GGSA 2NZWA 5CLJA 1YKGA 3HJFA 1OBVA 4QEZA 2XSZD 4B79A 3HI4A 4DPMA 1I7PA 4R16A 1QKJA 3K9GA 1ENYA 1GYPA 5E1DA 3WISA 3AFGA 1AMOA 5F98A 5HFNA 4JITA 3CIFA 1H0SA 3A1NA 2ENWA 1JLHA 3ZU5A 3GEGA 4J7AA 1ZMBA 2WVGA 4F6LA 3WL7A 2V65A 3IHTA 3NBAA 3OICA 2D0DA 1Q2XA 2BDEA 4KHZA 3NHSA 4L72A 4QVGA 4CMKA 3KUDA 1YFKA 2HDOA 5T4EA 4M1KA 3SBEA 5TRTA 1JQLB 3ZKWA 3L8HA 5B57C 1C0IA 2XKJE 2WYWA 3ESXA 5FPKA 2IHNA 4P31A 2W6OA 5HQ3B 1BQ3A 3P26A 1OZ0A 1T5BA 3AVYA 1XB2A 1E59A 1P2VA 4LRSB 1YS9A 4D3YA 2B1QA 2C4HA 1LY1A 1M1UA 5M3BA 4UU1A 3G49A 4JB2A 1U5AA 3GK3A 1PZEA 4NZYA 1CDDA 3NTQA 3Q9UA 3DLIA 4GXQA 1WNTA 2QHXA 4LRQA 3IUEA 2QM3A 5K8JB 3HXKA 3T9AA 4H7HA 5HKKA 4LJRA 3PFBA 1ZS9A 1H2RS 2EZ8A 3F6SA 3RS2A 1Y5IA 3L0IB 1V71A 3LY9A 4GSLA 5EE1A 1O3YA 1ZBDA 4EZEA 1Z33A 3IHKA 1AKRA 4NCAA 3JZMA 4JBLA 1YU9A 3OWHA 5J59A 1NU6A 1XZCA 4F1JA 5DTRA 4WOJA 3GT3A 1IHPA 2AUNA 2CFOA 3IKMB 4AJ4A 2IZ6A 1DXOA 5KNBD 3P2MA 3GC6A 1P17A 3MRSA 2P2CA 1XHLA 3AI3A 3FKSA 4KLRA 5DLQC 3N2YA 3WJ7A 5FOXA 5PNTA 4NKRA 3X1MA 4ZU6X 1MP0A 2KE5A 4J4HA 5K0GA 4AY2A 1C9DB 2CUZA 1HV8A 1NHGA 1K2VN 1C0PA 2XTJA 3A26A 5EJGA 4GMXA 3RK1A 2O8DB 2DPYA 3L1IA 1YVRA 4L7VA 3MAGA 1KJ9A 1FYVA 3QZUA 4U3JB 4PZEA 5B2ZA 1Q0RA 2G17A 4WDQA 2GEJA 2WWHA 3MRXA 1FVOA 5TQ2B 1UMCB 3ZBUA 4DLBA 3OH8A 4F97A 2O8FB 3FFTA 2D2IA 1SBTA 2ZT8A 4O1HA 3AU8A 4KREA 3TD6A 4C76A 3DXYA 2RGGA 3QJYA 4UNSA 2GBGA 2WT8A 1R3DA 1FFHA 1ZK0A 3GLHA 3AHIA 3HCRA 2ESRA 4K1XA 1JXQA 4FN5A 4URFA 5ARBA 4UFPA 3CN9A 4BLWA 1E9CA 3N2GB 2WWWA 1XX6A 3OIWA 1I10A 5EMLA 3ZE8A 4GL2A 2GR9A 2R1ZA 3GO4A 4EHFA 4IFBA 1GPH1 2R8BA 4WFQA 4R0MA 1FPQA 2QN1A 4H6XA 2AKYA 2W22A 2ZI6A 1Y1KE 1ZM9A 2C03A 4BBZA 5AM0A 1QFJA 4Y2PA 1XFDA 5ALVA 4QXRA 3ND7A 1DKMA 4ENTA 2GEVA 3CE6A 4G1BA 8LDHA 4WZZA 1QTIA 2X9QA 5IVPA 4JR1A 2E1PA 3DL7A 4BV9A 5C0OE 2VC2B 1J2YA 2W93A 4RENA 4ZHQA 4JVSB 1GTRA 2R6DA 1UP4A 2Z2YA 4BRZA 5B7PA 3DYIA 3C70A 1DDGA 4WVLA 1XQ1A 4WXYB 1CQWA 4AJ9A 1QV7A 3DP9A 2NUTA 4H1VA 5FWNA 3PC8C 4FE4A 3KJQA 1P2BA 4W7HA 3W90A 1X8JA 5JDCA 1OY1A 2C0QA 3IXLA 3MCVA 4M38A 3A2MA 1VXOA 3MTJA 3MJEA 3EWNA 2JGFA 4N7BA 5F5LA 1ZXLA 2PANA 2XGJA 2OHFA 4NABA 1W4LA 1PWYE 4AJHA 5I4KA 1FP4B 2MYTA 1OR8A 4EKIA 1NW3A 3CF6R 1IOWA 4A1FA 3MELA 5CITA 3RC7A 2EIXA 4I3GA 5FJIA 5KNBH 2ISQA 2IYOA 1UK9A 2PT9A 2PUVA 2X5XA 3ON5A 4NQZA 3S44A 4BQQA 5FDFA 1R15A 1WY7A 3FDXA 1Y3FE 3N8KA 4A73A 3L2OB 3I28A 1DE0A 1OFIA 4WK2B 1NDUA 3F71A 3AEQA 5LUBA 3ECAA 5AJZA 3U7QB 4LXTA 4ZXPA 3FVVA 1A8QA 3LSTA 2AJBA 1YRQA 1J9EA 1Z6YA 2W2XA 1JFFA 2QN6A 1QWOA 1E0DA 4OHUA 4N3GA 1L5RA 1T2AA 2C1ZA 3E2PA 1CUWA 2Q0HA 4GVPA 3U7HB 4RACA 1SCIA 2NYVA 4Q9LA 3UO8B 4XB2A 3AZPA 3EW7A 5LYJF 5EYPA 2C4VA 3KT0A 5BSVA 4RK1A 1OGYA 1C3JA 4S1WA 2G1PA 2G1AA 3LE8A 5JLJA 2FSUA 2AE2A 2H0QA 2O07A 2Q5QA 4B73A 4Z5XA 4I50F 1AX9A 1NATA 1Z0AA 4DG8A 2HA4A 3HVKA 2QRMA 2G6TA 3DXFA 1TAHA 3LQFA 4X20A 4LK3A 3NHUA 2QE7A 4CBVA 3FNHA 1Q16A 3NBYC 4PRKA 4DLWA 1GHTA 3K6RA 1E2MA 1JYSA 2UXCB 1GQSA 3WBFA 5B7NA 1VKRA 2IHBA 3CTMA 1NVMB 3JQGB 2WICA 1MEOA 5L6LB 4B0PA 1ZKMA 1DTWA 2ZRGA 2OHJA 1WCXA 3FNFA 5KNDA 2MSNA 2Y8EA 4X60A 3VISA 2ZZMA 1GSOA 3BE8A 5CRIA 3Q5DA 3UQYS 1URPA 4NIMA 3EDRA 4R7ZA 1ORIA 2WJHA 3I04A 3F47A 3GBVA 4Q9IA 1GFIA 5BW6B 4MA5A 5AQEA 3ZNPA 2CMHA 5JPCA 3RTAA 2V7VA 1MHPA 4Z4HA 4ZCIA 4RV9A 5JEEA 2CDAA 4X1KA 2RKOA 3PCRB 4J75A 2QRKA 3HFSA 3OZIA 2XYHA 4CM4A 2I2AA 4TRJA 3LPMA 3ZD7A 4FMCF 3QG1A 3VXKA 4CU2A 5ELMA 5SV2A 5IH3A 3SJUA 2OXFA 2Z4RA 3HA2A 1M6WA 4II2A 2QKYA 5KYNA 3FLAA 1Z63A 3JQFA 5BQPA 1P4JA 3TUJC 4BV2A 2IC5A 3D3WA 3OD5A 4ILEA 4JU8A 4O5OA 3HDTA 2JARA 3TR6A 3T7JA 3ORFA 3AF4A 1WZUA 4ROTA 1NP6A 1Z0JA 1SUPA 5BYJA 2I29A 4IHQA 3TS1A 3DW3X 5DEIA 1U2GA 1RPZA 2K2WA 2PD3A 3LWDA 2OORC 4QTYA 4HWPA 2IYVA 5SZJA 4UM7A 4LOJA 1K9SA 4MVXA 3FTPA 4J29A 4DUGA 3BCRA 3C6QA 3GX1A 1YJ8A 5KHLB 4RDHA 2E3JA 2QX6A 4FZ5A 1DFIA 4OD0A 4N3CA 1GPNA 1IUPA 1MJGM 5GONF 1S5PA 1RHRA 5H9VA 4DJFC 4LK2A 2XUDA 3ANMA 3KC2A 3I39X 1UBSB 1RJDA 2HJRA 2F00A 3PICA 1F4PA 5C7YA 1Z3IX 4N41A 1SFRA 1U4OA 1DKUA 4Q9HA 1QIMA 2GAFA 3MG9A 3D7LA 2GHRA 3EOAI 2CK3D 4OMCA 4D2IA 1M6VB 3SG0A 4NBTA 1SK9A 1PWHA 1KOFA 1TLTA 2BHTA 4QJIA 4CCSA 3VKGA 1B74A 1WEHA 2AOTA 1BXGB 1EBFA 4PQGA 3KOMA 3EDCA 4NDZA 1DTSA 4ZHQF 5EHIA 2GM9A 1V8FA 2J3QA 4V3CA 4Y2YA 3BIXA 5KPDA 1FFGA 1HDXA 1VCOA 2ZJ2A 4L7QA 1G16A 4S0XA 1CJCA 3GOQA 4CKYA 1KEKA 4HDKB 1GNTA 4FK8A 4TWRA 3L7LA 1VSUA 1YCGA 3G0CA 3M81A 3PV0A 4F04A 1LBHA 3NHBA 4I36A 3R3ZA 5ES3A 1HUQA 4BWYA 2FGKA 1ZD8A 2G1KA 1TJ5A 2IW3A 3RIYA 1QQAA 3UJ3X 2H4FA 3IPXA 5AKGA 4ZCLA 3INNA 3D3NA 5FPHA 4JP2A 3LECA 4XUGB 2DJIA 1JALA 2WT4A 4Y98A 5EPEA 5JSHA 4D44A 1NC1A 3IPLA 2CD9A 3H7AA 4C05A 4QNMA 2P0AA 2IS4A 4QPCA 3NC4A 4GM4A 4IO1A 3VR3A 2OZLA 3KVNA 3QXGA 1AB6A 4M8KA 3M0EA 3CRVA 3N8GA 3CNNA 4E88A 2A8YA 1I24A 9MHTA 1B23P 1J2UA 3ABSB 5KAPA 5DISB 3KOXA 2VYFA 1GD1O 1XEWY 2P3LA 3BHMA 2F8SA 3FI9A 1UBCA 1SWVA 1CLEA 1FQOA 1JLRA 2CHQA 2FSIA 2J3KA 3L0DA 3VR5A 4P3NA 1B26A 2GEKA 1CZUA 2QTCA 3Q98A 3W9SA 4B3JA 2P27A 2EZ4A 2FPWA 2G82A 3IUMA 5REQA 4MWOA 4Z2YA 2WSMA 4I0WB 3I9NA 2ZIAA 3EXHB 4GZ3A 4PZUA 1MAHA 1OXKB 1RPTA 3B1ZA 1J8FA 2JKZA 4L5JA 2H07A 5BQOA 1Y37A 1H3FA 4XX0A 3FYUA 2VJYA 4C5BA 5FH9A 4OIMA 3WNVA 1BHSA 3LA8A 3RRYA 2A7XA 2Y0EA 4H4EA 4DJJA 4JEHA 4GR9A 4QOEA 1XE3A 4QT0A 3VNQA 2WWYA 2JGLA 4HDOB 4IGKA 1O8BA 4MB6A 1E3DA 2DCUA 2A0YA 1UJCA 4MR9A 5EUCA 3GLRA 4CF4A 4B3FX 4RZUA 1B8PA 1Q0LA 1JHOA 5DNUA 3H1AA 4XIYA 1U80A 1E60A 4II3A 3E5NA 3O4HA 2V0CA 3SS7X 3T1TA 4RVDA 2ZRJA 2DHCA 2EGHA 2ES4A 2FZKA 2R6FA 1SEPA 2HLNA 3M8KA 4LFBB 3FRJA 5L3SA 4LE2A 3PDIB 3KJZA 1FXWF 1TJNA 2ZWAA 4I55B 3EVDA 4PLVA 4I6GA 2B2CA 4EY8A 3HVJA 2HXYA 4I81A 2HLHA 3AIKA 4WXPA 3TNYA 4ZYXA 4ETMA 2BM1A 1C3VA 3JYOA 2PVCA 4PYJA 3LXUX 4XB1A 4KR3A 4Z99A 1A5TA 2C0CA 4ZT7A 4HUJA 4FFSA 2CLEB 4RL6A 3NAZA 1J23A 3L79A 4CRWB 3F7MA 2J5QA 4TXLA 5IJ9A 2O14A 4JEIA 2JK0A 3FWKA 3MS7A 3V8QA 1PKXA 2ADOA 2IXGA 3GIDA 2NVBA 3P5SA 3T54A 3LOUA 1YR3A 5SZKB 3HM9A 5KPJA 3CJTA 4PWYA 3G8DA 2WSBA 3ZEIA 3GLFA 2BSAA 5AJWA 1BO6A 1L6RA 3CLUC 4LJLA 5JV5A 4Q1AA 2QJWA 2GK4A 5L45A 3U19A 1TTPB 4QPJC 1RJFA 2SCUB 3LT1A 3UKJA 4NBUA 4ZU3A 3IAUA 1PJAA 3WOHA 1PJQA 1X70A 2PSFA 5IP5A 5HF8A 3SLKA 1CUVA 4TYYA 1VKZA 1P9OA 2IKSA 3VX3A 4E03A 1T1EA 1NKTA 3KUCA 2REQB 1X80B 2PV7A 5HBGA 3SZGA 3VPDA 1ILWA 1V41E 4RSGA 1FP7A 1OH5A 4G0PA 1QONA 1ZGZA 1WQ4A 3I6YA 3WKEA 4BGDA 5JY6A 4YUXA 3IXMA 3BJIC 3PXEA 1NR5A 1Z2EA 5IW8A 3W1VA 1V5IA 2J9FA 4V0KA 4ZQFA 5IC4A 1KI9A 2PKYX 3HYSA 4Q3DA 4X62B 2DB3A 4IIEA 1A76A 5JVDF 1HZZA 3JATB 3EGXA 3F6EX 2X4DA 3JRXA 3O1JC 3PR2B 1I5RA 4IF6A 4OSEA 2I6TA 4PXAA 2PUJA 4UEWA 3CZ5A 4AF6A 2X8JB 3BXEA 2HFJA 4MKRA 3UAWA 1NVTA 5JUWA 4QBIA 2QRUA 1XMOB 4EUKA 4CYMA 4JEMA 4AZ3B 5DTEA 4ZVVA 1R8SA 2RC5A 1GKIA 3UBMA 1ESDA 3G5AA 4P98A 3L4BC 3M33A 3VPCA 4KQFA 3V4OA 1VPWA 1KEEA 2CBGA 4DIFA 1W0JD 1MQ9A 2PZMA 2Y93A 2ZFUA 1YHZA 3CSDA 3LRXA 3SYNA 4UQOA 4QYIA 2P75A 3G2HA 1XZFA 2OHGA 3T3GA 4LGVA 4PZLA 3M9XA 1OT3A 4HTFA 2R79A 3QQPA 4ZRDA 5F77A 4DMLA 2PBRA 3CW8X 1M7GA 4OU5A 1V5WA 1W46A 3MTBA 4B0OA 2XQIA 1DAEA 1GJRA 4ARZA 5EHNA 4B40A 4QDUA 4R8LA 1A7JA 2WF9A 4BQOA 4RGQA 3UK2A 5JATA 2B34A 1AC5A 4F45A 1VDMA 1QHGA 2OCLA 1FYDA 2IZ0A 1TPZA 3OUUA 1GO2A 2ZXUA 4RNDB 2XWPA 2JIZA 4KVFA 2JHPA 4V0SA 2GARA 3S4YA 4ZVRA 1LU9A 4OM7A 5IFKA 1P19A 1RE0A 5AXCA 1AKEA 2EFEB 1QRTA 2C77A 1YZ3A 2EFYA 2JW5A 4M89A 1E1CB 2BRUC 1WAMA 3Q7PA 4TKLA 1KEWA 4YDQA 1CVLA 1NN1A 1SA0B 4UTZA 5LQAA 1T2UA 3A4VA 3DLHA 1CUJA 2X19A 1WLYA 1ZESA 2H16A 1QYRA 1W87A 2PX8A 3DZGA 3GMDA 3LUPA 5EE0A 4YP7A 3V7WA 2WUEA 4LYAA 2UYOA 4CQLB 5AKEA 1SD2A 2JI8A 4DAOA 4J16A 5GP1A 1XTTA 3L5KA 4AAYA 2C4NA 3QJGA 1TO6A 2VP5A 3JSXA 2C84A 2WM3A 2ZS8A 2EX4A 4FGSA 5AQ1A 3QXJA 2PT7A 1UBNA 1WXGA 2P9BA 4QXQA 3SX2A 3NZEA 4A4DA 3PLRA 1A2KC 4MW4A 2CZCA 4LCEA 2C99A 4YBRA 2Y76A 3WQRA 3F2IA 4NFYA 3VH4A 3WL8A 3HA3A 2J59A 3KHSA 3OY2A 3SF8B 4H77A 4OBEA 1ZK3A 4AY5A 3FVRA 1E2QA 1HI9A 1P4AA 1M8KA 3G0BA 1KMIY 1P7WA 1LDBA 1ETUA 1OASA 2ROQA 4K9RA 4FSXA 2I1VB 3KZKA 3LQ2A 3GLTA 4IEFB 4EW2A 3CBQA 1Z0DA 4RAQA 3HN2A 4HT3B 2Q8PA 1N8SA 3ZKWB 3PE3A 1JG4A 3C24A 4MUHA 1KYYA 2VP2A 3LUJA 2X0KA 2GAOA 1IJBA 2X0RA 4X1OA 3WFJA 2P5SA 3QVGB 4QQRA 1K88A 2JD2A 3L7KA 2QN3A 2Y1GA 3MQFA 2XYGA 4FLFA 4IGFA 5H0IA 5CH8A 1H2ZA 3DHWC 4Y6GB 2H2HA 1DEXA 1HEIA 1YR1A 2H4YA 2SKCA 4GD3Q 4HDQB 1UBFA 1RKBA 2F8MA 4NECA 2HB6A 4QGHA 1H5UA 4FQ8A 3MWEA 4O8CA 4GAEA 1FRZA 2YZKA 4XGRA 1AHIA 2ZJYA 3ZXIA 3MZ0A 1VHQA 3MC1A 5EIOA 1RLTA 4LYDA 5IVIA 4QDJA 3T7DA 4ZCRA 5CAEA 1SVLA 3FTCA 2C2YA 4A0QA 4IDHA 1C1HA 4TN5A 2VOEA 2YWJA 1D1SA 2YICA 2OBYA 4RD0A 2X14A 2IX9A 3HDVA 4OPMA 4YAWA 5L51A 4DHEA 4BJHB 3A3OA 1C7QA 2FSPA 3RRXA 1XEXB 3I01A 1R4MB 2PJZA 4JYCA 4GU5A 2BEVB 1NI4A 1Y3DE 2VWQA 3B13B 1F8YA 3I0MA 1OWNA 3JPWA 5K7SA 1ZGHA 3RODA 5KOYA 4N65A 2RC6A 5G4LA 2R5FA 1N4AA 5H81A 3P9KA 5FL7A 4AMGA 1XCGB 1XTVA 1N8KA 2ON6A 2PUGA 4C21A 1XALA 2CZGA 3BJMA 4JI5B 4C4TA 4DUPA 2G4LA 2PIAA 1V3QE 3SQMA 3HLKA 1G2OA 1VZ2A 2PNFA 3DMHA 1XCPA 4GMFA 4TXJA 4CEIB 2GYUA 2Q3JA 2QZPA 3NASA 3RHFA 4HV4A 4XFKA 1P73A 3H6KA 2QAIA 2VJNA 3N58A 4I2VA 4RL4A 3TZKA 1Y8ZA 1TEVA 1T9GS 2GPTA 1PLJA 2AZDA 2PEYA 3NAMA 2B4KA 4YRPA 2Q5JA 3KYBA 4JLVA 2CXTA 1GPBA 1QZTA 3ESYA 3CUYA 3GJQA 4KXVA 1KDYA 5FTLA 2R68A 1H65A 3GEMA 2LIPA 4ZZ1A 4C4RA 5LZ8A 1Z73A 1GNSA 2Q9UA 2ARKA 4P5DA 1QANA 1BN7A 2AFVA 2JGNA 4IIUA 3H2JA 4IDQA 4TL8A 3TNJA 2R0QC 2Q8QA 3ENNA 4A1OA 1YDEA 3LX8A 5L7YA 2ZOSA 5GADl 2EHJA 1QIJA 2NO4A 3VNAA 3UT0A 2J41A 3MWJA 4Q9DA 1XU4A 1W5AA 4XX1A 3UJ9A 1N7GA 3U81A 4ZO7A 3A1CA 1H6AA 2WAYA 1QCZA 4QUJA 3U2QA 2V7QA 3EMDA 1M34B 1TDJA 4FXOA 4KQJA 1SXJA 3D8TA 4UARA 1CHNA 5G4KA 2ZG6A 1LA2A 1X39A 4MA0A 2YWDA 4TYMA 5BN5A 1CW2B 3IO5A 1U5BB 2ONYA 3UJHA 1E7RA 1WHTA 1CBUA 4RIEA 4QDTA 1WDTA 4UMDA 3S28A 4HVLA 4UASA 3L4JA 3A3YA 1QE3A 1VL1A 4LVOA 3DPUA 4TMKA 3VU3A 1PG0A 4NYJQ 1N2CA 3O8DA 1L4HA 1T6XA 4Q03A 4TUYF 3GLGA 3DB2A 4C9BA 4D9JA 1KFEB 1JF8A 1UM9A 4N7MA 4CJXA 2CBZA 3AEYA 4AJ1A 4ITVA 5DGHA 1NIJA 3P2KA 3IBYA 5FTJA 1TA9A 2HIGA 1CR4A 2GK7A 3AEQB 4CWAA 1O58A 2RG7A 2I2FA 2HXSA 4E09A 3G59A 2VAWA 5U9CA 5B55A 3W6PA 1GTJ1 2VUIB 1YZNA 2ECPA 2PFKA 8MHTA 2YXLA 2JH3A <