2X4DA

Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
270
structure length
270
Chain Sequence
SMAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESAASRAELVGQLQRLGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYAATSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLYSINE PHOSPHOHISTIDINE INORGANIC PYROPHOSPHATE PHOSP
publication title Crystal Structure of Human Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase Lhpp
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 89
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2x4dA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2x4dA02
3VAYA 2I34A 5AW8A 3QU9A 5A3QA 2WF5A 4G63A 2QLTA 3ZU6A 3NANA 2AGVA 1IWOA 1WPGA 3QNMA 1ZD4A 4DWOA 1Z4MA 2B82A 4EX6A 2Q5EA 3IJ5A 1L8OA 2HOQA 2AH5A 3ET4A 4YIHA 1Z4JA 1ZRMA 1F5SA 3DAOA 1U02A 3A3YA 2EARA 5AK4A 4Y2JA 2ZBGA 3WKCA 3W5DA 1YJ5A 5AVZA 2FPRA 1L6RA 3OCUA 2R8ZA 5ALNA 5JJBA 2YY6A 2R8XA 1WZCA 1TJ4A 2OA0A 3KOOA 4EEKA 4RETA 2IYEA 3K1ZA 3ONNA 2I33A 5AW9A 5AW2A 2P69A 5AKXA 3HYCA 1YDFA 1RRCA 4HGNA 3EPRA 4C4TA 5ALWA 4YCMA 2GHQA 3NAMA 1O08A 1TJ5A 3AR2A 3SKXA 3QYPA 2HCFA 2PQ0A 4NV0A 2Q4RA 4G9BA 1Z4KA 3FPSA 5AVSA 4DW8A 2RAVA 4F71A 3ED5A 4C4RA 2HI0A 2IOFA 4CE6A 2ZBDA 4CF4A 1Z5UA 5ALGA 5ALLA 5A3SA 3S6JA 2FDRA 5ALZA 2C4NA 2CFSA 3I6BA 3WK5A 5AW1A 2YBDA 4UM5A 5AW0A 3WKEA 4KNWA 2Q4TA 2JAOA 3KBBA 1K1EA 4DFDA 3B9RA 2G0AA 2EAUA 3NRJA 2G07A 3QU5A 2HHLA 2JAWA 2ZOSA 3PGVA 3GYGA 3WKAA 5AVTA 3NUQA 3PDWA 1Z4OA 1U7OA 3OCWA 2C8LA 3MMZA 2IOHA 5ALEA 4QJBA 1SWWA 1QQ5A 1S2OA 4CF5A 2WF6A 3ZVNA 1NNLA 3QU2A 3DV9A 4Y2UA 5FP0A 2B1QA 4Y2RA 4Y2YA 3I76A 3PGLA 5AI4A 1QQ6A 3U26A 3KD3A 3ZUPA 4ZEVA 5A3RA 3NALA 1VJRA 1CR6A 2YMMA 1AQ6A 1L8LA 4OD0A 3N28A 5ALSA 2OM6A 5ALTA 2I7DA 1RLTA 1PW5A 3FGOA 3QU4A 4HGPA 4IG4A 5AKLA 3SLRA 3N5KA 5IT0A 3QGMA 3CNHA 1RC8A 3QUBA 1T9ZA 3ZWKA 5AKHA 1QH9A 2YMPA 3WK7A 3UMCA 5AW7A 1NRWA 2HF7A 2WFAA 4UASA 4Y2SA 4GIBA 4HGRA 1NF2A 2GO7A 5AI8A 5AVUA 1KYTA 3UM9A 4J2TA 1YMQA 1Z4IA 4XPZA 5ALPA 2FUEA 3E84A 4YH1A 1RQNA 1XPJA 3SHQA 5AW6A 1O03A 5ALJA 5ALKA 5AM5A 3ZTWA 2YMQA 4C4SA 5AM1A 1Z5GA 2JGAA 1LVHA 2W11A 4JDPA 2PR7A 3QX7A 4Y2QA 4F72A 3HLTA 4Y3UA 3UMGA 5IS2A 1RMYA 2B30A 2MU1A 3AR6A 4PNHA 4Y2XA 5AI9A 1VJ5A 5AM2A 3DNPA 3P96A 2HEGA 1Q91A 4MUMA 2RARA 3ESQA 3ZTYA 4FFDA 4RESA 4HAIA 5AI0A 3CZ4A 4UW9A 5AKYA 2YJ6A 3DDHA 3WK8A 4H1WA 4CF3A 2B1RA 4BX3A 3L1UA 4UMEA 5AM3A 3ESRA 3ZWDA 2AMYA 3KDPA 5AI5A 1VFPA 2D2VA 1L7PA 2OBBA 5AIBA 3OCYA 1Z4LA 2P27A 4BYGA 5AW4A 2HX1A 3ZW7A 1RKUA 5ALQA 1RQLA 4MWOA 2HSZA 2G08A 4Y2PA 4FYPA 3B9BA 3E81A 3SKYA 1RDFA 5AVQA 4XOUA 5T41A 5ALFA 4DCCA 1S8OA 2C8KA 2FPWA 2HO4A 5AVWA 2G1AA 3FVVA 2IOFK 4AS2A 4AP9A 4JB3A 2MSNA 4NWIA 3L8HA 1FEZA 1ZRNA 1YV9A 1TA0A 4NAVA 4XE5A 3MC1A 5ALIA 3U7EB 4YIKA 2WHEA 3MPOA 3L0CA 2W43A 1RLMA 1T5SA 5AI6A 1L7OA 3I28A 3M1YA 5AESA 1J97A 3D6JA 4J03A 3ZX4A 4BEVA 1LTQA 5ALDA 4EZEA 2ZXEA 2WF8A 2NO5A 3W5BA 2I55A 3OCVA 3WKBA 2G06A 1RMTA 3TLMA 2FI1A 3U7HB 5AVXA 1U2TA 4QQFA 2YFYA 3A1EA 4UATA 3KC2A 4XQ0A 5ALHA 2RB5A 4OHFA 4UARA 1CQZA 3UMBA 1QYIA 4AS3A 3AR8A 4ZEXA 4UU0A 5E0OA 3W5AA 4B6JA 1N8NA 5AK5A 1XVIA 1T5TA 5AKEA 4EELA 3NASA 3EF0A 2FPSA 1L7MA 1ZD5A 3BA6A 3L8EA 2YJ3A 2IA5A 4CNQA 3U19A 2R8YA 4UM7A 2R8EA 5AM4A 2B8JA 3R09A 2X4DA 4L57A 3SF0A 5AVVA 2NYVA 3L5KA 4UMDA 3R9KA 3AR5A 3J7TA 5ALYA 4BNDB 5ALXA 3RF6A 3A1DA 3IB6A 1U7PA 3PCTA 1ZD3A 3ZVMA 5ALOA 2W4MA 1SU4A 4BNDA 5AM0A 1ZD2P 2BDUA 2JAUA 3WK4A 1XP5A 1JUDA 3AR3A 4NFLA 4UMFA 4Y2TA 3QXGA 1ZS9A 1EK2A 4NABA 3WK9A 5AICA 3F9RA 3EF1A 3M9LA 5AHXA 3OTQA 5AK6A 3ET5A 1ZJJA 4BKMA 3WGVA 4EX7A 4YGYA 4KX5A 3L8GA 1EK1A 4KN8A 3AR7A 3FPBA 2FPUA 4L6AA 3L8FA 4UU1A 2G09A 4HYTA 2C88A 1Z4QA 3B8EA 3U7FB 3OCZA 4OCZA 4EENA 2ZG6A 3OPXA 1MH9A 4UMVA 2B0CA 5AW3A 2WF7A 3SMVA 4OFZA 5AVRA 1YS9A 4YCLA 2YN4A 2FUCA 5ALVA 3N1UA 3MN1A 1RPZA 2YJ5A 2DQSA 3AR9A 4Y2VA 3U7GA 5AVYA 5AK3A 3WGUA 4FE3A 3OCXA 3I1YA 2I54A 3QUQA 3NIWA 4IFTA 2WM8A 5AKKA 5ALRA 3SD7A 1Z4NA 2O9JA 4BBJA 3FM9A 1Z88A 3QUTA 2HF2A 2CN1A 3W5CA 4HGQA 1TE2A 5AKGA 2JARA 2P9JA 2HDOA 5ALUA 1RMQA 2G80A 2BDEA 3A1CA 4KYTA 5AKIA 2ODAA 5IT4A 2CFRA 3QUCA 1J8DA 1X42A 2O2XA 3ZVLA 1QQ7A 2GMWA 2PKEA 4YCNA 4ZEWA 4KX3A 2YJ4A 1WR8A 4O8CA 3U13A 5ALMA 2I6XA 3ZX5A 2B8EA 2OYCA 2CFTA 2WF9A 3AR4A 2GHTA 3IRUA 4L6CA 4KNVA 4E88A 3E58A 4BEWA 2ZBEA 3L0YA 2QYHA 3WKDA 1RKVA 3ZI4A 4UAUA 1Y8AA 3RFUA 3QU7A 4HGOA 2P11A 3KZXA 4GXTA 4UAVA 3N07A 5AKZA 2FEAA 3EWIA 3QLEA 5AKJA 3FZQA 3WK6A 4I9GA 3L1VA 3E8MA 4I9FA 5AIAA 3R4CA 1N9KA 5AW5A 3N8GA 1U2SA 2C9MA 2YMLA 2FPXA 1YNSA 1RLOA 1Z4PX 1TJ3A 1WVIA 1L7NA 2GFHA 4BX0A 1ZOLA 2EATA 3L7YA 1RKQA 4BX2A 3BWVA 2AUTA 2VKQA 2ZBFA 1Q92A 2BY4A 2NO4A 3L0BA 2RBKA 1SWVA
chains in the Genus database with same CATH superfamily
5GONB 1LUAA 3CMMA 2V7BA 3PIIA 4HH0A 1PSZA 3CZ9A 1QUEA 4PIMA 2GN1A 5HCUA 4CKYA 2AC2A 3H87A 3HJNA 3MMNA 5TQ0A 5INTA 1RYDA 2Z04A 2Y93A 5KYGA 3ICWA 1Z5ZA 4F2HA 2Z8YA 3T12A 2XUJA 2WINI 1IN5A 1WDLA 3CA8A 3NI2A 3UKDA 1RPZA 2ZYSA 2FW9A 4KGZA 1GYQA 5IAJA 5FOTA 3B9PA 1L8XA 2ESRA 2QTWB 2RB4A 3TE6A 2Z6UA 2PSHA 3TVDA 4GGMX 4RGBA 3ET4A 2ORIA 4B2PA 4D81A 1PX0A 5BURA 1J1IA 3OUTA 4RZQA 1GJRA 3HY4A 2R1VB 1X7GA 1Q3KA 1Z2NX 1ZHFA 2C07A 3C5HA 3HZRA 5COQA 5JW6A 1DBSA 2EBWA 3W6NA 5KX5F 3WLTA 2FFRA 1B0AA 2FPRA 2H7CA 1Z12A 1SHUX 2OK8A 2ZWVA 3CUSA 3GXOA 3VAZA 4I6GA 1EXDA 2GA9A 4GW3A 2J9YB 2FEPA 5DW0A 1A9RA 3V33A 3K16A 2ZTVA 4EEKA 4XQCA 5HKLA 2ZYTX 1YI1A 5F35A 2NV0A 2GCIA 5B7GA 3HFGA 1EWTA 3QZUA 3PC7A 4M89A 4OV6B 2NVWA 2P0YA 3NCTA 1NV9A 4WCDA 4YI3A 1SD2A 2HK9A 3EPRA 1T0JB 1LRJA 1LSSA 1U3TA 2RHMA 3T1YB 3V55A 1C8LA 2X3UA 1GG2A 1XWFA 1G0NA 4LX8A 4IXTA 4I8XA 1ZBQA 5BUZA 1TJ5A 3BBLA 2ORED 3AMVA 2VYCA 2JIPA 4ODIA 1P4RA 2PMWB 1MR3F 3CUYA 4XIJA 3JCZA 1O97D 1NI4A 1HWYA 1Z4KA 1NRJB 4QUHA 2P2ZA 2P7IA 3A9WA 4F71A 1NBME 1CHDA 2C3YA 2OV3A 5BNZA 1HYEA 3F7NA 3FNEA 3IMEA 3UMFA 4K1XA 2VHEA 4QODA 2GFIA 5F7XA 3UAOA 3G2HA 4UTRA 1X3SA 3K1YA 3SSOA 4Y1RB 4LCEA 1H2XA 1ZWKA 3TN7A 2BKAA 2XDAA 3OQJA 4H9GA 3I6BA 4Z86A 2C57A 2HA4A 4AECA 1J21A 2RHTA 2ZWIA 2GVZC 4OHPA 2P8SA 4DUZB 1KJNA 2AJTA 2Z4SA 3HY6A 4FSHA 2WTNA 3DD5A 4N3BA 4AMBA 3FCYA 5IXYA 4RTSA 2JAOA 4O2BA 5G3YA 3FF4A 2UZAA 3K5PA 4S24A 3QMWA 3RAEC 1Z56C 5EZYA 1L4LA 1Q77A 2IYSA 2VEDA 1F1JA 3E82A 1IH8A 3HCEA 3HYLA 3ICPA 3O82A 4OKSA 4WOCA 5EINA 4DMKA 2JAWA 5GIOE 1EE9A 4OLAA 1Z0IA 2GBLC 1CP3A 1SVSA 4KSCA 4RPGA 1YMVA 3VYWA 2A9FA 3ZJUA 4QU5A 4YO7A 1VG1A 2RH4A 2AEJA 4LXHA 1MEEA 1XT6A 3SC2B 1TO1E 4FNGA 3TECE 1JLKA 1ZUIA 2R11A 3OKPA 2A9OA 2HV9A 4BRZA 3IR5A 3OCWA 3RTEA 4J1SA 2YX1A 4LF6B 1KI6B 4W5RA 2Z9BA 2HD4A 4DA8A 1XU4A 4IIBA 1NNLA 1XX6A 2XIJA 2GOYA 2B0JA 4CXMA 2ZR7A 2PX3A 3IT0A 1A9PA 1V6CA 2ZI7A 3FGZA 4KE6A 3HY3A 5EAIA 3VDRA 4WE3A 4H6PA 4P7JA 3QE0A 2FFJA 3HWRA 4UXJA 3A3NA 3VC1A 4GECA 4L9RA 1IQ0A 4KNYA 3GZNA 2VQ6A 1C5KA 1LX7A 1PLLA 2QUKA 5LOVB 3HJHA 1AX9A 4TYYA 1IRIA 4DPLA 1CUEA 3LCRA 3OIWA 1GZVA 2Y76A 3FGOA 4N6OA 4NZNA 3FLAA 1VLMA 2QD1A 2EIXA 3SLRA 3STYA 5DRYA 4CKBA 1U3UA 4UQLA 3PS9A 3RK1A 4X8OA 5IT0A 3NHWA 2HW8A 1DT3A 1YJBA 2OCDA 3M2TA 1L7AA 4O4IA 4A8TA 2H4HA 3HKBB 5JO0A 5EMNA 3I58A 4NU0A 1D6MA 2BM1A 2FG7C 5E38A 2XWPA 3PD1A 3QITA 2GUWA 4GPD1 3BKXA 5B57C 3GT0A 4WK0B 2ZI5A 3UW1A 1P1KA 2Q5JA 3DCYA 2XF2A 1WHSA 4TTJA 5DM0A 4G4GA 1FC0A 2X23A 4G0MA 2ZJ2A 3BDIA 3K35A 5BV0A 1UMBA 4ITUA 4ZVTA 1JDVA 3JATA 4WXYB 4HVAA 1I5RA 3C7CB 3AUFA 3ZKAA 4CGZA 1IBRA 2CXQA 4PW0A 1K08A 1NPYA 3H2BA 5GJCA 4V0KA 1HF3A 1XPJA 1L5MA 3SHQA 3ZJ4A 3KALA 3BSFA 4CN9A 3BB3A 3DE2X 2FSIA 1KO8A 2RJ3A 3LP5A 5FA8A 2O8CA 3KLMX 4HDKA 1PJQA 5HXAA 3OOJA 2GCOA 2QL7A 2AFHB 1KEKA 2H4YA 3OQIB 2X0RA 1YJQA 3LTEA 3RYHA 1BA3A 1TMKA 4XAQA 2KX7A 5KNCH 1NLYA 2AR9A 3C5WP 4L74A 4TS3A 4PVDA 1N8SA 2IYFA 3R3YA 4JI0B 3C3KA 5DASA 3HU3A 1NQVA 4XB1A 5TPWA 5IKOA 4GI1A 2E87A 3AJAA 2FLWA 4JJKA 1DBPA 3BMXA 1KMHB 3A3OA 1P18A 3IBGA 2FQYA 1JDJA 1CQIB 1LTKA 4HAIA 3IBCA 1E3JA 3OOWA 1FDSA 5FQOA 1SG0A 4BVHA 1TEXA 2PLNA 4Q66C 3S2YA 4I9UA 2GT1A 1IJEA 1D3AA 2OBMA 1XVAA 4BB5A 4XD2A 4M54A 2YUIA 1AKNA 4QUGA 3KHUA 5ERXA 3QIAA 4B4WA 1FU7A 2EIHA 3U7RA 4EFDA 5CYGA 1KHTA 5IX8A 2QEQA 4LYEA 1N9ZA 1MABA 1RR6A 1QHGA 5EIXA 4EMTA 1EFCA 5A1TA 5KHLB 3M6LA 1WJGA 2CHEA 5C37A 1ORIA 1V8PA 1X8XA 3WBFA 5JFOA 1W5TA 4L9WA 1R6TA 5ELMA 1W0JA 3FVWA 4A2WA 4PGHA 4RUKA 4UUPA 3H9GA 1WCXA 1U6IA 2OCPA 4UNIA 4ZJPA 5T4HA 5CFPA 2WFMA 2H1CA 2VUIB 3MJCA 2W2TA 1GT91 3K9HA 5B2FA 4O33A 1WF3A 2GM4A 1DCFA 3N53A 1MN6A 4FYPA 1ES9A 5JFTA 2X8AA 4OJTA 2OYSA 1W0JD 4MRPA 1JG6A 1RDFA 3UWMA 4Q4HA 2Y1OA 1OZGA 3LPDA 1VKHA 1C9NA 3GGPA 2C00A 5ALFA 4ZEOA 1XMSA 4D9MA 3V4RA 5CA0F 1ADBA 2G88A 4F3CA 4PXYA 1A8HA 4ZOBA 5D3KA 1OF1A 1ZGAA 4JSTA 2WIJA 4W1PA 4AS2A 4MEJA 1BEEA 1LH0A 4LDZA 2PLRA 1U1GA 2XPCA 2UZ4A 4URWR 1TMYA 1D1PA 3F1LA 1T29A 3OWHA 5TRTA 2ARKA 2H6EA 4WI1A 3TI7A 2B9EA 4HFRA 5LQJA 4HC4A 1IN7A 4QO7A 1JHQA 1WXFA 3BIWA 3VZPA 3H7IA 3T7JA 1P5JA 3A9UA 4O63O 1ZM2A 4OB6A 4OO3A 4BO8A 8ATCA 1CY1A 1Q0HA 1UXGA 1L5LA 1P1FA 3MUEA 1T3TA 4RK6A 4G0WA 1K7FB 3H42B 4LZZA 3TLAA 2AXPA 2WJIA 4J0HA 4W1RA 3OTWA 2XDWA 3QH4A 4L4ZA 4W8OA 1EFDN 1EFLA 1LC3A 3GGSA 2UZ1A 4U00A 1WMBA 3EAQA 3EVEA 4KV9A 2BFDA 2F1KA 3BTOA 3LX4A 2EF1A 1FX0B 5CT9A 2D1SA 3VTKA 3WFIA 5EG5A 2MSKA 3U16A 1NVWQ 2OAGA 3EVFA 2ABWA 1RLJA 3TFWA 5DGCA 2EJWA 8OHMA 4AJEA 3KSDO 5KYKA 2I1LA 1AH2A 4UCQA 1XMPA 2PEZA 3F8SA 4TSRA 3KC2A 5ALHA 4CMEA 3CLSC 2Q3JA 4P81A 4MQFA 3TNJA 1YZLA 2WLSA 4YACA 4A1FA 5KWJA 1O96B 3DC2A 2WU8A 2IPOA 4Q34A 4MJ7A 2GARA 5BQFA 2XBMA 1K3TA 1LPNA 1UOQA 2D0PB 1WVMA 1TYCA 3AR8A 3PGXA 1LPPA 4NRDA 4WA8A 1GDDA 1GTG1 2ZUDA 4B6JA 5BSKA 5KSPA 5KVSA 3QFFA 5FKJA 4O3MA 4N3AA 2PFSA 4ML3A 4JJEA 3BCRA 1E79A 1OKKA 3VUFA 1SPXA 3H2YA 4HCJA 1KDTA 1GITA 2XW6A 4DQVA 1BHJA 1MW9X 1NXPA 3R41A 3SIWA 4TWIA 5EJ7A 1T2UA 1JQBA 2GRAA 4HWRA 1W5AA 5E1MA 3ZU3A 4BO0A 2WVHA 1EUQA 1VSTA 1RS0A 3GJ0A 1KZ7B 4JODA 3HR7A 3W06A 4EHLA 2UXBB 2X0EA 1E79D 1OKKD 4RTMA 4CL3A 5C7YA 1FRVA 3RS7A 3ZE7A 1G0OA 2C9ZA 2VPWA 1E2FA 2VCHA 4I5DA 1PJRA 4PCVA 5A06A 3PNKA 3VA7A 4U7PB 4YCJA 4C6SA 1ZX1A 1OV6A 3TX6A 3V7FA 3AR5A 3CEHA 2V9PA 1JJFA 1O58A 1YRWA 3CX4A 5ALXA 3B82A 3SZLA 1P1IA 3DLAA 2O8EB 1PGJA 4MR7A 1U8XX 3R3UA 4B3FX 3B1YA 1ZD3A 3D8BA 1DRUA 4MJ3A 4UNSA 4YUXA 4DNXA 1T4MA 5HOQA 2KHZA 3RK0A 1H1DA 3R8XA 3CTMA 1EIZA 4QOGA 2ZYUX 1GARA 1YVRA 2XITA 4WGFA 4KQHA 1DAIA 4LNHA 4YJKA 2NZ8A 4EGAA 4FCVA 1EP1B 1KSFX 4OP1A 1V1JA 2PIDA 2HWKA 2QU7A 4DZRA 2AKYA 3AR3A 1KU0A 4QLOA 4UD2A 3RSFA 1YBAA 4XSHA 2JANA 3QXGA 3T9CA 2IEAA 1Z7GA 1C81A 1VCIA 1UP7A 3L8MA 3LZ6A 1ZFNA 1NW9B 1QHSA 1SZPA 1E2LA 4R0NA 3PDCA 2VTBA 1F60A 3FPKA 1N5OX 4PGMA 1L7EA 4RTRA 5FHQA 1Q1QA 1Y8CA 2ZRFA 3QEOA 1JKJA 4KZPA 1N8KA 5EP3A 3IEMA 5DT9A 5EERA 4X3CA 2JIRA 4JBYA 3PI7A 3DLHA 2Q1UA 2GSDA 2WFLA 2Y2UA 2XAUA 4N4AA 3N86A 4MWCA 2I7TA 2AKEA 4M53A 2DG2A 4JP2A 4K3UA 4AG5A 3RVBA 2FX2A 4U7DA 4P0TA 3DZ8A 4N0DA 1ISJA 2HY7A 4AYWA 2IXTA 1FPMA 3MXTA 2X0IA 4DMGA 2EU8A 3MB5A 4QYTA 2WG1A 2XMGA 3E5NA 4LHYA 1C9DB 3G13A 2J9RA 1OZAA 3VHXA 4LJSA 2EVWX 1U0JA 2WHYA 3OICA 5JMTA 5HBRA 2PR2A 3A2MA 3EVBA 2DFDA 2DULA 1PU2A 3EVGA 1B74A 3KPVA 2NP6A 2IP4A 2AG1A 3N1UA 4UAGA 4LJ4A 4NS4A 4QG3A 2Z1DA 2P9QA 2QAGB 3KV1A 3B51X 4KMSA 1NLMA 4BXOA 3I5MA 4L9SA 3T1VA 4RPLA 2ZIUB 1D2GA 3F6CA 5AO9A 4DV7B 1E7YA 4LIPD 1SBYA 3L79A 3ICEA 4WLFA 1Z6XA 4OLJA 3S8MA 1WG8A 2FP4A 4IFTA 1C3XA 1XTUA 2OK7A 1N6NA 3C15C 3NW9A 4JCOA 4OVKA 4G5XA 5AUNB 2X4IA 2Y0DA 5CNJA 2QPLA 4C3UA 4BBJA 1XXLA 4KQ1A 4EGSA 5IDWA 5K0ZA 3ZWNA 1SVKA 2NO9A 1Y5NA 3VJLA 4BVAA 1RRKA 4CM6A 4BN5A 5IMSA 1N5DA 3E9EA 4JEMA 2ZCVA 5DXFA 1XPUA 2BH9A 4WXEA 1EUCA 1V71A 4IP0A 1UQTA 2Q5IA 4HRAA 4KYTA 4TL9A 4EG6A 5HZKA 5E2BA 3ZZTA 5L7TA 1C9JA 1YAHA 121PA 1YWGO 1IM8A 4R2XA 4CIBA 1G3MA 2YVUA 2DLDA 3DLCA 3D8NA 2QJWA 3COWA 1VXRA 3EC1A 4LXYA 1M6VB 5IVKA 5B6JA 2P0AA 1AQLA 1H4TA 1A3CA 3WY9A 2PZMA 2P5UA 5JCJA 2OYCA 1V7QA 2HF9A 3T1NA 2P2LA 2XHZA 3Q5EA 3QVTA 5F9FA 1JA0A 3AHIA 3VR6A 2JFUA 5CYOA 3O6VA 4DS3A 2C1EA 5CT6A 2HGZA 1O95A 3BICA 3NCHA 4NE7A 2GWRA 1OT3A 2B4YA 3LC0A 1V2HE 3O0TA 1IY2A 3CH4B 3OBIA 5JCJD 2HMSA 3IESA 5BR8B 2FSSA 4UFOA 3TB4A 1I7LA 4YN3A 3VR6D 3LHKA 3AIOA 4IQFA 2RC5A 3QTBA 5FTNA 4OHBA 3N8KA 3GHHA 1O95D 1V8ZA 4H7PA 3SEZA 4FCWA 4TSFA 3JQGB 3IT2A 1M2HA 3GRPA 4C78A 4PZLA 2CL0X 4E11A 2JHAA 1JALA 1T9HA 1VBNA 2E1PA 1KPHA 3ENWA 3EBPA 3D02A 3IPRA 1DBIA 1S7CA 4J1QA 4G67A 4KPUA 2NOAA 2B92A 3H0EA 3THXA 3H2KA 1NXVA 2ZPTX 4L8GA 4GRIA 4ZQFA 2FUKA 4TSFD 1IY1A 3CBGA 2IQ5A 1MO5A 2JKVA 1KH2A 1PJAA 1T3LA 2X9QA 2PGXA 3IEKA 4OUDB 3I9KA 2HDHA 3PPWA 4G37A 3C24A 1Q7CA 3IUPA 3AFNA 3Q9NA 3AKEA 4D3XA 4ER0A 5E6RB 2VG8A 2X41A 1JQDA 5EWMB 5L3QB 2V9ZA 2IELA 4XWYA 1N9GA 1JHOA 3GFSA 4WBNA 2AUTA 1AHIA 4QPCA 3RTBA 1I32A 4WEOA 4P58A 1EFVB 2IHBA 3D8UA 1Q92A 1Z22A 2H2DA 2NT4A 3F9IA 4G4IA 4G5SA 2IDMA 4XGIA 5A7HA 3O4FA 3RAPR 3VDNB 3WWDA 2NUTB 5E7QA 3VAYA 5IVHA 4MWBA 5GTDA 1OA0A 1BHO1 1C2YA 1A82A 2A1IA 2B35A 2VHZA 3EQ6A 4G63A 4NL4H 4FEAA 3REOA 5AJZA 3WP0A 4PR3A 4WZAE 5FBZA 5G0VA 4EUHA 3MAJA 1V3TA 2W6IA 2W6CX 3GP3A 3TLGA 3ZYZA 4BMYA 2CHQA 3MRSA 3DE1X 2HRZA 3NT2A 3ISTA 4O25A 1LZKA 3MCTA 3WLPA 4DC9A 1IWOA 2WZCA 1PGQA 3ICCA 3TTSA 4UEOA 4G0QA 5J5VA 1V35A 4XYMA 4Q3EA 1OHHA 3LVQE 1G8MA 3OO1A 4H4DA 1KRHA 2G4VA 3NVAA 2W6ID 1SKMA 4WKBA 4UOZA 4DG8A 1WU7A 2D3TA 2H8GA 4HDNB 4YIHA 5KTNA 1WETA 1N5MA 4B33A 3BK1A 3ESAA 1G6KA 1DJQA 1K8RA 1TC2A 3EY4A 3WKCA 1Q0SA 4BNFA 3OMLA 4MGKR 1OHHD 1OXBB 1DNPA 1TLFA 2CB9A 3OCUA 3HVUA 5B2ZA 4YMHA 3F6RA 2HH9A 3KM0A 4O59O 4F9TA 3H0KA 1ZSYA 2X9GA 1VBKA 3LA8A 1ZXXA 3OF2A 4RO0A 2OA0A 3AUYA 3P0EA 3PUYA 2ONJA 3MTAA 1CZUA 3RUAA 5MN6A 4BDTA 1AM4D 2YVLA 3QX8A 2DR0A 4P1ZA 4E3ZA 2FW7A 1GTZA 5EA2A 2X3FA 3QF4A 1IDOA 4AJNA 1HPLA 4Q1DA 4NBLA 4BNXA 1AKTA 1FUIA 3G8CA 4OYYA 1RXEA 3NAMA 4IH9A 5JJLA 2YNMA 4TRNA 5I5GA 1K89A 1T13A 5JY6A 1YH3A 1TT7A 2H5JA 2Q2OA 2ECFA 3G5MA 1U28C 3WL6A 4D80A 4UBNA 1OASA 3GRYA 1JP7A 2J9ZB 1W76A 1J6UA 2W2KA 3P9YA 4MCAA 4NG4A 5M3BA 4L2IB 1Z5NA 4KDEA 2CLKB 3T7KA 2Y9PB 1BEUB 3K9FC 4GGOA 5HDBB 1NI5A 2YNMD 3RK4A 1MQAA 2GCGA 3I2IA 1E3WB 4HRVA 1UBJS 2ACVA 3E9QA 3DVLA 3QLJA 4IYJA 3TJRA 3DWEX 1JDPA 1NBHA 3D0OA 4MQUA 4NYMQ 3KCNA 5ALLA 4C06A 1QRDA 2Q50A 3VNRA 3E8SA 3QEMA 4RVUA 4YK7A 1GYPA 2JLQA 5K9ZA 2PKXA 3AB7A 4EI9A 3WK5A 1BXGB 3EUWA 3M6MD 4P86A 4TX1A 4KXVA 4ZK2A 2SBTA 1A97A 1FU4A 5FBKA 3UT6A 5ABPA 5KVVA 2Q4TA 3EG9A 5C7IO 2JG3A 4OI1A 1NOJA 4JUCA 5COBA 5BRNA 1MRNA 1UC4B 3ONFA 3Q7IA 3U1VA 1PO7A 3FCAA 4N5HX 2J45A 2ZS9A 1X9IA 2YYSA 1TVMA 2J5XA 1PGNA 3S55A 5EP2A 5E7IA 1T5IA 2K5UA 3JXEA 3O03A 3V2GA 1SQSA 1Z0UA 4NCNA 3IV7A 5JXGA 1QZUA 2BMEA 2QW1A 4MQ6A 3OUZA 4OJKA 4CLOB 5CLFA 1TZBA 3VPFA 1NTRA 3FYUB 2F9MA 3LKVA 2I3DA 4IWNA 4NNJA 1NVDA 1P39A 4E5DA 3VU3A 3OA2A 3PGKA 4QJBA 5DK4A 4H27A 1KTVA 3SYNA 3PLRA 4P8RA 1DJLA 1QIKA 2OHXA 5HA5A 1QZTA 2WOOA 1MC1A 3EVZA 5LD2B 1C9YA 3CJRA 1HT0A 3CH7A 1GR0A 2AFIE 2WR8A 1I4LD 3TOVA 3U4MA 3K9CA 5KHOC 2X2OA 5JJ5A 1P3JA 1Y8RB 3KAKA 1AUQA 2J85A 4IJWA 5JQGA 3R20A 2B9VA 3CWZA 5ETJA 3HYTA 3ZHSA 2G4LA 3IUMA 4B48A 5A3RA 3R7WB 5IPFA 2O6HA 2BMWA 3EGXB 4YJ2F 4MDYA 3R5FA 3FIJA 5EHGA 1MO6A 3JQ7A 9LDBA 1VPTA 3RVMA 4O02B 4JJ4A 2QGZA 4MV1A 2OHIA 2NIPA 4HY3A 1MPXA 5ADHA 1FXWF 1PW5A 3NBFA 4ZDKA 3WRYC 3KQLA 4DCGA 2I65A 2F8TA 2RGXA 3TQQA 1A95A 4XDZA 2OV8A 3LW8A 1M3SA 4PZ0A 3PL1A 3CNHA 5SZKB 1KRXA 3A1WA 2ZQYA 1O9GA 3LAWA 3PRJA 4JLNA 3AI3A 4CG3A 2I7XA 2BWJA 4F5WA 2CHGA 1W6RA 1CZLA 1ZNYA 2P6MA 4HNTA 1YA4A 3LUKA 3FCEA 3GFPA 1V16B 4P98A 1KZ6A 2QTNA 4NARA 4EEZA 4JI4B 1KYVA 2GXSA 4RXTA 5LBTA 1T8PA 3ZJVA 5ITWA 2XE4A 5U4XA 2PUAA 3CVYA 3NTOA 1ZONA 3C7AA 2MDTA 1XROA 1TU3A 3A3KA 4RZ3A 3RV3A 1TEVA 2Z2ZA 4DHEA 4YH1A 3VNUA 5J1SB 4TWJA 2A0FA 1LW7A 4G4SP 4RKQA 4MV8A 4E6EA 3E1SA 1DQRA 1XE3A 4D92A 4E1AA 3O26A 4JI3B 2JGAA 5BVGA 4JD5A 3KB1A 2H06A 2BFCB 3L2OB 3NOVA 3HYRA 2OHOA 5JS2A 2C0PA 3BMNB 1THGA 2FQ1A 2E4ZA 2C42A 4DJEC 2RI1A 1NJ2A 2HWUA 2P7HA 4FN5A 3D7LA 2WJ6A 4Y2QA 1D9ZA 3VXKA 1OBVA 4ES6A 3SS9X 2D4HA 4WH0A 4U8GA 5K8IA 3JWEA 4KGXA 5REQB 5ADWA 2VAWA 4ZI7A 5IJ9A 5KQSA 1NG9A 2KWIA 1CBUA 3O1IC 2KS6A 4A8JC 4M99A 3PWZA 2WFZA 1AK2A 2X8JB 3L9XA 2E5WA 2XB4A 1EXWA 2B69A 1WBDA 3C3EA 1PFKA 2DUWA 3LUPA 2J0SA 2Q8QA 3DOOA 1OI7A 4FZRA 4KTVE 2O0LA 5FNVB 3DDNA 4UMEA 1PT9A 1IJKA 3EFOB 3HCRA 4MUNA 3KDPA 2H00A 1E5XA 1RC1A 1GWNA 1OFGA 5EIEA 1X7XB 1UINA 1DG3A 3EGVA 5CVTA 1IN1A 1T8TA 3GNTA 1N6IA 3HBNA 3K4PA 1T6NA 3OKCA 2AQ8A 4JASB 2BFNA 2ZLBA 3FUXA 3G0OA 4YBRA 5A0FA 1JSRA 4CQJA 5AIBA 7AT1A 2G70A 4GLLA 1M6HA 1NL3A 2FA9A 1VCOA 2D0IA 2JFGA 4OJNA 5JH7B 3T8YA 4U9UA 3ZZNA 1UWLA 2QN2A 3K6RA 4LBWA 5DPMA 3ZDQA 4MW2A 3ZXYA 5JNLA 3I5YA 2OLEA 1ZYUA 3GFVA 4ZCSA 2PUGA 1MZPA 1XVTA 3H8JA 1SCUA 4AZWA 1O0CA 3PC8A 1DT5A 2W6NA 1DC7A 1Z34A 4LDPA 3FNRA 4ETIA 2EJUA 3PQ5A 2NO0A 5C52B 3C7TA 1CWUA 2E4XA 3TCNA 2B6NA 3HV0A 4OJYA 1OY1A 4GVPA 1MORA 3O21A 4EGQA 4K46A 2Y3IA 3ORYA 3PPIA 2CJYA 3C48A 1ZRNA 4NZPA 2JGRA 1M9NA 4QLBA 1Q3TA 3HWX1 4GAEA 3ZK7A 3USES 4P0QB 4AICA 1E2PA 1B76A 2QTFA 3DFMA 4H08A 2F2TA 2XNCA 3WXBA 4CFZA 4HTFA 2QMHA 1Q2UA 2YWFA 3L0CA 5DX1A 2PJUA 2BSAA 4D8VA 1AA6A 1OB5A 1SIUA 3C1AA 4LRSB 2CYAA 3S5UA 3OF3A 4RIFA 4ANFA 3A1FA 1NM5C 1N1MA 4ZCMA 1T9BA 2OCAA 3D6JA 2FFBA 3DZBA 2Z98A 4HLNA 4JJAA 4J03A 4KLZA 3TAXA 3WXMA 4BEVA 4INPA 4E07A 3U5TA 2IHZA 3UFXA 5JLJA 4HEJA 1AK1A 3WTCA 4C7XA 1RWKA 2HHJA 3RVNA 2I55A 3VDXA 3E7WA 6CHYA 1B0UA 1VP3A 4KYIB 3ZU5A 4PPYA 1AKVA 1IN4A 1E0KA 1RACA 2FI1A 4E2ZA 4CTMA 4MS4A 1KDYA 2CVPA 1SQ5A 3LXUX 4G1CA 3U61B 1JFRA 3C16C 3R0QA 4J0FA 1DWQA 1Z5WA 4EO4A 2R7NA 2REXB 3QWBA 1BCRA 4GMDA 5ERYA 3O9VA 2GRJA 2VT6A 1U5CA 1XD9A 2GTPA 2E6KA 4M55A 3TFQA 1SUAA 5FTLA 1R9GA 1RJDA 1VG0B 2FUG6 2QZSA 4RVNA 3Q7TA 3NXKA 1O6CA 4X1YB 3OIDA 2NU8A 4J16C 2BFBB 3NZEA 5JTTA 1KMQA 1P2TA 1PS0A 4PZPA 5I45A 3I62A 5AK5A 1MT3A 4BE9A 5JYDA 4N41A 2ZM6B 2H5EA 2QVZX 4PAQA 3CZ5A 3KHSA 1QX4A 1U0TA 5CNMA 2GZRA 1XJWA 2P3QA 4OJQA 4UNNA 2C7OA 1ZD5A 3BA6A 3OT1B 3SQWA 1YHYA 4ZCIA 3MJTA 4KR3A 4JJ6A 3RBXA 4GM0A 2GR9A 4FMCB 5AJYA 2V8BA 3DPSA 1TO2E 2IP1A 3OI7A 2GTHA 1ADGA 2DPXA 3KOYA 1UIMA 4U2GA 3PUJA 3U3KA 1H23A 4BV3A 1I1HA 4W5OA 1S2NA 4BJ1A 2POCA 1P1CA 3ONEA 2BFEA 4QICA 1WZUA 4ECAA 3H1PA 4ZOQI 3KVNA 4DWWA 4MPPA 4YUWA 1YZNA 3H9QA 1TQ4A 4XGNA 2JZNA 4U7JA 1ZGCA 3G89A 4W5QA 1LY1A 1DAMA 3R40A 3QUAA 4CI9A 4E7PA 1W19A 3DBRB 3TKYA 1E3LA 2FGKA 1WW8A 2TECE 3T3HA 3TW6A 3TRHA 2FWAA 3CW9A 2WSBA 1P80A 2R8PA 3EY9A 1XBTA 2CZGA 4A1OA 3U39A 2W4MA 3RKUA 4NH4A 4RLHA 4UULA 3M34A 3RUIA 1JIIA 2NXCA 4MP8A 4B3IA 1DGQA 3CLTD 3T9EA 1L1FA 3FSRA 3WK4A 2O5EA 1OR8A 2PMCA 4NFLA 2WKWA 4YRQA 3OC6A 4U2KA 4LXQA 2IV2X 4S05A 4RLQA 3RAGA 2GF0A 1O94A 1UPAA 1ZBDA 3DMHA 4KW7A 1CZKA 1X7ZA 4C0HA 5E6UA 4ZOLF 3ET5A 2DT8A 1I7PA 2PL9A 1ZJJA 5A9SA 3GBVA 4QYIA 4CLDA 1U1IA 2P5SA 1D2MA 2H1RA 5EJ2A 7GPBA 4W9MC 1ZJ6A 2X9VA 4KOEC 5ADVA 1O94D 3R5SA 4HT3B 2GYWA 1YB5A 4UU1A 4ZWNA 1AZLA 2G09A 5BMOA 1Y6GA 4IDCA 4G0YA 1UBUS 1E1CA 4F56A 4JQZA 2EKBA 4A6EA 4RIGA 2SICE 1NR5A 2VFAA 2Z3ZA 4LECA 4CEJB 1N8TA 2PA3A 1JVSA 4TSKA 4D9HA 1E7RA 1MX9A 1RWNA 3NWEA 5F51A 2JLVA 3DR5A 3QY0A 5EJFA 2FRDA 4GHWA 1UAGA 1BJRE 2QMOA 2YVKA 5KTPA 3GNQA 3MJRA 3Q85A 1G8FA 4NFHA 1GG5A 4EYGA 3O90A 3GVCA 1HORA 3OAAA 5EWJA 1IPFA 4GP9A 3IJPA 4G4JA 1HL7A 1KBOA 4FGZA 4S1NA 4JI5B 5IAAA 2QUAA 2HRDA 1KI9A 4NHEA 2BTEA 4RCZA 1EJBA 1GPWB 4XVHA 3KYJB 2J5QA 3WJAA 2X14A 3KT8A 3LUBA 1W4AA 4DN6A 2D6FA 3OAAD 1U9ZA 2BGLA 3C3XA 2ECPA 2QQEA 5F23A 2I54A 2FR8C 3IQHX 3QUQA 4ZU3A 5CCXA 3JPWA 3LY9A 1SO8A 2OORC 3LUDA 4DBLC 3LBHA 5C0OE 3ER6A 1MX3A 3GDFA 1AMOA 2XBLA 4IMJB 5BW8A 2FPMA 2SECE 4RHEA 3V4FA 2FZ5A 1I6MA 3I64A 4HGQA 2IH5A 2XMZA 1RJ9B 2VATA 4WERA 4D3FA 4JB8A 2I6FA 4L3WA 2OXFA 1US8B 3R24A 2MSLA 1Z83A 2BDEA 3HCWA 3N2GB 2ODAA 3RBVA 5IASA 3SVTA 2WV9A 3A14A 4QVGA 1P2UA 3QUCA 3RUDA 4F12A 1POXA 3ZD8A 5CFMA 5HSGA 3TINA 4ZKDA 1XAIA 2Y1CA 4A16A 1DRJA 3EXG1 4UTZA 5IFLA 2XZOA 2EEZA 3ZV3A 4P9NA 2B2CA 2UU9B 4QG7A 3WYAA 1Y3CE 2WAMA 4KJZA 2RC6A 2GEDA 1R12A 4PU0A 1NUQA 1XZBA 2REBA 2Z9CA 2AMLA 3D81A 3IP5A 3SSAA 4G56A 2ZJOA 4N8DA 4OB8A 3BXGA 3TEFA 4ZMSA 5JD4A 1SCBA 2H7VA 4L4XA 1UIRA 4UU7A 2P6RA 1NBWB 1F2TB 5EWLB 3A6FA 1ETHA 1ZK3A 3QG1A 1SQ0A 2H92A 4QOHA 2L69A 1LPBB 1HDOA 4GXRA 2AZTA 2A1UB 2Z83A 4Q0MA 1TJNA 1R27A 1UJBA 1K75A 1WZEA 3GZTB 3O9MA 1W36D 4A8HA 3BZBA 1TXGA 5LA6F 4ZREA 3AM4A 1WUHS 4ZYXA 3GJQA 2TMGA 3LXXA 4XUGB 2D7CA 3QVJA 3T3PB 1U3GA 4D8WA 3E8MA 4GLBA 5JC1A 1RTTA 2AOVA 3KUDA 4L72A 4P80A 3K31A 4L28A 1D0VA 3SYTA 2KSQA 1NW7A 1F20A 1EGHA 2ZSDA 3T5TA 2J3IA 1R6XA 2D4AA 2NW6A 3ZNPA 2C9MA 3PNVA 4OXIA 3HR8A 3EEIA 2Q6VA 3N2LA 3ORSA 2QRVB 3OUUA 3U2QA 1WRBA 1N34B 4DSTA 5BNFA 1B14A 1XNJA 2E6UX 4I81A 5A2GA 2ILTA 5B4VA 4YQFA 4N7JA 3LC7O 1H1TA 4CMJA 3FTCA 1J06A 1M0WA 1P73A 1ZOLA 3AF1A 4HSGA 2LDBA 4MIKA 3QPAA 3CNNA 2W6ZA 4HATA 1CQWA 1J0BA 1FYEA 4V0LA 1YI0A 3BWVA 3VU8A 4EY5A 4Q7QA 5F2EA 1QZXA 2BSXA 5TQ0B 1BH2A 4RA6A 1CY6A 2NO4A 3RRXA 4YAIA 4B7ZA 2B20A 1HL3A 1WXIA 4N8SA 1OXVA 2AN9A 1DKPA 1U0OC 2JEZA 1MOPA 1C3VA 1N2GA 2B4RO 2CLDX 1WDTA 2GXUA 2XMQA 4HDRA 3NANA 3TQFA 3ZH2A 2AGVA 1WNTA 1DKUA 3K0CA 4EABA 3LUHA 3ADCA 2VTVA 3PUIA 3PQ7A 3BHIA 3NQ41 3IP1A 3A36A 3GRVA 4KXFB 1QOPB 1UK9A 2ODPA 5JXWA 3ZV7A 4YRAA 2IGTA 4Q4LA 1UK6A 3CVXA 4PPGA 1YMUA 5CLJA 3EGIA 5I8WA 1VJGA 2GWHA 3Q3GE 2PCJA 4MZXA 4O1HA 1BS2A 1I2AA 1T9GS 1TZ2A 3DS8A 3JQ6A 2VHCA 1G2OA 3WSTA 4FI3F 2GYUA 5FUWA 2I8LA 2ONZA 3BAFA 2J6IA 4RETA 4DA4A 3NJ8A 2XUOA 4R1NA 3FRIA 2PYDA 3DMNA 3ONDA 1I3LA 4BGVA 1FFYA 5HUQA 3D3JA 4UTXA 1TQ2A 4F6CA 4IHJF 1G8KA 3RC9A 2ZB8A 3ACBA 1IN8A 1XXHE 4ZHSA 3N0TA 2Y1DA 3O3CA 2R5WA 4I7EA 4F46A 2QSUA 4MW5A 2RKOA 4A23A 4AY2A 1NI4B 3N9IA 3NNDA 3UMMA 2BAGA 2EX4A 4QQRA 5L6MB 1E32A 1GGEA 3L0IB 4IHQA 3R5HA 1SCQA 2QPAA 1NP6A 3IAHA 1B15A 5CH5A 2RGRA 4AJLA 5JVDB 4Y6LA 2UYYA 2XUDA 5JRDS 4ITVA 2IF2A 4ROTA 1A8PA 3LLUA 5FWNA 2O54A 1RWBA 4D4GA 5GVSA 3DL7A 2WMDA 4BV8A 2C4UA 2Q7DA 3EZ9A 2GD2A 4COKA 4YMWA 1N0VC 4L51A 4GI5A 1PR3A 3PXCX 1DUVG 5CJPA 3IIEA 1Z6QA 4O2BB 5ALGA 5F7JA 1PD1A 3T7AA 5IKEA 4FW9A 4Q1CA 5EZYB 2W0SA 3JQPA 4R5MA 5AW1A 1QAOA 1H4SA 2BJVA 1GKYA 2I8CA 2OMEA 3N8DA 4X45A 3X2EA 4ZDJA 5A6VA 2PZGA 4UBKA 3SC3A 1BVUA 2NUAA 1PRYA 3AV0B 3T0IA 1Q16A 2FKAA 3TR0A 4C6RA 3HXPA 3KJIA 1XF1A 3QTTA 4NU6A 4HHEA 2UXDB 1KKUA 1KFKB 2D7JA 2EAUA 4OMFG 3BWDD 4AX8A 2O8NA 1NF9A 3R6WA 4LV8B 4M0EA 4MR8A 4IGKA 2OZLA 3I2YX 3NM4A 4HD8A 4JEHA 1EM6A 1HR0B 2NU6A 4U2EA 5FUVA 3BCSA 4OK3A 4C4AA 5JAUA 3HR4A 3PEUA 2FSGA 1G18A 3EF3A 5EN4A 3DTTA 1KO5A 2Y05A 4JU8A 4ZEMA 3GEIA 4D9EA 2R2GA 3DHVA 3TPFA 2Z08A 1IJFA 3ZGVA 1O54A 1CIPA 1TCAA 4KXYA 4XQ9A 1GGNA 2C03A 2GJAA 2H2WA 3VH1A 3GZNB 4B75A 2CXOA 2EX1A 4BNVA 6YASA 2AD1A 3I3OA 1KOFA 4BQFA 1XZEA 4GOOD 2C97A 4KGVA 4MINA 3ASYA 5EZ5A 2JD0A 2QQFA 2YY7A 4S2EA 1KIMA 2G77B 4YPOA 4MIOA 5K0FA 1QQ6A 1NU8A 4EDHA 4YC7A 5HKOA 1MOQA 2E37A 3NALA 2N1MA 1OXKB 4AW9A 4BAZA 1T6BY 2OL4A 1MNAA 4Q4JA 4O4IB 1TA4A 2GPYA 2DWPA 2GK6A 2EWWA 3OTHA 2GBGA 5THKA 2JGDA 2HPAA 2I7DA 5JXHA 2NO6A 2VUTA 1TKAA 2G1UA 2N3ZA 2QRPA 2C4WA 3OQ1A 2MOKA 4GWKA 4HJXA 1Q6YA 4QNNA 3ABIA 2O7SA 3DL0A 1WHSB 1I14A 1TUEA 1J99A 2ZE7A 5A3VA 1LF5A 2C77A 3KNZA 1CY7A 4W5HA 5IM4F 3O83A 1L5NA 3JATB 1W4LA 3RKRA 2YMPA 1B8NA 2PVPA 1E8DA 2Q7OE 1OWOA 1DIRA 2WFAA 4DC1A 2QVGA 2QTAA 2ZRQA 2OO3A 4QTYA 4P84A 1EI9A 3VSBA 1KYTA 4D4KA 1K4MA 1Z4IA 1LBSA 2O8CB 3UTDA 4QPDA 3L0PA 4DCSA 1YONA 3GIDA 1J56A 2GCOB 4P3OA 4CGYA 4L6IA 3CTPA 3RRMA 4GKKB 1P1RA 3RYHB 4QEZA 3EA5A 2RG7A 3AG5A 1BWSA 1IHUA 4DIEA 3WIVA 3FOEC 1LVHA 4IGEA 2GEJA 5TPWB 4H60A 1J0EA 1NF8A 2FWMX 3C1UA 2FPLA 3WGKA 4C89A 2VVTA 3OQBA 4HAVA 1MEOA 3AESA 3B3QA 3OEYA 1QU3A 2F9LA 4KGDA 1I6WA 3WYEA 2Q6TA 1KP3A 1X80B 4KDCA 3VH4A 2LKDA 1R8XA 1MC8A 1ZGGA 3LD9A 1VKRA 5AMXA 3AHEA 3EIWA 2RARA 4AF7A 5B6IA 1XQ6A 1DXHA 1E9SA 4S1OA 3OLWA 3TSOA 4EGJA 5DFAA 4Z4EA 4BFXA 3C45A 4L8YA 1J2JA 5H68A 3ZOKA 1A77A 1MABB 3M83A 4H1WA 2IXEA 3NG1A 3KT3A 3A6PC 2A0XA 4ATNA 5AM3A 3LX6A 3MT7A 3RFFA 1Q6ZA 3PXAA 5ILOA 4FLMA 2EHJA 2O52A 1WMFA 1WBJB 2IYOA 3I92A 1L7PA 4HB4A 3AOEC 5DM60 3KHKA 1OAKA 3CF4G 1KYIA 4V3BA 2O5VA 2QYSA 5DCUA 4L27A 3FOAA 3UJBA 1EX1A 2HMWA 4EPWA 3IPAA 5HQJA 3GDWA 3VPAA 4Q4HB 1TK3A 5ALQA 3WLRA 1PNQA 1KQOA 5L51A 4WOBA 3OKAA 1K68A 2F8LA 2QVCA 1JDSA 1YA8A 3ODPA 4ADSG 4XUCA 4Y2PA 4CKXA 3K71B 2RHWA 4P5DA 4GVXA 4KXWA 3F46A 5FI0B 1N92A 3OTIA 3DQZA 1D2HA 4UUBA 1E64A 5DGDA 5F5NA 2I2XB 2ZE5A 3RTAA 4DV6B 4CFYA 1FTYA 2QWXA 2QRZA 2W6PA 2W37A 3AWDA 3MS4A 3TS1A 1NUAA 1SXJC 1SU6A 2BGJA 2NTNA 1WXQA 2HO4A 4M76B 5BQ5A 5SZHB 2XBUA 4DNPA 1U0LA 4IVQA 3ZK9A 3TAUA 5EE0A 5I9NA 2IUEA 4JB3A 1QHEA 2JIBA 2VJAA 3NP9A 1MQ8B 2WK1A 1JEAA 1ODTC 4L7QA 5JARA 1E1NA 2OZVA 4A0HA 3MD0A 4W1QA 1DAPA 4FFBA 3UHAA 4G2TA 4IIYA 1KY4A 1YBVA 1QSGA 5HF5A 4JUFA 1N2JA 1V4BA 2UZ1B 4I2VA 3WX0A 2IVZA 2ADMA 3MOIA 3E1GA 2BFDB 2VP2A 4UVDA 1KJWA 3J81k 2AJ8A 1NUTA 4YRPA 2AA3A 4ARVA 1ACJA 2NLOA 1M8KA 5ITVA 4UQOA 4N48A 2OGSA 4U6SA 2XWSA 3CW2A 2OXIA 4RF5A 3QPUA 1H66A 2RHDA 3QBEA 2Z6VA 4MQFB 4BZQA 4B2LA 3WBBA 4TV8F 3S68A 2GEVA 4BLVA 3LW7A 3BS4A 3R9XB 4UQPA 2B4AA 3A58B 1PL8A 2RMKA 4UATA 5C32A 1RADA 5EXSA 1G21B 4O5OA 4C0LA 2IYXA 3EA4A 2A5YB 4H7EA 4JWKA 3TCXB 1K88A 5DJ5A 5BN4A 1MNQA 4K9PA 1RI3A 3I9MA 2MYNA 4U6NA 4ESHA 2BUAA 3HKDB 1EMDA 2IUYA 4OUKX 5F5LA 3TK1A 2IIBA 5E0OA 5AXCA 5CFNA 3C8HA 5IBRA 3MLBA 2AZDA 4OH1A 1I4EB 1UBLS 3LWDA 1UPBA 5AKEA 1TM3E 4EUEA 4JENA 4X84A 1VRVA 4KI0A 1VGQA 1CNFA 4QLAA 2A5LA 2Q45A 4BMDA 3S7ZA 3PV0A 3PUWA 4I50A 4PZDA 3EVAA 2C59A 3GLGA 4PO8A 2BR4A 2B8JA 1N33B 1H2BA 1W46A 4MR7B 1ULAA 3OO0A 2QAIA 2ZVQX 4X1OA 2W98A 3IE2A 1KEVA 3BFJA 1KEEA 5BOVA 4LF7B 1W0KA 1YR1A 2P2SA 2RGUA 4WCVA 2FPOA 2DECA 4C7KA 3U17A 2RIRA 1Z0DA 2D74A 1D2NA 4G8JA 3DE3X 2QPOA 4RD0A 5HK9A 3PCTA 4L4YA 2ZJ5A 4DGSA 3F90A 3AP1A 3L04A 3HXLA 3URMA 1BQ3A 2JFVA 2PPLA 1UQRA 2C9YA 2WZQA 4RK7A 5IZCA 1GEEA 1W0KD 3P8ZA 1GGKA 1Y6FA 3S44A 1YVPA 3S5JA 1YZ3A 6PFKA 2QR5A 3QRWA 4BNNA 3RGWS 2OCBA 1XG5A 2VTBB 2JZOA 2OGWA 2UKDA 2HTEA 2VL7A 3L1JA 1JKJB 1JUDA 4ALMA 2ZUFA 1N6OA 3QA3E 1JSXA 3PNQA 2BRUC 2WFLB 4OYRA 3QKUA 5KREA 5ER6A 3TG2A 1XKTA 1TB4A 1EEHA 1EKXA 1GRVA 2AR0A 4EIWA 2F17A 2V1XA 3OTQA 5IANA 3HP1A 1E3QA 2OWEA 3H5NA 4J0IA 2AFVA 4AIIA 1R8QA 1D6SA 2B3DA 1GVNB 2JJ2A 2JLAA 2OCLA 2X5XA 2IUUA 2YBEA 4M9RA 4RD2A 3WR5A 4EOGA 1E2MA 2PU7A 3HI4A 1QHYA 2JEYA 4MJLA 3OPYA 4TPKA 3SGLA 1WUYA 3FGPA 2VZ8A 5TMEA 5JC8A 5L4SA 1Q7EA 1C30A 3LA6A 1JVNA 1I1NA 3Q98A 4WY5A 3HTXA 2JJ2D 3R76A 4EQ6A 1W4BA 2IFTA 3C3WA 3OPXA 3WL3A 4X7RA 5JYCA 4KR7A 3FETA 5C8YA 3U4QA 4ZYWA 1YS9A 1YT5A 4NS1A 4G0VA 1U6KA 2O2DA 3K96A 4OHUA 4UKDA 4Z1MA 2FJ0A 1MV8A 3MWDA 3PE4A 1E3TA 4D99A 2H5IA 2VDOB 3GBPA 4DIFA 2FP4B 2ZRKA 3K1JA 3BJMA 1DVRA 4MUYA 2QJFA 1L5HA 1J1UA 3FWHA 3WGJA 4Z1MD 3WGUA 3I8SA 3G9TA 5DMXA 2B5VA 1KIAA 2GHRA 1A76A 1O0SA 4YMUA 1CUBA 2WWGA 3G2MA 5I7VA 2DBVO 5B58T 4XW2A 4WN3A 3EN0A 1DWPA 5ECGC 5BSVA 4JT4A 4OHVA 4C9BA 4TLEA 4JWTA 4OK6A 1A2KC 1GAJA 3KJXA 2P9GA 2OZKA 1OFVA 2NZJA 1GNRA 1KVTA 4X8HA 1V1RA 4PFJA 4E7OA 1UP6A 3PNPA 5C4GB 3BHNA 4MKRA 3O73A 2P9JA 3ZC3A 3WQBA 3ZE6A 2BH2A 1GQQA 4E1BA 4JJGA 3UV7A 1SOMA 2WTAA 5TDHA 2PBRA 3EXFA 3HRHA 3MBIA 3JQBC 2CMFA 4J07A 5F52A 4EARA 4EKIA 3N2NA 1L5VA 4HRYA 3QVSA 4L16A 1SEVA 2R96A 4IJMA 4F4IA 2QTHA 3LDGA 4YLEA 3ZCXA 1Y7IA 2LRHA 2IEIA 3I2HA 3ITKA 1JMYA 1EHIA 3ELWA 1H2AS 5KTKA 1G5IA 2FVXA 1RXUA 2CEKA 2J4CA 1YR9A 3HCAA 3K9GA 3N0WA 3GG2A 4OL9A 1F06A 5UKDA 1FP6A 4NDNE 2RGNC 2XJ4A 3F4BA 2WF9A 4TTRA 2QT1A 3IRUA 3U9TA 4AY3A 4CMIA 2FETA 4KNVA 3HBJA 1RQGA 1AB6A 3AOGA 3QOWA 4D25A 3F3KA 1HLPA 2JIOA 1CJKC 1KI4A 3DMDA 1R0BA 3CZCA 3JZFA 4EA9A 3UPTA 1Z5VA 1EGQA 1EUDA 3GWGA 2RBEA 1UDWA 4R2LA 2GNPA 3JVDA 4JEIA 1NFQA 3ZHQA 2J3KA 2X1VA 1FJGB 1XO1A 2JDIA 1S4MA 1JEQB 2VPZA 2W90A 4LSZA 3THXB 3ANLA 3K0KA 4M6WA 3E6AA 3EWIA 3HGTA 3QLEA 4J0CA 5AKJA 4R0MA 3W5UA 3LDFA 3FHTA 1VE3A 2ST1A 3C14C 2H7XA 3FR7A 2DY0A 2JNWA 2JDID 2FSVA 4O4JF 2XQFA 3BGWA 4ZDIA 4N39A 3OPQA 1UFQA 1N9GB 4N8EA 2WTMA 1E4EA 2R60A 4WY8A 1KQ3A 1ZCAA 1T6XA 1TGVA 4WBNB 2D06A 3AH8A 1QKJA 5K6AC 3ZHUA 1KU6A 1WVIA 1KBZA 4X8LA 5D85A 2HR1A 2A9VA 4KRFA 4JLWA 1T2DA 1XQYA 1HKUA 1H2FA 1TC1A 2GJKA 2JC3A 2ZJ7A 4L8WB 1P7YA 1U4OA 4PRYA 5CK4A 1TZJA 1U3FA 1DPGA 4JQOA 1MAWA 3ROMA 2NUPA 3F73A 1HSZA 3G5AA 2VHJA 5MGNA 4EJ0A 4ZI3A 3TLGB 4DIKA 1DX4A 2HDNB 1GV0A 4RY0A 5CLHA 5A7GA 4B83A 1NUHA 3DLTA 2Z5VA 1FLNA 1SKAA 4FKMA 3V1KA 4DIMA 4MYCA 5KTYA 3NYWA 4ZT3A 3NBQA 2QTVA 1U04A 3CLKA 1A8IA 4OXQA 2Z5GA 1OLUA 1CVRA 2H2AA 4IF4A 2QZ4A 4JDUA 2WJYA 1Y8ZA 1L0BA 4OQPA 1ANKA 4KXNA 1M83A 1MLDA 3IH5A 5DM4A 2Q1WA 1ZD4A 2E48A 2QIPA 3B7WA 3LY7A 1EH5A 4ZAXA 4WECA 1QKKA 4A6DA 1JHUA 3VV2A 2VQEB 1R9NA 2ZRPA 4D4HA 2DH6A 4R84A 4XVQA 2H08A 3IJ5A 1N2XA 5FEMA 4X71A 2DP4E 1QJCA 3R2JA 5C3MA 1OYWA 1T35A 2I87A 1AUOA 2W6OA 3QVKA 1U5BA 1GY8A 3BE8A 1WUIS 2EARA 4HS9A 3W5DA 3IXLA 2R00C 3IMGA 3G2QA 1PUIA 1YGPA 1QRTA 1T9DA 3QF4B 2HA0A 2BKUA 3VGJA 4RZXA 1ULHA 2SKCA 1HTBA 4L0QA 4AL4A 4BQSA 3QFSA 2VDQB 1V45E 3T1QA 5LQDA 2LE0A 3K2IA 2MSEB 1G21E 2V0CA 5FWDA 1Y1TA 4WJLA 2E21A 4DSOA 5B7PA 2OY0A 2ZAIA 1WSBA 1VLZA 2C98A 1ECLA 1JHXA 2NPOA 3DULA 2EFCB 3Q3EA 1H22A 1Z6YA 2Q6IA 3EEBA 3H2JA 4L5IA 4DYVA 4HLUC 5LP6A 4IKOA 4P7KA 2G1KA 2JGLA 1TCUA 3ZD7A 1PSWA 1FNDA 1NJSA 2HCFA 2PQ0A 4WIAA 3VH2A 3G6KA 1BMQA 1JBKA 5GGXA 3P9QA 1IVSA 3ELBA 2JEOA 3FMPB 3QEMB 4LBVA 4OX9B 1JHDA 1T9KA 1UC5B 3SX0A 4B17A 4WADA 4KO8A 4ZO8A 1E2QA 3ONWA 5IXJA 4MVJE 1SUWA 1NPDA 2QUBA 5A3SA 1K4KA 1M8PA 5CLLA 1KRWA 4Q82A 4KVAA 1MDFA 2G28A 2OO7A 3Q15C 1JAHA 1CT9A 1JDUA 1KKMA 1EZ4A 3LUCA 4D8YA 3Q7QA 3QOFA 4HQNA 5KKCA 5G41A 1HMYA 2LCQA 2ZIEA 3T7RA 2QZJA 3UCXA 3B9RA 1NVUQ 1RABA 3PX7A 1UZLA 4IKPA 3X44A 3LL4A 1RXCA 2ZOSA 4PQRA 3RHTA 4LDNA 1UWCA 4Q3OA 4HNUA 3MS7A 1PTKA 4QXAA 3CSUA 4Z8XA 4W9RA 3PGVA 4CIAA 1E20A 1UXIA 5EXTA 3GRKA 3WKAA 4R83A 5E1BA 2YDXA 2BMFA 3CPJB 3DFUA 1IQUA 2H11A 4K26A 5DYYA 3GGJA 3AJ8A 2FWJA 3MFYA 5JQGB 1JQKA 4FEGA 2V3VA 2Z43A 3ZDFA 2R85A 5T8KC 1VG9B 5KMGA 4ZVLA 9LDTA 1DX9A 3MLEA 2I2DA 1WOYA 3DV9A 1GL6A 3FDIA 3JQ7B 4GSKA 4P4UA 3G82C 3HYNA 2CMGA 1MVOA 1BWRA 2V5UA 4R1TA 1YQTA 3DAFA 4Y9TA 1AU9A 2PUCA 3ITNA 4BY9E 2A86A 1FVOA 1QZZA 1ZGJA 2QLJA 3GLTA 1CE8A 5EIBC 3HS3A 1FIUA 4GOLD 1CF4A 2BEUB 2ERYA 5CB4B 2YS6A 3ZHRA 5IABA 5L4LA 5HP4A 3BRSA 3BT7A 3EZFA 1JQLB 4NZYA 4CG1A 5A4FS 1MFPA 2AR7A 2PO7A 3D3KA 3H6KA 1JPNA 4IW3B 1RLTA 2VJQA 5JAQA 3CNQS 4FSXA 2AX4A 3VZCA 2XGJA 2ANBA 1QO0A 1XTIA 3SIXA 4Z3KA 3HJTA 3I5UA 4NCIA 1MKYA 3ROZA 4XLZA 1D0SA 4UBMA 4OHWA 1RC8A 3WGNA 1UPTA 3UUGA 1L1EA 2YHUA 3CISA 2KQUA 1FMFA 3WIUA 2ZYGA 1KF0A 1P7VA 1EA7A 2WWFA 1QO0D 4X91A 1E3EA 4LQLA 2PSDA 5KDDA 1VHJA 3TTVA 1G16A 2PBLA 1LGYA 2H51A 2WD9A 1JFFA 2HF7A 4RPCA 2YZ7A 2Q3FA 4G86A 5EHXA 2O8FA 3FWKA 1NAHA 1YL7A 3WVNA 5BVGB 2XZLA 5ALPA 1H6BA 3G23A 1SVMA 5EZSA 3VVCA 1KOGA 3X2SA 2VCYA 3IVXA 3KUKA 4J0KA 4ZZ0A 2Y1LA 2Y1KA 3HA7A 4X92A 3BIFA 5G0WA 4OQMA 5BYKA 4M0KA 4XX0A 5ALKA 2F8SA 4BQEA 2A84A 3OQ6A 4IGFA 4RK4A 4WKOA 4ZI7B 3I34X 3BSYA 5IJ9B 2ZSFA 3BXEA 1IVNA 3MOGA 4FZJA 3WGTA 2VLIA 1A5TA 3WDSA 1U4SA 1PVVA 4CUKA 1NXSA 4EUSA 1TM7E 5KQPA 4Y3UA 5DK6A 3RTCA 2AJDA 5ARCA 1ODFA 2J6CA 5FL3A 2B30A 4Y2XA 3E3AA 3P96A 5TC4A 4MPDA 4XGRA 1SVOA 2Q2WA 4PTLA 2PZAA 4W6ZA 5FPTA 4FQ7A 1U3DA 2DUMA 3IR7A 1SB8A 4OAOA 3WI7A 4KU4A 4FD3A 4FYKA 4F72A 2FK7A 1HV8A 4WINA 5FTWA 3S1LA 1E69A 1M67A 1DEAA 2O7QA 2Q0HA 3GD5A 4AULA 5EJ9A 3CNBA 3H05A 5AI5A 1L5FA 2Z95A 1NJ1A 3R7NA 5AT1A 2AMVA 2CLLB 3PUHA 4K03A 4ALLA 2A1TS 3GCXA 4E94A 5F3RA 5JWOA 2XEXA 2PUBA 2FCAA 4YONB 6Q21A 4L4UA 2YWRA 3IQXA 3LWNA 3PXGA 4RJ2A 1XZPA 4ZJUA 4JI2B 2B4KA 4DLRA 4GKAA 4U63A 4KFUA 4UU8A 2G9QA 1SCUB 1OH5A 4JC4A 5ITZB 1DINA 3NGXA 4KYVA 3FHJA 3LXRA 5DNVA 1XZKA 4HRXA 3OLCX 3AVVA 4QQNA 4RJLA 5DW3A 3E9DA 2PQMA 3L93A 4PPNA 1GFIA 4JVOA 2OFPA 2X1HA 1P61B 3ZEAA 1CUYA 3JVVA 1YDEA 4MKIA 2RHHA 5CVVA 3SDSA 2HIAA 3B9BA 5CURA 2ZE6A 4GX2A 3RFXA 1GEGA 3ENZA 3S29A 2BONA 1TM4E 2V7PA 4LYYA 3P45A 3TZQA 3RG8A 1AGXA 1W1IA 3F7MA 4OP3A 3W5IA 3C6KA 1YVUA 4DR2B 1CDDA 1FF9A 2KPOA 4CPDA 4R7GA 3M82A 3T3NA 2LIPA 2ZQZA 1I3NA 1A8SA 4CUJA 2PKRA 3L43A 3L7OA 3EQZA 1K5DA 1EB8A 4RXMA 3W1WA 2UV8A 3IEIA 4MVJF 2QP4A 2TRSB 3UENA 4Q7LA 1U2DA 2JI7A 3CSSA 3UFXB 2DSNA 5JZBA 4KN5A 3JQFA 1DKOA 4GL2A 4EMUA 2VPTA 2PD3A 2IOQA 3SJZA 3CPHA 4GOND 1BHQ1 3NAZA 1R8JA 2QZPA 2G04A 3HCBA 2OCGA 4ZDWA 2BCGY 1E77A 2DC1A 3N2YA 4MS4B 2IRWA 1ZH2A 2Z5LA 4E5UA 3LE8A 4I5GA 1M0EA 3UJ3X 5A0VA 1BCRB 1UBRS 1RPTA 2XMRA 1HRDA 3ENKA 2WWVD 4ZA2A 4RNDB 1PV4A 4RS4A 3H11B 4FYYA 4W9NC 1D7AA 3KCQA 1VSVA 2WAAA 1WDKA 3GMSA 2DPMA 4LMBA 3N2KB 4R2WA 3IPLA 2DTXA 3VPHA 4BNMA 4EKDA 3LBNA 1XD2A 4W63A 3U09A 2MTBA 2P91A 1NA5A 3N0RA 1PR1A 5JU6A 4Z7JA 3TMKA 5CDGA 3KSRA 4BLSA 2IHTA 2I3GA 1GPKA 4IBOA 1H0RA 3JALA 3AVUA 2R4UA 1TQHA 4UU0A 3WB0A 1KORA 4IGAA 4D3DA 4YRFA 1XLVA 4AWBA 4F3YA 1OWLA 4D0LB 4MWGA 2P75A 5FI3A 3EF0A 2QP3A 3G79A 1AO0A 2P3OA 4ZK6A 2OWDA 4U7FA 1HE1C 2BFEB 4EHHA 1C1YA 1GGFA 2A4MA 3DMYA 3P0JA 5TPZA 1WBBA 1BE1A 2CXUA 4US2R 2AL7A 3PRKE 1V7PC 1XU7A 4KRYA 4Q7EA 4YP1A 5PNTA 4PSUA 1DWOA 5BWOA 2OCIA 3HSYA 5AXAA 1HOXA 1H6CA 1PFVA 4WDRA 2QTBA 2IVFA 1R4NA 3B1VA 4F7DA 3SF0A 5JNSA 5EPEA 5AVVA 3DCJA 4LA4A 1WQ4A 4U2CA 5KOIA 2FN9A 3E4CA 4AZVA 3KQSA 1F0KA 3O2QB 4CF7A 1CTQA 2F4NA 2J5BA 3L9WA 1NI3A 3L0ZA 4RTKA 1WVGA 4WA7A 1N2BA 4Z99A 1WSAA 4ZVPA 3Q87B 4K9OA 5AVJA 3ROXA 2EZ9A 3J81A 3NKVA 1G17A 4ZVUA 2QN8A 3HNPA 2QM8A 4IZ6A 3WV4A 4F3KA 2OQVA 3ZGOA 3H5LA 1P17A 1OZFA 3AZQA 3LM8A 3B1WA 5DCYA 3RVPA 1U8TA 1NVTA 2PEYA 1IE3A 1X7ZB 2H16A 1SUBA 5E6UB 1Q83A 4I4TF 1B1AA 2YXBA 4X7PA 3QPVA 3CUKA 1EFTA 1ISHA 4QYIB 5A9SB 1G59A 4ZQBA 3KQTA 3TL3A 2AN3A 1YHZA 2IIQA 1UM9A 3G2LA 4O4LA 1YR8A 4TQGA 4DPMA 2VF7A 4OI2A 1M1ZA 4ND4A 3M9LA 1PS8A 1JJ7A 4ZCPA 5F3DA 1E1CB 1R5JA 2RHCA 3G7SA 4TLMB 1DCTA 2GZHA 4KX5A 3COPA 3AEYA 3B5JA 5AOCA 3W5JA 3DT9A 3UYLA 2QENA 1CCWA 1WM1A 3CRRA 1AQYA 2YV3A 4LOJA 1DOAA 5ED0A 3SJCA 3WMXA 4ZHQF 4EJ2A 5KQGA 2L42A 4NNOA 1CW2B 4B3CA 5EWJB 3L7DA 1CUCA 1DBQA 2VRWA 3KU4A 1JDTA 1TCVA 4JA0A 4AM8A 3UN1A 1W5SA 1T5OA 2AZ4A 3NHFA 1BA2A 1WKCA 4LRTB 2TS1A 1SBNE 1K7EB 1N2OA 4N0EA 4WVLA 2XMSA 5EIFA 2D54A 1A0OA 3SY8A 1V8BA 3E22B 1EK5A 4AVYA 1YK0A 3LT5A 5C81A 1ZVVA 3KTAA 5LOVF 4G1EB 4DBLE 3QUSA 2HIHA 2PU5A 2FP3A 4YJ3F 3Q8MA 2FUCA 4P2GA 2NXJA 4S1WA 4QGFA 1EQAA 1KZYC 1C3EA 3LOQA 4KWEA 2YJ5A 4E4TA 5E2AA 1N2CE 1YE3A 5EJGA 3EIUA 4PV7A 3T9FA 4LF4B 2LCFA 1AHPA 2JIQA 5JALA 1PX2A 1HM5A 1G64A 1F2UA 3R6DA 3LSYA 1F4PA 4FE3A 4XQGA 2BZGA 4BV9A 2CHVA 2JAXA 4FYXA 1W34A 3WSVA 3PHBE 1K6IA 4EKNB 4GQIA 4H18A 2AFRA 2DWCA 4R05A 3E48A 2I2FA 4NPAA 2JFPA 4RXUA 5E4FA 1KR5A 4FOPA 1MB9A 3FMGA 1RYMA 2FEXA 3G3EA 5TR9A 4ARIA 4QPPA 3PTLA 2JARA 3T5PA 1JHMA 1HT3A 3TUZC 3LJKA 2NU9A 2R6R1 4HH3C 5TIIA 3KX2A 5AKIA 1CF2O 2YZKA 4U7GA 3M2PA 5E9WA 1TD1A 1H3NA 3CKMA 3CO5A 3L4JA 3DWFA 1ZG3A 9GPBA 4GOJA 2YASA 2CCGA 3M1IA 3RHSA 4B35A 1W36B 2DR2A 3TLBA 3WLIA 3B1KA 3AW9A 3UGJA 1H69A 2YFKA 3F49S 2ZRIA 3NH9A 1TUIA 1V2GA 4PHCA 4MH0R 4WXHA 4CODB 4HNAB 1JKMA 3DKKA 2ZFUA 1VL1A 3AETA 2XVXA 4EK9A 4ZAWA 3PXDA 3PKJA 1C0LA 3WL4A 1HLDA 4AUNA 3B7PA 5DYWA 5KX5A 3A1NA 1L5KA 1A50B 1CUZA 4NZMA 3WAJA 2XMBA 2C3MA 3GO4A 3RYTC 5BR1A 1O9HA 5ICCA 1Y8AA 5KNDA 4KMRA 2H0RA 1OFHA 4D8TA 5HS4A 4KPFC 3ZWPA 1C41A 2JLYA 2W6MA 4D4LA 3ADBA 4BO2A 3FOFC 1QG2A 2ODQA 2ZANA 3JYNA 3TOXA 1HE4A 1I7NA 4Q03A 1H2RS 2H1HA 5C8DA 5BN3A 1WZ2A 1NN0A 4NAHA 4MWZA 5CXUA 1Z6PA 3FUWA 4NQZA 5KNDD 3WOHA 1N9KA 1JHRA 3F7TA 5CUQA 5FBHA 1TTQB 2ZAGA 3ABQB 4E2YA 1SBCA 5AW5A 2WA2A 5IW8A 2NADA 5DWQA 1QHXA 3P5BA 4F4UA 3H5RA 3N7TA 1UXJA 4EY4A 4MITA 3WWCA 1E2IA 1JJAA 1UBGA 1ULUA 2VNKA 4PG7A 4LCJA 4ENUA 5WRFA 1SELA 3M3HA 1WTCA 2UYQA 1LDMA 2QT9A 2EATA 3IIIA 1M8JA 4LI3X 4E2FA 1K2WA 2WYHA 2FRVA 1UBNA 4IRMA 4M37A 1PAUA 1XZIA 3VDMA 4BX2A 5JAHA 1ZY2A 4IIHA 5L8VA 4HDRB 5JE8A 4XOIA 4F84A 4ZZ3A 2R7MA 2CNDA 2WU1A 2CJXA 1TF7A 4DV0B 1XELA 4REQB 4TXMA 4WL0A 3PJGA 1XK7A 3CO0S 3NDRA 1NIPA 3H83A 3QFCA 2J87A 4FZVA 1RXVA 1WHTA 4RVHA 1P9WA 1F8UA 2HEIA 3K53A 4B4UA 4BMXA 2FRXA 1KYXA 1MRSA 2QRQA 2GPJA 3OKFA 1T0UA 2OMKA 1K9SA 1FFSA 4QBIA 4A7PA 4YR9A 1XMIA 4ZAFA 1LBHA 1TGYA 4FEEA 1W9MA 3AXSA 3DKPA 3FYSA 3TH5A 5SYNA 2R8BA 4DNFA 2RHRA 3T4EA 4MVJG 4Q1AA 3DHYA 4FP9A 3NS7A 3AVWA 1KI1A 2V3WA 4K8RB 4LWPA 4J3JA 1XDWA 3OECA 5JBNA 1PG2A 1MJNA 2DWUA 3BN3A 4GMFA 1FQWA 2VSNA 3EUEA 2OR3A 3C3JA 3RG2A 1DO2A 1UC9A 2P77A 2LVBA 4NOMA 3T54A 2Q46A 3ZHXA 1SOUA 2FEKA 3CCBA 3RHFA 5ALNA 1A7JA 2FF5A 2G25A 2YIDA 5T57A 4B7XA 2FZWA 4TMWA 3W9YA 3ZY3A 2XUAA 3KEOA 2BKLA 4XLTA 2OAEA 3K72B 2I33A 2ZR9A 4F3TA 1QGYA 2F1RA 3DE6X 5JSKA 1NPTO 4JB2A 4RAOA 1YDHA 3TTWA 3B53X 4HQ0A 3DF7A 5FUXA 2W2MA 3DZHA 2MCFA 1LSUA 3DXXA 3GUCA 3UKOA 4FJ1A 3T1HB 2GHQA 1CUHA 2KM1A 1R16A 3H84A 2VPIA 3HNOA 4PG5A 4REOA 5AFSA 5E3HA 4YRNA 1EWVA 3NKLA 1T5BA 3KTOA 1JHYA 4OU5A 5ERGB 3BGSA 2OVFA 3B2EA 4JLOA 3GRFA 3FPSA 1TK2A 4K3VA 1JECA 2F62A 3BD6A 3D2CA 5BSEA 3GLIB 2CVQA 3SJUA 3SICE 4B8WA 2R47A 1A8UA 1FYVA 1LPOA 1P5HA 3S2GA 3TG8A 1S9HA 3RRBA 3NEAA 1YULA 3O3OB 3TSAA 4DWJA 1QAQA 1Y1QA 4GBED 4ZQEA 2EFGA 3TLEA 1SXGA 3WHPA 2WSYB 2FDRA 3WMRA 2QRGA 4D57A 2YQ5A 1ETUA 2CFSA 2OHFA 3PUZA 4NJOA 1QIMA 4WCFA 2Y8EA 1F6DA 4MQEA 2PZEA 2PV0A 2OZLB 3JQ9C 2N0SA 2PH3A 4TYPA 5K99A 5BXQC 1J5EB 4R9UC 4HDOB 2NU6B 5LYYA 2G63A 2P4QA 4Z2AA 4G4SO 5G4KA 1JMVA 2RI0A 3II6X 2IPMA 5AJUA 2PMEA 1I2DA 4K40A 3CLUD 3GJ3A 3GFFA 4B74A 1Q0QA 4LOHA 4XJXA 3CG4A 5H83A 2AOUA 3L6RA 2HA2A 4M1TA 4EHDA 1E62A 2VT7A 2APJA 2DPYA 3I45A 4RF4A 5GZ3A 1K5HA 3INNA 5KINB 3W6UA 4ZC1A 2QD2A 1IEVA 2WG0A 4RZUA 2HSEA 2BEVB 2YWDA 5D1NA 2YQ4A 1EUYA 1L3IA 5B58C 2PY6A 3M3DA 3UANA 3ZDCA 3WBKA 1FUEA 3DWIA 3PVSA 4AP6A 2F7SA 2H52A 3JWGA 3TLKA 2OZEA 1ECBA 1V5GA 2CXSA 2ZRHA 4XH9B 4CM1A 2QG6A 3HH8A 1Y0BA 5KI6A 4FFMA 3VR5H 3TSCA 2CUTA 2WOJA 3GV0A 1S2OA 2I7CA 4H3HB 4GLJA 1V5EA 1DV2A 1UM8A 3P9SA 3R23A 4YRDA 4Q4JB 5FP0A 3U62A 5FT9A 1MB2A 2JIZA 2JGDB 3MA0A 4WK4B 3TW8A 4CNBA 2QXYA 2ZUBA 2VS1A 4TS1A 5LP1A 4UBLA 1ML3A 3FX2A 3ZCQA 4ENTA 2B1GA 2ZZNA 4IJ5A 1VJRA 4OATA 3MJFA 5C34B 4P92A 4M8SA 3A0UA 5CDTA 1P77A 2JIZD 2E55A 4G5FA 3FOBA 3HLKA 5C3UA 5EMHA 1W5BA 5HFAA 4N3NA 3P9ZA 2EG9A 5GZ1A 2Y27A 1H65A 3JWPA 3GLFE 3BXZA 3LGXA 2C20A 4G01B 1NX9A 5TEVA 2A9KA 3WBJA 4DMUB 4DSZA 2C7GA 2FKNA 3A2LA 3D6NB 3MAAC 3N7AA 2B4TO 3BXHA 3ZZ1A 1NXWA 3OQHA 3H3JA 1WUJS 3HJAA 2EFEB 3T61A 1MU0A 1L5WA 2MSDB 4TV9F 4HB2A 2MT9A 1NN1A 4ZVRA 1JG7A 1H4VB 5B3LA 4GMGA 1D1TA 4AKHA 3O84A 4LJ7A 1XGKA 5EEGA 2PGDA 1NBMA 3CIOA 5DHUA 3RO7A 4B7CA 3HLYA 1J39A 3NDJA 3EXHC 5CH3A 5EE9A 4Z53A 3ZZ0A 2NTEA 7YASA 3AESB 1LNZA 2JCYA 3PKZA 3UVEA 3C8DA 3CB4A 5C2JB 2D1FA 4TZ0A 3GUZA 2YMQA 4J2HA 2EFYA 1Z5GA 3HZHA 1NBMD 4JOCA 3WLKX 2PMKA 5JISA 2VDWA 4R1MA 5DLPA 4V24A 4C4OA 3TDNA 1HEIA 4Q3KA 3ZGYA 3GA7A 5EXXA 3T0GA 1WL8A 1QV6A 5EE3A 4RHTA 3OP1A 2HGSA 3ZI0A 4MV4A 1UDCA 2VTEA 4A8PA 1ATIA 1GNVA 4JSRA 2OGTA 3RSLA 4C3VA 5KDOA 3UJ9A 4KWHA 5LLTA 2FFAA 1OIVA 2VNAA 3TTTA 1PGPA 3A31A 3CLRC 3F2IA 3ANNA 3Q5DA 3TNFA 4KLRA 4MMXB 3DAHA 3GUYA 3TZCA 3QEAZ 5TS3A 1SHTX 3WL5A 6LDHA 3KQUA 2BUBA 3PWTA 5JT1A 2XXAA 5G0TA 1ZH8A 2CT8A 4RYLA 1CHNA 4FGJA 3KZNA 3LIPA 2Q5OA 1QCYA 2H1IA 3BTSA 4KXQA 1RFGE 1TVKB 5GGYA 3VJMA 4BRSA 1PW7A 4MRRA 3UJCA 3RC8A 2HRQA 2C8VA 1TT5A 1E5VA 1SXJE 3OQVA 2A33A 1IEQA 3AB8A 4P31A 3B1XA 2HX1A 4S2UA 2V0NA 1N3LA 3I0MA 4POAA 3GFGA 4MTLA 4DZZA 1MOZA 4DB4A 1UODA 1PZFA 2O1XA 5EIHA 5A4MS 2I2AA 2ZBRA 3DW1X 2CE2X 3JZAA 2VAPA 3NPAA 4AZ0B 3I6MA 4CCYA 3WNBA 2RCNA 2XGGA 3UC5A 2IW1A 4BMZA 4BDSA 4X62B 3KETA 1SCJA 4EG0A 1I3MA 2I9PA 2ONCA 5CPBA 1QG4A 5I7SA 5JCZA 4I36A 5KQMA 3MB8A 5G0SA 1S8OA 4NBSA 4IKEA 2C8KA 1P0MA 3H4TA 3R3JA 3NT4A 4AO8A 1A7AA 3ZE1B 4AP9A 3AIKA 1NRXA 5CTJA 3UAYA 2MSNA 4JQCA 4MYUA 4EJSC 4MLZA 2XGOA 4N5LA 1EP3B 1ACLA 2XNJA 3IILA 3IERA 1A98A 4TTIA 3WLNA 3DT6A 4J0DA 5EZQA 4J0QA 3JQDA 1J0XO 3NC1C 3UAZA 3LPCA 1N7IA 1Z16A 3BJIC 3MTEA 2C4HA 4Z0NA 3AKCA 1W4CA 1ZNXA 4GR4A 2FQWA 4FN4A 4DZTA 5KVAA 1GPLA 2OUKA 2J5RA 2GLTA 3OLXA 3PUVA 1IL0A 6NULA 2VBIA 1GSHA 1JT9A 1R4MA 2O8BB 2QJOA 3DZCA 3LCCA 4YRJA 4B09A 4DLZA 4HYQA 2BJWA 1QCZA 1MG5A 4FYHA 5B3JC 3ZJTA 2VP0A 4WNCA 3MGBA 2G06A 3AONB 5KYTA 3BGIA 4RH3A 3ROPA 3TUIC 3WDLA 4Y30A 5ADUS 2HSWA 3DDOA 4YCSA 1TIBA 1VMEA 2HK7A 4MGHA 3BCUA 4ENRA 5DI3A 1SC3A 7REQA 2WIDA 5TMBA 3F3SA 3PR1A 3TDMA 1R0WA 1HQCA 2JBHA 1J2UA 3ICQB 3DLBA 4TZKA 1Q0RA 1CD5A 1UJMA 3LUAA 3K8YA 3IRVA 1FSZA 5BT9A 4BWFB 1E89A 3DFIA 3M0EA 3NHLA 2YXLA 4I50B 1MPTA 1TYDE 4S04A 4L0CA 5EHIA 4AX4A 3L7LA 3CLHA 3LZCA 2Q4EA 5JO9A 4RDIA 3ECAA 4YASA 3IL2A 3G9QA 1E0SA 4FHEA 5BNWA 1GGHA 1C4OA 4R3WA 2ODEA 1Y82A 4LOIA 1SK8A 3DEIA 3SBOA 4B3JA 3HN7A 3L8EA 2W22A 1KEEB 5BW5A 5LYJF 4F4HA 3INTA 4MS3A 3N0VA 3ZGNA 3NAQA 2O2YA 4N6GA 4QWWA 3QPDA 4P2BA 3DYBA 3AHFA 5AHKA 2XRZA 1JB1A 4HEQA 3FTNA 4M8KA 4L8VA 3ESCA 4ROSA 3R8CA 3S8EA 3EX7C 2NYVA 1E6MA 1M2OA 1R64A 2Z8YM 3KK0A 4A6PA 5GMOA 4B0PA 2OGZA 1U0HC 2HSGA 2AZXA 1COWA 4IJUA 4JOSA 4BVBA 2MR5A 4HMPA 4AXBA 3GLIE 3GJXC 1IG3A 3IB3A 3M4JA 4HX9A 2IZZA 4TMXA 4V39A 5J5CA 3OFNA 3SJ7A 1M1UA 2WTEA 1AXEA 2QQ0A 4LVOA 4C0QC 3C6MA 3U7IA 1Z25A 1COWD 3C3AA 4FYVA 4IDOA 5DYGA 3AY3A 5LB4A 4M0LA 1E9VA 1ADYA 1CDEA 4GOKA 4W7IA 2DETA 3LDHA 3L92A 3OFND 3REQA 2WHQA 4AAYA 1NNI1 1L9XA 1GSIA 1WW3A 1EWRA 1UMDA 3GEHA