2X4DA

Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
270
structure length
270
Chain Sequence
b'SMAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESAASRAELVGQLQRLGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYAATSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLYSINE PHOSPHOHISTIDINE INORGANIC PYROPHOSPHATE PHOSP
publication title Crystal Structure of Human Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase Lhpp
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 89
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2x4dA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2x4dA02
4H1WA 1Z5GA 2G0AA 2YFYA 5AVSA 1L7OA 2PKEA 1U7PA 3AR9A 3FPSA 4PNHA 4YCNA 2FUEA 1YMQA 3ZUPA 1U2TA 3OPXA 2OBBA 5A3SA 3ESRA 3SMVA 2R8EA 4CE6A 3B9BA 2P9JA 5ALTA 2Q4RA 5AW4A 2FI1A 3IJ5A 4L6CA 4Y2VA 2VKQA 4HGPA 4BNDA 5AW1A 1U7OA 3L1UA 3TLMA 2I7DA 5AVUA 1Z4OA 3AR5A 4CF5A 3ET4A 5ALXA 1ZRMA 2HF7A 3WKCA 2CFRA 3N1UA 2I55A 2IOHA 5AVRA 1X42A 2W43A 1RMYA 3WK9A 2JGAA 4NABA 3L8EA 2I54A 3UM9A 4DCCA 3QU9A 3ZVLA 2HCFA 3DAOA 1LVHA 1NF2A 2G08A 3NRJA 3A1CA 4J03A 5AKLA 3HLTA 3S6JA 4BX0A 4BX3A 5ALVA 2YN4A 5AM3A 2RARA 5A3QA 2YJ5A 5AVTA 1WVIA 2QLTA 5ALEA 3EPRA 1ZD5A 3N5KA 5AESA 1ZD4A 1ZJJA 5AI5A 2YMQA 2AMYA 2BDEA 5AVXA 1WPGA 2YY6A 3SD7A 2JAUA 2HOQA 3IRUA 4C4TA 4DFDA 5AW9A 5AW6A 5AIAA 3KBBA 3L1VA 5AIBA 1AQ6A 3QUTA 2WF6A 5IS2A 1RLTA 3WKEA 4RETA 4KNVA 3ZVMA 1O08A 1ZD3A 3W5DA 2BY4A 1YNSA 2OM6A 3I1YA 4UMVA 1MH9A 2B1RA 4Y3UA 2WHEA 1J97A 2P11A 4KYTA 3E58A 3D6JA 3ZI4A 5AKXA 1L7NA 1Z4KA 2DQSA 3ZX5A 4UAUA 1Z4LA 5ALGA 4KX3A 4OCZA 3NUQA 3A1DA 1RMTA 2IOFA 2W11A 3SKXA 3ZX4A 1EK2A 1ZS9A 5AKJA 4BEWA 4BKMA 3SLRA 5AVVA 1QQ6A 3FVVA 4UAVA 1Q92A 2OA0A 5ALOA 3WKAA 1S8OA 1RRCA 3B9RA 4OD0A 1U02A 5ALIA 5JJBA 2IA5A 2RB5A 4HYTA 3E84A 3R9KA 5AI6A 3ED5A 3L8HA 3QXGA 5AM4A 4NV0A 1XP5A 2G09A 2FPSA 5ALFA 3U7GA 4Y2SA 3DV9A 4IG4A 1Z4NA 5AW5A 3QU4A 4Y2TA 3A3YA 3FZQA 2GO7A 2NYVA 2FUCA 2Q4TA 3EF1A 3L5KA 1Z88A 2HI0A 1L6RA 5AW3A 2C9MA 2FDRA 2HHLA 3E81A 4ZEWA 3OCZA 3WK6A 3QNMA 3PGLA 4KN8A 4AS2A 1FEZA 3OCYA 4YIHA 3ZU6A 2FPXA 4J2TA 4Y2UA 2HO4A 3RFUA 4FE3A 3E8MA 2BDUA 5ALHA 2YMPA 5FP0A 4DWOA 2CFSA 3NASA 3ZWDA 4XPZA 3R09A 4GXTA 3L8FA 2RAVA 3WKBA 1YS9A 4HGNA 1RQNA 3CZ4A 3AR7A 4FYPA 4UM7A 1TA0A 5ALDA 3ET5A 2I34A 4Y2QA 1S2OA 4CF4A 2HSZA 3KC2A 3QX7A 5ALUA 3WKDA 3W5CA 2JARA 4L6AA 4UW9A 3F9RA 5ALMA 2CFTA 1T9ZA 3I28A 2GHQA 2AUTA 1T5SA 4I9GA 4MWOA 1Z4QA 2O2XA 2B8EA 1Y8AA 3L0CA 4YGYA 4XQ0A 5AKIA 2B0CA 3BA6A 3N28A 3OCXA 1TJ4A 3PGVA 4GIBA 4Y2JA 4YIKA 3ZVNA 4L57A 1XPJA 4EELA 2HEGA 1K1EA 4YCMA 2YBDA 1VJ5A 1QH9A 3GYGA 3U7HB 4ZEVA 1RMQA 4HGQA 3AR6A 3AR8A 4Y2YA 2ZG6A 4HGOA 2YJ4A 5ALQA 1CQZA 1SWWA 2C4NA 2YJ6A 4HGRA 4C4SA 2EARA 3HYCA 3KDPA 3QGMA 1RDFA 4EX7A 5ALNA 4FFDA 4EX6A 2B8JA 5AW8A 1IWOA 1RQLA 5AKYA 3NIWA 1VFPA 2I6XA 3QLEA 4E88A 4CNQA 4Y2XA 3KZXA 1JUDA 3QU5A 2MSNA 4Y2RA 1RLOA 5AK3A 4UM5A 3RF6A 4UMFA 3NANA 5AW2A 1VJRA 5AK5A 4O8CA 4C4RA 3L8GA 4Y2PA 1L7MA 2OYCA 2GMWA 3N8GA 2R8YA 2AH5A 1Z4MA 1Z4IA 3DDHA 3R4CA 3AR4A 2P69A 3NAMA 1Z4JA 2HX1A 1XVIA 3QYPA 3QUQA 3ZW7A 3QU7A 3DNPA 3I76A 1QYIA 2R8ZA 5AVZA 5ALJA 5AI4A 1Z5UA 2W4MA 5AI9A 4YCLA 4UMEA 5ALRA 3J7TA 1J8DA 4I9FA 4B6JA 1YV9A 4UASA 4ZEXA 4NAVA 3BWVA 1ZOLA 3KD3A 3VAYA 5ALZA 3FM9A 4DW8A 4UMDA 4AP9A 5AM5A 2C8LA 5AKHA 5AI0A 3WK4A 3ZTWA 1U2SA 5ALPA 2AGVA 2ZBGA 2FPUA 4OHFA 1Q91A 5AI8A 1WR8A 1QQ7A 4UARA 5ALSA 2FPRA 3ONNA 2CN1A 3AR3A 3U7EB 5AM0A 1RKUA 1CR6A 2MU1A 2WFAA 5ALYA 3ZWKA 2B30A 3A1EA 4CF3A 3M9LA 3UMGA 1NNLA 2C88A 5AKZA 3L0YA 1YJ5A 4BYGA 2G07A 1NRWA 5IT0A 2NO5A 4BBJA 3EWIA 2ZBFA 4YH1A 1TE2A 2YMLA 3WK7A 2WF9A 3UMCA 5ALWA 3U26A 3W5BA 1Z4PX 2PR7A 3MMZA 3M1YA 3OCUA 3QU2A 4EENA 1O03A 2B1QA 2ZBEA 1N9KA 5AVWA 4HAIA 3FGOA 3K1ZA 2FPWA 2G06A 5AW0A 1TJ5A 3P96A 5AK4A 3PDWA 5AM2A 2X4DA 2WM8A 3ESQA 1F5SA 5AK6A 2WF8A 2G80A 2QYHA 1LTQA 4NFLA 3W5AA 3FPBA 3OCWA 1L7PA 2NO4A 4KX5A 2JAOA 5T41A 5AVQA 2D2VA 4BNDB 3L7YA 1SU4A 3MPOA 4UU0A 2B82A 2HDOA 2FEAA 1L8LA 3WK8A 3U19A 3N07A 2IYEA 4AS3A 2ZXEA 2ZOSA 4BX2A 2I33A 3SF0A 5AHXA 5AKKA 4F72A 2WF7A 4XOUA 2GFHA 2WF5A 2R8XA 4G9BA 3U13A 3L0BA 5AVYA 1RPZA 3KOOA 3U7FB 3PCTA 5AICA 2YMMA 3CNHA 1RLMA 4OFZA 1WZCA 3IB6A 3OCVA 1EK1A 2ZBDA 4F71A 1L8OA 3MC1A 4EZEA 5A3RA 2GHTA 2Q5EA 1N8NA 1KYTA 3B8EA 4MUMA 5ALLA 4G63A 3WK5A 2JAWA 1ZD2P 4UU1A 4JDPA 5AKEA 1RKQA 2EATA 3MN1A 4IFTA 2RBKA 4QJBA 1PW5A 3I6BA 1QQ5A 2G1AA 4RESA 3SKYA 5AW7A 5IT4A 3UMBA 3AR2A 1RKVA 3EF0A 3QUCA 4JB3A 1TJ3A 2O9JA 4QQFA 5AKGA 2IOFK 2ODAA 2HF2A 2C8KA 4NWIA 1RC8A 2PQ0A 4XE5A 4KNWA 3QUBA 4BEVA 3ZTYA 3WGUA 3OTQA 4EEKA 2EAUA 3SHQA 5E0OA 2YJ3A 4UATA 1T5TA 5ALKA 1YDFA 2P27A 1ZRNA 1SWVA 3NALA 5AM1A 3WGVA
chains in the Genus database with same CATH superfamily
3UO8B 4DJFC 5K8CA 1EX6A 4JI8B 3K4PA 1U7PA 2YZNA 3HBMA 3ESYA 4CM7A 4NBSA 2B4YA 3IDQA 1P17A 3PD0A 3BH7A 4F21A 1ZWLA 2CXNA 3QKUA 4UBOA 1H66A 5SV2A 1IQ0A 1TLLA 1ONPA 3W78A 2EF1A 2I6GA 3RVQA 1A9QA 3CMMA 1D2AA 3JYQA 1H23A 2CK3A 2RHHA 4RABA 2PMBA 5FCDA 3TNYA 5IZCA 4YWJA 2P9JA 2YXEA 2BCEA 2FDCA 1V5GA 3TSZA 2DBYA 4ZT4A 1XZLA 1P0MA 2D3TA 1A3CA 1NI4B 1E4EB 1E9CA 1NV9A 2IF2A 3DBLA 3L1UA 4HNRA 1HE5A 3I2KA 4CFSA 3AR5A 5LPNA 3HCRA 3FLAA 3QVOA 3EXHC 3WL7A 3IUMA 1E3IA 3VU0A 2NV6A 1VE9A 1X1QA 4OH1A 2JGJA 1BO6A 2G9QA 4H08A 2FMTA 2Z1DA 4EA9A 1J9EA 3K8QA 3ZGLA 5CCXA 1Y42X 5ESDA 1N2EA 1X19A 5AK0A 2H63A 2J5XA 4TL7A 4URHA 4H3VA 2D2IA 1KF0A 4Q9JA 5EKXA 1V3TA 5EWMA 4RPLA 1KBQA 4DM3A 1Y1RA 1PF7E 2AW5A 1ZSVA 3GP5A 3U3MA 2Q3DA 2R97A 4CM3A 1FTWA 3A1CA 3F3YA 3F6CA 5BMVA 3SZGA 4RGQA 1HSZA 4CZ2A 4F38A 2EKDA 4JBGA 3EK2A 3UQZA 3C87A 1C9KA 1OWPA 5I8PA 3MJHA 2VJCA 1WVIA 2WD7B 2WMYA 4H15A 2QLTA 2JI6A 1YOVA 4L4YA 4M9SA 4Q47A 1PJ4A 4AIRA 1KARA 1RWMA 2GBCA 2WYIA 3BIJA 3IJEB 4MYHA 4YONB 2NYAA 1U9CA 1VI2A 1OT5A 2PKYX 1E64A 3ETHA 2FEWB 3GVHA 4GWLA 1A4IA 4N9QA 3V48A 1ST2A 2NZ2A 1I32A 3U49A 3USCS 4C0KA 3D3WA 3SD7A 3S7ZA 1MEOA 2GR9A 2H1VA 1Z15A 2CK3D 1YQGA 2H5JA 2ZJ7A 3FWYA 3VVCA 4ZZ1A 1DCMA 3U3JA 3CCBA 4IXNA 4RS3A 2IP1A 3DDWA 3WB2A 1NAIA 2UZAA 2R1ZA 1FYEA 1THMA 2A5YB 3KHUA 3I9V6 1MB0A 4RMJA 4XPIB 1E5TA 2HK6A 2WKRA 4P2GA 3IUBA 1E32A 3GLVA 2HM7A 4DIFA 4B3GA 4UM8B 1YCHA 4FN4A 4KP7A 5IMSA 1OLXB 4QICA 4JK3A 5JQWA 1VKHA 10MHA 4C3VA 2B4AA 2R85A 4UFOA 3OESA 1WB5A 3UXHA 4UEJA 1LK5A 1EI9A 3IR7A 3OZEA 1T36A 5AKXA 3DLIA 2DQSA 5CFMA 3BXEA 3D7MA 4TRJA 5DYWA 4WI1A 3K6RA 2H2FA 5BNIA 4QXAA 4DQKA 4FGKA 5GZ1A 1ZNWA 2Q5HA 2YOGA 4KPYA 1S4MA 1TU3A 1ACJA 2IXGA 1AS3A 2MSCB 1UMCB 1ZQ1A 3V2UA 4KU4A 4L8FA 3BOSA 4Q7LA 3SG0A 1JDPA 3TQFA 2QZ9A 3M6VA 3B9RA 1SZJG 1ML3A 5ERXA 4ZXPA 2EGHA 4E3ZA 4XWWA 4ZCPA 3OLZA 2O8BB 4K0KB 1HL3A 1PJAA 1R8SA 4XDYA 5HIAA 3BK1A 3HH8A 2N1BA 4B9AA 1WTAA 4DIKA 5D1HA 2VEOA 4HH3C 5AI6A 4CMHA 1NX6A 2YIVX 4AS1A 4E1AA 1J0DA 2Z8YM 1F7UA 2Q0QA 4FXPA 4NZPA 4QPCA 1J8VA 2J3DA 5CXSA 4EVSA 2FPSA 1QIJA 3TAHA 4LMAA 2P9GA 1V3QE 3INNA 4TZKA 2C2YA 1JG2A 3HVJA 5I7VA 1CUVA 3CLSD 3LPDA 4N7MA 2XF8A 2CXPA 3FZQA 1HUQA 1DC5A 3F4LA 1UBLS 1ESEA 1JR3E 3G1UA 4LKRA 5HCIA 2CW5A 1WXFA 4PE5B 5JY1A 4CLDA 1CUBA 2QHXA 3KQOA 3RWMB 3PJDA 2PX8A 1NXPA 1SOUA 3UJHA 3X3HA 3IYLW 5D3QA 1ZK2A 2R2GA 1MT0A 2B98A 3Q8WA 4OSEA 1Y5NA 3GPCA 4KN8A 1C7QA 1UMKA 4QOEA 3ZDAA 2HCRA 4EGJA 3BTUA 2YYZA 5EHGA 2KS6A 1DTWB 3IJPA 4KH0A 1P5JA 1WP4A 2NMVA 1WKBA 4G0ZA 3L2OB 1UBOS 3JQGB 1RWNA 1RJWA 1VDZA 4YMVA 1OH5A 1G6OA 1XJCA 3ZWAA 2EBUA 1N5IA 1JQ5A 4F8JA 3JASA 3VR6A 2CLMB 1EUCA 4PG8A 4K6KA 1NHGA 3RS5A 4RPJA 4P4SA 2X0FA 2OTCA 1EJBA 3HP1A 5F1PA 2IU4A 4L0MA 5FA8A 1E2HA 1NWCA 3EZGA 5EUBA 4AYTA 4DCJA 4ZFNA 4GXQA 3MMSA 4YMIA 5DISB 2Q9BA 4OHPA 4BJ3A 1TEZA 1NUAA 3DCNA 5LZ8A 3R8FA 4KACA 1EA5A 3VHQA 2OGWA 4LI3X 2EX0A 2YKGA 1Z2OX 4PLTA 2AL7A 5ALUA 3WZMA 2RE8A 1P5RA 1QYVA 3W5CA 1IHPA 2HH9A 2XQJA 1ZGAA 1BYUA 1JR3D 1LSOA 3ZD7A 4B73A 5K6AC 3DYIA 1CZHA 3G7SA 3ND6A 2VH2A 4LFCB 1MVLA 2QZ4A 1GTZA 1ZUWA 2X3YA 3GH3A 3GXBA 3HWWA 3R6WA 4JELA 3RVDA 4BFCA 5EXTA 2PAAA 2Y2VA 1L7QA 3ENKA 4HDMB 1R15A 5LOVA 2XQKA 4JBXA 5TXGA 1U90A 2EFEB 4UFPA 2XWSA 3KTAB 3QELA 4LYHA 1ZXBA 5B1IA 3KCNA 4EARA 3RFXA 5KJEA 4P93A 2PLFA 4D9BA 2QAGA 3HGQA 1WY7A 2ZXFA 3OFJA 5DTIA 1L1RA 3TLEA 1DXHA 3N0VA 3PGVA 4O0MA 4HLDA 3I9NA 4MV0A 3SU8A 1PFVA 4I4NA 5FPQA 1GG9A 2O4UX 3GFBA 2AC2A 2HHCA 1RM4A 4AUMA 1VJ5A 2O0JA 2YWFA 4IDCA 4MB0A 4WKPA 5CT9A 4NTZA 2YOHA 4R98A 1RMQA 1RFLA 2HHHB 1SVOA 2BUAA 2YJ4A 1TYCA 3DAYA 5THQA 3RUAA 5DYNA 1PBNA 1ISMA 4D82A 3IE1A 3Q8KA 3OMLA 5AQEA 1GN8A 3ZU5A 1UIMA 3E9ZA 1A2KC 5JXGA 3HKCB 4BKOA 1FCJA 3EE6A 4JC5A 2IHYA 2PMKA 2PMDA 3A25A 3DTNA 4PYQA 4Y2XA 5CT5A 4EPXA 1KAEA 4ZI2A 4BVEA 3H3FA 2JJ1D 5BYKA 1ODIA 3IAS1 4N3CA 4HWSA 4P80A 3WWOA 1VJRA 4E12A 4C4RA 5ENVA 4UCFA 3SMQA 1QCYA 1RE1A 3CVJA 3Q88A 4YRPA 3TG2A 4POAA 1LXCA 1V25A 1ZUIA 4IH9A 4B3MB 3GMSA 5TGTA 5DM60 4MB6A 1I2DA 1RZRA 3EIWA 1CJUC 2I29A 5AHRA 3K09C 4UD2A 2O0LA 4WLFA 1SQ5A 4DVGA 3AVUA 5TJ9A 1UH5A 1B8VA 3VDNB 3GI1A 4EYGA 2G82A 4H7JA 4YAKA 3AEKA 3NWOA 1OWOA 4CDMA 2PWPA 1T6YA 3AI7A 3QPDA 1HZZC 1FMTA 1T9CA 1X9HA 1C30A 2V6JA 2X42A 4Q9DA 3QVSA 1TK9A 2I78A 2R84A 3QU7A 4QBGB 1TVKA 3U9LA 1HX7A 5FWNA 5ARDA 1BVUA 3W7VA 3B6MA 1T5DX 2HJRA 2P78A 3EZFA 3GRKA 2I62A 4F2HA 3AETB 4Z3KA 4YCLA 1ST3A 1Q5PA 1E8NA 1GSIA 3SX2A 1SNYA 1MA3A 4UHEA 3FXAA 4Y6PA 5LP6A 3IBTA 5K0SA 2YHIB 1EBUA 2GPNA 4CGZA 4EW6A 4DRXB 4D57A 1RJEA 3KJZA 5EVCA 3DVRX 4I55F 1DIHA 3X1ZA 3BWVA 1DO2A 4PC1A 4WVLA 3PIDA 4PCVA 4P34A 2PTGA 5BW5A 3JATB 1CZRA 1U0FA 3BZUA 4Q3NA 3O4GA 3A70A 1EHIA 2FEOA 1NIPA 3AM5A 3DOOA 2HT6A 3QXHA 2H1CA 4X6LA 3SEQA 3MELA 5K6TA 2FWBA 4UOQA 2B69A 2QDKA 3IPCA 4UE2A 2NSYA 3IUSA 5AXAA 3Q8LA 3EXIA 4GOKA 5CAEA 2G71A 1XUOA 4O4LA 3TQOA 5IULC 4K6MA 5F21A 2AGVA 1P8JA 3TO5A 3BMQB 3KFLA 1MX5A 1K5HA 4N03A 3FUXA 3GVCA 5JYCA 1RYFA 2Q6IA 2UUPA 5J2TF 4DANA 1NZDA 1CFJA 4NEHB 2AFHA 5DBFA 5L9AA 1X1EA 1W75A 2C2OA 3EDRA 1SBYA 1NT4A 1QP0A 2WA2A 1QK5A 3K5WA 3D0OA 3L0YA 2IEGA 2AFHE 2PGJA 1XTQA 2AK2A 2O14A 4FEYA 5JVDB 2IHVA 5C34B 2G07A 1NRWA 221PA 1BX1A 4DV3B 1VC2A 1QP7A 3TEFA 1PWZA 5L7TA 2YMLA 3JYLA 2WF9A 4QGFA 1KEEB 3RYHA 4HZUA 4E5KA 3AK4A 3MLBA 1MVNA 5IHPA 2Z0MA 3LCJA 4CDRA 4RA9A 2O5RA 4DA6A 2C5BA 4MSUA 4U63A 1G7CA 4KQ6A 5CBPA 4TKVA 2ZTHA 1RHRA 1EPUA 4KXLA 3FWZA 3NBAA 4DCVA 1K6MA 1K2WA 2P4HX 3QBDA 3VHXA 5K2MA 3D8UA 1TJ5A 3FUCA 3IIEA 4IQFA 4JAVC 4PO8A 3UMJA 1QRRA 2OCDA 1BAPA 3U81A 3LYAA 1M2VA 4IW3B 3JQ8A 1ZG3A 4J9UE 1E3TA 4MIOA 2K4MA 3QFCA 2CUKA 2M9MA 2E1RA 3N9IA 4RLHA 4XWAA 5J4VA 3EMDA 3GRYA 2WF8A 4Y0AA 1BH2A 5KKNB 1TADA 4R1UA 1RIFA 1F4LA 1E77A 5SZIA 4URZR 3H2YA 1EJ2A 1H5NA 1I3KA 3W7AA 4GLOA 4PTYA 5AXDA 3DEKA 1ZCBA 1XZGA 2GJ8A 2JAOA 1EIZA 2VQSA 3HRIA 4A6XA 1HFEL 2HQSA 5JISA 3DBLB 3FY4A 3KSUA 2HDOA 2VDVE 1DHTA 2VYQA 4NZMA 1D2GA 4PN3A 4YMHA 2WSSA 7ABPA 3DB1A 3QA9A 2Z9BA 1A71A 3HNOA 3MXTA 5AJXA 1DQNA 1PT9A 4ZRDA 2ZAMA 5CBKA 5E7MA 1IJBA 4BX2A 3BKXA 4IX9A 4L0CA 1P7PA 4KRGA 1CY7A 1XGKA 1T1RA 5AHXA 1DC7A 1KH1A 4XOUA 3GFFA 3WIVA 1MAAA 2ZIGA 1GSAA 3L0BA 4O02B 5EJ6A 1U1EA 2BTQA 2NTJA 3A37A 1I9CA 3QKTA 3QEAZ 4S1VA 3KUKA 1TCUA 4K2HA 4MQ4A 3QNUA 2WAOA 3OY7A 3QEMA 4XWGA 1G3RA 2AFIE 5A7FA 1R9MA 3K5PA 3ST7A 4ARBA 2R6CA 5BMVB 3SHWA 1FFAA 3AB7A 1GZ7A 2EU8A 3CG0A 1JSLA 2GHTA 4DILA 1H4QA 5GJBA 3PJFA 1RP1A 1N8NA 3B8EA 3WGTA 4OQNA 1KAOA 2FH5B 4LJ9A 2Y4OA 3NHBA 4RK5A 4U00A 4FZRA 2QYTA 3DO8A 2QPAA 1M1UA 5ICSA 5IUJC 5KYTA 5T67A 3F47A 4PLYA 5KBYA 1X94A 3JWEA 2NUBA 5EGSA 3V4FA 2I2WA 1X9IA 5CXUA 3L93A 2NAPA 1WU7A 3JQFC 1MA0A 4GP6A 4H27A 1GA1A 4C7JA 5JAOA 1VCHA 1QGZA 3G49A 1RAAA 2LIVA 3D3WB 4JJKA 4NZOA 3V55A 1GNTA 2GOYA 2QKYA 5ANRB 1NOJA 3TLXA 1NW5A 1NZJA 4K7JA 5KNDH 1ZIPA 2CKDA 2DLDA 2GM9A 3IQXA 4H18A 4JEUA 2EWVA 4RC9A 4D3FA 5A9RA 3PX7A 5H0IA 3W05A 3E1SA 3TLYA 4E09A 1TQ2A 3OD1A 5LKRA 1Y1PA 2P30A 5FPPA 4NBTA 4FBLA 5IDVA 4ZCTA 1D6NA 2PU5A 121PA 3KHSA 2WSSD 4RVUA 1NI3A 2YN0A 3OG9A 1E79A 4A1FA 3T3PB 3LV8A 1CRZA 4ALMA 2FJUA 1P6QA 4KCGA 1SK8A 2O3QA 2YQ5A 1KZHA 5D6NA 5LLTA 1G4UR 1T2DA 1W4RA 3BEOA 2I2XB 4TKUA 2X2OA 5KNCA 3FPGA 3R7WA 1T36B 1U2QA 4BO3A 2FSGA 2C4MA 2X0NA 1Z7EA 3HO8A 4HYQA 4WKOA 4DMFA 2RG7A 3AFGA 5D00A 4AYWA 2VAMA 1EHCA 1ISHA 3E3OA 1MDFA 3WGNA 4BNTA 3PQ2A 6ADHA 5ICEA 3GQBA 1USKA 2EZ4A 4JT2A 1C29B 3W90A 4D81A 1GYQA 3LY8A 3WMWA 3I52A 2XVMA 2LR0A 2AD5A 5IH7A 2V3CC 3ZXIA 1EFPA 2H48A 3B52X 3JR3A 3R7FA 1GUAA 3JAKA 4ND2A 5D7BA 1U8UA 1DKNA 4C14A 1XVTA 1MMFB 1TCAA 1O5OA 2QLBA 1A77A 4MR9A 1BGXT 3FPSA 4D5GA 1EQAA 1W4AA 3UJ3X 1E9EA 3LY9A 4OJMX 2WSLA 2R00C 4EYSA 1P2VA 1Q12A 3EGDA 1YMQA 3PD7A 4H77A 3EVAA 1N5OX 3MJVA 1IZZA 2F1HA 3CVVA 3R3XA 4FXOA 4JYMA 3KIPA 1R4AA 3A9UA 2VJPA 2QORA 1R6XA 3TECE 1NI5A 1VGVA 1DC6A 3G79A 3AEYA 3ZWBA 1JLRA 3OIYA 2QGNA 3GLKA 3GARA 1VCIA 4RHYA 4TM8A 3TVDA 3T3HA 1N8KA 3N87A 1TECE 1NXSA 2D0DA 2GLUA 4FCCA 7GPBA 1M5RA 1CF4A 3ET4A 1OGYA 4X20A 5FBHA 1QRUA 3OQHA 3L9XA 5KNDA 3KEGA 4DBVO 1E79D 3VM6A 2GD1O 2VEDA 4GWKA 1DIGA 1XZHA 4X6XA 3WK9A 2AOUA 1U0EA 3AOGA 3QMPA 3NHYA 5KNCD 2V7XA 5JZVA 2Q0XA 1FNCA 4KBYA 4ER7A 1T2VA 4OLHA 4N1AA 3F2VA 3CRVA 2PUWA 1NF2A 2WV9A 5J47A 2PFKA 2SHKA 2GZDA 3P1JA 5KYVA 5ITZA 1EJ0A 2C2KA 1Y9DA 4PSVA 2QRGA 3KZOA 4P38A 1FDWA 4BX3A 4F60A 1M2NA 4AKTA 2AN4A 1NKVA 1O58A 2B2XA 1EFDN 3GG9A 4R2XA 4H31A 4D4JA 3U9SA 2ZIZA 1Z39A 4GXNA 1V9CA 1T6BY 3CKLA 3JASB 1UINA 1EUCB 3G59A 5I7RA 3K70D 5KKCA 4P4SB 4JLJA 5EKDA 1ELOA 1U0BB 2AN1A 1SBHA 3D6UA 4KAJA 3ZGVA 1X2BA 4EECA 1N5RA 2JGDA 5FV4A 4JJEA 3VNQA 1P2GA 1XEFA 2O2ZA 2AMYA 4FTWA 1Z75A 2Y77A 5B53A 4EFKA 3E7DA 2ODPA 4OG2A 4B71A 2O2JA 4DMRA 4UTVA 4ZDKA 2HEIA 3IRUA 1OHHA 3LWBA 2AC7A 4II3A 5FBKA 4Z0TA 5TQVA 4QYIA 3SOPA 5K8TA 2ZRJA 1QV9A 2Z3ZA 1JLKA 3IXMA 2ONKA 3KLNA 1UKEA 1Q1GA 5BUQA 4F91B 1XYYA 2I2CA 5GONA 5HZMA 1SBTA 5ELLA 4BGDA 1Q3HA 3ZVMA 1HLFA 2O8CA 2BY4A 4YUWA 2TMKA 1IJFA 2Y1WA 1CQPA 3E1GA 1XEAA 2DY1A 3CRRA 3MQ2A 3PFFA 1TMGE 4FR2A 4XVRA 4D92A 2XMQA 4G65A 1Y63A 4Y6SA 5KNDD 2PZJA 2GBGA 4OQMA 4LOJA 3T7EA 5B1YA 2RGBA 1OJ7A 3U44A 2CDBA 4OBWA 3BHJA 1UT8A 1XALA 2GEFA 1RCTE 5F78A 3TJRA 4CKEA 4WFJA 5CURA 2HU7A 5BOVA 4EJSA 3WGLA 2QAGB 3AJ9A 1HQDA 2V1XA 4QDUA 5K51A 3RREA 2R6AA 4RVGA 1M2JA 1YASA 2IY9A 2IEDA 1YQEA 2HJVA 2PZFA 3QBEA 4I2NA 1ZHOA 4P22A 2RH8A 3X2SA 5C5CA 5K9ZA 1QQ6A 1K7XB 1P9NA 2BLLA 2CXRA 4WESA 3I3OA 2VWPA 2OA0A 1CR1A 1DV2A 3SXPA 4YRDA 1EQUA 2LVBA 1LBIA 2QN9A 3SLKA 2OWEA 1TZJA 2X5XA 5A1JA 3AONB 3FE2A 3M6LA 2BHSA 3PC2A 4ZVTA 1D4OA 3Q3IA 2B7CA 3WNCA 4LC9A 5BWNA 3HCNA 1IZ8A 4LRTB 2VJKA 4QIHA 3RFTA 3T1OA 1JP7A 2C5HA 4Z7JA 1FC0A 3DJFA 4HEJA 1R9NA 4Q3CA 5KYKA 4ARSA 1C50A 2J6CA 4B5LA 1GZ5A 1E4OA 4QASA 4YCJA 3ZY4A 4GHWA 3QLVC 4W4TA 2W83A 3TMKA 3EHDA 1NR7A 4DLYA 5LP1A 1RQPA 2WKSA 1QORA 3ONWA 1TQ8A 4G0OA 2GRAA 3NH9A 4L4XA 5EIOA 1X15A 3ZDFA 4X00A 3FBGA 5AW3A 5CD9A 5LQSA 3Q12A 5LA6B 2QXYA 4AICA 4ENUA 2FOLA 1KK1A 2YRXA 1WOYA 1YB1A 3LM8A 1PP4A 1TFUA 3MW8A 5CPBA 2DXIA 1FSPA 1C30B 5H02A 2XRZA 4IJQA 3EVZA 3FCCA 4UJ3A 1NDHA 2OL4A 2HZ7A 3EMKA 5SYNA 4AO7A 1TVKB 3NZEA 3R2JA 1LW7A 1DMSA 1PLLA 3DV2A 1JQKA 4UVHA 1QDEA 2O5VA 2JFVA 1KYYA 1ZLXA 2H5IA 1S7GA 4XXHA 5KU1A 3KB1A 4MR7A 4MQBA 5DXJA 4NCAA 2UU9B 2WNSA 5SY4A 5BT9A 5LP6B 1NMXA 3BXGA 1OSNA 1HL7A 4NONA 3NDRA 4CI9A 2KBEA 5J4LA 1YS9A 3DZFA 5JASA 4LRQA 4HFJA 1BEUB 4G5RA 4OQQA 1DOAA 3V46A 3O83A 2WV7A 1M2FA 3T7DA 4EA7A 1KSHA 1U4SA 3R3JA 4Y2QA 1NW9B 4XGNA 5BORA 2I3BA 2QVGA 3M3PA 3WB9A 5BR4A 5C4IA 3H4IA 5KPJA 1IOWA 4UQLA 3VYUB 5I45A 4L28A 4BV2A 3CZMA 2OB1A 3EXIB 5CAEB 4GMDA 1QB7A 2HTFA 3AGQA 4EKEA 2WVJA 2VT6A 3W4JA 3PNPA 1T5SA 4D6XA 3THWB 5IJAA 4QX6A 3KWJA 4YI3A 1DBRA 7REQA 5C80A 5EMKA 1I94B 2PGDA 2FW6A 4DPLA 1EH5A 2H59A 2AFHB 4I08A 4RXMA 2Z9DA 3IUQA 3OU2A 3NGXA 4C5CA 1CS4C 3PC8C 1FE8A 2HBYA 3UK2A 2WVHA 2B78A 4WY8A 2VF4X 2QRMA 1CB7A 1ZSYA 3TGPA 2JIRA 1FS5A 1Y80A 1JFTA 3GPBA 5J2UF 4AF8A 5CH8A 3CLRC 4YIKA 3OOYA 4K6FA 5TMBA 3WL6A 1RVDA 4J49A 3SI7A 4DDMA 5K3OA 4MS4A 3EC2A 4ZAWA 3F5QA 3WIOA 1RPTA 3RAEC 1EINA 4U6QA 1G5FA 3RYHB 1KP3A 2VQDA 3I83A 1SRRA 4HZUB 4QBKA 1QIDA 3LWZA 1PVVA 1FL9A 3W8RA 5K09A 2AR7A 4DSZA 5IVDA 1NYRA 1P1JA 3M6MD 5AJUA 1CIJA 1F4VA 2YH2A 3L7LA 1BRMA 2B9VA 1XELA 2NX2A 3H9CA 2OAQ1 2GPJA 4RA9B 4BATA 4ZZ0A 4TVSA 3HC7A 4TKVB 4F5DA 1T2EA 5CBPB 2O8VA 721PA 4MA0A 2R6JA 1NUTA 5ISMA 4LOHA 1NN0A 4MW2A 5JAIA 3VHXB 3GUZA 3IL2A 2X2EA 1J9GA 4K3UA 1DCTA 2WOJA 2DFPA 2R60A 3MJFA 1QTQA 3QUAA 1W35A 3FDZA 2C9BA 1R4ZA 1YDMA 1I0LA 4Y2PA 1M2VB 2OMEA 2PXAA 2Q3HA 3JQ8B 3LL7A 1G20E 2XAUA 4R1LA 3R3UA 4IEEA 2PH7A 4DIOA 2WI8A 3H7AA 3OBIA 1A72A 4Z6KA 1PZFA 4XH9B 3TDKA 4EBBA 5KX5F 2JIDA 1KGSA 4ZVRA 3USZA 3SY8A 3Q0TA 3R3HA 4KO3S 1X1SA 3RC9A 1U11A 3PUZA 1GKLA 3KVRA 3OZGA 4DV5B 2QW0X 5JARA 3AKCA 2JA2A 3QTLA 1AV7A 2ID4A 3PR1A 2ODNA 2KBFA 3VPGA 3GZJA 3ZW7A 4ETWA 4YDRA 1B0ZA 5FBRB 5HW0A 2PRKA 1DMRA 3HVHA 3ANYB 5IMBA 2CUTA 1KEVA 4U6NA 2O8FA 3EISA 2FFAA 3WXBA 2H9YA 1NJGA 5GOTA 5AI9A 3U9TA 2NWQA 3A4TA 4TTSA 4FGZA 4S2UA 2BTQB 2DULA 5M2QA 4F84A 1SOVA 4PFJA 1D4AA 3DLPX 5A3JA 1TMYA 2JGIA 4FZJA 1JE1A 3H6KA 4NOKA 2WWIA 4M46A 3R7LA 2XCTB 2C31A 1XZJA 3QEMB 1VDMA 4OQYA 2ZKIA 1I30A 1OAKA 3TTTA 1G9XA 1UFKA 3PLRA 4OGGA 1C3LA 1XWFA 4JBYA 4R7TA 1GRCA 1NVVR 1YK0A 2VF7A 2XH8A 4JEHA 3E82A 1C9EA 1YJXA 4GVXA 1SCKA 4EJ6A 3F46A 1WMEA 3MJDA 4LFAB 4C1BA 3DOEA 1YCGA 1MNAA 3VH1A 3OU7A 3BRCA 1J22A 1ECPA 5H5JA 3U2QA 1TUIA 2COKA 3CM0A 4R3WA 4BL5A 1GCAA 3VPCA 2DRIA 3VQTA 4YRGA 1BSVA 3DKKA 3CGWA 4UBNA 1QFYA 2CEKA 3AINA 4GZLA 4MI6A 4BVGA 1JDNA 4EG8A 2MHCA 1ZN2A 2B20A 2HMWA 4JVOA 1CY6A 1FUIA 2XUKA 1YZUA 1GLGA 3MILA 3PE4A 4RVHA 5LXTF 4U2EA 4JBLA 3TEMA 2E3JA 4LISA 4LECA 1V7PC 3MLEA 2GUGA 1NE2A 4RMGA 4ZYUA 2FQXA 3BGOS 1FVOA 2I6FA 2Z4TA 1KNQA 4ZV7A 2VUIB 4J6EA 4LZJA 3RTCA 4CLHA 5JBIA 1F9EA 4OI1A 2KMLA 4HG2A 3GVPA 3EVEA 4GI1A 4XJXA 3A4VA 1E4YA 5TGZA 3TIFA 1EA7A 3HYTA 3LI2A 4FYKA 3K92A 5I5GA 4ZMRA 1IE3A 4TKUB 2MT9A 3R7WB 1KI8A 1TAGA 3UUFA 4JJ7A 1JFSA 5DT2A 1LQTA 4QJIA 1JECA 1P44A 4GYWA 4RGVA 3G6KA 1AXGA 4DWWA 1JXOA 1NATA 1P7ZA 5DRTA 1ZJ4A 1R9JA 3CVWA 2B4QA 3GQBB 3IEVA 3M6WA 3D8NA 4TN1A 4ZALA 2XAAA 4QYTA 5B2ZA 5THXA 2J8ZA 3JAKB 4NEGA 5H70A 1IG3A 3MB5A 2YVKA 3NNSA 4DLTA 2AN3A 3K70B 2AFRA 1MQ8B 3AHDA 4MR9B 3W2HA 2PSFA 2DPMA 1C2TA 3QE4A 1D2EA 3OETA 3HJNA 1H0KA 1H05A 2YCBA 1CVIA 2X5KO 3EGDB 3QWHA 4EMTA 4HXFB 1DZIA 2CHGA 1DAGA 3PUXA 3B6EA 1FS4A 2RHBA 4IR7A 5HCUA 3MWKA 4EI2A 3GJRA 4KDCA 2FZEA 2CCGA 3HY6A 4IAOA 4D4LA 4V0QA 1VYVA 2LWIA 2Q7OE 3T3OA 3FPBA 3H11A 1GPDG 1W0KD 1YU6A 3OJFA 4J94A 3AYZB 2QRHA 4HPJB 2V97A 3DS8A 1J0EA 4ROTA 3L6UA 5A4FS 3U19A 4PPGA 1U63A 1MPTA 4XJVA 1GTMA 3X1KA 1CEEA 2IYLD 2BZ1A 3C8HA 4X20B 3CVUA 3VPDA 3D7NA 5DHRA 2CFIA 2E49A 3QMVA 5I7HA 2YFHA 1QDLB 2F8MA 4TUYA 1QIHA 4OI4A 2EHJA 4NS4A 2AOUB 5IKXA 1YK1A 1IC6A 4V0LA 1J0BA 2W2LA 4YBZA 2IWRA 1PV2A 1EE2A 2QJFA 4F3NA 2RHRA 2JFXA 1YCDA 2VHTA 1M6VB 3MGAA 3E61A 5DB4A 1ZCAA 3EOAI 3R0IA 5K0BA 5JS1A 1QOQB 1RRPA 1JWLA 1WBDA 4L02A 1QKKA 2C9ZA 1YJBA 5ITZB 4EG5A 2CNWA 4MINA 5A3RA 1M1ZA 2VLBA 1O9BA 2PUCA 1JQBA 1Z2PX 2IEYA 2D59A 2HMTA 3ONEA 2GO1A 2JW5A 5C32A 4QODA 1KDPA 4KZPA 3KO8A 3TD9A 2ZJOA 4DRYA 4P3PA 4LF6B 5ITVA 1D7AA 2K5UA 4H1UA 4X7MA 4IIFA 3EXFA 1ZCFA 5HMLA 2H07A 3GJTA 1KOFA 4RW0A 5DMXA 4LC1A 2CJPA 1MB4A 2ZREA 3RYFA 4UXIA 2F00A 1RRFA 4XLLA 4X8LA 1QQ5A 2WKPA 4H59A 3A3KA 4JC8A 4TSRA 4QYIB 4WXRA 5EJ9A 3P94A 2G1AA 4CG1A 4NXMB 1VJTA 1KSFX 2QY9A 2RIRA 3REQA 3S0JA 2NAFA 4D1YA 3RAFC 3U4HA 4J0IA 3CNEA 1FPMA 1Z13A 3LC1O 3BRWA 3N2IA 3I39X 4GKAA 5GONB 3V1NA 4R2WA 2BGUA 4EVRA 1KZYC 2IOFK 2ODAA 1Z7YA 2FW8A 3RC8A 5KJ6A 4KXQA 4IUDS 1RBQA 1MIHA 2ZQ5A 1P31A 3ZH9B 3PXBA 3V1TC 6NULA 1WPRA 3U44B 5ECDA 4RMHA 1IU9A 1VJDA 2JL1A 1Q0LA 3WWZA 2OQ2A 1QGED 3WLAA 3CUEF 1QF6A 3COPA 3SHQA 1TI7A 1Z25A 4B3XA 1A8HA 4CKEB 4CQNA 4EJSB 1Q17A 2PS1A 1YDFA 5ALKA 3ZZNA 1DX4A 4ZYTA 2W2LD 2PLAA 4ICIA 4Z4GA 1JDSA 1QTNA 1XRLA 3BFPA 5IBCA 3VOSA 4C2BA 3THRA 3WS7A 1TA9A 4BVAA 4EPVA 4DV2B 2VDLB 3L7AA 2ZSIA 1QQBA 2RHTA 3QRWA 5I9SA 1FJHA 3B51X 1QVRA 3QVUA 5TJHA 3KLPX 4FZ3A 3TLJA 1W0JA 3Q5GA 1PUJA 3OWXA 4IM7A 2PAFA 1GZ4A 4YJKA 4YO8A 2P9EA 3DMFA 3ZK7A 2OCIA 3HP4A 1WS6A 3C6MA 2CT8A 1J49A 1H2EA 4JHXA 2YY5A 2KW5A 5DDIP 4O1HA 2H8GA 4YJ2A 4YUXA 3E9QA 4FKMA 4QTZA 2FCRA 4V0RA 5BQ5A 3RTBA 1B76A 1KJJA 2BM0A 3LVQE 4KQWA 1SKAA 4BOYA 3G7NA 4G0QA 4E31A 5EPUA 2QJTA 2CCJA 2V65A 3A1SA 5FL3A 2C8VA 5C1BA 3B6IA 4EW1A 2IDJA 1U0RA 5AVUA 3W2TA 4H0FA 3PHCA 5LLSA 4KAAA 1T8UA 4KIJA 3PYLA 4OB7A 1QV7A 3ZS9A 1U28C 2YVLA 1I7LA 3A3NA 4G1FA 1RD4A 1KDZA 1UOEA 1G2QA 2JZOA 4I1YA 3AB8A 3NT5A 4J7AA 2OPBA 3KSMA 3WKCA 5LU8A 3WLSA 1HBJA 3EUEA 1VSQA 1HNZB 3T5MA 3DMTA 4UXJA 3D7RA 5AVRA 3Q3VA 2JGAA 1E2LA 2I3GA 4MKGA 1RJDA 1SD5A 4ZK2A 4GOXA 4XR4A 3G5LA 4K6HA 3MT0A 3LCUA 1GUZA 2HCFA 4I50F 4P3OA 3S8YA 3HY4A 4AWAA 4I1RA 4NFSA 2HGSA 3BHNA 1BCRA 3M5WA 1YZHA 3PIRA 1QQTA 3LBHA 3WIUA 3A6EA 2N47A 1Y4SA 3H18A 3CEMA 4GZ5A 4FLFA 4CDNA 4I1PA 1P1IA 1UBNA 2EEZA 2YXPX 3FKSA 4MR7B 4R9VA 3JRWA 5DKFA 2C0CA 3VTKA 1PUXA 4QSMA 4F5YA 4AL4A 2VSYA 4CMJA 1N0HA 3DZDA 2FHSA 2NGRA 3RBXA 3QPBA 5HIKA 5JRDS 4RFSB 3P9RA 4EDFA 1ZJJA 1KQ3A 1OKKA 3OWOA 2BDEA 5CVTA 5CXQA 1Y7HA 4MVJM 1E3JA 3G9QA 1JI0A 2YNMC 4ZO9A 3ZV4A 1I51A 1TIBA 3DL0A 2J9YB 3MQFA 4X41A 3P0RA 2VJAA 4W1SA 5HJ5A 2QG9A 2C77A 3EW7A 2CNLA 3DYVA 4YFYA 1Q84A 2L19A 4XGKA 4X93A 5DTRA 2IYRA 2VFAA 1GKYA 5CJJA 3JU3A 4UUPA 1XZCA 3BWMA 2V3WA 3LT5A 4HF7A 4LBZA 2JLVA 2Y6UA 4KWEA 2PTHA 1U8FO 2AZTA 4OSOA 2VNAA 1GU1A 1TX4B 4D6YA 2ZI4A 4WXEA 3VC1A 1TAUA 2F1JA 2LZ0A 2A0FA 2WHEA 3TF5A 2Q3BA 2ZB8A 1OV4A 2DR0A 2VYVD 4JD5A 3KALA 4RVNA 4A26A 5CA1F 3LBAA 4ND3A 1PW7A 3H4MA 4WK2B 3FTEA 5IAJA 1X92A 3LXRA 4PYLA 4ZVSA 4BQPA 4OLJA 1QPGA 3O1JC 2OLJA 5BO5A 4Q9KA 2BAGA 3RV3A 4G07A 1U3UA 3WYDA 4XSHA 4QFBA 1ILWA 4XDHA 1REQA 5FFFA 3KX2A 2JCYA 4MMYB 5F73A 1V43A 3TNDA 2FJ0A 4BWYA 5FTWA 4BEWA 1FQWA 3UJ9A 2ECQA 2IUYA 1GAEO 1P0PA 1WZEA 1TMOA 2DPXA 3HB7A 4HDQB 2CDNA 3V7UA 4QVGA 3PC6A 3KTFA 1YS1X 3B60A 4J0EA 3RFFA 2DOKA 3E70C 5HS4A 1YGPA 5DHFA 4ABYA 4OMUA 1T0BA 3HK2A 4YX9A 1TQ4A 1G60A 1GQQA 4JZKA 1R6TA 1LJLA 3K73O 2WQZA 4EPTA 4JJGA 1TF5A 1PG0A 1V4VA 2Y9PB 4BVLA 1NNSA 3DFZA 2WTMA 2ZIWB 1DU4A 1G20B 3TLZA 3K0CC 4B34A 3TSYA 3HJFA 1JSZA 4NV0A 4WLEA 1OXMA 3A7EA 4Y67A 3CX8A 3GCGA 3FDZB 4KITB 4DR5B 1YE8A 1UZLA 1C0PA 1BXGA 3E27A 1P0FA 4BJHB 4D3DA 3QV1A 1U7UA 4IG4A 3SYTA 4W5NA 1CP3A 5FRDA 4AMGA 2ZIUB 4YMUA 3GN1A 4PQFA 5EJ2A 2Q4TA 3LDGA 4QL3A 3X1MA 2RC6A 5B2FA 1MIOA 4IYRA 2PNFA 1B7GO 2VN8A 3M7IA 4B45A 4C20A 4J16A 5ARBA 2WVGA 4UCXA 1ZFNA 3HM9A 2IU0A 3K6SA 3F3SA 1T3ZA 3CIOA 2ZRBA 2HD4A 4JEIA 4C3OB 2AG5A 1AD2A 4KQ9A 3TPFA 1WUIS 3D7LA 3MRTA 3ZDXB 4HNTA 5P8WA 1CG6A 4OU4A 1INLA 1M0SA 2G9VA 2ZCUA 2W6MA 1I2AA 3AY7A 3DO6A 3GLHA 3NRCA 3R3WA 5JDIA 3B2NA 1TC1A 1OBCA 1NG9A 3FTFA 4RD1A 3BCHA 5C8YA 1X9GA 1FSZA 1RXCA 3GUVA 2QRKA 2QTFA 2O8FB 3E7WA 1OIVA 3GRPA 2C78A 1K68A 1GP2A 5G3ZA 1MOSA 1WXIA 4NIMA 4QBIA 1EXMA 2FAXA 2QU8A 3PFIA 3LXUX 3SX0A 4A2CA 3WQBA 1FYXA 1QGOA 3GPDG 2OZEA 3L8FA 3R7AA 1GCOA 2FLVA 2UYOA 3PNSA 1N2XA 2ZRHA 4NRDA 1N6NA 4C0WA 4E5PA 3EDCA 4HGNA 3CKMA 4Z53A 4OUKX 4RK4A 1NVTA 1CTQA 3SQNA 1PL0A 5BSEA 4Z9BA 3BE6A 1DJMA 5BN3A 1MQ9A 1QIKA 1LS6A 3F6EX 3SJAA 1DIAA 4LZAA 3AZPA 5EIFA 3LLSA 1F8UA 5BUZA 1E89A 4P3XA 1L4UA 3NBZC 4DR1B 2ANBA 4BKQA 3U3DA 2XGOA 1X13A 3RU2A 3F9RA 4CMIA 1B26A 4X54A 3EGCA 4TS3A 4BCDA 4KFUA 1E6EA 2GCOA 4CGYA 5DBOA 3EA5A 2E4UA 4MWOA 4Y1FA 5L3QA 1CY8A 5FFNA 3PENA 1DKOA 1JEYA 3GNLA 3VKGA 2CLLB 1H2RS 4PZZA 3UJDA 4UE6A 1ZIYA 3OZTA 1LBQA 1FQOA 1AHHA 1R64A 2OGTA 5DZSA 4GI5A 4PAWA 2CC2A 2XE6A 1XQXA 3P9CA 2EJVA 1IDN1 4Z99A 4CKYA 2Q4OA 3N28A 2BM8A 3U37A 5CEJA 2QR3A 2VZ9A 3GJSA 2GF9A 5E6SA 1U3FA 4DNFA 3H2GA 2GZMA 1T1GA 5F3DA 3JVDA 3PR2B 4Z4EA 3A4YA 4GW3A 2FETA 1D1TA 3W79A 5DX0A 3GLIA 1UXKA 3HUUA 3K0HA 4DMGA 5LNK6 4EBFA 2Z56A 2H11A 4RTJA 4AFNA 3RS9A 1D2RA 1EX7A 1KHHA 4R71A 5JAHA 1U3VA 4FOTA 1ZR4A 1NVFA 3DGEC 3HL4A 3HFRA 4MW9A 2BKEA 1SUEA 1DP4A 4EG3A 2HBQA 1LJ8A 1FMCA 3MBOA 1ZQ9A 3E3MA 2ZUEA 3ERCA 5JS8A 4YUAA 2CDCA 4P7FA 1SUSA 2JBAA 4WPGA 1TT7A 5K4GA 1I33A 2XNJA 2ZYGA 1CJKC 2ZTSA 3I6ZA 1T4BA 2H9AA 3M0EA 3O2QB 3QIVA 1KHTA 4N54A 4JT9A 4B8ZA 3O0TA 5F9MA 1B2RA 4BQEA 2ZAGA 2AEFA 2C2GA 2E4WA 2H31A 4N8EA 2OYCA 3TBHA 4D46A 5JOQA 1M0EA 4MS1A 3LDUA 3DE3X 1M67A 4O3FA 2GZHA 4MKHA 2DBVO 3AP1A 2IP4A 1NBOA 3CH7A 1FB5A 2FKAA 1GA6A 1NNUA 2P69A 4OHVA 5JCZA 3C98A 1IN1A 1JTFA 1XVIA 4JB2A 4ZCSA 3VJMA 3R6TA 2AJDA 3AUAA 4ON9A 2VHUA 1FNDA 4HDNA 3RNOA 5A6SA 4CIYA 1XRNA 4LJ8A 4E2FA 4QO7A 3L18A 5HJEA 3I76A 1JDVA 1NVDA 4OIMA 4BCCA 5CX1A 3NPMA 4RTLA 4MH0R 2O0KA 3NHRA 1FZQA 1Z63A 2AVDA 4FOPA 2UUBB 1GSHA 3FMPB 4PYMA 3NWPA 3UKOA 4B6EA 4TUYB 4IOKA 2YWCA 3E22B 1D1QA 2WVAA 4RU1A 4RY2A 2HLDD 1EDEA 2PZ8A 3HBLA 4HEHA 1KZ6A 4C0AC 9GPBA 5JFOA 3UG7A 2WIJA 1T24A 2JFUA 3UENA 2QN6A 3R9WA 4Y6OA 4P4LA 4LSGA 1YU9A 3BB1A 4CLRA 1I3CA 4NAVA 1GR1A 2X76A 4FT4A 4WJZA 3HCOA 5EE0A 3VJLA 3VZCA 2VATA 3SQMA 1G5HA 2BEVA 4DW8A 4PPFA 4ENTA 1K5PA 2PX4A 1XMIA 1GOTA 3F5SA 5DGIA 3W04A 1X77A 3WE7A 5K0CA 3QE9Y 2P4UA 3OF5A 4GU5A 3EXFB 3A2MA 4LBVA 4KI7A 1L7RA 4B43A 3A6GA 1G7SA 5B12A 2PCLA 3DHVA 2IHNA 1B2LA 3RYFB 3UWPA 5KQRA 4OVKA 1KU0A 1GPBA 3EIQA 4WCDA 5LZ7A 2PGIA 2LD4A 1NJ8A 2JDIA 3GIDA 1ZI9A 4M4SA 3TTXA 3WMRA 2B7BA 1COZA 2WSMA 2HSDA 1HMYA 3MS2A 5G41A 3KETA 3UT0A 2B30A 5DGXA 4EVIA 4KSYA 2F4NA 4J9VA 3LTEA 3KAQA 4NBRA 1I5OA 3RR2A 1A76A 3DEAA 3ZLBA 5LC1A 2J7PA 3ON5A 5JZMA 3REFA 4YVFA 2BRUC 1N2CA 2Q2VA 2PJUA 3K31A 2QV7A 4EY7A 1KJYA 1UWKA 4GPBA 1KQFA 4FSXA 4NMMA 4D4MA 1V4BA 3SZ3A 4WW0A 3UK1A 3VNAA 2XMZA 3C5EA 3I1JA 3ZCQA 1F17A 4XYGA 1GFSA 1SCJA 3LWNA 4YRTA 5CEEA 1S2IA 4DZZA 3OJCA 1OI3A 1YBAA 1XTUA 3DDOA 3VSDA 5ARCA 1VZ3A 2VCYA 3F9IA 4HYYA 4OB6A 2B92A 4NCXA 1S0UA 1O96A 2IHKA 3R9XA 4F1JA 4C87A 1JWBB 1V5FA 2IOYA 3MGGA 4IH1A 3ANXA 3E15A 1ZX1A 1FUUA 3PNMA 2O3TA 3UN1A 1RE0A 2ON6A 3TR0A 4RH0A 4OHXA 1Z07A 3JW8A 3P96A 3X0DA 3ZXYA 5L3VA 2VNSA 1A7AA 2E82A 2VH5R 4AWXA 2X4DA 2O5CA 2Y0PA 4GLJA 4JI4B 1H9CA 3UAWA 4RHUA 3AIKA 2WG2A 3JQ9C 1UF9A 3U62A 3DNMA 1XQVA 4YJ2B 2ZVPX 3AF2A 1XCJA 3HADA 3B3FA 1ADJA 5LBTA 2CLHB 4D4IA 3OCWA 3CRNA 1WCV1 3IT2A 3RAGA 4FFLA 6AT1A 2WHYA 4P6VF 3ZI0A 1AM4D 2NTEA 2X40A 3L7YA 4ENWA 5SZKB 2QLNA 1FNNA 1KO1A 2BTOA 2I65A 3NYQA 5F33A 2HWUA 4PGAA 1NY5A 4Z9XA 3OJWA 1L7BA 3QPWA 2FPGA 5JNLA 3EY9A 4ID9A 1AF7A 2HXSA 2CV2A 2WSBA 3KPVA 3UBTA 1Z38A 1O2DA 3MWEA 4GGPA 1WBBA 4BNGA 1EFLA 4MJ3A 1U6KA 3WVNA 1AGRA 1AX9A 1DG1G 4PAGA 3NHLA 1VHLA 3HO6A 2F3UA 1N2ZA 3ND7A 4TMWA 4Y9RA 4B6FA 3KYIB 4HQ6A 2ZYHA 4RBNA 1YB6A 3O82A 4I36A 3CZRA 3LBYA 4FNGA 4QDOA 1A1VA 3LLVA 4GOLD 4I5GA 1BCRB 3OX2A 1J1ZA 1YIAA 2AG0A 5CCEA 4YCAA 1GV0A 3OU6A 4J43A 1KYTA 3WK5A 1F6BA 1HF3A 3HCBA 3UUGA 2MTBA 1KYIA 3DMYA 1K3TA 3AU9A 3ZPXA 5JJ5A 4XDGA 3M49A 4X60A 2JIBA 4RDXA 2YN2A 3OIDA 4RYLA 1II0A 2QQ5A 1PVOA 2J30A 1EXWA 5FO0A 3M9XA 4M49A 4Z2AA 3E0XA 3WNDA 4DR2B 4KVZA 4IIYA 4R3UC 2ZJ5A 2R7AA 1EZZA 4WCFC 2ZSUA 1JAHA 1KEUA 2AOXA 3U39A 4KQJA 4ER3A 3KQLA 1A9RA 4JB3A 1ZBQA 1M2WA 3OQ6A 3ZDCA 4G81A 4ALKA 4QAQA 1YMUA 1NNI1 1ZM4A 1NY6A 1EGQA 2KYRA 3I4CA 2GN4A 4IIJF 4NWIA 3LVFO 2QTNA 4G37A 1RC8A 4OHKA 2YFKA 1CFZA 2W9XA 3LDFA 4UU7A 4EF4A 2UUAB 5A9TA 1E7RA 1T8PA 1ZESA 4MEBA 4H3KB 3OLWA 5IM5A 2GPWA 1RLUA 2GAFA 1LDGA 3QF7A 3G0GA 2UZ3A 3CTPA 2YJ3A 4GRDA 2R87A 1G1MA 4LV6A 4UC0A 3HU2A 3EEFA 1D8AA 3IHWA 1F3LA 1H22A 2DHCA 2WKQA 3FCEA 4MYCA 2IZOA 1NYQA 2Q6VA 3L0ZA 1JFLA 5LFAA 2OLEA 5TS2A 1SWVA 4DLSA 1REQB 5KWSA 4BTEA 2ENUA 2GASA 2ZCVA 5T4EA 1SVUA 1IM2A 3ZHZA 3BVPA 3LYLA 3PI7A 2X9GA 4JC4A 5EMMA 1TZBA 4AG5A 5JDCA 4DV6B 3H1EA 4LJRA 3VO2A 2Z8YA 1TZCA 5GOZA 1XVVA 1HA3A 3NW9A 1OI2A 4R0NA 3TN7A 4NECA 3ODPA 2GA9A 4BLTA 5KSZA 1FU4A 1UKZA 3AKDA 1U0JA 4M36A 3K0BA 3PT5A 5YASA 2VJLA 3KU1A 5SZHB 1XTBA 1T4MA 1X70A 4M55A 5FUXA 1ZH6A 5H9VA 1R27A 1M7HA 1TPYA 2IEIA 3AKEA 1YOBA 5FR1A 1FYFA 1WMBA 3PRJA 5HIIA 2XLBA 2Z95A 3AQIA 3IJ5A 5EWJA 2VKQA 3NDPA 3WDMA 2UZ1A 1W8IA 1P9OA 1BXGB 4FB4A 1RYBA 5J23A 2X6RA 3AFNA 1B42A 3GUUA 1SXHA 1GLNA 3K9WA 4JQCA 4Z1OA 3VKFA 4IFBA 2FSVC 3HZZA 4CF5A 2XEXA 1MIOB 1RIIA 2XB9A 3A7DA 3LT0A 3SHTA 2GBLC 1ZHHA 2JJ8A 2OCBA 3VYTB 2R5WA 2CCKA 1JPUA 3DAHA 3K6SB 3MCUA 2W43A 1RMYA 4B2LA 3KRTA 3UWSA 1KS2A 2VWQA 2I8AA 4ZTZB 2ZZKA 1ZMOA 1WSAA 4ZAZA 3GLHB 1JSXA 4KPEC 3DL7A 2WICA 3BQMB 3DLAA 5C8YB 4LMRA 3CRZA 5EFZA 3HKBA 5JDIC 2NZXA 3KYCA 4PZ0A 3EGWA 3TZ6A 4BZQA 1RCFA 1WXXA 2H4JA 5JBQA 4F2GA 4MARA 3RSHA 4XLZA 3I92A 4KMRA 4FP9A 1GQ2A 1OIXA 4HAUA 3KR2A 5HKKA 4K88A 5ALEA 4DCMA 1Z62A 3U31A 4JUBA 1JIKA 2EDAA 1YR9A 2FU5C 1YFZA 2C98A 5HCNA 3O74A 4MUBA 1GDHA 3KR0A 4PPQA 2CL7X 1Y6JA 5EZYB 1SR8A 1U2ZA 2ZB2A 3NM6B 2YMQA 4FPXA 2HPHA 4HRXA 3ZK9A 3PFBA 3RJTA 1MGPA 1O95C 4OP1A 3KZNA 3FWPA 1TQHA 3O73A 5BN3B 1FRVA 2OORA 3TL3A 1RI5A 2A86A 1VSBA 2HHAA 3MLAA 3GWZA 2RGEA 3HFJA 1IPEA 3KFVA 3O95A 3RT1A 3NQ41 2NIPA 2CFCA 2QLJA 4I1VA 4DE5A 5CIWA 1L5WA 3A32A 3OE1A 2GCOB 4JSRA 2GYVA 5JG7A 2C97A 5H80A 1BDIA 2ECKA 2ZJ6A 2CMHA 3DKPA 4ZDIA 3M5PA 1IY9A 5IXYA 4IXDA 3ZQ4A 4OREX 2X3FA 1PLJA 2B1RA 3MIIA 1C9YA 4UVGA 4ATNA 1JEYB 1BA2A 3WLQA 4NE2A 2VT2A 3PFNA 2V4UA 2FRXA 3EEYA 3TNLA 4DJJA 3CVXA 2AXQA 2IXBA 4MA5A 3IMKA 5ALGA 1PK7A 5BSHA 5MGNA 1T91A 5B7QA 1YF3A 5E6SB 5TVKA 2CLFB 4U39A 1R5OA 1R5JA 1TU0A 4S0XA 5DW3A 2LUOA 3V1MA 2NUAA 3PCRB 4BKMA 2VBGA 4LXXA 5AJYA 4EY6A 1M5UA 1HKHA 2OAEA 1SU8A 3AOEC 3B53X 2IEBA 4MVJP 4NPHA 2QX7A 3LLCA 4O33A 2BZSA 5G0VA 1D9ZA 1DVRA 3WKAA 1QZTA 4AY2A 3WG9A 5HKKD 3DEJA 5T6BA 1MW9X 3TRIA 5HEKA 2QVYX 3O92A 4UPDA 4GLBA 1OCEA 2FEXA 4KN5A 2TMGA 3GMIA 5E0KB 3TTWA 3O5AA 1IVSA 4DCTA 5LQRA 1Y0BA 4LDAA 2R4UA 2C57A 1FMJA 3FZNA 5HM6A 1ESZA 1L5RA 2JJ2D 4O2AA 4MEJA 4XGQA 1GPKA 4B6RA 4BNKA 1GAQA 1O1YA 2JBAB 3DVAA 1ZXXA 2C5LA 4FOSA 3IDOA 1C81A 2QR2A 3GFTA 1BYIA 2P2ZA 4XQCA 2AZMA 3OY2A 2IXAA 1VHQA 1CZLA 1SK9A 3R3SA 2WK1A 4MS1B 2BEKA 1XMPA 3UIEA 1T4CA 1U9JA 1T1SA 1YIDA 2JFHA 5KWVA 1RJ9A 2FZGA 1OR8A 2ALJA 4IIGA 4V0NA 4XKJA 4GE3A 1D2NA 5E2AA 2Q1SA 4UM9B 5LL6P 2EBHX 3LX4A 3W8NA 1XCBA 4QTXA 2OBLA 1Z0DA 4HDNB 4LEIA 2HU5A 1XL0A 2OG1A 3JQAA 3M2PA 4IRXA 4JA2A 3UG6A 4BZWA 4BX9A 2Z8XA 5IT9A 5TMDA 3D6AA 2CBZA 4LOLA 2FPXA 1L5FA 2PCJA 5CX1B 3LKBA 4HWGA 4X90A 3TOVA 1TRHA 4IOLA 3T34A 4BVJA 4DXHA 1VYHA 1KAHA 2FK8A 4RH3A 5FB3A 1UKBA 3QY0A 2XUFA 1GKIA 1GUYA 1MC8A 1YCFA 2H4FA 3CW9A 4MW7A 5CVDA 4A6DA 5B6JA 1WKVA 2ZWIA 5EPOA 3WQSB 1JVBA 3QXSA 4NC9A 4GPAA 2IOQA 2XQGA 4DIUA 3AHIA 2WUWE 3C45A 4CLRB 4MKXA 3JY6A 4EHBA 3K35A 4O6VA 1T15A 5ALDA 1LCIA 3B3QA 3X44A 1RBZA 2O2IA 2OBNA 1W9HA 2BEVB 4FEEA 5IW8A 1IRIA 4ZTBA 1IH8A 2GEJA 1JMYA 3G9ZA 4L5AA 2W70A 2V7TA 5JS7A 2QZZA 2JAXA 3ZZ0A 1FDRA 3TLCA 2O54A 2X2FA 5J3JA 1HTWA 2GVNA 3QITA 1YUMA 3CLUD 3MMNA 5TV2A 4JVNA 1NR1A 4CL0A 3LLMA 1GTG1 4PQYA 2ZRDA 4PM4A 5EPEA 3KOMA 1AC5A 5E1BA 3E2IA 4KO2S 1PN3A 4GECA 3VSAA 3EZ6A 2RAUA 2OD9A 4JJIA 4DKXA 3CZQA 1ESCA 2HCBA 1STOA 4FNMA 4Q4JA 4ZKDA 3JALA 1NVXQ 1U1IA 1TIKA 2YIJA 1E3MA 3IXQA 3DWEX 4RFLA 3AI3A 5G4LA 1JGTA 2OCAA 5GGXA 3JQAD 2R00A 2R62A 3DOUA 3INRA 4EY5A 2H2HA 5LMUB 1WMFA 3V3TA 4BN5A 4ARIA 5JSFA 1N2CB 2CD9A 4EQ6A 2NZVG 4NULA 4YCDA 3L7IA 1I4LD 4B35A 2ZB4A 5FA6A 3IAM6 4GKJB 1TPZA 3THXA 5AVYA 4Z2YA 4A82A 4PGHA 1QANA 2OQRA 1A88A 3B2QA 3HV0A 5BMVF 1JEDA 3B3GA 2H8KA 4HGOA 3SE0A 4BV8A 4CT5A 1PT8A 3LP5A 5B3KA 1EGMB 4V3CA 1DZ3A 4RQUA 2RG1A 2JCSA 4Y0VA 2V8OA 2ZSDA 2POCA 1ADGA 2B8JA 3FIJA 5EN4A 3FVRA 1JZTA 1O96B 3KZXA 3R9XB 1MC5A 2I9KA 5A7GA 1CQJB 3M8KA 1LPPA 1PE0A 2MSNA 3O2NA 5KU7A 3RWOA 1JFFA 3U4IA 1D3AA 4B4DA 2YHAA 4FHFA 4HH0A 4PZUA 1GR0A 4JENA 2BSQA 4BAGA 3CNQS 2FR8A 3HI4A 1UBRS 3I09A 1X1AA 2OBYA 1IPFA 3D4NA 4Q24A 4RH1A 4EMUA 1VL6A 4R6WA 1GNSA 1VRWA 2XT6A 3D4IA 4YQYA 3F4KA 1VCNA 4N41A 2X22A 4MQEA 1HRDA 2RH4A 3WY9A 5HX7A 1H4VB 2VDKB 3G8DA 2XZLA 5CNIA 3WOHA 3BF7A 2AD1A 2R5FA 1QRAA 3NHWA 3QBTA 3TLAA 5IYZA 4OJNA 3CBQA 1LC0A 3GX1A 4HN9A 2HX1A 3W3ZB 3B5EA 1NM5A 3QUQA 1E9BA 1SIWA 3M5CA 1U1GA 4HYEA 4PSUA 5DI3A 3ER8A 1P75A 4NU8X 4PBSA 1QLHA 3BC1A 5CJ2A 2FPGB 3ZDYB 4E13A 3WMFA 3ORHA 3QA3E 5JNUA 1GZ3A 2Z4RA 5FUBA 2HMSA 1YRHA 3MWEB 4KIUA 4OQZA 1GEEA 3TFWA 5F2EA 3TQCA 3LNCA 4IVPA 3J80A 1HDXA 2EKQA 4HB4A 4DZTA 5ALRA 4MV6A 3CZ5A 2XHZA 3RROA 4OHMA 3I32A 1RRMA 2YFQA 1A04A 3PJEA 4EJFA 2XUIA 3G0CA 2EV9A 4FMPA 3EQ9A 1V8OA 4MWCA 2OESA 2OENG 3UKDA 1XZDA 4EABA 1IRXA 2ZT8A 2B1GA 3CV3A 3KD3A 2CZQA 5DU2A 4BFZA 1M7BA 1YZQA 4GX1A 1J24A 1MQAA 1NMEA 4H60A 1EAYA 2DMRA 4UXHA 1QPBA 4P7GA 3RRMA 5IKPA 1M2EA 4DA9A 1FQJA 3QKSA 3ZCRA 1EVQA 2PMFA 1GIAA 4YRZA 2NPIA 1FDVA 2VJBA 3A04A 3K30A 5J40A 4BMCA 5IVIA 2CNBA 3DM5A 4X1KA 5JHHB 4ETMA 4AJ1A 4O4IB 2OKGA 2NVWA 4OQPA 1IJEA 1XA4A 1SVWA 4AMBA 3D02A 5ALPA 2PGXA 1HDOA 2C4KA 1IB0A 1YO6A 4CXMA 3KKNA 3L9WA 4F97A 4RKRA 4N01A 2CV1A 4KW7A 3SQXA 1IPHA 2WT9A 1NQUA 1G4HA 3FGZA 3L79A 4DC1A 1KY4A 2I03A 2WIKA 1T0IA 2Y27A 4OEHA 2P5YA 1BS2A 1ZRSA 1N2IA 3ZWKA 3M6FA 4RTPA 2CHUA 3ZIAA 2C5EA 1YKSA 1ZMTA 5CIYA 4N47A 4R01A 1RACA 4CL3A 3BMOB 4ZGWA 3WAGA 1W5TA 3B1ZA 2OK7A 2IZZA 4LCJA 3HN6A 3ZWXA 2FN7A 4AZ3A 2LBPA 3G89A 4QARA 4TM7A 1QR2A 4JP5A 4OATA 2CMGA 3V1LA 2QBYA 3IERA 3GUCA 2FZKA 1RC0A 1FDIA 2QMOA 5IP5A 4B80A 1XJ0A 2PX3A 4DY6A 3PL1A 4I6JA 3DEFA 1RI2A 3OCUA 1L5SA 1G3UA 3I64A 5IDWA 1QNFA 3C3XA 1S5PA 1C7EA 2CF5A 2HWXA 4I9NA 4TLAA 4RVDA 4CRWB 1Z74A 2ISSD 4EFLA 5L4LA 3QEOA 4P8RA 3VPSA 5LYJF 3SSAA 2REOA 4AXXA 3SC3A 4M6WA 3ZE9A 4YHBA 2LCQA 3L0SA 2X7JA 3NIGB 4WE3A 4Z4FA 3F5DA 3KSRA 4KN6A 4UEOA 2LPMA 2CMDA 2NXNA 3K72B 1XNJA 4X97A 1C8BA 4Z8XA 4EZBA 1UBEA 5AFSA 1E8MA 2QTTA 4L22A 3Q9SA 2P9YA 2J09A 4AN4A 3KBOA 3CKKA 4IZIA 1CRPA 4NP6A 1V8BA 2EF0A 3A1NA 3Q7IA 5K3FA 3TW8A 5EWJB 1BX0A 1UZNA 5C5EA 4MQLA 2UZ1B 3LCVB 1Z35A 5EIAA 2OXEA 3AGPA 3WSWA 4GL2A 4EEZA 3N2EA 5LOVF 2IYEA 4DSTA 3S2EA 4YB8A 2WTXA 3ZIAD 2ZXEA 1RXEA 1K0UA 1CR0A 4YO7A 5TQ2A 5IC5A 4BGIA 1MXFA 3SBEA 4FFRA 3VOBA 1WM1A 3THSA 2R8XA 4OMFG 5DE3A 2V03A 3FYDA 4NZ9A 1V37A 1C1HA 1JJ7A 3C3EA 2GEDA 1I7PA 2ZQYA 4JJ6A 3SBOA 3T9BA 4CTJA 2XMPA 3AZQA 2AEJA 1WXEA 2DUUA 4EUHA 1XAJA 2D6FA 2NXCA 4PQEA 5AICA 2H4ZA 1Q0HA 4BNMA 2FR0A 4D0GA 5KPDA 1W5FA 4CTMA 1HFWA 4YRJA 5SYAA 4C89A 1K7YA 2AG1A 3HKBB 4HT3B 5IVPA 1L8OA 2C84A 3KYCB 3LXXA 4EZEA 2Q5LA 3WRYA 2WZBA 1UDXA 2X41A 4LY9A 2HU8A 1HORA 4Q3KA 3RVKA 5GM2A 2RHLA 4C6SA 4DUYB 2DPGA 2JB9A 3NFRA 3KKKA 1E4VA 3OOJA 4KBFA 4WACA 5DWDA 4WZBA 4E1VA 2GSWA 1PSDA 2EW2A 2AXPA 3RIMA 4TROA 1RKQA 2P6OA 4U1RA 4G1BA 1KXZA 5M3BA 5IM4F 5G0WA 5TPWA 3KDAA 1PJ8A 4WZBE 1ITZA 1QAMA 4U7DA 3DUFA 4IWYA 3T0FA 2PUEA 3LX6A 4K87A 4A6PA 2HR1A 2W2XA 4HS9A 3LBIA 2VTDA 1YFJA 3EVFA 1BVRA 4RESA 4F5ZA 3T3NA 3IE2A 3QUSA 5KSYA 2A4KA 3HR4A 2MYTA 2YICA 1R0WA 3K2IA 3UMBA 3F1KA 1M8KA 1UC5B 2YV2A 3GA5A 1OWMA 3QUCA 4OK6A 3U3RA 3ZE7A 3ECSA 4FYMA 1IZ7A 1B23P 2H7XA 3KB6A 3KXPA 2C8KA 1Z47A 2GDJA 1O6GA 2PQ0A 3NH6A 4KNWA 2WLTA 4ZEOA 4FGLA 2F64A 4B3JA 5I7OA 2EC5A 3ZTYA 1ODJA 5ENDA 4H4DA 3C8MA 1WPQA 3U1BA 1QG2A 3EWNA 5DWQA 4JL6A 1UM8A 2QE7A 1AZTA 3E3LA 1D07A 1TYAE 1YZFA 2ERXA 4J8PA 5G02A 1OVMA 4Q1EA 4BP8A 3GD7A 1D9XA 1YJ8A 3QWAA 4U7PB 2PGOA 2NUAB 3GPLA 2BC9A 2H7YA 2W22A 4IMJB 1SUCA 2XKBA 3QE0A 2W4QA 4H6VA 1P8AA 1TZKA 5EMLA 3LU1A 2I6SA 4C2UA 2BR3A 1U9ZA 1CETA 4YRKA 2GEKA 1YL7A 4YCNA 1ZA2A 1MG0A 1MJFA 4MYSA 1SO8A 1Q7GA 3QH4A 5LQCA 2Q2QA 3M1IA 5DWVA 4YV2A 2D5AA 1YACA 2VAPA 2DZDA 4G8JA 1LLFA 1W7AA 3H1FA 1IMOA 5L4NA 1I1QB 3SMVA 2PSEA 3T3IA 4A0QA 4O2AB 1YQUA 3AI2A 3MZ0A 1ZMBA 3DVAB 4L6CA 4O4LF 3U1VA 4ZICA 4DCOA 1SOAA 4JHLA 1MBZA 3FJOA 1UL1X 3TW4A 3H8WA 4B4WA 2PJRA 2XTAA 2WAYA 3IILA 1PUIA 2J4DA 4LYGA 1JB1A 2OC9A 2FSPA 1HPLA 4LF8B 1O87A 2C96A 1H2WA 1T4CB 3JV7A 2WU4A 1TA4A 4ND8A 1RJ9B 3K94A 5L95A 3EZNA 1BMTA 4KG7A 1WW8A 4M7OA 4X8HA 1VIMA 2W2NA 3VDMA 1ISJA 4MGZR 3SX4A 1UADA 2W00A 4BUCA 3OQPA 2D3WA 2XCIA 3JQAB 4DCCA 4BGEA 1V3VA 3CO5A 2AT1A 1DSSG 1ONOA 2N46A 1I13A 4GP9A 4IXWA 4XD7D 3WJ2A 4XIGS 2YJZA 2H2WA 3NBUA 5BQXA 3COZA 1XTZA 3S2FA 5JAMA 3OX4A 2QXTA 4YMWA 2YJ5A 4OHWA 4UDOA 4LVNA 4DLBA 1M75A 4CUKA 3AKYA 4Z0NA 2WEKA 3KXLA 4PN7A 4CIVA 1R0YA 1TF2A 5ELMA 4AKHA 1CUUA 4OJQA 2YHBA 5KOYA 2PH1A 3N5KA 3GIWA 1XLWA 2IYXA 4ALNA 5JECA 5JNSA 1WD5A 4FM9A 2GRUA 5CLLA 1G9SA 1TJPB 3OICA 1OUMA 4NJOA 4WBXC 4LRXA 4TQAA 4CLOB 1SJ9A 2B9EA 3M89A 1QF9A 1L0BA 4J1NA 3VDRA 2YJNA 1QJ4A 1Q74A 3A2NA 4HWOA 4GBMA 3W6ZA 5JH7A 1I5RA 2FEKA 4PR3A 1HR0B 4YRBA 1C0KA 4RETA 5C8VA 1O08A 3D5TA 3HWSA 3H2KA 4PBRA 4X3PA 5JAQA 4YLYA 5LYYA 4G86A 1KOLA 5IJ0A 1H2AS 2XB6A 5BSWA 2OM6A 3O47A 4JLPA 3ETGA 4FI3F 3OA2A 1QP4A 3EA4A 4HVCA 1GZDA 4YK7A 2P75A 2IUSA 2WMOB 3FMIA 3JALB 4CTKA 1CZOA 4PFQA 4XJSA 4CT4B 1HDCA 3J81k 4JL5A 1PQPA 1VLZA 1XXHE 1LU9A 4RKFA 2KPOA 2ZUBA 4KLRA 4ND7A 1K86A 4C7VA 1T1JA 1R0BA 3KDSE 1BFUA 1HEIA 1PT7A 3QJGA 4WT7A 1AF4A 1B0PA 1NQOA 1ECGA 3QSGA 4QDTA 4EQ6B 3H2ZA 4HDOB 3NP9A 5EZ6B 1A5ZA 2XTNA 3IV7A 4KXYA 2C5FA 1WNFA 1D6SA 4CKWA 1SXPA 4IGEA 4H4EA 4EB8A 4JT4A 4XA8A 4ED9A 1E94E 3UAXA 1YB5A 2JH3A 3KV3O 1QU3A 3C6BA 3NV7A 1USIA 1XTPA 5CD1A 1VI5A 1BEEA 1J8QA 2BIFA 2DFDA 2BI8A 2RB5A 4YV1A 5CP8A 1E9RA 1P72A 2DT5A 2O7SA 4RIEA 4CIWA 5EKTA 2DH6A 3HGMA 4DA0A 4BKUA 4OHZA 3Q6NA 1JFFB 1AQUA 4H7DA 3QYAA 4GPD1 5CDFA 4U6SA 3F67A 4C4AA 2IS2A 3PT9A 1V95A 1Z4NA 2C9CA 2Q27A 1PTJA 3M3DA 4FUTA 4JXXA 4TL6A 2BP7A 1S2NA 3FKJA 5DK4A 5HOQA 2WUEA 5KOJB 4W5WA 2QR5A 3H2JA 4MQEB 1EFAA 2UXCB 4RJKA 2FRDA 3ONDA 2C2XA 1P7YA 2VTKA 1OXVA 5IYZB 4MIEA 3W06A 1M2GA 4MYTA 1A9OA 5CM9C 3OCZA 1LRJA 2FSUA 2ZU0C 3WBKA 1MKYA 1BRTA 2VPYA 4QPZA 5DI3B 5DIFA 5MN4A 2WUVA 4E0BA 5C7IO 3LQYA 1N9GA 4HRAA 3OCYA 2FOXA 3K53A 4KR6A 1QHSA 2ID7A 1E1MA 2IY8A 2OHIA 4F6RA 3G1TA 4NVRA 2BFAA 5TPZD 1LNZA 2EYQA 3VOAA 1PGNA 1SC9A 2V7BA 2X8WA 1SC6A 3IO3A 1QWSA 3NS7A 5CMLA 3OQIA 4C9BA 2Y67A 4WLOA 3T5BA 3GLGE 3MGBA 1ZH4A 4A5SA 3HUFA 2PXXA 2XMCA 1U1CA 2JFWA 3D6HA 1G55A 3JVVA 4QUIA 1BQ4A 5A4KA 5CDTA 5M34A 1WJGA 1F12A 1L5KA 3OFVA 1FNMA 2ZUVA 4BMVA 2A84A 3WK6A 5KSWB 3D5QA 4D02A 2AXEA 2H08A 3GRZA 1XPRA 2NO1A 1TQDA 2W7TA 1AMOA 2I34A 3DLCA 1DCFA 2IHUA 4ZANA 1UP7A 4INJA 5HILA 3QKSB 2E6UX 3R0QA 2ETXA 2YYSA 3EQ6A 4IZ6A 5IWCA 4NMXB 4RIIA 3CLSC 2NQ8A 3DNFA 1FQKA 2BZ0A 4RORA 1I3OA 4X1KB 4F4JA 3L4JA 4IGIA 2VQ3A 1XKQA 2PPVA 4P08A 1H2BA 1H1LA 3TTYA 2WTEA 5AD1A 2VPXA 1Z2CA 4J91A 4DNXA 1PR4A 1N7IA 5A0TA 3ESBA 2Q9CA 3QXCA 2PKCA 3KVNA 4B1FA 2BDTA 1M6YA 4JYAB 5GADl 3GLQA 1AN0A 1SKMA 1XAHA 4E6EA 4NJMA 3CPJB 2GNPA 3D0KA 4J1TA 1MOQA 1HTBA 2C07A 3H1AA 4GNKA 4HDRA 1G8SA 4ZT6A 1QPZA 3L0CA 4I99A 2E87A 2ZBRA 1KZ4A 2EFHB 1GG5A 3SYNA 4RENA 3M4ZA 5KWIA 4UNSA 4E11A 1J21A 4IILA 3HCAA 2UV8A 1BNCA 1WVMA 4GIBA 1XA3A 4W99A 1TM4E 3AFIA 3NYWA 4ZYZA 3ZVNA 4M9ZA 2FSFA 1MN6A 3B1JA 3GYGA 1O97D 4AZ3B 3U7HB 4UDYX 3DQPA 2SKDA 4GNRA 5I7WA 3GZTB 3VH4A 1N6IA 2Y3IA 5JTUA 3CMCO 2QBYB 4HQ0A 3CLVA 4NQRA 5CW1A 1AGYA 4JT8A 3QE2A 3T38A 5JI2E 3PPWA 3ROKA 5IK2A 1FYVA 1OTYA 5AKYA 1AV6A 3VC2A 4J07A 2XBUA 2ZE8A 3O31A 1G63A 1U28A 3Q7PA 3ZBTA 3QTBA 3F7OA 3EA0A 3HLKA 2A5LA 2Y93A 3GDGA 4M6WB 2X6TA 4IEFB 1UDBA 4DXDA 1KI7A 4ZU6X 3ZE2B 4QRDA 4YYEA 1YZ3A 1O94A 3F3MA 2ZWAA 3TIGA 3UUWA 3CJRA 3FUWA 4CG3A 2P1ZA 1Z83A 2D2XA 3A2LA 1I14A 2DFLA 3QEBZ 2IUFA 3I04A 4MVYA 1XPOA 1JQ3A 3WJ7A 1XBTA 3CXUA 3HFGA 4IQGA 1POXA 2O2CA 2GM3A 4MW4A 4R1TA 5E4YA 2VSFA 5K3FB 1XMXA 3TW8B 1JI3A 1OAAA 3NAMA 4RA6A 1UKYA 2UUOA 1KMNA 5LDGA 1NXTA 4MVJG 4DIEA 3HYRA 4LXUA 4MTLA 3QMMA 4FT2A 3PUJA 1CJTC 5DTQA 4NDNE 1T2NA 2PL1A 5CA0A 3VDQA 4ARCA 1E7MA 4G1MB 2HGZA 5DNEA 1XQ1A 2R8ZA 1J2RA 2XODA 3PEVA 3PDUA 4YQEA 4AG6A 3DLBA 5H4GA 1V39A 5AM4A 1UPUA 1SG0A 2QN2A 1PS8A 4ERNA 3ADKA 2KX7A 4M83A 4TTJA 2PS3A 2Y4NA 3AXSA 4OQ4A 3ZW9A 4EI8A 4FX5A 4I9FA 1QO0A 4REMA 2AJLI 2VDOB 1C80A 2GEUA 3PNYA 4OXXA 4RVOA 3ZBPA 3AUYA 4BV9A 4C1NA 1V1JA 2ASEA 2D5LA 3KE9A 1K3UB 3U4AA 4CTNA 1PSZA 4HVAA 2JAQA 3P2IA 4B40A 1BCSA 2JHCA 4DC9A 2AI1A 2PXCA 1M2KA 5IK2D 1S8AA 4RTNA 2OP0A 2NO7A 4EYOA 1VMKA 3A6FA 1R6DA 2J67A 1SU7A 1WP9A 2GZ3A 2ORVA 2VUUA 3JD1A 4JSYA 1E9FA 1HFJA 5A6SB 3WNBA 3ZDQA 1EB8A 4WZBB 1XNQB 5ECWA 1W1IA 2FXIA 1GN9A 3IXLA 4TMTA 1O94D 1VBFA 2QXUA 2FZ4A 3W5SA 5TPWB 1Q95A 1VBMA 3WGIA 4UUAA 1E92A 4NYIQ 4DMMA 4IWNA 4W9NC 4AY5A 3FPJA 3DUFB 7MHTA 5E8JA 3VPBA 1E59A 3RODA 4EPRA 5T8KA 1AHNA 2ZIXA 3EBLA 1TDJA 2OHOA 2VHJA 1T34A 2FPIA 2HBRA 3F6RA 4ZYLA 4RADA 3SZMA 4CI0B 3B13B 3ZCTA 1CDDA 4ZP1A 2ZPTX 5FBVB 1LQ2A 1QVVA 4O2BA 4I5DA 5CH5A 1AUPA 3G9TA 3ZK8A 2QAGC 2PL9A 5BSUA 1WXQA 3MTAA 1D2CA 2A9FA 3A27A 4WLNA 1FYDA 4FCVA 3P9YA 2Q0SA 5KO2A 2OFXA 1CC1S 1TM1E 4KQKA 1AN9A 3BK7A 5E9JA 2EGUA 1ORTA 3BICA 2JD2A 3FB4A 1YJCA 4E5SA 3V97A 2NV0A 4KHZA 2NO5A 1QGYA 4MQMA 2JLRA 4DIDA 4MVJH 4B3BA 2P90A 2GQ0A 3K0CA 4R9NA 2Q6KA 4Y9UA 4QUDA 1G98A 3D5EA 2Q1YA 1HTTA 1NQXA 2QYOA 2WTBA 1Z08A 3AUJB 5BWCA 4QPPA 3KKZA 4XW2A 1DXQA 2AOTA 3BJRA 1QO0D 2XUGA 3IV9A 2X14A 4MRVA 2Q5QA 5JMPA 3I9FA 3DOCA 1ODKA 4XM2A 5LNK1 4R2KA 2IYOA 3NETA 3W6OA 1O03A 1N6KA 1EWVA 1WA5A 4M8LA 3DEHA 2COUA 5A05A 2P68A 4PGMA 4MW6A 1MXHA 4WNYA 2IV2X 4B8YA 1LK0A 2IYVA 3A6JA 2ONZA 4LK2A 4W9MC 4OX9B 3FSGA 3DE4X 2QMHA 1R0ZA 2IDZA 4A73A 3COYA 2Z2XA 1QX4A 3ZOKA 2WR8A 4EI7A 2V1UA 4WK4B 1IY1A 1YBFA 2CHVA 2YTZA 3U5ZB 3EY4A 2H2DA 1ONSA 3BWYA 5EE9A 3HB0A 4L73A 1N2OA 3EXEA 3QYFA 3FGNA 3KXDA 3JTMA 4FDMA 4W6QA 2OBFA 4QEZA 3WFIA 3P9SA 3ZE8A 2XB2A 4FK8A 3K96A 3CGGA 4G4IA 1Q20A 4PONA 4WASA 5KKAA 1F06A 1FRZA 5IKMA 1GKUB 3PGMA 1GPJA 2B82A