2X4DA

Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
270
structure length
270
Chain Sequence
SMAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESAASRAELVGQLQRLGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYAATSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase Lhpp
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PHOSPHOLYSINE PHOSPHOHISTIDINE INORGANIC PYROPHOSPHATE PHOSP
total genus 89
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2x4dA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2x4dA02
1RKVA 2OA0A 4BNDA 2WF8A 5IT0A 5ALYA 3PGVA 1U02A 3QUBA 2AMYA 5AI6A 3KZXA 4NABA 3MN1A 3S6JA 1U7PA 3ZVNA 4CF5A 4OD0A 5E0OA 2YJ4A 4Y2RA 4BEVA 1QQ6A 4FYPA 3DAOA 3I6BA 1L8OA 5AKEA 1TJ4A 1VJ5A 2ZBDA 3QUCA 4BX3A 5ALFA 4F72A 5AVSA 1Z4LA 4BEWA 3U19A 4UMVA 3SKXA 5ALHA 5AW5A 3AR4A 3R4CA 5AI4A 4CF4A 5ALNA 1YV9A 2HX1A 3U26A 3ZVMA 5ALDA 1CQZA 5AICA 4CE6A 3VAYA 4C4TA 1L7NA 4RESA 4UATA 5AIAA 2AGVA 2BDEA 2YJ6A 3FM9A 5ALPA 4BKMA 4ZEXA 2ZXEA 5ALLA 4BYGA 1S8OA 5AM0A 5ALOA 2B1QA 3FPBA 2G0AA 2O9JA 1Z4PX 3L8EA 1RQLA 2YBDA 3F9RA 1Z4OA 5ALKA 3ZI4A 2HHLA 3OTQA 3UMGA 2G07A 3ZW7A 4EENA 3OPXA 4MUMA 4XQ0A 2HO4A 1XP5A 3WK5A 4CNQA 3ZVLA 4OFZA 1RDFA 4DW8A 3E81A 2CFRA 2ZBFA 3EF1A 2ZOSA 2AUTA 3W5DA 4NV0A 5AKXA 2G80A 5AVQA 2Q4TA 4J03A 2W43A 4Y2SA 5ALZA 1ZD4A 3K1ZA 1Z4IA 4OHFA 3ZWDA 3AR2A 5AKLA 4Y2PA 2EARA 2I33A 2YMLA 3QX7A 1ZD5A 5IS2A 3RF6A 2C9MA 3W5CA 3N8GA 4FFDA 3AR8A 2FUEA 4Y2VA 5AESA 3SMVA 3L0CA 5AKHA 5A3QA 5AVYA 1NF2A 3FVVA 1WVIA 5AKYA 4DWOA 2HCFA 5AVVA 3FGOA 2NO5A 2B1RA 1O08A 3L7YA 1U2TA 3EPRA 3NAMA 3ED5A 2EAUA 3W5AA 2IOFA 3L1VA 4UM7A 4Y2XA 5AM3A 1T5TA 1ZOLA 5AVTA 2B8EA 2DQSA 2NYVA 4HGPA 5AKZA 4UARA 2ODAA 4CF3A 3AR6A 2GHQA 3DNPA 2WF9A 4NAVA 2G08A 3HLTA 3WKBA 3DDHA 4Y2UA 5AM4A 5ALWA 2C4NA 4GIBA 4HYTA 1RLTA 1YS9A 3BA6A 2RARA 5AI5A 3L5KA 4KX3A 1L7PA 4ZEVA 1L7OA 3R9KA 1QYIA 3ZWKA 5AIBA 1AQ6A 5A3SA 2MSNA 4PNHA 3MPOA 2HDOA 3WKEA 1Z4NA 4JDPA 1RMQA 1Z5UA 3KDPA 3ONNA 5ALSA 3I76A 3B9RA 4HGRA 3UMBA 2D2VA 1YNSA 3AR7A 3FPSA 4L6AA 4UAUA 5AKGA 3AR3A 3U7HB 1RPZA 3E8MA 1RQNA 3QUQA 2HSZA 3AR5A 2WHEA 2P11A 1LTQA 1T5SA 5AI9A 4XPZA 2RBKA 3M1YA 3NIWA 3A3YA 1Q91A 3QU4A 5AI0A 5AK6A 5ALIA 3ZX5A 4FE3A 3N1UA 3OCYA 4YIKA 5AM5A 3QNMA 2YY6A 2JAOA 1LVHA 1SU4A 1T9ZA 5AM2A 2JAUA 4KYTA 3U7GA 2X4DA 4YIHA 4HGQA 2CFSA 3B9BA 5T41A 2FPWA 3ZTWA 2FPSA 4F71A 4KN8A 3ZTYA 5AW1A 2I6XA 4BNDB 5AW8A 3EF0A 3N28A 1WPGA 2B0CA 4UW9A 5ALXA 1ZS9A 4BBJA 1S2OA 4Y2YA 4MWOA 4DFDA 3NASA 4UMFA 5AW4A 1FEZA 2EATA 2P69A 3W5BA 2G1AA 5ALEA 5AM1A 1RLOA 5AVRA 4UU0A 1U7OA 2YMPA 3NANA 1N8NA 4EELA 4JB3A 4ZEWA 2CN1A 3R09A 1XPJA 4YGYA 2GHTA 3CNHA 5AVUA 3UM9A 3QGMA 3IB6A 2HOQA 3OCXA 3KOOA 4YCNA 4UAVA 4EX6A 5ALUA 1Z4MA 4XOUA 4Y3UA 2ZG6A 3N07A 3WK4A 3WK8A 4Y2QA 3ESQA 3L0BA 2IYEA 3E58A 4G9BA 1WZCA 4C4SA 5AKKA 3SD7A 5AK5A 4EZEA 1KYTA 1WR8A 2WF5A 2YJ3A 3WKCA 4HGNA 1F5SA 3A1DA 1SWWA 4Y2TA 4H1WA 1J8DA 5ALTA 5JJBA 2GO7A 5AW2A 2FEAA 1RMTA 1Y8AA 3BWVA 4HAIA 2B8JA 3ET5A 2YFYA 4RETA 2B30A 2GFHA 1QQ5A 4IG4A 3ZU6A 1YJ5A 3ET4A 3WKDA 3QXGA 3IJ5A 3SKYA 2WFAA 5ALVA 2NO4A 4YCLA 1NNLA 4OCZA 3ESRA 2OM6A 1RLMA 1Z4QA 1Z4KA 1ZD2P 3I1YA 3QLEA 3U13A 2W4MA 1RMYA 3QU9A 2I7DA 3SLRA 2MU1A 4O8CA 3QU7A 2PKEA 3A1CA 2I54A 1O03A 4Y2JA 3IRUA 2HF7A 5ALQA 2JGAA 2C8KA 1QH9A 3KC2A 1VFPA 4IFTA 4G63A 5AKIA 1VJRA 1MH9A 4QJBA 3GYGA 5ALGA 3PGLA 2VKQA 2QYHA 2R8ZA 3QU5A 3L8GA 4BX2A 2WF6A 5ALJA 1Z4JA 2FPUA 1YMQA 3E84A 4EEKA 3L0YA 2ZBGA 5AVXA 2W11A 2YMMA 3OCZA 3MMZA 3OCWA 3SF0A 3UMCA 1RKUA 1X42A 4XE5A 1TA0A 2PQ0A 4YH1A 1L6RA 3KBBA 3WK9A 4BX0A 5AHXA 1Z88A 1PW5A 3WK7A 1L8LA 2FPRA 3M9LA 2P9JA 5AW6A 4UMEA 2IOFK 2HEGA 2YMQA 3QYPA 2OBBA 3N5KA 1N9KA 2I55A 1TJ5A 2JAWA 4HGOA 2FI1A 4GXTA 2G06A 2AH5A 1NRWA 3WKAA 2CFTA 1EK2A 5AKJA 1SWVA 3DV9A 1ZJJA 1Z5GA 5ALMA 2QLTA 2Q5EA 3OCUA 1J97A 3L8HA 1ZD3A 4I9GA 4UMDA 3RFUA 2WM8A 4KNWA 4C4RA 4AS3A 5AW7A 3CZ4A 1IWOA 4NFLA 2YN4A 3EWIA 2O2XA 4KX5A 1TJ3A 2RAVA 2YJ5A 4L57A 4E88A 2GMWA 2R8XA 5FP0A 1CR6A 2G09A 1XVIA 2WF7A 5AK4A 3HYCA 4DCCA 1JUDA 4QQFA 2FPXA 3WGUA 1QQ7A 1K1EA 1Q92A 2C8LA 1RRCA 2JARA 4EX7A 3KD3A 3OCVA 2C88A 1EK1A 5AW9A 2BDUA 3WGVA 3J7TA 2IOHA 3FZQA 3PDWA 2R8EA 3SHQA 1U2SA 3I28A 4UASA 1ZRMA 3NRJA 3B8EA 5IT4A 3TLMA 4AS2A 3WK6A 3P96A 1RC8A 4KNVA 2R8YA 3U7EB 3PCTA 2I34A 3AR9A 3D6JA 4UU1A 5AVZA 2FUCA 2ZBEA 5AVWA 2IA5A 3NUQA 1YDFA 2BY4A 2HF2A 3QUTA 4I9FA 3ZX4A 4J2TA 5A3RA 5AI8A 3NALA 5ALRA 4L6CA 3L1UA 2HI0A 4UM5A 5AK3A 4NWIA 3MC1A 3U7FB 1L7MA 3L8FA 3QU2A 5AW3A 5AW0A 2PR7A 2RB5A 4B6JA 2B82A 2OYCA 4YCMA 3A1EA 2FDRA 1ZRNA 1RKQA 3ZUPA 2Q4RA 4AP9A 1TE2A 2P27A
chains in the Genus database with same CATH superfamily
1RXSA 1S6YA 4GI5A 3VKVA 2YCLA 3HB4X 1XEXA 5DBIA 2L42A 3JWGA 5CYPA 3ZHVA 4PX2A 4L72A 3RE1A 4A36A 5DXJA 1U02A 3L41A 1CVRA 5IBRA 3S99A 3QWHA 2GJAA 3O9VA 5JAOA 4ZV9A 1R50A 3OA0A 1ZIPA 3K0SA 2Z2XA 3L4BA 1NBMD 2LR0A 5MGBA 4LBWA 1B4DA 2B8NA 3QVXA 4PXAA 4F60A 1RJDA 1B0ZA 1ZN7A 3TPCA 2C4VA 3JATB 4JOBA 3JASB 1UBJS 4TXMA 4EHAA 2B7CA 4AO7A 2JFNA 4BQFA 2FWPA 1O95C 1M2KA 2XMGA 1LK5A 4UBJA 3A1VA 4HEQA 4PQYA 1FDUA 3Q12A 1EE9A 4MXDA 3T1NA 3ZQ6A 1T4CB 3W8EA 3H2ZA 5LUAA 1USKA 4AC9A 1V4BA 1J00A 1J0AA 3CZRA 1W8DA 2DQYA 3EAQA 5DZSA 4YAOA 5D51S 2VQDA 4MVJF 1UDWA 3WWPA 1OVMA 2PXHA 3L8ZA 2Q2OA 3C1TA 3EDOA 3QSGA 2X0EA 3DTYA 3QQ5A 1U3TA 3BYZA 1HRKA 1R8SA 1G6HA 5DISB 4Z2AA 3U19A 1CY2A 1W34A 4MRVA 4QOIA 5AJVB 3V7WA 3ZDRA 5AW5A 4R41A 1PZMA 5HKKD 3K9NA 1RYYA 5CITA 1FS6A 1A88A 2BBTA 1J2EA 1NZJA 3IP6A 3USCS 4TSFD 1Y4UA 4L7QA 3ZWBA 1UINA 2CUZA 2QTMA 3V4LA 4F4UA 4CM9D 2XYGA 5TJ9A 2NO0A 3M3PA 4K9PA 2XNKA 4IDGA 4JP3A 3RK4A 2O1WA 1U80A 1RQGA 1YJBA 2O8DB 1HQCA 1WCIA 4DLPA 3AYXB 2HU2A 1SEPA 3CEAA 3F0TA 4JYBA 5ELMA 2GZ3A 4TV9A 1PVDA 4IO0A 5ALPA 2VJLA 2J33A 3EIUA 4YP1A 3TSYA 4BKMA 4S24A 4OB6A 1X1TA 1H2YA 3L0DA 3KHSA 4REQB 3WSWA 4CKZA 1SK9A 4P33A 2FEOA 4C4XA 2XWBF 5DKFA 4LBZA 1GR1A 2VP0A 1Z4PX 1NQWA 4ZRNA 5HBGA 3UOGA 1FB5A 3IEVA 4R2JA 2PUAA 4B3XA 2CHUA 3OIVA 2Z8YA 2IYPA 3N0XA 3OHPA 4HWGA 1TKAA 4X1IB 5HS4A 3GLIA 4ALLA 3ZI4A 3S1AB 2EXXA 3UMGA 1ICEA 1TO1E 5BYKA 3NYRA 3ZV6A 3P2JA 1JEQB 1QK4A 1ILWA 3MWDA 2ZUFA 1ADYA 2XKJE 2GGSA 2PWYA 4IILA 1O8BA 4JJEA 1F8YA 1XTSA 4CNQA 2GYVA 4EA6A 5BW8A 4DW8A 3H42B 2J31A 3RVLA 3JU3A 5EPEA 5BV8A 3W5DA 5EIAA 1L5KA 1P81A 3RS9A 4II7A 2G80A 3RREA 4OPMA 3DFZA 4LY3A 5KX5B 1X7DA 1LS6A 3UT0A 1OZFA 1PK8A 2Q1SA 1QP4A 1V3VA 1BWQA 3SP1A 4D5GA 1WM1A 1QHNA 3KE9A 2FQYA 4I0WB 5IH7A 4HNSA 5EP3A 5IYZA 3FHJA 1CY0A 3O6VA 2EARA 2YMLA 3QX7A 3VM6A 1LXCA 1RIFA 1BHQ1 1G2QA 2WKSA 4D0SA 3NP9A 3ZC3A 4KRXA 5EP2A 1A9QA 1P31A 1Z7WA 1KVSA 4EB8A 4X6UA 2IDZA 2R85A 2QD3A 4YB8A 4AJPA 4C0AC 1NNEA 1O6CA 1BXRA 2BUBA 3KSDO 4NOKA 5HK8A 4NJEB 2IZ0A 4FJ2A 4FNMA 5JSKA 5A3VA 5JLJA 5AT1A 3T9EA 3MTJA 1YR2A 5CFOA 2D1SA 4KZKA 4R7ZA 4XX1A 4AKEA 1EAYA 2AN9A 3FMOB 4TUYB 3EPRA 1FFXB 3ED5A 1A04A 2ZB3A 3ROXA 3V7YA 3UWMA 1EEXB 3L6BA 1FVXA 3TSZA 3RC7A 2GHRA 2QN7A 1MB4A 2QX9A 2TRSB 2WQZA 1Y9DA 3BM5A 4X8OA 5I9BA 2E7ZA 5HJ5A 2Z3WA 3AL0C 4IKPA 1L1FA 3CURA 3D6UA 2OXEA 3FDZB 5BY2A 4XJXA 5FPQA 4MWTA 2QJTA 5IC5A 1VMEA 4F4CA 2LRHA 4G56A 3CVJA 5AHWA 2Y66A 2HREA 2C94A 1G66A 2DHDA 1ORWA 2BL4A 4ETNA 1M0TA 5G41A 4JVMA 1V11A 1MH1A 3DPIA 4WESB 2FK8A 4G4SO 2PIDA 5AJHA 5AWFC 2VQ3A 2CNLA 1FFDA 2HGSA 5FAKA 3TK1A 3TDNA 1XAIA 2C7RA 3UF0A 2E4VA 4M54A 4IXTA 1S2GA 4EQ6B 3U4DA 3C6KA 2EF0A 1L7PA 4I5IA 4EJ0A 3QE9Y 4NECA 3Q5GA 5ULLA 4HAXA 4Y1RB 3ADDA 2FZ5A 5AIBA 4V03A 4FWIB 1QG2A 1KKUA 3AILA 4J6FA 1C0KA 1XG5A 4QM6A 2PFKA 3AKEA 4RZSA 2GLUA 3VU1A 1GTZA 4RH0A 3OY7A 5JBQA 2I66A 3WICA 4YPVA 3PC3A 2IHUA 3TTYA 4KMOA 3JZAA 3ZJ5A 5J23A 1JT9A 2E4AA 1TVCA 1ZQ1A 5K1ZA 4JX8A 5E1OA 1ZM2A 1DKRA 1ZICA 1E59A 3K8ZA 2FRDA 2VJAA 3UB3A 2C7GA 4GL4A 3EDMA 3VBCA 5KNDH 2IEYA 1P2FA 1J0XO 5KPDA 3UGJA 4EYQA 1K92A 1YDEA 3JPWA 4H2DA 4L78A 2WHEA 4GLOA 4HDKA 4JFRA 2I78A 2CNWA 1E92A 3FOBA 2GXQA 1D2AA 3ZIAA 2ZIZA 2Q4BA 2FUKA 3B70A 4NCNA 4TQAA 3DAPA 5E7JA 1KI3A 2GPBA 2VP2A 3OTIA 4YREA 1TYZA 2XVZA 5C7OO 2Z8YM 4DLTA 4F3RA 2RGRA 3T7CA 1TW3A 1VA4A 3BCHA 4MIKA 3DYBA 3P0JA 1GL9B 2BHSA 2GILA 1HDYA 4C4PA 5CT6A 1O94A 3X1ZA 1Q50A 4NJEA 1T3HA 1WNFA 1E7RA 1DE0A 3KJFA 2RE8A 1GADO 3IV6A 4G5OA 3SR4A 1RP7A 3TQSA 1QFMA 1E69A 2FPSA 4QTXA 2DJIA 3ILYA 1LDYA 4BNDB 3DLBA 3EF0A 2AG6A 3MS2A 3IDFA 2JIDA 1E9AA 2INGX 3CZ9A 2QSUA 3C97A 4JEIA 4NNPA 3E6AA 4HEA1 4BNXA 1P9LA 3HKEA 1E63A 3BHNA 1YU9A 1PJTA 3FMGA 2VRWA 4WN3A 3TLGA 3RT9A 2D7CA 1VBKA 2YOHA 1P3JA 2WJ3A 1I2ZA 3PKJA 4NYMQ 2WSLA 4GEGA 5JYDA 3V2GA 4N7JA 2YMPA 3B1WA 2OCXA 3EN0A 4V0KA 4EMTA 2GD6A 3B6IA 1Z38A 2C2HA 5LNK1 4MV4A 4Q9KA 2X14A 2CN1A 1UXGA 4LF5B 2F43B 4RE5A 3OD1A 1J7JA 1QBGA 1KP9A 4L2IB 3T7JA 3ZXYA 1MAAA 1GYPA 1UK7A 3AXSA 4B34A 4LOAA 1H9AA 1LLQA 2LZ0A 1V16A 2I7CA 3OUZA 4UUMA 5L3QB 2R3SA 3HPQA 4EGSA 1SBIA 1NATA 1I3KA 2GXSA 2Z2ZA 3UK2A 5JTUA 5TNXA 1H6DA 5JU6A 2I91A 2HADA 3FSRA 4D4JA 1U8EA 4E4TA 5BNZA 1UH5A 1ZO8A 2QNIA 3CKYA 3W05A 4AN4A 3DTTA 3W6UA 2VVTA 1AZSC 1RXEA 3CGWA 4QUDA 2C5HA 3VVLA 4LHZA 4RLFA 3WIUA 1NW8A 5B7PA 4C4SA 2QRGA 3IUBA 4M46A 4WHMA 1VP3A 4WOPA 1O4WA 1RC0A 4C7BA 1LRKA 5I7EA 1E7QA 1XALA 2ZSEA 1RRFA 5JJBA 3DGFC 2BTEA 5IJ0B 3L84A 1IN8A 1DUIA 1RMTA 2WAXA 3B7PA 3FIJA 4LE1A 3NETA 4ZQFA 3BWVA 4JU9A 3C8UA 4YR7A 4OMDA 1E3TA 3AP2A 1JJAA 2UYQA 2JZOA 3OJFA 3ACDA 1H9BA 4PLGA 3G9ZA 1AGPA 1CUSA 2EFDB 3P20A 4R9NA 5CX4A 1QQ5A 2DHQA 2KHZA 4GX2A 1MC4A 3QNUA 4J0CA 5DHAA 1MHPA 1U4OA 2BFFB 2GEJA 3T3NA 4NEGA 4GYKA 2OXCA 3KTDA 1J24A 1SVIA 1XTKA 4MRRA 2XNSA 4LVOA 1NPDA 3FDXA 2FN8A 2BFWA 3D7NA 2NO4A 1WXEA 1II9A 4GOJA 4WDRA 4XR4A 4YLEA 3CW9A 2XT9A 5JSUA 3GPBA 5WRFA 3IVXA 3B9QA 2Q3HA 2VDMB 1RMYA 1BKDR 4GR4A 4UOZA 3PLNA 1V96A 3Q10A 1NQUA 3EQ8A 1XRRA 4JYCA 5CCBA 2OSVA 3O4IA 1GZUA 2JJ1D 2WPDA 3Q88A 4NENB 4Y2JA 2FEPA 2HF7A 3GDHA 2CV0A 1KETA 2ZS7A 1REQB 4GM1A 3TRDA 5CFRA 3KOZA 3KK0A 4DCTA 2VWQA 2HPVA 3KUXA 2DETA 1GQQA 5DXFA 5ALGA 1ORHA 1Y5IA 4K28A 4BECA 2QK4A 1AKEA 3P5SA 4LE2A 4OI2A 2JA1A 4R1LA 4AKGA 4LKOA 3WIEA 1NW3A 3IP5A 4QE3A 2BSXA 3A32A 4HWOA 4BUZA 2R84A 3RRXA 3LLMA 5HKKA 2ZT8A 2PXCA 3ND7A 3B51X 3EMKA 2B1IA 1YC2A 3VNAA 1O0CA 2H3HA 2BGLA 4JH0A 4PTLA 3PC8C 3DOUA 1BA2A 3E22A 5E3IA 5FLKA 3R5TA 1BA3A 1EP2B 4DBLC 3HCAA 1WB9A 5E2AA 1JR3A 2ZRIA 4AZ0A 1NBAA 4FQ8A 3HUEA 4PHCA 3WLMA 5LWQA 3A27A 2UXDB 4ZJYA 1IK4A 3UW1A 2G40A 4QBTA 5EQTA 1W88B 4MQUA 1JIJA 4LY6A 1GPWB 3P8ZA 4DDHA 4DV5B 2VG8A 4WTOA 3KU1A 3SMQA 2OV1A 4U2BA 4XWTA 2DFNA 2X42A 3G79A 3JS5A 1ZD8A 2GM9A 2X2FA 5JCJA 4CL3A 3DBRA 1E5QA 1OJ7A 1UBEA 4MYSA 3KIPA 2H57A 2YHUA 4BO1A 2IS4A 3TI9A 2L0XA 2EG5A 2C3YA 2DFTA 4QELA 4J7UA 3CX7A 1TX4B 4ZI7A 3F2IA 1NYQA 1DTEA 3WZLA 1C4XA 3QOWA 3ZV7A 3PFBA 1LI7A 3LPLA 3MWKA 1GCOA 5EZ5A 1WY7A 4AYXA 3W34A 3J80A 1VHDA 2GWHA 2OHGA 2JCVA 1QR6A 1PVOA 3R41A 2PSSA 4FP9A 3RFXA 3B52X 1QRDA 1KVTA 1RWPA 1U0LA 2QTWB 1U4SA 4MJ3A 5BN3A 3DDCA 3GFFA 1HSZA 2Q5EA 4X24A 3IVAA 4NPAA 3AT1A 4IICA 1C0IA 1ZD1A 2I80A 2I5PO 4R2XA 3FI0A 4PSCA 2BV3A 1LRJA 1MABA 1LS1A 4NHEA 1CJCA 3HSKA 4UFOA 3VC2A 4RKQA 3O4JA 5HZMA 5IVIA 4R69A 1JJBA 5IN4A 1SELA 1M0WA 5L40A 4D1YA 1CUDA 1HE3A 1Y8QB 2WNIA 5AK4A 3KYDB 5DGIA 3QHAA 3PXXA 1GXSA 3NHSA 4WV3A 4XVQA 2PFGA 4R2HA 3KWLA 5K51A 2G76A 4RJKA 4ONEA 2PZEA 1AKNA 3F67A 1AUXA 1C7FA 1L5YA 4OLJA 5LXTA 1N1MA 3AIKA 3AUYA 1FX0B 2XX3A 2C42A 1UZUA 3HP7A 3J7TA 2EW8A 3FZNA 1IOWA 5I7OA 2FCAA 1FTWA 3BXHA 4R4JA 1TZJA 2FFBA 3ONFA 1ZRMA 3A2NA 4UTRA 1PCXA 1Z13A 4ZOLB 2O7QA 1U8TA 5FHQA 3CH7A 3ETHA 3ZZNA 4PGFA 2O8NA 3G02A 3QVLA 4D92A 5DN6D 2VT3A 3NNSA 3AM3A 4UHHA 2IU0A 3TZLA 5K8UA 2DUNA 3DWGA 1QG6A 3EULA 3WLHA 3PJDA 1X3SA 1HDEA 4BKOA 3QXSA 5LFAA 2VPXA 5JRDS 1FMTA 1PD0A 2WAAA 3ORQA 3TH5A 3EPJA 2P78A 3ZX4A 4CQLA 1S1MA 3C8MA 4OXYA 1VL5A 1XVTA 2ORWA 3E4CA 5K0ZA 4F4HA 2VWPA 4Q4JB 4WLEA 5B4TA 4UBIA 2PUBA 2H1WA 1U9IA 4JEUA 3TJRA 1TA4A 4P32A 3WVNA 4CQNA 5MHTA 4N40A 1SCJA 5A4KA 1T34A 4UM5A 3TW0A 4R1QA 3KFVA 3L8FA 3HXKA 2JCGA 3L7MA 3QU2A 1GJRA 4CLXA 1G4HA 1XMSA 3Q72A 2RB5A 3VHXA 4C21A 3MG9A 2GNAA 4KXLA 1VE9A 3TZCA 4UU7A 5JDIA 1JQBA 1D03A 1ZRNA 3MINA 4IXMA 3TQIA 3B3AA 1QQAA 4QU8A 2Q4RA 4UNIA 2W37A 1TE2A 4IJ5A 3ER8A 2GBCA 2P27A 5JATA 4QOHA 1VSBA 5IP5A 2ZPAA 3OLZA 1WU7A 1M2WA 4UULA 4AROA 3DQZA 3EGVA 1IVNA 1I7NA 1K6MA 2PAFA 5KOJA 1G5PA 1HURA 1GTL1 3EDQA 3R20A 5IK2D 4QBFA 2J7PA 4WBNB 1EXNA 3DMFA 3KZXA 3ZJYA 3K2IA 1US8A 4JLUA 3HKCB 5LKAA 1J5EB 2CUKA 1XHFA 3OZRA 3TEFA 1CUHA 2H1HA 1U7PA 4JBYA 1X8KA 1NASA 5BVHA 5FYQA 4G1UC 4CMBA 5I9MA 3H83A 2Z5LA 1MU0A 1ZJ5A 4PEVA 2F9FA 3T9AA 4C22A 3G0IA 1QAOA 2JAXA 3BIFA 4QT4A 2QSYA 4P36A 5L3SA 2ZAOA 5MDHA 1UDCA 4TT3D 2NVUB 3T5AA 2C2WA 1WB6A 2PRYA 4J0GA 2AVNA 1TJ4A 1SHLA 1Y1KE 3TTXA 4J76A 4B3CA 5C53B 1XI2A 4MR9B 5FPTA 4EMBA 5JASA 1I2BA 4PSKA 3VR4H 1U7WA 1Z8DA 4AF8A 1HT2E 2CD7A 4ILEA 2ZGVA 4LYHA 2BEVA 4CFSA 4HJXA 3CR8A 4YJFA 2HDHA 2A0UA 3QMPA 4WNYA 1TCUA 1UKVY 2J0QA 2QN2A 5ITZA 4H15A 1FFEA 4EFMA 4E08A 1ODKA 3RANA 2G9QA 5F3DA 5BO5A 2ODNA 5TV2A 4JJKA 4Y6GB 4DXDA 5JT1A 3FYSA 1KRWA 3H5RA 5EN4A 1ZJ4A 4YCBA 5K03A 1G7TA 2BM0A 2OPHA 1J9GA 3NATA 4TL7A 4BMXA 2EWMA 2NV0A 4NAUA 2VBFA 1OA1A 3CN7A 1O5OA 3D6HA 3OTGA 1U28C 4B9AA 2HD4A 3RQIA 5AIAA 9ATCA 1NJGA 5BSRA 2ZJ4A 4GI2A 1J8VA 3TL6A 3E8XA 5L4LA 1LK0A 2G72A 2V5VA 3DLPX 5ALLA 1W581 1Z34A 4TSRA 1S8OA 3AF4A 4MP3A 2QZJA 4FYYA 2BCJQ 4PCAA 3U4QB 5IVKA 3UXHA 2PUCA 5ELXA 4N0QA 2G0AA 4CMIA 4D26A 5CAEA 2J3MA 2Q3JA 4GX1A 4QJIA 4EL0A 4N18A 1RYEA 1I2MA 1E1MA 2BFCA 3OM0A 5CVEA 1F2UB 2QTRA 4LHYA 5FR1A 3PK0A 1Q7GA 4OXNA 1JG1A 3RRYA 2B4KA 2XSZD 3KOWA 5JPIA 3O90A 4F2WA 2Q27A 2WWTA 4GBED 1DQNA 1W6UA 1R4MB 1E96A 2PO7A 2JHGA 3W2TA 2B4TO 3B1FA 3AERB 4NC9A 3UICA 1FBNA 3TAHA 4AJHA 4H0FA 1F0PA 1ACJA 2VLIA 4ZOCA 5T5QA 2OFFA 5C18A 4CLOA 1K8YB 1UBNA 1X7YA 1V8DA 2NUPA 3ZU4A 3CUTA 4ZC1A 2F4VB 3E8SA 1F51E 1O2DA 1RDFA 3NEYA 4BOYA 3D2CA 3R5XA 1I7DA 4GRIA 2VQ6A 4AD8A 4B6QA 1RVDA 1PD1A 1E2DA 3EIHA 5JCOA 2VDWB 1N2ZA 3KJNA 1U63A 1VPWA 4EHDA 1USUA 2JGIA 2WLSA 3DO5A 4FMCB 3I3SR 4A8JA 4YCAA 1WUKS 1P9NA 3PRKE 5L8VA 4EGAA 3W5CA 2IYTA 2DT5A 4AZTA 1JYEA 1U5BA 5LM3A 2L69A 4UBOA 3C5VA 3L0CA 4D43A 1ZU5A 5DI3B 1NI5A 3G1UA 4A1FA 1XKTA 3TIFA 1JR2A 1I30A 3PTAA 1WPQA 1ZD9A 3DVAB 4HRVA 4KGXA 2IYSA 1JEOA 3EUWA 1O57A 4RLHA 1ZKMA 2CFOA 3L7YA 3R5JA 1JAHA 1EDDA 3QPVA 3T6KA 1UC4B 2A1IA 3OT1A 4YUXA 5BUZA 5KNDA 3U56A 1LH0A 1RAFA 3P9IA 4MV6A 2Q62A 2VZLA 2PL5A 3RUFA 4WL0A 3TG2A 1J49A 4ZOAA 4DAOA 5GOZA 2FEKA 2B8EA 3KQUA 4XEHA 3TPZA 3CT4A 2C8JA 2NYVA 1N4AA 1JLLB 3ABSB 3F2VA 2XOKA 1V8BA 2LWIA 4Z9BA 1NUTA 1OXXK 3JAWB 2WHRA 3MRVA 1ZBDA 1MX1A 1VC2A 2OR3A 2VT7A 1BG6A 1K9VF 1Z0KA 4UNQA 4HSEA 2D0PB 2QL9A 4LAFA 5DSTA 4U4AA 1V16B 2XCLA 3G2QA 4AX8A 2XXAB 5ERGB 5IHXA 2PRSA 2PR2A 3I12A 4L8VA 2VHZA 2C4NA 1HQKA 2ZCVA 4RKEA 1CXZA 1W1IA 3MSCA 4HYTA 3KPVA 4I1IA 4PANA 5IKOA 1LF0A 4HHEA 5EWMA 4A0GA 4CIVA 4EJFA 1SCUA 3HMQA 3UB2A 1S7GA 2FG6C 5G4KB 4NOLA 4N5NA 4PF1A 1JEYB 2V98A 5H7XA 2XGGA 3TR6A 3ANMA 4Q7JB 3U7JA 4G41A 1PO7A 4KPYA 3KG2A 3Q0TA 2POQX 2YHAA 3TVYA 2JIMA 3DDZX 2MSNA 1IAQA 1VLVA 3QUSA 4HNHA 1NJ8A 4RVDA 3V4VB 3DS8A 3QFSA 1L5HA 3O4GA 3UPUA 3KKLA 1FUYB 4ZMBA 5LN1A 1B8PA 1P7YA 3D4BA 3QLVA 1NXQA 1UR5A 3ORHA 2ZSAA 3UQZA 2TMYA 5JXJA 3B9RA 1E9DA 2YDYA 1W35A 1RM4A 1D2EA 1M2OA 3AR7A 3DFIA 1F2TA 1QKKA 2NSJA 2ZZKA 4XFDA 2X0FA 2W6JA 2B7BA 1CP2A 4MW6A 5KTTA 1PQYA 3VC1A 2QGZA 1UMBB 3E8MA 2P3QA 3Q2OA 1OXVA 1SOWA 3FCAA 4XCVA 3AMVA 5AD1A 3WWEA 4ZDJA 1ENOA 1Y98A 3GLTA 3IIJA 4TTAA 2RBEA 4V2IA 3AKYA 1Y1SA 2NQ8A 3UPTA 2IE8A 4PQEA 4WJLA 1OC2A 5E6SA 1BE1A 4QRDA 4X97A 3ZVRA 4TKUA 4HN9A 2NQTA 1RWXA 1GPUA 1AUOA 1E0AA 3GLQA 4FLFA 3U7GA 3CX4A 2ISCA 1YTLA 1MTZA 4OHBA 3O3NB 1RKBA 3ORSA 3O9ZA 1MDBA 4TMWA 1BJTA 4DDMA 3AG5A 3RAPR 2CVFA 3V4OA 2DYKA 4XUDA 1FDOA 1W19A 4BB0A 1M34E 4O0MA 1CFZA 5AW1A 3K70B 5TDHA 2GJ4A 4EY6A 3ZXIA 1OLUA 4TYYA 1ZJWA 5CURA 3AGPA 3GZ4A 1S2OA 1KZ9A 2C7VA 3FPHA 4J43A 3DAFA 1YS6A 3C45A 5FO1A 1Z17A 3U7IA 1G8YA 1C3LA 2Z57A 5AW4A 1MG0A 3QW2A 2P69A 2UV8A 5EJIA 3KT3A 4LMBA 4C6TA 2CZGA 3LW7A 4L7VA 3SZ3A 1U7OA 4M38A 3HWX1 1K5PA 4MW9A 4ZO9A 1FYXA 5KWVA 1D04A 3L8CA 3P45A 3PNOA 4CU2A 2M32A 2O1EA 1NLFA 5H5JA 5CTJA 1UKBA 4V38A 1JB9A 1ESCA 1D2MA 4WZBA 5IKEA 2PSDA 1M2VB 2ZUTA 3DXXA 4YX9A 3G2MA 1VQ1A 1AXEA 3AU9A 1LBTA 2G7MC 3CX8A 1HLPA 1W1UA 1XRNA 2WAYA 3OCXA 3W9UA 3GX1A 9LDBA 3COJA 3B1JA 1W73A 4Y7DA 2RHGB 4AY3A 4CM4B 2PEYA 3CF0A 4EYEA 2XYPA 5KQRA 3FVQA 2HWWA 2DLCX 1USVA 1W0JD 4N8SA 4B2LA 1UT6A 4KC0A 2Q7DA 3R75A 1QYXA 1TCCA 2BT4A 3BFJA 4ZODA 4WXHA 1IEVA 4JYMA 3ZY2A 4MUIA 3CCCA 1CHNA 3PEVA 2AHOA 4L0MA 1EXMA 3GELA 4UAGA 3ASUA 5J63A 3UHAA 1ZU4A 3GXBA 2A8YA 3UBMA 2Q9AA 3VYRB 2PT5A 1E3DA 5DCYA 5K6AC 1ODLA 3JALB 2Z9DA 4MCIA 1S9HA 3UPDA 5J4VA 3PJEA 5FEUA 1X0VA 2QEQA 1K5GA 5TY0A 3PFCA 3WL8A 1L4YA 2Y1XA 2BAGA 3UHPA 4ZTZB 4DMLA 5KSYA 3ZWPA 1AT1A 3WS7A 3PRJA 4BAGA 2E85A 2V6MA 1GPAA 3RFVA 4Z3OA 4LX0A 3ZU6A 1WPRA 1I01A 3IHKA 1CUAA 1YACA 4I1PA 1IWBB 1S8AA 4NDAA 2IUEA 3PITA 5IYZB 1MAUA 3B3JA 4TM8A 2BHNA 3MBOA 4GECA 2IHTA 4G8CA 1DKOA 4M8KA 5JR3A 2NADA 1CEYA 2I8LA 2YQ4A 3ZWQA 3L6UA 4P93A 5J47A 2W6IA 2RONA 4LZJA 4E2XA 2VPPA 4AY6A 4D25A 3QU9A 3K96A 5I7FA 2WWIA 1XP8A 3DOFA 1CTQA 3I6IA 4O8CA 4NH4A 1AE1A 2RK4A 1NV9A 1QGAA 2AXEA 1SKUA 4HO1X 2Y9MB 4IEIA 4MI1A 4YT5A 5DGHA 5J40A 3QEBZ 5DTQA 3KWJA 3ISTA 3ZGVA 1JEQA 1PSDA 3T94A 4B43A 5HJ7A 3NMUF 2I3GA 2WHPA 1OZHA 1VI6A 3HVHA 3QIAA 3P9SA 1V7CA 4PZLA 3BFPA 2I1VB 3ASYA 5B4VA 2P4UA 1HMPA 4CM1A 4HVCA 5B7NA 1T3LA 2LVBA 4D0GA 1KZ6A 1MEJA 2OC9A 1YULA 4U8HA 3DWEX 5HYVA 2QXTA 4XIGS 3RIXA 2Z9BA 3FDJA 3A7EA 1YJCA 4I2VA 2RJOA 3KYJB 1JLLA 3ICPA 2ZS8A 3QK7A 5ELLA 2O59A 2QF7A 2GAAA 2DZDA 3MIZA 1I6MA 1WXFA 4JX9A 2WJZB 1SVSA 3AEKB 3O1LA 2R87A 3L0IB 4M53A 3WGIA 3PP8A 3VU3A 4AFNA 1JQKA 4H3VA 2RH5A 1W0JA 4ABYA 3KQVA 4BLVA 3HUTA 3HJHA 4OKNA 4JI1B 5I9SA 1MFZA 2PZBA 2XUDA 3I34X 3K16A 2VRNA 5LQAA 1OHHA 2QXUA 3BE6A 2ZDHA 3RJ5A 1RACA 1XIVA 1ZUIA 3T35A 2FG5A 4FFNA 1ATZA 3CO5A 2C07A 2OOSA 3W2FA 1XUOA 4X8MA 5TMPA 3T7TA 1TVKB 2CXXA 1U5BB 3PDUA 4LGMA 1RWBA 4FBLA 3R8XA 3SI7A 2OECA 2DPGA 1ESMA 4ZDIA 1P2BA 1ADBA 1OR8A 2QYSA 4QHSA 1X87A 1WULS 3ZZ1A 5J4HA 2H7YA 5LLDA 4M8IA 4B82A 1XXHE 4W1SA 5BWOA 5JXWA 1EH5A 3ZDYB 4A2QA 2WJGA 2XXBA 3ELBA 3R8FA 2C84A 3LC7O 1SXJB 3C0KA 3LT4A 3AEZA 2J9ZB 2G06A 4A7PA 3WKAA 1VHTA 3EXEB 2GN1A 3OTHA 1DNPA 1JEYA 5AKJA 3DOOA 3G89A 2PZJA 3LTEA 3Q11A 4ROSA 1SC4A 4Z86A 5EHGA 2SNIE 4ZGWA 2EU8A 2FZLA 4G5XA 2R7KA 1HKUA 1TM2A 1AXRA 1IQUA 1PZGA 3OICA 2Y67A 3CW8X 4TL6A 1VZ3A 2EX4A 1PNVA 2A0XA 1T8RA 2BTQB 4P4TA 1CF4A 1Q6ZA 1ENPA 5JALA 4EJ6A 2FPMA 3O4HA 4LJ4A 1M2GA 1ZOSA 5JYCA 3SVZA 6PFKA 2F1RA 3W2IA 1CDOA 4YI3A 2UVQA 4DSUA 1IJEA 4RIHA 3NVKI 3C3PA 2D2FA 2PUTA 3S8MA 2H1IA 2PMKA 3BXZA 3MBKA 3MWLA 3Q3IA 1C9MA 4MS3B 1YA8A 4M3NA 3EPPA 4ZVLA 3FMPB 1EK1A 4HXEB 5CJJA 5BSTA 4B1FA 4EJSC 2DY0A 1XA0A 2Q2NA 1B8NA 2I2AA 2O0KA 1AV6A 1NA5A 3EA5A 3NTQA 5EXPA 4Q7QA 1AN9A 3BSSA 3TZHA 4CMGA 5IKPA 1Y6GA 4BO3A 1NSFA 2GUGA 1RRKA 4ME6A 2FW1A 1GRVA 3WLNA 3BN3A 1TQ6A 4M0EA 3ZK9A 3A7DA 3TQOA 5K0BA 3QX3A 1PDVA 1J0BA 1T5HX 2QTZA 3RTCA 3VZRA 3X1WA 4DCUA 2FOIA 1TGVA 2Q5FA 4JHLA 4QDKA 1UZLA 3DE3X 3RFCA 1KWGA 3OEED 1P6UA 4R1PA 4DR3B 4PXSA 1MOSA 5AVWA 1C1HA 1RRMA 5D3QA 1F48A 2X8BA 2QGNA 3HBLA 3TZKA 3WGLA 1RCFA 4ANFA 1WKCA 3S55A 3OURA 1GCUA 1N5OX 2FJUA 4IJKA 2FFJA 4MR9A 5H59A 1Q7CA 1IHOA 1RJ9A 1G5RA 3P52A 4RHTA 4W8HA 1G16A 1N3LA 2VP3A 2ZAGA 4FDLA 3HFSA 4XLZA 2EC5A 3LBYA 3IFSA 1N8SA 1X7YB 2NUPB 4OA5A 3T5GA 3S1LA 4S1NA 1NXWA 4OHCA 4BV2A 2Z4SA 3T9CA 1SHUX 1OTXA 2HLDA 4YAJA 4CL8A 2W6ZA 4DV7B 4MVYA 4RNCA 4ZANA 1RXYA 3FNIA 2YNMC 4JC4A 1NXVA 3KSBC 5EP1A 3RW9A 2QX7A 4YJ2A 5KTKA 2H0AA 1NULA 3OZ7A 5ALYA 5JHHB 2O54A 3L77A 1BN6A 2X0DA 1KO5A 1XEAA 3PI6A 3SIRA 4BKQA 5JBNA 5JDIC 1YJQA 1E3WB 5DBHX 3ABQB 4OHUA 1H22A 1X2EA 3WXBA 4YNBA 4CKWB 1BGVA 3SICE 1ZI9A 2B5OA 4N3BA 1BEUB 3AFNA 1II0A 3OLXA 4AM8A 2KLHA 4K9LA 3B6MA 3UWSA 1NVWQ 3DE4X 2Y1WA 3CWCA 4JT8A 2J3DA 2WSSA 3HZOA 3PE6A 3J7AC 2PL3A 2X1VA 4FMPA 3AOGA 1OAAA 4N3AA 4ALMA 3ESDA 2IXBA 4B35A 2ORIA 2BCEA 5HFNA 1WCV1 2LD4A 2BONA 4P6VF 4Z7NB 4BX3A 2A5LA 1PZFA 4IWNA 1I4OA 4GLBA 4LHSA 4TMYA 3S27A 1YB1A 1ZK2A 3PPXA 2VJMA 1Z26A 2C3OA 3JAMA 3M2TA 2C2ZA 4QHYA 3BH0A 1T9AA 2WAMA 3GB9A 4INAA 4QPCA 3RYFA 2GKSA 4I6JA 5KIAA 4I7EA 3TGWA 3NAGA 1XZPA 3GGGA 3V8NA 4HB0A 3FPEA 1P2TA 5CA0B 4S1TA 4F12A 1LW7A 3WAJA 4LMPA 4XRGA 1UFOA 2BW0A 3LUFA 2IF0A 3GF4A 1PU2A 1CQZA 4W7IA 2WJVA 4PG5A 3B3FA 3IJPA 2R7LA 1DGQA 3KJGA 2WD7A 4YTEA 3N8NA 4D7AA 3S29A 2Q5IA 3K8QA 5YASA 5HSGA 4OYRA 5EJAA 2P6NA 1M6WA 2HNAA 2VYND 2W2VA 4FFLA 5FUBA 1ZVJA 5JSZB 4RGQA 5A9SB 3M6FA 4QUKA 1T0BA 1BD4A 1ZA1A 3MJCA 4UZEA 5CXQA 1USWA 3VJLA 3GGSA 1MVOA 4TWBA 2O20A 3HBAA 4RS3A 4ARAA 2DBYA 1P1JA 1Z37A 4DPKA 5HOQA 2G88A 5K3SA 2XMPA 4CMCA 2K2WA 5M7EA 4DHWA 3E7PA 4YRMA 4PO9A 5IMSA 3QBTA 3R7WA 3NDIA 2YV4A 4EI9A 1DTSA 1C7QA 3WK5A 4HG2A 1A9YA 4TSKA 1ZR2A 3NG1A 5G3YA 2EG9A 3ND5A 4HNGA 3KZNA 4RQAA 1WXQA 5HRUA 1HSOA 1KAEA 2JASA 4PRKA 3EOBI 1AMNA 1P8AA 4O63O 4OKIA 3A6LA 3OOSA 4Q4JA 3QVUA 3MLAA 4FEYA 5DW3A 3RH0A 4KTVE 4OK3A 2R47A 3HP4A 1V1MA 4FLMA 4OAPA 3U9SA 2I62A 3IBSA 4F45A 4ZIRB 1JPJA 3USZA 2YVKA 1FRZA 2JIQA 1XTQA 5FQNA 3QPUA 3HCPA 4Y2PA 2I33A 4BRSA 2GS9A 3BHIA 4JT9A 4EB6B 2ACEA 1CKEA 2FQ1A 1E4OA 2FUEA 1C8BA 1LI5A 1GSHA 2RSLA 2TS1A 4X1YA 3LNTA 5AUPB 2JLAA 1K8XB 3NJ8A 1G3MA 1YC5A 4L4YA 5U1PA 2XA9A 3OJEA 1RWOA 5JO9A 3FVVA 3T5PA 1TCVA 1LJLA 2H5EA 3WYBA 3OLYA 1VSTA 2OK7A 2WIAA 4FYMA 2H2AA 5ILQA 3HVKA 4MA4A 1KDVA 4J0QA 1QHYA 3RHZA 2HDNB 4JASB 4GKAA 2HNBA 4RZQA 2DX7A 1GV1A 3AU8A 2ZJAA 3EWAA 4AZ0B 4EUNA 5HKBA 2EBWA 4TMKA 3ZWXA 1QOZA 2IOFA 4ECAA 1S4QA 2YNMA 3DDSA 3JRXA 3TLBA 4CKWA 3L9WA 3OWXA 1SHTX 1E3WA 5EE9A 4KOEC 3LT5A 1K5HA 4FB4A 1PIWA 1Y5MA 3CIOA 1CUIA 4KI7A 4U2KA 3KQLA 4QPZA 5HRCA 3BE5A 1O5IA 4UTXA 5B6JA 1SZCA 5D86A 4DPLA 3T0FA 4JI8B 2R6CA 5J4YA 3GNQA 4OGFA 5F4ZA 3OTWA 4FGSA 4KAXA 2C7QA 2QT9A 4NU5A 2JLSA 1SBCA 4PZUA 5DE3A 4MW1A 2DFVA 1DBWA 1QIIA 3E9RA 3L7NA 4GIBA 2I3BA 4K8RB 2WSMA 5K3BA 1E2UA 4BCBA 5CT4A 4MEJA 1ZW1A 3AUXA 2HUNA 1PKXA 2WZQA 5DF1A 5B6PA 4XVRA 2ZIVB 4K9OA 3P26A 4OQ4A 4RD4A 1N5IA 4Z4GA 2MCFA 4FDMA 1AQJA 1X1AA 1E62A 2QTVA 4WCFA 4BRUA 1FTNA 1RJ9B 1ZMXA 2JNWA 4PQRA 3KKPA 4HBZA 3WNDA 4DMMA 1ZAKA 2Y99A 2QD2A 1JECA 3LLSA 4ZYXA 1FXWF 2OBFA 4TWZA 2ECOA 3MPOA 3VPCA 4BUJA 3L9XA 2F00A 4I55B 1PEKE 4S05A 2QL7A 4PX5A 3WDKA 2PJZA 4TQ9A 4QVGA 3ZNNA 1XLVA 3U31A 1LNZA 2QVXX 1SRRA 2D8MA 2FB9A 2PSFA 2X58A 1JXOA 4KR9A 1R9NA 1SQGA 4BWYA 5AKGA 4AJ1A 3N59A 1S4MA 1ONNA 5SZKB 2E49A 3G2IA 5CX1A 2BMDA 3AV0B 3LOPA 4XCQA 2Q2WA 3C5EA 1R4ZA 3M83A 1QYDA 2FP4B 1MJFA 1T5SA 2PS0A 3DW3X 1UM9B 1BIFA 1XFDA 3QH4A 5AI9A 2CXHA 1ZNXA 1Q91A 1VL6A 2AQHA 2LE0A 3L6OO 3X3HA 4CYMA 3SWWA 1KSFX 2BEUA 4MUYA 3ZS9A 2QT1A 3W5SA 3U80A 5CCXA 4MAMA 3HNPA 1SU4A 3LP8A 3HSYA 3H9BA 2WE7A 3LCVB 3L6EA 4RD6A 4P5EA 3SHTA 2ARKA 2BHRA 2ZYWX 3STVA 2P9ZA 2VYQA 4NNJA 1UF9A 4KVZA 4EB0A 1VMDA 2VHTA 2QTGA 3B9BA 3K72B 4H6WA 3G0DA 5KS2A 4JYAB 2Y1EA 5G0VA 1JDJA 1RVV1 3BZUA 4KTTE 4Q37A 1OE0A 1NVBA 1CZOA 1DDOA 2FZGA 1WD5A 2XMSA 3I92A 3SIPA 1AUQA 1CR0A 3BGVA 4RY8A 1MIOA 2BM1A 3PYLA 1K7XB 2B61A 1QB7A 4ZAWA 4MWOA 3TWOA 4EHFA 1ETUA 1N6IA 2A14A 2O1XA 3B7GA 3NX4A 4NZNA 1Q20A 4Q1CA 1NF3A 5LZ5A 4HGZA 5IZCA 3IPCA 2D7JA 5CJ2A 1NMYA 1T6ZA 4CV2A 1HDZA 3NANA 4U7FA 1O0SA 4RFVA 4XIYA 5H02A 4C14A 1NMQA 1QKIA 1R18A 4RAQA 3WGHA 1QNFA 4D3FA 1M76A 1E9EA 4QUHA 2DBVO 4Q1VA 1U6KA 3V7UA 1ISJA 4JBIA 1XCPA 3BB3A 1G1AA 1NU8A 3VO9A 4BGUA 4LRXA 4N47A 4DJTA 2FSUA 1AA6A 3D6TB 1OZAA 3S40A 1WTCA 1JB1A 1R27A 2Y1KA 3IESA 3N58A 3QJGA 5E38A 4G86A 3ASVA 4BATA 3QXHA 2B9EA 1EK0A 5EXSA 1XMXA 4ZT4A 4XIFA 1JWLA 2QKYA 4ZI5A 1ZHFA 3P94A 1XQWA 3ESQA 3FPCA 3L0BA 3VO2A 4KPUA 1PEYA 2Y4OA 3E58A 4FHFA 1SUEA 1C4WA 3I37X 1AB5A 1L5NA 3NKVA 3TTUA 2GTPA 2PLFA 1FFGA 1J1ZA 2YVUA 3I0MA 2LIVA 4UEOA 5KNCD 1HC7A 3EBLA 4RSRA 2Q28A 3QW4B 2GT1A 3UMRA 4YJGA 1EUYA 5DLPA 4E70A 1BHJA 1SWWA 3NBXX 4J29A 3ZGOA 3UVEA 5JXGA 1EM6A 2PU7A 1N2EA 4LYGA 4MMZB 3FUXA 4YJHA 3OE4A 2DTEA 1Y8AA 4FMBB 1MV5A 5FNVB 3IP7A 1Z2PX 4HNUA 4ZOBA 5MF6A 2ZYTX 3PT5A 2FX2A 4W9NC 2JBWA 3ADOA 2NPFA 1JMYA 1DJPA 1WP4A 3GDGA 3URMA 2HU7A 5IXJA 3AF5A 3DNFA 4G67A 1JU9A 2XBUA 3VJKA 2V03A 4LYEA 2C0CA 5EZ6B 3TUZC 4YALA 4CR8A 5JMOA 1PG0A 1Q84A 3NM4A 3W7AA 4UHKA 3TNJA 1CG6A 1PL6A 3E5MA 4RS4A 3K9FC 4ENUA 4PLPA 3CF2A 1BS2A 2H1VA 4JA0A 4TZTA 5JJCA 3IAS1 4BXOA 5EIBC 4OJKA 4TLEA 2XBLA 2XZOA 2IS6A 3CNBA 3OOYA 1YASA 3DM5A 3U13A 2QDKA 1TKBA 2X1LA 4O1IA 3VV3A 2FVYA 2CXUA 1HZZC 1GQYA 5BNFA 1LKZA 1Q0UA 5C5DA 4KFCA 3NHFA 5KYYA 5E9WA 3A1CA 3DAYA 2VH5R 2BFAA 4ZCSA 1JWAB 3JYQA 4RQBA 2QR5A 1RP1A 2VHJA 2XE7A 4P1ZA 4PFKA 4C6TB 4HDAA 4ZCRA 3AY0A 3DMTC 2C95A 3GN2A 4WNAA 3JQAA 4QJBA 3H2HA 1E4VA 1Q57A 1S89A 4N3NA 3IJRA 4TTIA 1GTMA 4BLWA 2VA9A 1Z5NA 5CH8A 4BDTA 4C76A 2C98A 4P54A 1XHEA 3NBZC 4BBPA 1RHMA 4Y1EA 3IUEA 1N32B 2G9RA 2FDCA 3HHEA 4X7RA 1F38A 5CMLA 3VISA 3Q9UA 1U3UA 4EUKA 2G25A 4Q7LA 4XJVA 1OIVA 2VP9A 2OZVA 3FUUA 4TVSA 4O4IB 4DHEA 1AGYA 4QAJA 2IS1A 3D5EA 4NEHB 2W11A 5JS7A 4Q1DA 1SCBA 3COYA 2JA2A 2OORA 2ZAMA 1T13A 3WGQA 2YZGA 1RXVA 2WW8A 1T29A 1VJ0A 1WABA 3HN2A 1CJVC 1NVVQ 1XLTA 4MZXA 4OHXA 3E70C 1SCNE 1SR8A 3HE3A 4K87A 1D8TA 1PT9A 2FSHA 4PRLA 1MVNA 3RROA 2AFHE 1G2OA 3DT8A 5E95A 3PD0A 5E6UB 4AJEA 2QPTA 1KO8A 2F1HA 2H7XA 4O4IA 4BNHA 4LUCA 3AESA 4IGAA 4QU9A 2PX8A 1ENZA 5BN5A 3V1KA 3OP1A 4TVKA 4QDOA 1EFKA 1MXHA 3UAYA 4DQVA 4DANA 3GMSA 1T9DA 1WG8A 3LRXA 2OHFA 1ZM3A 4Q3KA 2BJHA 3V5NA 4I81A 2Q3EA 4PO8A 4UMEA 3HABA 1VXRA 1YAJA 2HLDD 4JGBA 5J5AA 2EEPA 1GGFA 2XR1A 3R40A 4BV9A 1HQYE 5DIFA 1FS5A 2CMFA 4U63A 1JSXA 2BFOA 4M0KA 4LF8B 3DC7A 1U5CA 3HKDB 2XUIA 3CVXA 2QMYA 5F2NA 3WA7A 4F8JA 2P5TB 3KOUA 4JNCA 5KYYB 1VKHA 2ID9A 4F96A 5LP6B 4ZU3A 4WOKA 2CUNA 3EZXA 3EVGA 2GYUA 3BF7A 2BBSA 4YUAA 2IXDA 4V1CB 1PWHA 4GKVA 5G4KA 3FSGD 3NVMB 4A8PA 4CG1A 1MAWA 2BELA 3FR7A 4UDOA 4DMHA 4JC0A 1KZ7B 1K68A 2DXIA 1NGSA 3L8HA 1LSSA 4B6GA 3E2IA 4UEJA 3CPEA 3PWTA 1ABBA 2WM8A 5DHQA 4W4TA 1Y4SA 1JAZA 3IBTA 1TDJA 1TO2E 1C14A 2O2XA 1XRPA 3KEQA 4WKOA 4LFBB 1WMAA 3BKWA 1A5TA 3SIWA 1Q0SA 3DFUA 2Z6UA 1WKVA 5IAEA 4DPMA 2G09A 3D3JA 1J8MF 1P9RA 3GP5A 1NR7A 2W8BA 1GRQA 1HDIA 4JENA 2AHRA 3A6ZA 1QGDA 2L82A 4JL8A 4TKUB 3RV3A 4A5OA 3EEYA 4WBNF 2JARA 2QQEA 3KD3A 4E5DA 4FOSA 4PGGA 2C88A 1KIAA 1D6NA 4B6FA 5KQGA 1HT3A 1XTIA 4WLNA 4MHTA 2P4EA 3U9LA 4UVEA 1CYEA 4JT4A 1Y9ZA 1HDOA 4KQJA 4B6RA 1E6EA 2Q6KA 4H4EA 4IXDA 1WMDA 1XZKA 3VR6A 1BX3A 3D2AA 5KTYA 3ROQA 4PYNA 1COZA 4J1TA 3A6EA 2JFHA 1YUNA 3B8EA 4IVQA 5E1MA 3BWMA 4F3KA 3IQIX 5DPMA 2V7VA 1V37A 1RXUA 4F21A 2P4HX 4Z1OA 4GGPA 3D6JA 4LC9A 4UU1A 3N3BC 3KYBA 4DEXA 1E1RA 5A6SA 2V6IA 2KMLA 5KU1A 5DCWA 3GEEA 3EGDB 1O97C 1Q0HA 1J09A 2VPTA 3T7SA 1SHKA 2I1QA 4L28A 4YAGA 1H5QA 1UEIA 5IT9A 4Y9DA 3UK6A 4RVHA 3OZUA 5C1BA 3UKDA 1C2TA 1DEHA 5D7NA 4DGQA 1VCHA 3R0XA 3RARA 4DBLE 2C7PA 2F4NA 1PR1A 4DUGD 2VNAA 4JR1A 2C29D 2V7BA 2RH8A 1JKMA 2QUAA 1UMKA 2WYVA 5DM1A 2J5KA 4R3WA 1HTBA 3QJYA 3DC2A 4NCIA 1DIHA 3JATA 4RTPA 5CB4F 3FX2A 4R8KA 3KLOA 1V9LA 3GRFA 2I4RA 5KDLA 1M73E 1L1RA 3EXHC 1XZHA 3EVTA 2C2BA 1XZEA 3BTOA 1MA0A 2XKAA 3FOWA 2OCBA 1NR1A 4LG1A 4PFSA 3K6SA 3NVAA 4Y6QA 5A71A 4ETMA 4R9VA 5LC1A 2WF8A 1N7JA 2J9GA 2JFBA 3JVUA 2QRMA 4FT4A 4JUAA 2V0NA 1D2CA 2VP4A 3NUGA 3PCRB 3MOIA 3LDHA 1Q0QA 4P84A 1NVVR 3N9IA 4ZRMA 4QNMA 1TRKA 2J3IA 3GFBA 4MR8A 5DBFA 1LLFA 4NABA 3T99A 4CT5A 2DH5A 4G5GA 3W2GA 1XMIA 2NVWA 3BJEA 3Q2IA 1PS9A 2VUHB 3QX9A 3UH1A 1NV8A 1TVEA 3QVOA 2FSVA 3A9TA 3NBUA 2HR1A 4P0QB 1EB9A 4ZPXA 4FYHA 4GSLA 2XE4A 4C2UA 1O3YA 2Z5GA 1T4GA 1JA9A 4G65A 1QMPA 1WBDA 5CEJA 3GHYA 4IH1A 2WTEA 2XQFA 4MW7A 1WCWA 1UM9A 3PGA1 4PY2A 4KU4A 3ST7A 1B0UA 1VKNA 2YV3A 4KJXA 3G0GA 1NFQA 5FWAA 2ID7A 3SSNA 1NM5C 3T4XA 5C9ZA 1HEYA 4HWTA 2EFJA 4QIHA 3IBGA 1CF9A 1A77A 2BM9A 3CVUA 3EPHA 3HL0A 4I55A 4F5EA 3DEJA 1E9SA 4RZUA 3MJDA 2XCSB 5KC8A 4II3A 1T4CA 2R86A 4M0LA 1JXAA 1M7HA 3GBPA 3N39C 4MVWA 5EHNA 3IEMA 2W42A 4I19A 3F49S 2GKGA 1I3MA 2HJGA 2WU1A 1ZH2A 5COBA 1K7CA 4DR7B 3KS9A 1TAUA 4H0CA 1Y7LA 2BFEB 3GMDA 3R6DA 1QVVA 3NDBB 1SOVA 2Q46A 4IVPA 5A2GA 1L5HB 4RESA 3UAGA 2CWWA 2H5IA 1V8ZA 2WJYA 3DQPA 3I04M 4G97A 3OX3A 4POAA 5FL7A 1RI3A 3W2EA 1KTIA 3GJ6A 1QU3A 2OBLA 2QT0A 2REQA 1H65A 2HKIA 2QLJA 1OW3B 3KKQA 2FQXA 3LVBA 3TBKA 5ALOA 2B1QA 2KW5A 3FPBA 4DE5A 2RD2A 1F9EA 1X7HA 5IZCC 4KH1A 2I71A 3PQ2A 5ABPA 4X41A 1X7GA 1Z5VA 1J90A 2VNJA 1Y4ZA 3K92A 2WILA 2CZQA 5CAEB 3WSVA 4BGVA 4M99A 2R751 2FSSA 4BGIA 1QGOA 4M8NE 4CUKA 1M1NB 3AHJA 1S2IA 1GU1A 4KXXA 3FRJA 3IO3A 4MIOA 3RPEA 1UOEA 2VK1A 1Z5PA 1VIAA 1CWUA 3MAGA 1SC1A 3OPXA 5THKA 3WHLA 2A9JA 1YR1A 5LA6B 3L92A 2ZETA 4HQNA 1PYOA 4H7DA 2A9PA 1Q19A 1G9SA 4L4ZA 3PX3A 3E81A 2EFEB 3O8DA 2K7ZA 4AIRA 1T2UA 2KWIA 3E23A 2QAGB 1ZINA 4TXJA 3MAAC 4EEXA 2W48A 3GQBA 1JT2A 3OKPA 5K0GA 3RFTA 1DKLA 4U3JA 2ZB7A 1OBVA 1ZOOA 5FWYB 3LLCA 1EE1A 3OSZA 3LCMA 5D1NA 1H05A 3ZDQA 4BO0A 5CNMA 3HDGA 4RZ3A 5F1OA 3WLRA 1K8QA 4YDQA 2A94A 4Y2VA 4DV2B 4TZ6A 2W4IA 4L02A 1JKJB 2W2XA 1J2YA 3H2JA 3OFNA 4CT0A 4BLRA 1NDQA 5ESWA 4WSOA 1QTQA 5THXA 4IGKA 5HM6A 1BD3A 4B6OA 4DCSA 2XRMA 2IBMA 3E5HA 3DWFA 5J59A 3K1TA 2CYBA 1XMQB 2CV1A 2B1RA 1EDEA 1O08A 3R3HA 1ZN2A 4D42A 3KPJA 1U2TA 1HDRA 3TRKA 4EGJA 1PEAA 3W1EA 2PQ2A 3CLTC 4EW1A 1XKXA 4Q0MA 3L7LA 1NP6A 3KKNA 1CERA 4Y2XA 5JNVA 2FR8C 1UJBA 4FZRA 4TS9A 4J16C 5TQ0A 4B3JA 3R6GA 2DQSA 2Q99A 4GZMA 4C04A 3CIFA 4I36A 5BXYA 3U0VA 5DWVA 1KZYC 5DTJA 3WIDA 3AW8A 4UC0A 3QVWA 1JGTA 4XWWA 3GH1A 4QRHA 4WKGA 2WQ6A 4F3NA 1TTQB 3D1LA 3H1BA 1F8UA 4PVCA 1VHQA 3HZRA 3WKBA 3KB1A 1N6NA 3O75A 4L8LA 4M1QA 4Y2UA 5ALWA 4N5MA 2O06A 4RTSA 1UPUA 1XGKA 2JHPA 3TOXA 1P4HA 4LZNA 1UQRA 1LD3A 4MRAA 1DQPA 1SU8A 2JFVA 3MRXA 3WHKA 5K4GA 1UC8A 2H7VA 2OB2A 4KX3A 2NU9B 4GBMA 4RXTA 3R9KA 3RUIA 4QFMA 5B1IA 4F9TA 5BSHA 4JODA 3K3PA 3PGJA 5K0SA 5EG5A 3Q8MA 4RMJA 5M3BA 1JFRA 2H3EA 3OX2A 3WX0A 3FCCA 3M4XA 4Q01A 4PYMA 4YK7A 4ISBA 5KTRA 2JI9A 4TLDA 5EKSA 1FFYA 5HEKA 2AOVA 4PNZA 4BVAA 1Z5UA 1D9XA 1OROA 1C3XA 2R2GA 1UPCA 1BKSB 1DBSA 4JP5A 5E4YA 3U60B 3HMKA 1JLMA 4OF4A 4FYKA 1K6EA 4REMA 4RELA 3WGMA 4BNNA 4L6AA 4UAUA 3IMEA 2PXXA 3LRTA 1W5SA 3ENQA 4RHYA 1E1CB 4G1CA 1NKSA 5ESRA 4E4RA 4J1QA 4OMUA 3QPCA 1NSTA 2F1OA 4AJ4A 1UIMA 2JLVA 2DGDA 4OXKA 4UVIA 1GFSA 1T5LA 2Q0XA 2XYQA 3F6RA 2JJ2D 2WUVA 2RGAA 2Z09A 1VL1A 4PBSA 4RY9A 2H2HA 2IZOA 4HTFB 4B7AA 3F3YA 1X15A 4B3SB 1CIVA 3ABOB 5FL7D 4CKBA 4Z4QA 1BYIA 4O08A 1JIIA 2GPWA 2O2HA 2VWHA 3ML1A 1E3SA 2GYYA 1KJWA 4DT1B 3RUPA 3FYUA 3VPXA 4FZVA 4GW3A 5CLFA 3RSLA 5IASA 1TK3A 4P53A 1XTBA 2FN9A 3IUMA 3NQ41 3OM1A 4OXIA 3J81A 1H2EA 1KH3A 2PKCA 2JLRA 4EHKA 3GLGE 5EC8A 5DU2A 3WYNA 3AP1A 2E4YA 1RHUA 1DWOA 5DM60 1EP9A 2HK8A 4XTCS 1AKMA 4MLPA 3IT0A 4IZIA 3X1MA 5HUHA 1ZS9A 1HE2A 1JSRA 5I7VA 5F52A 2GSWA 4AMGA 1FC0A 2G77B 3KVOA 4HX9A 3ROMA 5BN3B 3IBCA 1MPTA 4Q03A 1POWA 4ZZ2A 1DRJA 4TWAA 1K08A 1WDKA 2ALJA 4G0OA 3HB9A 4L9WA 3EFBA 4GLFA 1OCEA 1UOQA 3MJTA 5JPCA 1NTRA 1NVUQ 4Z0TA 1TIKA 4H60A 5LUBA 5I8PA 4I4IA 1DC7A 2XWJI 4CODB 1EHIA 4V24A 1R88A 5B7QA 3MMNA 2IE0A 4UHJA 1MOQA 1U2RA 1CUXA 3QV2A 3WQHA 1ZXLA 2RGNC 5EE3A 1C50A 3PHLA 4KWCA 1JQEA 3MS4A 3OPYB 4PS1A 3DR5A 1UJ6A 3KZKA 3QA9A 4L5AA 2BFFA 3OZIA 4PYRA 5CT5A 1CDEA 1T2AA 1UPAA 1PN3A 3AZOA 2A3RA 3MJ4A 3N07A 4QPPA 1G60A 5BSKA 4PLYA 3L0ZA 3U7RA 4JJZA 3R2JA 3RVQA 4HMPA 5TS3A 3WFJA 4RTOA 1DO2A 2ZJ1A 3EVZA 4K46A 1N25A 3W8DA 3ZE0B 4BB5A 4J90A 3RGWS 3PQDA 3GJYA 4G1MB 4DBVO 2EJUA 2YJ3A 3ZGLA 1PT7A 1SVUA 2I3AA 3KKZA 4RABA 4WLUA 3RVRA 4A0SA 4AXXA 4XPIB 2PS1A 3N2KA 4FFRA 1WEHA 4PYKA 4XSGA 5JXHA 3PHJA 4MS3A 1XQ9A 2PLAA 2YYSA 5JADA 4R2WA 1YRQA 1NLZA 3RKUA 3GLHB 1T1IA 2AUNA 3NZEA 4CMJA 1MX9A 4PHGA 1A7UA 3FRIA 4E94A 1SQ5A 1SFRA 3WMWA 1AZWA 1RFLA 2HMSA 1MF7A 2KI5A 1GILA 3H5LA 1QJ4A 1YB4A 3OZBA 4FFWA 5B1EA 4DR6B 2IY7A 4A0HA 2R6GA 3K1YA 3O73A 4DIKA 1OH8A 2PMWB 3D81A 3PIDA 3O5AA 5ICMA 4HS9A 4AJ9A 1HH4A 1PV1A 1RQ7A 1JEDA 1SVKA 1YBMA 1BCRA 2WFAA 1SCIA 2CD9A 5GMOA 2FX3A 5JSYA 3ZLUA 3OZDA 4NOMA 4RLQA 1NBME 5LDGA 5LLSA 5JQWA 1NQOA 2J48A 3UAWA 2QX4A 1OAOC 4L5YA 3THOA 3CPHA 1WSDA 1PNRA 4Q5IA 2IH5A 2GZMA 2AZDA 3AUJB 4BO9A 1NF8A 2C2XA 5IT0A 3MHTA 1KFJB 1O8CA 2RI1A 5DEIA 2H31A 4ES6A 4V0ME 3C15C 1JXMA 5KSZA 1V26A 2W5UA 2Y9PB 3DPUA 5ALQA 4DCJA 3L49A 4X0EA 1N34B 2NSYA 1CUBA 5AKIA 1F6WA 2DSNA 4MICA 4Y0VA 5CDFA 3Q3GE 3O8LA 3JWHA 1E0SA 3T54A 2I7XA 1H4QA 3BE4A 3RYCB 2QYHA 3HXQA 4ARSA 3RSZA 2I9PA 2Z3ZA 4BX2A 4RD1A 1EUCB 4INJA 2RMKA 2NZUG 1MDFA 1NXTA 1FQKA 3LC1O 3L7AA 4FBMA 4LRWA 5FOVA 3RR2A 3ZNOA 1JG3A 4BE9A 1KWKA 1K0FA 5A03A 1MEEA 3IMFA 2WTMA 4BEJA 5AVXA 1BYUA 1X80B 3H9QA 3H8SA 5KYKA 4AMBA 3KYIB 3MMZA 4IQFA 4OIMA 2HF9A 2PZFA 4RVFA 1P2UA 1MW9X 2PBZA 4FJ1A 4G5HA 2BFBA 3X2EA 5IUNC 1YE3A 3I9KA 2O6LA 3CWQA 2VLBA 1SGWA 2WHXA 1FDVA 4JT2A 1KJNA 1LPNA 3OEWA 5TJHA 2YBEA 1OZGA 5IDVA 1WZIA 4X7PA 4IH9A 1CJUC 2F2TA 4IV5A 3AI3A 4A4DA 2PJUA 1GYRA 5CDTA 2VTEA 3DZBA 4R81A 1H5NA 3HKBA 1NC1A 5H3LA 3QVTA 4GICA 1GPNA 4XKJA 4H3SA 2WNSA 4F9GA 3CVVA 4RK4A 3NHYA 4MQEB 4KVFA 4ZVOA 4BNLA 2R6R1 1U90A 5GJCA 4QOJA 3LQKA 1M2NA 3QYPA 3KBOA 5JCZA 3N5KA 3I0NA 3K9BA 2RGEA 1EHCA 3V8QA 2JAWA 2Z83A 1R74A 4H7PA 4PVDA 4MQFA 3N5CA 1EWKA 3FYCA 3U3OA 2ZE6A 4CUZA 2AH5A 4GQBA 1NRWA 4ZGBA 1OU0A 4L5CA 1UBOS 1TMGE 2OV4A 3DVRX 5C2JB 3Q3HA 1R16A 3I5MA 4KQEA 3DV9A 3V8MA 3HKDA 4Z1MA 5IAAA 2QUBA 3BWEA 4LRQA 4ZC8A 4YP9A 2JCYA 4O2AA 4OO3A 3V4ZA 4E5PA 5TQ2B 3QWAA 3NCHA 4C1BA 2E4WA 1N77A 1A98A 1HL7A 2A5GA 2R00C 3NDRA 1QF9A 5EE0A 4BGDA 1QH0A 4XLLA 3DVQX 3FETA 2H9IA 2QW0X 4PAWA 4O4LF 3EX7C 2HJVA 4IDHA 1P7CA 3SXUA 4BN4A 1NOJA 2WYUA 3SCZA 3SJCA 2P3LA 1IPFA 2FWBA 1CR6A 3LIPA 4EHHA 6REQB 1TU4A 4EUFA 3IIMA 4F4JA 2YV1A 3KR1A 3B8HA 5E6UA 3Q7TA 2ADOA 3GQVA 1B1CA 2UZ3A 1MV8A 2B5VA 1Q92A 3KELA 3USES 4BNMA 4DZZA 3OCVA 3FYDA 4LXHA 3UV3A 4KO8A 5DHSA 3SSOA 3D7LA 4MQMA 1SPXA 1IRIA 4HYYA 1NXXA 3TRJA 4K0RA 4LVCA 1T6BY 1K3TA 4JOCA 4CMAA 4DSOA 2W2QA 1E1KA 3IAAA 4XDHA 1UDRA 5EJ2A 4N7MA 5HWSA 9GPBA 5AR1A 5ICEA 2IXFA 3TLMA 3OZEA 4AS2A 3FHTA 2NAPA 3JAKA 3VDMA 2EP8A 3PCTA 4P4GA 2QVGA 3L4SO 5D1HA 3U9TA 5IK2A 4G0UA 4HB3A 3AETA 5AVKA 5FUYA 4DLKA 3TB6A 4MI9A 3H99A 4DM7A 3CF4A 1Q5PA 2IYAA 2BUAA 3TOVA 1WKBA 4A6XA 4Z4EA 1Q1BA 1UWCA 2ZJFA 1LBEA 3PZBA 3NGXA 3V1TC 5EEGA 1I14A 3BICA 3FLAA 5BN5B 4AVYA 2OFPA 1L3IA 4ZK6A 3FTEA 4LJ5A 1HOTA 1R6UA 1YBHA 2PO5A 2V55B 1XTTA 2H8GA 2X9GA 3KJZA 3ITEA 1DG9A 3KVNA 2V4UA 2ZRGA 4G4SP 1TCBA 1D6MA 2AWNA 2HEIA 4P4LA 3STXA 4CL0A 3EMDA 2W2LD 3V80A 5AW3A 3RK1A 5BRAA 3CUSA 3CUWA 4DJDC 1EFPA 1Q1ZA 2C78A 2HA0A 3QYJA 5H8WA 1PW7A 5IDQA 4BXOB 4XM2A 5C8XA 5D6OA 3BEDA 1T9CA 4UUOA 4MV3A 3RBVA 3HB1A 1JSCA 3M4ZA 1RKQA 1Z6TA 4IP0A 1ZKDA 5FLXA 1TC2A 2BUCA 3N7AA 2NV6A 2GJ8A 3PUIA 5FPYA 5BT9A 1GQSA 3QNWA 4X1KB 3S1AA 4Y6LA 4FMDB 1RKVA 2CBXA 1PJSA 1H23A 1TAQA 4J3FA 4OU5A 5DN6A 4EL5A 3THYB 2H59A 3DG9A 3IR6A 3WGKA 1E9CA 1R9JA 1HK7A 3I2HA 4L8WB 3WOHA 4EI7A 4PYLA 1L7QA 5AVOA 3IR5A 3ADBA 4OA8A 3EZ9A 3RM3A 2OLEA 3OJXA 4ACBA 4BZWA 2QM7A 5FYDA 3EFOB 4HH0A 3FWKA 5TQ2A 4DADA 3GLFE 3THWB 3CKMA 1VFNA 5CVCA 2PG3A 3GP8A 2VAVA 1QWSA 3RYTC 1CIPA 1NBEA 1T1EA 3Q7QA 1GZ6A 2V7TA 5BNTA 1FPMA 3P2EA 4NIMA 1M6EX 3JTEA 3R4VA 2ZU6A 4LF4B 2A5DA 2ZE8A 4LZWA 4F38A 1YA6A 5GONF 4E5SA 1IFXA 5B1SA 4BLQA 4OX9B 3NHZA 1SU6A 5FAXA 2OPBA 1PYGA 4ZO4A 3FPAA 2FEWB 3WSTA 1UMBA 2D2IA 3KD2A 5EXTA 1U1FA 5LBTA 2D0DA 4PZCA 2FPGB 5BN4A 2P77A 3GJQA 4HPJB 3R0JA 1F2TB 2OO5A 4H6PA 5KYWA 1WMBA 4HFNA 5CGQB 3RB8A 4CU5A 3E53A 3PC2A 1GPJA 2ZREA 3S0JA 1DAHA 4KB5A 1LBQA 1XO1A 2VTDA 5DVZA 2PJRA 1N5RA 5K20A 4IIBA 5AHKA 2F17A 2FY8A 1HE1C 1KJ9A 4KUEA 2G8LA 2JEOA 1AJEA 5EPOA 2V1XA 1YKGA 3A0RB 4NV1A 2Q3LA 4D6PA 1NRXA 4MUEA 4WDQA 5IX8A 1T9GS 2NG1A 4K9KA 5CNIA 1TGYA 1OBFO 4DQUA 2V7WA 4FDUA 2CXTA 3K4HA 5AICA 4FWTA 1SULA 4RYLA 5KJ1A 2NUBA 4ZRDA 2BFBB 5CXXA 1KDRA 2FW9A 2AL7A 4EG3A 5JY6A 5JZVA 1N5JA 1JWBB 4R5HA 5EMNA 1UZNA 4BY9E 3DBLB 2ZIUB 3CPJB 1W76A 3GLIB 2GM3A 1ACMA 2PRKA 4J75A 4B8WA 4I08A 2X22A 3G2JA 4FYVA 3STHA 4DM4A 3O94A 1ZNYA 4X5OA 4P3XA 3BXFA 4AZ3A 4F6LA 2HFJA 2FZ4A 3DYVA 3U3ZA 2FFAA 1OIWA 2V7EA 2VXBA 4B2YA 4KDCA 1U99A 3PRYA 2BEJA 3DZFA 3JD2A 4FS8A 2OO7A 1EWQA 1EX6A 3ZDXB 3GBVA 1NBHA 5DNWA 3SHOA 4ZJUA 1QFYA 3WL6A 4NK4A 3NRCA 4YMGA 1GNSA 2XZTA 4NZ9A 1BWPA 3GIWA 2PMCA 3Q3JB 4BCDA 4D99A 3KJEA 2W90A 4U5XA 3LK7A 2CDBA 5MFZA 4RPHA 2G8NA 1GG8A 4A26A 3UV6A 1W85B 5D3MA 1BEEA 3BWDD 3CNEA 3L3BA 1A50B 4M1WA 3WB2A 5KJEA 3RVMA 4G1BA 2CVZA 1IUOA 1NBOA 2B1JA 2DVMA 1Z4IA 2O19A 1A1SA 4YCCA 4L6IA 1IUKA 4ZEOA 1PUJA 3B48A 3K9WA 2UYHA 2VK2A 4DYHA 1E2NA 3BXOA 3GVIA 1DWUA 1O95A 4GOOD 1B8OA 4DG8A 1I0ZA 5GVSA 2A35A 2XB6A 3N2YA 4BB6A 1M1UA 4BFYA 3MTGA 3RTAA 1XYYA 4I55F 1W93A 5HVNA 1PQUA 1THZA 3U44B 4AN1A 3I6QA 3LNCA 2EL9A 2RGGA 1VL0A 2H1OA 3MW8A 3NTVA 3H2YA 3H11A 4B4WA 4BEBA 1DAMA 3I1IA 1Z18A 3NWEA 3ORFA 4EF6A 2VDUE 4WY2A 3JQEA 1ISFA 4AIIA 2FK7A 1U8UA 1EMDA 1CNMA 1VLHA 4X54A 4AECA 2A1UB 2M6KA 4BP9A 1BGXT 3LZ6A 3GLFB 1HNNA 3FFAA 1UC5B 5KWIA 2IIQA 2ZITA 1WQ1R 2G5CA 1E60A 2XNHA 3PZRA 4LX8A 4F5WA 4DNFA 5AM3A 4UXIA 3GFVA 7ADHA 2QD5A 2DOKA 2MMGA 4IHKA 1X13A 4NONA 3IKTA 2F3SA 3N0RA 1IG3A 2C99A 3U1VA 1QU2A 1UBTS 2H6EA 4J3NA 2XYRA 1FU4A 3UCEA 1OI2A 1W4CA 3I6ZA 4G5YA 4PHHA 4QJ5A 2BFCB 4UEWA 5TRTA 1NG9A 4HAVA 1J6UA 4JWKA 1KVUA 2WJHA 2J46A 3C7TA 1RLJA 1BX1A 2JEYA 3VYTB 3GWZA 2WJPA 3KT8A 2PPVA 1E89A 3D6AA 4MCJA 4S1OA 1QFJA 3ISJA 4BWGA 4U2CA 3KEOA 3N70A 4FX5A 4KQ9A 2NUTA 4ERXA 2UXCB 1YZVA 4RMNA 3O31A 1F8FA 3G5AA 2ACVA 3L02A 1CE8B 1DU4A 3NH6A 4FGWA 2P1DA 3S2UA 3IE2A 1KYQA 1KJ8A 2QTVB 3M82A 2RHTA 4KGDA 1U3GA 3AVUA 3QWIA 2IS2A 3VMFA 4JUBA 3TI7A 3WHPA 1SURA 4KIUA 2WVJA 5KBYA 2PMBA 3LCJA 3VSBA 4JXXA 1Z4NA 5F21A 4FQ7A 4G0PA 4Q1AA 3FCUB 4V0MA 5F9FA 1RCUA 2P9GA 4JLAA 2VHWA 3IVRA 5T4HA 1UKYA 3BRQA 4RHUA 1BX0A 1IQPA 2YZ2A 3RYIB 3F47A 2NZVG 3KKMA 3MWYW 3WY9A 2XE6A 3OQOA 4JMLA 3MRTA 4UREA 1QYRA 2BEWB 2FQWA 3OQJA 1XPOA 1JDUA 4JVNA 2GM4A 4ZAFA 1DG3A 1RLUA 5C31A 5KKNB 1B1AA 4TWJA 3ENKA 4BMZA 3SQDA 4W5JA 4C08A 4CBVA 3VVBA 1RI1A 1YVEI 3H5OA 3M1YA 4RHCA 5ALIA 1TKCA 3FKSA 3RVBA 4XFKA 1X1CA 2EFYA 3L0OA 1EVYA 1S3GA 2EBFX 4Q3NA 1N6OA 1TTHA 1UK9A 2BMWA 2GJ9A 2I4OA 2WT8A 4QXRA 3AFIA 1QO0D 4UBLA 4DLRA 4B4VA 5JRJA 2ODBA 3BMOA 2Q1WA 4UCQA 2HU8A 3LUAA 4KQMA 4KYTA 1WF3A 1A8QA 1CF2O 4ND5A 5JMWA 1IULA 1FUIA 1Z15A 2IJGX 3FD8A 1P7VA 4WBNA 2FPWA 1IN4A 4B3HA 3ZLVA 3F78A 1KYIA 2UVPA 4DXHA 1LF5A 5DNEA 2ZIWB 1K2VN 3N28A 4N8DA 1WIWA 4LQCA 4OOFA 2I4MA 4UCFA 1YO6A 2UUAB 4F2GA 4UMFA 2IL1A 4RDXA 1Z6AA 2J59A 1FEZA 3C24A 4QXAA 4XDZA 5JQGA 2WY2D 3COPA 3LY9A 4O4IF 5BR1A 4LHWA 1LVUA 4KH0A 4YWJA 1EM8A 5HRAA 2AFIE 4E6EA 3EEOA 3I9LA 4R84A 3FGNA 4DC1A 3PR3A 4KAAA 2JLWA 3IA7A 4MRMA 4IJVA 2AMFA 2AA3A 2GHTA 2QRLA 1QGYA 2TMDA 3UT5B 1C7EA 1I33A 3VOBA 1T2CA 3F4KA 2OXFA 1GU7A 4CQLB 3R7WB 5DYYA 3DZCA 4D4HA 1RS0A 1EK5A 1S2DA 4HR7A 4MKFA 4IDCA 3TX2A 2ZWOA 3REGA 1E6WA 1M8JA 3Q1KA 4C4ZA 1AF4A 4LKRA 2RI6A 5I51A 1UP7A 1T0PA 3LY7A 1D4FA 4YCNA 1YHNA 2HWXA 2OM2A 3UH0A 5BW6B 5FD8A 3BXXA 4Y3UA 5E9AA 1R8XA 4X93A 2OHVA 4XIIA 3AEUB 1Z0JA 2YJTD 2Q9CA 1SKBA 2I6UA 4ZOLA 1JH8A 3NLLA 1VIDA 4LJ6A 4G9BA 2RFLA 1DADA 3T0GA 3GEHA 3V2UA 4ZU1X 1J20A 3GGJA 2WWFA 3QEAZ 4RDIA 3PQ7A 2BHLA 1FX0A 1KYTA 3KXPA 2VAWA 2PZAA 2ZBVA 1SXQA 5HUJA 3LGAA 3E03A 3VR5A 4CGZA 2VTVA 2UUBB 2RBGA 4TLBA 4B0OA 4RCYA 2WTNA 4AJKA 4Q12A 2B4QA 5DHUA 1A5SB 2IIVA 2OP0A 4R8LA 1KC1A 1LC3A 1UJ4A 4EABA 2ERYA 1L1QA 3HA2A 5CVDA 4YJ2B 2IWRA 1ZUNB 1ZONA 4KL8S 3TZ6A 2WUWE 3H4IA 3GAMA 2YWFA 3L01A 5K0JA 1QG4A 2RC5A 3B1ZA 3HXPA 4M87A 4MV9A 4GZLA 4L9SA 2P7IA 4IOMA 2A9FA 1FZTA 2JAPA 4P81A 3UG6A 3I83A 2JGDA 1O9HA 5KQMA 4CDRA 4BMNA 1CP3A 1WZNA 4DG9A 1CQJA 3QLEA 4HDMA 4P83A 4EKDA 1JIXA 2NZYA 3CLUD 3F3SA 1GL7A 2FR1A 3H2IA 5FQOA 4V0SA 3D0KA 1U94A 4S2UA 1G7SA 1Y5NA 1E2JA 3FR8A 3MJSA 4DLBA 5A4MS 2FWIA 3GRZA 1DFIA 5TIIA 4YT2A 2F90A 4UE6A 2W2TA 5K8LA 3HCCA 4JITA 5HKAA 1LB1B 4O3MA 5E2IA 3WGGA 1FVFA 5F7JA 4DSTA 2LDBA 1B0PA 4C3UA 2CKDA 3PGLA 4GWGA 5CFNA 1XDUA 2DLDA 2Z1MA 1Q6YA 1RXCA 4J7XA 3VR3D 1G20A 5L7WA 1A69A 3GRPA 2G9ZA 1GP2A 1D6JA 2IHJA 3WGZA 1SG0A 2J87A 2FZVA 4FNAA 1RWNA 2N1MA 3G68A 1TJNA 2HQSA 3NXKA 2DPLA 2GBPA 2P62A 4I50B 2FJ0A 4EG7A 3CE6A 1H85A 3PFNA 1WUIS 4J2OA 1CUCA 1YT5A 3L7CA 3B1YA 3KQTA 1GZDA 1JR3D 1Q3TA 3A31A 4A91A 2W2KB 4CIWA 4Q66C 4CKEB 3GFTA 1U0OC 4ARCA 4UKDA 4CR6A 1YS2X 3KLBA 4PZAA 3SF0A 1K2WA 2PLWA 3RBXA 2TECE 2VDLB 3I2GA 5ARDA 3ZY4A 1J2RA 3R9WA 3A6GA 1JMVA 3D6VA 4PZEA 4XE5A 4BFXA 4RADA 3AHIA 4X1OA 3SU8A 4BKPA 1G4UR 4IF4A 1CULC 2ZKLA 4ZAVA 4CMEA 2D3WA 5AHXA 4BX0A 1T8WA 1YZUA 3VTKA 2E5WA 1GA6A 2COUA 2WFMA 4A23A 4CM8A 1ZK3A 4PINA 5FTLA 3UCXA 2QRNA 7REQB 1Z2CA 3HCNA 2ZSHA 4DM3A 3GRYA 4KXYA 1FS4A 1B6TA 1TO6A 2GJKA 1EFCA 2XB4A 2B4RO 3DP7A 4RPJA 2RI0A 1GN8A 2Q0HA 3HEMA 2O8FA 4AJLA 4HWSA 4H59A 1W0KD 2ZJZA 3DQQA 1NYRA 1UMCB 4ZTBA 4E2YA 4BVKA 1KHTA 4HGOA 2NV2B 1EDBA 4GXTA 4EVQA 2GFIA 4JBWA 3NTXA 4D3YA 2JD0A 3TX6A 5CDYA 1OI4A 1YCDA 2H2FA 3OI7A 4ZA2A 4NULA 5LZ7A 4FOLA 3H84A 1VCIA 3ZD8A 3EXIA 4MUGA 3T1TA 3CM0A 1FOEB 1MIHA 3A9WA 5DHRA 5T67A 1B76A 2RG1A 2Q4DA 1ODJA 1V5WA 2JIOA 5E8JA 3C3KA </