3FMOB

Crystal structure of the nucleoporin nup214 in complex with the dead-box helicase ddx19
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
232
Chain Sequence
NLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear pore complex protein Nup214
publication title Structural and functional analysis of the interaction between the nucleoporin Nup214 and the DEAD-box helicase Ddx19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein/hydrolase
total genus 75
structure length 232
sequence length 232
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmoB00
4W7SA 1E2HA 1N3BA 1W36D 1ZMXA 3Q9LA 5C4GB 4AIIA 4QGAA 3SFZA 4D25A 1AIPA 2MMGA 2VP9A 3DOEA 3LH5A 2VEDA 4RD0A 4MDFA 1XXHE 3KKPA 4Q4JA 1QG4A 4LWZA 4MRPA 2JLVA 3X1ZA 3NVAA 5KO2A 5EE3A 3L2OB 4F91B 1G4UR 2ZRBA 4DCNA 3LDAA 1G8PA 1HEIA 4M8NE 5AJZA 3AP3A 1HURA 1G8HA 1KAOA 2GZDA 3GFPA 4F92B 1G5TA 1LTQA 3FB4A 1UKVY 3F3YA 2FGJA 1FQKA 4PZLA 2BM1A 1KJYA 4JLMA 4QC2A 4RD1A 2QROA 4TSFD 1GRQA 4BQSA 1FNMA 3K9LA 4V0MA 1W4BA 2BCGY 4PO8A 2RGGA 3W5JA 2QT1A 2P3SA 4B32A 2ZU6A 1NIPA 2ZJYA 2ZE6A 1NF3A 2J7KA 2Q3FA 4BZPA 1G8FA 5EP4A 4BRUA 2WV9A 1X86B 1TPZA 3NBYC 1GTVA 1P9WA 4NPHA 1TQ6A 1VIYA 4XVUA 1U0JA 4KSCA 1RE0A 3K09A 4JKYA 3PEYA 3EZ6A 2GCOB 1QHIA 1NL3A 2GXQA 1YR6A 4IVRA 3AGQA 4YC7A 1QRAA 2OHFA 3C5HA 3OIVA 4O2RA 3I5XA 4FWTA 2GXAA 5C2JB 1IM2A 1BKDR 4QBIA 4BPBA 1BMFD 2XJ4A 4UNQA 1Z07A 4TZ6A 4BASA 1BO6A 1UM8A 3IDQA 4BFXA 1QZXA 3VFDA 2ZSAA 1E94E 4HAWA 5DSZA 1WF3A 1GOTA 2FU5C 1P5ZB 2H1LA 1G3QA 2Z83A 4V02A 4BLQA 1E2DA 1KJZA 2QN6A 4C4PA 1PVOA 3GLFA 4ZCLA 1K8RA 3OESA 4G0NA 4XWAA 5HCIA 1ZP6A 3BFXA 2W2TA 3E2IA 2PX3A 1MKYA 3PIRA 4HB0A 1DAHA 1X6VA 3FPAA 4GRAA 3SU8A 5JZVA 3ADCA 2V9PA 1TADA 721PA 1TEVA 4I1UA 2RGCA 3BH7A 3THWB 3P20A 1P2UA 2V1XA 3OE7D 5C4MA 1ZYUA 2G0TA 2YC4C 4JVNA 2XZOA 1YKSA 1N6OA 1E9DA 1P7CA 3KQKA 4DSNA 4ERNA 2VSOA 2GK7A 2WJYA 4MYHA 2JLRA 1KO5A 2F1RA 3U2QA 4PQFA 5FOTA 1T8UA 4C0LA 4OQLA 1W0JA 1UEJA 4OBEA 4M1MA 2OFOA 1D5CA 4HUQB 3CPHA 4OHVA 4DBLC 3VU9A 5SZKB 3BIFA 1IY1A 2QEQA 4MUAA 2GAAA 2FSHA 1NSTA 1RYHA 4HB3A 4BEBA 4M1OA 2VYFA 1Z0AA 2XB2A 2DY1A 4KBFA 2ZVPX 4O25A 3L8YA 4Q4HB 4RZ2A 3T5GA 3TUJC 1CBUA 3J81k 2HV8A 2OESA 4PHTA 4CT4B 1OIXA 1VG0B 3U6KA 5F2EA 1CJTC 4IDHA 1ZM3A 4RD3A 5JS7A 1TUEA 1HT1E 4XSGA 4C3ZA 1ZM9A 2ZRGA 2J0SA 2QBYA 1VMAA 5DI3A 1NLYA 2O5VA 2R6DA 4US0R 3RS5A 4YDSA 3AVWA 1AA9A 2ATVA 2J5XA 4FMBB 1P73A 1XF9A 1G291 1LFDB 1WP9A 1A2KC 1P61B 1ETUA 1QHHB 2W6ID 3IHWA 4PC6A 4HAZA 3C8UA 1GM5A 4JVMA 2GNOA 2WVJA 4ILEA 4TQUS 3GJ5A 3FMPB 1M74A 1ONBA 1E1RA 1KI4A 3U3JA 2HEIA 1JR3D 4M1TA 2KBEA 3BD9A 1UPTA 2P0EA 4GDFA 2E87A 2HCBA 2QY9A 2RCNA 4OL0A 1DTSA 3QF7A 5DLQC 5JEEA 2VIIA 2G1KA 2B8WA 4K8OA 1G18A 1UAAA 3IEVA 4RSGA 3SR0A 4MDEA 2J0VA 2IXGA 4BFUA 4QHYA 4EPXA 5JCPA 2ZRCA 1CJVC 2BJVA 2WPDD 5BYJA 3AM1A 1G3IA 2F3RA 4A2WA 2ANBA 2BVNA 4N3NA 4MA4A 1JQJC 4OHXA 3CR8A 1EWQA 1U9IA 5HE8A 4CEIA 1NJGA 1VCOA 5KNCA 3KFVA 2JLWA 1ZM7A 4A0RA 1YZLA 4NP6A 2ZTSA 1KK2A 1Q0UA 3CRVA 4PC2A 4RD4A 3NH9A 3CF6R 1ODFA 1H8HA 3CM0A 3SBEA 3KJHA 3LLUA 4LPKA 4A0GA 1OH8A 3C15C 1LF0A 1KYIA 1PUIA 2F1JA 3MD0A 1LW7A 2CEAA 4DT1A 5B64A 3TW4A 1X8JA 1NLFA 2VO1A 1Z2AA 2GAOA 1AQYA 4Q1CA 4R98A 2VA8A 1HV8A 2ZI4A 1G7RA 2R6GA 3GPLA 2YYZA 2OXCA 1XBTA 3H4MA 3P4YA 1GG2A 4EQ6B 4BLTA 1U8AA 3I73A 3LD9A 4V0OA 4DJTA 3UK6A 3T34A 1S4QA 3K0AB 1LY1A 2V7QD 5FBVB 3K9HA 2F43B 1E1QA 4LZZA 4O3MA 4RCYA 1TQ4A 2QORA 821PA 2KSQA 1E96A 1WDTA 3AH8A 4US1R 4AURA 3K70B 4MQBA 2ZSBA 1G16A 3HPRA 4B3GA 1N6KA 2G3YA 2CMKA 1NN1A 2RGNC 1E2IA 2R62A 5FPHA 5JSZA 1G17A 1QVRA 4LDJA 1T3LA 4LYFA 4N0DA 2WOOA 5FTLA 1XJCA 3X1YA 2A30A 1MO3A 1OHHD 3K70D 1MH1A 3Q5DA 4WA7A 1BH2A 1IHUA 1R5BA 2BMJA 2FFBA 2QP9X 2GVZC 4UNNA 4WXRA 1SVKA 1EFHA 4X8MA 1T0JB 3QKSB 2JA1A 2IL1A 2GJ9A 1OSNA 2N1BA 3QEOA 4RZXA 1OXTA 1NBMA 1CXZA 2QTFA 2X8AA 1HA3A 1KJWA 1M6NA 4TMXA 4B73A 2BCJQ 4BFYA 2QMHA 3ZD7A 4P3YA 4WZBE 1CR4A 1XTSA 1GUAA 4MGKR 4QFMA 3THXB 1ZNWA 2CL7X 4Q01A 1EFUA 4WXPA 1KDTA 3P32A 3C14C 1ZIOA 2FV8A 3B13B 2CVHA 2JDID 1UJ2A 1R0XA 5EZ5A 4DSUA 2VBCA 2DB3A 2V6JA 3RAPR 3T06B 1XWIA 1SVLA 1M7GA 4AI6A 2CDNA 2PJRA 2QAGA 2CCKA 2GBLA 3RABA 3AVXA 1C4OA 3NEJA 1OB5A 1UADA 4I4LA 4A6XA 1K6MA 1OIWA 2E1RA 2WJJA 2FNAA 4MGYR 2HF9A 4KJZA 2RHMA 4M4SA 3K09C 5BN4A 4EFLA 1TNDA 4OQFA 4DIEA 3EWAA 1E2JA 3CWZA 1P6XA 3S1AB 4DKXA 4ZI2A 5C18A 4OQXA 5JI2E 2O8BB 5IRCD 3MLEA 3BWDD 4TTRA 4JBWA 1YR7A 4JLBA 2PMDA 2J0UB 3L8ZA 4ZIRB 1E4VA 1E9RA 1RJ9B 3C7KA 1EFCA 4Q7LA 1DG3A 1NVVR 4YMUA 2YOGA 1BYUA 1VCNA 4TMVA 3V4RA 4GBMA 4AY2A 2K5UA 2FPMA 2RGAA 3GFOA 3IIMA 5E7MA 3ICQB 2O52A 4LGMA 4WOPA 3IQXA 2RB4A 1KDRA 2XEXA 4A2QA 2QM7A 1P60A 2JLZA 2VHUA 2UVQA 4JYBA 4QHSA 2ZUCA 2NTYC 1KSGA 1N6LA 4ACAA 4OJKA 1XXHB 2WJHA 2WSMA 1XTRA 3U3KA 1C1YA 2W2VA 3LQRA 2QA5A 5FBLB 5H68A 4HAUA 4JIMA 3DMNA 2LKDA 3RVBA 1DE0A 5K8LA 4OKSA 3BOSA 3BFVA 4EPRA 3D6TB 4G5SA 3EZ2A 2CJWB 1F48A 2H18A 1FTSA 4C0SA 2VP5A 1GNRA 1HY3A 2FEMA 4OK5A 3GLHE 1D6JA 4LHWA 1N6IA 4EPWA 3A37A 4PHGA 4LI0A 1ZUHA 1KY3A 1KI6A 1SVIA 2CHGA 2FPKA 2HYIC 2XOKA 1VCIA 3A58B 3ZVLA 3U44B 5D3MA 1IJFA 2ZRKA 3WMGA 4KFTA 3ZS9A 2EFDB 1L4YA 4W5HA 5JS8A 5EZ6B 2J59A 2JLUA 4TLBA 1LS1A 1AM4D 4D80A 1HH4A 1YR8A 3LXRA 1V5WA 1ZM2A 4UXJA 1U99A 3NHAA 4LV8B 3P26A 4TYWA 2HUPA 2VP4A 5FTMA 2AK3A 3L43A 2FSIA 3NH6A 1X8KA 5E4FA 1MO6A 2OSBA 4HLQB 3KL4A 1CRPA 2EWWA 4BFTA 3FMIA 5JECA 1YRBA 2N42A 2OFXA 2PL3A 1CKEA 5EXPA 4D81A 2R2AA 1FX0A 4Q9KA 1NLZA 3BAFA 1P4SA 4HLDA 1CJKC 1HE8B 4QNMA 3VNVA 3SOPA 2NO1A 1S3SA 3HR8A 2Q3HA 2IA5A 4TMTA 5IDVA 3TVTA 4Q1FA 2X1VA 2IT1A 4CT5A 1ELOA 1IN5A 1P3JA 2JLQA 1U0HC 3FWYA 4HAXA 1W7AA 3EA0A 1G5RA 1A4RA 1BYIA 3CWQA 4EPYA 2H92A 4IRUB 1N2CE 3GFTA 2JLXA 1NVVQ 3UXMA 4QHTA 1W4RA 1NMZA 5K8UA 1RPZA 5J4LA 2WWWA 2REXB 1VYTA 2WWXA 3FHCB 2C04A 2YV5A 3LW8A 2IUTA 4C0KA 3LBNA 3RS2A 2FSFA 2W00A 4LSGA 2VSXA 2JGNA 3EPHA 1U9IC 4NONA 3VX3A 4JSTA 3OIYA 2A7QA 2KE5A 1MOZA 1S1MA 3LBIA 4B48A 2PZFA 4E07A 1OYYA 3K8YA 4DLSA 5CB6A 1E0JA 4KI0A 5GJCA 4ZCMA 4TWZA 3DKVA 4RKFA 4K81B 2O0KA 4LJYA 4NCKA 4PPQA 4Z51A 5KYKA 1RFLA 1UKEA 2HJGA 1OF1A 1KKLA 3QF4A 4GOXA 5EE1A 4A8JB 4M1SA 2QZ4A 4MGZR 4BECA 3CNOA 1Q3HA 4JT4A 3ZH9B 4C0QC 1D9XA 1GRRA 1VCMA 5L3SB 2YWGA 4XVQA 2ONKA 4MYCA 4JBXA 5FR2A 3VHXA 1ZW6A 3ZIAA 2QGNA 5FFMA 3Q85A 4G01B 3IBYA 1I2MA 4OJQA 2GEDA 2ECKA 1D2NA 2J87A 3VTKA 1GRNA 3Q72A 1XTQA 2I1QA 3UWKA 2HF8A 4B76A 3FFAA 4OI0A 3B9QA 2ODNA 4PSVA 3RWOA 1FL9A 2A2ZA 3T1OA 1KNQA 4YMSA 5J4HA 4CEHA 2JAQA 5JWOA 4L4UA 3AVQA 3CONA 2W6JA 3T1QA 2VHCA 1P2SA 4LJ4A 3DVLA 3VR1A 3HYRA 2KB0A 2EFGA 2C77A 4R9UC 4KHZA 4P4SA 3OZXA 3OIUA 2GESA 2YWHA 3CLVA 4DLRA 2YVUA 2YOFA 2Q0HA 3MUFA 4QGHA 4PSKA 1CP2A 3PUXA 5TB5A 2ANCA 2MSCB 2RHDA 3NEYA 1Q44A 2BEKA 1A7JA 2PBRA 1ANKA 3JVUA 4NCHA 3EPJA 1KI9A 5BYKA 3B6EA 4TMWA 1P2TA 4KO8A 4PPGA 2ZR7A 3DL0A 5AR1A 1R10A 2HYDA 3LBHA 3I5YA 3H86A 1CLUA 2R6CA 2ZYTX 2QAGC 2GBLC 1II8A 2GEVA 3LXXA 3FTQA 4RCZA 3QXHA 1T91A 1N5LA 1G5PA 3JZAA 5JWRA 2WKRA 4YMTA 4GNKA 5DHFA 3BFKA 1SHKA 4M21A 3QXCA 5FOVA 2WWGA 4ARZB 4LC0A 2H7VA 4JS0A 4NTZA 4MGIR 1KSJA 2D74A 2C99A 1E2KA 4Z1MA 2Q9BA 1MO5A 3GLGA 1E2PA 2IYUA 3FDIA 5KSZA 3WMEA 2G0NA 1WB9A 2FN4A 5HZKA 4RJLA 5DI9A 3B60A 4Q00A 4MITA 1E1QD 2GK6A 4ZO4A 2ONJA 4I99A 1XMVA 3BXZA 1M7BA 4TTPA 1E9SA 4V0LA 2ZRIA 4C7OA 1VG1A 2IYXA 4HI0E 4TT3A 4M9ZA 2WJGA 4D0NA 1OIVA 5AK0A 5CK5A 1U81A 1ZAKA 3M0EA 5EXXA 4CIDA 1KHTA 2J3EA 5A0FA 3HU1A 2QTHA 1G4AE 4U7DA 3WHLA 4N1AA 4ZI3A 4AK9A 3CX8A 5JRZA 2BOVA 4IXNA 4WIAA 2PX0A 3UMRA 1W5TA 2R8RA 2V8OA 5HE9A 1XDBA 3QQ5A 4L8GA 4DDWA 5LB4A 4URYR 3TAUA 2OCBA 2V55B 2I3BA 3R8FA 4BRWA 5EXTA 1NBMD 4TL8A 3TMKA 1HUQA 5B57C 3KUDA 3GLIE 3EPLA 4PC1A 4RY2A 2A5JA 2J45A 3F8TA 3IHLA 2ZRDA 1KSFX 3U3MA 3B82A 2AFHE 1Z8FA 1Y3AA 2DCUA 1G1MA 3ND9A 1RVDA 1MRNA 3TSWA 3GLIA 3CNNA 4LOAA 1W36B 3CUEF 4LV5B 1VIAA 2XX3A 2RGXA 1XEXA 1JALA 1L8QA 2C96A 2GF9A 2PH1A 1SKQA 2IYWA 3A8TA 3QXSA 4EKDA 4QKQA 3NXSA 4E09A 1DAMA 5E95A 4C30A 1ZC4A 5KUTA 1A2BA 2HDNB 4KAXA 1GP2A 1DADA 1VPLA 1ZC3A 4IEIA 4LHVA 3RANA 5J40A 1QDEA 4CRWB 1R0ZA 3BRWD 4MYUA 1Z0JA 3GP8A 3SJAA 3TVDA 2A5GA 4Q4LA 1XD8A 2OILA 1DAGA 1HTWA 2BEJA 3K0FB 4JLAA 1IXRC 1R5NA 2DYKA 1RKBA 1N25A 2GZHA 1VG8A 4V0ME 1Z47A 3AGPA 4ZPXA 2ZJ8A 1S9DA 1RRCA 1JJ7A 3FMFA 4BFVA 3HPQA 1G3UA 3OEEA 1OFUX 4L16A 3DM5A 1AK2A 2H5EA 1Z08A 4DLWA 3SS8A 3TSZA 2IWRA 1T3SA 2OCAA 1KMQA 1SGWA 4F38A 3B85A 4JL6A 1F5NA 3KKNA 2XAUA 3B1YA 1IONA 3EAQA 4CEJA 1E9BA 4IKEA 4OHZA 3W3ZB 1NKTA 3AUYA 2F3TA 3TSOA 3AF2A 1SVOA 2CNWA 3GLHB 1AZSC 3EASA 3TAHA 1I4DD 4Q1DA 4F4JA 4GZMA 1S3GA 1SXJA 4DWJA 4M22A 5EJEA 1FP7A 2V1UA 4S35A 1W49A 2AKAB 3KX2A 2XOKD 4UNSA 2IHYA 3IEUA 3PFIA 2OT3B 4V0KA 3K9GA 5JMTA 1XNJA 1OKKD 1OW3B 3GLFE 4IFBA 4G1UC 2EW1A 2VH5R 2O8EA 4YDHB 3KUCA 4I1VA 4Z8XA 4B6EA 1G3RA 4LC1A 2IYVA 2WSSA 3W34A 2ZS7A 4DHEA 2AR7A 2NO7A 3I8XA 1Z0DA 3L0SA 3L82B 3QJYA 3LW7A 4WAUA 2GCNA 1I2DA 5IHPA 1JECA 1GWNA 1TX4B 2GTPA 3MGCA 3THYB 3PEUA 3CBQA 2Y8EA 2ODWA 1W2GA 1RYFA 1G6OA 5HKKA 3KQLA 1QVAA 1XD2A 3VKWA 1KSHA 1GKUB 1E2GA 5KHOC 3HU2A 3RNLA 2O8FA 3UMSA 2AN9A 1IXZA 1WCV1 3FHOA 3AVTA 5B2ZA 4FCWA 2FEOA 4EDHA 4TTQA 4UNPA 5CIWA 4G5RA 3LY5A 1ZNXA 2QMUA 4JLDA 2P65A 2PLFA 3MWLA 4KYUA 4LPSA 3MWKA 4XD7D 4B35A 3KXLA 5FTKA 4GPTA 4G5QA 2C8VA 4JYCA 4QM7A 3PEVA 1AS0A 1TMKA 1VYVA 5FUVA 4HZUA 4D4JA 3CZQA 2ZR9A 3KKOA 4YONB 3TNFA 1NIJA 3WNDA 1IY0A 1AJEA 5F9FA 2AL7A 1S2MA 3EW9A 4IVQA 3QVUA 4HLUA 5EQTA 5L3RA 3VX4A 3ZVRA 4MKGA 1H65A 3PCRB 3AKCA 421PA 4GP7A 2VLIA 4H1VA 2BKUA 1N0UA 3CPJB 3CRMA 4QJ3A 1II9A 4Q19A 2OCPA 3BJIC 4LYHA 4IOJA 5FI1B 2BC9A 5CJPA 3OAAD 4EFMA 2XZLA 3TH5A 4BZQA 2JJ8A 4F4CA 4JJKA 1ZD8A 1LF5A 4LCBA 1FZQA 5DN6A 2GWHA 2FFQA 1R8QA 2JIZA 1IBRA 5CIQA 2Z0MA 4LBVA 1BS1A 2WICA 1Z0IA 3HU3A 1CIPA 3CZPA 4RKEA 3ZQJA 4PQRA 4MKHA 1YHNA 1G8YA 1U2RA 4NE2A 3R7WB 1CF4A 1R0YA 2ZJBA 3N5CA 3QNUA 3QY0A 1VG9B 2B7BA 4P4TA 1OT3A 4GI7A 3SHWA 4AKGA 1VHTA 4HB2A 2VRWA 2XNSA 5L3QA 4YMVA 4EJSA 3ZIAD 2IS1A 4U00A 1P75A 3MFYA 4JLPA 5FUYA 4Q4AA 1NRJB 4KODA 1YZQA 3GCGA 1XPRA 3WNCA 1XPUA 2ZPTX 2NZJA 1HQYE 1KK1A 4FMDF 1EXMA 2BMEA 3B1XA 1ZJ6A 1R2QA 1YU9A 2IYZA 3SFVA 2V54A 3GQBA 2XGJA 1E2MA 1EX7A 1KMHB 1YZGA 1KO8A 4G5GA 1W44A 5G3YA 4A9AA 4DUGA 1F2UA 2W6JD 1OXUA 4DVGA 1JPJA 2Z43A 1ZIPA 4CGZA 4DDVA 5C1BA 3KTAB 1F2TB 3WRXC 3TW8B 1MABB 1NSFA 2QP3A 2XXAB 3CRQA 1PLKA 3RS4A 2ZANA 4M9SA 3BS4A 2BKEA 2VPPA 1JAHA 5DIFA 4HDCA 4LJAA 1B23P 3TLXA 1ZINA 3DKPA 4US2R 3Q3JB 1G20E 5FOXA 4YQFA 2F6RA 2HXSA 4GL2A 4HDOB 4B3XA 3O8BA 3RS3A 4UJ3A 4ITRC 2YINC 3RS0A 1T0HB 2B6HA 3VR6A 2FZ4A 3WRYC 4B3DA 2C2HA 2ZITA 4LYAA 3PUVA 5KPDA 1G41A 2XITA 2ZRLA 3DZDA 5AJXA 5E7JA 4JLJA 3TGPA 2ZJ5A 4TLEA 3WXMA 1UF9A 4IDNA 5HCNA 5HPYB 5FR1A 4ZDIA 1LNZA 1KK0A 4JL8A 2EFHB 1XTKA 4OYHA 2IX3A 3AUXA 4Q1BA 2YHSA 4KSBA 1H8ED 2JASA 1NJFA 2N46A 3RDPA 3U4QB 2O8DA 3BORA 1EFRA 1T9HA 2HJVA 1E2NA 3SEAA 1YZTA 1NBME 1ZCAA 4NHOA 1J2JA 1N6PA 4Z1MD 1W0KD 1JB1A 1AKEA 2G9NA 5KSPA 3TR5A 1IN6A 3Q8XB 3L0IB 5AJVB 5JHGB 1Z6TA 2Q9CA 4LHXA 4OHYA 121PA 1QHNA 1UEIA 2ORVA 1DS6A 4I1OA 3KZ1E 5L3VA 2QE7A 1DVRA 1ZCBA 3QKRA 4EUNA 4TT3D 1KKMA 5CJ2A 1L7VC 4AG5A 1VHLA 3B2EA 4LV6A 1KZ7B 4QOSA 2F9MA 2QPTA 2O8CA 3PVSA 4YLGA 4ASUD 4OI2A 5D3QA 5A4JA 1RRGA 4NBSA 4ABYA 3TRFA 1E32A 3X2SA 2ZSEA 2CBZA 2J7PD 2OAP1 3I1FA 3FFBA 3GD7A 2IS6A 4Q21A 2QU8A 3I8SA 3G0HA 2QQ0A 1NY6A 2W58A 4RFSB 5TV2A 2BMDA 2G6BA 1G64A 4BFWA 1UKYA 3I32A 4D82A 1KI3A 2AXPA 5TY0A 2DFNA 2WMNB 3E5HA 3SQXA 2C03A 1X3SA 2QG6A 4EPVA 3GJ3A 4B47A 3UATA 3SYNA 1WXQA 3ICEA 1T8TA 5UKDA 5DYIA 5DH9A 4KFSA 4B43A 1NNEA 5FL3A 2X19A 3ZZUA 3KKMA 5B30A 1JPNA 2ZAMA 3D8BA 4DZZA 5KSOA 3UPUA 1SXJC 1IOZA 1BOFA 5CM8B 1GAJA 4LJ8A 1US8A 1BIFA 1XMJA 3AEZA 4HYYA 4KVGA 2YZ2A 4RD2A 3W90A 3ZZ0A 1XZPA 2QRNA 4JLNA 2J1LA 4KU4A 2QI9C 2V6IA 4HATA 4Q4JB 5FTNA 2AD1A 1OLOA 1OFTA 1FW6A 2ZRNA 1WMSA 4U02A 4PO9A 2C95A 2X77A 3WHKA 2GDJA 5EP3A 2NO9A 1MV5A 3GJ0A 2HCJB 2FSGA 1E79A 4LX0A 4HEJA 5EUQB 3SJZA 3TK1A 3ZJYA 4AYWA 5H70A 2PMKA 2WM9B 4DEYA 1NN5A 3HYTA 4XH9B 1RW4A 3UG6A 1W1WA 4XIGS 1W48A 1LV7A 2F1HA 1JR6A 4DT1B 1G7TA 5IT5A 1R8SA 2BDTA 1Z22A 2VTKA 2A9KA 1P9NA 2QM8A 3QEJA 3W3AA 1UBCA 1FMJA 3LA6A 3PENA 1KTVA 3OEED 4TSFA 3MRSA 3AF1A 3TE6A 3C41J 4D0LB 4XOIA 2OFWA 4WVFA 1R7RA 2P5SA 1QF9A 3QBTA 5EE0A 2PT7A 3SHFA 3GEHA 5FOWA 4EAQA 3H1TA 4PZYA 1DOAA 1W2HA 3B8HA 3EIQA 4CF7A 4Q9LA 1K5GA 3X1DA 4R7ZA 1AGRA 1Q12A 4FMCF 4PHFA 4F93B 1HYQA 2NQ2C 1YRAA 5J4VA 3PXGA 2QSYA 2F55A 3W9YA 4DLYA 1VTKA 3SNHA 2WWYA 3T12A 4K46A 3DO6A 4HLUC 4M53A 2VF7A 2ZI7A 2JJ1A 3WBJA 2YWEA 2IUSA 1RIFA 5K8TA 4ZKDA 2P5TB 3PEWA 4PHHA 3IPYA 1SXJD 2GCOA 4NYJR 1MT0A 2FX3A 2J0QA 4F7WA 4QRHA 2CVFA 1ZM4A 3CH4B 2ZSFA 1Z6YA 2D7CA 1DO2A 3GLFB 3MSXA 2CK3A 3HP1A 5DYGA 4ZKEA 4CZ2A 2ZXUA 2W83A 4DXAA 4B75A 2PCJA 2GILA 2GKSA 4B34A 4NZYA 5AJYA 5GJBA 2H16A 1RRFA 1QG2A 1X1RA 1XCMA 3THOA 5IK2A 3W8NA 3U7FB 3VNUA 5FPTA 1S9HA 3EZ9A 2B8TA 1PJRA 2NO6A 1PV4A 4HB4A 5HKKD 4IOLA 2R65A 4PANA 3OHMA 1XTJA 2ZAOA 4XJXA 2JCSA 3OE7A 1LB1B 4BE7B 1EFTA 4P33A 4Q9IA 2IWHA 3LO5A 1YVDA 4EJSC 1KO7A 2JLSA 4D4KA 1KI2A 3ZDQA 5CM9C 3AB3A 2P6RA 3VU9B 3THWA 1Q21A 2DWOA 2DFKB 3AVPA 2C9YA 4YXWA 4II7A 3QG1A 3SC3A 4XVRA 2R6FA 1XEFA 2J46A 2NIPA 5TDHA 4J0QA 4DSOA 3PV0A 2AWOA 2IXFA 1W0JD 3KFXA 4Y0VA 1JEEA 1WE2A 4BLPA 4FINA 3G5UA 3OFNA 4PC7A 1FFHA 3TIFA 3KQUA 3I61A 5JEDA 3KKQA 1KGDA 4HUQA 2ZIAA 3MCAA 2AFIE 3A4LA 2QBYB 1YE8A 1NP6A 3VR3A 5DI3B 2AWNA 2P6UA 2FGKA 3DMDA 5BQ5A 1Z29A 3FGNA 2WKQA 4Q4HA 2L0XA 3A36A 2VHJA 3RC3A 3AVYA 3CF2A 2RGBA 4Q48A 4C2UA 1ZNZA 3WYFA 1D2MA 5H8WA 5CYPA 4BUJA 2ZM5A 2WWIA 4URUR 1XCPA 1J8YF 1JEDA 3LAWA 1F6BA 2BMFA 2JIZD 1HT2E 1IY2A 4NDZA 1SKYE 5JJLA 1CEEA 3P4XA 4KFUA 3R9XA 3AF4A 4X8OA 2JEOA 1OJLA 1G7SA 3A4MA 3ASZA 4P31A 1JR3A 2VHQA 1E1RD 1XMSA 2FA9A 4ZV4A 3QPVA 3KJEA 1QHHA 1Q22A 1JQLB 4V0NA 5K8IA 1N0VC 4GMXA 5G53C 1UKZA 4U5XA 1WBDA 2NMVA 1SQ5A 3CNLA 4NYJQ 1RC8A 3AVVA 4QM6A 2BBOA 1J99A 2ZRJA 3I62A 2CE7A 4OK6A 5JFGA 1S1CA 2R6AA 4AWXA 4CEIB 5KNBA 2PLRA 3KQNA 1KDPA 1IJEA 1GIAA 1NN3A 3LQQA 4DC9A 1NVXQ 1M1YE 1EX6A 1OXSC 4Q03A 3U5ZB 5JCZA 4EIWA 3IO5A 3A6PC 3LWNA 4C0JA 5CDFA 2JJ2A 3V00A 3ZQ6A 3P27A 4IFEA 2UZIR 3CIOA 4BLSA 1QHGA 2AKYA 5E3HA 2GJKA 4QG7A 4DUGD 2RH5A 3RC8A 5BWMA 1IQPA 1RRPA 1CR2A 3I72A 1GKYA 1Q20A 1H8HD 1U8YA 4ZCIA 3DM9B 621PA 1N5JA 2ZE7A 3W8RA 2YJTD 2WWFA 3U61B 3UMFA 1COWA 3QG5A 3SN6A 2H57A 3B5JA 4Q1AA 4TQAA 4HAYA 1FQJA 3GLGE 4TYYA 4AKIA 4IDQA 4JZKA 1G19A 4XTRA 1W4CA 2XTZA 3AF3A 1CRQA 3E70C 4JVLA 1G9XA 3BH0A 1UDWA 3Q7PA 1Z0KA 4ON9A 2XTNA 1Z0FA 2PJZA 2V7QA 3SE0A 5KPJA 3CO5A 4B6FA 4TL9A 4NYMR 3U3OA 3DDCA 4M1WA 1JI0A 5AUOB 2ZJOA 3ADDA 2NO0A 4D0GA 2FFHA 5JSZB 4TLCA 1L4UA 3OF5A 5AUQA 4YMWA 4EQ6A 1NG9A 1OH7A 5EE5B 4DDTA 5CLQA 4B33A 1SVSA 3K0AA 4FD2A 1ZUIA 2CL6X 4I81A 3RHFA 2VHTA 2ZJZA 2F43A 1G8GA 2ZR0A 2NGRA 1P62B 2OLKA 3CF0A 3KB1A 4IDOA 4DDUA 5BXQC 4L5BA 1J7KA 1EFRD 1NVWQ 5LD2C 4D26A 3QOFA 4TZ0A 1TQDA 3NC1C 2WJIA 1MRSA 2ZROA 4M9XA 4DLXA 4DIDA 2IF0A 3AKYA 1EGAA 1JJVA 3ZS8A 5EE9A 2ZJAA 2GEUA 1GL7A 4D2IA 2PZEA 1G21E 4IJMA 3BK7A 1E2QA 3QKSA 2ZUDA 1TAGA 5ELXA 1QBKC 4Q47A 2QAGB 2JDIA 3C5CA 4UXIA 5CLLA 4JBYA 5FUXA 4LHZA 4MRVA 2GJ8A 4D4MA 3T35A 4JLVA 3THXA 5CITA 3UWOA 1Z63A 4PAMA 2CHVA 2FH5B 1F60A 1W5SA 2C9OA 1DAEA 1E9FA 1PLLA 5SZJA 1GNPA 1SVWA 5DGXA 1FTNA 2FF7A 4FI3C 1N0WA 2YC2C 4LJ9A 3ZGXA 4WBSA 2QNRA 1EESA 5FL7A 1YJ5A 2IBMA 2IYLD 2WHXA 3E1SA 3VQTA 3BGWA 5EUMA 3O8RA 4C0HA 1OFHA 3REGA 4F4IA 1G3MA 4B2LA 2ORIA 2IYSA 1P2VA 3GJ4A 3KXIA 1FUUA 3PR1A 1UBEA 1OFIA 3LVRE 4JMPA 4JJZA 3WBKA 1TF5A 3H84A 2XB4A 4PR0A 3S1AA 1NN0A 1PUJA 2O8BA 5FH9A 1HE1C 2GCPA 3D31A 5EXSA 3EX7C 2ASEA 3AV0B 4AD8A 1V43A 3QI2A 2J0UA 4IHQA 1DEKA 2CCJA 2OM2A 4FN5A 5TVKA 4ZIRA 3U6BA 1RJ9A 2CHQA 2G88A 4Q1EA 4ESVA 4TYPA 4AC9A 5FPKA 2FPLA 1ESMA 2ZQ5A 2B21A 521PA 5EP1A 2WOJA 1J90A 5G40A 1E79D 2ZRPA 2CXXA 5FI0B 5C46F 4HSEA 5BN3A 4HDQB 2OUKA 3ADKA 4XWKA 5M04A 4DB2A 1N6HA 4NYMQ 3ADBA 2ZI9A 1XXHA 3SQWA 1SXJE 2XSZA 5TARA 1KI6B 1KI1A 3W6PA 1OB2A 3K0SA 2G1JA 2DWQA 3RRMA 2RMKA 4O0MA 3W6OA 3B1ZA 2GXSA 3B1WA 2VQSA 5D3MB 3C4JA 1Z6AA 5JJIA 1D8TA 2IS2A 3GJ6A 3RSLA 1GKIA 3AKDA 2OBMA 4I1SA 1E2LA 4UNRA 4TYQA 4OK3A 2CJWA 2W2XA 3JVVA 3GEIA 2GETA 4GP6A 4DB4A 4MRSA 1DAFA 2EVWX 2XJ9A 4N0EA 1ZUNB 4L9SA 1KO4A 4PFSA 3TKLA 2ZS9A 3K0EA 4JVSB 4Q02A 5G41A 2D4HA 5DHAA 4OQNA 4PSAA 4PZZA 4TQ9A 3TBKA 1E69A 3PG5A 4A6PA 3U44A 3CB4A 1XCGB 3IIKA 1U98A 1S96A 3QPUA 3QVVA 3DPUA 5P21A 2BJWA 4UKDA 2JJ1D 3HJNA 3NBFA 3L0PA 1Z6XA 3WMFA 1FNNA 3AVUA 5TXGA 1CR0A 2DHRA 4M1KA 1FX0B 3K0CA 4MKFA 1DAIA 3VAAA 3ND8A 3K53A 1KIMA 2XNDA 2QUZA 1NKSA 3NKVA 3LVQE 1XEWX 2Q9AA 4BEJA 1EG7A 1GSIA 2CK3D 2GF0A 4W5JA 2NZ8A 2G77B 4B3FX 1F3OA 2OAQ1 1O87A 2QPOA 4UQOA 4G5OA 4GSYA 3CRRA 4LJ7A 3B7GA 4KFRA 3V4FA 4M2LA 2R44A 4JLOA 4L9WA 4MKIA 5CYOA 2BM0A 1FPMA 5HTKA 1FOEB 3BB4A 5IK2D 4FCTA 2OZEA 2AX4A 1JXOA 3EC1A 2IC5A 2BBTA 5FPYA 3GJ7A 4NCNA 4GT1A 3HDTA 4B2IA 3EZFA 4QGGA 2OBNA 2ZRFA 1E99A 3WYAA 2X2EA 2O0JA 2ZUBA 2QENA 2O0HA 4QJ5A 4QJ4A 3RYTC 1KOFA 1AS3A 3BBPA 4Q7KA 3QIAA 2IEYA 2WAXA 3H0KA 3X1XA 3LX8A 1AS2A 1JAIA 4OI1A 3C16C 2QP4A 2IS4A 1XX6A 5FBQB 4YXWD 3FYHA 1U8ZA 4URXR 2ZRMA 1GZSA 4MH0R 5GVRA 2MSDB 4QBFA 1XFAA 5FTJA 3RRNA 1LVGA 4MUBA 3ZVMA 3QSYA 3N70A 3EARA 2YWFA 5FOSA 2W0MA 3ZYCA 3OFND 3R20A 1W46A 4M9QA 1DAKA 3QF4B 4OHWA 2GVDC 2C78A 3UIEA 1KY2A 4WW0A 4P32A 3VMFA 3OEHA 3ECCA 4KBGA 3VKHA 4IW3B 1LS6A 4W5WA 1A1VA 3RLFA 4PAQA 3VKGA 1E2FA 2IYTA 2F7SA 1II0A 2PEYA 3GMTA 3RRYA 2P2LA 4KV9A 4D6PA 1ZBDA 3N2IA 5AJWA 4CW7A 5F9HA 1PZNA 3A1WA 3R9IA 3IGFA 2D3WA 4LUCA 2RAPA 4A8JA 3PJRA 2IW3A 5FBRB 1NMYA 4XTCS 2BBWA 2HT6A 5KDLA 5SZIA 3REFA 1XZQA 2YKGA 3QUSA 3HWSA 4CEHB 2EWVA 1M2OB 4R2IA 3LLMA 3TR0A 5L3SA 1SKYB 3VR2A 3MG9A 5SZHB 4ACBA 1U94A 4GFDA 3B9PA 2HLDA 2QMOA 3MJHA 3F5FA 5KDDA 2VP6A 3O8DA 3ZVNA 4CVNA 3FOZA 2Z4SA 4P4SB 3EC2A 3NDPA 1XPOA 4OQMA 2IUUA 1AGPA 5BN5A 4X8HA 4CDGA 2ZEJA 3EIEA 3K70C 2C9CA 3EPKA 2FG5A 3FKSA 2EFCB 1E4YA 3ASYA 2EYUA 3SDZA 5DE3A 4C9BA 3I3SR 4BLOA 2IXEA 3LX5A 4LYJA 8OHMA 3RS7A 3MMPA 2DFLA 2OBLA 2GJSA 2DPXA 4JSYA 1E3MA 2OXRA 3A4NA 1FMLA 1FUKA 4B74A 3R9WA 2QT0A 4FCVA 1ZD9A 2D2FA 2W0SA 4KXFB 221PA 5EP2A 3RRZA 3WNBA 3VHLB 2JJ2D 2ODEA 4P0TA 5L8VA 2Z4RA 1II8B 5JHHB 3LV8A 4GMDA 5BW8A 1J70A 1NMXA 4PXAA 4E5UA 1GL9B 5ANRB 3VR5A 4BZXA 3PUWA 2ZU0C 3T1TA 1GITA 4ZDWA 1DO0A 4BLRA 2D2EA 5KDOA 5DNYB 1Z83A 2OV2A 2ZJ2A 1E2EA 3AVOA 4ZDJA 3GJXC 1OPXA 1COWD 3IBGA 4POAA 5AWFC 3VR4A 3GLGB 3A1VA 3U7EB 3AF0A 1Q3TA 1N5KA 4DLZA 2IEZA 4TN1A 4DRZA 4BGDA 4P4UA 5JRJA 1E0KA 1RZ3A 2WMOB 1Z28A 2C98A 1AQUA 2EYQA 3KDSE 4Q5IA 4QL3A 2Q21A 4C7OB 1JXMA 2ZI3A 1PLJA 2ZS8A 3WP1B 5KTYA 4ARZA 2KJQA 3KJIA 2QL6A 1CULC 3N2EA 2ZRAA 3IPXA 1GVNB 4Z8YA 4A82A 2MSEB 1TU3A 3K9NA 2REOA 2YOHA 2MMCA 5TMPA 3TJZA 2KWIA 4RZ3A 3TUZC 2J41A 3SYKA 1KAGA 3CKLA 1NY5A 1Q1BA 3DEFA 3PUYA 4NKRA 3SZRA 1XB2A 2FOLA 5LB2A 1R5OA 2QMEA 3CH5A 3NG1A 4C0BA 3MWYW 4MRRA 1Z5ZA 4EFNA 2E9SA 2ODBA 1GILA 2D7DA 3SYLA 2ZI6A 1GDDA 4PQYA 3GLIB 4URVR 4PPNA 1KI8A 2BBSA 3K1JA 1OV4A 4QXAA 3A1TA 3O47A 1Q1ZA 1TF7A 1XEXB 4A0HA 4M1YA 3KXKA 5J47A 1GNQA 2RGEA 4JT2A 1R4AA 3DHWC 1T3HA 4HUTA 2WIBA 1DBSA 1UFQA 4MRNA 5FBWB 5KOYA 5LDDC 1ZNYA 1G7CA 3FKQA 2H8KA 1XTIA 4TL6A 4LBYA 4LRWA 4PC3A 1VYUA 3AQ4A 1R6BX 1X1SA 2AK2A 4H1UA 4NCJA 1E6CA 1I4TD 2OEPA 2YNMA 3U7HB 3CX6A 4B44A 2ATXA 4E22A 5FL7D 4IEEA 4WZ6A 3QXXA 1ZD1A 4QNRA 4A1FA 4MYTA 1XJQA 2NPFA 2OE2A 5JWHA 1JNYA 1I4LD 4GOJA 3A1UA 3K0CC 3BB1A 1Z6GA 3ZLJA 2LWIA 2NPIA 3TUIC 2VL7A 4PTLA 1Q1QA 2A3RA 2QQEA 1FP6A 2JATA 1CU1A 1P9RA 3K0FA 2ZRHA 3FMOB 2GXUA 2FE4A 4CEJB 4C0AC 1CR1A 3QENA 1U90A 4URZR 4DCTA 4GZLA 2P6NA 3T15A 3T1VA 4DCVA 5J4YA 1YR9A 2DR3A 2XZPA 3QE0A 5KNDA 1VECA 4FW9A 5F3WB 4QBGB 3UKDA 2ZYUX 1ZVQA 5IF9A 1N6NA 3AKEA 1SXJB 1ZRHA 3NIBA 2XSZD 1O3YA 1CS4C 2ZREA 2ZYWX 4Q66C 1XD9A 5J4KA 2B7CA 2LCFA 2CNWD 5LBIA 3B1VA 5JLJA 1QHYA 3IUYA 3BERA 4RZUA 4EPTA 1T5IA 4NYIR 2AD5A 1SHZA 3PITA 2PEZA 2O8EB 3H2YA 2HXYA 1BMFA 3I4LA 3T61A 1TTTA 1CJMA 1MR3F 4Z54A 4XWOA 5JJKA 2QTVB 3GLHA 4WZAE 1OKKA 5KSYA 5F98A 2CLCX 1NI3A 4Q9JA 3WP0A 3DOFA 1E9EA 1SULA 4FXPA 4X8LA 5H1YA 3M6AA 1XD2B 2UKDA 6Q21A 2WSSD 4LY6A 1DPFA 1A82A 4BFSA 2OCYC 2O8FB 2OO7A 3PQCA 4R71A 5G3ZA 3EG5A 1OH5A 3TQFA 2Q6TA 1W4AA 2VP0A 2SHKA 3BH6A 5GVSA 2FJUA 4A2PA 2DWPA 3IIJA 4Q7JB 1P72A 3CRW1 1WA5A 2B92A 2XNDD 1NG1A 2I4IA 2A5YB 4KITB 2CL0X 3NBXX 3X1WA 3THYA 3MWJA 1KO1A 4A8JC 2F9LA 2ZSDA 3W5IA 4KCGA 3BC1A 4HAVA 1SVMA 1Z06A 2HT1A 4XD7A 3LRPA 5DISB 1MO4A 3M1IA 2FDCA 4HZUB 1WBBA 3NWJA 1XEWY 1KNXA 4LBWA 4S2EA 2UZ3A 4V03A 3U3RA 2VSFA 3BE4A 3OIWA 5AUPB 1DELA 2P67A 2WZQA 1XU4A 3JZMA 4LK2A 4M0LA 4IXMA 1TEXA 2BV3A 4XSHA 4DEXA 4TMKA 2WJVA 1Z3IX 3U60B 2RGDA 1GFIA 4TYNA 1YZNA 3PUZA 2JLYA 1E9AA 2ZE8A 3KJGA 5CK4A 4Q18A 3L0OA 3U7GA 4Y0AA 2G83A 4FMDB 2R9VA 2WTUA 4DCUA 4PPFA 2CLSA 3OAAA 1DARA 1XP8A 4UJ5A 5GJVC 3SBDA 2CLDX 2IYRA 1XRJA 3WYGA 1M34E 1Z2CA 5J5CA 4AYXA 3EXAA 1JBKA 3WY9A 2WBLC 1D2EA 2GA8A 4KLZA 3ETLA 1D9ZA 2OG2A 2VF8A 1JR3E 3Q5EA 5FUWA 5DN6D 4C2TA 1YQTA 5A5GA 4FWIB 2W6IA 3EIHA 4A0FA 5HZHA 1WRBA 1TL7C 3NTUA 3OEHD 3MJRA 1E98A 4H9GA 1IN4A 1KDOA 3CX7A 1E0SA 1QHXA 1UBGA 1OXVA 3CW2A 5L3QB 1L2TA 2C5LA 1T4GA 3CR7A 2QRZA 2GJAA 4EJSB 4DLUA 2AHOA 1TQ2A 4B71A 2I1VB 2Q3MA 4GOKA 4A92A 4Q4AB 5JI3E 1OYWA 4R2HA 2QPAA 4Q9HA 1B0UA 2RKOA 3Q7QA 2EQBA 4IDPA 4NYIQ 4HLCA 4PAOA 3UANA 4TLAA 1N6RA 1E9CA 4LJ5A 1IN7A 5E7IA 3R7WA 2CCGA 2GZAA 4LHYA 4JKIA 5CDFE 2FWRA 2IHBA 2QSZA 2WPDA 1UBFA 2QGZA 4B3BA 4DLVA 4ZDKA 1ZU4A 3LFUA 4AG6A 1S8FA 3NDBB 1F2UB 2ZYVX 2ORWA 3P1JA 3IQWA 4DCSA 2WKPA 3GEEA 2HLDD 2ZVQX 4LBZA 1KZGB 2V4ZA 1OH6A 1TUIA 2NG1A 3UG7A 1IXSB 1M7HA 4IOKA 1Y63A 3W6NA 2GHIA 1W47A 3HR7A 3BB3A 1ZU5A 4A36A 4ESHA 2PT5A 3LNCA 4L15A 3QXJA 2LKCA 1YZUA 2XTMA 1TF2A 2KI5A 4NH0A 1WQ1R 3FKSD 3QKTA 2BWJA 5HR5A 1KMHA 3CPEA 3NC0C 3R8CA 5KU1A 1C9KA 1Q1EA 3SJCA 1XJ0A 2WWHA 1VDZA 3B78A 4LJ6A 2IYQA 4NU0A 2DFTA 3QKUA 2BHRA 3QPWA 3KTAA 1DG1G 1F2TA 4OI4A 1EWRA 1QHSA 1MABA 2FMXA 2WIAA 2XXAA 4FIDA 4AKHA 2QAJA 5FOUA 4A15A 2V3CC 2F1IA 4A4DA 1EK0A 3D7MA 4NMMA 5LPNA 3RSOA 5AUNB 1KK3A 1T5LA 1TU4A 2GRJA 2IYYA 4CYMA 3FHTA 4B2PA 1OE0A 3IKJA 3AP2A 2O8DB 1N5IA 4QBHA 1YZKA 2A78A 2A5FA 1KI7A 2REBA 1E0AA 5DO9A 2ERYA 1NVUQ 1IN8A 3DZ8A 3A1SA 1HQCA 4RVCA 1H8EA 3ZZTA 2ZETA 1K5DA 3KB2A 2NOAA 1W36C 2H17A 1CTQA 4NCIA 1ESNA 2EFEB 4DLTA 1OHHA 1M8PA 1VKJA 4G3XA 1W0KA 3EA5A 2BIFA 3F0TA 5JBQA 3G82C 3EZ7A 3QKRB 2DBYA 2Z5FA 3U4QA 1AZTA 4E03A 3QBVA 3EWSA 1SZPA 2O8CB 3M4YA 4URWR 2PZGA 4IOMA 1R0WA 2FZLA 2QE7D 4IVPA 4QGFA 4Q7MB 3GJ8A 2A5DA 1GL6A 4ASUA 3IILA 3MAAC 3V9PA 4RFVA 1AN0A 2WAYA 1IAQA 1CJUC 2J7PA 3FVQA 5GJWC 4KLNA 4BWYA 5FPSA 3NHBA 2VP2A 1XMIA 2FFAA 5CB8A 2CE2X 3FE2A 2KBFA 2J9RA 2X2FA 2TMKA 2PCLA 3O8CA 4DSTA 3IO3A 3T5DA 3ZD6A 3SJBA 3NBZC 4RD6A 1A5TA 4JLKA 1AKYA 1OXXK 2ZE5A 5B58C 2D62A 4PO1A 2OLJA 4HZIA 4RFSA 1G6HA 3AP1A 4B3CA 4BFZA 2IK8A 4TLDA 4O2LA 1S0UA 4PX9A 1US8B 4KVAA 1U0LA 3TQCA 3I92A 4UXHA 2D06A 3D3QA 4JL5A 4AKEA 5GADl 4TL7A 2ERXA 1Q57A 2EU8A 3ONWA 4FMCB 3RWMB 4KYIB 4TMZA 5LD2B 2Z6VA 1J8MF 2IF2A 3SI7A 4NL4H 3KQHA 2ZI5A 4W9MC 4D4LA 1T6NA 1X8LA 2RGNA 4AYTA 2AXNA 1UDXA
chains in the Genus database with same CATH superfamily
1E2HA 1W36D 2EG9A 4MI6A 3Q9LA 2ZCUA 1DC3A 1KRXA 1T0UA 3L40A 3M2PA 2PGOA 3PXUA 1GG8A 2N0SA 2VP9A 3N0WA 2C1ZA 2HF7A 2FRDC 3T3MB 3SXJA 1DAOA 1XXHE 1PF7E 4I1IA 3VDXA 1LPBB 1QG4A 4LWZA 4ND1A 5SYAA 4FD3A 5C7LO 2VAMA 3LP8A 1OFGA 1XF1A 2VKQA 3BULA 4OM8A 2MWMA 4LW8A 3WIEA 1G4UR 1GTL1 2COEA 3TR6A 4BWFB 1X42A 4DM3A 3HU5A 1U5BB 4UASA 4DCNA 1V47A 2C8LA 4LMAA 3C85A 5AJZA 4BE4A 1CPYA 1BU5A 1G5TA 4FBLA 1JZQA 3E61A 1XZJA 3DWIA 4IV8A 3RVOA 1ZKDA 1KJYA 4QVIA 2HM7A 2QROA 5JIBA 3EMBA 4V0MA 2RGGA 4W99A 3KR0A 1U28C 4MWGA 2G9VA 2P68A 4R6XA 3VO9A 1X7GA 2ORED 3V2HA 2LPMA 1AKTA 3EIWA 4EI7A 4IUBS 4BZPA 1PK7A 3VKVA 4AT1A 1PV1A 5EP4A 4F5ZA 4BRUA 4TRRA 5IYZA 5KNDD 1X86B 1TPZA 1Z4JA 2Y1WA 4ZOLA 3ETHA 3LIIA 1JA9A 1R8YA 2O2DA 1MDBA 1K5HA 1R27A 3ANTA 2EG5A 2GX6A 3RVDA 4B6OA 4CL8A 4RL6A 1ZK2A 2AHRA 5HIIA 4AIRA 5K45A 3LOUA 1A71A 1NXTA 3RSHA 5HIMA 3R5TA 4YC7A 2OHFA 3C5HA 2OC4A 3MGKA 3OIVA 2VZ9A 2ONYA 3T3EA 2GXAA 2B0JA 1BKDR 1QAQA 3PVZA 3PTAA 4TTSA 1BMFD 1RKUA 4UNQA 4AJJA 3CRNA 3HUFA 4CBVA 9LDTA 4DKJA 5AESA 1QZXA 4FDMA 3GDGA 4R8SA 3FWNA 3DWGA 2AZMA 4PSCA 4IIFA 3ZXUB 4B09A 4BQPA 2Z83A 2V6FA 2IZOA 3GBSA 5DGTA 4JP1A 2VF4X 3F1KA 4MVJH 4ZCLA 1K8RA 4GEKA 3HCEA 5AK3A 4G0NA 1ZP6A 3BFXA 1OWLA 3DBOB 3MBOA 1CUGA 1L6RA 1LC3A 1SUPA 3E2IA 1DAHA 1EJ0A 2I2WA 3DFUA 5ER6A 2HCTA 5AOBA 4ETNA 2X4IA 1E3WB 2B2CA 3OLYA 4V1CA 2H08A 2X9QA 4DQ0A 4I1UA 4JI1B 1ADCA 4BZZA 2QD3A 3DMHA 5HWSA 3MXOA 1VLJA 3P20A 4J7UA 3OE7D 2IRWA 2H0QA 1DT3A 1N6OA 2HHAA 1E9DA 5CP8A 3VPFA 1VE9A 2UV8A 4ERNA 2VSOA 1K2VN 4IKOA 4EZIA 1C8LA 1OYOA 2F64A 2NO4A 3B36A 4MPTA 4D1YA 5EHZA 2G4LA 4JELA 4MQEA 1KAEA 1ORTA 1T8UA 3AHDA 1K2WA 3KPYA 1W0JA 4FYIA 4M1MA 4BGIA 3WAGA 1D5CA 3KM0A 2H6EA 2P79A 4OHVA 5FLXA 3QMVA 1YZ3A 4JJ7A 1HDYA 2QQFA 3UW3A 1ZH6A 2NU7A 1RI1A 3NBUA 1YL5A 2OC9A 2VYFA 2V9CA 5CA0A 3CLHA 1DTEA 1FFXB 2PSDA 2ZVPX 4KBFA 4RZ2A 4J2HA 1ECJA 3T5GA 3V2UA 3NPMA 2CT8A 3G6WA 3J81k 4K05A 2HV8A 4U2KA 5D1HA 1VJ0A 4PHTA 1QRRA 2JIRA 2W2LA 1VG0B 4EABA 4IDHA 1KYTA 2HA4A 3L4BA 3AFIA 5JS7A 3KWJA 4II3A 1MC4A 3T5MA 4DFDA 5K3DA 1ZHHA 1DT5A 4WY2A 4ND2A 4Z9FA 3BMCB 3N0TA 3UA4A 4RACA 1H05A 5L9AA 4HQRA 2O5VA 3KCQA 2K2WA 3RS5A 2W5UA 4YDSA 1KRHA 1RAGA 1U8FO 5H02A 4AJNA 4BO2A 3FWHA 4KHPB 2VHWA 1P73A 2IY8A 1P80A 2PBLA 1WP9A 2XDAA 2QUIA 4G0VA 1ETUA 2W6ID 4NNJA 4CV1A 5I4BA 1L5LA 4DR7B 5BV0A 1TZKA 2IPMA 1R6UA 1L3BA 1YQWA 3W2IA 5IVPA 1GZVA 4QPZA 4UEJA 4W1SA 3MCZA 1KI4A 1O1YA 1OXKB 3OKFA 4NATA 1HR0B 2HEIA 3ZGNA 5A5DA 2QD2A 4M1TA 2KBEA 2OVFA 5AVJA 4DM7A 4AECA 4OJYA 1ONOA 5ALFA 3BD9A 3NV7A 3JRWA 2P0EA 1NJ5A 2HX1A 3PGMA 4PRLA 5IULC 4G63A 4GDFA 4L4ZA 1DTSA 3U4DA 3ZJUA 1HTTA 1FVHA 4FSHA 4C88A 2B8WA 4K8OA 2BKXA 3NAZA 4CR8A 1TJ5A 4M0FA 4TUYB 1OI2A 5D8DA 4FHZA 2OV3A 2DPLA 2QR3A 4QHYA 2BJVA 2DULA 1U7OA 1E5TA 2WPDD 1BSVA 1TA0A 1G3IA 1M33A 2XUAA 3LGSA 3KVRA 4O2AA 2J6BA 1R6TA 2NXCA 4WN9A 3ZKWB 3VZPA 1RHUA 2CKDA 3CR8A 5KKCA 1GNSA 1EWQA 1Y6JA 5HE8A 5LQNA 2GT1A 3TIVA 2P9EA 5KNCA 1TEZA 4NDNE 1ZM7A 4A0RA 4NP6A 4J0GA 4LZJA 4MHSA 4DY6A 1KK2A 1MU0A 5F73A 4PYIA 3VYTB 3C87A 3CRVA 2QRVB 3UHJA 4TMFA 4RD4A 3AEXA 4O4LB 1O5TA 3NOOA 3D4OA 4XX0A 3R7SA 1ODFA 1H8HA 1WXWA 4J2OA 1K7XB 4YAJA 2QLJA 4YRBA 1NUPA 2WUFA 4X3OA 2DSNA 5F64A 5H81A 4D9IA 5JCOA 3ROQA 4RAOA 5LL6P 5JBIA 5B64A 3WLEA 1PUIA 3LUFA 4KI7A 4NK5A 1RAIA 1LSUA 1O9GA 1X8JA 4DV4B 1ZR4A 2BZSA 2GAOA 4L72A 3KQVA 1FLAA 1WLYA 4QFCA 1TE2A 3TSAA 1KVRA 3ZHCA 4CMEC 1I9CA 5A4IS 1XTTA 1XBTA 1TJYA 2HA0A 1PR2A 3T5BA 5IWAB 1GG2A 5P8WA 4BLTA 1USVA 4KQEA 4WNAB 1FSZA 3NJRA 2J4DA 2WYWA 1DQRA 3UK6A 1QYVA 4OXXA 1G20A 3I9OA 4YK7A 1J5EB 4BQRA 2F43B 3ZEIA 4LZZA 1JDUA 4H7KA 4RCYA 3SE7A 2FZWA 1IM5A 1M6EX 2EZ4A 1UWVA 4N49A 4UARA 821PA 1Z33A 4GPAA 3DV0A 1K3UB 3L05A 2HSWA 4US1R 4UREA 1DRKA 3KCNA 3GDHA 3GFGA 4PO3X 5FIUA 4LOHA 5DGHA 4B3GA 4TOIA 5DHRA 2G3YA 4OH1A 4LISA 4X6UA 3SS9X 3T1YB 4B3MB 2W71A 1QRUA 1E2IA 2R62A 3DQQA 5FPHA 6CHYA 3QWFA 2NSDA 2XUZA 2YRFA 2CNDA 4PAGA 5L95A 1EFLA 2R11A 3DAFA 3EK2A 5FTLA 1MO3A 4LGYA 4F2PA 1AMNA 2UVPB 3Q5DA 4WA7A 4WXRA 1IHUA 2BMJA 2QP9X 1LJUA 4UNNA 1SVKA 2CJXA 4ZO7A 1T0JB 2PQ2A 1PDVA 3QKSB 4LDRA 4UM7A 1XGKA 2FR8A 2JA1A 2N1BA 1GN8A 1SO8A 4BRZA 4RZXA 2X8AA 1NBMA 4I5FA 1M6NA 1SUCA 2QDXA 4UEOA 4P3YA 3RUEA 3WV4A 1BFUA 4MGKR 5EY5B 4H3HB 1CE8B 5MN4A 3THXB 1PJAA 2Q8QA 4WXPA 1FJXA 2HK8A 2R1TA 3C1AA 4TWBA 1K7SN 1WZCA 4H4DA 5DK6A 2P30A 4C4SA 5IEJA 1PWHA 1V16B 3QKIA 1ZXBA 3D1VA 3TB6A 2V6JA 3DAPA 1IBSA 3VV3A 1I3CA 4H6PA 4B7UA 3Q87B 3RUPA 5LQKA 3ETJA 4MWTA 5DLYA 4AI6A 3HNOA 1RPTA 2PJRA 3T5TA 4ONEA 2CCKA 2PWBA 1DU4A 1Z4QA 3P9XA 4EI8A 4BQNA 1C4OA 1I1NA 3AM5A 3NEJA 4U2EA 4C4RA 3UZUA 4B4KA 1AOXA 4MGYR 4WOKA 2YQ4A 4L22A 4M4SA 2IY7A 3MD9A 3T0GA 3BJEA 3BZWA 5HMMA 1ZI8A 2M1XA 1JIJA 2PY6A 2IUEA 1N3LA 4ZI2A 5JI2E 1THMA 2OQRA 4GDMA 4WD3A 3GOQA 4ZEOA 2AJTA 3RBXA 3EH2A 4TTRA 2ZATA 4JBWA 1YR7A 4QPNA 2PMDA 1EJ2A 4OYLA 1F8GA 1QH1B 1ZGAA 3JY6A 4ZIRB 2QMQA 4I9NA 5T41A 5FEUA 3EQ2A 2XE8A 1ECBA 3P2MA 3R76A 4TMVA 1CP3A 1UWCA 4JJEA 2IGTA 1WTAA 4M0KA 1MO2A 3RU3A 2AG6A 2P9ZA 3D6AA 4WOPA 4YCBA 5CXXA 5E1DA 1AUOA 3HWX1 4A2CA 3TRDA 2AQHA 2GWRA 4A2QA 3UJ3X 2VHUA 4OMFG 2ZPAA 4JYBA 4RH0A 3I9NA 4W8HA 4YP7A 3OT1B 3N58A 3HXPA 1XXHB 2GPNA 1SELA 3IQEA 1XTRA 1SN7A 2GPTA 3OIFA 4WXMA 3TE7A 1XZNA 3LC1O 1TXGA 5E8RA 4X64B 3GHHA 1ISMA 5TQVA 2XRFA 2J3IA 3BIJA 4BBPA 2HRRA 5F12A 3PFFA 3DMNA 1DE0A 1NE7A 4ARVA 1HDRA 1U8CB 1UC8A 4BQFA 5K8VA 3BOSA 3BFVA 4G5SA 5CB4B 2CJWB 1ILWA 1CZNA 3N39C 1F48A 3PRYA 1PGJA 4OAPA 4Y1RB 1FTSA 4C0SA 5JAZA 1GNRA 1HY3A 1UZAA 2X40A 3GLKA 3U81A 3DAYA 4LHWA 3V8MA 4K26A 1ISPA 3IRVA 3B3AA 1KY3A 3SXUA 2X86A 5GGYA 3GBPA 3HB7A 4BO8A 4DV6B 2BKVA 3AUSA 3ELDA 3UEOA 2XOKA 4IWXA 2HYIC 3U44B 1T0BA 1A4XA 3OJEA 2BFFA 2I4OA 4JP3A 5D3MA 3WMGA 3K72B 4HGOA 2CSUA 5B3JA 2GBPA 4KFTA 5GWXA 4OOEA 2UXBB 4GECA 3PGJA 2I67A 1N2ZA 1TTQB 3SHVA 1BVUA 1JHVA 1PP4A 3A70A 4TLBA 3VPAA 5AW3A 1HH4A 1TD9A 2Z9DA 1UMBA 4PZ9A 3ROXA 4MV7A 1YR8A 2ZTVA 4HKTA 3VGPA 2PVPA 4UW9A 1V5WA 4P82A 3FLAA 1EBUA 3V34A 1Y6QA 4UXJA 4C4YA 1PE0A 4Z3KA 2FEXA 4GX5A 2OQ2A 2XAAA 1DX4A 2G70A 3EGIA 1NMSA 2VP4A 3MT0A 3NJ4A 4TQGA 4CKYA 5HQ3B 4ZXFA 2YZMA 2QJOA 3H8VA 2AK3A 5FTMA 1X14A 2I65A 3L43A 3NWPA 3JX9A 3L4BC 4I55B 4QDOA 1KJ9A 3NH6A 3WTBA 3WSTA 4NXNB 3ZBPA 5EMJA 3R7BA 1YDMA 3SM3A 1DIOB 4RUKA 5BOSB 2CXTA 2ZB2A 1EA5A 4BFTA 3FYSA 3V7FA 1QK3A 2XB6A 3RS8A 4D79A 4EY5A 1JLHA 5F2KA 5FOQA 1RQRA 2YHAA 5CU7A 4O5AA 4MW4A 2MINA 1NLZA 1RKQA 3OTGA 4AJHA 5IW8A 1P4SA 1QIMA 3G8DA 3PXEA 4J90A 4S1WA 4KVFA 3V7NA 1HDOA 5LA6A 3UPDA 2JZCA 2ZB7A 3HDVA 5GZ1A 1MC5A 1PVVA 2YW2A 1FX1A 1G60A 1P3JA 1QOQB 2JLQA 4HVAA 1F9EA 4PINA 4E2ZA 1L5VA 1U0HC 1HG1A 3FWYA 4H7FA 3TTTA 1G5RA 1P8AA 3S5JA 2O9JA 3TZQA 4F06A 1DUVG 4EPYA 5DZSA 3LC2O 5KINB 1EAMA 1SJ9A 2ZBUA 3P94A 2PA3A 3AY0A 3RTBA 4QHTA 4ZGGA 2YDYA 1DXHA 1W4RA 5LP6C 5K8UA 3HBLA 1RPZA 3D8UA 3OHPA 1Q7GA 1KWGA 4MV9A 2FTKE 2IELA 3FHCB 4WMLA 4X1IB 4D99A 1T5OA 4EG4A 2Q46A 3LW8A 2IUTA 5CA1B 1P45A 4RKYA 3LBNA 1D8AA 1T5DX 1U3TA 3GL9A 3HR4A 3RS2A 1K9SA 2M1ZA 2VSXA 4RMNA 3FETA 3KYCB 2J9GA 3BWMA 3FTCA 4J4BA 1FYFA 3VX3A 1GU7A 2WFLB 3GAAA 3B9BA 4B9EA 5I7VA 5D5HA 2E5FA 2A7QA 4IX9A 4Q4CA 5HXAA 3MILA 4K1LA 2PA0A 3VDQA 1S1MA 2F9FA 4BGVA 4E07A 4A6EA 2NQ8A 4JHXA 3G2HA 3K8YA 4E5NA 4JFAA 5CB6A 1QYWA 1E0JA 2RAUA 1V26A 4Z51A 2LTAA 4K81B 4LJYA 3EIUA 4D6YA 3AONB 5JCOC 5G1OA 2PKQO 2PIAA 1KKLA 1SC9A 4GOXA 4R9VA 4ZO9A 1NUTA 4MGZR 3VA7A 2Q6VA 5DLPA 1ZNQO 2PKCA 4JT4A 5EIWA 4NOJA 3ZH9B 3GEMA 3QELA 1DEAA 4YO7A 2AFIA 4KMOA 4LXYA 3ITNA 1VCMA 4GI5A 4WJLA 4S04A 4KUGA 5L3SB 2IQ5A 1PZHA 1FDSA 2E1PA 2ZJFA 1YZYA 4J7CA 4ECAA 4Z0HO 2C7RA 2AOUB 1HO3A 3LRTA 3MUEA 3CVYA 1B6SA 1X80A 1XDZA 4HH3C 1I2MA 1CUIA 2VYND 4YS6A 4O5OA 3BXHA 1H2HA 3ELUA 5EQFA 4DWOA 3KK0A 4ANFA 1D2NA 1UJBA 5HUJA 4C7BA 3Q72A 5C5IA 2HF8A 2QTAA 1U31A 4LX8A 3DEJA 4W7IA 3B9QA 1DEXA 2ODNA 2CFOA 5TQ2B 3TXXA 4ND8B 3VR2D 2LIVA 1YZFA 2C8KA 4KWCA 3TZHA 4RFLA 4HDRB 4HK4A 3CNEA 5CT6A 5J4HA 3EW7A 5JNTA 4CEHA 2G8NA 2Y05A 3H0EA 1XFDA 5BVHA 1NUUA 1UBTS 2R85A 2V7EA 3A2KA 1ZW1A 3G5AA 5TEWA 4XAQA 3IDFA 1KP3A 5A5EA 1P2SA 1MXFA 1ZGHA 2A9FA 3Q6IA 4DN6A 5HYVA 2OA0A 1HE5A 3IRUA 4OQDA 1QU3A 4J2TA 3GGPA 4R9UC 4KHZA 2HR1A 4N7RA 4W5NA 1EGMB 2HB6A 1R9MA 3R8XA 1ZWKA 1A9ZA 1ZEMA 2A9QA 3D2BA 4FE4A 4AAYA 2F3UA 2YVUA 3AF6A 2RHLA 4N5NA 2IXAA 3T3IA 2FR8C 1XO1A 3MUFA 2XMRA 3KXDA 4KR0A 1WB6A 1KS2A 2NQTA 4YUYA 4UMVA 3TMAA 2J85A 2BEKA 6ADHA 4MV0A 4PXSA 2MSLA 4MW7A 1ANKA 2YYSA 4XFJA 5FUBA 4NCHA 5AK5A 4RY0A 3WK4A 5CX1A 3KQTA 3B6EA 3FVVA 3K7EA 2Q3JA 2ZDHA 2I33A 3EGDB 3ES9A 4I7EA 1V11A 2P7IA 3L1HA 4IQ8A 3P8ZA 3AIKA 2A0XA 3D81A 1PL6A 1O4WA 2ADFA 3FYTA 1JA1A 5A1TA 2JFFA 4HH0A 1E2UA 4REOA 3GFVA 4Z5XA 4N82A 3IPAA 3OM9A 4A6DA 1PNVA 4J6EA 4LZOA 1OTHA 3RC2A 4KFCA 4JBLA 1NRIA 1SU6A 2EBHX 2UZAA 4MVWA 2WKRA 2JKVA 2FSUA 4GNKA 4XI9A 4B7AA 3BFKA 4IAOA 1CUVA 1SHKA 4QLAA 1ZN9A 3UY4A 5FOVA 2FN8A 3WWYA 4D43A 2WWGA 2MOKA 1ZOSA 3O38A 1KQGA 5ILOA 2RHBA 4KBYA 5J3JA 3FNFA 3W2FA 4MGIR 4M36A 2C99A 4UAGA 4Z1MA 3VO1A 5KYYB 3O2NA 2UZ1A 1E2PA 1OBVA 3D1LA 1H2AS 5KSZA 3L79A 2H4YA 5ESDA 5B1DA 3WL6A 4Q00A 1E1QD 1ZMRA 1XMVA 1M7BA 2HQ1A 3MQ2A 3CH6A 5EGSA 3EVZA 2B8NA 2IYXA 3K96A 3R3VA 3A1CA 3LQ4A 1OIVA 3QA3E 4L0CA 1JLLA 3IPLA 1N2XA 3URMA 5JH7B 5EXXA 4Z4QA 4ITUA 4CIDA 5KKNB 2TSYB 5BYBA 2R5FA 3HU1A 4U7DA 3WHLA 5CEJA 3WRXA 4TV8F 2VCHA 3DHYA 1AK1A 3G9XA 4WIAA 3TL2A 2Q50A 4BXOA 3OF3A 5HE9A 2V8OA 4NF2A 4F4DA 1N0HA 3VZCA 1A8PA 1LI7A 1PS0A 2P4EA 4DDWA 1UDBA 1LLFA 4URYR 3TAUA 3MJVA 1IIRA 1X19A 1PBTA 4CM1A 5EXTA 5A03A 3IV6A 4OL9A 2UDPA 2PKRA 4GZ3A 4TL8A 3WE7A 5EKUA 2I5PO 1VBMA 3Q9UA 4EX6A 1AV6A 1KEEA 3CZ5A 5DEIA 3WRWA 2B4KA 4Z4FA 2NNLD 4X9XA 3EF0A 3LHSA 1RZVA 1XRPA 3U3MA 4JJ4A 3WR5A 2XF2A 2CJYA 2BE9A 1SIOA 3QTLA 2YFHA 2DCUA 4EEZA 3N3BC 4HPXB 2Q45A 5BV1A 1L1RA 1LBTA 1MRNA 1RVDA 3O8OA 2ZUEA 3ND5A 3IKLA 4LOAA 4RNDB 4EH1A 3KHKA 3F78A 5HGXA 3HRKA 4UD2A 2SKEA 3H5TA 1SCUA 1D6NA 1XEXA 1D0SA 1JALA 2QX6A 4ETIA 4BNYA 2W98A 5I9MA 1L8QA 2GF9A 2RH4A 2PH1A 2ONZA 2YJ6A 1QO0D 2IYWA 2ZUTA 3ZE8A 2AN1A 1NQVA 3ORFA 1ZC4A 2C0CA 3ISJA 4K03A 4C30A 4WWHA 4EO7A 4TM8A 2R1UA 3RANA 2J5QA 2J9ZB 3KAKA 4AVYA 1D0IA 1R0ZA 4RULA 3U56A 1Z0JA 3KWFA 3DQPA 2ZWPA 2ZUVA 3M82A 1TZMA 1DAGA 1W25A 5K1ZA 3R3UA 3RFFA 6GPBA 1S2OA 4JLAA 3HNRA 1CUBA 2PKQP 1QFSA 1SIBE 2CXPA 3DDOA 3PGA1 1XN4A 3ONVA 4ZU1X 2XDQA 3PXBA 4ZPXA 3M6FA 1NLUA 3EUFA 4PIMA 2V5AA 3D6MA 4BL5A 1H93A 5LOVF 3VSAA 1Z62A 1XDDA 1YB4A 1OFUX 1R18A 3AYZB 3OY7A 3O4JA 1TB4A 3TSZA 4LTNA 2IWRA 4C22A 3IXQA 2FFRA 4O3FA 3EDMA 3N86A 3AYXB 5KI6A 5A3QA 4Y7CA 2VQEB 1SGWA 5AICA 4LJSA 4WACA 4PE5B 3AZQA 5JDCA 3EZGA 4XCQA 3BWVA 1CY2A 1IONA 4V0RA 4M83A 1Y8QA 3O0DA 1KE2A 4CEJA 3UAXA 4O33A 5IVIA 4K1XA 1YUNA 3GT3A 1TM1E 1V48A 1OYVA 1AZSC 3EASA 1IOLA 4OJTA 4Q1DA 3TAHA 2A9PA 5ARCA 3CGGA 3PGXA 1C14A 2UUOA 4DWJA 2BJHA 3UOWA 1QFMA 1S3IA 4DJJA 2V1UA 5FUQA 4CM6A 2AKAB 1DXYA 1X92A 3KX2A 2QTWB 3HCNA 4OA5A 1H5QA 3PYXA 4RENA 4OYRA 3PFIA 3JAKA 1KTIA 5DYTA 3K9GA 5JMTA 1XNJA 5KTOA 3OJXA 5ED4A 3GLFE 4IIUA 4MINA 3FHLA 2NU8A 3H9GA 2O8EA 4AMUA 3UMYA 2JLUA 4IYRA 2VRBA 3L01A 2NAFA 2Z56A 5HIKA 1U3FA 4DHEA 3QHAA 4XUGB 2JK1A 3I8XA 4TX1A 3L0SA 3L82B 3ROKA 4WAUA 2GCNA 1SIUA 3E0QA 5ICEA 3MGCA 4M46A 3QZUA 4HYEA 1MEJA 1GJRA 3LCVB 3N2LA 2XZTA 3FNIA 4UM9B 5AVSA 1XD2A 4Z4IA 2FEKA 3FPLA 2WUDA 1E2GA 4P3NA 2B6NA 4FOLA 3O1LA 5KHOC 4UBLA 3I6QA 2QTZA 3RNLA 1I7PA 2P9FA 2FWMX 3ZU4A 4BN0A 5IJ0A 5JALA 1IXZA 2BEWB 1QOZA 2E49A 1UBOS 3CYFA 3WZMA 4G0OA 2HWYA 5HKBA 3F5SA 5B2ZA 4JI8B 2Q9UA 4ZYXA 1JG2A 5DSXA 4EDHA 4M60A 1V8BA 4LKRA 3LY5A 4N3GA 2ZTUA 2QMUA 4JLDA 2W2MA 2P65A 1J2EA 4KYUA 4DC1A 3KXLA 3UJAA 4IIYA 1UFRA 3IBFA 3W2GA 3O1JC 1YVEI 2WU4A 1L7OA 2ZZKA 4JYCA 2ATIA 1UK8A 4GO1A 4OG2A 2L2QA 4QUKA 3M1AA 3SSMA 3TBHA 2J6CA 3PEVA 3NT5A 4F46A 3KPJA 1VYVA 2I78A 4HFRA 3QU5A 1VI5A 4HZUA 3CZQA 3WGOA 1LH0A 1YMVA 5TJ9A 1IY0A 1JSRA 3TRHA 5F9FA 1P19A 1BDBA 1MENA 1S2MA 2ONCA 1ZL0A 4HWSA 5I7RA 1M0EA 4WV3A 3EW9A 3A26A 3QVUA 4HLUA 1QIJA 3VX4A 4MKGA 1H65A 5A05A 5K3SA 3AKCA 1Q1NA 2QX8A 4GP7A 2VLIA 2OD9A 4H1VA 4F5YA 3M9XA 3F7OA 3D0QA 4Q19A 2OCPA 5AVZA 2FPRA 1DXQA 2VR1A 1ZISA 3O8QB 3PWZA 3DZBA 4IGEA 1YVRA 3PQ2A 2BAGA 5E6RA 3KQWA 3OAAD 4WNYA 4BZQA 1IPEA 4JJKA 1LF5A 1IEVA 1M34B 4NZMA 1Y1SA 3PP8A 3Q10A 4L08A 3WADA 4A26A 4UTPA 2FFQA 4OXNA 3U3XA 3ANLA 2IH4A 4JH0A 5KNBH 4WDRA 2JIZA 1IBRA 5CIQA 1TTPB 2IYAA 5KJFA 1NXWA 2Z0MA 3RVQA 1BS1A 1DRUA 4ETMA 1R74A 5H0IA 5JD6A 3HU3A 4L76A 4Z0NA 4FFOA 5LU9A 5JATA 2NV2B 5I3CA 5ICSA 2XT6A 2DUWA 2W2KA 1CF4A 2VUSA 2GEFA 4PZEA 5AM4A 3AESA 3KHUA 4KQIA 3I9JA 3B38A 3IERA 3JR7A 4GI7A 4H7PA 4G84A 1ZY2A 2AJ8A 4P4TA 5H9WA 2AE1A 2NVUA 2P27A 4CUZA 4CU2A 5JYBA 1L9XA 1V8FA 3ZIAD 4L2IA 4EJSA 4IH1A 2IS1A 2BKLA 2P2ZA 2W6CX 1JAXA 4KODA 1J0XO 1YZQA 3MTGA 2ZSIA 2CFSA 2GBIA 1XPRA 4EY8A 3IHKA 1PX0A 2D1QA 1XNQB 1Q0ZA 3WYNA 1NU8A 3ZDRA 3ZLBA 4E5YA 1KK1A 3OTOB 3I5MA 3ESZA 1SD2A 3MZ0A 4MRMA 2IYZA 4CKZA 3FB1A 4IIXA 3VZBA 1P33A 3IMKA 3GQBA 5ES3A 1L1FA 4OD0A 1EX7A 4JFRA 1YZGA 4BB0A 1KO8A 3QSGA 4YEDA 1LEHA 3EQ7A 4WUVA 5CD9A 1TO6A 2GUWA 1N2HA 3G2IA 2M2IA 2D7DA 4DVGA 2Z43A 1ZIPA 1H0SA 4Y9TA 4DDVA 5A5VA 3WRXC 1F2TB 3ZWQA 4H0NA 3TW8B 4MW2A 3QEAZ 4QXRA 1TCCA 3BE6A 3RS4A 2ZANA 2PYZA 3H8SA 3BS4A 4GSKA 1H2RS 4K6CA 4M9SA 3UJCA 1Q1GA 1UP4A 3MJCA 5DIFA 5DX8A 3U62A 3ZNOA 3LCCA 4A3SA 3PNPA 2W4IA 1FFSA 4WK4B 2X4LA 1Q92A 1YONA 3LO8A 4LJAA 3TM5A 1LPAB 2VQ3A 3X43A 2X7JA 1YFZA 4R40A 3TLXA 1N2IA 1ZINA 1JQDA 3DLCA 1UJNA 2B5WA 4N9WA 4REQA 1YK0A 1CFZA 5FOXA 2RHHA 4US2R 4RLQA 2F6RA 2HK7A 2HXSA 5LWHA 1I0LA 4G0YA 1DIRA 1ZD4A 1ESCA 4HDOB 3A6GA 4HNGA 3O8BA 4UJ3A 4ITRC 2QL9A 1YI1A 1QONA 3VR6A 3WRYC 5KB3A 5A4FS 4TKVB 4HCJA 2GBGA 4IIEA 4YAWA 1G41A 3VYUB 4XB1A 2ZRLA 3O3OB 5E7JA 1X3LA 2Z5LA 3MRVA 4GZ5A 1V8OA 1XRNA 4TLEA 1EP2B 5K0ZA 3ABSB 3UHFA 3OD5A 3ILSA 4OYHA 4GX0A 2CKMA 1T9ZA 3Q7SA 4BTLA 3BXFA 1HC7A 4ADSG 4D8YA 2O8DA 1G98A 3BF8A 4D41A 4IHKA 1EFRA 2BFDB 1JE0A 1E2NA 3SEAA 2ACWA 4EHNA 1YV9A 5ALDA 1KDZA 1ZCAA 3AHFA 1J2JA 4G6ZA 1URPA 4E6EA 5MF6A 1AHNA 1W0KD 1AKEA 3A10A 4OMDA 4YJGA 5KSPA 3HXKA 1N9KA 3Q8XB 5FA6A 1V7CA 1RHRA 4YMGA 3E22B 3S28A 4CNBA 4ZHQA 2Q9CA 3PPWA 3OQJA 4HDMB 1HORA 2EF0A 3GVIA 1UEIA 2BN4A 1QJCA 4EJMA 2BH2A 2SECE 4GXQA 5KOJB 1ZCBA 3QKRA 3RB8A 1NW4A 1YA8A 2AA3A 3DLTA 5CJ2A 1VHLA 3TJRA 4LV6A 5CG2A 1V6SA 2F9MA 4YY3B 3WA6A 1PEKE 1OLUA 4F12A 1P4AA 4OI2A 5D3QA 5HEKA 3V1UA 2GO1A 4R84A 4IR7A 3TRFA 1E32A 1DUSA 3HA3A 2Y1GA 5TSDA 4Y30A 1KFCB 2J7PD 1RMTA 3DG9A 4A03A 1R4NA 4IS3A 3HJRA 4Q21A 2QU8A 1FNSA 2C5FA 2G72A 4Q3OA 5TPWA 5JDCC 5TV2A 1AF4A 1X2BA 2G6BA 3CLRD 3EQZA 3JYLA 2KHZA 5GPBA 2AXPA 2WMNB 3T4PA 1T6YA 5JOQA 1H4SA 3SQXA 1X3SA 4KNWA 4EPVA 2MSNA 3GRUA 3I83A 3UATA 2IIQA 4E88A 1JZSA 1XDWA 5HIAA 1T8TA 1M8KA 3N2GA 4IJWA 5DYIA 1MLDA 2PKYX 3CJQA 4UUNA 3HEAA 3RTDA 1WKBA 4I14A 3S2UA 1Y7IA 2ZAMA 1EZ1A 2J3DA 3ZXSA 1HE3A 1QKIA 1OWOA 2GPWA 2Z1MA 4GEGA 3AEQB 3PDIA 1BOFA 1J8VA 3MIZA 1EDEA 1WM1A 1T4BA 2A4KA 2R5WA 2AEJA 1GAJA 2QV7A 3FH0A 3TRJA 4O4JA 1MJGA 5REQA 1BIFA 3VZQA 4KVGA 3W90A 1EDOA 4Z7OB 1U9YA 2XPCA 1WOMA 2QRNA 1KJ8A 4ZJUA 3ZTTA 1BGWA 2VJKA 3FCXA 4Q4JB 2CDCA 5FTNA 1OFTA 4I5IA 4QICA 1WMSA 2DFVA 2XUQA 3BE8A 2C95A 3L6CA 4E2FA 1MV5A 2BSXA 2HCJB 3H1BA 3HUDA 5IKOA 5EUQB 2JGRA 4HEJA 3ELBA 3ZJYA 1H9BA 3VH3A 3MJTA 1IBLB 2XD9A 4XH9B 4LOIA 3S4YA 1W48A 2E4WA 1LV7A 2F1HA 1JR6A 1UBLS 4DT1B 1GVHA 2M32A 4UAVA 1G59A 1F5SA 1Y9DA 1Z22A 2BDTA 1W9MA 3AR6A 3DMFA 1QTNA 4FQ5A 2QM8A 2PMFA 3QWBA 1R1DA 5B2FA 3A25A 4YRLA 5IN5A 1Z82A 2RBEA 3K1ZA 1NASA 3SZ3A 4RXTA 2P2CA 2H9AA 4CM9A 4G0MA 1U5BA 3MRSA 3BA1A 1U7WA 2PVSA 1GPYA 4D0LB 1YU6A 4D3YA 4WVFA 3DZGA 1RLJA 4P7KA 1KEVA 2YV1A 5A62A 5FOWA 3UV7A 3BQMB 5CB0A 5DBEX 3ZG6A 2HLNA 2WLSA 5IKPA 3ENKA 3U3DA 4YJFB 5JJCA 3CPSA 5BSGA 3X1DA 4W5RA 1KEKA 3LLVA 4ZK2A 3TTWA 3DULA 2BZ1A 1PK9A 3I52A 1L4EA 2Y67A 4YO8A 5JNVA 1C8KA 3MBIA 4HYQA 4X44A 5CW1A 5B12A 3E3LA 3OO1A 4H0FA 5AVVA 2P5UA 2V58A 4PZCA 4DLYA 3T12A 2XWJI 4NCBA 1P1BA 3FPJA 3GAMA 3CV3A 4HLUC 3O3CA 4HNQA 4M53A 4E30A 2C2OA 1NWCA 2FDXA 2B1QA 4G97A 2WM3A 5T64A 4CQMB 3RK1A 3DNMA 4DLKA 5A9SB 1UK9A 4PGHA 3UMJA 4N3AA 3BMQB 2VS1A 3GA7A 1SXJD 4JQOA 1PD0A 4NYJR 1SB8A 1P2FA 1P4RA 1J7JA 2FX3A 3JD4A 3O83A 4L5IA 2J0QA 1B0ZA 4F7WA 5CTJA 3VNRA 2OZLB 3CH4B 1PS9A 3DXFA 4UD6A 3GLFB 3C1OA 1ZSVA 3UAVA 5IXSA 1BRMA 3BSYA 3G2MA 2W83A 4Z6KA 4G07A 3G2PA 3NW9A 3IV7A 2PCJA 1WZNA 4PX2A 3RQIA 1GCIA 2I55A 1J20A 5IAEA 3VH2A 3HY3A 4N39A 1RRFA 1QG2A 2XNCA 5DBGA 3U7FB 3N8DA 1U6KA 3UICA 5LXTB 1JWBB 3PJDA 3NHWA 5FPTA 4CLOB 5DYWA 5JPIA 1UJCA 4IWNA 2DBVO 3H8JA 1XRLA 1SQ6A 1TI7A 5JT1A 4IOLA 5D00A 1T34A 1UC4B 5EQJB 1BXKA 3R09A 5IABA 4N03A 2TECE 3VMMA 3L8DA 2JCSA 3OE7A 1QPZA 5L7TA 1EFTA 3NRJA 2IWHA 4EJSC 1CDZA 2D00A 3K5PA 5F5LA 1NNI1 4TVKA 2QM0A 1E3WA 3P45A 1I2ZA 4N40A 5CM9C 3AB3A 3SIWA 3SOZA 1WHTB 5EHIA 3VU9B 3ZDQA 2DWOA 2DFKB 1G6KA 2RB5A 2VT7A 3AVPA 2C9YA 1QPGA 5C8XA 4OUDB 3UAYA 1I0ZA 1BVYF 1CZRA 5CG1A 3JQAD 3ZOZA 4ZZIA 1QX3A 4JUIA 4HWTA 4IJQA 1WE2A 4Y0VA 4EGJA 4YT2A 1WTCA 3N7TA 5CCXA 1BXZA 4PC7A 2UZ4A 4QWMA 3JU3A 1ODJA 2YIMA 2F67A 3N76A 5CVDA 5HUQA 2YUTA 3KKQA 1KGDA 3DCJA 3QU2A 4J9UE 2ZIAA 4OHPA 4X7PA 3KAPA 1I3KA 3NWOA 1H1LB 2I7TA 3D7RA 3A4LA 1NP6A 5GINE 2FGKA 4IJVA 4PFQA 3UMMA 4EHIA 5FNZA 3SLKA 4YMHA 1VIMA 2HA6A 5J5VA 1FP1D 1WDWB 1FFXA 3I3OA 3DOJA 1V3VA 2JLBA 3A36A 3NO4A 1XLUA 2A3NA 4RETA 3ZLTA 4XEHA 4B85A 2CZCA 2RHJA 3MW8A 2RGBA 2E4ZA 4C2UA 4H27A 4AJ1A 3WOHA 4P7FA 2N75A 3WO0A 4BUJA 2WWIA 1J2RA 2IOQA 2LW7A 1WW2A 2XGSA 4URUR 4WESB 3RTCA 1XCPA 4X84A 2HO4A 2NN3C 3GVHA 3BMCA 1F6BA 3D4BA 3LS2A 3U31A 3OO0A 2DETA 4NDZA 3EEFA 1B8VA 1NXSA 1Y9EA 5LZ5A 3GLTA 4EB6B 1F0NA 1G7SA 1T3ZA 5G02A 2P0AA 4P31A 4JUCA 5B55A 1QAMA 1W34A 2VHQA 3ILVA 3IVXA 1JQLB 4GUDA 1N2GA 1N0VC 4GMXA 1D1PA 2IITA 2PPLA 2YN0A 4WK2B 3KJZA 1TYDE 4CMKA 3QKWA 4WGFA 1L5OA 4LVNA 2BBOA 1P9OA 4Y3UA 1ZZEA 4EARA 1Y5LA 4EQZA 4X62B 3S3TA 3DTVB 3H3FA 4EFKA 3IVAA 4CEIB 5KEIA 1Q7EA 2ADMA 3TNDA 2GEKA 2Q8NA 1GIAA </