2X4DA

Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
270
structure length
270
Chain Sequence
SMAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESAASRAELVGQLQRLGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYAATSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PHOSPHOLYSINE PHOSPHOHISTIDINE INORGANIC PYROPHOSPHATE PHOSP
publication title Crystal Structure of Human Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase Lhpp
rcsb
source organism Homo sapiens
total genus 89
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2x4dA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2x4dA02
4UMEA 3E58A 2WFAA 1O08A 2ZBGA 2WF7A 4B6JA 1NNLA 2C88A 3L8HA 2IOFA 3R9KA 3WKCA 3WGUA 5AW5A 2Q4TA 4KNWA 1ZRNA 4OD0A 2WHEA 3DDHA 3ZUPA 2WF6A 5JJBA 2FUEA 3WK7A 3KDPA 3KOOA 2HF7A 4Y2PA 3WGVA 3ZTYA 4KNVA 4NV0A 4YIKA 3SKXA 4HYTA 1N9KA 2IYEA 3U7EB 2HX1A 3BA6A 2OBBA 3WK8A 1S8OA 3R4CA 5A3RA 1SWVA 2G1AA 3L8FA 4FFDA 2GHQA 5AI5A 3W5BA 1L6RA 1J97A 3RFUA 2I55A 3B8EA 4L6AA 3ED5A 3OCYA 5ALUA 2FPXA 3WK9A 5ALTA 2FPSA 4YH1A 1Z5UA 1EK1A 1WZCA 3DV9A 2ZXEA 2DQSA 3L0BA 3SF0A 2HOQA 2EAUA 3HLTA 3QU9A 5AW0A 3OCZA 1YMQA 4BYGA 3QUCA 4L57A 5AW7A 1RMYA 2I7DA 4HGQA 5AW6A 2HCFA 2B1QA 3RF6A 2P11A 3QUQA 2W4MA 4UAUA 3OCXA 1ZD4A 3EPRA 3IB6A 4HGNA 1J8DA 3ESQA 3NANA 4ZEVA 2G06A 2EATA 3P96A 3KZXA 1MH9A 3L0CA 3EF1A 2NO5A 5AM5A 3CNHA 3MC1A 1TA0A 5AI9A 4EELA 3ZU6A 3UMCA 4BX2A 2YJ6A 5ALPA 2I54A 4QJBA 4GXTA 1RLTA 3SHQA 3OPXA 5A3QA 3OCVA 2BY4A 1X42A 2RAVA 3U19A 2ODAA 3ZWKA 1XVIA 2FUCA 3D6JA 4PNHA 5AM3A 2JAOA 3N07A 4XPZA 1Z4QA 2G07A 1RQLA 5AKXA 1XPJA 3A1CA 4HGRA 5IT0A 2JARA 2P9JA 2Q4RA 1K1EA 2RB5A 2B8JA 1QQ5A 4MUMA 2CFSA 2VKQA 5ALXA 1Z4LA 3AR5A 2RBKA 2JAUA 3N5KA 5AI8A 4C4TA 4CNQA 1Y8AA 5AICA 3NAMA 2IOHA 3UM9A 4CF3A 2C9MA 2QLTA 3K1ZA 5FP0A 1Z4PX 4QQFA 2OM6A 1RMQA 1NF2A 3FVVA 3ZX4A 1L7PA 4C4RA 5AK5A 2B8EA 4Y2XA 5ALWA 4XOUA 1RKUA 2HDOA 1YNSA 3AR4A 2HF2A 4YIHA 3ESRA 3AR9A 3B9BA 1SU4A 1Z5GA 4O8CA 4NABA 4Y2QA 2B30A 1AQ6A 5AK4A 3U7FB 1FEZA 2ZOSA 3FPBA 1Z4OA 1U2TA 3IRUA 3PGVA 1N8NA 4Y2RA 5AM1A 5AW1A 3QU7A 1LTQA 3ET4A 4HGPA 4OCZA 3AR2A 1TE2A 2C8LA 2JGAA 3R09A 2R8EA 4G9BA 5ALJA 2G09A 5AI4A 1L7OA 4HGOA 3L0YA 4EZEA 3I6BA 1CQZA 3EWIA 5ALYA 2BDEA 2MSNA 4J03A 1RC8A 3L8GA 5AW2A 5AESA 5AI6A 5ALSA 3ZTWA 2PR7A 5AM2A 1QH9A 2EARA 3SKYA 2C8KA 1O03A 2G0AA 3ZVLA 4KX5A 4DWOA 5ALVA 3S6JA 3B9RA 1U7OA 1L8LA 4BBJA 3I76A 2AMYA 4CF4A 3FM9A 3SD7A 1T9ZA 1Z4KA 5AW4A 4RETA 5AI0A 2ZBEA 4UATA 3OCWA 3E84A 4CE6A 2WM8A 3WKAA 3I28A 3ZI4A 1F5SA 4BNDB 5AK6A 3L1VA 3WKEA 2YN4A 5T41A 1TJ3A 3KBBA 5ALRA 3KC2A 3MN1A 4YCLA 4XE5A 3NRJA 4ZEXA 4NFLA 3L1UA 2JAWA 2R8ZA 1SWWA 3TLMA 3N1UA 1Z4IA 3UMGA 2CFTA 4HAIA 3FZQA 2HSZA 4GIBA 2YJ3A 1QQ6A 2PQ0A 3E8MA 2FPUA 4EX6A 5AVTA 4OFZA 4FE3A 4NAVA 1Q92A 2YFYA 3VAYA 4UU1A 4KN8A 1YJ5A 1U7PA 5ALGA 5ALFA 4G63A 2IOFK 4Y2UA 1YS9A 3NIWA 1Z4NA 4BEWA 2I33A 5AVZA 1QQ7A 4EENA 3EF0A 3PDWA 2O9JA 5AHXA 2R8XA 3A1EA 2X4DA 5ALOA 1TJ5A 2P69A 2P27A 4BX0A 1VFPA 4F72A 2I6XA 2Q5EA 3QXGA 3OCUA 4JB3A 3AR7A 5E0OA 1XP5A 1RDFA 2ZBFA 4EX7A 2WF5A 4Y3UA 2GHTA 3N8GA 1CR6A 2PKEA 5AKZA 2YY6A 3QYPA 2BDUA 1EK2A 4Y2VA 2NO4A 1ZRMA 5ALQA 4JDPA 3DAOA 3U13A 5AVXA 1RPZA 3I1YA 3IJ5A 3M1YA 4UM5A 2HO4A 1PW5A 4BNDA 4DFDA 5ALKA 2YJ5A 3W5AA 1L7MA 1ZD3A 2O2XA 2MU1A 3QX7A 4Y2TA 4IFTA 1WVIA 2CN1A 4AS3A 2YMLA 5AW3A 1T5TA 4UMDA 1YDFA 5AKGA 1ZJJA 5AW9A 4BKMA 3QLEA 2GMWA 1Z4JA 5AM0A 3QU4A 3L8EA 4KYTA 4UW9A 3SLRA 2GO7A 2R8YA 1ZS9A 3L7YA 4YCMA 5AVUA 4E88A 4UAVA 2B0CA 3QGMA 5ALZA 5AKEA 1RMTA 5AKYA 3QNMA 3WKDA 3ZX5A 4UU0A 1RLOA 3KD3A 1QYIA 1U02A 3PCTA 3OTQA 3WK5A 4F71A 1Q91A 4BX3A 1T5SA 1L7NA 1TJ4A 4XQ0A 5AKHA 5AIBA 3W5DA 4OHFA 4UM7A 2FPWA 5AVSA 2WF9A 3NALA 5AVVA 1U2SA 1RKQA 3SMVA 3NUQA 4L6CA 3ZW7A 3QU2A 5AW8A 2B1RA 3ONNA 5AK3A 1LVHA 2B82A 5AVRA 2D2VA 4CF5A 4MWOA 5AM4A 2YBDA 1RQNA 2RARA 3NASA 3QUBA 3U7GA 2AGVA 2IA5A 2FI1A 2HEGA 2G08A 3AR6A 3WK6A 4AS2A 4KX3A 4UARA 1RLMA 2G80A 5AVWA 3GYGA 3CZ4A 4YCNA 3U7HB 1YV9A 3W5CA 3HYCA 4UASA 3N28A 4J2TA 4DCCA 3L5KA 5ALNA 2QYHA 4I9GA 2W43A 4FYPA 5ALHA 3F9RA 3FPSA 3FGOA 4Y2SA 3E81A 1L8OA 3J7TA 4Y2YA 4AP9A 4IG4A 2FPRA 3WKBA 3AR8A 3A3YA 2YMPA 1WR8A 3ZWDA 1ZD2P 2ZG6A 2YMMA 4EEKA 1Z88A 2ZBDA 3DNPA 5AVYA 1WPGA 2FEAA 5AKKA 2AUTA 5ALMA 4DW8A 5AKJA 4ZEWA 5ALDA 5ALLA 4Y2JA 2CFRA 3BWVA 4C4SA 2AH5A 4UMVA 1KYTA 1ZOLA 2HHLA 3A1DA 1VJRA 4NWIA 5AKIA 4YGYA 5ALEA 5AIAA 3PGLA 5ALIA 1Z4MA 3U26A 2GFHA 3MMZA 1JUDA 1IWOA 2YJ4A 3ZVNA 3QU5A 2FDRA 4I9FA 2NYVA 3M9LA 5IT4A 2WF8A 5AVQA 4BEVA 1RKVA 2HI0A 2OA0A 3ZVMA 1NRWA 4H1WA 3QUTA 1RRCA 1S2OA 3AR3A 2W11A 4RESA 4UMFA 1ZD5A 3UMBA 2I34A 3ET5A 5IS2A 5AKLA 3MPOA 2C4NA 5A3SA 2OYCA 2YMQA 1VJ5A 3WK4A
chains in the Genus database with same CATH superfamily
1CB7A 2QNRA 4YCDA 1DUIA 5HK8A 1U7XA 4YQYA 1DDGA 3GEPA 4ICIA 1K8QA 4QQ8A 3H19A 3WYEA 3X43A 1Z47A 3H3FA 2C88A 3RJZA 3WGNA 4FQ8A 4DUPA 2AXNA 1XNJA 2WTXA 2PMKA 3GA0A 4M6WB 3Q6IA 5G2OA 1SB8A 4TSKA 4W63A 3RRJA 2IF2A 1NXTA 2WF6A 2IS2A 3WWZA 2X77A 2I6QA 2UYOA 1XIVA 1M7GA 4KN6A 2B21A 3OQ1A 2SNIE 1NBAA 3TB6A 1VKHA 4PZLA 1ZD8A 3ZTYA 4CQMB 4ZT3A 4Q5IA 1APBA 5B2ZA 1DG9A 3VDMA 4AZ0B 2GJSA 4JQSA 3PB3A 4RCZA 2DY1A 4MSUA 1SWVA 1T25A 1QMPA 2XUFA 5KTMA 1P1JA 4A1FA 1DV1A 3DEFA 2PRIA 3GYBA 5FI0B 1RHJA 3UV7A 4OUDB 4QYWA 1ISJA 1SC6A 2YRWA 2Q5CA 4GKBA 4LNHA 3MS4A 3BWBA 1H93A 1YZ3A 2OHGA 4UVHA 2OZEA 3RJTA 4EJ0A 1K7YA 1V7PC 2A0KA 1QHIA 3K9QO 4UFOA 5ALUA 2K2WA 1T43A 1E6KA 3WIBA 2CHFA 4LPSA 3EK2A 1PUXA 4YPFA 4EA9A 3SNHA 1EK1A 3NW9A 2AN9A 4NEGA 3L0BA 2JRLA 1HNWB 1TF5A 4G1CA 2IYWA 3JWJA 3HZZA 1G7CA 1E0AA 5FOWA 4R2WA 4XX1A 3U17A 5IF3A 5SZJA 3OM8A 3A36A 4B0PA 4N9QA 5I3CA 3EVNA 3M5PA 1UWKA 4AYXA 4EG0A 5CIQA 3HBFA 4GHWA 4WNAA 1KO1A 1OZHA 1OLUB 4E51A 1EP3B 1XTQA 4B2YA 2RI0A 3G8CA 4HNSA 3PGA1 1EXDA 1YB7A 2BMAA 3CX7A 3O95A 4HGNA 4QLBA 4MI9A 1Q7BA 3DZCA 1OLXB 3PHLA 4N0DA 2F1HA 3IP3A 1F60A 3GD5A 3R20A 4JSYA 4CU2A 3DLHA 3JQRA 1H85A 1MH9A 5CDYA 3A25A 2CK3A 1D2HA 3I0MA 2ZIUB 1MFZA 4PTLA 5F1PA 2NZUG 5FADA 5JVDF 4AI6A 2VP9A 3DM9B 5TJHA 2VZLA 3RIXA 5JZOA 3ESAA 1MP0A 2HU7A 2VK2A 2ZRKA 1W36D 3OQIA 4A36A 3VNRA 2H3EA 5KX5B 3B6KA 5F1YA 5TPZD 3QFRA 1J24A 3DBRB 2ZB8A 3PFGA 4X8LA 4DBLC 1IEVA 1RLTA 2VDWB 1SZDA 3RHZA 5HOQA 1B4DA 3VYRB 4GI1A 4KQIA 3MLAA 5A3QA 2ATEA 2HMVA 1II0A 1IB0A 1UFQA 1R6DA 5HUJA 4DHWA 3E2MA 1R9JA 4KQ6A 3ZGLA 3BXHA 4HFJA 4BE7B 1NM5A 2D3WA 2XRFA 4V0KA 1L5HB 1JT9A 2OAGA 2CYAA 4P36A 1JFVA 4V1CB 4E1VA 4XVQA 2DHRA 5LJIA 4BWFB 2ACKA 4IJ5A 2FWNA 2JARA 1JAZA 4F56A 1GRVA 4JJIA 1CUZA 3H8JA 4M8IA 3TNYA 1D0SA 1Q0ZA 2RB5A 1MJHA 1HA3A 2ENWA 1U8AA 4P93A 1PU2A 4YQFA 2FB9A 3VXKA 1W88A 1CNEA 4WOJA 1SA0B 3OZGA 2IYAA 2O1WA 3FOBA 5CMLA 3VV2A 3HGTA 1LUAA 4KVGA 1VDMA 2GK3A 4LNUA 4LXTA 4URHA 1Y8AA 4NNOA 4C4TA 1OIVA 1HTBA 1FS6A 1G5QA 5KJEA 1TIKA 2W37A 4E5DA 1NP3A 3OUZA 1Z56C 3AXSA 3M6MD 5CXSA 3SCZA 3V8PA 3VU1A 5CU7A 1ABEA 2H1SA 3G9ZA 1TUBA 1ZUIA 3A2KA 2MSCB 2ZT8A 1E60A 1RTTA 3I2GA 4YRDA 3W05A 2YQ4A 3IXQA 3QFTA 4HKTA 5E4JA 3WLNA 4AB1A 2XNDD 1BFUA 4Y2XA 2CZCA 3N9IA 1YA4A 5JCXA 3DEJA 3PFBA 1GVHA 3ZWXA 1GARA 3R5SA 3SE0A 4OKIA 1SD5A 1J21A 4FSXA 5H4HA 2W90A 3I8XA 3MMXA 3EFBA 4MWDA 1NUAA 4QLAA 4D8XA 2VJPA 4LRWA 4WQMA 2UZ1A 4JP8A 4EYQA 1J5XA 1PWEA 3O4IA 4NYJR 1UK9A 2AMVA 2Y4NA 3BBPA 3C7DB 4FHFA 5HS6A 3UCFA 2IGBA 2BCEA 1HT1E 4PANA 4ZD6A 2O5CA 2G71A 2IY7A 1XEFA 2VIIA 5JDCC 2ZEJA 1Z38A 3LP6A 3EIFA 3GVHA 4WACA 5C9ZA 1R8XA 5IYZF 4F8EA 3GLFE 1PQYA 5LCXA 2AR9A 1ZGJA 4M0MA 4MVJH 3LBFA 4XCVA 2PGAA 4ZAGA 1L5FA 5E4FA 3DL4A 1Z3IX 5A4AA 1PFVA 1B73A 1FUKA 1Y1PA 5K7SA 2PSEA 5LLDA 4TYWA 1JMVA 1VE3A 2GPWA 1P4GA 2QU7A 3KR9A 1SVLA 1RP1A 1SY7A 2XJ9A 4Z54A 1B14A 5AI4A 8ABPA 4P22A 2MMCA 1MB2A 4CTKA 4UCXA 1JHOA 3BHMA 1Q0SA 1J5PA 1RNLA 3EWIA 3FYCA 4GPTA 2KPOA 1MT0A 3IDAA 2VPWA 3K05A 4I6GA 2V96A 2GGSA 4TWBA 3ZVNA 1FBTA 2NXNA 1LVGA 3K2QA 3ZHQA 2O3SA 3HCAA 5U4XA 2BWJA 1LRJA 1FYXA 1IBSA 1OC2A 1T5DX 3OSZA 3ZIAD 4DSNA 4E46A 5GONF 5DNUA 2EARA 1JG2A 5JI3E 1QU2A 4MQFA 3SKYA 1HE3A 3AESA 2A1UA 2ECOA 3G6WA 5AJXA 3UENA 3WGQA 4DXAA 1NX6A 1EWVA 4F21A 3OMLA 1J06A 3GT0A 1YDEA 1Z0FA 3PXEA 1A82A 1JI3A 2FJPA 3I3SR 4JLVA 3PKIA 4PYQA 2BGMA 2P5TB 3PYMA 5DHPA 3FKSA 4X71A 3N7AA 3UKOA 4B74A 1XQ9A 4BBJA 4K9QA 4KIWA 4M0PA 1UWVA 1JMKC 1XK6A 2MR6A 3HY6A 4Q93A 4ZPJA 1D4FA 3WNZA 1VE9A 2CW5A 4IX9A 1N2GA 1OLOA 1Z8NA 2GEUA 3U7RA 3WIDA 1U63A 3EIHA 4ECAA 4RETA 4R5MA 4U7TB 3UPDA 3UWDA 4ZMBA 2W4IA 3R23A 2VQ3A 1NOIA 2ZBEA 4PLPA 4X1YB 1RC1A 2JLVA 2JASA 2PZAA 3GT4A 3FHJA 2B0JA 3CSDA 3G2HA 3BJIC 1C81A 1P2DA 2B4QA 2V9PA 3NEJA 4MW2A 3V97A 4ZVMA 3SHVA 4EKNB 2MMGA 5DNYB 3HZOA 4I36A 1MAVA 3LUGA 4GBED 3MMNA 4GMKA 5JSUA 1RBMA 2O14A 1CJKC 2GH1A 3SNKA 1NATA 5KYWA 1WETA 1R8YA 3CEJA 3QKRB 4KTTE 2IP1A 2OCIA 1XZAA 2ZUWA 3AP2A 3H17A 1A5ZA 3HO8A 2Z6VA 3FH0A 3CLUD 3K09A 4IQ8A 5BSUA 3IKTA 3DEYX 2CFTA 2Z95A 1X7GA 2C4VA 4PIMA 1XTRA 3VH1A 1C7JA 2EVWX 4XEHA 5GJVC 1GXSA 1RQ7A 4NKRA 4X7RA 3IPYA 1QQ6A 1YXMA 2MSKA 4KXYA 4MW6A 3JZMA 3DOUA 2E5WA 3Q98A 1TVMA 1V5EA 2F3UA 3HKBB 1YB6A 4HEA1 5FB3A 4R71A 1KJIA 3FMIA 2YUTA 4KI0A 3DE2X 3MCZA 1QRUA 4CVNA 4EA8A 2OTCA 1IN1A 1SXIA 2OBMA 3LF2A 4EABA 1XRQA 1QGED 4CCAA 5GONA 5F51A 2H5EA 3NTOA 3WIUA 4ABTA 3ORFA 3WLHA 4UTNA 4MUFA 1B74A 1GKIA 2JGNA 2JHAA 3TQCA 3N86A 5D5HA 1YS1X 1QG2A 3PDWA 3WLPA 3ZD7A 3FWPA 3RIYA 4B4KA 1JXAA 2R8XA 1CVRA 1JSLA 2R2AA 3PGKA 4YJKA 5LZ7A 2WPDA 4MVJE 5AOAA 5HZHA 4OXNA 1ECGA 5F5LA 5H9VA 4DIMA 1JQDA 1OB2A 3W04A 4RJTA 1ZVQA 2IYYA 2X0FA 3ZHSA 4ZOQI 1YGYA 1VB3A 1VFPA 4K9SA 2VATA 2FN3A 3ONWA 1JT2A 2ZRDA 2VRWA 3KJEA 4HFMA 1NQVA 4DBVO 5DNEA 3PQDA 2ATCA 3AR7A 1IDN1 1L7VC 1XP5A 3EGEA 5BSWA 4FGUA 4K6GA 4MQ6A 5GMOA 2QUIA 1ZBQA 4O08A 3ZLUA 2FZ4A 3FDIA 3K0AA 4I1PA 4YT8A 4EJ6A 1FF9A 2BGNA 2DCUA 4DLLA 5IVHA 3EVCA 3SHTA 1EK2A 4N6NA 4H7IA 3T1OA 3VU9A 4FUTA 4HGZA 3FCCA 2AN1A 1SCKA 1W6RA 3LQ4A 4J4TA 1NJFA 3MHPA 5CVTA 4FGWA 2PZFA 2RAFA 3JQBA 5AVXA 2JCVA 3QUSA 3RYHB 2UYCA 1BWQA 3NMUF 4UM5A 5IBCA 3JR7A 1AS3A 1LBSA 1KJ8A 4RJJA 3ZWPA 1TYCA 4WLEA 2RGRA 3GLUA 5DBOA 4FXPA 5IJWA 1VCHA 3CEAA 3TD6A 3D6NB 2W6PA 4M98A 1ZD3A 4MR9A 1AQNA 4NXMB 2J0QA 1GCGA 4XCXA 4B7ZA 5BW6B 4OHMA 4OA5A 1VJGA 1WVIA 4MGIR 2E48A 1J2TA 1RQ2A 1ZEMA 3KLNA 1ZI9A 2H1IA 1P91A 1QGZA 1VE7A 2QRMA 3L8YA 1FYVA 3ZZNA 3GPIA 2ZB3A 2AFIA 3KQMA 4PYOA 2Q8NA 1ZJJA 4QELA 1EDEA 4C5CA 4E22A 4TS1A 1AT1A 5FHRA 2IUFA 1S2MA 2C7BA 3AP1A 3DNMA 2ADMA 4G5QA 1TM1E 3U3OA 8ATCA 4OB7A 1YR1A 4M53A 3R7WB 5I7HA 4X84A 4UVEA 4PAMA 5KYUA 3SIWA 5IDXA 1QM5A 4KSCA 5JH7F 1WUJS 4DUGD 4WOPA 1A5AB 5E8JA 4UVGA 2MDTA 1UBRS 1OZFA 3HN2A 3PJDA 4MKZA 4MVJI 2H8GA 2REQB 4R0VA 4WN3A 5B3KA 4QVIA 2O3QA 3B1WA 4S1WA 2VDNB 1KYWA 2VUTA 1ODCA 5HJ7A 3EGWA 4G25A 2RH9B 4WY8A 4C6RA 3S2UA 4D98A 2FN8A 1DBRA 1U94A 2XE8A 1OA0A 3D7KA 3LHSA 3N75A 2C7GA 4N0QA 3SMVA 5HKBA 1X6VA 5EIXA 5AOVA 2M98A 2QDXA 3AFNA 3MGKA 4YVFA 1D3AA 3H13A 2PV0A 1W8IA 1S8FA 2N47A 4HX5A 1G6HA 2ZR0A 2WVAA 5KOIA 5KTYA 2FOXA 5TY0A 1E0DA 1J8FA 3IV6A 4AL4A 1GUAA 1LPSA 1Y98A 2RARA 3FBTA 3NASA 1AE1A 5TVKA 5K8JB 3BE8A 1ADCA 3LBNA 1KZHA 2IX9A 3HE3A 4R2KA 4YPOA 3I73A 4RV4A 3V8BA 1J1IA 2Q3CA 3VMMA 4AN1A 1MGPA 4B4WA 1RXSA 2E4WA 4TTVA 1W5TA 3ADOA 3QX9A 4AN4A 2I22A 4M0CA 1JB1A 2FMXA 4H3VA 4O4HB 4DJAA 2V6MA 5ICEA 3GLGB 1VKZA 2NU6B 1W44A 2G0TA 3BGSA 1DIAA 2PAAA 4ARCA 3F8SA 4GVPA 4OQZA 4C21A 1X7DA 3PEFA 3AERB 3BT7A 4YECA 1GSIA 4PSUA 9ABPA 5A7FA 1KSFX 3TDNA 4GI7A 1NXWA 4JK3A 3G9UA 2NPFA 4D79A 4P08A 5IU6A 3U4QB 2XOXA 3WYCA 3G8YA 3L0OA 1D2CA 3ELWA 4IUDS 4L5CA 5KOHA 2FVYA 2JCSA 3I34X 3PA6A 4Y2SA 4V2UA 1M73E 3RTCA 1XJ5A 5JH7A 4EA7A 3ZCVA 4ER3A 3A05A 4INZA 4OQ4A 4RH0A 2PT9A 1PNVA 3AM3A 2YFKA 5FLKA 4V24A 3GJXC 1Y6FA 10MHA 4MQBA 3DUFB 5ELLA 1ENPA 1JIQA 2JDID 3AJDA 2FLWA 2QRZA 3CW8X 4XWYA 4YAFA 5DK6A 2IFTA 3RBXA 4E33A 2YDXA 5AVYA 4KBFA 2JEZA 4NOJA 1LSOA 1WPGA 4IZHA 3FLBA 3N76A 3TI9A 1C0IA 2AUTA 4ROTA 4FYIA 1ODTC 4CV1A 4B5KA 2ZE6A 1P18A 4EI2A 1QE0A 2O8DB 2A4KA 3HDVA 5FQNA 1DC3A 4KRXA 3TEJA 4DGQA 3WHIA 1PUIA 2O57A 4FMBB 3K1YA 1PCXA 1UP7A 2QMHA 4HRXA 4D9BA 3VNUA 4M60A 5HOEA 1UPFA 3FE2A 5A3VA 3VH3A 3SM3A 3WDSA 1RCFA 3B2QA 4AX4A 3W5IA 4K9MA 5ECDA 1M1NB 3K9WA 1RXIA 4EDFA 4D4IA 3WYGA 2ZITA 3ND7A 4X92A 4EQ6B 2NSHA 1JUDA 1FQJA 1EFDN 4Z0HO 2QMOA 3Q3CA 4C5BA 1HWYA 1E3EA 1YAHA 5CDHA 1XTUA 1CLEA 3ORRA 4AKSA 2WWWA 1GNRA 2HXYA 5F3WB 3UKDA 1D2RA 2QR2A 1L4YA 2MYPA 2PUWA 1PYOA 1BHO1 4XWTA 3RVKA 4ZHQA 1DSSG 1S02A 1M2EA 2NV2B 3O8QA 4J49A 3VV3A 3ZLJA 1UPTA 1T4DA 3ESBA 5FBKA 3ZJUA 3S2ZA 1JEQA 2AUNA 4MWCA 4N9WA 1EE1A 2V03A 4ERNA 2RK6A 4I5FA 2YJZA 2WKQA 1LLQA 3QEJA 2OYSA 3GXBA 2Z2KA 3AX6A 3NFRA 3KPWA 4XCQA 1G2OA 3AFOA 3ZQ4A 2C5HA 2E6KA 3F7MA 5E3HA 3K0SA 5AKLA 3U3JA 1P74A 4LOAA 1VJ5A 1G55A 3DB1A 4JI5B 3IJRA 1MLDA 221PA 1GJRA 2H9IA 2WFAA 1Q3KA 3IQZA 1RWXA 2H92A 2CXXA 3WYNA 2M2IA 1LCIA 3DMGA 1T91A 4QQKA 1JLRA 4MVXA 4K1LA 3CTPA 3SR3A 4C0SA 2Q4TA 2FZKA 2FRXA 4KNWA 4LF8B 4D4KA 4KXUA 1G2PA 3ZBTA 5ICMA 3OJ0A 3H6KA 2ZS7A 2EKZA 2PUJA 4NX2A 1ZZEA 3ABSB 3EC2A 1YR8A 5FLYA 3AUKA 4U7PB 3RT7A 3RSHA 5BSVA 4A91A 2PUAA 1U65A 4AF8A 1XDWA 4TUYA 4RPJA 2V6IA 5IJ0A 1A9QA 2HF9A 3IMKA 4IGEA 2O8EA 4EB0A 2PQMA 3OIYA 1KEEA 2BFEB 4BB9A 4DLUA 2JL1A 1I33A 1LLFA 3EA5A 1U5CA 2OESA 2PL3A 3EW7A 4Q66C 4Y98A 2Q2OA 3HR4A 3O9VA 2WU3A 3RJ5A 3GDFA 1VMDA 3P26A 3WK9A 1NU6A 3QEMA 3L4EA 3EGXB 4BO1A 2IV7A 1QOPB 2H4FA 4RSHA 1SUSA 2R1TB 2IBTA 4JR0A 4H08A 3QKTA 3STUA 1VLLA 5E1OA 4D8VA 1RWKA 1GQQA 2EC5A 4RZ2A 4Y6QA 5JBIA 2LCIA 3TOVA 3U19A 2IZ1A 2MTBA 4F4CA 1FPMA 3WAJA 2J5KA 1M1YE 1X13A 2FCRA 3P97A 2W6ZA 3QUCA 4MKXA 4N1AA 4YJ2B 5DSXA 4LEIA 2RHLA 2WT9A 3DKKA 4GRAA 4IIHA 4NRDA 3F3KA 3LH5A 5KCMA 5MF6A 2B4AA 1TVCA 3OCCA 4HGQA 4J8PA 3WA7A 3E9CA 3T06B 3A58B 4X41A 5DN9A 3RC1A 2R8BA 3VZDA 2QN8A 5L6MB 3L7CA 1XZKA 1M6VB 2JHFA 4GPD1 2P35A 2JJYA 3BTSA 2ZB7A 3GGGA 2XWSA 1P6QA 3L2OB 3MUEA 1OPRA 1V16A 3KZXA 2PZ8A 3GCGA 2NUTA 2Z30A 3RS9A 3D5QA 3THXA 1GFZA 5CCXA 1WE2A 2YWRA 4ZANA 4OU4A 1G8SA 4B4DA 1IQ0A 2ILVA 3B52X 4UKDA 1FFWA 3QIVA 1E2BA 2HBYA 4MDHA 4URUR 4F85A 1QF6A 1ISPA 5IAEA 3H1TA 1PX0A 1NXXA 4Z2YA 1NW7A 1AQLA 1ENYA 1BQ4A 1HMPA 1Z26A 3IOYA 3KM0A 3PVSA 2IQ5A 1DINA 4M8SA 1P5JA 2P75A 1MEJA 3ADCA 2AWNA 3FMOB 3MCVA 1B3BA 4EDHA 1ADBA 1YCGA 2OR3A 3IUJA 3BFXA 4OL0A 2I3ZA 3A04A 1EIZA 3OPXA 5B64A 4MVWA 2W98A 4J7AA 2OSVA 4CMBA 5HS4A 4N65A 1KK0A 5ABPA 1XVIA 3TE7A 4KP7A 1F9EA 5FA6A 5I4CA 5LKAA 1DE0A 3LSYA 1G7SA 4K46A 5DGTA 3TLBA 5JAIA 3ZZ1A 1NI4A 5THKA 3IAFA 3OZSA 1KE1A 1S8AA 2RK3A 2NYAA 4IUYA 4HBZA 4UHCA 3VC1A 1IUNA 1JJ7A 1L1QA 2QVBA 4X24A 3WS7A 5BQ3A 1E1NA 1ZC4A 3GVCA 4JT9A 2JS7A 3V4SA 4YJ3A 1PK7A 1JU4A 1DRVA 1SIWA 4KU4A 1CY7A 4Y0AA 1FNSA 3ZCTA 3P9YA 4RIHA 3UV3A 3KKLA 3OT4A 3GZJA 5KVAA 4ZCIA 2H51A 2CFSA 2Q29A 1OFGA 1GU0A 2QV0A 4AZVA 1Y4DE 5C37A 2IXBA 3MBKA 4LDAA 1G0NA 4UOQA 1HNNA 2HJSA 5EXEA 3PF9A 4ZAFA 1RRKA 2BBOA 2OLJA 1W76A 1D8AA 1YZFA 3K1ZA 4W5TA 1A9TA 3BL6A 3CFYA 3N2NA 4I4TF 3C3WA 4C0QC 4DA9A 4HN2A 1GUYA 2C2OA 5BNZA 2PBFA 1H8ED 1X19A 3LXUX 3U1VA 2D7DA 1DQRA 1JTVA 2CHVA 3EIOA 4GICA 1YBHA 3THYA 1J33A 8LDHA 1JLKA 2KWIA 3EVGA 3FDZA 2VJNA 1HEUA 3H5RA 3I2KA 3OURA 1JHZA 4ZODA 3QVXA 2VHVA 2GKGA 3TINA 3DZJA 3DG9A 1TYAE 4I9NA 4PZCA 4CG0A 3NU1A 5TR9A 2PUFA 2ADFA 1R0YA 1DAMA 2X9GA 3ZV4A 5CEFA 2DLNA 2XB2A 3EVTA 5CDTA 1R64A 2OBLA 3K9LA 1PNOA 2V8BA 4JL5A 2VF8A 4O6VA 1R88A 1C80A 3RM3A 2OZVA 3Q8XB 5LL6P 4R5HA 3QX3A 3OWHA 5A0TA 5BWBA 1X7ZA 1R6XA 1QGOA 3FPLA 1E2EA 3HDHA 2BMVA 1WBJB 1KC1A 1ZESA 2HCRA 3A6EA 3H2GA 5IW8A 4BKUA 4EZIA 1RBYA 2JLXA 2JGAA 3WAKA 4M7RA 1EFAA 2WAOA 3ZLVA 2XVAA 3VPBA 3H4TA 1CUDA 5LMNB 2YXLA 3GFRA 4RY9A 3UATA 3P2IA 4OQYA 1ZI8A 4ODIA 4IDHA 4GW3A 3VTZA 3WIEA 2Z1NA 3H0KA 3K35A 5C8YB 3NCTA 3MGCA 4M7WA 1SZCA 4MKRA 3U9LA 1KMQA 1UODA 2X7HA 3RRXA 1ZCZA 3CB2A 3WNVA 1ZDMA 4MUGA 1IK6A 1RBQA 5A71A 2QTZA 3N2IA 5IABA 2IZZA 2I66A 1O03A 2V97A 2P5SA 3TG2A 1SBYA 4ZDJA 3FSJX 4EECA 2VH1A 1RQRA 2F9FA 2EL9A 3VDNB 3HJHA 4YAGA 3WB2A 1D4OA 4I08A 2I3GA 4BLTA 1BE6A 3SZOA 1QVRA 2WWHA 2IHZA 4E5UA 2FLKA 3Q9SA 4JUFA 2JI7A 3DZ8A 4U7FA 2WI8A 3W3AH 2QV7A 2Y0CA 4G41A 2ZIEA 4M7PA 1LJ8A 2D8AA 1QQTA 5DTMA 4PN3A 2Q0QA 3G0GA 4ONEA 1IPEA 3KKOA 4KQ9A 1ZAYA 5J23A 2AL7A 4Q7JB 4B8YA 4NHOA 3HDGA 4J3FA 2G9NA 3V6LA 3L06A 3R9WA 1DT5A 3GUYA 4Z7QB 5A4DA 3MB5A 2CNWA 4P3PA 2IXFA 3WKAA 1TTTA 4CFSA 1LNZA 1CRWG 4RY0A 5IMSA 2YS6A 4XZ3A 2FW7A 4D82A 1E5DA 1TJ3A 1XEAA 2WSBA 2WWTA 5IM5A 3SF8B 1MEEA 4M9ZA 3LPCA 4W8HA 3OJOA 4JLPA 5JJCA 4RTMA 2ISSD 1WDWB 1G9TA 5JAPA 3T7SA 3HSYA 4MUHA 3T4XA 2VP0A 3PUJA 2R47A 5SICE 2H2WA 1ODJA 4RY2A 1HDCA 4CLOB 2ZWPA 4MB6A 2JLAA 4XDYA 2FG5A 1N6OA 4A7PA 1NW9B 3L6OO 1A4RA 1NW8A 3CUYA 2VLIA 4NC9A 1PBNA 1S2LA 1UOEA 3NP7A 1NFQA 1TD1A 5BMOA 3DE6X 3K0FB 5FOVA 4JS0A 5CUQA 4BTVA 1U0HC 2IF0A 1V71A 2OFWA 2QM8A 4ZI7A 1YA6A 1C4KA 1I7SB 1FY2A 5FORA 3G0CA 2QTTA 4QJ5A 3ZWMA 3MQFA 4Q7QA 3H86A 5A0FA 4R1TA 2HN9A 3V2GA 5AT1A 1U3VA 4C4YA 3V2IA 1NNUA 1YS9A 3ZHRA 1D0IA 4ZGBA 5K20A 3GN2A 4D8TA 1MDBA 3LLUA 2JDIA 4HLQB 4I2VA 2QYOA 2X8AA 4YP7A 3VTFA 1ZWKA 4C4PA 4U2BA 4C6HA 4EL0A 2FFAA 3RYTC 4NXNB 1EX1A 3ABRB 2WD7A 4JQZA 4EZBA 3KE8A 2CV1A 1I8TA 3TCNA 2GNPA 3QG5A 5IHXA 1L4FA 4IHJF 3SJ7A 4A92A 4G67A 5HGJA 1EP1B 1QUEA 1AHNA 3OG9A 4AUNA 1J9ZA 5CDUA 1Y7IA 4ZAXA 1LI5A 2AS0A 3KVNA 4P82A 5EC8A 3NUGA 4MXDA 4L7QA 1YK0A 2OV8A 1L7RA 1V8PA 1KY4A 5A2GA 1JSRA 1GG8A 3LX4A 1IXYA 3E48A 2BGTA 1UMCB 3TIGA 2YZKA 2GAFA 2FQWA 2YRFA 3WWOA 2PLWA 3C85A 5CJ2A 3SYTA 1AGYA 3E9ZA 3IFSA 1PEYA 1PZFA 4POAA 4ED9A 4DR5B 5C7LO 2OAEA 4IEIA 5BR7A 1XJ0A 1G60A 3N70A 1AZLA 1XI2A 1QHFA 2FWMX 2RI1A 3REGA 5KDDA 1NYLA 1SUBA 2IP2A 2O2JA 2HRRA 3LWZA 2C92A 3PR3A 3B1KA 4H4DA 4OI4A 3ZGOA 3CBQA 3QPDA 2WE7A 3CEPB 4JWTA 2XHEA 1DO2A 3ICCA 4HAYA 1AG9A 4FC7A 2XMDA 4H4EA 2R8OA 5JNVA 5GGYA 4Y2TA 5KVCA 2OEPA 3N7UA 4M1WA 3EUWA 3TD2A 1U0RA 3OZ7A 1CR2A 3WNQA 4L2IA 3I45A 3KIPA 5AKGA 1P0MA 1CUSA 2Q7XA 3CPHA 3L07A 4G86A 4XJSA 4YRLA 5LA6F 1YHNA 1YRWA 4BVAA 1EXNA 1L5QA 4PZPA 3QF4B 1E3MA 3AVWA 1ZLYA 1PHPA 1E7SA 2Q62A 2SBTA 2C96A 3GUCA 2FWBA 3LV8A 1YUMA 5K3SA 3F5FA 4NMHA 1XJWA 1ZS9A 3RUAA 2L0XA 3TZEA 4CUKA 5AVUA 4OBWA 4A8JA 4JT2A 5BSHA 2O19A 4BB0A 4V38A 3LOUA 4LI0A 3IT2A 1DOZA 3JSAA 1FSPA 3VYSB 2BE7A 4PGGA 1WY5A 2BZGA 3CNQS 1DIRA 4QBGB 5SYNA 2AJ8A 2W2XA 4JLWA 4MEAA 1TIPA 1KK1A 4RZ3A 5EYPA 2ZWMA 4AN0A 2XQIA 2E9SA 2E55A 1E3SA 1JAHA 2FR8C 3AL2A 1SULA 1FYEA 2JJ1D 4P0TA 4F71A 2P2NA 3BMNB 2BJHA 4N82A 4YMVA 1TJ4A 1V9SA 1Y3FE 1NW5A 4JLBA 4IS2A 2ZB4A 1M66A 3KJIA 4PC2A 3EXEB 3EMKA 4ZVUA 4WK0B 1K98A 4XIIA 2J4DA 3JQ9A 1QONA 3DFFA 4MMYB 5ELMA 1GSHA 2YYZA 1M5TA 1QRDA 5CLQA 3TR6A 5CM2Z 1GTSA 3A11A 1NWHA 1PS8A 3CRNA 3M81A 3WGJA 1OF1A 4BDTA 4E7OA 2BFNA 5KU1A 2XIQA 3KT6A 4LBZA 4C20A 2AFVA 3IBFA 5FI5A 3TD9A 1FW8A 4D0SA 2YFHA 4HQNA 1NBIA 2FRVA 3OOHA 4ZHSA 5REQB 1IFXA 4UQPA 2PSJA 1YVPA 3QHPA 4QWWA 3S7TA 1WUKS 2WIDA 4ZVQA 3L79A 2RH8A 3NT5A 2L18A 3N2LA 3U0VA 5T4BA 3MVEA 1TW3A 4QRDA 2HRQA 2HNAA 1F8YA 3AMVA 3ZE9A 1BX0A 2AFHB 1URPA 3GNQA 1K6IA 3KSDO 4KRYA 3GBVA 3ZHOA 2AV6A 3ZQJA 4PLWA 4WTOA 5DYTA 5E7QA 3DB2A 2AXEA 4P4LA 5HGXA 5LA6A 5BR1A 1ONNA 4KZKA 1PGJA 1CHNA 1SQ0A 2XRMA 3ZUGA 2X7XA 2HDWA 2ZROA 3F6YA 1YBVA 3TVDA 1H0SA 1E92A 1Q77A 4GWGA 1I2AA 1QH1A 3HBMA 1I2ZA 2WAYA 3P9PA 4YRGA 4F92B 3OZRA 2CVOA 2EFDB 5ALHA 5FPTA 1EWKA 2ZDHA 1FFEA 5LN1A 4MEJA 1E2DA 4Q48A 3UAWA 4FYYA 3WYBA 5C18A 4RTPA 1AHIA 1XDGA 5I8PA 5GJCA 5CW2A 3X1DA 3A3PA 5D01A 1U3DA 5EJMA 1V8DA 2VJQA 1G59A 3GXOA 4JASB 1DIGA 5HJEA 4ZOEA 1KJWA 1LK5A 2VJCA 3SIRA 1XZMA 1T9GS 1ZD2P 4C04A 1UC8A 2HGSA 2YBEA 2OXTA 4AK9A 4BVGA 3NHMA 2P9TA 4FW9A 5BN4A 2VZEA 3P9CA 1HK7A 3BC1A 5TQ0A 4L9SA 3UYLA 2R6FA 4IF4A 5LQSA 4QYMA 5KC8A 3JQ8B 3DWEX 4CV0A 3PTZA 4MHTA 2XGJA 3KQKA 1TU0A 4FYHA 5EY5B 1QF9A 3HVHA 1MC1A 4EHAA 1J1ZA 4FNMA 2JCXA 1UBCA 3LLVA 4KVAA 4Z7NB 4Q37A 1OFHA 4M86A 1CQJA 3B38A 3C5HA 1VSBA 3CSSA 3L02A 4HFNA 4LC1A 3PXDA 4D4HA 3D3QA 2I78A 1P0QA 4PVDA 4QQRA 2GZHA 3MJRA 4OAQA 2W0SA 4TL7A 3MHTA 3E35A 4E3ZA 1XL0A 3DDCA 3DMHA 3NJ4A 4R68A 3R6DA 3FA2A 1HH4A 1NR5A 5A05A 2YJ4A 1GRNA 1TLLA 2A33A 1JV2B 2FDRA 3LHDA 1SPBS 3DUWA 1DL5A 3M9LA 1OH7A 3WNBA 1BWPA 5J4HA 2I2BA 2R3SA 1KTIA 3SAJA 2EZ9A 3DBOB 3ADKA 5LNK6 2BMJA 2FZWA 1H8EA 4FI3F 4HR7A 3UGTA 4FGSA 2KS6A 5FWYB 2WJZB 3JQ6A 4ZVKA 8MHTA 2P4SA 3GGOA 3HC7A 4DDTA 3G68A 2EHJA 1S2OA 3LW7A 3OHPA 4N5HX 4YRIA 2DX7A 2K6GA 5B6PA 1RYZA 5BMVF 3K96A 3UBTA 1DB3A 1ORWA 2VT3A 2GCOB 3WBFA 2QZ9A 4K88A 2RKWA 4JFRA 4PR3A 1U9CA 4KJXA 2ACWA 2WUDA 1XCPA 3GB9A 4HNQA 1O08A 4ZYYA 5LOVA 1NNLA 4Q1FA 1FMLA 5K3FB 5CYGA 4P84A 4H18A 2ZIWB 2NT3A 3H9QA 4MZDA 1RKBA 4XJXA 1CJTC 1UJMA 4AF7A 4R7TA 1BU5A 4D9NA 1E62A 1XZPA 3ZE2B 3IKLA 3W77A 1T0JB 1K7CA 1YIDA 4YRJA 3PVZA 4DKXA 1A7JA 2W2TA 5DU2A 2CEAA 1RE1A 4MVJD 5DBFA 3TSYA 1CUGA 3NRBA 3JARB 1PVDA 3GLIE 5DI3A 3ANSA 3EB9A 2B5OA 4G5GA 3VOAA 2LKCA 4X64B 5DM2A 4HQ6A 2FW9A 1EDBA 2ABWA 3ACBA 4CDRA 4MW0A 1OZGA 2YOGA 3VZQA 3H97A 4YQEA 2H2FA 4FCWA 3TCKA 5T6BA 3KJGA 1EVLA 3LVFO 4Q4HA 5GM2A 4WVLA 3SS8A 4QATA 2IYNA 1CHDA 3KNZA 4KHZA 5TPWA 1T0IA 2JB9A 4BDSA 3BRWD 2H0AA 3QFFA 3P2JA 2LCQA 4PAQA 4LNUB 4YH1A 2QSZA 2QENA 4NPAA 2DETA 3DP7A 3ZY6A 2AF4C 4NBNA 4HMPA 1R66A 4GD3Q 2G36A 4I50A 2XB9A 1T34A 1EK5A 4L5JA 2I3BA 1G66A 2ZRAA 4QX6A 1TUBB 3UXYA 4RKFA 4TWJA 1GT91 2Z8YM 2QRJA 3A9TA 4QECA 2IL1A 5BY2A 5ES4B 1E1DA 2VJMA 1YAJA 3FMGA 1KMNA 1K06A 2PX5A 3FAZA 4I5GA 5FL7D 5K0CA 2XZOA 1C9MA 2V7UA 3FOEC 4NYIR 2B8TA 4FBGA 1O4VA 1TCBA 2BM9A 1PF7E 2C97A 2GRJA 2TS1A 3IAAA 3MTQA 4KKVA 5DZSA 1Z5NA 4PPNA 4AJ9A 3WQQA 4BQQA 1B6RA 1IUKA 4F4DA 3CR7A 2XJ4A 2W00A 2UZ1B 4ZEVA 5KHAA 2GD0A 2PRYA 2QGZA 3HNOA 3DPIA 3AOGA 3GP3A 2P4UA 5EA2A 2OO3A 5KWEA 3OC6A 3SQNA 3KG2A 4DLBA 5HM8A 1QVAA 1GZ4A 3PQ2A 4INOA 4JT8A 4KQKA 5AI9A 3S2IA 3SEQA 4B82A 4PGFA 3D7SA 1FNCA 1KFKB 4E08A 2BEVB 4FP9A 3TF5A 1YC2A 4DZRA 2VL7A 1JG3A 4PZDA 2C0CA 2BI4A 4AFNA 1QO7A 2HBQA 4NCXA 5I7RA 5LFAA 4MGEA 3VZSA 1NPDA 1OFTA 2VHTA 2C2KA 2YN0A 2HJGA 4FOPA 4HDSA 1K6MA 1RXYA 5J2TF 3MWYW 4E07A 4KK4A 13PKA 5JNTA 1YR3A 1Q1EA 1XA0A 1TEVA 4GR5A 5GJBA 2D5LA 3R5FA 5C7YA 4PNHA 2Z8ZA 2IYOA 4RNDB 3BXPA 3EUEA 2VQ6A 4KAAA 2G07A 3LCCA 1CS4C 4G9GA 4QEDA 4PFJA 5DIZA 1EFTA 3QG1A 3TNDA 3NVDA 2FGJA 5IWCA 2RK4A 1P9LA 4AZTA 2GFQA 5DLPA 3PHJA 2JGIA 1J0AA 4OTZA 2E18A 3P8ZA 2J6CA 4GE0A 3M1IA 4CMEA 2Q49A 1EJBA 2BGIA 3DTTA 1R10A 1TO1E 1JB9A 1TPYA 4PQYA 4ASUD 4G4GA 3V7UA 5HHTA 1SU7A 1Z4LA 4MHOA 4X93A 1O89A 4MGKR 3AR5A 3RNLA 5B4UA 2OXEA 1YMVA 2WTBA 4IHQA 2PX6A 2Q6VA 5FUVA 1RJGA 5EJ6A 1MAWA 2FSUA 3DMRA 3KZKA 5C1IA 3WRXC 3NAMA 4MRNA 4NJMB 1NRJB 4CHTA 1W87A 3DVLA 3NVMB 1Z25A 4K6CA 4FB5A 5BWMA 4LF9B 2Q3MA 2QN1A 1A7KA 4ENVA 4K6MA 4QOHA 2IWHA 1NF2A 1E20A 2C3PA 4HWGA 4LE1A 3K2IA 3AHGA 1V9CA 2HL6A 3ONVA 3HU3A 1YE8A 2X41A 3AR4A 1TPZA 1EE9A 1VYVA 3LKDA 4ZQBA 1K6EA 5I9SA 3NG1A 5BRNA 2G9RA 2I87A 3BE6A 5HUHA 5EI5A 1SKBA 1K27A 5IYZB 3VNVA 4WFKA 3RRMA 1PN3A 1J09A 3TLCA 1ZSNA 3AEYA 1IZ8A 5LQMA 1NURA 2BFBA 3FOAA 2WT8A 4GNRA 4ISBA 4RVHA 3FPBA 1ZEJA 1U8FO 1CKEA 2JI9A 4NMWA 2ZSIA 4IV5A 4Y9TA 3AOEA 3TZ6A 1I6LA 3EVAA 4U3JB 2O8FA 4UCQA 3ET4A 3ZIAA 1E6UA 1TMGE 1MTOA 1QTQA 1KYIA 1T3GA 5YASA 5DHTA 3O8OB 1TC1A 4HDNA 3KFXA 4G9BA 3A9UA 1C7ZA 5GONB 3DR5A 4OHRA 3QOXA 3TRFA 1L7OA 3EEIA 1ZZGA 1LVUA 2C54A 4IWXA 4TMWA 4ZO8A 3SC3A 4MB2A 3WB0A 3ILSA 2O5RA 3OEYA 4RTRA 3O7WA 1AKMA 2IQIA 4B34A 4C1NA 3KLMX 5BV2P 5CFQA 5EJ7A 4NDZA 3LCRA 4MUBA 4V02A 4MR7B 4XYMA 5LUBA 3RIHA 2ZR7A 2ZRCA 3CE9A 3C41J 3JQEA 1CEXA 3FJYA 5ALSA 1UUFA 3KJXA 2R97A 3D0QA 1QH9A 3S40A 2E6UX 2VJBA 5MGNA 1PGNA 2JJ1A 3DVAA 3TRHA 4URVR 1QYDA 2UAGA 1JFFB 4I99A 1YFKA 6Q21A 3OUUA 2ZJ7A 2ZI4A 1D6SA 3O0TA 1HXHA 1AGRA 3ICOA 4KBGA 3RH0A 5CLIA 4WPGA 2VAVA 4QPPA 4EY4A 2BBSA 3BIJA 4XXHA 1EB8A 3B7GA 3P27A 1BGWA 2JGFA 3I8SA 5KWVA 3H84A 2PQ6A 3G2NA 3R3SA 5FLEX 4WESB 1MBZA 3C6QA 2LIVA 4QOGA 4HVLA 1PTJC 3HDQA 4MUEA 1K8ZB 4PC3A 3DC2A 1ETHA 1Z2NX 2WHPA 4FJ0A 4N01A 4AZWA 1MVNA 1ULHA 3MZ0A 5J1TB 5EQTA 2P5YA 4NCAA 1JHYA 2HJ9A 1RADA 1M3SA 4EPWA 3I4CA 2FFHA 2WRZA 3A6GA 3FPHA 2FJUA 3JWPA 3KLBA 5BQOA 3KBBA 3RG2A 4F11A 5K0FA 4IZIA 3OU6A 5E3JA 3RIMA 4ZEXA 3WAGA 4A73A 3I09A 1IVNA 1VA5A 2BH2A 5KYYA 3U37A 3Q11A 2ZREA 3QPCA 3ZV3A 2B1IA 1NN1A 4XIYA 3T5TA 1IY8A 1BCRA 3LP5A 4TQ9A 3H1FA 5EQDA 4LCEA 3KPUA 4UEQA 4MDEA 3C3PA 3BWDD 1CZKA 3D5TA 3OQBA 2FPUA 4F84A 4EHLA 3AZQA 3SBXA 2Q4OA 3DL0A 1TK3A 3ZTTA 4MP8A 4O2LA 3B60A 3AY0A 3OKPA 1YVEI 5KYUB 1Q92A 3LS2A 3ND9A 4BE9A 1GZSA 5BSMA 4KN8A 1OILA 1LPBB 5E1MA 1LFDB 2Y99A 1XBTA 3HB5X 1TYEB 4B3BA 1GTZA 1HT0A 1KYVA 3INNA 2HNKA 2MT9A 3N6RA 3P9NA 1I9CA 1ZC3A 2XUOA 3HLYA 2ZR9A 3NIWA 3IVRA 4K7JA 4J0QA 4RENA 3FHTA 2I33A 1P0FA 1QQ7A 3EF0A 3CPSA 2BMFA 1H2XA 2DJIA 3LBHA 3CGWA 5AVSA 2VQDA 3AVUA 1ZNXA 1EI9A 2DFLA 2D1FA 2FUG6 1SBTA 4BMDA 1K7SN 4INPA 1CUIA 5ALOA 2KX7A 2QKYA 4MWGA 1SHUX 3FWNA 4BJ6A 2X4GA 5FBZA 2QX9A 3DPUA 5GZ1A 3FNIA 3R7BA 2CVQA 4ZT7A 4ALIA 3OD5A 2AZMA 4BRWA 3R9XB 2GZAA 1FX0A 2REOA 1T1IA 2LZ0A 4OMDA 3W5UA 2Q5EA 1W4BA 1L8QA 3OICA 3MTGA 1W7AA 3I01M 3G17A 2Z8YA 5LP6F 2BONA 2YINC 1WDLA 3S1SA 4DCOA 2CDRA 3N8GA 5M7EA 4P7KA 3GHYA 2Z5VA 1FXWF 2OFFA 3IKMB 3DWFA 1VG9B 4KWTA 4UREA 4NBTA 1NP7A 3HP1A 4EUFA 2Y0PA 1ZHOA 3DAOA 1U0BB 3L6RA 5IEJA 4GQIA 1RT9A 3CPJB 2TRSB 2R65A 2YZ7A 1N5OX 1QXSA 4ZK6A 3OHMA 4FK8A 4ZRMA 3TL2A 1JR6A 4H7EA 4BNDA 5JANA 2TMGA 1RYBA 4MQEA 5EINA 4OHKA 5K8IA 3LVQE 3ABOB 3Q2IA 3VKGA 3UMSA 1P4AA 3CH7A 4QGFA 3D9QX 2CLIB 1H42A 2ZT6A 5FAKA 4FLMA 2C2MA 4F2HA 2QRHA 3BXFA 1QFYA 2BMDA 4YRZA 1YHZA 1O1YA 2XDAA 2XF8A 4JVSB 4NCJA 5EWLB 1VL8A 4DV6B 5JH7B 2OO5C 2QI9C 3D6MA 3QLEA 3UJ7A 2GMWA 4J1SA 1WD7A 4IIFA 4PHTA 4BVKA 5CURA 1N5JA 4G5OA 5F4ZA 5GWXA 9MHTA 4P3YA 2OXCA 2O0MA 4ZCSA 1Y4UA 1IBKB 1AXRA 1TMOA 5HF9A 5DF1A 3NEAA 3R1IA 2JJ8A 2CWWA 2KI5A 3GFBA 3GIWA 3PUVA 4TKVA 3RVNA 1W0JD 1QYIA 3CGGA 3U40A 3CZQA 1LPMA 5EJ9A 1JKXA 1GPJA 3BCUA 4DIFA 1FQWA 1H5QA 1KZ9A 1F9AA 3VNSA 4G8JA 4CEJB 2OGWA 1GLNA 3ZE8A 1UIRA 2AJTA 2I71A 3OIFA 4AU1A 6LDHA 2WF9A 3RC7A 2QMYA 1AKRA 3WP0A 3JTEA 2FGKA 4L73A 4NR0A 2C9YA 2XQFA 1FXWA 9LDBA 1AS2A 1UANA 2I7XA 2M9MA 1QIIA 1CY1A 4MQLA 3SKVA 3LWNA 3ZIUA 2WKRA 4DNFA 2IPLA 3C16C 5A62A 4TZ0A 4WEQA 4BNIA 4EB6A 1TRKA 4HDOB 1LDBA 1RQNA 1YKGA 2ATXA 4GUAA 4JFAA 4LDJA 1OYWA 5F3RA 4OL9A 1WXGA 2P9YA 1UM8A 4N03A 3UPUA 1DHTA 2CUTA 4K9KA 4EHHA 2JLYA 1G8JA 3CR3C 2VQEB 3NKVA 2AJLI 2HWWA 3DEHA 1GNTA 3OM1A 2GHRA 2G80A 4FE7A 4Q01A 4BX8A 1JR2A 4DADA 5FV4A 1N9ZA 1S5PA 2X5NA 4Q05A 2YQZA 5CT6A 1NVVQ 4XGKA 5FL7A 3HYCA 3GRPA 4TLDA 1ZKMA 1PEAA 1ZCJA 4ZT5A 2B78A 4JKIA 1RAHA 3ITDA 1CERA 4NBWA 4YMIA 4E31A 6AT1A 4FNAA 4TRRA 3G59A 4I8XA 5JXJA 2IUEA 3KVRA 4F91B 5JOQA 2QQ0A 5KMGB 2IY9A 3QKWA 4RF5A 4BBPA 1VMEA 2FQ1A 2NNLD 3CT4A 1U0EA 2N9UA 3LWDA 2X4LA 3V4PB 2GEKA 1CY8A 4FVTA 1U2EA 3L1IA 2ASEA 4DB4A 3FGOA 4IZOA 3E81A 4CXMA 1QVZA 1Y9ZA 3RSQA 2VHXA 3IVMA 4BV8A 3FF4A 3QVSA 2ONJA 5HVNA 1T36B 1ZK2A 3RRZA 1WPQA 1JEOA 1ZIOA 1DAKA 1VIYA 2YMPA 4LYJA 3SHOA 3ZBPA 1C1XA 2A2ZA 2HLDD 4HRVA 2GNAA 2DY0A 4KYVA 1ULSA 3O31A 4TTQA 1Z88A 4EF6A 3VI3B 5JPDA 3LQ2A 4RTQA 3H83A 2QM7A 3ZEAA 5JD5A 1WS6A 5AVOA 3U7QA 3AF5A 1H2RS 2RGAA 2ORYA 2W9XA 2P68A 4IDNA 5ALMA 2B69A 5TEVA 1KEEB 1NJ1A 3ILVA 1IN8A 4LJAA 4OQMA 5TRTA 3TDKA 4F6LA 1FBNA 1AX9A 3HCBA 5IASA 4Y2JA 3SHFA 2WU8A 2GQ0A 1NBMD 3BGIA 4ETIA 5KKCA 4N40A 3Q3VA 4B0OA 1LJUA 4KMOA 4MVJG 4RHXA 3NC4A 3TAHA 1BXRB 1KIMA 4PPYA 4C08A 2OUKA 2HV9A 1HNZB 4IXNA 3O4JA 1TTPB 4J1NA 3JYHA 2BZSA 3UAXA 3L1KA 3UMVA 3W9UA 2O23A 1ZVVA 4BPBA 1P60A 1PYGA 3IUBA 4LJ5A 1I0IA 3U26A 2AIRA 4BO2A 2H29A 1HURA 3T7JA 5LC1A 1BA2A 1KBQA 3QU5A 1O6BA 2A0UA 2I65A 4OSPA 3ZG6A 3DTVD 3T3IA 2VUIB 2I7VA 2WF8A 2ZYHA 4MR8A 3WLSA 3TX2A 4BEVA 4CIDA 2EG5A 3KV1A 2QD5A 3HGMA 4NCNA 2WG0A 2Z83A 4ZU1X 4DSUA 2BEJA 3ZWYA 5HPYB 2VH5R 3P1JA 4OQLA 3I05A 1VLMA 2GPTA 3LY7A 2NWQA 2QD3A 2O2SA 2BR3A 4FI3C 3STXA 5BVGA 1J8MF 1JZTA 4DANA 3AM4A 3UWKA 3THXB 5CXQA 1VJDA 1WSBA 2PZLA 3WJ1A 2JHCA 4JUIA 3S1LA 1XZCA 3MJEA 2V54A 1QTIA 1ND5A 2ODPA 3EXIB 5H83A 3DCNA 3T38A 1FYDA 3QMWA 2EQ5A 4KFTA 1EFLA 4XASA 4JXXA 2VHJA 3ML1A 2O3RA 4FC6A 1GZ7A 1XK7A 4KI7A 2JBHA 1HZZC 3FNFA 3NWJA 4FMPA 3GZNB 3CZRA 3TOZA 1N8KA 2JIZD 4FZRA 3FYUC 1BO6A 1VM6A 1OMOA 2CXPA 1OY1A 3CNOA 3KWLA 4HDKA 5JS2A 1P5ZB 1ZUNB 5BUQA 1XZGA 1TQ4A 1G4UR 3ASVA 1JVBA 4FX2A 4BLQA 2X4IA 2OILA 5B1SA 3O90A 4PTZA 1YDMA 5FXMA 2HWYA 3AWDA 4ESVA 1GAQA 1KHTA 1O97C 1OFUA 3H0EA 1NI4B 1P72A 5J4KA 2BMEA 4DNXA 5JECA 1LNSA 2HX1A 1LFAA 2AN3A 2XEXA 2QSUA 3CX8A 4L4YA 4RLSA 1E1CB 1VE5A 4M2LA 2Y8EA 4URYR 1NVFA 4YJFB 1PEKE 1OBFO 1TX4B 3AUUA 5E6SB 3RC2A 3TPCA 5E7JA 3KKNA 4XLZA 3C6ZA 5KKNB 4CEIB 4ZV4A 3K9NA 2AYXA 3PFFA 2O7VA 2J09A 3MCTA 4LYEA 3FSRA 3I01A 2VDQB 1E1RD 4HS9A 5G3ZA 2J46A 1QIEA 3MJTA 2ONKA 3SOPA 1M6YA 4BFXA 4V1CI 3C3KA 2ZZKA 3LGXA 3LUHA 2EFCB 3Q10A 3PU6A 1ZISA 5BOSA 4NULA 2L69A 1HSZA 4CM9A 2Q5IA 4BQEA 4CMEC 2QN2A 2AYZA 3QU9A 4KE9A 1H05A 5AQ1A 4QBTA 3OCZA 4KK3A 5TXGA 3GRZA 3W3AD 1DOHA 1ZWLA 4LV6A 3PYXA 2VBFA 3RI3A 1XMJA 4L57A 1IHUA 1JN0A 3AEQA 1IJEA 1RMYA 2V6GA 3T0IA 3PQ6A 1GQYA 5EZQA 5I9IA 4P83A 1L3CA 1NAIA 4Y2HA 5F33A 1LW6E 2JLZA 5KVVA 1XZHA 3U9SA 1DJNA 4I1UA 2VQSA 2FRDC 1XC7A 4NDAA 1V8OA 4RF2A 4S2EA 4WT7A 2VSOA 4K6OA 3OIUA 4REQA 1M2KA 1ZHFA 2GBLC 4CIAA 1NMXA 4HZUB 1X7WA 3C2QA 2H65A 4V3CA 4FS8A 5DRTA 2J9GA 1M0EA 3NHZA 2VF7A 1FXSA 3CX3A 1UXKA 2HW8A 4G0NA 3DLAA 5JDIA 1G63A 2GT1A 4FN5A 3LRTA 1C7QA 721PA 3AWIA 2DP4E 3H1GA 4TS4A 2NN3C 2X5KO 1QP7A 4RM3A 2DLCX 3VZRA 2J1LA 1SBCA 3UMCA 4XWOA 4F4FA 3PEEA 2YV5A 1Y42X 2QX7A 3EFEA 3FYHA 2BEWB 3OZEA 3FBWA 4XEUA 3VUFA 3EEOA 3AQ4A 5LZ2A 2O07A 1P29A 4LY3A 3GAAA 4A2PA 1OT5A 5CVDA 1ENZA 4KR7A 3FFWA 3PZBA 1ND6A 1IY0A 5B1HA 1D7AA 2JFHA 3OCVA 3KALA 4JBNA 1UXHA 1GGJA 3W9SA 3KPJA 3GGDA 2CXSA 2CVPA 4YRPA 2ZTLA 1VLJA 3IV9A 3PV0A 4MUJA 4P54A 3GJYA 4Q3CA 2OQVA 2OAP1 2V5UA 4AYWA 1SU8A 3HUUA 4IWNA 2ZQYA 3HXPA 4HJRA 3MRXA 4IKOA 5ENVA 3CX4A 3CZ5A 4QUIA 4EYOA 4WOBA 1M2GA 3DD5A 2PCLA 3QQ5A 3LBIA 4H1HA 1H1TA 1NUSA 821PA 4X97A 1XELA 3FCOA 3EJWA 4MUMA 4ARAA 3WO0A 4I4TB 3RT1A 5LYJA 4D44A 1AO3A 3KT0A 5JAQA 1ZH8A 2NACA 4MV6A 3S55A 3N6XA 4P53A 3WGTA 4CCSA 2XBLA 4NBVA 2G3YA 4PNPA 3ETHA 3RUPA 1RI5A 3SG0A 3N7TA 4BMOB 4DC0A 4BQIA 2G28A 3OIVA 1B23P 1EUCB 4ZU3A 3NGLA 1JE0A 2O52A 3RFVA 3MA0A 4XB1A 4GI5A 2CL0X 4H6PA 1EGVB 3I2YX 4D42A 7MDHA 2Z04A 3LC1O 2XBUA 4C06A 4HB4A 1GL3A 1G8FA 2QZZA 1NZFA 5G0WA 1T9KA 3DONA 3CLHA 4I66A 1VCOA 4PQRA 3WGLA 3GLTA 1IBLB 2QTCA 4UAGA 3TRJA 4FFRA 3W5VA 2HF2A 1SCUA 3KXLA 3NH6A 2O5VA 1GU1A 1M2WA 2XVMA 1RM3A 2SCUB 2FSHA 2Y4OA 3B9BA 3W79A 6YASA 5AH0A 4AZ3B 1SU4A 1OWNA 2YQ5A 1Z5GA 3HLKA 3MS7A 4O8CA 5DCWA 1DADA 3H3XA 5CAEB 4FZJA 2CNKA 2R6DA 1P2TA 1QOQB 2QM3A 4JC0A 2HMWA 2W8BA 1F48A 2W5UA 3GL9A 3JZIA 4JLUA 3F9CA 4OA8A 1GZ3A 2VP5A 2NUBA 4YP5A 1WY7A 2O8VA 3VC3A 4EYKA 4X9XA 1A7UA 5HQ3B 3OIWA 4INAA 3EZ6A 1UPBA 5GV8A 1L7BA 1OXUA 1P9OA 1D4AA 1EBUA 1LTQA 2UYQA 4X54A 4Q3EA 4W6ZA 1A9ZA 5KHLB 4CIWA 1TE2A 1ZXLA 3NCHA 2FDXA 3JPWA 1V3QE 3TFQA 1IJFA 3ZD9A 4OGLA 3C3BA 3HZHA 3TG8A 4UDNA 3SS7X 1D2MA 1MZVA 1RWVA 2IJGX 4HEA6 1SUCA 1OGYA 3T4EA 3V2HA 2JGDB 3ICWA 4UNRA 3BWCA 1MO4A 3RS4A 1TQHA 3N0RA 1C7FA 3H3JA 2FUKA 2WD7B 4RLFA 3AUSA 4W4TA 3VTKA 4P33A 3LUAA 1Y6ZA 1IOWA 1N9GB 1R0BA 5BUSA 1W0JA 5I7UA 5EESA 1Z33A 2XWBF 2I2AA 3TQHA 2QW0X 4JHXA 1OI3A 4DWOA 1EYZA 3S6JA 4J16C 4JA2A 4UQOA 1JW9B 2HYIC 1AA9A 1AF7A 1X9IA 3A7EA 1Q0HA 1U2GA 3TS1A 1T10A 2VJAA 3I9OA 2WWVD 2CDBA 1FRNA 4JBLA 1VIAA 1SN7A 3A2LA 2ZUTA 3MSXA 4DHEA 4BXOB 3BZUA 3UQYS 1BGXT 2V3CC 3KL2A 1HY3A 1AA6A 1T9GR 1B00A 3EW9A 4MWBA 2H7XA 3DOOA 1EGAA 5DWDA 2P6UA 1C30B 1BCSB 1V1RB 1YHYA 3D6HA 4K9RA 4LHEA 4MAMA 4UCWA 3SR0A 3ZE6A 1GL9B 1T5BA 3E9NA 4HADA 4YR9A 1LF5A 1JBQA 4F5DA 1CY4A 1AVTA 1I4OA 2ZE7A 1UDXA 4I1OA 4WNCA 4X94A 2OHHA 3NBFA 4F8YA 2HADA 4F93B 2C9ZA 2VZ9A 4NK5A 1UT8A 1DQZA 3OPYB 3VAZA 3D6AA 4BKQA 5LQKA 4YUZA 1ORVA 3NGMA 4HZIA 4FMDF 2I2DA 1JRLA 3HJAA 1KVSA 3BRSA 4MV7A 1SBHA 2Q7OE 2BT4A 5HKKD 5KDLA 2GRUA 3FVWA 4P32A 3FCAA 1ECBA 4G01B 4XWAA 4M1YA 3FHOA 4EG3A 4DM7A 3L1UA 4N3GA 2R8ZA 2V5AA 2QF7A 5IANA 5LKRA 5K0EA 1RAEA 3OOWA 3PDCA 5JWOA 2QG6A 2W58A 4Q4JA 3BM5A 3M6VA 1JEYA 4MKGA 3PWZA 4OJNA 1CRQA 1KJ9A 2WU4A 4LMAA 5JS7A 2GKSA 2VZ0A 1J22A 1JA0A 1DNPA 3IHLA 5EKDA 4LJSA 5MDHA 3GA7A 2EZUA 4Q7MB 3RS2A 5IAOA 1KMHB 1PSZA 1VXRA 2V7PA 4Z86A 4F5EA 3KAKA 3HN6A 4W82A 1XCJA 1PS0A 3GFGA 3L1HA 3U7JA 4ZYXA 4PZYA 3C1UA 4CMJA 1H6AA 1TMKA 3EXG2 4E5PA 1TVEA 1YQUA 5A3JA 5EZ6B 4EA6A 2VPPA 1J39A 2IPAB 2DSTA 2BFCA 4IHJB 4UNIA 5GY7A 4MQMA 2HLDA 4ZT4A 4AKHA 4RLHA 1J07A 1CQPA 3IQDB 3OLCX 3UN1A 3O47A 4RDIA 3V5NA 3F1LA 5J1SB 4DIBA 2BL4A 3FROA 4R2LA 4ZI2A 1O6FA 1N6LA 5ADWA 1FVXA 4PAGA 3L7DA 4RX1A 4OHYA 2VP2A 3TJRA 5JD6A 2Q9CA 3LUKA 4BX0A 1UDCA 4ON9A 4HK4A 3R75A 3K7EA 4QHSA 4TKLA 5ILGA 5FI1B 1ONSA 1NBMA 1ZM2A 2GK6A 2IXGA 3QW2A 3R24A 1JSXA 1HC7A 1VJ1A 4R8LA 2QYSA 4Z9FA 5M3BA 3ZS8A 4CKYA 2FFQA 3FPEA 1GKYA 4FLEA 2WF5A 1FP1D 1T8UA 3IHWA 5LP6C 1PD0A 1Z63A 3DWGA 3DXXA 4MCHA 1F2TA 5BYKA 3PFWO 3PR1A 1E9BA 1R0ZA 1SVSA 2R6JA 1T6BY 5ALQA 3KQYA 5TEWA 3I9LA 4OG2A 2F17A 1VCIA 1CEYA 2RHGB 4Z49A 3FD8A 1GL6A 1O5IA 1GITA 1PLKA 2G4CA 1GQOA 5ESWA 1AQIA 3QJYA 5GZ6A 3DTVA 5LA6B 4JJ4A 2VSQA 1SXHA 4Z3DA 4LJYA 1XWFA 2I4LA 2YXNA 4C0KA 3OE7D 4P9NA 4CI9A 4BKRA 2HRCA 4LGMA 1C7EA 3W9YA 1KRXA 2TSYB 2AX3A 2ZE5A 1NF9A 3JD4A 4IH9A 3O75A 3LPMA 4PHGA 4IFTA 3PSHA 2FFJA 5L51A 1TK2A 1JFRA 1DC8A 1T5TA 1XCBA 3PC4A 4MV5A 2NG1A 4GWKA 4MZXA 4PYJA 3PPXA 1E7YA 2QAGC 2XMQA 1BSVA 1NVXQ 5CCBA 1E9VA 2GS9A 3ROMA 3FKQA 4GLBA 4S24A 4KQJA 5JYEA 4CIXA 3LCJA 4LDZA 2D00A 3NNNA 5K0SA 2DTDA 2EEZA 3I64A 1NRIA 1JDUA 4YCMA 5LM3A 3E1KA 4E88A 4F6CA 2IYPA 1ORTA 2JIZA 2WC1A 2A4MA 3K0BA 5BN4B 5ALZA 1FDRA 2O2IA 5AKYA 4F5ZA 4TSRA 4TMZA 1O4WA 3FUUA 3HI4A 3KJNA 5EJEA 1AKWA 3O5AA 2DMRA 1Y9DA 4B3JA 2VK8A 2P2DA 3IUEA 4S0ZA 1T3ZA 3GPBA 5M29A 1IY1A 1GUFA 1JALA 4NG4A 3SC2A 3GW8A 3QE2A 3T61A 4BV2A 1PL0A 5KJFA 4OAPA 3T1NA 2K5UA 3JWEA 3KEFA 2ZQ5A 4Q15A 4RKEA 5EZYA 3ETCA 4DMFA 5BV0A 4IJQA 1U2SA 4KO2S 4B83A 4X7BA 4CZ2A 3OZDA 3VJRA 4GMGA 3IPAA 4K9PA 4L6CA 2OZPA 3KP1A 5ITWA 2QMQA 1U0LA 4EUEA 1KYQA 1C0PA 1E1RA 1GN9A 3ONNA 5EPEA 3C1AA 3D59A 3SX2A 5AVRA 3PDIA 5DX8A 1WO8A 5IXJA 1M2JA 1EUYA 1JDNA 2YBDA 4RPKA 4DCPA 4OXQA 2ZCJA 3C0KA 5U1PA 1HDOA 3TLZA 3P2OA 3PIRA 2ZRPA 1KL7A 4MO9A 1XA4A 1KHHA 1L9XA 1YRQA 4LSMA 4EEZA 1KI2A 3W3AA 1GCUA 1NVUQ 3D8TA 3M89A 2N46A 3SEAA 4CNBA 4ESOA 2H4YA 3U7HB 4QPDA 1MJFA 3RARA 2XCRB 4R2XA 3QJGA 1T1EA 2GLXA 2JBAB 2Q3JA 1K9VF 4L07A 1RQPA 2IEBA 4GYWA 3H16A 3WMFA 3K2BA 1HDYA 2PFKA 2XNSA 3Q88A 1MHPA 5KWSA 3QTBA 3EIEA 2BBWA 3NOXA 1MABA 2QW8A 4P5PA 4TM8A 2WYHA 4G8DA 3WMGA 4EGSA 4FYPA 3SGLA 3QYJA 4QLOA 3CX6A 4V0NA 5KINB 4MDFA 3WGOA 1E2NA 3ABIA 1YRLA 3NDRA 3VHXA 3CVVA 3G6KA 3DMFA 4GOND 4HDMA 1SHTX 4WNYA 3ZH2A 4C2TA 5JROA 1ZITA 1E1QD 1M33A 3Q9NA 4GKAA 1DPGA 5TGZA 2WG2A 3PDUA 4NZMA 3HHPA 1SXQA 3D4NA 1CX9B 5DI3B 3LQYA 4X61A 2A58A 3SXPA 3L6DA 3WDMA 1XMQB 2ZYUX 4UBNA 2ZKLA 4L15A 2Q9AA 4X85A 3V8EA 3BF8A 3BG5A 5JJKA 1J00A 1SHZA 1G5FA 2W6OA 1LDYA 2QVCA 2YH2A 2WTAA 4CDNA 4NMLA 2RJ3A 4Q02A 1ECJA 2C3YA 3G2KA 3B51X 3TTTA 3HP7A 2QTRA 3LSTA 4XR9A 1N5IA 1QFSA 2G4LA 1QWSA 3EZLA 1OLSA 4UMVA 4MV0A 2HHLA 4XVHA 5TPWB 3IE1A 1ULBA 5BR4A 5CK4A 2HK8A 3G2IA 1NN3A 3PWTA 4BGIA 1P1RA 1IHOA 2ZJ8A 1YCDA 3P2YA 1FSZA 3K9CA 1XVVA 3ZHCA 4AG5A 2AF3C 3S3TA 2R0QC 3K3PA 4FT2A 4XYBA 4EOGA 5C46F 2ODBA 1F2UA 1G19A 1X7HA 3A1FA 5EUCA 4D9KA 4IXMA 5BPFA 2FK7A 4J0HA 2H2GA 1VL0A 2IITA 3VO9A 2B7CA 2BKAA 3WMXA 2GFHA 421PA 2P1RA 1XPRA 4MP6A 4UEWA 3WY9A 2O2GA 5FPQA 3C45A 2OQ2A 4NARA 3AHFA 1Z6AA 5E2IA 3PNBA 5AVQA 1U1GA 2G04A 4A1OA 3LY8A 5BMVB 4ANFA 2E87A 5HF5A 4FOSA 2GXQA 1W96A 2OA0A 2P40A 4R8KA 3LPDA 1MNQA 2W6QA 4A4DA 3PHIA 4MRMB 4NPHA 5HJ2A 1GVNB 1PWZA 1SUDA 1WU7A 3FYUB 3QUAA 3R76A 3KQOA 4IUCS 2H4HA 2Q6OA 4RESA 1ZD5A 2GBGA 2P91A 3D8RA 2GYYA 3BA1A 3ET5A 3I72A 4XQ9A 4KW7A 3SXUB 2DGDA 2ZJYA 4DQKA 5I7FA 2X8WA 4W5NA 2QRPA 3ND5A 4B6JA 1QQBA 3WKCA 1HO3A 4Y6LA 1U9ZA 4AULA 1YFLA 3RHTA 5TJ9A 3NHFA 1RLJA 1EZ1A 1IEQA 4NCBA 3K72B 2WIJA 3U49A 4WKOA 5EG5A 3G0BA 2XY4A 4HDSB 1BMQA 4R6XA 2FUEA 3W6PA 3GRUA 1W47A 3R6LA 1N4DA 4RPIA 2HF7A 3TBKA 4EBFA 1ORRA 1F5NA 4NV0A 2QORA 3U7EB 2PH1A 1D1SA 2GBFA 1O95D 1FSGA 4LG1A 4BP3A 1JIXA 1HQKA 3JVVA 4MX8A 5K2OA 4CQLB 3DQPA 1B0UA 1PJTA 3ANNA 4FGKA 4DLAA 1R6AA 5G1NA 5SY6A 5ER9A 1U0NA 4TWRA 1RZVA 2CLOB 4CR8A 3HFSA 3P52A 1C14A 1RVV1 4JBIA 2QRGA 2BTEA 2DPLA 1UZAA 2YRXA 1Y3IA 2QVLA 1FFCA 3TR5A 5FRDA 1TA4A 1CNFA 2R11A 2FZ5A 1IRIA 3V4ZA 2Z6AA 3TPFA 1FRVA 3CZAA 3IERA 3PQ3A 4ZDKA 1EQUA 4H0FA 4G0QA 5ED4A 1U4NA 5BWLA 3I12A 2YS7A 4MARA 3WIVA 1Z34A 3NIGB 3W6NA 4BFWA 1HDRA 2NP7A 1M5RA 2QD1A 3FYTA 5FF9A 1EGMB 1TC2A 1KKUA 4ZCRA 1P7PA 4RHUA 5IKXA 1M2OB 1XVAA 4A8PA 1X9GA 1U1FA 1CP3A 2G6TA 3GLKA 3I3OA 1VHJA 3K0EA 4LV5B 4MQUA 4QHYA 5DEIA 4CF7A 1T4BA 3A6FA 5AHKA 5FOUA 1CUVA 1WEHA 3HGQA 4PFQA 2DM6A 1E2KA 3IB6A 1NYTA 3QXCA 2FWRA 4CRWB 2AN4A 3HBJA 3DDOA 3N2KA 4E4RA 1JPUA 2XA9A 2BFBB 1Z5WA 4PG8A 5M5BA 4TWIA 3PRYA 1B1CA 1YFZA 1UQRA 4LJ4A 4YCJA 4C7OB 5HKKA 1OBHA 1VKNA 1V5IA 2IU0A 3C1TA 4RGQA 3PFKA 5IJ9A 2VK4A 4EELA 1QHGA 4LYYA 3TW8A 2O4UX 2A86A 3MTBA 4HLCA 1I6MA 2YJ6A 5J2TB 2WSYB 3NAQA 2GA9A 1DXOA 1EBFA 4HDNB 1LBHA 2I54A 4MUKA 1FFYA 1T5OA 2EX0A 2NVUB 1Y9EA 2J9FB 2PGIA 1TKBA 3OOSA 4FTWA 3RWMB 1X7XB 3ROFA 1YI0A 3RU7A 2I03A 1FRZA 1QDEA 2HC9A 2XNKA 3GLIA 1UC5B 1J2EA 2VP6A 2WJ3A 2V7VA 4HYYA 5G02A 3A6ZA 3VPAA 2E85A 1PZMA 1F20A 3LKZA 4GLLA 2D5IA 4MK4A 1W0KD 1PKXA 4HNTA 4UAJA 1KWKA 1P17A 2FUCA 4US2R 4M55A 4HYQA 1FFAA 2FP4A 4H17A 3N07A 4MKHA 3DVAB 4CQMD 3VOSA 1ZQ9A 3C3AA 1MQ9A 1UBGA 1VG0B 2B36A 4V3BA 5IAGA 5EL0A 3MFYA 4HGRA 5BSEA 4OV6B 1XUOA 3K6KA 3NV7A 3QKIA 4Q3BA 2DOKA 2ACEA 1QYVA 3KBOA 3ICEA 3UCXA 4DMGA 4H15A 5FJJA 1KE2A 3RAPR 1E2FA 5C3MA 4HLDA 4PX2A 3UGJA 1UBTS 3E3OA 4JJKA 4LF4B 3FCEA 3OUTA 1BW9A 1KU0A 3WQBA 4LJ9A 5BMVA 1TK9A 1AS0A 2ZCVA 3HB9A 3NKFA 4BO9A 1I7PA 1X39A 3LC7O 3ND8A 1E2QA 2MJLA 2X1VA 3G5LA 1USUA 2ZSJA 1P2BA 4KXMA 1DWPA 3RC3A 3S4YA 3SBDA 1TNDA 3V1NA 2PZGA 4XVUA 2VDUE 3LJKA 2DHEA 3B1JA 4H16A 5DHSA 4ZDWA 1H69A 4HY3A 3QA9A 3OJCA 4XUEA 5AFSA 1Q21A 4LS3A 3QVLA 2H4XA 3BL5A 4MTLA 5SZIA 3HCOA 2QN7A 3EIXA 1RKUA 2HDOA 4BP8A 2XYVA 3H4MA 5CEEA 4AMZA 1B15A 4IIUA 4DWVA 1E69A 3A4IA 3EXFA 4H7HA 4CL0A 1K8YB 4DWJA 3DOCA 5DNVA 1TM3E 1WIWA 4O25A 1R5NA 1R0KA 2MOKA 5AK4A 1HDZA 2OUIA 1CUUA 2XTNA 3OE7A 3ZDYB 5HR5A 4WZBA 4MS4A 1DARA 1MOSA 4QUDA 3S1AB 1U2TA 3KSZO 3A4MA 3AIOA 3N2GA 3ED1A 4X6XA 3K32A 3N53A 1N33B 1YRYE 1P1FA 4PRKA 5HFJA 2WYWA 4HP8A 4R0NA 5EMLA 1W85A 4KUHA 5HIIA 4B35A 1SIUA 4BB5A 2NU9A 3R09A 1NNI1 4YJGB 4QUGA 4ZC1A 3YASA 2FCAA 1F51E 1QHSA 2O8EB 2WKPA 3W2IA 2DWCA 3W4KA 4AY5A 3GEMA 1EIWA 2C9DA 2FF5A 1W8DA 2GM3A 3KZOA 4QSHA 5L7YA 2PXHA 5FFNA 3BS4A 4DCMA 4YQZA 3S27A 5K03A 1Q16A 4DMKA 1YIAA 2PUEA 4X20B 1DRJA 4OI1A 4AKGA 3QV1A 3EPJA 1I7DA 3H9JA 4KXQA 2PEYA 2FEMA 2LV8A 2XE4A 3T3PB 2G0AA 4KLRA 2WWXA 5PGMA 2ZI3A 3MJVA 2IXEA 2Y68A 1FX0B 5FPSA 5CFZA 1EDOA 3LT1A 3NKLA 1JQEA 4DMRA 1ZH0A 2HBZA 2QVXX 4BWVA 2EZ8A 2GASA 3V34A 16PKA 3JQAB 1IVYA 1QO0A 1SZPA 4NATA 1T8WA 3BXXA 4TLAA 4F5WA 1GY8A 3GJ7A 1TXGA 1PFGA 1U8ZA 2VBCA 4F9FA 1B1AA 5I4KA 4R2HA 5I7AA 1SJ9A 5JS6A 3CLTC 1H5UA 4RXUA 3CEMA 5IFKA 2VNSA 4WL0A 4HWRA 4ND5A 4YI3A 2CYBA 2VK1A 2WU0A 5ANRB 5KNBH 4IKPA 2ZYGA 1MX3A 3PFNA 4TMTA 2RB4A 2BPOA 1SXJA 4PYIA 4BNDB 4B71A 3WMEA 1V4BA 1V8FA 1UBHS 4FDUA 4MQEB 3UT5B 1CXZA 3E9EA 1V6SA 2YN2A 4KTVE 4OLFA 1TKAA 4J2OA 4Q7EA 3AYZB 3MN1A 4YCLA 1KTVA 4L27A 1MV5A 4LBVA 1W1IA 3I9JA 1CF9A 1JQLB 5F35A 1S4QA 4YJHB 1CEEA 3CIFA 1FMFA 1B2LA 4W5JA 3JX9A 5HWSA 1TAHA 4HZGA 2YY7A 2K7ZA 3B89A 2ILTA 3BCSA 4EO7A 4RPCA 2PJDA 3W6OA 1TVKB 3COWA 5FH9A 3KAJA 5TQJA 3FVRA 1M8PA 1GYPA 5FYQA 2II6A 3Q3HA 3SQWA 2LWIA 1NVKA 3H2SA 3GX1A 1M76A 1W4RA 2OXRA 3DMYA 3KOYA 1QYRA 3ECAA 1MJNA 4LZWA 4YP1A 1GPMA 2WTEA 4BC1A 1T26A 2YFYA 4RF4A 3VPDA 4UU1A 4D02A 2D0PB 2AZDA 4ZEOA 4M54A 1CVLA 1ZIDA 2IHBA 3KQPA 1E1QA 3LT0A 4ZAWA 1J1UA 1W35A 1E2PA 5HX7A 4DLVA 4RGBA 2CHUA 2BIFA 4MYUA 1MW8X 1KI6A 2UUAB 1WTAA 2JFXA 2FV8A 1K4YA 3QW4B 5LYYA 5EP1A 3TX6A 4A10A 1HI9A 1U11A 2UUPA 5DM70 1MC4A 5H68A 5LP6B 1M0TA 2JJQA 2YXEA 1UJ4A 4F12A 4YI5A 5T3YA 3DH0A 3OKFA 5IUNC 4LK3A 2WUWE 5K3CA 3GY0A 1Z36A 2JAHA 3BWMA 2ECPA 1HE8B 2OGTA 4D9IA 5F7XA 1TM5E 3TLGA 1LPNA 3KQSA 2D2IA 2GF0A 1XAHA 1ZMBA 3VSDA 1MPTA 1R3UA 4LISA 5KC9A 1M34A 2CUNA 2I8LA 3D5EA 4CG2A 4H3KB 1F4PA 1UKZA 3QH4A 4TVSA 3RNOA 2OB1A 3QVJA 3D2AA 3S2FA 1EVEA 4D41A 5CVCA 1KH1A 5JSFA 4HWKA 3RUHA 3T5BA 1JVSA 4YY3B 3ANXA 1U2PA 2WFLA 2QXUA 4BLSA 4A15A 4EYSA 2Z8XA 4ILEA 2CNDA 3ZK9A 4P3XA 1OU4A 3UG6A 4BNLA 3CM0A 5ETJA 4HQ0A 3HY3A 3TDMA 1MC8A 3EXHA 4HH3C 1REQB 5F5XA 2QAGB 2VH2A 5C4GB 5JLAA 3RREA 5ICCA 3HUEA 4KPEC 3W5AA 4KHPB 5FTNA 2YZGA 4MNTA 3O3CA 3D3WA 5A5DA 4HH1A 3RWBA 3TQQA 2HV8A 3UOAB 4XGIA 3MTAA 2CN1A 3P9QA 5F76A 1XRNA 2HY7A 5CYPA 2CKMA 1OXTA 1YGPA 4F9GA 2D4HA 3ROZA 1RPNA 3N39C 1QF7A 2VJDA 1QCYA 5LDDC 4UW9A 3UV6A 1E9FA 2ID7A 5BVHA 3OT1B 5C1PA 1V4VA 1OQAA 4ZMRA 1C1XB 2VBIA 5DTRA 5JAHA 2B0CA 4Y9UA 3IXMA 3AEZA 1UPAA 2L82A 1BDJA 1UMDB 1F12A 1DKLA 2ZZNA 4TM7A 4G5SA 1QRSA 1PS9A 3QNMA 1KXZA 1M83A 1XL1A 3DBHA 3KRTA 3OE4A 4M8KA 2VLBA 1E32A 5KQRA 4W9MC 1Q91A 1DU4A