3FMOB

Crystal structure of the nucleoporin nup214 in complex with the dead-box helicase ddx19
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
232
Chain Sequence
NLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the interaction between the nucleoporin Nup214 and the DEAD-box helicase Ddx19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein/hydrolase
molecule keywords Nuclear pore complex protein Nup214
total genus 75
structure length 232
sequence length 232
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmoB00
3IIMA 4MRPA 1Z29A 5E7MA 4DCSA 1QHHA 1I4TD 2O8CB 4ZDJA 1NN3A 1UJ2A 2ZSEA 2MMCA 3SJZA 3GJ5A 4I1UA 1FQKA 5EP4A 1D9XA 3RWMB 4C3ZA 8OHMA 2VTKA 3E2IA 4JL6A 2XOKA 3KXLA 3WYFA 1IY0A 3IPYA 3OE7A 4TYWA 2GZDA 4F92B 1X86B 3L82B 4PPNA 2NO9A 2MSDB 5LPNA 2KE5A 5EE5B 2QP3A 4UXHA 4DLVA 2FE4A 2XZOA 3NWJA 5CIWA 1Z5ZA 2WAYA 1L8QA 2HF8A 2VSFA 5EXXA 3IQXA 4ZDKA 2NOAA 1EFRA 1NN1A 3AVXA 4XWAA 1JR3A 3KKOA 2IHYA 1E2IA 3DZDA 4US2R 3HDTA 3OIVA 1KI6B 1ZMXA 4B3FX 2WOJA 1AKYA 4JIMA 3OAAD 1P7CA 2QAGC 2J87A 3KUCA 3QE0A 5LD2C 2FSFA 1DO2A 4J0QA 5KTYA 1R6BX 2WJYA 4Q4AA 2C95A 1HT1E 2VHJA 3K70C 2GJ9A 4Q4HA 1GKIA 2H8KA 4PPQA 3R7WB 1TADA 4US1R 5KDLA 3H0KA 2FGKA 2GXAA 3NKVA 4AYTA 1W4CA 4E07A 1XF9A 4XSHA 5BN5A 1WRBA 3B1XA 3W8RA 2V7QA 4Q02A 4KODA 3ZS9A 2SHKA 1XP8A 4RZ2A 5M04A 4Q47A 2QUZA 2QGNA 2NO1A 4LJ7A 3RLFA 3IBGA 4Q4JB 1P60A 2C99A 3LLUA 1LB1B 2G1JA 3NEYA 4NCIA 4HZUA 3P4XA 3LA6A 5AWFC 3GLIB 4JSTA 2QMOA 3K09A 1II8B 1RRPA 2QTFA 2J46A 1XRJA 5H70A 4G1UC 3QXJA 1G9XA 2CHGA 2TMKA 4GI7A 2QQ0A 3TUJC 3EA5A 4GZMA 4WXRA 4OHXA 4B3XA 3U5ZB 2J0SA 4KU4A 4QNMA 3PEVA 3ZQ6A 4MUBA 1CR1A 5C4GB 1E9EA 5CLLA 1RC8A 2MMGA 3K0FB 1GRQA 3LBHA 2DWQA 3CRRA 2OFXA 1H8HA 2BMJA 1T5IA 3KJIA 1G5TA 1VHLA 2GJSA 2HJVA 4HAYA 3MJHA 1RPZA 4RD6A 5FL7A 1W0JD 3MD0A 1JAHA 2PX3A 6Q21A 3FHCB 3M1IA 4PC2A 2ZUDA 4V0ME 1W5SA 2QRZA 2OO7A 2CE2X 5DI3A 3SHWA 3A36A 3E5HA 3NIBA 4D25A 3U44A 2ZQ5A 2GK6A 1SVIA 1QHNA 3LXXA 3CRW1 3OESA 2FX3A 4L9SA 4D0LB 3GPLA 4Q1CA 3K70D 1US8B 4O2RA 3B82A 3LH5A 1JR6A 1VMAA 1GRRA 3BC1A 3F3YA 2H17A 4C0QC 1S4QA 4B34A 5AUNB 1ZVQA 3BERA 1E94E 2RMKA 4DLUA 4TYYA 1H8EA 3A1SA 2NG1A 4QBHA 4LGMA 3TW4A 2Q0HA 5SZKB 1NBMA 5B58C 2IS1A 1XMJA 2GF0A 3L43A 4XIGS 4JLVA 5DNYB 3CW2A 1GILA 3MUFA 3EIEA 4M1KA 2IEYA 3RS5A 4JYCA 1KI6A 4B6EA 4C0HA 2IS6A 2VHUA 3VNUA 1S9HA 4DJTA 5JBQA 2ECKA 2HCJB 3NXSA 4L4UA 3U3RA 3UIEA 1Z0IA 3CX6A 2EFCB 2X2EA 3I62A 2Z4SA 1N3BA 5F3WB 1FL9A 5KPJA 3VMFA 4L9WA 2XZPA 5AUQA 5G41A 1JEDA 2RGEA 2A5FA 1EXMA 1SQ5A 2AK2A 3THYB 5TDHA 4H9GA 3D7MA 3TUIC 1R8QA 3T5GA 1J8YF 1WBDA 4LJYA 4OQLA 5JECA 2DWPA 4G0NA 4XVRA 3VAAA 2VF7A 2QTHA 3DZ8A 4CZ2A 2C04A 2G88A 2RHDA 3GEHA 4MQBA 1GTVA 3R8CA 5KO2A 2IW3A 3THOA 5E7IA 4JJKA 2RH5A 1K8RA 5DSZA 4Q1DA 1RYFA 4AYWA 1SGWA 4RJLA 3LW7A 4TYPA 2HYDA 4NZYA 4IFBA 2B92A 2YWEA 3DHWC 1IN7A 3CB4A 4TMWA 5C4MA 3PUZA 2WJJA 2ZSBA 4Q1BA 3A4LA 3FB4A 2DR3A 4MDEA 3BS4A 5J40A 2QAGA 4OI4A 5BYKA 2C5LA 3I8SA 4JBWA 4JJZA 4NL4H 3TQFA 1P5ZB 2ZYWX 3NBYC 2ERXA 5FOXA 4HAUA 2JATA 3H4MA 3E70C 2MSEB 1VG8A 4QNRA 2WMOB 3S1AA 4L16A 2QRNA 4PPGA 5JWOA 2WKQA 1N6IA 1G5PA 1ESNA 1Y3AA 3R8FA 4URUR 1Q1ZA 4WIAA 1HTWA 2CDNA 1D2NA 3K0CA 5EE3A 1R7RA 2V3CC 1YZTA 1KI4A 1YZNA 2X2FA 3LQQA 4PTLA 2D2FA 3RS3A 4RY2A 1SVLA 3CWZA 3PEWA 2ZRIA 2A5YB 2JASA 4QBFA 3LQRA 4XD7D 3W6PA 1BKDR 5J4YA 3K9GA 2O0KA 1ANKA 2KWIA 2J0QA 1T9HA 3OAAA 4BUJA 5EZ5A 2GEDA 1FFHA 4P4SB 3PV0A 1MT0A 4F7WA 2VP0A 2CLDX 3G0HA 4ASUD 2OCAA 5KSPA 2PX0A 3MAAC 4KVAA 1A4RA 4TMVA 1XPOA 1M7BA 2QGZA 1BOFA 1CR0A 4BRUA 4C9BA 1RVDA 3GQBA 1G18A 3JVUA 2QN6A 2FEOA 4DEXA 2BBSA 2BIFA 4MKGA 5EP3A 1AS2A 4QJ3A 4V03A 3DMNA 1W44A 1IM2A 4LYHA 1KSHA 4N3NA 1W2GA 3ZH9B 4B2PA 3PR1A 1W2HA 5CK4A 4B32A 5C18A 3GJXC 1NVVR 2QENA 2DY1A 4WZAE 3P32A 3AKYA 2CXXA 1P72A 4CT5A 3V00A 1MO5A 3C8UA 3X2SA 2EFEB 3TMKA 2IA5A 1CU1A 2N1BA 5JS8A 4KO8A 2QL6A 5IK2D 3A37A 1G3MA 2FNAA 4Q7KA 3CNNA 3QKRB 4JLKA 1MOZA 2ATXA 1E2QA 5K8LA 3ZVMA 2XNDA 1E2MA 3SE0A 4MYTA 4IDHA 3ZD7A 2IXEA 1X8KA 1MO6A 1AS3A 4C0BA 4I4LA 1V5WA 3K0AB 1Z07A 2R8RA 1F2UA 2FWRA 2HLDA 1A82A 3AVQA 1KJWA 4AG5A 1I4DD 3WMGA 1GZSA 3U60B 4NYJR 3W34A 2FEMA 2JIZA 3QSYA 2IT1A 3KFVA 4LJ9A 2OLKA 1DE0A 2XX3A 4TWZA 1E2NA 2P3SA 1DELA 2PCLA 2ZROA 3QVVA 1SXJC 2ZEJA 3U2QA 2W6IA 1Q1QA 5GADl 1L2TA 2JLWA 2ZS8A 3MG9A 2IUSA 2OEPA 5JRZA 1GSIA 1NN0A 2GVZC 2VO1A 3KXKA 1KGDA 1B0UA 2FSHA 3CKLA 1KDPA 3QPUA 2GCOB 3AVYA 5SZJA 2W83A 1RKBA 2FPKA 2QI9C 5FPKA 4EPYA 5KNCA 1AK2A 3SJCA 4DIDA 4URXR 3TUZC 4JSYA 1G3QA 2OESA 1L4UA 4TZ0A 4R2IA 3ONWA 1P75A 2ZI7A 4A0HA 4QKQA 4DBLC 4Q18A 3T5DA 3RS4A 2AD5A 1ZYUA 4K81B 2ZSFA 3CM0A 2J9RA 3UANA 2YZ2A 3CPHA 2AHOA 4M8NE 2KSQA 121PA 3A58B 1IJFA 4JL5A 1LVGA 1IXSB 3PUWA 1QVAA 1W5TA 4LJ6A 1LV7A 4JL8A 1RE0A 3T1VA 4BEJA 2HDNB 1OKKA 3GJ3A 4PZZA 1G1MA 2VRWA 3IO5A 5FPTA 2DCUA 1S2MA 3A4NA 2G9NA 2LKDA 4QFMA 5E4FA 2V54A 5J4LA 1AS0A 1CJMA 1DO0A 4QJ4A 1VKJA 5L3SB 1NF3A 1JALA 4FMBB 4A6XA 4LV5B 1E79D 4HYYA 3Q85A 5CDFA 1PLJA 4DCNA 4OHZA 3HU2A 3VKWA 1KY3A 5AJWA 4ZCMA 2J7PA 3SYNA 5UKDA 5JCPA 4IVRA 5FH9A 4QC2A 1OYYA 4JMPA 4CGZA 4BGDA 1IN8A 5JRJA 3LV8A 2VPPA 4FINA 1BS1A 1D5CA 5K8UA 4YDSA 1N6KA 2ZRDA 2AK3A 2GTPA 2OXCA 3N70A 1T91A 4B2LA 1WP9A 3LBNA 4A8JC 3VKGA 4IDQA 5EP2A 3ADCA 3BOSA 3QPWA 3AB3A 3F0TA 1CJVC 1G7RA 1A7JA 2C9CA 4PO9A 3L0SA 2R62A 2FU5C 1IN5A 4RD0A 4V0MA 5KSOA 1XMIA 4D4MA 1DS6A 4EPVA 2ZYVX 2FSIA 3T12A 4OK6A 3NTUA 2XXAA 1KK0A 1P6XA 3HPRA 3EC1A 4F4IA 3AV0B 2WWIA 1FUKA 1NN5A 3BBPA 3CRMA 3QPVA 3LW8A 1NRJB 1ZW6A 3BGWA 4YMSA 3U4QA 4ZKDA 2OFWA 1R5OA 3MJRA 4TMZA 5FOTA 1CULC 4ZDWA 2D2EA 3SC3A 4D2IA 5DI9A 2ZRGA 4OQXA 4A9AA 1KK1A 3LDAA 4A2PA 1Z83A 1XTSA 2ATVA 4JLNA 3TRFA 1AZSC 2QEQA 4JLPA 2RGNA 4JS0A 1MABA 4PC1A 1IY1A 2XSZD 4OBEA 3Q5DA 3EPLA 1P4SA 4KLNA 4ABYA 3UK6A 1GKUB 1C4OA 1G7TA 1JXMA 2OCYC 2IWHA 3VTKA 4URVR 1D8TA 4B48A 5J47A 1J8MF 3BK7A 1N0WA 1F48A 4U7DA 2NZJA 3EW9A 3LRPA 4XVUA 5FTLA 5A4JA 5IRCD 4CEIB 4A0RA 3IKJA 3NH9A 3KQKA 2JJ1A 3OE7D 4G5RA 1N5KA 5EP1A 1ZUNB 2BJVA 3C16C 4QXAA 4ZCLA 4BLTA 5F2EA 2EYUA 4Q1FA 4ZO4A 2QAJA 2B7BA 1K5GA 1MRSA 3TK1A 1J99A 4Q7MB 2FFBA 5DO9A 3I4LA 3QKSB 4MRVA 4BLQA 5FR1A 3CZPA 3BFKA 1SVWA 1S8FA 3IHLA 2UZIR 3GJ8A 4LBYA 2YVUA 3HWSA 4B3DA 4D26A 1HA3A 1JI0A 4NCNA 1DEKA 3J81k 5EXSA 1G7SA 1TF7A 1EFCA 1L7VC 3ZJYA 3RVBA 3KX2A 4KAXA 4MKIA 2WTUA 1OF1A 1N6HA 1CIPA 5JHHB 4WZBE 1Z6YA 1LY1A 2VQSA 2HF9A 4CT4B 2V1UA 3D3QA 2R6GA 4B44A 2FZLA 3BORA 2EWVA 3SEAA 5B2ZA 3BE4A 3ZYCA 4FWTA 1TU3A 2QP9X 1G21E 2XTZA 4M1TA 4EPTA 4D0NA 4NMMA 2DWOA 3GLFB 2OAQ1 2A9KA 1QHXA 2F43A 2FDCA 3BAFA 1OKKD 4C2UA 1KI3A 3OEED 2W6JA 5GJVC 1QHIA 3VR4A 4Q7JB 3GJ7A 4LK2A 3W5JA 1KZGB 3EXAA 4A8JB 3LFUA 3D8BA 5HE9A 1XXHE 4LY6A 1LTQA 3OIUA 5CK5A 1G20E 2FF7A 3VR1A 1G291 1YU9A 1G3RA 2A3RA 4HLUC 4MYHA 4R71A 5FBQB 2GETA 3X1XA 3KB1A 4A0FA 2ZI3A 4C0SA 621PA 1WF3A 5DE3A 1ZIOA 1ZCAA 4UJ3A 1E0SA 2BDTA 3LX5A 2GILA 1SVSA 4MH0R 4KFUA 3TNFA 4BLSA 1XMVA 3DKPA 5HKKA 3K0AA 2PZGA 3EWAA 1YRBA 2XITA 2C96A 1F6BA 4D80A 2JLQA 1GOTA 1XEXB 1COWA 2FSGA 1G4AE 3O8DA 1BYUA 1OPXA 2RGDA 4OHWA 5H8WA 4JT4A 3NHBA 4XH9B 3AEZA 4OL0A 3CLVA 4H1VA 3ZS8A 4LSGA 4DWJA 4M4SA 1RRGA 4ACAA 1G5RA 1KI1A 2R9VA 3DL0A 4II7A 1GITA 5AJVB 2QBYA 3U7HB 2BC9A 4RCZA 4RSGA 1IHUA 2IYRA 3B60A 4HAWA 3P20A 4P0TA 3REGA 2PJRA 2PEYA 1II8A 4AD8A 2BKUA 3AP1A 1YR9A 2ZE7A 3NVAA 2CNWA 1JPJA 1VCIA 4EQ6A 3FHOA 3KKPA 4UNQA 2HV8A 2O8EB 1Z6AA 4I1SA 1DAMA 5DGXA 4OHVA 4HDOB 3AKEA 2OSBA 2UKDA 3CNOA 3SBDA 4PC6A 3RNLA 3W9YA 2OZEA 4TQUS 4G01B 1T3SA 2CVHA 2YKGA 2ZRMA 4US0R 1OSNA 1HE1C 4CW7A 1T4GA 2A5JA 4NCHA 4AK9A 4N0EA 2ZR0A 2OBMA 2IYTA 4HLCA 1TX4B 1SVKA 4Z54A 1FPMA 4A1FA 5K8TA 2EVWX 3MLEA 3H84A 4FIDA 2PT7A 1SXJB 2V7QD 3AGQA 5GVRA 5F9HA 2OT3B 4Q00A 1XCMA 4V0NA 4BZXA 1FP6A 1WCV1 2G83A 5CJPA 1GAJA 2RB4A 5HE8A 1KYIA 1KO5A 2OAP1 1P61B 4HAVA 1AA9A 4TSFD 4HDQB 4D81A 1ZCBA 4Q9JA 2VF8A 4LOAA 1WB9A 1OXXK 1OFTA 4QGGA 2W6ID 4JLMA 4RD3A 5FPYA 5BQ5A 1CF4A 3KJEA 1G41A 2EYQA 2KBEA 1NSTA 1Z8FA 2XNSA 2B8TA 3P26A 1KNXA 3EZ2A 4PO1A 1ESMA 1MR3F 1U81A 2RGNC 3N2EA 2YWFA 4CIDA 2Z6VA 1JECA 1LF5A 3ZVRA 2CLSA 1IN4A 2QAGB 1WXQA 3C41J 2XZLA 1ODFA 4KFRA 5BXQC 5LD2B 1ZIPA 1GNRA 3BB3A 4HUTA 4TMTA 3EC2A 1OFIA 1NJGA 3EASA 3FMIA 2IUTA 1HURA 3GLHE 2YINC 4H1UA 1H8ED 821PA 2P5SA 3IQWA 4CEJB 4TL7A 1G3UA 3TJZA 3BFVA 4LJ8A 1W47A 2QP4A 2AFIE 1IBRA 3UATA 4LV8B 3MGCA 4MUAA 3L0PA 1A2BA 4NYJQ 4OI1A 4NPHA 4QG7A 1QZXA 2JEOA 4OJQA 5TY0A 4TL8A 4A6PA 4ARZA 1EESA 3QKRA 3WNBA 2Q3HA 4P33A 4C4PA 4TLCA 4O25A 1U8YA 1CJKC 4U00A 2OILA 1NL3A 3WBJA 2E87A 1YZLA 1HUQA 3KKMA 2DFLA 4WAUA 4BLOA 1KKLA 1BMFA 1VCMA 2J0UA 1UBFA 2XB2A 1ZD8A 2HLDD 1HV8A 4OKSA 3OIYA 5JEEA 3PITA 2BBWA 2J7KA 2D3WA 5DN6A 1UKVY 4FMCF 4W5WA 1UKYA 4LJAA 3TH5A 2JJ8A 3X1ZA 1XU4A 2R6CA 4YMUA 3CPEA 3WRYC 4KHZA 1GIAA 4XJXA 2ODEA 3QF7A 3I1FA 1UEJA 2NQ2C 3GEEA 4P32A 4QHTA 4BFYA 1R4AA 5L3RA 5IHPA 4IJMA 2A5DA 4P4UA 2XTNA 3RRZA 4MKFA 1VG1A 4MYCA 4M1WA 2D62A 2ZJZA 2YHSA 1EGAA 2R2AA 4N0DA 4TSFA 4Y0VA 1FQJA 1Q0UA 4FMDB 4KYUA 1YZKA 221PA 5KU1A 3AVPA 4LV6A 3CIOA 1HYQA 2AR7A 1UBCA 1R0YA 4NH0A 4DVGA 1PJRA 3R9WA 5DN6D 1ELOA 3A4MA 4WXPA 2I3BA 1SKQA 2R6DA 2VSOA 3VR6A 1YR6A 4M22A 2ANCA 1RJ9B 4AIIA 3RABA 1G8YA 3QXCA 2F3TA 5L3QB 1Z0JA 2ZVPX 4B47A 3ZZUA 2XB4A 2ZRJA 3TGPA 1IAQA 4GDFA 4JVLA 3S1AB 421PA 1KTVA 1NBME 4ON9A 3TBKA 4A36A 4GPTA 1T8TA 2AL7A 2P6NA 5JMTA 3K8YA 4BE7B 1A1VA 3IPXA 3LBIA 3AGPA 1OV4A 3JZMA 3K0FA 4JT2A 2CCGA 2YC4C 2AKAB 2OFOA 3CX7A 2CJWB 5J4VA 2W0SA 4BZPA 2VP5A 1QHYA 5KSZA 4ZI2A 1UF9A 3TVDA 4JLDA 1DARA 1ZD9A 2BEJA 3IHWA 3ICQB 1QG2A 1DAEA 4LBWA 1OT3A 2IYSA 1WE2A 4NP6A 4JLBA 3B7GA 1P2VA 1ZNWA 2X77A 1UDXA 2RAPA 1HH4A 2D74A 5JJLA 1XJ0A 2JLVA 2ZUCA 1NG9A 1XWIA 1TQ2A 4D0GA 3EZ6A 1OJLA 5JLJA 1E6CA 4S2EA 4EJSA 4F91B 2IF0A 2E1RA 3PQCA 3OIWA 4FXPA 4GP6A 5FUWA 5KPDA 3I61A 1N6RA 3TSWA 1ZUIA 1U9IC 1DPFA 2RKOA 4DCUA 1UKZA 1TF2A 2C98A 4MA4A 4GNKA 3EPJA 3I92A 3U7GA 2CL0X 3WP0A 4GOXA 4AWXA 1GNQA 3AKCA 2O8EA 4KI0A 4YMTA 1U94A 3DOFA 2GZHA 4S35A 4DT1A 1GDDA 2OCBA 4NCKA 2JJ2A 3KL4A 2A2ZA 4YLGA 1XJCA 2IYXA 3O47A 3VU9B 4MRNA 3U61B 3CRQA 2NO7A 2BKEA 4DB4A 1CR4A 5B57C 2AKYA 2D7CA 5CM9C 1XZQA 2IYYA 3ZD6A 1KDRA 4KBFA 3RRMA 4EKDA 1SHKA 1Z6TA 2QMEA 4PR0A 2PCJA 3QJYA 5JEDA 3L2OB 1IXRC 1SKYE 1XBTA 4QBGB 2FN4A 3ASZA 2CL7X 1GWNA 3PXGA 4NDZA 3W8NA 2GHIA 1R5NA 2IXGA 1EWRA 2DFTA 1CS4C 3RSLA 2GEUA 3Q7PA 5AJXA 3CNLA 2CHVA 2ZANA 3A6PC 4HB4A 4RKFA 1AM4D 3REFA 4QHSA 1M74A 4I99A 2GXSA 3H86A 1N2CE 1PUIA 4JLJA 3LD9A 4YXWA 5AUOB 2O8BB 4DIEA 3KQHA 1GFIA 3KKQA 4TT3D 3I3SR 1IQPA 1KMQA 4UQOA 2GWHA 3X1DA 3PEYA 1ZINA 2WIBA 1XD9A 3FTQA 4KSBA 3SDZA 1VYVA 3AM1A 2ZU0C 1ONBA 1JEEA 3DDCA 2H16A 1I2DA 1LNZA 2VSXA 3NBZC 3AVWA 1XNJA 3CF6R 2IYVA 1GNPA 2XEXA 4MRSA 2Q6TA 3AF0A 4IEIA 3VNVA 1TQ6A 2ZI5A 4GL2A 2VHQA 2WKRA 2WMNB 1U2RA 3B2EA 3O8BA 4M9QA 1KO8A 4HLQB 2G3YA 3UMSA 1OXSC 2DB3A 5FFMA 3GFPA 3K53A 3HU1A 3QBVA 1E9RA 2F3RA 4QHYA 2IX3A 2ZRBA 3B78A 4CEHA 2N42A 1NSFA 4P3YA 1E9SA 1J7KA 3TE6A 1XTQA 4LYJA 4X8HA 3UXMA 4Q9HA 3PIRA 2GEVA 4V0OA 1JNYA 2YOFA 2F1JA 3THWB 1Q57A 2R44A 2XAUA 1EWQA 3A1VA 2C03A 3TLXA 2UVQA 2R6AA 5KSYA 2V4ZA 1TPZA 3NH6A 1AZTA 2GVDC 5CJ2A 1G8HA 2F1RA 1VG9B 1M8PA 3WP1B 3VKHA 4URZR 3EARA 3MWJA 1N0UA 1OXVA 3R7WA 4ILEA 3WBKA 4W5HA 1GG2A 4O0MA 5G40A 3GD7A 4JVNA 4C0LA 1UADA 1NLFA 2A30A 4ESHA 1BIFA 2QT1A 1F2TB 1O3YA 4GT1A 2OHFA 2CNWD 1KI7A 3L8ZA 2GAAA 4RZUA 1KMHB 4AKEA 1EFHA 4A0GA 3KJHA 2WZQA 4Q4LA 4DLSA 2WAXA 4O2LA 1II9A 4LWZA 2ORVA 1KO4A 1NKSA 1RFLA 1E1QA 3DEFA 4P4TA 4QOSA 1P2UA 3AH8A 5DIFA 4ESVA 4M1SA 3SOPA 3UWKA 2I1VB 3K9NA 3L0OA 4N1AA 1J2JA 2ERYA 2O8FB 3ND9A 4WBSA 1JQJC 3ZIAA 3GLIE 2IC5A 5TARA 4KSCA 1LS1A 4IXMA 4PQRA 1JAIA 1X1RA 1QF9A 2OXRA 3AF3A 2QM7A 2BMDA 4WZ6A 2WSSA 4OQNA 1AQYA 5KOYA 3TAHA 2RHMA 1DBSA 3BFXA 4A2QA 2ZJ8A 3TSOA 1RYHA 5CYPA 2CCKA 5IK2A 3DMDA 5F98A 2YV5A 4B35A 1YRAA 4GMXA 3SU8A 1AKEA 5FTJA 2W2XA 4CYMA 2XJ4A 3FKSA 4KVGA 1W4RA 4HAZA 2IL1A 1OB5A 2H7VA 5JZVA 2Q21A 5BWMA 2ZAMA 3Q72A 4CVNA 2WHXA 2ZE5A 2OV2A 2ANBA 2GK7A 5CM8B 1FMLA 2YC2C 1G8PA 2HYIC 3DOEA 1NVWQ 3LX8A 2YWHA 1FTSA 4EUNA 2QPOA 3B13B 5J5CA 1SULA 2IF2A 3THXA 4CEHB 1RZ3A 3FPAA 4EQ6B 4F4JA 2WOOA 1E9CA 2QU8A 4FMDF 1IJEA 1XJQA 2ORIA 3NDPA 3T15A 4DSOA 3KTAA 4O3MA 1E1RD 1EG7A 3TKLA 2CMKA 3MMPA 2QBYB 2GA8A 2EW1A 4G3XA 1KOFA 1T3HA 4EFMA 2J0VA 2GRJA 4K46A 2VA8A 1CTQA 1P9NA 1OHHD 1XXHA 5L3VA 4RFSA 4MYUA 3SNHA 3PCRB 1TUIA 2OCPA 2YOHA 4TZ6A 1UFQA 2LKCA 4UJ5A 2W2TA 1SHZA 1H8HD 2XTMA 1O87A 1E2DA 1YZQA 4BQSA 1NI3A 2FA9A 2IYUA 4I81A 3W5IA 4UXJA 4QM7A 4HZUB 3I5YA 3V9PA 2PEZA 3EPKA 3U3OA 1E1RA 1GUAA 3QF4B 3W90A 4LC1A 5AR1A 1JPNA 4Q19A 3R9IA 2ZS7A 3EA0A 3B85A 4RZ3A 3FMPB 2ZIAA 1AJEA 2GJ8A 4B2IA 1VTKA 5EXPA 2BM1A 2V8OA 3I72A 3I5XA 4I1VA 1XTIA 1XB2A 4Q03A 4V0KA 2O8FA 2BHRA 2ZRFA 1CBUA 1ZD1A 1Q21A 1Q44A 4UXIA 5B64A 5CB6A 3K0CC 1E96A 1KZ7B 1BYIA 1SXJD 2Y8EA 2ZI4A 5TB5A 4AURA 5HCNA 3UPUA 4NCJA 2P6RA 3AF2A 4FCWA 1TEXA 4C30A 3FGNA 5EUQB 2Z0MA 4RD4A 2JLUA 3VU9A 3U3MA 2H5EA 1KI2A 1E2PA 2BWJA 4AI6A 2W0MA 4BZQA 4PXAA 5JWRA 3V4RA 1F2TA 3IGFA 3QXHA 4B43A 4LZZA 1Q1EA 1NVVQ 2JA1A 4HSEA 3SN6A 1N6PA 4D6PA 1J90A 1TAGA 1XTRA 4M1YA 1AN0A 3B9PA 3AUYA 2BJWA 1E3MA 2VIIA 2KB0A 1W49A 2AXPA 2V9PA 2ZJYA 1HQYE 5H1YA 3SI7A 4KFSA 5K8IA 2QM8A 4POAA 2EFGA 2Q9CA 4URYR 3SHFA 4W9MC 2KI5A 3BB1A 3NG1A 1ZU5A 4G5SA 1EX6A 1G8GA 1EX7A 1TL7C 1DADA 4BFSA 2BVNA 2KJQA 3AP3A 2ZU6A 4AG6A 3GLGA 2CBZA 1G8FA 1E69A 4QGFA 1E1QD 1M7GA 1UBGA 1OIXA 1Q20A 5AJZA 1ZUHA 3MSXA 3QOFA 1ZNZA 2RCNA 2ZE6A 3I32A 4M0LA 5L8VA 1SZPA 2MSCB 2GKSA 3C5CA 1OFHA 5TXGA 4NYIR 4NKRA 3UG7A 4RFVA 5C46F 2DYKA 5JI3E 2HJGA 4BLPA 2N46A 3MFYA 4IOJA 2JLYA 3ICEA 3TIFA 2ZUBA 2OM2A 3N5CA 1DOAA 4QJ5A 2D4HA 4NONA 4PC3A 4AY2A 3MRSA 1W1WA 1GL9B 1TMKA 4WA7A 4Y0AA 2ZS9A 3RRYA 4QRHA 3ZLJA 1G19A 3NBFA 1ZU4A 1A5TA 1MRNA 1U0HC 1XZPA 1E2LA 1SVOA 3FDIA 4UKDA 5E7JA 1OXUA 1T5LA 1RRCA 4C2TA 4M9XA 3W3AA 1NVXQ 2I1QA 5EQTA 2VL7A 1MKYA 4BFVA 1OIVA 5DYGA 1VIAA 3RSOA 3W3ZB 1Z3IX 3HU3A 4E22A 5FBRB 721PA 2D7DA 3RC3A 3QI2A 4ARZB 3PUXA 2FGJA 3RC8A 1OFUX 5EE0A 1B23P 5G53C 4P4SA 1KO1A 1BO6A 1W0JA 3KJGA 4AKIA 5FOSA 2VP4A 5HZHA 2WWGA 4HB0A 2WWFA 1XEWX 4TQAA 1XMSA 2BCJQ 2REBA 4UNSA 5FPSA 3L8YA 1JJVA 2GBLC 4HATA 2BBOA 1UKEA 3KZ1E 2IS4A 4BFXA 1SKYB 3QEOA 2B21A 4PHGA 2ZYTX 3GMTA 1NJFA 4M1MA 1KSFX 4DDWA 3WNDA 1IY2A 2BCGY 4FW9A 3MCAA 2V55B 521PA 4DSTA 4DSUA 4LHZA 3LVRE 4PAMA 1E2HA 2EWWA 2WJGA 4ZV4A 2HUPA 4FN5A 3T1TA 5JJKA 2Z83A 1TNDA 1CKEA 2J0UB 5IDVA 3O8RA 1N0VC 3RYTC 3WHKA 3GLIA 4PSVA 5JJIA 5FUVA 1KO7A 4MRRA 3RHFA 2PL3A 4XTRA 5KHOC 2ORWA 3F5FA 3GJ0A 2P2LA 4MGIR 4TTQA 1FW6A 2NO6A 2P67A 2NZ8A 3EIQA 4XSGA 4CEJA 1X3SA 1JR3E 2JDID 4EPXA 3FFBA 3ASYA 1OIWA 1EFRD 4Q9LA 5E3HA 4EJSC 1EFUA 2F1IA 4Q4JA 2FMXA 3T61A 3U6BA 3FMOB 4B74A 2VH5R 4Q4AB 1VCOA 2ZSAA 3PUVA 3BIFA 1OXTA 2ZJAA 3EWSA 2CK3D 4IOLA 4E5UA 1X8LA 5SZIA 4TMKA 2QMUA 3PENA 1IOZA 4DZZA 2RGXA 5G3ZA 1AGRA 1Z47A 4TYQA 4EFNA 2ZRLA 1MO4A 1S3SA 1VYUA 1NNEA 1UEIA 2C78A 2JLSA 3QKUA 4DCVA 2IWRA 3Q3JB 2WWXA 4LHVA 4A4DA 2J45A 1CRPA 1G7CA 4K8OA 1TTTA 4PAQA 5SZHB 2J5XA 5EE9A 4ZPXA 3QXXA 1F5NA 5FTMA 3T06B 1QDEA 3G82C 1DVRA 5DHAA 1N5LA 2QTVB 1Z0AA 4QL3A 4KXFB 4KCGA 4LDJA 4W5JA 5BYJA 1YQTA 3IEVA 3Q7QA 4DLRA 1KDOA 2GCOA 4EAQA 1FTNA 3MWLA 1E98A 2WVJA 2Z4RA 3LAWA 5JCZA 2HXSA 3GEIA 1I2MA 3TQCA 2WWHA 5FTNA 1W36D 4M21A 1EFTA 3GFTA 3QEJA 4LHWA 4Q9IA 4B71A 2G0NA 4GFDA 1RRFA 5KUTA 2IYLD 1Z0FA 2NPFA 2FV8A 5LBIA 4MDFA 3QKTA 2C9YA 2O8BA 4EPWA 4UNRA 1CEEA 4LX0A 1RIFA 3B8HA 4C7OA 2FJUA 5P21A 4XD7A 1Z0KA 3FYHA 4XTCS 3PJRA 2GF9A 2QQEA 4GP7A 4MGYR 4RD2A 3ADBA 2NGRA 2GXQA 2FPMA 3X1WA 1Q3HA 4RFSB 3WYAA 1DAFA 2P0EA 4ASUA 2OBLA 5GVSA 2G0TA 2WM9B 2YWGA 2NMVA 2AN9A 3NHAA 1II0A 3QUSA 4KJZA 1NIPA 2W2VA 3IBYA 1YE8A 4XVQA 5CYOA 5GJBA 1NIJA 4OJKA 3TR0A 5F9FA 2ZXUA 3IO3A 1DG1G 1D9ZA 4FI3C 4LJ4A 1QRAA 4R9UC 1NG1A 2JLXA 1Q22A 3R20A 2WBLC 3HPQA 3Q5EA 4JVSB 2ZRNA 4Q66C 5TMPA 2F9LA 1AQUA 2J3EA 5AUPB 3HP1A 3THXB 5FBVB 3A1UA 1G3IA 4PZYA 1XD8A 1L4YA 4HB2A 3OHMA 4HLDA 1E0AA 3A8TA 1T3LA 3TAUA 3VR2A 5L3SA 1PV4A 2B8WA 5ANRB 1TQ4A 2JLRA 1YR7A 4PZLA 1XFAA 3GLGB 4OQFA 5BN4A 4LC0A 2X1VA 2OE2A 4Q1AA 1QHGA 2ZTSA 1U98A 4DLXA 1KHTA 5DI3B 2QPAA 1T6NA 2AWOA 2PZEA 5FBWB 5A0FA 1P3JA 1E32A 3TW8B 3WXMA 5FR2A 3FVQA 3IILA 5A5GA 1ZJ6A 5KNBA 1E0KA 1ZC3A 4Z51A 1DAGA 3QKSA 1E4VA 4KFTA 2VHCA 5EZ6B 4OHYA 1TF5A 2WSSD 3KQLA 2BV3A 4RVCA 1SVMA 2ZRAA 1M7HA 4KV9A 2J59A 3U7FB 1MV5A 1KI8A 4HLUA 3UG6A 1W4AA 4UNNA 3QQ5A 2LCFA 3OFND 5DHFA 4JLOA 2WJIA 3RDPA 4F38A 3AP2A 5FI1B 1AGPA 2O5VA 2VHTA 3CUEF 4TLDA 2QG6A 5FL7D 1QG4A 5C2JB 5DLQC 2IXFA 1GKYA 1VPLA 4LPKA 4LRWA 3CF0A 1CJUC 3L0IB 1XCPA 4DHEA 2JJ2D 1IXZA 3OEHA 4EFLA 1OH7A 1JJ7A 1DAKA 1GVNB 2J1LA 5LB2A 1XX6A 1ZBDA 4JLAA 1FNMA 4Q5IA 4DLTA 3O8CA 4TLEA 2IUUA 3LXRA 1I4LD 2OBNA 2XOKD 4X8MA 4DDVA 2EFDB 3V4FA 4Q1EA 1U9IA 3LNCA 3QNUA 4DLWA 2HT6A 4EDHA 3SQWA 2RGGA 1W48A 4MGKR 1GL6A 1W4BA 3KUDA 1ZC4A 2BEKA 3DM9B 2NO0A 4OK3A 5D3MB 4DLYA 2J41A 3PUYA 5HTKA 2RGAA 4V0LA 5HCIA 2CEAA 3QVUA 1FX0B 3P1JA 1QHSA 3Q8XB 2BM0A 2ZI9A 1R10A 3GCGA 4B75A 1U99A 1Z2CA 2CHQA 2BMFA 1KDTA 1FMJA 1Z06A 1U0JA 4L8GA 4CEIA 4NU0A 4TLBA 4BRWA 3KFXA 3OF5A 3KTAB 2V1XA 2ZJBA 4JZKA 5TVKA 3B1VA 4DDTA 4E03A 2QNRA 4RKEA 1XDBA 2Q3FA 4BLRA 1N25A 1E2EA 5KDOA 3QBTA 3TSZA 2JLZA 1JXOA 1NBMD 1TEVA 2V6IA 3HR8A 4B73A 4PHTA 2ZRCA 4NYMQ 3FOZA 2AXNA 4HDCA 2OG2A 2GJKA 4E09A 5FUYA 4G5GA 2D06A 4TTPA 3FHTA 2A7QA 2ZPTX 3QENA 4IW3B 1Q1BA 4JBXA 4PHHA 4ACBA 4DKXA 2B6HA 2CL6X 1YR8A 2IHBA 3EAQA 1BMFD 2W6JD 5GJWC 3U6KA 4MGZR 5DISB 5FTKA 1D2MA 4IDPA 1Z2AA 1S9DA 1YKSA 3VX4A 1NLYA 1ETUA 3QF4A 3EPHA 2R65A 3BH0A 3I8XA 4FWIB 4XWOA 3GJ6A 2UZ3A 1ZP6A 4DC9A 2YOGA 3LLMA 4BPBA 1ZNXA 3THWA 5BN3A 4KBGA 3RS0A 3K1JA 4BFUA 4D4LA 4Q01A 4AKHA 1F2UB 3G5UA 1OB2A 2QE7D 4DSNA 3T34A 3ZIAD 3GLHA 3B9QA 3GLFA 4L5BA 3HJNA 3M4YA 1WA5A 2IYQA 1TUEA 4YMWA 5HZKA 3ZDQA 4B33A 1N6OA 3EG5A 1R0WA 3ADDA 1ZM7A 2ODBA 4P31A 2P6UA 3EX7C 3C7KA 4IHQA 4ITRC 2WSMA 2K5UA 4EPRA 1ZM3A 1S1MA 2GXUA 2GDJA 3D31A 3A1TA 2EFHB 4WVFA 1W36C 4LHYA 4BFZA 5JFGA 1SXJE 2IEZA 1T8UA 1E2JA 3DKVA 3N2IA 4G5OA 4M2LA 4YXWD 1M6NA 2PLRA 4C0KA 2H57A 4JYBA 4TYNA 1A2KC 4D4JA 1N5JA 2PZFA 2GCNA 1TQDA 1TU4A 2YYZA 3EZFA 4YC7A 1Q12A 4IXNA 5H68A 1FX0A 3ND8A 3ZZ0A 3LWNA 1T0HB 4YONB 3CF2A 3VHXA 2Z43A 2O8DA 1NMYA 5D3MA 1KKMA 1M2OB 3VQTA 1W0KD 3B1ZA 4LYAA 3BB4A 3CR8A 2QROA 1VCNA 3ETLA 3QXSA 4JVMA 3RS7A 5KYKA 4B3GA 2IYWA 5LDDC 5C1BA 1G6HA 2GESA 2O52A 2XJ9A 5DYIA 1JR3D 1XPUA 1U90A 1K6MA 3M6AA 1HE8B 3IEUA 4C0AC 4V02A 4EJSB 1D2EA 3CZQA 4FCTA 2WJVA 5D3QA 3WY9A 3K0EA 4BECA 5AJYA 1IONA 1DG3A 5JWHA 4HEJA 4Q4HB 1Z63A 2CE7A 4PSAA 3VR5A 3AF4A 3ZQJA 1P9WA 3W6NA 4QGAA 4PQYA 4B6FA 2ZE8A 1ZRHA 2FOLA 3AVVA 4IOMA 5CIQA 2PH1A 2DFKB 4HAXA 1FZQA 1NMZA 1XD2B 3MWKA 3UWOA 1G6OA 2JIZD 3F8TA 3WHLA 4ZDIA 3DM5A 2BMEA 4TTRA 3GJ4A 4M9ZA 1VYTA 1OH6A 4Z1MD 1N6LA 4IOKA 1MH1A 2VEDA 3LO5A 1U8ZA 4BFTA 2AD1A 4GRAA 1IN6A 1E2GA 1Y63A 2G6BA 3EZ7A 1KMHA 4ZCIA 3NDBB 1E2FA 1UM8A 2ZVQX 1P2TA 3T1QA 4ZIRA 1F60A 3MWYW 3KXIA 3IDQA 3NC1C 4XWKA 2WWYA 4LCBA 1N6NA 3PEUA 1KI9A 3DVLA 1QVRA 1VG0B 3BWDD 5EE1A 5HR5A 4TMXA 3U4QB 1OH8A 4W7SA 2QSZA 1E9BA 2RGBA 4PO8A 4WOPA 2WPDA 1OLOA 2ZRKA 3GLFE 4RCYA 4A15A 1PLLA 4F4CA 4DB2A 1JB1A 4Q21A 4R7ZA 3ZVNA 4NE2A 3H2YA 4DLZA 1PZNA 2JCSA 1VECA 2HEIA 5IT5A 2WJHA 1XXHB 2X8AA 1V43A 1W0KA 2A5GA 4U5XA 2PMKA 3VR3A 3WMEA 4DUGD 2C8VA 2F43B 2ZI6A 2WWWA 4GSYA 1Z6XA 1E9DA 5FOWA 2CVFA 4DEYA 4DDUA 4QM6A 4Q7LA 1U8AA 1Q3TA 3CRVA 1NP6A 1KK2A 4HI0E 4URWR 2GBLA 4LHXA 5FPHA 2PMDA 2REXB 2REOA 1C9KA 4FD2A 4NYMR 2WPDD 1YVDA 2C9OA 1S0UA 2CK3A 2PLFA 3EIHA 2C77A 4GZLA 2ASEA 4PPFA 1KJZA 2OLJA 1OW3B 3C14C 2H18A 2IBMA 3BH7A 1Z0DA 2ZRPA 4IKEA 5DH9A 3VHLB 3RANA 5KNDA 4EIWA 4ZIRB 3WRXC 4LUCA 1FOEB 3K09C 4AYXA 2F1HA 1KIMA 3RRNA 2F6RA 3U3JA 4YQFA 2Z5FA 4BASA 2XXAB 4PQFA 3CR7A 1R0XA 4PAOA 4KLZA 4Z1MA 3B1WA 1QBKC 4IVPA 2FH5B 4I1OA 5FUXA 1RW4A 5BW8A 1JBKA 3GP8A 3BD9A 3THYA 4OI2A 2VYFA 4A82A 3CO5A 4NYIQ 2EQBA 1LFDB 1HT2E 2PJZA 3Q9LA 3ZGXA 3K0SA 1CR2A 3P4YA 2QPTA 3FKSD 2ZREA 1FNNA 5HPYB 3GLGE 4MKHA 1KAOA 1MO3A 2ZM5A 1GL7A 4D4KA 3JZAA 2ZJ2A 4JBYA 3QG1A 3K70B 2GJAA 2DPXA 3SYLA 3T35A 4B3BA 1J70A 1KNQA 1MABB 1X6VA 3IIKA 5E95A 4PANA 1ZAKA 4PX9A 5EUMA 1LF0A 2BBTA 2C2HA 5JS7A 2BOVA 1GP2A 2ZETA 3BH6A 4QBIA 4DT1B 1NLZA 4TQ9A 4LJ5A 4IDOA 4DUGA 1E0JA 3SFVA 1G16A 1OYWA 1OHHA 1XEFA 3C15C 2PBRA 1G64A 2ODNA 1OE0A 3KQNA 1R5BA 1WMSA 2ZITA 4IFEA 4LBVA 1QHHB 4BEBA 2AX4A 2WICA 3SBEA 1VHTA 3GFOA 1LW7A 4HZIA 3FE2A 4TN1A 1G4UR 4CF7A 3SFZA 2P65A 5CB8A 3CBQA 3PFIA 1AIPA 2QZ4A 1Z6GA 1P2SA 3CX8A 4GOKA 3PG5A 1KSJA 4A92A 3CONA 3SZRA 1CLUA 1XCGB 3NEJA 1FUUA 2B7CA 3JVVA 2PT5A 3B5JA 1UAAA 2QORA 5FBLB 1N5IA 4TL9A 4JKYA 5J4KA 1WDTA 2WV9A 1VDZA 4YMVA 4FCVA 4UNPA 1EK0A 5L3QA 3GLHB 3P27A 2DHRA 2QT0A 2VP2A 1T0JB 4Q48A 1UBEA 2H1LA 5HKKD 1NY5A 2W00A 2IYZA 3E1SA 1R0ZA 1P62B 1W46A 1XEXA 2LWIA 5CLQA 5JSZB 4OK5A 4GBMA 5FOVA 1COWD 3DPUA 2QA5A 2HT1A 3FWYA 2QSYA 3QIAA 4LPSA 5EJEA 5GJCA 4F93B 3RAPR 2O0JA 1CP2A 3SJAA 1E79A 2AFHE 4AC9A 2HCBA 3C4JA 3CH5A 3RWOA 2EU8A 3PVSA 4RD1A 3WMFA 2FPLA 1DTSA 3ECCA 4KYIB 1NVUQ 1US8A 2W58A 1KJYA 3VFDA 2KBFA 3IUYA 3TR5A 3AVUA 3CWQA 4LYFA 3RS2A 3SQXA 1M1YE 3K9LA 3OEEA 4X8LA 1VIYA 2GZAA 3H1TA 4LI0A 2ZJ5A 1R8SA 5LB4A 1KK3A 2JDIA 4HUQB 1PLKA 2O8CA 1ZM2A 3NBXX 4B76A 4A8JA 4TL6A 3CH4B 4NTZA 3X1YA 4B3CA 4CDGA 4YDHB 1HY3A 2ZR9A 1DAHA 4IEEA 3QY0A 4PFSA 1FP7A 1C1YA 3D6TB 4XOIA 2O0HA 1CRQA 1CXZA 1XTJA 1Z22A 1F3OA 1S3GA 4C0JA 2FG5A 2ZR7A 1XD2A 1P73A 2ZAOA 4R98A 5FL3A 3AVTA 5AK0A 2GCPA 1XPRA 3ZVLA 2NTYC 4PHFA 3FFAA 2YJTD 4PSKA 4ZKEA 2QE7A 3HYTA 1W36B 3U7EB 4IVQA 3K9HA 2F9MA 1YHNA 2FFAA 1WQ1R 2CLCX 4OI0A 2ZRHA 3C5HA 5ELXA 1UDWA 3LVQE 1HEIA 3NC0C 2QY9A 3DO6A 1KSGA 3UKDA 3ZZTA 4HB3A 4A2WA 5JI2E 3U3KA 1XEWY 1BH2A 3KKNA 3KB2A 4LBZA 4KITB 5JHGB 2VLIA 2QMHA 1K5DA 2XSZA 3LY5A 2IS2A 3WNCA 3UMFA 5TV2A 1M34E 1LS6A 1DAIA 1XTKA 2Q9AA 1H65A 1YJ5A 2AWNA 3BJIC 3HYRA 2A78A 2FZ4A 3M0EA 4M9SA 5IF9A 2XGJA 1D6JA 5CDFE 4GOJA 3KDSE 2YNMA 1HQCA 1S96A 5FOUA 1NY6A 2DBYA 2JJ1D 4OYHA 2CJWA 5FI0B 3FMFA 4DXAA 1WBBA 5G3YA 4MITA 3AUXA 2F55A 1ZM4A 3FKQA 4WW0A 2X19A 2NPIA 2ONKA 2JGNA 1R2QA 3AF1A 3KQUA 5J4HA 4NBSA 2GAOA 3VX3A 1OH5A 4AKGA 1JQLB 1PUJA 1KY2A 1X8JA 2RGCA 3A1WA 2FFQA 3AQ4A 2Q9BA 1U0LA 5B30A 4HUQA 1RJ9A 1ZM9A 2HXYA 3T1OA 3EZ9A 4G5QA 4NHOA 1S1CA 1NMXA 3AKDA 4ZI3A 1E2KA 2VP9A 2F7SA 4Q9KA 4Z8YA 2E9SA 1SXJA 3OZXA 2WKPA 4IDNA 1Z08A 1E9AA 4R2HA 3QG5A 1ZNYA 1X1SA 3UMRA 4CRWB 2DFNA 3W6OA 3U44B 2GNOA 2Q3MA 3CPJB 2O8DB 2L0XA 4OQMA 5EXTA 3TVTA 2R6FA 2H92A 1CJTC 4QGHA 4L15A 4TLAA 3SYKA 4DRZA 3R9XA 3B6EA 3OFNA 4M1OA 4IRUB 2V6JA 2VBCA 1GM5A 5CITA 1GRNA 1Z28A 5JSZA 1P9RA 2ZYUX 1YZUA 1YZGA 2XNDD 4X8OA 2P5TB 2G1KA 4FMCB 1NKTA 3SS8A 2I4IA 4ERNA 4TT3A 1W7AA 3OEHD 4JKIA 4U02A 3SR0A 1UPTA 3SJBA 2JAQA 4DCTA 1PVOA 2ONJA 3AVOA 4RZXA 4GMDA 2FFHA 1KAGA 2NIPA 3IIJA 2WIAA 3BRWD 3BXZA 2OUKA 4Z8XA 3WYGA 2IK8A 1E4YA 1G17A 2CCJA 4D82A 3ADKA 1E9FA 3I73A 2VP6A 3B1YA 3HR7A 2ODWA 5KDDA 4BFWA 2J7PD 4PC7A 4BWYA 1E99A 4C7OB 4M53A 2ZJOA 2G77B 2ZSDA
chains in the Genus database with same CATH superfamily
3IIMA 1XLTC 2GZRA 1FUYB 1CDDA 3M1YA 3V55A 4YJ2F 2TMGA 4YMGA 5B58T 1BU8A 2J5KA 1BS2A 3WSWA 3AHHA 2NLOA 3SJZA 4RTNA 3EOZA 4W9RA 1HYBA 1PDOA 1U9ZA 1FQKA 4LHSA 8OHMA 3S2IA 1FU8A 2CLOB 3EVBA 4W7HA 3E2IA 3RV4A 1RE1A 4V0QA 3TLCA 2WMYA 2XOKA 4KPYA 3CZ5A 3WYFA 3K5WA 2F17A 3I6ZA 3L82B 2NVBA 1A04A 4PNPA 5JAZA 5LQJA 3LDHA 2I33A 4LNUA 4J0HA 5EE5B 5KC8A 2A9JA 3IMEA 4KTTE 1YA8A 1K66A 1Q15A 3AOEC 4IHAA 3JZFA 3NWJA 3PDIB 1VLVA 2WAYA 1J49A 2HF8A 2LDBA 2VSFA 3AEXA 3QV1A 4JFAA 3P2IA 4O4LB 4P0QB 2WYOA 4RQUA 2NOAA 4AQ7A 2ZIFA 1VSQA 4QU9A 1EFRA 3RT7A 3DTVA 2IHYA 1KXJA 3DZDA 4US2R 3E81A 1ND6A 1JWLA 4CQLB 4B3FX 2WOJA 4DLLA 4EW3A 1ID1A 1P7CA 3EQ2A 3FCEA 3UAWA 3KUCA 3W9SA 2C9BA 2Z1MA 3R6GA 4KPGA 5C0OE 1DKQA 4J0QA 2RDMA 3VNBA 2WJYA 2VHJA 1HT1E 5KC9A 1KETA 2JIPA 1AH2A 3G1TA 4QEKA 1JLMA 1FS6A 1LPAB 4PPQA 4K3UA 3N2GA 2PA0A 3KVRA 1NXWA 3H0KA 4KRGA 4CR7A 3D8TA 4BJ5A 2FQ1A 2R5FA 3FOCA 1PS9A 2ZYSA 5A3RA 3WKBA 1JG1A 2SHKA 1PNTA 3A6FA 3IP7A 2QUZA 4Y2SA 9ATCA 2NO1A 4MVJA 3FOWA 4DV4B 3EGDB 3RLFA 3STHA 3IBGA 4QVGA 1GEEA 4D57A 4QM6A 1P60A 3LLUA 1ZXXA 1DL5A 1ZO8A 4QZVA 5I01A 3EVEA 2G1JA 2P27A 3NEYA 4HZUA 3OCXA 3LA6A 4TZKA 3GLIB 4JSTA 1QCZA 3PYMA 2BSXA 3K8QA 3BIOA 1OC2A 2KLHA 2X1HA 1GG8A 4UOQA 1FFAA 5HYVA 1RRPA 2ETVA 1CQWA 4FP9A 1EUYA 2J46A 3I83A 1R5JA 2V5VA 3H5IA 1NKVA 4G1BA 4IZOA 3M6UA 3AINA 4HCJA 1IH8A 1P7VA 4WXRA 3F1LA 3CKKA 3H1FA 2FJPA 3OQIB 1H3NA 1NUUA 5C4GB 1JBEA 5INTA 4RF5A 4KDCA 5CLLA 4N49A 3T8YA 3IODA 3RI3A 4QTUB 2A1TS 1ZD2P 2DWQA 2AMYA 2FB9A 3M6WA 1FSFA 2OFXA 5LSAA 2V6BA 3C3JA 2BMJA 4J3FA 4H1HA 3C0KA 4O5AA 4R2KA 4KDEA 3NRCA 1S2NA 1Q92A 5IABA 2GJSA 4N5DA 3OC0A 2OFPA 3DCYA 4X3PA 2FPPA 3CGWA 3FRIA 3ZWMA 1TCVA 2LNDA 3ICPA 4XCQA 5HJ5A 4BNVA 1W0JD 1WETA 1JAHA 2PX3A 4E14A 5FUQA 1H6AA 3SHQA 4V0ME 1WQ3A 2ZUDA 1W5SA 3GG2A 3R4VA 2QRZA 3ELDA 2CE2X 3W3AH 2H00A 1IZ8A 3E5HA 3NIBA 3C4VA 1VKHA 4YK7A 2GK6A 1ZN8A 1P0IA 1SG0A 3LXXA 3CRW1 3OESA 3K3PA 4D0LB 5LJLA 3DLHA 5K0EA 4OMCA 3B82A 1H66A 1PFYA 3DHYA 3BRSA 4TV9A 4XXHA 2XUQA 3CY6A 1L5KA 4WXEA 3F3YA 1AHNA 2NTEA 3W3AD 1I7QB 1KU6A 4ZQCB 1ORHA 4C0QC 1UIRA 1S4QA 4PR3A 3VPAA 5LWQA 1VRVA 3D2BA 3R5SA 4EKEA 4HQFA 5AUNB 3FMVA 1ZVJA 3WWPA 3DBHB 1QBGA 1NW6A 1UBNA 2QTCA 3IMCA 3VJRA 1Z2DA 1ZD5A 3D1VA 2D1SA 4N6NA 5C8XA 3TW4A 4RY8A 3TI9A 5SZKB 3NIWA 5FORA 3SZMA 3HM9A 3L43A 2GF0A 1C2TA 4Q3NA 1D0IA 2MR5A 1NDHA 1UFKA 3MUFA 4FNAA 4WHMA 2ZIVB 1KI6A 3E8SA 3I5AA 4B6EA 1ZG3A 4TWBA 4XLTA 4DN6A 4DNXA 3OOHA 5JBQA 5JUWA 2ECKA 5CTJA 4EI9A 3L93A 2HCJB 3K8ZA 4A6EA 4S1TA 3UIEA 4CLRA 1S5PA 3ZWYA 4BV9A 3GP5A 3BD8A 2ZP1A 2XGSA 5GZ1A 2X2EA 3UVEA 1EBUA 2IITA 4MWBA 1YR3A 3H1PA 4OV6B 2LD4A 5IAGA 1PBTA 5KNBH 4ID9A 5LQMA 1U2SA 3H6GA 1NBWB 4N39A 4L9WA 1JX6A 1THZA 2Q5HA 1JDPA 2B20A 1YCGA 1H2AS 2A5FA 3HZHA 1EXMA 1USGA 2AK2A 3NHKA 3PQ7A 4GO1A 4H9GA 1RXVA 2YW9A 1QQ6A 1YBHA 1CP3A 1JWAB 3T7AA 1I30A 2CC2A 1QYDA 4WV3A 1MBZA 4ZVOA 1EVLA 1ZGZA 4IFTA 1DJMA 4XVRA 1DIRA 1NRXA 1RWKA 5KS2A 1M75A 1XVAA 2QTHA 1WW3A 3CF4G 5BUCA 1QYCA 2C04A 1J8VA 3GEHA 3LVBA 4DAOA 2RONA 2Q27A 4ZAXA 2PHZA 1OTHA 4X6YA 4JJKA 3ISTA 2DFPA 3K5HA 1K8RA 2QLTA 4TV8B 3STUA 3WO0A 4FE7A 3U4DA 3Q7TA 2E82A 4KREA 4WNIA 1XCOA 2WINI 2C57A 2B92A 1RQ2A 1K9VF 1NW9B 3DV0B 4QAJA 2IP2A 2ZSBA 4Q1BA 3FI9A 4D46A 2V0GA 3QE3A 4C3VA 4DMLA 4YMIA 3K32A 1QFSA 4JJZA 4KL8S 5F76A 4TKUB 3X1KA 2ZTHA 1VPDA 4EATA 3H0CA 1DJPA 1DRJA 1EVYA 3NPMA 4CMGA 1I4WA 3NAQA 1VG8A 3AJAA 4GZ6A 4KWEA 5ICMA 3UAGA 1YK0A 3RUPA 3Q7IA 3RBZA 1Y6ZA 2I22A 1P3Y1 1U9CA 4FBGA 4FD3A 3R6LA 2FR8A 4URUR 1V8BA 4HGQA 2WNIA 1PI3A 2WNSA 2JD2A 3GX1A 5IAKA 5ITZB 4I4IA 5K05A 1MB3A 1Z4LA 4D56A 3IIIA 1E3IA 1YZTA 1YZNA 2C0PA 3LQQA 2VZLA 3B3FA 4I6EA 3ETCA 1KJQA 2IQ5A 4GYKA 1JQAA 5C7YA 3S2FA 3KWMA 1P5RA 2V4MA 1SVLA 1UM9A 3CWZA 3EDCA 4R5MA 5DX0A 2IBTA 3PEWA 2ZRIA 3GU3A 4WLOA 1ADFA 2A5YB 2R7NA 5JXJA 2JASA 1GYRA 3IUJA 4AZ0A 5LU8A 5IZ4A 2CVQA 2AIRA 3KQQA 4PYLA 2DBVO 3RK0A 3UNXA 2O0KA 4DA0A 1O9BA 1VDMA 4BUJA 3SMQA 8MHTA 4UD6A 2R84A 1DWQA 3FBTA 1FFHA 1BSVA 1W5AA 4F7WA 2HF7A 5HQ3B 4UVGA 1I7LA 2CLDX 1WHSB 2QJFA 2OCAA 4TKZA 4ZT4A 2PX0A 4KVAA 1A4RA 2WP8J 3LX6A 1CZOA 5B7NA 5KWEA 4C9BA 3RYIB 3GQBA 1N3LA 2AW3A 1KQNA 1ZONA 1OFGA 3A9CA 4EYGA 3L8FA 1V5EA 4M87A 2FCAA 3MAJA 2IOYA 4V03A 1LW6E 1YQ9A 1Q2XA 1RQLA 3I0MA 2GEFA 1KSHA 3O2SB 1RPAA 2AOTA 2FPRA 3MLBA 3OETA 4R9SA 4CM9A 2P9TA 2P2NA 3ACBA 3ZH9B 3T3IA 4HMQA 3CLRC 3BMOB 1KEUA 4B3HA 2HHHB 1W2HA 2DH6A 3IURA 1ZD3A 3LUGA 3BTVA 3GJXC 1AK9A 1NVVR 4HX9A 4K9DA 2DY1A 3GMSA 1IIBA 3FTPA 4ZYZA 1KYZA 2RD2A 1E3WB 4JOCA 1MO5A 5KYGA 1AGXA 2GBIA 1KE1A 3L7IA 1LDYA 1T43A 3TQSA 4OSEA 3S2YA 4O2AB 1JDBB 4A03A 2ATXA 1NXXA 3S8YA 1E2QA 3EH2A 3N7UA 4K5QA 3WV5A 1ISGA 1Z56C 1E2MA 2VH1A 4LYDA 4MYTA 1AV6A 3ZD7A 3TSYA 2W6ZA 2UXDB 3S7TA 5ER9A 1AS3A 1N9GA 1XOIA 2B8EA 3HY4A 3LT5A 4BMXA 4C0BA 5HVNA 3C8HA 2MYNA 2XQJA 2FWRA 1N34B 4Q9AA 3T7JA 3HKEB 1CC1S 1E61A 4LZPA 3EGDA 3WADA 4P3PA 5AHOA 4YP7A 1CWUA 4I5IA 1AO3A 1QQ7A 1WY5A 3H13A 3KFVA 1OTXA 2ENWA 4F72A 3NCTA 3DE5X 1KZ9A 1LLDA 1PVDA 2P3SA 1M34A 3EVZA 2FUG1 1QANA 3ORYA 5EZYB 2FZ5A 2G17A 1K08A 2VT7A 2P2YA 3SX0A 2YFKA 1WUJS 3DE2X 3UAOA 3D5EA 5F4ZA 1WD7A 4CR8A 4EKYA 5FPPA 2XUGA 5JRZA 1NN0A 2WC1A 3H11A 5H81A 1EPUA 1KGDA 1SBTA 4DV6B 1A3CA 3NDJA 4X1IA 2IGTA 4R1OA 5C8ZA 3PQ5A 4LECA 4I8XA 1RKBA 4Q93A 4EPYA 1YBAA 4ML3A 3DTVB 1AK2A 4URXR 3QE4A 3TUZC 1P7WA 3D59A 1HQDA 4MS1B 4TZ0A 4I5GA 1IZYA 3ONWA 2OBFA 2ZI7A 1K86A 3L9WA 2GPAA 2AQHA 2Y1WA 2AD5A 3NNNA 4M98A 1JMVA 1VL0A 2XUIA 4KPUA 1Z2OX 2FVYA 4ZU1X 1MGPA 2J9RA 2PANA 3RSGA 2ZGVA 2VN8A 1QO9A 2BZ0A 3L6DA 4OU5A 1J2TA 5L95A 4LVNA 3L4EA 1HDXA 4JSRA 1BKYA 2ZAIA 3M70A 5EJIA 2V1UA 3DYBA 1QVAA 1W5TA 3GWGA 1QIIA 4LJ6A 4YJFA 3SVZA 3TW8A 1XHLA 2HDNB 1A95A 3BILA 1YUNA 3KSAC 4BP8A 1HDIA 2CVOA 2EERA 2LKDA 4RETA 5E4FA 1TVKA 1PEKE 4F4HA 4M46A 1M2GA 1EFVA 1CJMA 3CUSA 4QJ4A 4YRCA 1AN9A 1T35A 1NF3A 1JALA 2HFKA 4A6XA 1DAOA 4KC0A 1RM5A 4N40A 5CDFA 5WRFA 2BSQA 4PGGA 4XDYA 3ANLA 3LUJA 2AG5A 3UPTA 1KY3A 4G0WA 1LTHR 2Y0DA 3MJCA 5LN1A 1TO2E 2ZIGA 3HYLA 4G26A 4IVRA 1C3LA 1RLUA 3JU3A 2BFEA 2HPHA 3RB8A 5BW4A 3OQ1A 2ZJ0A 1OYYA 2XRYA 4NU5A 2OKGA 1IN8A 4GXQA 4D9IA 1J9GA 5LLDA 3LV8A 1Y37A 4FINA 3EYWA 5JBIA 4YDSA 2JB9A 1N6KA 2ZSUA 3JZDA 3CWCA 2XKBA 3NWBA 2AK3A 3T9BA 4C5AA 4U2CA 4B2LA 5EJ7A 3CH7A 3LBNA 1EBBA 2V97A 2QG4A 4L3OA 2ZW9A 1OI2A 4GYWA 3BOSA 3OPMA 1RXSA 3QPWA 1HE5A 5CVUA 4BBPA 1CJVC 3V4LA 3C3EA 4P7BA 1YL6A 2C9CA 5C5IA 2WJ3A 4PO9A 4MQMA 2R62A 2KW5A 2QTZA 4RHXA 1BEEA 1XMIA 1AKQA 1DS6A 1MX3A 2OZPA 4KQCA 3ETNA 2FSIA 4MWOA 2RHCA 3NTUA 5DHUA 4AUKA 1XDWA 4F4IA 3AUTA 2XXAA 3FWHA 4YRDA 2WWIA 1FUKA 1NN5A 1PDWA 3OJOA 3CRMA 4PSDA 3QYPA 3O4FA 3LOPA 3P5BA 5CVCA 3UHOA 4RA9A 4UQPA 1H5UA 1WP4A 2BEVA 2R86A 2FQXA 4NU8X 3U4QA 1O97C 4TV9B 3N2GB 1MQ9A 3ZY2A 4DMRA 2FPPB 1R5OA 3MJRA 4BNJA 4E15A 2WTXA 1YUBA 1Q19A 4L51A 1CULC 1UANA 3HUDA 1CQIB 2YWCA 3SC3A 4EYKA 1GLVA 2ZR8A 1U0NA 3DOOA 1RKQA 3IDOA 3V4SA 2NP7A 3FNEA 1KK1A 2FEWB 3GGGA 4GL4A 1AZSC 2QEQA 2ZK7A 4XEUA 3TKAA 5B4TA 4P0PB 4PC1A 4ZU3A 3QWBA 5FAKA 3Q5DA 1BXKA 5CYFA 1GCIA 4WX2B 2RI6A 5FJIA 1G7TA 1JXMA 2OCYC 3NP9A 3KLOA 2IWHA 1OA1A 1ZZGA 2AI3A 2ZBVA 3EUAA 3VTKA 4B48A 3ZJ4A 2AOUA 3A1CA 3SIXA 4Y1RA 3K1YA 1F48A 3OUZA 4M6WB 4YACA 2NZJA 4B4DA 1Q7EA 3LRPA 1K68A 3OM9A 4XVUA 3ABQB 1ABBA 3NH9A 2JJ1A 3BTSA 3HYSA 4C06A 2BJVA 4ZCLA 4BLTA 4EJ2A 2VQ3A 3PC8A 4LS3A 1IEVA 1ZN7A 3OLZA 2OQ2A 2BGTA 4UBJA 4PNEA 1RAFA 3KQYA 2H1VA 3O2NA 1P8AA 3SNKA 2B7BA 2QAJA 3DW3X 3DYVA 3MWDA 5K8VA 1MRSA 1T8SA 3TK1A 2BFPA 2O7SA 4MV4A 4QTZA 5AQEA 5J5VA 1Z7WA 5K0ZA 3TG8A 1KL7A 1J99A 2V6MA 4Q7MB 5I9MA 3UWDA 3NJ4A 1ZJZA 3MXTA 2OSVA 1E3TA 5FR1A 3CZPA 3BFKA 1SVWA 1S8FA 4Z9FA 3IHLA 1X1EA 5I9IA 2UZIR 3BHNA 1EDDA 5LP6A 4M7PA 2FG7C 2W90A 3T3GA 1DEKA 3S2UA 3PHHA 2IZ1A 5CFQA 5AIBA 1L7VC 1YDMA 3ZJYA 4JI2B 2HMVA 1NJ1A 2ZSJA 3FGPA 4H17A 4KAXA 3RUDA 2HMAA 3EGOA 1P0FA 3UMJA 1OF1A 1YO6A 1H2WA 1T5BA 3HRKA 4YJ3F 1D5WA 2C2GA 5AM3A 5JHHB 2O7NA 3FZYA 5CB4F 4YFYA 2BT4A 1LY1A 1ATZA 1K7YA 2VJQA 1F38A 1YVEI 2HF9A 3QBDA 3IRVA 2G07A 4IDAA 4WUTA 1GL3A 3SZGA 1NF8A 3LXMA 2IHJA 3TFQA 4HNRA 4PYNA 1FFBA 4HGRA 4YCNA 1E7WA 2AXEA 3VMMA 3E53A 2MTBA 4FWTA 3ZNOA 1TU3A 5JCJD 4M1TA 1H3FA 5EUBA 4NMMA 3EQ8A 4TS1A 3T7RA 3IUQA 2ISQA 3UM9A 3HO6A 3IAM6 3A11A 4GLLA 4AQYB 3VOAA 3SJ7A 4JCCA 2W6JA 4GS5A 5GJVC 1ZSVA 1I1NA 4RTQA 3E58A 4WCFB 3UMYA 1MAUA 4Q7JB 3VR4A 4EI7A 3CEJA 5I7EA 1KZGB 4UHFA 2DTXA 1CY1A 1EB9A 2OCIA 2L17A 2Y1LA 3BJEA 4TYMA 1EXVA 5DNCA 1YC5A 2BEUB 2A3RA 4MYHA 1BXRA 4CMIA 2X9QA 4R1UA 4FFBB 1LNQA 3K1ZA 3F3MA 3TXXA 4EOGA 4EEXA 4TVKA 4O2AF 4XQGA 3MJFA 5FRDA 3JQEA 3Q3HA 3LX5A 4D7AA 5FWNA 4RLHA 4MH0R 1CUZA 4KFUA 3TNFA 5HKKA 4B3MB 1KS2A 2XITA 2DKNA 4X24A 4CXMA 1SU6A 3VBCA 4F56A 1Q0QA 1FVXA 3CQ9A 3B53X 1LUAA 3L0BA 2XADA 2ZXFA 2RGDA 4OHWA 4MPRA 5H8WA 1T9CA 3UAZA 2XMZA 1T5HX 1Z18A 3AEZA 3JD4A 4QXPA 4XH9B 2D1RA 2JFYA 1RT9A 4O2BF 1UWKA 5FLYA 2PS1A 1G5RA 1AHHA 3HP4A 3WLEA 1K0FA 4MROA 2P41A 4RSGA 1U0TA 3HU5A 4OQPA 4N47A 4GR9A 3VJLA 1CEQA 2D5LA 4NE9A 3VISA 3VU8A 2FDRA 3KBBA 4BNDB 3PR3A 4YRMA 3T99A 1QNLA 1II8A 2BKUA 3AP1A 5A9SB 4FT2A 1LQTA 2ZE7A 3AUUA 1Y4SA 4ALJA 1H9BA 3NVAA 4E32A 2DR2A 1FNBA 1VCIA 1YS6A 3ZH2A 5IDQA 4CM9D 2O8EB 1Z6AA 1IPEA 4IZHA 2QYOA 1V5FA 5IFLA 1A9OA 3AM5A 3AB8A 3ESXA 1U2EA 1RP1A 4FFLA 3KKZA 3QPAA 2XIJA 4DQVA 2QM0A 3HHPA 5CHYA 3WBFA 1SUWA 2XF8A 2EKQA 2ZRMA 3C97A 3PNBA 4RADA 3HFJA 5ALDA 3WGTA 4AF7A 4CW7A 5KTPA 4NCHA 3PWSA 3GAZA 3HB0A 2OBMA 5EN4A 1IVNA 3PE6A 3DEHA 3UMCA 4N5HX 1NAIA 2FR8C 3BUSA 1E3QA 1ESEA 3O3MB 4YB8A 1SOMA 2EVWX 3MLEA 2H1OA 3OUUA 5CW1A 1OLUA 1XCMA 4BZXA 1KEEB 5KSWB 1D7OA 3V8RA 1U0RA 1XTBA 5LXTA 1GD1O 1ZH6A 5HE8A 3AU8A 1P61B 3HKBB 2AMFA 5KHAA 1HL3A 5BN1A 3BICA 4OIMA 1L5OA 1NSYA 2YL2A 1L7XA 1XN4A 5DBHX 2QJOA 5K0LA 3ZDEA 4IDCA 2YVQA 1UK9A 2VDMB 3LL4A 2QX6A 5EI5A 2BPOA 1GUFA 4JLMA 4PZEA 4RD3A 2X9NA 5BQ5A 3RIHA 3PFHA 1RWBA 2XNSA 1NW5A 2HK8A 4MUMA 4XB6B 4JJ4A 3WOHA 2AYYA 2UUAB 4LZOA 1LF5A 3LZ6A 1EDBA 2QAGB 1V16B 3GB9A 3C41J 3CUKA 1QU3A 4KFRA 5CFMA 1GNRA 2BHLA 2J08A 1O89A 4G07A 2GI4A 4JK3A 5GWXA 4KV7A 3EC2A 4IJKA 4TMTA 2J48A 1TYBE 3Q88A 4G4IA 4K8RB 4TN5A 3TL3A 3TSCA 4P7FA 5DHRA 3VHQA 2IUTA 1HURA 2R25B 1PJQA 3K2EA 4X3OA 1H8ED 1NZJA 2P5SA 3WMRA 2MU1A 3IQWA 3LRXA 4I3FA 4YR9A 821PA 3ETGA 3L8DA 2PRKA 3BFVA 3TJZA 3EHDA 5C7LO 1A9PA 1W47A 2QP4A 4GBJA 2C3OA 3QOYA 5E8JA 1IBRA 2EJUA 3JQRA 2O2IA 3D3NA 1AO0A 1A2BA 3JQ7B 5E0OA 4WNAA 3KZKA 4OI1A 5DU2A 4JD5A 3OJ0A 4A3SA 3L7BA 1VJGA 2VOJA 3IP8A 4EY3A 5L9AA 4CCWA 3G85A 2UV8A 5JNTA 5LBTA 4WJLA 1C50A 3BSFA 1B6TA 2RHHA 4MJ7A 2BFCB 4QOJA 1NJSA 2O2HA 4U00A 1SQSA 2XUDA 3AERB 4YT4A 3QELA 1YZLA 2DFLA 3MMXA 4PTYA 3D6JA 4GKVA 3RBXA 3P9XA 3LWZA 1E58A 4YX9A 1NZFA 1XAGA 1ZD8A 2PL9A 1MOQA 2JF0A 2RARA 3B6JA 3O83A 3OIYA 4RANA 5ENVA 4BNDA 5JEEA 5JO0A 4J1NA 2GUGA 4WXMA 1ST2A 1P1RA 2GOYA 5BUQA 5DJ5A 3TH5A 4CMKA 4DLNA 4DYDA 3HO8A 1TLLA 1I2BA 1XMPA 1AG9A 1SHTX 2II6A 2UZ1B 2R6CA 4G1VA 1Y1SA 4W6QA 4DR2B 1JLLB 4RPIA 4LF8B 3RVSA 3I1FA 4DIOA 3A6GA 1Y7HA 1UEJA 2NQ2C 5TPWA 2ZOSA 4QHTA 5IF3A 5IHPA 1SO8A 5DXJA 1EE1A 1P81A 5G4KB 3Q8LA 1A9XB 2XTNA 2GLTA 4X6UA 3VBEA 4UBOA 2WILA 1VG1A 2DR0A 1FLDA 4MYCA 2PR2A 2ZJZA 4N0DA 1IOWA 4R2JA 4YCJA 3D4BA 4V1CA 4YDQA 2ENUA 3KZOA 1Q0UA 3CX3A 2R8PA 4FMDB 4KYUA 4MWGA 4PFJA 1YZKA 1YOVA 2E4AA 2P40A 3K15A 3O9ZA 5DB4A 3FJOA 5KU1A 3CCFA 3CIOA 4ZZ0A 4WRRA 4FLMA 5DMXA 1UKBA 4BNYA 1W5EA 5DN6D 3SF8B 4KOEC 5K8CA 1GAQA 2PQ6A 2PGLA 3EDMA 1CZKA 5HIJA 4WXPA 5LMZA 1OD6A 1FP1D 1UP7A 1D04A 1HDRA 2Y4NA 4FOTA 2BCEA 3VR6A 4YDRA 2B4QA 4ZQFA 4M22A 4Q15A 4YAUA 1HPLA 4D98A 1LV8A 1RJ9B 5FPQA 3RABA 1G8YA 3QXCA 2EZ8A 4D6XA 2F3TA 3AI2A 1ZGCA 2ZVPX 5JR3A 1YZFA 3TBFA 4JASB 4MV5A 3FDXA 3OSUA 4HH1A 2LPMA 4UTXA 2QX7A 3ITNA 4JVLA 3WNQA 3EQ7A 4TTTS 2PG3A 1Z7YA 4LOJA 3K8YA 4QDKA 3CISA 6PFKA 3IPXA 3LBIA 1V9CA 4PINA 4GVPA 4MDYA 3AGPA 3ECSA 1VQ1A 3K0FA 3EGVA 2AKAB 1QH1B 4BKPA 1HMYA 1WV0A 2VPXA 1N2JA 2W0SA 4MV6A 2VP5A 4ZVPA 4C7JA 4XRGA 5BW5A 1VI5A 2CDRA 4HWTA 4KAJA 2Q7OE 5JYDA 3DFFA 3TVDA 4KK3A 1WDMA 1DARA 4GECA 1PT6A 3IHWA 4JLDA 4CWAA 1FTWA 1DAEA 1Q3KA 2HXGA 3AIMA 3EXG1 1BROA 3BWXA 2BN4A 2F3PA 3ZY4A 1YVUA 4EUKA 4C5BA 1P2VA 1Z4QA 2X77A 1J56A 2ASVA 3DXFA 2D74A 5JJLA 2OY0A 1XJ0A 2WSBA 2I8CA 2XGGA 4P3XA 2NT4A 5JO9A 5TR9A 2PUBA 1F51E 2E1RA 3PU6A 3ELUA 1N6RA 3F5DA 4ZZ2A 4HTAA 2RKOA 4XVCA 4DCUA 1L7BA 1H0RA 2G5PA 3FNQA 4MA4A 4ZAYA 5AJUA 3ZDXB 2CL0X 3LIIA 1GZ6A 1HRDA 1T1JA 5B3KA 4V1CI 1SA0A 4CIAA 2ZBDA 3HJAA 1ZA2A 4A8TA 3ZIDA 2O8EA 4YMTA 1U94A 1RQNA 2PFSA 4Y67A 5T57A 3UYKA 1JW9B 3WNZA 1PP4A 4XJVA 4DT1A 1GDDA 4IHJB 4M0PA 2NUTB 2AOUB 1JLHA 2WFAA 2YHAA 4XM1A 2JJ2A 2IY9A 2A2ZA 5DDIP 4ZJPA 2WU4A 2IYXA 3O47A 1CUDA 4N5LA 1QJ4A 1VXRA 4ZCPA 4CM5A 1DKUA 4AUEA 3DAPA 3L4BA 2FRDA 3CW9A 1X9IA 1QHFA 1ISJA 2BKEA 1BXGB 2Q5OA 3DUFB 1KP2A 1BJKA 1CR4A 1O7JA 3ESAA 1SCKA 4ZYWA 4L28A 3ZD6A 2XZTA 2I6TA 2OHVA 1U6KA 1O58A 1KDRA 5KAPA 4CETA 3RRMA 4ED9A 1Z6TA 1A96A 2QMEA 3AEUA 3EG9A 4NS4A 3QJYA 3KV3O 3MTJA 2EKPA 1IXRC 1EGMB 4QBGB 4W5QA 1Q7TA 2FN4A 2IYOA 3LGXA 3QEAZ 2CL7X 5TQ2A 4IV0A 1LU9A 2EDCA 1GR1A 2XYRA 2GHIA 2IXGA 1IBLB 4RDXA 5HHTA 2WNHA 3BVPA 2BLNA 3UJPA 3QVXA 5HEKA 2QD4A 1TGYA 2X58A 2GYUA 1B0AA 3GLRA 1CR6A 5EEGA 4ZYYA 3A6PC 1W1UA 5EQDA 3WA7A 1AM4D 2UZAA 1TAQA 3DR5A 4PG7A 5CNJA 3S5UA 1M74A 4IICA 4BO5A 3ILVA 1QMPA 4YUZA 3EVAA 4ZO6A 4RA6B 2G4CA 4YXFA 3HCRA 4JB8A 3UJ7A 4DMGA 4RMGA 3I4FA 4OF4A 5F33A 2Z2IA 4DIEA 2O1SA 4N5NA 5K20A 1VBFA 3MCUA 4KQWA 1KIAA 4EGQA 1IQPA 3T9AA 1U11A 2FWAA 1DEXA 3HXKA 3JWJA 2GWHA 3PT5A 4QODA 3V3TA 3PEYA 2LIPA 3FTQA 1EGHA 3P8ZA 2PZAA 2O07A 3U1VA 1BXRB 4CMIB 2W42A 1QGZA 7AT1A 1E8MA 2OENG 1LD3A 1RWPA 5AIAA 2H16A 1LNZA 4F4UA 1X0VA 3NBZC 4YV7A 5E2BA 2R1VB 1HFKA 1QWOA 1O94C 2HJ9A 2Z58A 2Q6TA 2HSEA 4JGGA 1FDTA 5DWDA 2JD0A 4ZEOA 2P8JA 4KQMA 2YASA 3B2EA 4UAUA 3OQIA 2CFSA 2W2MA 3O2QB 4N0QA 1R4MB 2CHUA 1JA1A 4RHUA 1HETA 4B0OA 4L5AA 4L76A 2QSJA 1SCUB 2QU7A 3TB6A 5FFMA 4ZYVA 1WDKA 3IKLA 2O59A 3T4UA 3B78A 3NYQA 2EZUA 3KYIB 2Q1SA 1LFAA 2I7TA 1K27A 1J7KA 4LYJA 3GLQA 5SY9A 2UYOA 2GEVA 1SD2A 2KX7A 4NK4A 1JNYA 4V0OA 2NU9B 3HVKA 3NUQA 4JELA 3QELB 1YIAA 2C03A 5E6RA 1NWCA 2FHPA 2UVQA 1NRWA 2PGJA 4GXRA 3L6OO 2V4ZA 3JQ8A 2DKOA 4A73A 1ZIDA 3RV3A 2GVDC 1QCCA 2XMCA 3HCCA 3LY8A 2F1RA 5LZ9A 3KKKA 1VG9B 3KSDO 1WF6A 4I46A 4JFRA 3RVDA 3MWJA 5THQA 3FETA 3HK2A 1DDIA 1OXVA 2B69A 1V1MA 4JX9A 1COZA 1JAXA 1Z5WA 4C0LA 3GD7A 4JVNA 5B2FA 5C5CA 2IOHA 1UADA 3MM4A 4AKTA 3KYCA 3I34X 2E55A 1JEYB 3RAFC 1F2TB 1Y81A 1TQHA 2R4TA 1MB2A 3ADOA 3L8ZA 1CJCA 4H7IA 4YCMA 5MHTA 4L4RA 1KMHB 4RZUA 4A0GA 1E8NA 3P2KA 2CSXA 3OX4A 4KXLA 3KJHA 3BGVA 1B2LA 3B1JA 3T9CA 1A8HA 5E8RA 5EJ8A 4LWZA 4HJXA 4R41A 3DAOA 2GB4A 2C8LA 4HDSA 4PV7A 2OPHA 5ALEA 5DIFA 5EFZA 3VC3A 1M8GA 3UWKA 4BJHB 1Z26A 1LPNA 3OOSA 2G1UA 3BL8A 4N1AA 4LRUA 1WWKA 1R74A 5J23A 3ANYB 1O96A 1RM3A 3GLIE 4ECAA 4YWJA 1OZ0A 4RIHA 4KSCA 1C3XA 4DNPA 3QVMA 3JYQA 1JEJA 2CKMA 4MAMA 2IU0A 4JI8B 4QTTB 5H80A 5HDBB 4NBKA 2QM7A 2H48A 2C61A 4XAQA 2ZWVA 2RHGB 3HSKA 3ONVA 4DA4A 3BFXA 4A2QA 1IC6A 4M89A 5CYPA 2CCKA 4ZCSA 5IK2A 1N2EA 1RCTE 3C3DA 3DMDA 3LKBA 3SHOA 1B76A 3U9SA 4JOSA 3SU8A 3IJ5A 1R64A 1X39A 3CRZA 5BSUA 3ZXXA 1M1ZA 1H2YA 4WKGA 5F7ZA 2BTEA 4HDMB 2Q1UA 2IVZA 1L4MA 1T5TA 4UVDA 1JKXA 1PR5A 1XVTA 4JY7A 5CA1B 2ZAMA 1U3TA 3Q72A 2ZE5A 3IQEA 3W1EA 5CU7A 3DVQX 1WKCA 2GK7A 2JEYA 4RMHA 3RSZA 9LDBA 4CM8A 3O82A 5AVJA 2NAFA 2YC2C 2XWSA 4MSUA 2O1WA 4TVSA 3NJRA 4PONA 2HK6A 2YWHA 1FTSA 4EUNA 3B13B 2P11A 1FDSA 1CB7A 3R3WA 1QAOA 3SSNA 5IT4A 1K92A 4CUZA 3O3OB 4W8GA 2NO4A 3P0FA 4O4JA 2X3UA 2H5IA 4O3MA 3RK1A 3OM8A 2WYWA 5JOQA 1K98A 1TCBA 1ZS9A 3BKXA 3MMPA 4OB8A 5HRAA 2P3OA 2WIGA 3WQBA 1GTZA 1Q95A 3O1JC 3QFSA 4K46A 3MELA 1PG2A 3WGUA 3O74A 3DHEA 3H3FA 4RFSA 3A4YA 3LPAA 4R8MA 3PCRB 1QVWA 5HCUA 3SNHA 4KO3S 3G9TA 5AK4A 1N7JA 2P9JA 2XMSA 2A9PA 2LKCA 1V37A 1JXAA 1LLUA 4DCMA 2AZDA 1JMKC 2XTMA 1YZQA 1NV8A 3QFCA 4BQSA 2IYUA 1AJEA 4UTNA 3CE9A 4K6FA 1KAHA 1EAMA 5DHSA 3U3OA 2X4LA 2IYAA 3NRBA 4L0QA 4KO1S 4UBKA 1N36B 2ZS7A 4HT3B 1Z25A 3AC0A 3EISA 3NHZA 4PZUA 1UZMA 3I9OA 3FHJA 1L3BA 2ZIAA 5E2IA 1LWNA 2XB9A 2V6GA 3F4LA 5KYYB 2ZYRA 4EJ0A 3AFOA 4PLVA 2WDPA 4FYYA 4QX6A 1REQA 3WZ2A 2OOSA 3SEQA 2VJLA 4CDRA 2R3SA 4Q03A 2BHRA 2ZRFA 2GX6A 3STYA 1Q44A 1PR1A 2A7XA 3K0CC 3KS9A 3STWA 4OXYA 5KQGA 2Y8EA 5TB5A 2F3SA 2HHCA 1G8SA 1C0EA 4R7GA 2P6RA 4XDGA 1Y42X 2G71A 3U09A 1TIKA 1EE9A 2WHEA 1U0BB 3P2JA 2I4NA 2IZZA 3FGNA 1MHPA 4TKUA 4WN9A 5LC1A 4DFDA 2BY4A 3UFXA 2JLUA 2QZ9A 3WLJA 3Q98A 3N6RA 1DC3A 3BIXA 5HQ3A 1KI2A 1E2PA 3GMIA 2W0MA 5JWRA 3ESZA 3GBPA 1H5QA 3UJHA 4HH3C 4ZI7A 1MRZA 3IGFA 4LZZA 4RWEA 5CCDA 1OAOA 4HSEA 2DQ4A 2LP4Y 3M9WA 4G5FA 4ZEXA 1TAGA 2X0KA 2YNMD 4AP6A 3D4LA 1FW8A 1H1LB 1HDEA 3B9PA 1UBJS 2AJ8A 1C9YA 2JLBA 4Y2RA 2KB0A 2V9PA 3SI7A 5H1YA 1SUIA 1SK9A 2I3GA 4KFSA 4WVLA 1GCAA 4QPJC 3ZKWB 4ANFA 1NBAA 5J59A 1ORWA 4POAA 2EFGA 2Q9CA 4W9MC 4LOHA 2CF5A 4QVIA 2IUYA 1G5QA 1P31A 3WK8A 2DU8A 5KQPA 3SWWA 2JAOA 4ND2A 4N65A 3FR8A 3PRHA 2KJQA 3DKRA 5A6SB 4AG6A 4J0JA 2G40A 4J29A 4PQGA 1G8FA 3UGKA 4QBTA 4ND6A 5F5XA 1UBGA 4E12A 5J58A 4WFQA 4N6GA 2G0AA 3DKIA 4RIGA 2DPMA 5TF4A 1UDBA 3VOBA 1J0BA 3HRIA 1DUSA 1QH9A 5J43A 1KZHA 6ABPA 1T36A 3JQ8B 1A5ZA 1UCFA 5C1PA 5JI3E 2YQZA 3O8OB 3MFYA 2Q8PA 4UTVA 2OM2A 4J1QA 2BFAA 3FTNA 2FXIA 4QJ5A 1FDUA 1P4RA 4NONA 1Z5UA 1K89A 2FEXA 4MIYA 4L8VA 4UHBA 1W1WA 3JQ9A 5CT4A 1G8AA 4O4HA 1GL9B 5EWLB 4U7TB 3O5AA 4BBZA 4ZCTA 4RYLA 1T5OA 4WA7A 4UEJA 5CA0B 2VDUE 4C01A 1AKWA 3ABRB 4DWJA 3X0DA 2NU6A 1SCJA 3TVYA 3ZLJA 5T4HA 1F8XA 1MRNA 2J9GA 4U6SA 3DCIA 1SVOA 4BNNA 3N58A 4EG7A 4F8YA 1R4ZA 1ZW1A 3AR6A 2RIPA 3JWIA 1RRCA 4C2TA 4AJ9A 2PZLA 4M0MA 4WCFC 3RU3A 3RUHA 4O5OA 4BVEA 4HVLA 1N7HA 4Q3KA 5C52B 1R9NA 3AJEA 4BFVA 3DBVO 4OPMA 1EH5A 5DYGA 3JD2A 3NBAA 3ZLUA 3H0EA 5GAJA 4Z1MD 5JU6A 1VL8A 5AOVA 1E1KA 3HU3A 4IV8A 5MF6A 3RC3A 2OXIA 3MMNA 4CIVA 3FWPA 1Y1RA 5DKFA 2OWEA 1OFUX 2Q4RA 3UGTA 1B23P 4U4AA 4J7AA 1KO1A 3D2AA 2I66A 3DV9A 5K09A 4AKIA 3MB8A