3FMOB

Crystal structure of the nucleoporin nup214 in complex with the dead-box helicase ddx19
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
232
Chain Sequence
b'NLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear pore complex protein Nup214
publication title Structural and functional analysis of the interaction between the nucleoporin Nup214 and the DEAD-box helicase Ddx19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein/hydrolase
total genus 75
structure length 232
sequence length 232
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmoB00
3ZD7A 1OHHA 3PITA 4JJKA 2XZOA 3E2IA 5E7IA 3DVLA 3HJNA 5EP1A 1KI7A 1JJ7A 1GP2A 3N70A 5CLQA 5FTJA 3RSOA 1UM8A 1BKDR 4ABYA 1JEDA 2ZJYA 3LX5A 4GNKA 1JJVA 2QAGC 4D4LA 1UKYA 4YMTA 4AG6A 2O0JA 4BLOA 3QKRB 3BJIC 3TJZA 2FE4A 2J1LA 1A4RA 1CJUC 4ZDWA 5HZHA 3TR0A 5E4FA 5FTMA 5SZIA 1EGAA 3R7WA 1UDWA 4HLUA 4V0MA 5B64A 2ANCA 2XTMA 4JKIA 1BYIA 3RS2A 1KI6B 3MWYW 3THYA 1SHKA 2VF7A 2HXYA 3K9NA 2XZLA 3DEFA 4MRNA 2J0QA 3QOFA 2VO1A 3C15C 4M1YA 1NMYA 3CX6A 1PLLA 3I1FA 1DELA 4G5OA 4IEIA 1TEVA 2OILA 4I81A 4A2PA 1IJEA 1ZP6A 4C7OA 4DEXA 3PENA 8OHMA 1VCIA 1BIFA 3T06B 3ZGXA 4KBFA 4HLCA 1J7KA 1KI1A 4B2PA 1LFDB 3A1TA 4Q48A 4OI1A 2QE7D 4Q01A 4M9ZA 4AYXA 5JZVA 2NO6A 5C46F 3Q3JB 2QRZA 4QBHA 4TTRA 4Y0AA 2LCFA 4FWTA 2AD1A 3RLFA 1Z6AA 4J0QA 1NN3A 5DI3B 2ZSAA 1PVOA 4EDHA 3ZYCA 4RVCA 5EQTA 4L4UA 2NZJA 3AEZA 1OHHD 5JWHA 1Z47A 4QJ4A 4MKHA 3W8RA 1KMHB 4IXNA 3SS8A 5DISB 4RD1A 2V6IA 1II8A 4IXMA 1F6BA 2V7QA 1SQ5A 3EZ7A 1R2QA 3MWKA 2FEMA 3K09C 4Q7MB 4YMSA 2CCKA 1CR2A 3F3YA 3K9HA 1QHNA 4P33A 1HURA 5DIFA 3KKOA 1G7TA 2G0TA 3KJEA 2WAXA 4M21A 4QJ3A 4DLWA 4BASA 3CRRA 4LC0A 5HCIA 1ZIPA 4O0MA 1G17A 2HCBA 1M8PA 2QL6A 3AH8A 3KXLA 4TQUS 4DSOA 1TQ2A 2CL0X 3BH7A 3OESA 1W47A 3CRW1 3PV0A 5ANRB 4JL6A 3SJCA 721PA 1NJGA 2ZRDA 5KU1A 3ZJYA 2GVDC 3QKSB 1AQUA 4DCSA 2A5JA 2WVJA 3GJ5A 4ACBA 2YWGA 1HQYE 1XRJA 1UBCA 3BC1A 4FMCF 3VU9A 1UBGA 1GOTA 1JR3E 4DKXA 3CPEA 4KFUA 4WZBE 3RYTC 2ODEA 1FOEB 1C4OA 2PBRA 5G53C 3CNLA 4BRUA 4LYAA 2ZRAA 4PO9A 1DAMA 4F4CA 3QUSA 1G8HA 2Z0MA 1D9XA 2J7PD 2R65A 1HYQA 2QAGB 1QZXA 5EE3A 5FR2A 4POAA 3KTAB 4BECA 5K8LA 4NMMA 2VSOA 3LD9A 4URYR 2EFCB 3QKRA 4WVFA 2IHYA 3LRPA 5E95A 5FPSA 2RGEA 3U5ZB 1GWNA 3KZ1E 1ESNA 4C9BA 3CO5A 1OPXA 1S1MA 3B9QA 3EC2A 1V5WA 4D0GA 2V7QD 4ZDJA 4G5SA 3BB3A 1QVRA 5KDDA 1KI6A 1LS1A 2VBCA 2VP4A 3PUYA 4BLTA 4PFSA 3QVVA 4PHHA 1J70A 1AIPA 4HAUA 2WWYA 1KK0A 1VECA 821PA 4NCNA 1E9RA 3A1VA 1KAOA 1M74A 2FSIA 3KX2A 2KBFA 4HAXA 4IEEA 4LV5B 1U0LA 3EPJA 3ZD6A 2PCLA 5JMTA 3EIQA 4ESVA 4ITRC 5GJWC 4B3DA 1RRCA 1YR9A 1GKUB 1R5OA 4Q02A 5FL7A 1CBUA 2Z4RA 2AXNA 1CJVC 4QHTA 3SJAA 2JLVA 1KJWA 1GZSA 5DI3A 5B57C 2JLUA 2OCYC 1VHTA 4XVQA 5EXTA 3LBNA 1TF5A 2QBYB 4XWOA 1GNPA 3BWDD 3NHBA 1ZIOA 1OW3B 4PHGA 3W5JA 4B3GA 1KMHA 3KXIA 4M1MA 1P6XA 5BW8A 4CGZA 5B30A 2RGBA 4LJ7A 4P0TA 4LJ6A 1SKQA 1KKMA 5KO2A 2CK3A 4BFZA 1R8QA 3CBQA 1W36B 3U60B 5IHPA 4E07A 1MR3F 4B32A 4TTPA 1XNJA 3D7MA 4KU4A 4A0HA 4IW3B 3LXRA 5KNBA 2DHRA 3P32A 1A82A 1F2TB 1KO1A 3NBFA 1QVAA 2GWHA 2IYUA 3LV8A 3U3MA 4WA7A 1CTQA 1YRAA 5FPTA 4ZKEA 1WBDA 2WICA 1Y63A 3QKSA 1GNQA 2OFOA 2V1XA 3KUCA 5KSOA 3KFVA 4NHOA 3EWSA 4JT2A 4XVRA 2QI9C 2JJ1A 2JASA 2RHDA 3OFNA 4GPTA 1QBKC 3EPKA 2JLRA 5TB5A 5JHGB 3FDIA 2BOVA 1UPTA 4GZMA 5FL7D 5IT5A 1XEXB 4Y0VA 4W5JA 3P4YA 1A7JA 1ZNXA 2WV9A 2CHVA 2PT5A 2QAGA 4QHYA 3KTAA 2DBYA 1Z3IX 3RS7A 2I4IA 3HYTA 4Z8XA 2WWXA 4DT1B 2DB3A 2W58A 2MMGA 2ZVPX 5JCZA 2EU8A 1JQLB 1IXRC 1S96A 4R7ZA 4CT5A 3QG1A 3SHWA 3BFKA 4LDJA 3A1UA 1GILA 1ZW6A 2F55A 3TVDA 2CK3D 3LX8A 4MYCA 3MSXA 2DFTA 1SKYB 3U3KA 2YKGA 1E2HA 5JLJA 3WP0A 3NBYC 3QJYA 4B2IA 2EW1A 1DS6A 1W44A 3PEWA 4GZLA 3IBYA 4OQLA 5CYPA 5DE3A 1JI0A 4S35A 4DDTA 2KJQA 1KJYA 2JJ8A 1GRRA 2C9CA 2REOA 4RY2A 1AKYA 3RABA 5F9HA 1HA3A 2CLCX 2B6HA 2WJIA 2OSBA 3TW4A 3K70D 3FHTA 2OO7A 2ZROA 3TVTA 3A1SA 3QG5A 4D0LB 4WXRA 2J46A 4A15A 1TF7A 4WIAA 1E32A 2JJ1D 4PZZA 4V0NA 4WZAE 3OFND 4EPVA 1E9EA 4RZ2A 4A0FA 2NQ2C 4G5GA 4JVMA 2QBYA 3R8CA 4TYQA 4Q1EA 1SVSA 5CIQA 1E3MA 4V0ME 2FN4A 5FOTA 3PUWA 3K09A 4LBVA 2A5DA 3T34A 2XB4A 1XB2A 5J4KA 4L16A 3BOSA 3E5HA 1Z28A 221PA 2HUPA 4Q1DA 4Q4JB 1NIPA 3H1TA 4BEJA 4LJAA 2VSXA 3DMNA 4I1VA 3GJ4A 2H92A 3NWJA 1E94E 4D26A 4A8JC 2FV8A 2O0KA 4AKIA 3IKJA 1AGRA 1F2TA 2QMHA 2AFIE 3L0OA 3QBVA 4HZIA 3UG7A 2ZVQX 3I72A 4KJZA 5BN5A 4KV9A 3MJRA 3UKDA 2ZRPA 1KK2A 3DPUA 3UK6A 1NF3A 4OHXA 3TUZC 3VNUA 4TYWA 3SNHA 4MKIA 2HXSA 1X86B 1KOFA 1H8EA 3IBGA 4DEYA 4G1UC 1D2MA 5FOSA 1KDTA 1D5CA 1XEXA 3GLHB 4LI0A 4CZ2A 2NMVA 1G18A 3TAHA 2JGNA 2XZPA 4LPSA 2YINC 3BS4A 4KCGA 4BFWA 1D8TA 4QFMA 4B76A 4A36A 4CDGA 2W6JA 4B73A 4HYYA 1P60A 2EFDB 4QJ5A 2CCGA 1TL7C 2GVZC 3A6PC 2GJ9A 1R10A 2A5GA 3NH9A 2Y8EA 4QHSA 1IN6A 3KL4A 4IFEA 3SQWA 3X1DA 1JPNA 2OBLA 2A30A 4MUAA 4OQNA 2H18A 1I4TD 1TMKA 3DHWC 5FPHA 1KJZA 1XXHE 4DZZA 4G01B 2JLSA 4HB2A 4LCBA 1MRSA 1AQYA 2WZQA 3JVUA 4PO8A 1UF9A 2UVQA 3X1ZA 4DLXA 1EWRA 3I3SR 4NU0A 4E5UA 4NYJR 1W36D 2BKUA 2ZS9A 1VMAA 4ZIRA 4LJ8A 5IK2A 5KDLA 3BB1A 1HE1C 3KDSE 1HUQA 2W2XA 2XNSA 4EAQA 5KUTA 2X8AA 4NH0A 2WJYA 3LQRA 3P26A 1YR8A 3SU8A 2CVHA 4KYIB 1KK3A 2FF7A 4NBSA 5AUPB 3K0FB 3ZLJA 1ESMA 4TL8A 4OKSA 4RZUA 4XJXA 2QZ4A 3IEVA 4HAYA 2F3TA 1J8MF 3G5UA 3LA6A 1H8ED 2N42A 3VR5A 4IVRA 5HZKA 1CP2A 2WWIA 1X8KA 3EPHA 5J4VA 5SZKB 2QQ0A 2CDNA 2ZSFA 5LB2A 3GLFB 4ZCLA 4EPXA 4FCWA 1FPMA 5AR1A 1LNZA 2IUUA 2YWEA 4OJQA 3RDPA 1IBRA 3LAWA 3U3JA 1WRBA 2VLIA 1S9DA 4LBZA 4GRAA 2W6JD 3OE7A 4PC2A 1FTSA 1FTNA 2AL7A 5EJEA 4O2RA 3NHAA 2FNAA 3VMFA 1GUAA 4JJZA 3TQCA 5C4MA 1P4SA 1ZINA 4Q4JA 1KO7A 2J41A 1R0ZA 1Z0DA 3PR1A 3EXAA 4A8JB 5JI3E 1AK2A 5IF9A 2IYVA 2RGGA 3BRWD 1KYIA 4TTQA 2GAOA 3B60A 5CM9C 3JZMA 1LV7A 3ECCA 2Q3HA 2XX3A 5IK2D 1VHLA 3E1SA 2NIPA 2UKDA 1RRFA 1XX6A 2IYTA 2NGRA 3NXSA 1L7VC 1JR6A 2RKOA 2VP6A 1NN5A 2JLWA 2X19A 4XOIA 3GEIA 1G9XA 3A4MA 2ODWA 5KPJA 4EPYA 1VG8A 4AKHA 3WBJA 3GLHA 4PAQA 1US8A 3TW8B 3CRQA 4JLKA 1K8RA 2C8VA 4US1R 4QNRA 1PJRA 3SOPA 1TQ4A 5H70A 2BWJA 2ZUCA 1CF4A 4B74A 4WBSA 1T4GA 1WQ1R 3NEJA 1ZNYA 4N0DA 3PEUA 4P31A 2V8OA 3IQWA 4JLPA 5KDOA 4BZXA 3C8UA 3CPHA 3SI7A 1QRAA 5BWMA 2JLXA 2YOFA 4MUBA 5B2ZA 1IN7A 1G20E 1M7HA 3O47A 3VR2A 1QHHB 5L8VA 4TN1A 2ZJZA 5AJZA 4TYYA 3ADKA 4JIMA 4HZUB 1OIVA 1YE8A 4IFBA 4C0JA 1GTVA 1YR7A 3VKWA 2QM7A 4LJ4A 2A3RA 2HLDA 1XMVA 3OE7D 2NO7A 4IVPA 4FMDB 2A2ZA 3LO5A 4X8HA 3U3RA 1X8LA 5LDDC 4MH0R 1U98A 2CEAA 4ZDKA 2GCPA 4TMZA 2D7DA 3W34A 1H65A 2J45A 2D62A 2ATXA 2N1BA 2B7CA 1IJFA 4HDQB 3QY0A 3B8HA 1E0AA 1X6VA 4ERNA 1MRNA 1NVUQ 4KLZA 1X8JA 1II0A 3MG9A 3CM0A 2OAP1 2QA5A 4M1SA 4F92B 1YZKA 2C99A 3SYNA 3TGPA 3K0FA 5JFGA 4DHEA 1P73A 1RJ9B 3Q5EA 1OH7A 1FFHA 1SVWA 5DSZA 2QPOA 1U81A 3EZ2A 4DUGD 4K81B 2MMCA 2P3SA 4EFMA 1MO4A 3ZIAA 1NLFA 3ZS9A 3H84A 3PXGA 2QU8A 3GLFA 1G3RA 1AKEA 1EESA 2FFAA 4HAWA 4DSTA 4JLVA 4E22A 3AP3A 1P72A 1Q3TA 4B2LA 3VR4A 4K46A 2ASEA 4TQAA 2F1RA 2QRNA 1G1MA 3HWSA 5DHFA 2V3CC 1VCOA 2FMXA 1XZQA 1MH1A 1Z29A 1ONBA 5L3QB 2QORA 5HR5A 2O8DB 3T15A 4JLNA 1GG2A 1DAIA 1WA5A 3WMFA 2IWHA 4AC9A 1CKEA 1E9BA 2DWQA 3FMIA 4TL6A 4PZLA 1Z6YA 1RYFA 1FQJA 5KPDA 3THXB 2Z5FA 2HLDD 3SE0A 4A8JA 2D4HA 3MLEA 4G0NA 3ZH9B 2BDTA 4A92A 1AS2A 1OSNA 2ZSDA 4URWR 4F38A 3IPYA 4K8OA 2O8FB 3W8NA 4C0SA 3B1YA 3TAUA 2F9MA 4B47A 2IL1A 3UWKA 1XEFA 3EZ9A 5A4JA 4TZ0A 1BOFA 1ZYUA 1P9WA 3NH6A 1W4BA 1YZNA 4OI2A 3M1IA 4JLJA 1COWD 3T12A 3ADBA 3OAAA 4YDHB 3TH5A 4PO1A 4UNNA 2FSGA 3UPUA 5J40A 2C2HA 4EPRA 2ZUBA 4FW9A 4OHVA 3CWZA 4UNPA 1EG7A 3T5GA 1DE0A 4GMXA 2RCNA 2IK8A 3HR7A 1R0XA 1XD2A 3ZIAD 1CEEA 3ZVNA 4GOKA 2JATA 3ZZTA 1FNNA 1ZUHA 1VIAA 2V55B 1ZM2A 2BBTA 2MSDB 1QHHA 4QBIA 3AUYA 4JSTA 4PPGA 2XJ9A 1T6NA 4HZUA 1T3LA 3AGPA 1HTWA 1KSFX 2VP0A 3QIAA 4RKFA 2Z43A 4DWJA 4IOMA 1VG0B 3TSZA 2QE7A 2PZGA 4LHZA 4UXJA 3VKGA 1L8QA 3K70C 3KJIA 3BD9A 1ZAKA 2QQEA 2BKEA 2O52A 1UEIA 2H8KA 4CVNA 2W2TA 3A4NA 1NMZA 2QGNA 1PZNA 1RFLA 4YXWA 3THOA 3VR1A 1R8SA 4KFSA 1OXXK 4YMWA 2NPIA 1SZPA 4HB4A 3RRZA 3QQ5A 3HU3A 3BFVA 2C04A 3PUVA 1ZNWA 1E9DA 3B9PA 2A5FA 2GDJA 3Q72A 1D9ZA 2G83A 4JZKA 4N1AA 3V4RA 2GZAA 2DFLA 4YQFA 1TX4B 1T9HA 2AKAB 4HATA 4E03A 2VP5A 1R4AA 2IBMA 1TNDA 2GCOB 5JECA 5KNDA 2BIFA 2H17A 3ASZA 2AK3A 2I3BA 1EFCA 4PC3A 4BLQA 2QGZA 4B3XA 1SXJB 3H4MA 2GBLC 2WJGA 4YLGA 2FZLA 1E99A 4XTCS 1RW4A 3AF4A 3AP1A 3OAAD 2G9NA 3Q7QA 3RRYA 4IDPA 4OI0A 3QEJA 2OV2A 4BE7B 3GFTA 2F7SA 1M7GA 1YU9A 1I4DD 1FUKA 4FCVA 3T1VA 1ZD1A 2JLQA 2J0SA 4MRPA 2N46A 2ORWA 1U9IA 4XIGS 1CR0A 3MWJA 2ZI5A 3WYGA 5L3QA 1FMLA 2O8DA 4F4IA 3GEHA 2BHRA 2R6CA 4PSVA 5HE8A 3G0HA 3THXA 5G41A 3LNCA 3NBZC 3QVUA 3K0CC 2B7BA 1UJ2A 3RS5A 2J7PA 1GM5A 2HYIC 4XWAA 3PJRA 1SGWA 4OK6A 5K8TA 2PEZA 2O8FA 2GF0A 2O8EB 1P2UA 1KY2A 2VHCA 2QROA 4PHTA 4YXWD 2ZRFA 3CF2A 4AYWA 3RS4A 3PEYA 3LFUA 5DYGA 2W0SA 1U2RA 3W5IA 4TYNA 1W2HA 3B2EA 1GRNA 4U7DA 4DIDA 2GK6A 2QN6A 2WWGA 1E9SA 5EE0A 4DSNA 5G3YA 5BN4A 4XVUA 3U6KA 2BCJQ 1R5NA 3ZZ0A 4W5WA 2WKPA 4LHWA 4KBGA 3EPLA 2QNRA 4BLPA 5FTKA 1W36C 4O25A 4BFXA 5F9FA 4OQXA 3T1TA 2VHJA 2WMNB 3T35A 3U3OA 4EKDA 1Q0UA 3B5JA 4DCTA 1G3MA 4CRWB 3BERA 1IN4A 1QDEA 1MO5A 4WZ6A 4MYHA 4HUTA 2R6FA 3LBHA 2X2EA 2NZ8A 4JKYA 1Z0FA 5EUMA 3WY9A 5C2JB 3K70B 2GETA 3NKVA 2VRWA 3QKTA 4X8LA 4TLBA 2OM2A 1D6JA 4BPBA 2D06A 4CW7A 1Z8FA 1N0VC 2ONKA 2ZE8A 5JS7A 2GAAA 2CE7A 4G3XA 3KQLA 2P67A 4LPKA 1EX7A 2D74A 1N6RA 1YJ5A 2OBMA 4B3CA 1WCV1 5JI2E 2ZYWX 4C2UA 3BFXA 1VYUA 4WW0A 3X1WA 4DJTA 3P27A 2FDCA 4F4JA 2W2VA 5JJIA 1A2BA 1FP6A 2HT6A 4JYCA 4FINA 2GCOA 4EPWA 1MABB 2OCBA 2HYDA 1W46A 3ND9A 2IYXA 2VF8A 3TQFA 3EC1A 5LBIA 1E4VA 3CUEF 1II9A 1NVVR 4MYTA 1Q1EA 1Z2CA 3A58B 2V54A 1E0KA 4QM6A 1DAKA 1AS0A 4Q00A 3L0IB 4KI0A 1N25A 3L0PA 5EZ6B 1E2KA 1N6PA 4D81A 4B3BA 2R8RA 4KSCA 2J87A 3IDQA 2EFEB 3VHLB 4DLTA 1KK1A 2W0MA 2WOJA 4BEBA 4PC7A 3IUYA 1T91A 4TZ6A 5GJCA 3RNLA 2ZI4A 4GDFA 1XJCA 3WHKA 2QT1A 2IF0A 3HPQA 3GLIB 3SYLA 4A6XA 1SHZA 1KKLA 1XF9A 4W7SA 5CJPA 3UMFA 4Q4AB 4DSUA 1IXSB 4WXPA 2O8CB 1S3GA 2IS2A 1ETUA 1G6HA 3MUFA 2BJWA 3D8BA 3AVTA 2V1UA 3C14C 4TLAA 2HJVA 4FMCB 4RCZA 2PLRA 4P3YA 1ODFA 4JBWA 2QTFA 1Z08A 4QGGA 1WF3A 1G8PA 3WBKA 3MGCA 3TUJC 1XP8A 1DAFA 2W83A 2O8EA 3HPRA 1E0JA 5FBLB 2P65A 5HCNA 2IYSA 1FZQA 1KSJA 3QE0A 2QTVB 4NZYA 2FJUA 4AK9A 1W4AA 2D3WA 3IHLA 2R6DA 2PH1A 2ZJ5A 3QXCA 2QPAA 5JEDA 4MITA 4YMVA 2XNDA 2V4ZA 1GL6A 1U8AA 4UKDA 3GJXC 4B71A 3VKHA 3SHFA 2IUSA 2FZ4A 2OBNA 5J4HA 4URVR 4RJLA 1RPZA 2VHTA 1SXJD 1EFUA 1TUIA 1YZLA 2GKSA 3C16C 4GFDA 4AWXA 2D2FA 2G77B 1T3SA 4D25A 4CEJB 1NP6A 5AK0A 3C5HA 1ZBDA 1QG4A 3T61A 3W3ZB 4L8GA 4JLDA 5FH9A 4PC6A 4M9SA 4NE2A 2AWNA 5JWOA 3PQCA 2IYLD 1GIAA 1N0UA 3H2YA 3PUXA 1OFTA 1QF9A 2PZEA 3CZQA 2AK2A 1N5KA 1G8YA 1G5TA 1KTVA 1OV4A 2OG2A 5EE9A 3SFVA 3TKLA 2Q21A 1OFUX 3TIFA 3I73A 1W7AA 2VH5R 4RFSB 3AVUA 5IRCD 5SZJA 1HV8A 2V9PA 3IILA 4IVQA 1S2MA 4C30A 5B58C 1X3SA 1ZC3A 2P6NA 3U2QA 1E69A 3KQHA 1KHTA 3FKSA 3DMDA 1TUEA 1UEJA 3QPVA 4L9WA 4NYIR 4DRZA 4O2LA 4QGHA 3C4JA 1Q1ZA 1UDXA 2WM9B 5K8UA 2DFNA 1TTTA 4DCUA 4HB0A 1LF5A 1MABA 2YHSA 5JS8A 2XTNA 1T0JB 4L5BA 4LHYA 4LV6A 2WWWA 1DO2A 3EAQA 3W9YA 5KSZA 2GBLA 1DEKA 1TQDA 4TQ9A 4BUJA 1QHSA 1JPJA 1KDOA 4NYJQ 5AUQA 1BS1A 2O5VA 3R20A 4JT4A 4HUQB 5FTNA 2XNDD 1HQCA 4P4TA 1L4YA 2Q9BA 3QI2A 4ARZB 1JBKA 2DYKA 2REXB 2WJVA 5BXQC 3H86A 5EZ5A 1NNEA 3GLIA 3OIUA 3N2EA 3AGQA 5M04A 2H5EA 4ZKDA 4PPFA 4Q4AA 3VTKA 2VTKA 1T5LA 1G8GA 2IHBA 3KKNA 2O8CA 3MAAC 4LSGA 2RHMA 3PCRB 4TYPA 4AURA 1JECA 3K0CA 1IY1A 1ZM3A 2R62A 1CJMA 4FN5A 4OHWA 5CM8B 1ZMXA 2J9RA 1IN5A 3TE6A 4DLSA 3V4FA 1W2GA 2G3YA 5HE9A 3W6OA 4PXAA 1NN0A 4EFLA 3T1QA 5EXXA 5TMPA 4L9SA 2C03A 3WRXC 1G19A 1XMSA 3IO3A 2ZI7A 1XPOA 1G291 4DDWA 1UAAA 2YWHA 5CLLA 1G21E 3EW9A 2HF8A 1NRJB 3AF2A 1VPLA 3FKSD 3OZXA 4UJ5A 3BGWA 2R6AA 2YC2C 4JYBA 1M1YE 3HDTA 4D6PA 5J4LA 4FWIB 3KUDA 1G6OA 4C0HA 2FEOA 3JZAA 3LW8A 4MGYR 4NYMR 2EYUA 5KSPA 2XITA 2A7QA 1ZUIA 1N5LA 3QPWA 2ZR0A 1G3IA 1XWIA 1XFAA 4V0KA 5FTLA 3OIWA 4PHFA 3KXKA 2G88A 1Z0AA 3GJ8A 3K1JA 3MJHA 5CJ2A 5CK4A 5FOWA 4PPQA 2VL7A 5J5CA 5AWFC 2KI5A 2WPDA 1BO6A 4CEJA 2ZRCA 1EFRD 4Z51A 3NEYA 2WJJA 2GILA 1KNQA 2HV8A 3AP2A 5EXSA 2DFKB 1YKSA 3OIVA 3AVVA 4PSKA 2J7KA 1DOAA 2RGAA 1GITA 3VAAA 4XWKA 4LBWA 2IXEA 2ZM5A 2A5YB 2Z4SA 4NONA 2ZETA 2PZFA 3O8BA 2C96A 3K9GA 4QG7A 4UNQA 3WYAA 4M1KA 3IIJA 3VFDA 3B1WA 4X8MA 3SBEA 4RFSA 1J90A 4C0QC 4HAVA 3LWNA 3VHXA 1NJFA 1VCNA 5H1YA 3ZQ6A 1F5NA 2GCNA 4YONB 3B1XA 2FA9A 1KAGA 3AVQA 3B82A 4N0EA 5CB8A 3IIKA 3EWAA 4DT1A 1SVKA 2CHGA 3U7GA 2EFGA 2E9SA 4EPTA 3FMPB 2QPTA 4KFRA 3U7HB 1HEIA 2BEKA 4UXHA 1UADA 2HT1A 3FMFA 1E2JA 4RD3A 4P32A 3F8TA 4JLBA 4DCNA 1E1RA 2ZE7A 4HUQA 1NBMA 2BMJA 3IEUA 4Q21A 4CEHB 2H57A 1G4UR 1G64A 2B21A 3UWOA 4ACAA 2WJHA 3A36A 3P1JA 1F2UB 3BK7A 3BORA 5CYOA 1AA9A 2G6BA 3TK1A 4A82A 4ARZA 1LF0A 3FOZA 4M9QA 2ZSEA 3NTUA 5TY0A 3U7EB 1E2IA 1B0UA 4PQRA 3W6NA 2WPDD 3AB3A 3A1WA 3GLGB 1JALA 1EFHA 3GJ0A 1XPRA 1E98A 4Q9KA 4UNSA 1N3BA 3R9WA 1G16A 1T8UA 2MSCB 3KQNA 1K5DA 1I2DA 1DAEA 1PLJA 4MGIR 1OB2A 2Q9CA 2P2LA 4ESHA 2GXAA 2YV5A 1NN1A 1HH4A 3PFIA 2RH5A 1IN8A 2WWFA 2C77A 5J4YA 5AJWA 1EK0A 3AVXA 5AUOB 1JAHA 4URZR 3MMPA 3VX3A 2ZITA 4EIWA 2ZRIA 4OJKA 2RMKA 2IWRA 3TMKA 2IF2A 5CDFA 4OHZA 3HR8A 3AM1A 2ZR7A 1QHYA 1U8YA 2C9OA 2WAYA 3IQXA 3KJHA 4B48A 4A4DA 4R2HA 2BMEA 2GESA 3LQQA 3Q7PA 1UFQA 2QP3A 3B78A 3QF7A 4KO8A 5CIWA 1U9IC 1NL3A 3LXXA 2GEVA 3WYFA 2VP2A 3CB4A 1MT0A 1WP9A 1YRBA 2BEJA 1U0HC 2GJAA 1YZQA 4C0KA 5TVKA 1W5SA 1AZTA 3QENA 2NO0A 2ZUDA 3L0SA 4AIIA 1E1RD 1NBMD 2OHFA 2DCUA 4Q9IA 4IOLA 1KI2A 4DDUA 4UJ3A 2RB4A 1F3OA 3BXZA 3X2SA 2JDIA 2IYRA 4U02A 1P9NA 4QC2A 2WIAA 1XMIA 2C95A 2ZAOA 2ZSBA 4LYHA 1AM4D 4AYTA 2PCJA 1NVXQ 3ADCA 4JVSB 3I61A 1LB1B 2WKQA 1NI3A 1XZPA 4H9GA 4C0LA 4OBEA 5KSYA 2IW3A 2CL6X 3L43A 2ZXUA 4DUGA 1XTJA 4MRRA 5IDVA 3W90A 5FUYA 1F48A 2BBWA 5C1BA 5GJVC 2W6IA 4DLVA 1F60A 3C7KA 1JR3A 2VQSA 4IOKA 2HDNB 4C0AC 4TL7A 1G7SA 2EVWX 4I99A 3HP1A 4DLRA 2AX4A 4PQYA 2ZRBA 1XTIA 1PV4A 2OLKA 5DNYB 4Q1BA 5EP2A 4OHYA 2V6JA 1OE0A 3CR8A 2I1QA 3DKPA 2JCSA 3P4XA 2WBLC 2QY9A 3X1YA 3CF6R 4JL8A 2OEPA 1NIJA 1OIWA 3H0KA 4AKEA 2P5TB 4JBYA 1D2NA 1Z63A 2P0EA 3AKYA 3ND8A 2BVNA 3I92A 4CEHA 3LVRE 4MYUA 2E1RA 1F2UA 2ZE6A 4NDZA 1SVIA 2RGDA 1DAGA 2F3RA 1EWQA 1E1QA 1CU1A 1Q3HA 2HCJB 2NOAA 3NBXX 2CBZA 2PJZA 2WMOB 4NCHA 4GMDA 3GLGA 4ZV4A 2FGJA 3EIHA 4MRVA 4P4SB 621PA 2CNWA 4FD2A 3ZZUA 4KVGA 4LOAA 2JDID 3Q5DA 4IDNA 4AI6A 1COWA 3K9LA 5P21A 4MKFA 1XD9A 3FMOB 3EA0A 1E4YA 3VQTA 5KNCA 2EFHB 4BQSA 4Q4LA 2C9YA 4LWZA 3SN6A 3VR6A 4F91B 5KOYA 1IAQA 4MGZR 2DR3A 4LHVA 3GFPA 1ZM9A 1SXJC 2GNOA 3IIMA 2XGJA 4XH9B 2ZRHA 2W6ID 3SZRA 2OAQ1 4M2LA 1ZCBA 5FPKA 2ATVA 3CNNA 1JR3D 5JBQA 4MQBA 3WNCA 2WIBA 1FL9A 2FX3A 2P5SA 2BBSA 1VDZA 2WKRA 2IS6A 1E2MA 4TLCA 3EG5A 3CPJB 3DDCA 1XTKA 3CR7A 4Q1AA 1FQKA 3DOEA 1BYUA 4CIDA 2JA1A 2XTZA 5DGXA 1TQ6A 5GJBA 3KJGA 2XJ4A 4TT3D 3FTQA 2ODNA 4NCIA 3NG1A 4PR0A 1R0YA 3WNBA 3I4LA 1N6IA 1NKSA 2YWFA 2ONJA 1MV5A 3CF0A 2FPMA 3A37A 1Q1BA 4HSEA 3QSYA 5H8WA 4PTLA 1G8FA 5LD2B 2RGXA 1E1QD 5FBQB 2ZJBA 3DL0A 3QBTA 2KWIA 1ZU5A 5DYIA 2ZRKA 4Z1MA 2ZJ2A 1G3UA 3EARA 2CNWD 3GCGA 4OK3A 1KSHA 2BCGY 3RAPR 4IJMA 4C2TA 3SQXA 3AF3A 4LK2A 2OXRA 4I1OA 4C4PA 2BV3A 4QKQA 4Z54A 1AZSC 4Q5IA 3LLUA 3QPUA 5TV2A 3IGFA 2ZYTX 3B1ZA 3W3AA 4JBXA 3T5DA 3ASYA 4XD7D 4B44A 1A1VA 5FPYA 1HT2E 1U99A 5GVSA 3HYRA 4LV8B 5DO9A 4JSYA 4Q9LA 1TPZA 4C0BA 3CRVA 3OHMA 2X77A 1XU4A 4PX9A 2D7CA 5JJKA 1KMQA 1U8ZA 2J3EA 2CLDX 1LTQA 3BBPA 4XTRA 2OCAA 1JNYA 1G7RA 2WTUA 1WDTA 1VIYA 3L8YA 3RSLA 3C41J 5K8IA 4KITB 1W49A 2R44A 4WAUA 5EUQB 1T8TA 1YR6A 3FE2A 2CE2X 4II7A 1FP7A 5JCPA 2AWOA 1R6BX 4MDEA 4D2IA 4JMPA 1LVGA 1ZU4A 2W00A 5FL3A 1JB1A 2BBOA 1XXHB 2ECKA 1G4AE 4BLRA 3L82B 4L15A 1NVVQ 3EIEA 4P4SA 3L8ZA 2OT3B 4MGKR 4GOJA 4DB4A 2XSZD 1VYTA 4S2EA 4ZDIA 4US2R 1E96A 1YQTA 2R9VA 4BFSA 4Z1MD 1RJ9A 2HJGA 3WP1B 5AJXA 5G40A 2GXSA 1DAHA 2ERYA 3X1XA 2IX3A 2NTYC 2VHQA 3ZVLA 3TLXA 1A5TA 3EA5A 4OK5A 4Z8YA 5DN6A 1Z6XA 2Q3FA 4GT1A 2ZEJA 3DZ8A 4BRWA 3GEEA 1T5IA 3QXSA 2AXPA 4IDOA 4NTZA 2ZE5A 2GTPA 1N6KA 3O8DA 4M1TA 3AF0A 1NBME 5LPNA 4KODA 3QXHA 2HEIA 1Q20A 4B33A 1SKYE 3FVQA 1XDBA 1IHUA 4ZCMA 1Q1QA 3KFXA 3ZVRA 3K0SA 2FFBA 3K0AB 4ASUA 2QAJA 2Q6TA 3K8YA 3ZDQA 2G1KA 3C5CA 1YHNA 4YDSA 3GFOA 3IPXA 5FI1B 1CIPA 4RZXA 2KSQA 5AUNB 1W4RA 1J99A 3GQBA 4B6FA 3KKPA 4LBYA 4KAXA 4B43A 1E9CA 1P5ZB 5CITA 4R98A 1E2FA 1NG1A 2OUKA 3MWLA 4Q18A 5SZHB 3CLVA 1XJ0A 1YZUA 3UIEA 4NKRA 2X2FA 5AJVB 4OL0A 3SC3A 1EFTA 1KZGB 1KO4A 1S0UA 1J2JA 5F98A 5HKKA 1P2TA 2F9LA 1O87A 3VR3A 1E2EA 4RD0A 2EWWA 3KB1A 3AVWA 5CDFE 2ZI6A 4DXAA 3TNFA 4JL5A 1N0WA 1OFIA 2RGCA 4ZCIA 1M2OB 3K0EA 5E7MA 1MKYA 3SBDA 4DIEA 4KLNA 5DN6D 2QSYA 1OYWA 1SULA 4QNMA 1E9AA 1OJLA 2F1JA 4PZYA 2QP9X 4TMXA 4OI4A 1W1WA 3N5CA 2EQBA 1JEEA 3WMEA 3B85A 2BC9A 1TF2A 2YOHA 1NSTA 3TR5A 4GI7A 1SVMA 2TMKA 1EX6A 1GAJA 1BH2A 2VEDA 2Z83A 2ZRJA 1XTSA 1DVRA 4ZPXA 4EJSC 4BFVA 2CJWB 4NYIQ 1ZM4A 4GP6A 2QEQA 2XAUA 1OKKA 1ZD8A 3CH5A 4BWYA 2YZ2A 3LVQE 4GSYA 1G5RA 4Q7JB 4IHQA 4ASUD 1XPUA 4TSFA 1VG1A 1GSIA 1XXHA 1DG3A 2O0HA 3A8TA 4KFTA 5EP4A 3I32A 3PEVA 2CLSA 3NDPA 1DADA 121PA 2K5UA 4IDQA 5CB6A 4PAMA 3Q9LA 1TU3A 1SVLA 4XSGA 3RHFA 3K53A 2B8TA 1DG1G 1NY5A 5DI9A 2Q3MA 3GLHE 4BFTA 4I1SA 4M1WA 5FUVA 1E2PA 1XEWY 1Z0IA 2WOOA 4GOXA 1SXJA 1IQPA 1LY1A 4AY2A 3DKVA 3GPLA 1OYYA 3E70C 4A9AA 1KI3A 5HKKD 4IRUB 1NMXA 1XTRA 1UBFA 1S4QA 4A2QA 1JXMA 1P2SA 4ILEA 2JLYA 2BM1A 1MOZA 5ELXA 1GL9B 4H1VA 4D82A 2ZR9A 3RS3A 3WNDA 2WSSA 5FBVB 4Q7LA 4IKEA 3ICQB 3NVAA 1XCPA 4LZZA 2BJVA 3U4QB 3SDZA 3K0AA 3SJBA 5J47A 2JJ2A 2OLJA 2ZS7A 5JWRA 1XJQA 4Q9HA 5BN3A 2NO9A 1K6MA 5C4GB 1J8YF 3GLGE 1E0SA 4Q47A 5CK5A 2J5XA 1I2MA 3G82C 2JLZA 2VYFA 4V02A 1AGPA 1OKKD 1CR1A 1UBEA 3DM9B 4FI3C 5JJLA 3QNUA 2ZJAA 4TSFD 4NYMQ 3L2OB 1Z5ZA 1RKBA 4FIDA 5D3QA 4JLMA 2X1VA 3AUXA 1CS4C 1HY3A 1R5BA 1Z22A 2XXAB 2REBA 4GL2A 3I62A 4RKEA 2QMUA 4BGDA 3GLFE 4HAZA 2JAQA 4B35A 1WXQA 1P2VA 4IOJA 4TL9A 3THWB 4DBLC 4FXPA 3CONA 1Z06A 3HU1A 4TWZA 1ZVQA 2GF9A 1V43A 5HTKA 1KDRA 3BB4A 4QGFA 1P7CA 4W5HA 1GNRA 2VP9A 421PA 3U6BA 1T3HA 4E09A 1LW7A 3KB2A 4Q9JA 4R71A 3AVYA 3ADDA 2VIIA 1C1YA 1KO5A 4GP7A 3BH0A 1C9KA 1OLOA 1W4CA 3ETLA 4EUNA 5F3WB 2CCJA 2GEUA 3GJ6A 5FI0B 4O3MA 1ZD9A 3SEAA 4Q19A 4KSBA 4UQOA 5C18A 4EJSB 2IXGA 4M0LA 2GRJA 4DLYA 2IXFA 2WSSD 1QHXA 2CJWA 2PT7A 3OF5A 2AN9A 3Q85A 5KTYA 4URUR 2JJ2D 3AKEA 2ZPTX 1KZ7B 1OXUA 2ODBA 4PPNA 4CEIB 1GVNB 1O3YA 2PMKA 2GXQA 5TARA 4BZQA 4KVAA 2H1LA 5JRZA 2IUTA 3CH4B 4QBGB 2RGNC 4LYJA 3LDAA 4QL3A 3D3QA 3JVVA 4MKGA 3SJZA 4MDFA 3BH6A 2OCPA 3B1VA 1B23P 1NSFA 4QXAA 5JSZB 4LJYA 2GEDA 1OB5A 2ZQ5A 4D80A 2BM0A 1E2GA 2ZS8A 3FFAA 5EE5B 3CIOA 3LW7A 1MO3A 4HI0E 4YMUA 5KYKA 1TAGA 1EFRA 3TSOA 4QOSA 1S1CA 2J59A 4TLEA 1UKZA 3OEEA 2AFHE 1NVWQ 4UXIA 3KQUA 2A78A 2KE5A 4DDVA 1HT1E 3D31A 2ZI9A 1GL7A 3QKUA 1E9FA 2GK7A 2AKYA 3M6AA 2VPPA 1UKVY 4JS0A 2FWRA 3UG6A 5JHHB 4QM7A 5JRJA 1CLUA 1RE0A 4M22A 1WMSA 1IY2A 1X1RA 1Z0KA 4FMBB 4QGAA 1TU4A 1XD8A 2CMKA 2BMFA 1E2DA 2I1VB 1N6NA 3U4QA 1N6HA 2FOLA 4OQMA 5FBRB 2ZREA 3PIRA 1KGDA 2PJRA 4G5RA 4JVNA 4N3NA 4TMVA 3NDBB 4BFUA 5EXPA 3BIFA 2ZYUX 1FX0B 1WB9A 3EZFA 3QF4B 4IDHA 3RVBA 4Q4HB 4R9UC 1IM2A 2RAPA 2DWPA 4B3FX 4ZIRB 1E2LA 2FU5C 1W0JA 4PSAA 1OXTA 2P6UA 4Q1CA 2H7VA 2P6RA 4RSGA 1XTQA 1DO0A 2KBEA 2XXAA 1DARA 3W6PA 4V03A 1RZ3A 2GA8A 1IOZA 4WOPA 3UMSA 3KKQA 3A4LA 1OFHA 1YZTA 4HDOB 2QP4A 3CW2A 1M7BA 3THWA 2VHUA 2IS1A 2OE2A 5UKDA 5LB4A 4U5XA 3REGA 1FNMA 1Z2AA 4JLOA 1IY0A 2ZTSA 4DLUA 2XEXA 1OT3A 3NIBA 5FOXA 1H8HA 4AD8A 4B75A 2C98A 4D4KA 1KO8A 3OEED 4M53A 2XB2A 1I4LD 1KDPA 1PLKA 1FMJA 2EWVA 2LKDA 2OESA 2GZHA 3DOFA 1NLZA 3KQKA 2FG5A 1RRPA 3FYHA 5GVRA 1AJEA 4EJSA 4PQFA 2AD5A 3P20A 3N2IA 1XBTA 1ANKA 4DC9A 1RYHA 1GDDA 1CJKC 1P3JA 3ICEA 1Q21A 4NCKA 4I1UA 4B6EA 4RD2A 4U00A 4H1UA 4DLZA 4US0R 1ELOA 2WWHA 5F2EA 1L2TA 2PMDA 2YNMA 3NC1C 2FFHA 4D4JA 4CEIA 4HB3A 5FFMA 4QRHA 1YZGA 2Q0HA 3OEHA 3RC3A 4A2WA 4RZ3A 5HPYB 3S1AB 2F43B 4OQFA 1P9RA 1GKYA 1W0JD 3BE4A 4BZPA 2IEZA 2ZI3A 3I5XA 2OFWA 2NG1A 2CVFA 1AN0A 2LWIA 3ZVMA 5JSZA 3OIYA 4LGMA 4JVLA 2H16A 2WHXA 4HLDA 1OH5A 1ZCAA 3GD7A 1S8FA 4BFYA 1X1SA 3VNVA 3O8RA 1US8B 2UZIR 1OXSC 1OXVA 2Q9AA 1S9HA 3KKMA 1N6LA 1TADA 4M4SA 4ZI3A 1ZM7A 1XCGB 1Z07A 1JQJC 1Q22A 5EP3A 2QSZA 2FH5B 3B13B 1KIMA 2QG6A 1FUUA 4A1FA 3TUIC 4NPHA 1H8HD 1BMFA 1GKIA 4ON9A 5FBWB 1E6CA 2IS4A 4UNRA 2IYYA 3F5FA 1E2NA 1KI8A 4C3ZA 4F93B 5L3SB 5E7JA 5D3MB 6Q21A 3AF1A 1OH8A 3TRFA 3CX8A 4CYMA 1TEXA 1FX0A 4M9XA 4LHXA 3QF4A 4MA4A 4Q4HA 2GXUA 2ZRMA 2F1HA 4G5QA 3U44B 1E2QA 2GJSA 1RRGA 5TXGA 2EYQA 2GZDA 3PVSA 5BQ5A 3EX7C 1P62B 1RVDA 1SXJE 5DH9A 3EASA 3IO5A 3OEHD 2QMOA 4EQ6B 4M8NE 3PG5A 4URXR 2CHQA 2C5LA 3FB4A 4DVGA 3FPAA 1P61B 2VSFA 3R9XA 5TDHA 3SFZA 1SVOA 1XEWX 3V00A 1CRPA 4LX0A 3VX4A 3AKCA 2ZANA 2B8WA 3LY5A 4LJ9A 3MD0A 1P75A 2ZU0C 2FFQA 4HLUC 2ZAMA 3UMRA 2QUZA 1NLYA 3M4YA 1CULC 5BYJA 3QEOA 2F6RA 3CRMA 3M0EA 5FOVA 3WMGA 2E87A 1VKJA 1AS3A 1OF1A 1N5IA 4X8OA 2G1JA 3I8SA 4NL4H 2F1IA 2ZYVX 4DB2A 1NY6A 1G7CA 5FUWA 4R2IA 3RANA 5LD2C 4FMDF 1G41A 2SHKA 1CR4A 3IHWA 1BMFD 1XCMA 1Z6TA 3FGNA 4FCTA 4TLDA 5KHOC 2R6GA 1PUIA 3GJ3A 4A0GA 2B92A 1QHGA 2ORIA 1R7RA 2PEYA 1DBSA 5L3RA 521PA 5H68A 1KY3A 3AQ4A 4HDCA 3I5YA 5DLQC 2J0UB 2RGNA 4LYFA 2CXXA 2KB0A 4RFVA 1VYVA 5E3HA 5FR1A 3AV0B 3ZS8A 2IEYA 4RD6A 3S1AA 2PX0A 1E79A 2F43A 3Q8XB 1EXMA 1ZRHA 4NCJA 2JIZA 1W0KA 4V0LA 3MRSA 2O8BB 4NP6A 1CJTC 4LRWA 4RCYA 1RC8A 1G5PA 2GJKA 2ZRGA 1NG9A 4TT3A 2OZEA 1XMJA 2J0VA 3CNOA 1Q57A 1GFIA 1CXZA 2GJ8A 4Q03A 2YC4C 1YVDA 4OYHA 1QG2A 2D2EA 1KI9A 1IONA 1CRQA 2UZ3A 2OFXA 3FHOA 3SR0A 4XSHA 1JAIA 1XD2B 3B6EA 4A0RA 1ZJ6A 2OXCA 5A5GA 2NPFA 2ANBA 4F7WA 1OIXA 1Q44A 1A2KC 3J81k 3NC0C 3T1OA 3BAFA 2IYQA 3QXJA 4Q1FA 5A0FA 5L3SA 4KXFB 1LS6A 3ZQJA 3U7FB 5D3MA 4TMTA 4W9MC 2YJTD 3RS0A 4AKGA 1U94A 3D6TB 5AJYA 1KSGA 2ZJOA 2ZU6A 1IXZA 4M1OA 1W48A 1VCMA 3AKDA 1G3QA 3U44A 1R0WA 1U0JA 3FFBA 1VG9B 4LC1A 1S3SA 4XD7A 2ZIAA 4QBFA 4AG5A 4BLSA 1FW6A 2PX3A 3MFYA 4MRSA 4CT4B 3I8XA 2WSMA 3AVPA 3FKQA 2G0NA 1Y3AA 4EQ6A 1E79D 1Q12A 2JIZD 1W0KD 3R8FA 1RIFA 3R7WB 2AR7A 2C78A 2QM8A 3LLMA 3MCAA 2ZRNA 1L4UA 2XOKA 4HLQB 2FGKA 2IT1A 3GLIE 2JEOA 1VTKA 2PLFA 3THYB 3LH5A 1UKEA 3WXMA 3DO6A 1ZUNB 1K5GA 2AHOA 1JXOA 2HF9A 4KHZA 4PANA 2R2AA 2YOGA 2XSZA 2MSEB 2YVUA 2IYWA 3UANA 1N5JA 5EE1A 3GP8A 4C7OB 3RRMA 3R9IA 1ZC4A 4PAOA 3CWQA 2FPKA 2ORVA 4I4LA 1W5TA 1U90A 4LY6A 4GBMA 4DCVA 3F0TA 1KNXA 2VA8A 2FSHA 4HEJA 4TMWA 4CF7A 1OH6A 3RC8A 3AVOA 2LKCA 2QMEA 3PUZA 2QT0A 2QTHA 4Q7KA 3TBKA 2NO1A 2J0UA 2ZJ8A 2YYZA 3HU2A 5G3ZA 2IC5A 3GMTA 3FHCB 2FSFA 1NKTA 4TMKA 3FWYA 3CX7A 3QXXA 4P4UA 4JLAA 1M6NA 2A9KA 1Z6GA 2DPXA 4LUCA 4D0NA 4EFNA 4Q66C 2O8BA 3EZ6A 5FUXA 3LBIA 1II8B 4RD4A 1N2CE 3WHLA 4YC7A 3UATA 2GHIA 3RRNA 1WBBA 3DM5A 2L0XA 4LJ5A 1T0HB 3SYKA 3V9PA 1GRQA 4D4MA 2IA5A 1QHIA 2PL3A 1DTSA 2FPLA 2XOKD 4A6PA 1HE8B 1Z0JA 2ERXA 3GJ7A 4KYUA 1N6OA 1ZNZA 2Z6VA 3CKLA 1MO6A 3CZPA 3RWOA 4B34A 5DHAA 1PUJA 1WE2A 2DWOA 3B7GA 5FOUA 2BMDA 4V0OA 5GADl 1DPFA 2ZRLA 3U61B 2CL7X 3RWMB 1Z83A 5BYKA 2QENA 3WRYC 2IYZA 2DY1A 3O8CA 4PC1A 1M34E 1D2EA 5L3VA 3VU9B 4ZI2A 3ONWA 3UXMA 4ZO4A 3REFA 3TSWA 5JEEA 1KI4A 3DZDA
chains in the Genus database with same CATH superfamily
4EJ6A 1N57A 2ZSUA 4IMIB 3CH6A 4RKWA 3RUHA 4BJ3A 3ZD7A 4JJKA 1TW2A 5E7IA 1XTPA 3HJNA 4LSWA 1GP2A 2BEVA 3KB8A 4UBJA 3RSOA 1NU8A 3EDCA 3F2IA 1CY0A 4QUAA 1IBCA 1CY2A 2VUIB 1JEDA 4UMDA 1FSZA 1YHZA 1MF7A 3LX5A 1BE8A 4LNHA 5LP6C 2QAGC 4D3XA 4D4LA 2V6FA 4YMTA 4LJKA 4XQ9A 1GT91 2O0JA 4AG6A 4BLOA 3BJZA 4Q1VA 4S1NA 2JGRA 1RWQA 3D4IA 4YRQA 2FE4A 3NIDB 1A4RA 1JG6A 4W9RA 5HZHA 3TR0A 5E4FA 1G4HA 4HRXA 1ACLA 1GEGA 1N7JA 4QO8A 1RYNA 4BDTA 5JJBA 3D8HA 5CNJA 3GFQA 1CJCA 1CUEA 1YIOA 1ODJA 1UANA 2XTMA 1BYIA 3AX6A 1H42A 1KI6B 4BLVA 2B3DA 3THYA 1SHKA 1DIOB 2GPYA 4PIVA 3B6IA 1F4LA 4W9NA 2OHIA 1ZUNA 3LJKA 2XZLA 2J0QA 1Y80A 3M8KA 3C15C 3ZYZA 1NMYA 1QMGA 3I1FA 2NSDA 3DZCA 1B6RA 3MW8A 4G5OA 2OILA 4I81A 5FUMA 1IJEA 5A6SA 2IELA 2XVZA 5BSWA 8OHMA 3AOGA 4YCNA 4I8DA 3C39A 1F1JA 5THXA 1Q19A 4KBFA 5H82A 3OE4A 4TRJA 4BO3A 5HX7A 1J7KA 1NA5A 1EXDA 3RYFA 1Y6RA 2HMWA 3O8QA 5AK4A 3QM1A 1Z38A 4U3JB 5E2AA 3EXEA 4OI1A 3KR9A 2QE7D 1VSQA 1W87A 3LUKA 4M9ZA 4EYGA 5JZVA 5KTRA 3KDPA 5C46F 2RHBA 3Q3JB 4GBED 5EKSA 2IV3A 3OU7A 2LCFA 3NOQA 1JIUA 3CVOA 1YVPA 2MWMA 5DYWA 3ZHBA 1JHDA 2ZKLA 3G59A 1OXKB 4FLMA 4GDMA 4U7PB 3ZWWA 3ZYCA 3LF2A 5LIPA 4RVCA 1JWLA 2C2MA 2NZJA 1OHHD 3FZNA 5COQA 4QEDA 5JWHA 4JA0A 2ZM6B 4MKHA 1ZGHA 1O0BA 1WXXA 3LSYA 5ALLA 4C14A 5LQCA 1TA0A 4RTPA 3QPDA 1IY9A 2RBGA 1F6BA 2V7QA 3EZ7A 1YZFA 2PAFA 3NIFB 4KVZA 4RZSA 4YMSA 1D09A 5ESWA 3EGOA 1CR2A 3URKA 1E3EA 3ICCA 1WZCA 4XCXA 4AJ2A 2ST1A 1DB3A 4ETNA 4KIJA 2HUNA 2EW8A 2FWNA 5D5HA 3A9WA 1FC0A 5JLAA 4P33A 1HURA 1PW5A 2JFWA 4XAQA 2JLCA 4OFZA 2HWUA 1DL5A 2WAOA 2VN8A 3FYCA 4QJ3A 2ETXA 3B6ZA 4TUYB 1YACA 2Y71A 4BASA 3ZDCA 4RESA 1P1CA 4O0MA 1M8PA 1X92A 4Y6GB 3WHIA 1OTXA 1M76A 4LGCA 1TQ2A 1SBTA 3OESA 1MEEA 3CRW1 5ANRB 3SJCA 4JL6A 3TDNA 4ENVA 1B6SA 1L1EA 1URPA 2C61A 4P83A 3ZJYA 2GVDC 3QKSB 1AQUA 4M98A 3CVXA 1HDRA 1M6VA 3ZG6A 3ORSA 2CF5A 4ACBA 2MSNA 2Q2NA 2YWGA 4IUBS 1GKKA 1U9JA 1UBCA 3BC1A 1OTHA 3FMVA 1UBGA 3VU9A 4DKXA 3CPEA 1HZZC 2OGZA 4UM9B 1UC9A 2GFHA 3ZUPA 3FPJA 4ZAYA 3RYTC 1LLQA 1OYVA 4LYAA 1COZA 5HFJA 4F4CA 3HV0A 4G4SP 5LQJA 2J7PD 1R64A 2R65A 2CJYA 5CVJA 3HRIA 1L7EA 4YRTA 5FR2A 3T38A 4AO6A 3G9XA 1SUWA 4L22A 4NMMA 4URYR 3ZWPA 1PCXA 3ZWYA 4KQEA 2FLVA 2FMUA 2WTBA 4M7WA 4DPKA 3A0RB 3OETA 5FPSA 4AJEA 3PQ7A 2JVJA 3CHYA 3CURA 1VL2A 1S1MA 4DBZA 3MJ4A 3WQBA 5IVKA 2HBYA 3EC2A 2B6NA 3FYUC 4XJVA 3ZQ4A 4GE3A 4J0GA 4C4OA 1KI6A 1YKGA 3RLIA 4U2EA 1QIEA 1KHHA 3JALB 1P4GA 2WZCA 4LOHA 4RY9A 4BUZA 4BBAA 2X6RA 2WWYA 1OROA 2ZIXB 4HFNA 2HEGA 1AX9A 2DTXA 4JBHA 4WCDA 2B34A 1IDOA 5EERA 4BX2A 4ZMRA 5KJ6A 1KAOA 1M74A 1PS9A 1USVA 1UINA 1XQ1A 3U4AA 5FWAA 4OAOA 3Q2KA 5IAEA 1HQKA 3WTCA 4CR6A 5IH3A 2CV1A 1RLOA 1G8MA 3PPXA 4IM7A 1CZLA 5AW7A 1MG0A 1X87A 2QVYX 3H1FA 4NOLA 5TPWB 4ESVA 4BN0A 2PBFA 4RHFA 3E9NA 3OZRA 5HTOA 3ZE6A 3FIJA 1TZBA 3EULA 3EQ6A 3KEQA 3M5PA 4HDRB 1GKUB 1R5OA 4U3JA 5FL7A 4HC4A 4D3DA 3ND6A 3G0BA 4FWBA 1V8PA 1VE5A 3SJAA 4Q39A 5T6MA 5CVEA 3LDHA 1KJWA 5D1HA 2XY4A 3QH4A 1N3IA 5GP1A 1DGQA 3NT2A 1E3IA 2OCYC 2JD0A 1SCKA 1VHTA 2OVBA 2ZRQA 4XVQA 5BUQA 1O97C 4TXMA 2V7BA 5HK9A 1TF5A 4G4GA 4XWOA 3UEOA 4C6RA 4A26A 1M0WA 3NHBA 4B3GA 1D2AA 4V38A 3KXIA 5TGDA 5A1JA 3T1NA 5B30A 3ITEA 4AAYA 4H7EA 2TYSB 4LJ7A 1MNAA 4P0TA 4MPDA 1SUDA 5IFKA 1JH9A 4LJ6A 2QXUA 1KKMA 2CFOA 4RJJA 5KO2A 1A97A 5ALRA 1JAYA 1GPNA 4BFZA 4EG1A 4BE4A 1C5KA 4G6ZA 4EB3A 4LJLA 1EGVB 1UJ4A 1EWTA 1Y6QA 3CBQA 2HRBA 4O6VA 4Z9FA 3VOSA 1MHTA 4UDNA 3UM9A 3OX4A 1KBZA 3TIXB 4TUYA 4AG3A 3PS9A 4HQKA 1Z39A 3QP9A 3LXRA 2AJ8A 3SEFA 1JT9A 1XXLA 2CZQA 4LX8A 3ES9A 2XCIA 3PVZA 3F1KA 1CF4A 1UZMA 3WRYA 3TLAA 1PNOA 2F8MA 4OLHA 3QKSA 5JRDS 3FHLA 3MGKA 4FLFA 3M7IA 2B9VA 4X66B 1GPDG 1B43A 5U4QA 5TR9A 4NHOA 3EWSA 5HIIA 2VDKB 1W35A 4FDTA 2VDNB 6AT1A 4PLPA 2L17A 1Y98A 1TD1A 3L4SO 1D6MA 5K99A 4PNPA 1H6AA 2WU3A 3FDIA 4IDDA 4GZMA 1ONOA 1GTRA 3RGGA 1ZPDA 1P1HA 1XNRB 4MAFA 1JZTA 2O5EA 4UPVA 2B61A 2TMGA 5DNEA 4M83A 3BK2A 2X3YA 2QLNA 1E20A 3N8KA 1FRZA 1S7GA 3IUNA 3SZMA 1Y4DE 2PT6A 2I4IA 3C1TA 2PS1A 1JEJA 2WWXA 1YL7A 4E30A 2W58A 2MMGA 3DH0A 4AKTA 1JQLB 2WA1A 2YVKA 1EQAA 1M1UA 1HDYA 2I4LA 4ZYZA 2JFUA 2HHAA 2ZYAA 1FYDA 3FB1A 1UBKS 5J23A 4XR4A 2DKFA 1RQXA 3A1UA 2B36A 3JALA 1LSOA 3ZDEA 2F55A 2QNBA 2XYGA 1L4HA 3MSXA 2VF4X 2ZIXA 3EUAA 5JLJA 2W2LA 1PVDA 4R31A 1GPYA 1TZKA 3QJYA 4QECA 4B2IA 1J2EA 1XZBA 2R2GA 1W44A 3RVQA 5F7XA 2VPXA 3PEWA 1TMOA 4BGIA 2GHQA 4Q7EA 1Z5UA 3BUSA 4S35A 1Q16A 3DZJA 4OP2A 1NUUA 3QVXA 4N3AA 5TPWA 5KKNB 2XTJA 1KJYA 1M5UA 3FF1A 3JD2A 4DLSA 1PR6A 3I9MA 3ZOZA 4ALMA 1AKYA 4LN1A 4WFQA 5F9HA 1HA3A 3E27A 1SU7A 3MQ4A 4HDRA 1Q83A 2B5OA 3FHTA 5C35A 1ZJJA 2JFQA 1Q0RA 4BP9A 4KO2S 3QG5A 1XO1A 1W1IA 3GEMA 1RTTA 3HRKA 1NVGA 4JBNA 2QTBA 2HWXA 2JJ1D 1HBJA 4WKBA 2P2DA 4V0NA 3U4DA 3GVHA 5L4LA 4EPVA 1E9EA 3OX3A 3RT1A 3QV2A 1ARZA 2X13A 4C5CA 3VDMA 3HJHA 1U2TA 4Y1FA 4AFNA 3N2KB 1P31A 4Q1EA 1SVSA 5CIQA 4EG7A 1DMSA 2JHGA 4V0ME 2D13A 2AQHA 4EVQA 2VEOA 4UUQA 4J3FA 2A5DA 4MKZA 5ELMA 4OGFA 3T34A 4GX5A 4G63A 4YJ3F 4F4FA 3OTOB 1PQUA 1GG8A 4JJAA 3W1VA 1RZRA 1JTEA 4MCIA 3E5HA 1Z28A 4ENRA 2BF4A 2O59A 2FN7A 1AN9A 1DOZA 1DTWB 2A8YA 2HUPA 3TS1A 3OJ0A 4BP8A 5I7SA 4MVJD 2GPTA 3CW8X 4ISBA 3U4HA 1VRWA 1LTKA 2XYHA 1V4NA 1BE6A 3GJ4A 4I1VA 4KGVA 4F6CA 4H1WA 1RQ2A 4UNIA 1E92A 3RJMA 1ZOSA 3WGUA 1IB6A 4XW2A 4A8JC 3IPRA 2CUKA 1X74A 2O0KA 3KKZA 3L0OA 3T4EA 2AFIE 2GBPA 4FFVA 4JQOA 2IZ7A 3MJFA 2GAIA 3KPJA 5BN5A 4ZJUA 1A1SA 2FW7A 4KV9A 3EEOA 4EYKA 2ZRPA 2E89A 2DH5A 1LUAA 1QDUA 3PYMA 1FNCA 1MTZA 4OHXA 1Y48E 1LEHA 1BHQ1 2QJOA 3BPSA 3AHJA 3FR7A 4ZEMA 1Q0HA 4RDHA 3AOEC 3QJGA 2QN9A 5AKGA 1MN6A 3SNHA 1QPGA 3AI2A 1GA1A 1QP8A 4LQ4A 2YJ5A 4BMPB 4BO5A 1H8EA 2PUHA 4IWNA 4G1UC 4EGQA 2P3OA 4IDFA 1YDMA 2HIAA 3CVJA 4FUTA 1C3OB 1DCMA 3GLHB 4GKKB 5KI6A 3L8MA 1KVQA 3BDIA 3AZQA 4WRRA 4UDYX 2Y27A 5CYFA 1YS6A 2XUHA 3P9ZA 1OBVA 4LPSA 3NHZA 1YJXA 1HORA 4YWJA 1FEZA 1B8UA 1MJFA 5CD9A 3RQIA 4KDCA 3ZWAA 4HYYA 4D45A 4QJ5A 2CCGA 1TL7C 2E4UA 3VR0A 5KU7A 3A6PC 4KG7A 3C43A 1RAGA 3ZDZB 4NZ9A 1WXEA 3S2UA 3D8SA 2Y8EA 3K05A 1BHSA 4IFEA 1UC4B 2IOFA 2WNIA 2XUDA 3EDOA 5EWLB 4BMNA 4ZEVA 3QVKA 2A30A 2AR0A 3VC1A 1I4TD 2H18A 3JTEA 2YY5A 4JH0A 3W9BA 4ND8B 2ZTMA 3B2NA 1KJZA 1D5WA 1PBTA 3HBAA 4LCBA 4DZZA 1T6YA 2DUJA 2FQYA 1AQYA 2FR0A 3ADPA 3F4KA 2UVQA 4G2TA 2VJCA 3ZD9A 4BZWA 5AI6A 2ID8A 3R0JA 2PT9A 4PCVA 1SQ0A 3S44A 1WDKA 1Q1GA 2ZS9A 1VMAA 2D3TA 3PYLA 6ABPA 3IP6A 1VIVA 4LJ8A 5EHNA 5IK2A 4EJMA 4CLRB 4ESEA 1J2RA 3M9XA 1HE1C 1EP1B 2GVNA 5ERXA 5KJCA 1X3LA 4IGEA 4GHWA 2X8AA 4PG6A 5JBIA 4NH0A 1A96A 4BKOA 2WJYA 1NKVA 4WXEA 3P26A 5LC1A 2CVHA 2AN3A 1XKTA 1QH1B 5D2CA 4GPBA 4NBSA 3D54D 4K9MA 5EZYF 3DS8A 3FPLA 1ESMA 4MMYB 3TZ6A 4TL8A 5IXYA 1ZSVA 4KUGA 4HQNA 2XB9A 4XJXA 5TQ0B 2BDUA 3BD7A 5F7OA 1J8MF 1VJ5A 1WSBA 2CHFA 4IVRA 4F3KA 1RS0A 4LZWA 4YGYA 2PVCA 5AW9A 2XF8A 2A0KA 2P2NA 2GPAA 3NTQA 3A4YA 1K92A 4OOEA 1T9BA 4AP6A 3N2KA 1MZPA 5LZ4A 2BFNA 1FPMA 2BFAA 1KH1A 1LNZA 2NNLD 2P1ZA 2YWEA 4HWGA 4KO3S 5AR1A 5A06A 4MAMA 2GD0A 3LAWA 2XMBA 1C14A 1JDPA 2CKDA 4DMUB 5BRAA 2NTNA 4GRAA 3JVDA 4H27A 1V96A 1UK7A 1S4MA 4DSAA 5EJEA 3OQMA 3NHAA 3ET4A 4F2GA 1DTWA 4JJZA 3TQCA 4U2KA 1ZUWA 3PDIB 1ZINA 1VKOA 2J41A 3D1LA 3NDJA 1Z18A 3K96A 3V8RA 3ZCTA 4OQYA 3QA9A 4PRYA 1B6GA 1ML4A 2GZSA 2O2IA 4U6QA 1VPEA 5DBHX 1AK2A 4FTWA 4O4JB 5IEBA 3KL2A 3BQMB 2VBIA 2I2CA 5IF9A 2XE4A 4O4HF 1KYIA 5GTDA 2Z2YA 4TTQA 4Y2TA 1MO2A 4CL3A 1YR1A 4KQWA 1GYRA 2AYXA 4LZPA 5GAJA 3VH4A 5C1IA 3A06A 4KO1S 3WIBA 1LWNA 5EJ8A 2Q62A 2O1XA 3EOZA 3LYHA 1KDYA 4XVCA 3DLBA 1A4IA 5DHRA 4X3PA 2NWQA 3SQMA 1E59A 2BTEA 4MZDA 2IYTA 1P7WA 4HTFB 4YFYA 3LFHA 3QEAZ 2VJYA 2YV3A 2IPXA 3QGMA 4NV3A 1DKLA 4IDCA 4Q24A 3LP5A 1Y8ZA 2JLWA 2AEMA 2X19A 2I87A 3GRAA 3LZ6A 4XOIA 3IOMA 3LK6A 3PA6A 3RAJA 3SX0A 4GG1A 1SZCA 1BZYA 5C81A 3K35A 1C3OA 1V7QA 1DU4A 1UQRA 3FETA 1R4MB 3GLHA 3TW8B 3QE9Y 3FOEC 2NUTB 2HA5A 3KNZA 1JSLA 4NRDA 4E2WA 5IWAB 2IH5A 2X2OA 1ZNYA 4N0DA 5FWYB 3ED1A 3VR5D 4JLPA 1O97D 3IQWA 5KDOA 3CH7A 1AUXA 2PG3A 3C8UA 1QRAA 1UQUA 2YOFA 1JEAA 1M7HA 3IP5A 5KTPA 3OUZA 4TN1A 4XB2A 4TYYA 3QVWA 3ADKA 1OIVA 2JL1A 5EWLA 4C07A 4DLPA 5BR1A 1FJGB 1MCZA 4FEAA 1KF0A 2FRVA 1LX7A 3AM1A 4ND8A 2NO7A 4FMDB 3U3RA 3LO5A 3OOSA 3EH1A 5LDDC 2JFOA 1FFWA 3WK8A 1UM9B 4H0FA 4MH0R 3FOWA 1QGDA 2XRMA 4LGYA 3OOEA 1RBQA 3JAWB 3Q12A 4B40A 4FDLA 4M8KA 4F1KA 5H16A 3FHJA 3W34A 4IUCS 5JTTA 1CC1S 3EPRA 2W2OA 4CLRA 5H5JA 3WO0A 3GIDA 4MHOA 2C3UA 3B8HA 1M6WA 2MJLA 1X6VA 2ZVDA 1LW6E 3DCIA 3DW1X 2AH5A 4ARCA 1E0AA 1IU9A 1K9SA 3MUNA 3CM0A 2OAP1 3G6KA 2FQ1A 3D4PA 2D1YA 2VNJA 1QH1A 2CLFB 2JGEA 5SY4A 3TGPA 4MGHA 3HI6A 4KRYA 2AQIA 1PZXA 1U9ZA 5IAGA 1BXGB 1OH7A 1L5GB 2O2SA 1FFHA 4FDUA 5TQ0A 1QQAA 4WESB 3CVVA 4LVNA 3EZ2A 4B6QA 3FRHA 5DBIA 5E9AA 4ZHQF 3U49A 1NLFA 4DMMA 2I3GA 1CEEA 4BNFA 3H84A 2DOKA 3L7YA 3Q7TA 4QYWA 4DSTA 3IQIX 4M99A 2A14A 4JLVA 4JELA 3S55A 2ACEA 3QLUA 2FEXA 2AA3A 4K46A 2ASEA 1FJHA 1YOVB 5AHKA 1G1MA 3HWSA 4MHSA 4U9UA 1IH8A 1Y6FA 4XVHA 4C0XA 3NRBA 1Z29A 1YFJA 4WY2A 5HM6A 4R1OA 2O8DB 2H1VA 1U2SA 1MJHA 3T15A 3VR2D 4H4EA 3PDIA 3L4KA 2VAVA 3BILA 2IWHA 2DWQA 4OHMA 4CW7A 1Z0ZA 4BV9A 5KPDA 3JAMA 2R7NA 3QHAA 2REQB 2IV2X 4JGBA 5JO0A 2D4HA 5SICE 3MLEA 3NM6B 3PQ3A 4O4JA 4TVBA 4A92A 1ZY2A 3LBAA 3PGMA 5C1PA 1AUPA 3GPIA 2BHNA 4K9SA 1OSNA 2SKDA 2RJOA 2CNNA 4URWR 4F38A 4M3NA 2O8FB 3DDWA 3KAPA 7ABPA 5T67A 1H2YA 1E6EA 4YCJA 4QG3A 2EIXA 1Q95A 1BQ4A 2H3EA 3FX2A 3R4CA 4UU7A 4ZO7A 4ANFA 2HM7A 1JIIA 1IBKB 4YRKA 4HTFA 4OVKA 4UUMA 1NURA 1UFRA 5A4JA 1BOFA 1ZYUA 3BA1A 5ES3A 5C7YA 5EXDA 1DV1A 1NXPA 3M1IA 3NHUA 4LNAA 2FMIA 1K7EB 2Q1SA 2VDOB 5C52B 1R0SA 2XWBF 3IMCA 3LVBA 3WWPA 4PO1A 3EMDA 4UNNA 1Y89A 1R4MA 2HWKA 2NQTA 3TW8A 2ZUBA 4CM6A 1U3UA 2Q50A 2NUTA 1EG7A 1DE0A 1H94A 1VI5A 3M1YA 1Z36A 3B3AA 4ZJZA 5DNVA 2IK8A 4R6XA 1R0XA 1XD2A 4TM7A 2PMBA 3DVQX 4Y2XA 2RHCA 4Y98A 3ZVNA 4GOKA 3ZZTA 2AUNA 1VIAA 1MAUA 6CHYA 3R23A 5A3VA 4QBIA 5IF3A 4JSTA 5ESRA 3SS7X 4B83A 4F4HA 3QIAA 3N87A 1GQFA 5DB4A 2AG1A 1BCSB 3V9AA 2XQKA 3PNYA 1L0BA 3G1UA 5HS6A 4BAUA 4DWJA 1VG0B 5AKLA 3TSZA 2PZGA 2VOJA 4EG3A 5A3RA 3N6VA 3L6DA 4PNHA 5K1ZA 2PRZA 1CHNA 1UM9A 4FFDA 2ZZKA 2BKEA 1T9CA 1PFWA 4KWHA 3IJRA 2XMSA 2QRMA 1G8AA 3JAWA 3A4NA 1NMZA 1N8TA 1ZL0A 2ESRA 3P8ZA 1RFLA 3I9FA 4KMMA 4NIMA 3G2KA 4DA0A 2TSYB 3K2QA 1RNLA 2NPIA 3D3EA 3W5AA 3MMSA 2C83A 3PPYA 2FPWA 5FAXA 3V6MA 3DWEX 1BWPA 3CRNA 3QXGA 4CE6A 1QORA 1D9ZA 4DCCA 3V4RA 4LY3A 4YQFA 3DKKA 3KZMA 4QUGA 3L1IA 2Z9BA 5BW6B 2I03A 2CJFA 1L5QA 3KR1A 3Q2OA 4MXDA 1WSWA 2GCOB 4TVKA 3V42A 3KDAA 1YT5A 2AK3A 2EL9A 2B0CA 1B1AA 1BXGA 2I3BA 4PC3A 4EY5A 2XRFA 2V97A 2HQBA 3K5HA 2BE7A 4BLQA 2Z30A 4K9LA 4KR0A 3LHSA 4WESA 4KGDA 2FZLA 3C6BA 3ESBA 2Q5QA 1Z2DA 2IXBA 5CGQB 1RW4A 3AF4A 3STHA 2G9NA 1MPTA 4R41A 2C4TA 2HCFA 2OV2A 3ECAA 3WIVA 3GFTA 2XV1A 1YU9A 4KTTE 4AJLA 3QPAA 2G9UA 1V5FA 3G0IA 3BTVA 1JHUA 2QUAA 1Q0QA 1YOVA 2P30A 3T9BA 4ER3A 2J0SA 2A94A 4QOIA 3F47A 4NFHA 3SLRA 3BL8A 2GK4A 4RM3A 2O8DA 4GYYA 3T41A 1QGUB 3MWGA 3G2NA 3TB6A 1CIJA 4RE5A 5EA2A 3GEHA 4NPAA 1SBQA 4ZI7B 2I8CA 3G0HA 1E1CB 5KBYA 1D04A 2YQ4A 2REQA 3I9KA 1ENPA 2D5AA 2A9FA 3I2FA 3VPAA 2X4IA 2WIGA 5DSXA 5I4BA 1O6FA 3PJRA 1Z35A 3G17A 1G2PA 1SGWA 2O8FA 4CN8A 3T9AA 1KY2A 4PHTA 4C08A 3CF2A 2HPHA 1U0TA 4AYWA 4CM9D 1ISPA 4HQFA 2VSYA 2OGUA 2VJMB 3C8HA 4JUCA 3F5QA 4D9NA 1QC5B 5F9MA 2BGMA 3LKVA 1LD3A 4KQCA 3H18A 3T7TA 3B2EA 1GRNA 2XHZA 2IPLA 4NWIA 4DIDA 4PLVA 4CV3A 1G2IA 1E9SA 1GQYA 1KVTA 1MVOA 3RUEA 1WLSA 3E4DA 3KUUA 1F9EA 3HP4A 3X1JA 5I9IA 3EOAI 4C4YA 1UQTA 1GADO 3HN7A 2O1WA 1DPGA 3IDSA 2DAPA 3SHOA 5TPZD 2BCJQ 1YQGA 1R5NA 2IP4A 4KBGA 3EPLA 3GNSA 4YVFA 1ODTC 1FUYB 4ML3A 4PFQA 4BFXA 1YR3A 2JFFA 1QJCA 4FM9A 4OQXA 3FCEA 5T4FA 3JVEA 3T35A 1A8IA 4BQNA 1GT6A 3PPWA 1I01A 1UC8A 4I19A 4CRWB 1QDEA 4U8HA 4HUTA 1G0OA 4RULA 5GZ3A 5JZBA 1RJGA 2Q3DA 2K87A 4KGZA 4YRRA 5EWMB 1BCSA 1G1AA 1M8GA 2PXXA 4LQCA 5AK3A 4E32A 2VRWA 3G3EA 4QOGA 1Z4LA 5C2JB 1CUJA 4U7WA 4UU8A 3OZWA 4ZVUA 3C6ZA 4BPBA 1FDUA 4AM8A 2D5IA 2JK1A 2WPNA 4WNYA 3RS9A 3FYSA 4OGGA 3GJQA 3FZEA 4F04A 3JQ8A 4G3XA 3ROKA 3KQLA 2HQOA 2PX5A 2P67A 3ENQA 3AJDA 1D1QA 1ODIA 2P2SA 3U19A 2D74A 3GP5A 1N6RA 1YJ5A 3ULKA 2YUIA 1PR1A 1L8LA 3NHKA 1JTFA 1WDMA 4EDFA 2XZTA 2L2QA 3IRVA 1LDMA 3MGBA 1Q50A 1RSZA 3GBSA 3P27A 1JKIA 3PHHA 5G0TA 2G9QA 2WMYA 4YMLA 1A2BA 3H2ZA 3IB6A 2GCOA 1IVYA 3AEQB 2AB0A 2V3VA 3L04A 3QVLA 4R2JA 5B2EA 3KYJB 4MUYA 5HYVA 3DDZX 4LOKA 1II9A 3IVGA 4MYTA 4BNMA 4DR4B 1SOUA 1KKUA 1E0KA 3RVKA 4AZ0A 1C3JA 4QM6A 1L7QA 1AS0A 5KVQA 3G8DA 4BB9A 2YV4A 4JOCA 2PSFA 1SCDA 3HE3A 5EZ6B 3T9FA 1XRLA 1RQRA 4F46A 1S89A 3IDQA 2EFEB 3VHLB 3SE7A 1KK1A 5B7PA 1R4NB 4PC7A 3ZIUA 3GGJA 3LY9A 5C7OO 5E3JA 4TZ6A 3VVCA 2HSJA 1AG9A 2VYNA 4XLTA 5BRJA 1RZUA 3HPQA 4UD6A 4UZFA 1UPUA 3SYLA 4A6XA 3OPYA 5CPBA 4HGPA 3OOJA 2HU2A 3C3WA 5GOZA 2IYOA 5LQAA 5CJPA 2ASVA 2QN1A 3UMFA 3TSYA 5JISA 1LC0A 1QGUA 1NC1A 3IVRA 1ETUA 2NW6A 1G6HA 3MUFA 4BMSA 2YICA 1C2TA 4ZI7A 1XRQA 1E1CA 4OQ4A 4TLAA 3S1LA 2V1UA 4JJ8A 1BEZA 2HJVA 4O3FA 4RCZA 2PLRA 4KDEA 3V2UA 1ODFA 4C76A 4EMTA 1LPOA 1V1MB 2D5LA 4ER6A 3HBNA 1WF3A 3VPFA 3MGCA 4RS4A 1EEXB 2PM8A 1R0BA 1XP8A 3ZHUA 2IHUA 2W83A 1L7XA 3RJTA 2OSVA 5FBLB 4N3BA 5HCNA 5I5GA 3UMBA 4E33A 3QE0A 1VC2A 1QTIA 3P0IA 3TQOA 4G1CA 4E6EA 1WAMA 2P9GA 2VJMA 3FZYA 1QC5A 3VBEA 4RELA 1ZCZA 1Y42X 3CJRA 3PDJA 2TECE 2Z5GA 5G1PA 2D5CA 3DAFA 4DREA 1XAGA 2FRDA 3G2LA 4AF8A 4E12A 3PWKA 3OEYA 4ETWA 3L7MA 2ZB4A 4MITA 1QGZA 2V4ZA 1BFUA 3BHIA 1GL6A 1NT4A 1U8AA 3GJXC 3MCZA 3SHFA 2CBGA 2IUSA 2OBNA 2ZUVA 5FNZA 2B4YA 1M5RA 1YGYA 1PF7E 2Q29A 3A1CA 1TTQB 3GRKA 2Y0BA 3FJOA 3T3PB 1YZLA 1P19A 5T3UA 4ZYWA 3QX8A 3CVYA 4CTNA 1N2CB 3VJRA 3UUEA 2IYEA 2IW1A 4KWCA 3DJFA 4V24A 1F5SA 4FHGA 5AK0A 3TG8A 4OHKA 2PXCA 4F2DA 1O5IA 1XLWA 2OZLB 3P96A 4RA6A 3W3ZB 5F1PA 3CMCO 5FH9A 5G02A 1ZEMA 5B3LA 3KJFA 5E6RB 4DANA 5BYAA 4LSZA 3PQCA 2IYLD 3VV2A 5EWMA 3PUXA 3FVRA 1OFTA 4D46A 4V3BA 4PLGA 1QWOA 1WXDA 3RC1A 1QB8A 1KTVA 3H5IA 2HPZA 2JCYA 3B89A 3NV7A 3SFVA 2Q21A 3T5CA 1F1BA 2V74B 3TIFA 2ILVA 3EFBA 5IP5A 3KEGA 5I3CA 5K6RA 1Z34A 2WE8A 3OJXA 4RFSB 4WA8A 3AG5A 3IILA 3IR5A 2INGX 2LRHA 4GIBA 1ZC3A 3Q87B 1YZYA 1BMTA 1JPUA 2XEDA 2GUGA 4M0UA 1FVOA 4L9WA 4F5DA 1W5EA 3KYIB 2V0NA 3C4JA 3GHYA 1Q1ZA 3VZRA 1UDXA 3CUKA 2Q3EA 2A1UB 5EQFA 4ZA2A 4OH7A 4C21A 4E4RA 4UCXA 4FLEA 2Z3ZA 1Y5IA 4O4LF 5HBRA 3G7NA 5JIBA 3AEQA 3LC0A 2XTNA 4L5BA 4H15A 4LHYA 4LV6A 3W9YA 1JDUA 3QTLA 4BVGA 2QN8A 5FWDA 3V4ZA 4PCLA 5JAIA 4RQTA 4LF7B 4W5TA 4J16C 1JPJA 2RH9B 2C88A 1BS1A 1JQBA 1QGOA 1V26A 2O5VA 2OKGA 2V6GA 3IAHA 2FW1A 2VJPA 2DQYA 3K3PA 3FLBA 3W05A 4UTOA 1MGOA 1GDHA 4AQYB 1IULA 1R4NA 3I01A 1JBKA 2WJVA 2RHOA 3QYAA 4CF4A 1Q7CA 1XSEA 4MR7B 3VZSA 4YECA 1E64A 1AUVA 2JPDA 3GCXA 3LUDA 4FONA 4WFJA 3RSZA 1JBEA 1ABBA 4S04A 2GPSA 5H4HA 5TS3A 2PBLA 3KKNA 3P9YA 3OCUA 1W75A 2RHMA 3PCRB 4LSGA 4TYPA 5BN1A 5JJCA 1ZIDA 1D1SA 1PT5A 3K0CA 3PC8A 3PQ6A 1CJMA 1KXZA 1Z8HA 4JY7A 4L76A 1ZMXA 5CM8B 4EW6A 3ZDXB 4ILKA 1L6IA 5GMOA 3PFBA 4W6ZA 1V1MA 4BNLA 2G3YA 3W6OA 4EFLA 4PXAA 2OB2A 3P52A 4CCAA 1MV8A 1MU0A 4EHAA 1UXIA 4H17A 4XX1A 1N5RA 1CZRA 3HXMA 1RYBA 1UAAA 2YWHA 5CLLA 5CB4F 5EPOA 3HTXA 3IP1A 3DLTA 1PJ8A 1RWWA 2EZTA 3EMVA 2HRRA 4LYGA 2BYTA 3GRVA 3PD0A 4KMSA 3DEIA 3K20A 4MJ7A 2RG7A 4B7UA 3IT3A 3OZXA 4R1NA 4UJ5A 1W52X 2YC2C 4J75A 2CC2A 1CX9B 1Q2UA 1X1AA 4JYBA 4CM8B 2IXDA 3UB3A 4EW2A 3JWJA 2F3UA 1XCLA 1XN4A 5DP1A 2PJUA 5TJHA 2WYVA 3LW8A 2FSVC 2A7QA 2CYBA 3LYAA 4QYSA 1N5LA 3QPWA 4A73A 3OP4A 4BKQA 4Z4EA 1G3IA 2R8YA 2FE1A 2KM1A 1J5XA 1IHOA 1XVVA 3PNLA 5CK4A 5FOWA 3MJHA 1AURA 4HXEB 4BB5A 3ZU2A 5J5CA 1C9JA 1N2CA 2KI5A 1BO6A 1QFZA 2WPDA 2XW6A 3AZOA 1EFRD 3UBMA 2GZ1A 5HBGA 3M4NA 3G5LA 2G80A 2FI1A 1AA6A 3AP2A 1Z26A 3ITDA 3OOYA 2ZLBA 1UT5A 4XYMA 4B8ZA 3AM5A 3M5CA 4QX6A 5E6RA 1Z25A 5A62A 1ZKDA 2AFVA 3MBOA 4XWKA 1UXOA 5DOVA 4LBWA 2IXEA 3E6AA 2ZIVB 4G86A 1XKQA 4HWOA 1DZ3A 2PZFA 3O8BA 3EVZA 4QG7A 5CTJA 4FB4A 3O6VA 5DBOA 3FBWA 3B1WA 4UM7A 2DEUA 3AHIA 2LGJA 2QQ5A 3NDRA 3MS2A 4K26A 5E6UA 4RFSA 3F96A 3T7SA 1NPTO 4C0QC 5CVUA 5FQOA 2XE8A 2PIAA 4XDYA 2X9GA 3ZKWB 1VCNA 1ORRA 3X1KA 4EHHA 7GPBA 3DWGA 4PLFA 2IYNA 4YONB 3B1XA 4G65A 3W2FA 3PE4A 2CFIA 1SZDA 1T2VA 2R7LA 3MLBA 1KAGA 3AVQA 4N0EA 1SJ9A 4ARAA 4HY3A 3D7KA 4TGLA 4H6WA 5GZ6A 4P7BA 4KREA 1ZWLA 5IBQA 1YRYE 3ZE1B 1YB7A 4PLWA 4FNOA 3IVAA 5LXTF 4BYMA 3U7GA 4OIMA 2QPTA 1GXSB 4KFRA 2A7XA 3H0CA 3HHPA 4UXHA 1WXFA 2J5BA 3OLVA 5K6TA 2HT1A 2H5JA 1TYDE 1Y7IA 3H97A 4WK0B 3F8TA 3FY4A 4IO0A 5ARBA 2QRPA 2W4MA 1JVBA 3ETDA 3FGZA 3DMTA 5F12A 3LPMA 2H08A 2BMJA 1JA1A 2BPOA 2OC9A 2Q3CA 2V3WA 3ONVA 4Q21A 2QMQA 4UMVA 1G64A 1VSTA 3UWDA 4ACAA 5JNLA 2WJHA 3JQRA 1OZHA 3P1JA 3ZGZA 4G26A 3ZLVA 3QWIA 3P0HA 4G56A 1LF0A 3U40A 4M9QA 3WWYA 5BV1A 1NHWA 4MR7A 5U4XA 1KGSA 1P74A 3SX2A 3AB3A 1EBUA 3JQFC 2P5YA 3C6XA 3ASVA 3DBHB 1GPMA 1EFHA 2J4CA 4CKYA 4IHAA 3S40A 1T8UA 3VC3A 3V4SA 2ZTUA 4I5DA 1IYZA 1DAEA 2H3HA 4RCVA 1PLJA 4MP3A 4GLJA 3LP6A 4ESHA 3FCXA 1BDMA 4PO3X 3P9QA 2WKWA 1NN1A 4UOQA 1HH4A 2FTKE 2QL9A 4IQ8A 4NZOA 1LSUA 5AW6A 1EK0A 3AVXA 3V80A 2XBUA 2DJ5A 1PJTA 2OG1A 3MMPA 4PG5A 4JEIA 3TQRA 4DIUA 1XYVA 2NU8B 2QK4A 1E5XA 3VZPA 2ZGVA 4Q3CA 1QFJA 2ZRIA 1RWPA 1UWKA 3CCFA 4HGOA 3UAVA 1M5TA 5ILOA 3I2IA 2MT9A 3A2LA 3UPDA 5AVTA 4OHZA 4RE6A 4EGAA 4CM8A 3IQXA 3KJHA 1X1CA 4A4DA 4R2HA 1ZK0A 2BMEA 3LQQA 1UCFA 1AY0A 2QVCA 5L3ZA 4NECA 1U9IC 1U7HA 1ZIYA 3LXXA 3L7JA 2O3SA 2VP2A 3CB4A 4MDYA 1UXJA 2E6KA 4V1CI 1HL7A 3GUYA 3N0VA 1M0EA 3KOYA 1W5SA 1AZTA 2C5GA 3QENA 1HDGO 3BTSA 3HJUA 2GYVA 3OFSA 3SEZA 4AIIA 1Y9AA 4K6GA 3WIUA 1NBMD 2VJDA 5HILA 3UAXA 4J1NA 1ADCA 1KI2A 4DLNA 3H1GA 3NWEA 2RB4A 4CI0B 5BMVF 3FWNA 4G8CA 4KXWA 4BBPA 2JDIA 2IYRA 4UAUA 1PT8A 1XMIA 3THSA 2C20A 2ODAA 1WB6A 2PCJA 5D84A 1BG6A 3ORRA 3PKZA 5NULA 1LB1B 4ZVNA 3I61A 4C0LA 4LDPA 2J3DA 1KS2A 1ZJ4A 2CMGA 3L43A 5GZ1A 1UBMS 2G76A 4DUGA 1JWBB 5JQWA 2Y1CA 5EZYB 3V34A 2I1LA 3W90A 1GPBA 4F9TA 3QNWA 3RRXA 2I91A 5C1BA 1JG4A 1NUSA 5JCJA 3ZKWA 1B26A 5AW2A 3C7KA 3AESB 1WVGA 2UV8A 3JV7A 1XWWA 1P2FA 5J2TF