3FMOB

Crystal structure of the nucleoporin nup214 in complex with the dead-box helicase ddx19
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
232
Chain Sequence
NLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncoprotein/hydrolase
molecule keywords Nuclear pore complex protein Nup214
publication title Structural and functional analysis of the interaction between the nucleoporin Nup214 and the DEAD-box helicase Ddx19.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 232
sequence length 232
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmoB00
3AM1A 2QN6A 4LJYA 1QG2A 1TAGA 5DO9A 1XBTA 1EFRA 3TR5A 3IO3A 1JR3A 3QG5A 4JVMA 2BBWA 1D2EA 1ZU5A 2C96A 1E69A 1KJYA 5TDHA 1XFAA 3PEYA 1FP7A 2ZI6A 2JCSA 5L3SB 2RGCA 2QENA 3MUFA 4BRWA 4MGZR 2J0SA 2W2VA 4AKIA 4II7A 4LYHA 1KY3A 2GCPA 1LV7A 5CK5A 2N42A 1FZQA 2IYRA 3K1JA 2ANCA 2GJ9A 3DMDA 1HEIA 4OBEA 5EXTA 2FMXA 1EESA 4BFSA 4JS0A 3QPUA 4V0ME 5HTKA 3W9YA 1F60A 2QUZA 4Q9HA 1DAFA 1MABA 4LYJA 4B3DA 3QF7A 3CPHA 4P4UA 1NVWQ 2GBLA 2IYYA 4Q21A 1R5OA 5BN5A 1AK2A 2JLSA 3QY0A 1X3SA 4B6FA 3B1WA 2Z4SA 4LC1A 2ZSDA 4WBSA 3T12A 1Y3AA 1I2DA 1P2UA 1KKMA 1SHZA 4E03A 2WZQA 2Q21A 3K0AA 2ZXUA 4OJKA 5FBQB 2ZVPX 4PC1A 2F43B 3DHWC 4LX0A 4Q66C 2P6RA 2BKUA 1W36D 3MWLA 2X2FA 3GP8A 1E2KA 3CNNA 5L3RA 1ZC3A 2CCGA 2VYFA 4QGGA 4W7SA 3TR0A 1GNRA 3M1IA 4OQXA 1AS3A 4P4TA 5FUWA 3ZYCA 4FD2A 2YZ2A 4ZDWA 3Q9LA 5H68A 2GF0A 1N5IA 1H8HD 4MGYR 5JRJA 2PCLA 3GJ0A 4I4LA 3C41J 4EPVA 2OAQ1 1OH8A 4IVPA 4C2UA 4Z8XA 4PXAA 2D3WA 4BRUA 1IXZA 4NMMA 4BEBA 3KQNA 2BMJA 2WKRA 4XTCS 1ZMXA 1G5RA 2A5GA 4DT1B 1WB9A 3IEVA 2NO6A 2C5LA 3GFPA 2J0UA 1IOZA 3FPAA 3LO5A 3QKRA 4Q02A 1XZQA 2CK3A 4MRPA 4NE2A 2FEOA 4AURA 1MRSA 1NN0A 3AQ4A 4IW3B 1XMVA 2Q6TA 1CEEA 2XB2A 1E98A 2CL6X 1V5WA 1N0VC 4UQOA 2NG1A 1IJFA 4QKQA 4DLUA 3J81k 3HYRA 3OEHA 2ZJYA 5LB2A 4ACBA 3ZIAA 5JLJA 5FPTA 3ZD7A 4M2LA 2WJJA 3AF2A 4C30A 2GAAA 1JQLB 1RJ9B 4BLQA 3A1WA 2XXAB 1TTTA 4A0RA 4G3XA 4NYMR 4IDOA 2OESA 5J4VA 4IDPA 4TLBA 1BKDR 4RD0A 2JATA 4TMTA 2X2EA 2ZRMA 4S2EA 1F2TB 1SKYB 1KSJA 1U9IA 2ZUCA 2CL0X 2J46A 2MMCA 2BM1A 2WKPA 3ONWA 1J99A 1XWIA 3ZGXA 3NHAA 2KE5A 4IRUB 4TZ6A 2BWJA 4PPNA 4B34A 1S8FA 3B9QA 4LK2A 2C78A 3IIJA 4LYFA 4UNSA 5HCIA 3I5XA 1CF4A 3PG5A 2ZM5A 2TMKA 2ODEA 3FB4A 2ECKA 1HQCA 3ASYA 3CWQA 5FFMA 5BWMA 3LBNA 1EGAA 4CEJB 2QROA 2ZJ5A 1F5NA 1AKEA 1E9DA 3RRYA 3KJGA 3KKOA 2KWIA 4C0JA 4JVSB 2XB4A 1QHXA 2VSFA 2GCOB 4K46A 1L7VC 1PUJA 1E96A 1Q1BA 3RNLA 2P5SA 2QTHA 3GLGB 1GL6A 1GFIA 1TF7A 3FHOA 3ASZA 2XSZA 1G4UR 4DLSA 4WA7A 1ZNWA 4AIIA 2GXSA 1VG9B 4DC9A 2VLIA 2CLSA 4TTPA 2OCBA 3SHFA 4LZZA 2AWNA 4LWZA 2NIPA 3K70C 2H8KA 3MWYW 3WBKA 2WWIA 3BC1A 1J70A 1R6BX 2DFKB 5EUMA 4A0FA 2E1RA 3MRSA 3W8RA 1G5TA 3D7MA 3GLIB 1PV4A 3W3ZB 1E2PA 3I62A 2Y8EA 2AN9A 3CBQA 2WWYA 3BK7A 3EZ6A 3FHTA 4G5QA 1E9CA 1U2RA 2ZUDA 3NH9A 5JZVA 3EASA 2BBSA 4FW9A 4I1UA 5TMPA 3AEZA 2XZLA 2AK3A 2GCNA 4MDEA 1EK0A 1FMLA 1E79D 5CLQA 3FKSA 4U00A 4NYIQ 3B6EA 2H17A 1MABB 3CRQA 4TMKA 2WJYA 4MYHA 1MO5A 3ZVRA 3Q7QA 1FUUA 5BQ5A 2B7CA 1G3RA 5HPYB 4Q5IA 1BIFA 1KZ7B 4PO9A 3KXIA 4DVGA 4E22A 3PUXA 2OE2A 2Q0HA 1E1RD 1GWNA 1YVDA 3OAAD 2G3YA 2QPTA 5DIFA 2HF9A 5BYJA 2CBZA 4DHEA 3AV0B 1YZNA 2CCKA 4ZIRB 1CU1A 4JSYA 2X19A 4RZXA 4D0LB 1Q3HA 1FW6A 4RCZA 2F6RA 3UK6A 1ZUNB 2VRWA 1FTSA 3PVSA 4HAXA 2KI5A 3EW9A 2FFQA 1S9HA 1NNEA 1RYHA 2WHXA 1FQKA 4EFNA 2F9LA 2BMEA 4P33A 1NBMD 2IF0A 4Q47A 2JASA 3SC3A 5JEDA 4W9MC 1OXXK 5J4HA 1UJ2A 4XVQA 4JLJA 3RYTC 2HJGA 3OZXA 2XJ9A 1XEXB 4GZMA 1KDTA 1DPFA 2VHTA 3BAFA 3WYAA 5P21A 3BB4A 2J7PA 1JQJC 5G41A 4E09A 3P32A 4KLNA 4CT5A 2ZJ8A 1SQ5A 1M7GA 2V9PA 1G3IA 3KXKA 3U3JA 1VDZA 4KXFB 1Z5ZA 4G1UC 1DAEA 2BOVA 3L0PA 1ZD8A 5BW8A 1CBUA 1FQJA 3KKQA 4MKHA 2GHIA 2J0UB 4QHYA 4Q4HB 3SQXA 1XTJA 1T5LA 3ICEA 1NMZA 1DAKA 5K8TA 4TYNA 2QQ0A 2PT7A 2VBCA 3NBZC 1Q21A 4WZAE 1JALA 2WBLC 1AJEA 4PX9A 1D9ZA 3GCGA 1UBCA 1B0UA 1GUAA 1MR3F 4M9SA 3CF2A 5F2EA 4OQLA 4TQAA 1LB1B 3CWZA 3VFDA 1GL7A 5FTKA 2KJQA 4TWZA 4AD8A 3IILA 2IEZA 2O8CA 2YC4C 2ZS8A 3AKDA 3ZZTA 1E9AA 1PUIA 2JJ1A 2JA1A 2PJRA 3IDQA 3RRMA 1J90A 4I1VA 4PZYA 5DLQC 1K5DA 1SVMA 2VPPA 5EUQB 2N1BA 1JI0A 4M1WA 1CR0A 1E4YA 3P4YA 5LBIA 1Z6YA 4W5WA 2FSIA 4C0SA 1JJ7A 2SHKA 2EWVA 3B82A 3SNHA 1G9XA 3HDTA 4HAWA 5EXSA 3QUSA 2A5YB 1G16A 4HAUA 4Q7KA 5AUNB 3R7WA 4C4PA 3G5UA 4URUR 4TZ0A 4LJ8A 4AKGA 1DO2A 3DPUA 1UKVY 1NG1A 4OHWA 4QXAA 1AZTA 1W0JA 3Q85A 3TW4A 3UMSA 4JLOA 521PA 1E1QD 2QM8A 1EFTA 4IXNA 1XEWX 3VHLB 3DKPA 2OO7A 2ZRNA 1U8ZA 4F7WA 1G19A 3I92A 3DOEA 1G7CA 3KTAA 5BXQC 1T4GA 3KXLA 3FTQA 2G6BA 1YRBA 3K70D 2GTPA 2BEKA 3R9IA 3TW8B 3KKNA 3B2EA 3C7KA 5ANRB 1Z3IX 2CEAA 1JEEA 2YNMA 4CVNA 5LD2B 5DI3A 2ORWA 3EARA 3BXZA 3GD7A 3B85A 3OE7A 1ZVQA 3ZZUA 2B7BA 5GJCA 2BVNA 1P9WA 3VR3A 1XD8A 3PUWA 1GITA 4EJSB 2JLRA 3HJNA 1IY1A 3TLXA 3PCRB 4CRWB 1R0XA 5TXGA 1FL9A 2FSFA 4IDHA 2V6JA 1AKYA 1G7TA 2V55B 4Y0VA 1Q0UA 1K6MA 2C8VA 1IN5A 2YHSA 2CCJA 4JBXA 3QXCA 2XOKD 3E5HA 2OBLA 4M1OA 3E1SA 4OQFA 2PZFA 4FIDA 5E7MA 1W44A 2FOLA 1OH7A 1WMSA 3KZ1E 3EPLA 3LLMA 3NBFA 1U81A 1PLKA 3TK1A 2PZGA 3ZS9A 4Q9JA 5CITA 3AP1A 2X1VA 3GPLA 2AXPA 2JLWA 1P9NA 1WRBA 1L2TA 1XTSA 1YR6A 2ZSEA 2DYKA 3HU2A 2QT0A 5DYIA 1D9XA 3SFZA 3RSOA 4HUTA 3K0CC 4LRWA 2ORIA 1DADA 4IOJA 1E2IA 4M21A 2QBYA 4C7OA 3GEEA 3X1DA 1L4YA 4MGKR 2IS2A 3K09C 2ERYA 1KHTA 2FH5B 1GKYA 1XDBA 5KUTA 4TYQA 1Q3TA 4TL9A 2XAUA 4BZPA 5KNCA 1IONA 4D2IA 1XCMA 4B2LA 2PEYA 1XXHA 1R4AA 1G18A 2CL7X 4HZIA 2QTFA 2WWXA 4BASA 3I32A 5CM9C 4H9GA 4TMXA 3Q3JB 4BGDA 1GILA 1JXOA 2W0MA 1ZNXA 2GEVA 5DHAA 3RS5A 1ZM2A 3AUXA 3LWNA 1KI2A 1S3GA 2EFHB 1QG4A 5C4GB 1N6HA 1T91A 1AS0A 2H16A 5JS7A 1T3SA 1M1YE 4NTZA 1L8QA 1TPZA 1ZIPA 3F3YA 2QMUA 4C3ZA 4DLRA 1N5KA 1P2SA 2VSOA 3DVLA 1M8PA 1ESMA 2J87A 3ZDQA 3VTKA 4DLVA 3CX7A 1KO1A 4C0HA 4FMDB 2HUPA 4RZ3A 1ZNZA 4KJZA 2P6UA 2VP0A 4DWJA 3KUDA 1NIJA 4LHZA 2AFIE 1TF2A 1XX6A 1GVNB 2WIBA 2GK6A 3K0FA 4TMVA 2VF8A 1G8YA 2IYVA 5GJBA 2EFCB 4JMPA 3GEHA 2RMKA 4M0LA 1PLLA 1Q12A 3PITA 1RRPA 2O8CB 1WE2A 5DNYB 4CZ2A 1E2FA 4DRZA 1Q57A 3KB2A 1Z0JA 4FCTA 4PAMA 4EUNA 3SR0A 3K9HA 1ETUA 1G8FA 1P61B 1RRCA 1MOZA 2A5DA 4NYJQ 4BE7B 3AF0A 3FDIA 4Q4LA 4ASUD 1U0HC 3MD0A 4RFSA 2EYUA 3IIMA 3A36A 2D2FA 5DHFA 2DWPA 5FOWA 3T35A 5HZHA 2IX3A 5KNDA 3B1VA 3CH5A 2FGJA 3LLUA 3H4MA 5FOUA 2V1XA 2OAP1 1ZRHA 5TV2A 3R7WB 2IA5A 4TYWA 3LXRA 5TB5A 4F4CA 1EWQA 3QBTA 5FPHA 3K9GA 1E0JA 4HEJA 4BFUA 1DS6A 1GIAA 3SJBA 2QT1A 1DAMA 1UKEA 4IDNA 3W6NA 1JR6A 1Q44A 1YHNA 5EE5B 3T1QA 2BMFA 4V02A 4C0QC 2AXNA 1I4DD 3OEED 2V54A 2ZAOA 4KFRA 5JI3E 3KTAB 3RDPA 2R6AA 3QF4A 2OBMA 4Q1BA 2EFDB 4C2TA 1E99A 2JLQA 3D3QA 4LGMA 4AKHA 2XJ4A 2MSEB 1P3JA 1OW3B 2DFTA 3HR8A 4M9ZA 5GJWC 3TSOA 2VP6A 2YKGA 4B3GA 3Q72A 5DI3B 2GF9A 1ZCBA 1K8RA 2WM9B 2I3BA 2QL6A 1SZPA 4FMDF 4JJKA 4GFDA 3PUZA 2D74A 3SE0A 4Q00A 1KSFX 2FPMA 2RKOA 2G1KA 3RAPR 4IOMA 2G0TA 4JL5A 1XNJA 2GRJA 3VR5A 4GI7A 4LCBA 4OHYA 1AIPA 2XTZA 4LYAA 1HV8A 3W5IA 1LF0A 3TVTA 3ZS8A 2IUUA 2OSBA 1OH6A 1OB5A 4DDVA 1E2HA 3GJ3A 2XITA 2ZYUX 3IQXA 3ECCA 4AI6A 3RSLA 1E6CA 3H1TA 2HEIA 1W7AA 1NJGA 1U90A 4E07A 1NN1A 1OLOA 3MJHA 2V6IA 3VU9B 3OFNA 3RC8A 1GRNA 2W0SA 2WICA 4B44A 4D81A 2HF8A 4P32A 2VEDA 4TQ9A 2WJHA 2RGNC 1N5JA 3VX4A 2IWHA 3Q5DA 4LHYA 3FHCB 4LHXA 4OHXA 5CDFE 1CP2A 2GAOA 2KBFA 2PX0A 4L16A 2O0KA 1IN4A 1R5BA 4C7OB 3DEFA 3GLFE 2R44A 3IHLA 3U3KA 3FMIA 4GBMA 4D80A 3TKLA 3K0SA 3O8RA 3C4JA 1TQ4A 1Q1ZA 1J8MF 4OK3A 4IOKA 1OFUX 1Z6AA 3MGCA 1XXHB 3MSXA 4QBIA 3SYKA 3GLFA 1LS6A 4L15A 5FOXA 1Z07A 3EXAA 3EPKA 3A4LA 3LVRE 3CH4B 1F3OA 1KK0A 1Q1EA 2CHVA 5FBWB 1N3BA 2AKYA 1W4BA 2ZI5A 2Z5FA 3KQHA 3DMNA 1LVGA 2JGNA 5J4LA 5TARA 3WXMA 1OHHA 3QPWA 4I1SA 1G21E 2CE2X 3W90A 2NO9A 2ATXA 2W2TA 4PSAA 4B33A 1JEDA 3IHWA 4Q1FA 1Z6XA 2DR3A 1G64A 5JECA 5JCPA 4YXWD 2IUSA 3RS3A 4UNRA 3U60B 3RC3A 1C9KA 3N5CA 4B3FX 2ONJA 1TMKA 3L0OA 2IS6A 4D82A 2FSHA 2UVQA 1Z0AA 1JNYA 3NWJA 5JSZA 1L4UA 1Z2AA 1P72A 1U0LA 2VP2A 3CZQA 1J8YF 4PHTA 4V0OA 2GETA 1TX4B 5IHPA 2PJZA 2C2HA 3A4MA 5BN3A 3L0SA 5FPKA 3WP0A 3Q7PA 1Z29A 3L0IB 4B3BA 2WSSD 2A5JA 5HE8A 2XX3A 1G8GA 3UWOA 1KOFA 4I1OA 2GK7A 1G20E 2J1LA 1IN8A 1QHNA 3M6AA 4YONB 1VMAA 4RFSB 2IBMA 1XEWY 3JVVA 4US0R 2Q9AA 4QNRA 4ERNA 1RRGA 1E0AA 3VX3A 2DCUA 3LVQE 4FCVA 3IPYA 4BWYA 4ASUA 3LDAA 1IJEA 2I1QA 1NIPA 2YV5A 4C0LA 1LF5A 4P0TA 3CKLA 4UXJA 3A1VA 4V03A 3BORA 3B1XA 1LW7A 3OIVA 1S96A 4LJ7A 1FP6A 1NLYA 2IYXA 2WPDD 2WSMA 5D3MA 4URVR 4GP6A 1OKKD 4ACAA 1XMIA 4B43A 1COWA 3EWAA 3U4QA 2REOA 2ZJZA 5L3QB 1GG2A 1EFHA 1Z6GA 4N1AA 1S9DA 3BRWD 1GNPA 4PR0A 2AR7A 2GVZC 3QF4B 1BH2A 1H8EA 1KMQA 4GRAA 3W3AA 4UXHA 4GNKA 1E2NA 3I1FA 2ZJAA 4IKEA 3QXJA 3G82C 4OL0A 4BFTA 1KNXA 1LNZA 2JJ2A 2JIZA 2ZRHA 1KIMA 4XH9B 4J0QA 2ZRKA 4L5BA 4GOJA 3JZAA 4PZLA 4V0MA 1DELA 2VQSA 2WMNB 2ZI4A 1EX7A 2Q3HA 2FZ4A 5B30A 2O0JA 4QC2A 1ZJ6A 3AVUA 1XPRA 1YZGA 3IIKA 1T3LA 2QGNA 3KJHA 1P75A 1GRRA 4C0KA 4NP6A 4HLCA 4Q7MB 4YMTA 1SVOA 1KYIA 1KK2A 1U99A 3BIFA 4XWOA 2HYIC 3RWMB 3X2SA 4ZV4A 1N6PA 3FWYA 1ZC4A 4EPYA 1CJVC 2F3RA 2G9NA 2R6DA 2DBYA 1N6KA 3LW8A 4FWTA 3CM0A 1AQYA 5IK2D 1W2GA 1SXJC 1AN0A 5FTNA 3F5FA 3U7HB 1CR4A 4ZPXA 2W6JD 2ODBA 2YYZA 2ZJ2A 4TLCA 2D7DA 3LNCA 4L8GA 1ZINA 4ZCLA 5C46F 1DOAA 3K0CA 5KDLA 1ODFA 1ANKA 2G1JA 3WNCA 4DXAA 1NY5A 4BLTA 2BKEA 1FX0B 4I81A 1Z0DA 3IGFA 2G88A 1Z0IA 1UPTA 3K09A 1O3YA 1US8A 1XJCA 2CNWD 2C04A 4ZDKA 5IRCD 5C1BA 4B73A 3U7GA 4BZQA 3O8CA 3RS4A 4AYXA 3ICQB 2ZU6A 4PC6A 1ELOA 1W47A 5GVRA 1U94A 2QE7D 5KPDA 3PEVA 4EFMA 2ODNA 3ZQJA 2HJVA 3BH6A 2XZOA 4JBWA 2B8TA 2YVUA 3BH7A 1ZM4A 3GLFB 4MYUA 4A8JC 2AKAB 2EQBA 4Q1DA 1ZW6A 3K53A 2KSQA 3CRVA 4TSFA 3WMFA 5DYGA 1Z0FA 2HLDD 2GVDC 5CYPA 5EXXA 3MFYA 1VECA 1ZAKA 4K81B 3BB1A 3WYGA 1A2BA 3PQCA 1OXVA 1XEFA 1DE0A 5DI9A 4UKDA 3F8TA 2J0VA 4WAUA 4P3YA 4HUQA 1GKIA 2D06A 4F91B 3OIWA 1WBBA 3DM5A 2LWIA 3U7EB 4D4MA 3CR8A 4PQYA 3FGNA 1JB1A 1G3MA 1OFHA 3TAUA 5F98A 2YWGA 5EXPA 1CRPA 4LUCA 2RHMA 1II8A 2J45A 1KZGB 1F2UA 2QAGB 3TGPA 4JT4A 1A5TA 2V7QD 3WHKA 4GMXA 2ZJBA 3QQ5A 3MCAA 5J4KA 3LD9A 4PPQA 3TNFA 3TQCA 5JSZB 4P4SA 3CF6R 2ZYVX 3LH5A 3THWB 1FNNA 3LV8A 3MAAC 2BCJQ 4TYPA 1VHLA 2FJUA 4B76A 4EFLA 5KHOC 1TQ6A 4URWR 1AGRA 1LS1A 3A58B 2QP3A 3AVOA 4YDHB 1E3MA 3GJ7A 3B1YA 1W0KA 1SVSA 3FYHA 5J4YA 5E95A 1P2TA 2GJ8A 2FX3A 1VYUA 2IXEA 4G5RA 2CHGA 4LI0A 1E9RA 1OF1A 3E2IA 5AJWA 4ARZA 3AUYA 4RD1A 5D3MB 4Q1CA 2IHYA 2GWHA 1ZNYA 3HU3A 3L2OB 4TMZA 4F4JA 3U4QB 1Z8FA 4WXPA 4S35A 3TUZC 1X86B 1DAGA 4NCKA 3TSWA 1XTRA 3HYTA 1U8AA 4KU4A 4QBHA 1LFDB 1EFUA 1KY2A 1XMJA 4DSTA 2YOFA 5AUQA 2QM7A 1R0WA 3QVUA 2HDNB 2OG2A 5FTMA 4B3XA 3FKQA 5CB8A 2ZE8A 1NLZA 4MA4A 1KO7A 4AKEA 3K9LA 4TT3D 1GSIA 3TVDA 5CB6A 1YU9A 2H1LA 2R65A 2XNSA 3U2QA 3EZ2A 2ZI9A 1NVUQ 4XD7D 1W4AA 1JAHA 2QG6A 1XRJA 4DZZA 4YLGA 4MUBA 3EC1A 3WRYC 4C0BA 1FPMA 4Q9LA 2QAJA 1IY0A 2XNDD 3SZRA 3K0AB 1MRNA 2LKDA 5B57C 3QXSA 5JCZA 1YR8A 3JZMA 1AZSC 2FFHA 1SXJD 3SFVA 2Z83A 3EG5A 4HLUC 4A6PA 1AS2A 4U02A 3CO5A 1Z83A 2CHQA 4TLAA 2FZLA 5FPYA 2V3CC 1JXMA 2OILA 4EPTA 2RGNA 3DZ8A 1RVDA 4JLAA 1RRFA 2G0NA 5E7JA 1KGDA 1H8HA 4W5JA 3ADBA 4IJMA 2HT1A 3GEIA 4QFMA 2W6JA 1NI3A 1TADA 3VR6A 3S1AA 2D62A 1OSNA 5C18A 1T3HA 2FFBA 3QKRB 1QVAA 3ZZ0A 5BN4A 4Q4AA 3KDSE 4OJQA 2EW1A 2CJWA 3IO5A 1TL7C 1W48A 4NCHA 1II9A 3W34A 5GVSA 3U61B 1P6XA 2GJAA 2QEQA 2IK8A 2P2LA 1P2VA 3NKVA 2EYQA 4YMSA 4KYUA 2ZI7A 4ZDJA 4XWKA 3TE6A 4L9SA 4YQFA 3RVBA 3VAAA 4JBYA 3O8BA 3AF1A 4BFZA 4B2PA 1VHTA 4MKFA 2OFWA 2GJSA 1NG9A 2NTYC 2P5TB 1PVOA 1JBKA 1QHYA 4JLBA 2HCJB 3R20A 4D0NA 1G7SA 4G5GA 4D25A 3UWKA 1EFCA 4LDJA 4HUQB 4HB4A 2BCGY 3CLVA 3RANA 3SYLA 3GFTA 4PC7A 3H86A 1Z22A 4U5XA 5SZIA 3CB4A 2ZS7A 5FR1A 2QY9A 1WXQA 3T1TA 3AF3A 5GJVC 2D7CA 2A30A 4OK5A 2DFLA 4D0GA 3VKWA 2JLZA 3WMEA 1YJ5A 4Z1MD 2K5UA 4M1KA 3N2IA 1VCNA 2CDNA 2RH5A 2V7QA 5TVKA 4M4SA 3N70A 2IXFA 1SULA 3FFBA 4DBLC 2FG5A 4X8OA 1G291 2GJKA 4Z8YA 3KQUA 2WAXA 2XGJA 2QMEA 1VIAA 3KJEA 1WF3A 3LAWA 3LW7A 1YE8A 1Z08A 2Z6VA 1KDRA 2ZSFA 3VHXA 4EPXA 4G5SA 2Q9CA 4QOSA 1UDWA 1OE0A 1M34E 5JS8A 1MO6A 3CNOA 1KAGA 3KKMA 1N6OA 3T5DA 1YZKA 1YZQA 2WOOA 4CEHA 2I1VB 3QEOA 2VP9A 4LV5B 5EE9A 4BFVA 2YWEA 2NPFA 4M9QA 3RHFA 2E87A 5EE3A 4AK9A 3SQWA 2QTVB 4KITB 2OFXA 2QQEA 5KDOA 3M4YA 3T61A 4PC3A 5FPSA 4RKFA 4AYTA 2QSYA 3R8FA 5DN6D 2PMKA 3QXHA 2ZRIA 4NYMQ 4A2WA 4XVUA 2BHRA 2A3RA 4BECA 1W1WA 4DDTA 1NKTA 1WP9A 2PCJA 1J7KA 1E79A 4XSGA 5KSYA 2NO0A 421PA 3GLHE 4DIDA 2ZTSA 3UPUA 4Y0AA 4JSTA 4DUGD 1D6JA 3BB3A 2B21A 1HYQA 3B9PA 2ANBA 2O8EA 3BERA 3B78A 2ZRAA 4ITRC 4QRHA 1SKQA 2FEMA 4ESHA 2ZRJA 4CW7A 4IDQA 4BFXA 4JVNA 1E1RA 4OHZA 4B6EA 3OAAA 3WMGA 3GLHA 2IYUA 1NBME 2CLCX 1HUQA 2IHBA 4KLZA 2QP9X 3W6PA 4PTLA 1KO5A 1Z47A 3ZLJA 4JVLA 1M7HA 2ZE5A 3P20A 4GOXA 5EP1A 4X8LA 4HB2A 1OXSC 4D4JA 3QI2A 1W36B 1VCOA 1R8QA 3SJAA 3K0EA 4RJLA 1NBMA 3ADDA 4B2IA 3PUVA 1XB2A 3QSYA 3KFXA 4UNNA 4LBYA 1CJMA 2B8WA 4QHTA 1WA5A 4HAZA 4FINA 1KI1A 4TTRA 5FOVA 2QI9C 4WVFA 2FPLA 2ZRLA 4A92A 1NSFA 2ATVA 2FNAA 4OQMA 3S1AB 3DZDA 2JDID 2QA5A 3TJZA 2UKDA 4LSGA 3A6PC 2GZDA 4BFYA 2X8AA 1R0ZA 1X1RA 1Z6TA 1ZBDA 4M8NE 1U0JA 4NDZA 2OCPA 4RD6A 2IYSA 2Q9BA 1XD9A 3DL0A 1O87A 3NTUA 4FMBB 3LX8A 5CYOA 3ETLA 3H2YA 1YZTA 3MLEA 4ESVA 4BQSA 4DB2A 1OYYA 1CIPA 1BO6A 4HLQB 4A8JA 1KO8A 2VIIA 2ZR7A 3QENA 4XVRA 3CPEA 4BPBA 4NCJA 1T0JB 3B13B 3FMOB 4F38A 4G5OA 4B74A 3A37A 3BGWA 1XPUA 2QRZA 3CONA 3MMPA 2FU5C 4B47A 1IN6A 2R6FA 2FE4A 3QKSA 3T5GA 4DSNA 1U9IC 1G3QA 2Z43A 3THYA 1RYFA 4QJ4A 2P3SA 3RRZA 4Q7JB 1AM4D 1S3SA 4N0EA 2ZQ5A 3WNBA 2ORVA 5KYKA 1MKYA 2ZS9A 1NF3A 3VNUA 4JT2A 1ZD9A 4QGFA 1RIFA 2F7SA 1W2HA 2UZ3A 1PJRA 1I4LD 2A5FA 3C8UA 3GJ8A 1TNDA 4NBSA 4GL2A 1CR2A 1W4CA 4Z1MA 2ASEA 4JYCA 1M74A 5AWFC 5FL7D 3V9PA 5FBVB 4OQNA 4GDFA 4Q03A 4WW0A 1BYIA 3KL4A 1DVRA 5SZJA 5JBQA 5KU1A 4M1SA 3FOZA 4R2IA 3UATA 4Z54A 2GNOA 2GDJA 2YJTD 5EZ6B 1FUKA 2WVJA 4KSCA 1EFRD 1JR3D 1E1QA 1OFTA 1N6NA 3F0TA 4MKIA 4TMWA 2RHDA 4IHQA 1I2MA 4KBGA 1QVRA 4PHHA 2JLXA 2IT1A 5LD2C 2DWOA 2I4IA 3EZ9A 1Q22A 2OLJA 1HURA 3P1JA 5JWHA 4RVCA 3T15A 1C4OA 3PV0A 2ZREA 4R71A 3SJZA 4EJSC 4DSUA 2QPOA 3LXXA 3DDCA 3CRRA 3NVAA 4LV8B 3HWSA 4CYMA 4G0NA 1A1VA 4DCNA 1GP2A 5JWOA 2OCAA 2R6GA 4HDOB 4TQUS 1RPZA 3FE2A 1GOTA 1U8YA 3AKYA 3RS7A 1E9EA 3B1ZA 3NDBB 1GM5A 2NMVA 3ZQ6A 1R10A 3L43A 3MWKA 4DDUA 1HT2E 1LY1A 1IAQA 3EC2A 1HE8B 2WWFA 5E7IA 2YWHA 721PA 1NMYA 2A2ZA 2OUKA 2A78A 1KMHA 2XOKA 1TF5A 1IN7A 2YWFA 3EX7C 3CPJB 5EP4A 4Q1AA 2IYZA 3AKCA 3D31A 1ESNA 3QJYA 5HR5A 2EFEB 2O8EB 2O5VA 1IM2A 1ZIOA 3R9XA 3ZVNA 4JLKA 4R2HA 2Q3FA 4LOAA 1IQPA 1T0HB 6Q21A 3FFAA 2QU8A 1KI6A 3I61A 2QBYB 3PIRA 1YR7A 3WHLA 2O8BA 1YZLA 1DO0A 1XTQA 3AGQA 1KSGA 3UMRA 1NP6A 4N3NA 3IKJA 4DEXA 2DWQA 1OIVA 2V1UA 1X8LA 1KAOA 5CDFA 1R7RA 1VG0B 3VKHA 2QSZA 3VQTA 1Q20A 3NC1C 3U3MA 1SVKA 4MRVA 1SHKA 2ERXA 4JL6A 1KI9A 2RGGA 2CK3D 4PFSA 4DT1A 1TU4A 2GESA 3TBKA 3TQFA 4RZ2A 2JLYA 4C0AC 2ZAMA 2WV9A 4MKGA 3P4XA 3U3RA 3SBDA 5KOYA 3WY9A 1D8TA 5EE1A 3UG6A 2BJWA 3OEHD 4F92B 3EIHA 4V0LA 3ZIAD 2IYTA 1MO4A 5KSOA 3B5JA 3BFXA 2OBNA 3BJIC 3DKVA 2F3TA 5G40A 3EZ7A 3SOPA 5DSZA 2ZITA 2IYQA 3OHMA 3NEYA 4LJ6A 2FF7A 1E2MA 5K8LA 1SKYE 1RJ9A 1VKJA 5FUYA 2BC9A 2VP5A 3K0FB 3C15C 5AR1A 1QBKC 2OT3B 4GSYA 1XMSA 3WNDA 3KB1A 4Q9KA 1CJUC 4NYIR 4HB0A 2RGDA 3ZVMA 1F2TA 3UMFA 4ZO4A 3QKSB 4EPRA 2GKSA 1WBDA 1F6BA 2FWRA 3AVQA 3AVTA 2MSDB 3FMFA 5C4MA 1OXUA 2FDCA 4URZR 2FGKA 1JPJA 4TL6A 4MYTA 3RWOA 1E2GA 3GJ6A 4DLYA 5EP3A 5B64A 4M1MA 2HT6A 3GLGE 4O25A 4NU0A 3RABA 3SJCA 3V4RA 5JRZA 3CUEF 5C2JB 4CEJA 1NVVQ 5AUOB 3QBVA 4LHVA 2IYWA 4F4IA 4US2R 4QJ3A 1UFQA 1R5NA 2GXQA 1RKBA 4OI2A 4QHSA 4KSBA 2XSZD 1JPNA 5F9HA 3BE4A 2ZVQX 1JR3E 4HDQB 2H7VA 4G01B 3GLGA 4DB4A 2ZE6A 2C98A 1XU4A 2BDTA 2IS4A 5FL7A 4PANA 4DLTA 3GLIE 1ZD1A 4JYBA 3MG9A 2C9OA 4KV9A 1DG1G 4P31A 4CDGA 4KFUA 3AP3A 1E9BA 4JLPA 2QRNA 5E3HA 1G4AE 2NZ8A 2XEXA 2R9VA 3OEEA 1ZCAA 2WIAA 1A7JA 4MYCA 4A0GA 5L3VA 4TTQA 3NEJA 5F3WB 1NY6A 4RKEA 5K8UA 3K70B 1TEXA 2REXB 3GLIA 1IXRC 3NH6A 2CLDX 3KX2A 3O47A 3U5ZB 4Q01A 2OM2A 2F1JA 3D8BA 2RAPA 3THXA 1S0UA 4BLRA 3FKSD 3VR2A 2ZI3A 2BBTA 1VG8A 1W5TA 1AQUA 1VPLA 4XJXA 5DE3A 3SDZA 1VYVA 4LV6A 4PPFA 3X1WA 3EAQA 1G8PA 3SEAA 4E5UA 4TYYA 3W5JA 3K8YA 2P65A 2WJVA 2ZR0A 3RS2A 4AYWA 4LY6A 1KMHB 2H5EA 1Z06A 2G83A 1WQ1R 1SGWA 2OXCA 3R9WA 4HDCA 2R62A 4XOIA 1GRQA 5A5GA 5AUPB 1ZM7A 3DM9B 1UAAA 1EWRA 4ZIRA 2OFOA 1HE1C 1KDOA 1KKLA 1OFIA 1VIYA 2O52A 4HAVA 1DG3A 4L4UA 5IDVA 1Z0KA 1NN5A 5CIWA 1CS4C 2X77A 2J9RA 3BFVA 3EWSA 3KFVA 2C9CA 2HCBA 3C5CA 3X1YA 1IXSB 1KI6B 1T8UA 1VCMA 2BMDA 4HZUA 4NHOA 1RC8A 2O8BB 5D3QA 2ZROA 2J7PD 2B92A 2YC2C 3AH8A 1XEXA 2J5XA 3TH5A 1TU3A 4LJAA 2RB4A 3KUCA 4D6PA 3G0HA 4R7ZA 4IFBA 5B2ZA 3RRNA 1AGPA 2Z4RA 3L8ZA 3P27A 4HLDA 3NBXX 4KFSA 2PMDA 4NH0A 3ZH9B 3BFKA 3OESA 1PZNA 4JJZA 2ZRGA 5KSPA 3SI7A 3CRMA 3ZJYA 2PL3A 1E2EA 1YQTA 1KNQA 3X1ZA 4Q4HA 3THOA 4RY2A 4Q7LA 1PLJA 1Z2CA 1E2QA 2BV3A 3EZFA 1GL9B 1RW4A 3VMFA 4EPWA 3QPVA 1E9SA 2AWOA 3SN6A 2XTNA 4M1YA 1NN3A 1ZUHA 5G3YA 1P73A 5JJIA 4BLSA 4KODA 4L9WA 2LCFA 5AJVB 3AVWA 2VHJA 4QNMA 2FA9A 4QM7A 2JJ1D 1M2OB 4YXWA 2C95A 2GXUA 4FN5A 1TUEA 2J7KA 4MH0R 4MITA 5IT5A 4M22A 3BOSA 2Q3MA 4B35A 1KK3A 1UKZA 1YKSA 1CTQA 4KVAA 3BD9A 4URYR 4QBFA 1XF9A 4O2LA 3BH0A 4NCNA 3NXSA 5CJ2A 4B75A 2VHQA 3WBJA 4PAOA 2R8RA 3NC0C 3EIEA 1OXTA 4O3MA 2C9YA 2WSSA 4LBZA 2ONKA 4WIAA 5JHGB 4UJ5A 1Y63A 3UIEA 1SVWA 3EPJA 4MGIR 1W0JD 5FI1B 4A6XA 1UDXA 3X1XA 821PA 1GAJA 1TUIA 2IF2A 3DOFA 3SBEA 2P6NA 3AVXA 2FSGA 5LB4A 4CT4B 1BOFA 4H1UA 1N0WA 1MH1A 2QMHA 4EIWA 1FFHA 2EU8A 5KPJA 2BIFA 1D5CA 1X6VA 2QP4A 2H18A 4PQFA 2ZR9A 2WPDA 4V0KA 3AF4A 1WCV1 1OKKA 1CJTC 4JL8A 221PA 3OE7D 5CM8B 2A7QA 3OF5A 4GZLA 1E4VA 2YINC 2P0EA 1RE0A 3H0KA 2CE7A 4XWAA 2WWHA 3AVYA 4EJSA 4IXMA 3QXXA 5LDDC 2J0QA 5HCNA 3UG7A 1UEIA 1YZUA 2PBRA 3IPXA 2ZRBA 3I72A 4QL3A 3THXB 3LX5A 4HAYA 3TMKA 2N46A 3QNUA 2EWWA 4IEEA 4MRSA 1A2KC 2R2AA 2W83A 2JJ8A 5FTJA 1R0YA 5DISB 2WKQA 3BBPA 5JEEA 1FMJA 1E9FA 5G53C 4V0NA 3GQBA 2ZYTX 2ZRCA 2O8FA 3KKPA 1E2DA 3IEUA 3BWDD 5B58C 2D2EA 1CKEA 1R8SA 5E4FA 8OHMA 4U7DA 2ZSAA 1E0SA 1RZ3A 4A2PA 2OV2A 2A9KA 2VTKA 1E0KA 1ZUIA 2OXRA 3GFOA 4FCWA 3AKEA 1OV4A 4DEYA 3K9NA 4NYJR 4X8MA 3B8HA 5CK4A 1ZM9A 4DIEA 4NPHA 5L8VA 4DCSA 5IK2A 2GZHA 2WWGA 1S1CA 3NG1A 4KFTA 2GA8A 1C1YA 1KI4A 4JIMA 4YDSA 3P26A 3LA6A 2REBA 2C03A 3KQLA 3LBHA 3T06B 4HZUB 4ZCIA 5KNBA 4JLNA 1H65A 3CNLA 1US8B 2XZPA 4JLDA 2W2XA 4XIGS 5LPNA 4XSHA 2RGXA 1DBSA 3A8TA 3ADCA 1DEKA 2GILA 2GZAA 3LRPA 4WXRA 4D4LA 2Z0MA 1D2NA 2CNWA 5J5CA 1T5IA 1DAIA 3IBYA 4PPGA 4A15A 4RD2A 4HB3A 1XD2A 4DLXA 2QE7A 4DDWA 3VR4A 1G7RA 1E94E 1XCPA 3CF0A 4LBVA 1KJZA 4OHVA 4TLDA 2J3EA 1A4RA 2IS1A 4C9BA 3M0EA 4PHGA 4QGHA 1S1MA 2IL1A 1KI7A 4LPKA 4A9AA 1VTKA 4AWXA 3W6OA 2XTMA 1NSTA 3ND9A 2HLDA 5FTLA 2AD1A 2VP4A 1NVXQ 4KYIB 1FOEB 2O8DA 1CJKC 4MRNA 2NPIA 2IC5A 4NKRA 3SYNA 2AHOA 2AX4A 5DGXA 1M7BA 4YMVA 5FR2A 2VL7A 2BBOA 3TUIC 2PH1A 2FPKA 5JMTA 2V4ZA 1T6NA 2CVHA 1CR1A 5H8WA 4EQ6A 2QAGC 2IUTA 3UKDA 4BZXA 2RGEA 4PAQA 5FH9A 1II8B 2HXSA 621PA 1F2UB 5HKKD 4R98A 2ZANA 1A82A 1Z28A 1F48A 4PC2A 2VA8A 4KI0A 3CX8A 4HYYA 3MJRA 5UKDA 4IOLA 4P4SB 1KI8A 5EP2A 5TY0A 2WAYA 4I99A 4K8OA 4O2RA 3D6TB 3AVPA 1ZP6A 5FBRB 2EFGA 3TAHA 1J2JA 1EXMA 4WZ6A 3VR1A 5FOTA 5JWRA 3C16C 4AY2A 4AG5A 5J47A 3A1TA 2QORA 3GJXC 2WJGA 4D4KA 1CXZA 5CIQA 4PQRA 2OEPA 2QNRA 4ZDIA 1ONBA 1NKSA 3I73A 3PEUA 4GOKA 1G41A 3CX6A 4NCIA 4BLPA 5IF9A 5KO2A 4N0DA 3T1OA 1KO4A 1NRJB 2W00A 2YOGA 4DSOA 2D4HA 2F55A 1ZYUA 3PEWA 1VCIA 4OYHA 3WP1B 5ELXA 3B60A 2KBEA 4Q48A 4ARZB 3LQRA 2H92A 4POAA 1G5PA 3HU1A 5EZ5A 1G8HA 2PEZA 1UBFA 1SVLA 2OLKA 3UANA 1R2QA 3W8NA 3PJRA 3TRFA 4IVRA 2FV8A 3SU8A 5GADl 4Q18A 1YR9A 2IW3A 5DH9A 4B3CA 1KI3A 4A4DA 4JZKA 5SZHB 1GZSA 3CRW1 2EVWX 1UEJA 1MT0A 1ZU4A 1GKUB 1NL3A 4PHFA 4ZCMA 3IBGA 2GBLC 3L82B 4NL4H 3OIUA 1DARA 4LPSA 3I5YA 1P62B 3A4NA 1OYWA 5EE0A 2DPXA 2CXXA 4QBGB 2F9MA 5EQTA 5EJEA 2JLUA 4TT3A 5FOSA 2C77A 4X8HA 5BYKA 4DCUA 1TEVA 4XD7A 5M04A 4F93B 1QHSA 1OT3A 3A1UA 4IFEA 5H1YA 5JHHB 4WOPA 2NO1A 2JAQA 1SXJE 1P60A 2XNDA 4Z51A 3OFND 2O8FB 3NDPA 2HXYA 2GEDA 2OZEA 2ZIAA 1XJ0A 2ZSBA 3VU9A 1BMFD 1E2JA 2VHUA 4TL7A 1N6LA 3JVUA 4UNPA 4PZZA 2G77B 1SXJA 1EG7A 2PLFA 3O8DA 4GT1A 3R8CA 2AFHE 4RD4A 1II0A 4NZYA 4FWIB 4OKSA 1XXHE 3WRXC 3T1VA 1CULC 1OB2A 3CW2A 3VNVA 1IBRA 1JJVA 3KQKA 1UBEA 5A0FA 5AJZA 1KDPA 2DFNA 4Q4AB 1NVVR 3REFA 2CJWB 3HPQA 2F1RA 1IY2A 2W6ID 1N6RA 2CMKA 3AB3A 3Q8XB 5FBLB 2H57A 5HE9A 4Q4JA 4HATA 1X8KA 1RFLA 5AJXA 3BS4A 4B71A 1N25A 2VF7A 3I8XA 4DJTA 1XD2B 3L8YA 2ZEJA 3PUYA 4CGZA 4TL8A 1OHHD 4A1FA 4BUJA 4KBFA 1MV5A 2OHFA 3V4FA 2NOAA 1T8TA 1HY3A 1DAHA 2BJVA 1XP8A 4QJ5A 1CRQA 1QF9A 4M1TA 1KSHA 1EX6A 1Q1QA 4KAXA 4A2QA 3TIFA 2RGBA 4YMUA 4OI1A 5KTYA 3N2EA 4IEIA 3RLFA 2O8DB 3H84A 2R6CA 2J59A 1JAIA 3CR7A 1GNQA 1KK1A 2J41A 3E70C 1YRAA 4LHWA 3LY5A 4WZBE 4UXIA 1UM8A 3FVQA 4EQ6B 1QHHA 5KDDA 3NBYC 1CLUA 1U98A 1XTIA 3SHWA 5A4JA 4NONA 1FTNA 1G1MA 2WOJA 3IUYA 2JLVA 1BYUA 2PZEA 3EIQA 4CIDA 2ZRDA 5SZKB 121PA 3LBIA 4Q1EA 5HKKA 2IYLD 1XTKA 3QVVA 2E9SA 3QOFA 1W46A 3HP1A 1T9HA 1QHIA 3Q5EA 5HZKA 2OCYC 2WWWA 3QG1A 3U44A 4CEIA 4B48A 3GJ5A 5J40A 3NHBA 1E32A 3GJ4A 3ZVLA 4ZI3A 3CZPA 4JLVA 2MMGA 2NO7A 5JJLA 4MRRA 3T34A 2DY1A 5F9FA 2C99A 5JFGA 2NGRA 2BEJA 4LJ9A 1COWD 3AP2A 3C5HA 4FXPA 1VYTA 4UNQA 1OIWA 1QRAA 1BS1A 3WYFA 3NIBA 4KO8A 3QEJA 5L3SA 4CEHB 1OPXA 4H1VA 1NLFA 3C14C 4AG6A 4D26A 5L3QA 4KHZA 1H8ED 2PX3A 2ZU0C 1DTSA 1UADA 2QZ4A 1HQYE 4PSVA 3HR7A 3PENA 4A0HA 2VH5R 4MUAA 2HYDA 3OIYA 1N2CE 4YMWA 2JJ2D 2JIZD 3KJIA 5FUXA 4ILEA 4LBWA 2KB0A 4OK6A 2AD5A 5DN6A 2PLRA 2ZRPA 2DHRA 2ODWA 2ZPTX 3TUJC 4US1R 1XZPA 4LJ4A 1N6IA 3I4LA 4PO8A 4ABYA 1B23P 1UBGA 2ZRFA 1W5SA 2V8OA 3LQQA 2QGZA 4XTRA 1P5ZB 3PXGA 3B7GA 1XPOA 5FI0B 4URXR 4DKXA 2ZUBA 2IXGA 3U6BA 5CLLA 2F43A 4MQBA 5G3ZA 3ND8A 4DUGA 4EAQA 4DLZA 1QZXA 1OH5A 1FNMA 1JECA 2WJIA 5K8IA 3AGPA 4GP7A 1KTVA 2CVFA 1E2LA 3PFIA 3GLHB 4JKYA 4KCGA 1K5GA 2RGAA 3U7FB 4RD3A 4FMCB 4R9UC 1D2MA 2DB3A 3HPRA 3EA5A 1W36C 3CIOA 2IEYA 1NJFA 2FN4A 2ZETA 1N5LA 2FFAA 1G6OA 2P67A 2YOHA 2ZJOA 4HLUA 3REGA 2VHCA 3QKUA 4IVQA 3PR1A 1HT1E 4FI3C 1HA3A 1G6HA 1S4QA 3AVVA 1IHUA 5CJPA 1SXJB 4CF7A 2WMOB 1BMFA 3QIAA 4UJ3A 1X8JA 1GTVA 5AJYA 2L0XA 5FL3A 1I4TD 3SS8A 5KSZA 1OIXA 2AL7A 4GPTA 1ZM3A 1FX0A 4JLMA 1LTQA 4ZKDA 5JJKA 1P7CA 2GEUA 2VSXA 4QG7A 4ZI2A 1NMXA 4HSEA 4OI4A 4DCTA 1G17A 1UF9A 5H70A 4M53A 1QHGA 4PSKA 2JDIA 4RCYA 2QPAA 4BLOA 3TSZA 3MWJA 1GDDA 4TSFD 1SVIA 1OJLA 4B32A 4PO1A 2W6IA 4QGAA 4Q4JB 2ZE7A 1W4RA 3ADKA 1X1SA 4A8JB 2JEOA 3ZD6A 2XXAA 2NZJA 1UKYA 4ON9A 2UZIR 4TN1A 4O0MA 1P9RA 3UXMA 3U3OA 1AA9A 4MDFA 4HI0E 3IQWA 2W58A 2BM0A 1N0UA 3VKGA 2GXAA 3GMTA 2F1HA 2LKCA 4W5HA 4DLWA 5JI2E 3I3SR 2WTUA 3EA0A 2QMOA 2VO1A 4EDHA 3FMPB 4ZKEA 1V43A 1KJWA 2MSCB 4KVGA 4RSGA 4DCVA 4EKDA 2B6HA 3I8SA 4JKIA 1Z63A 1VG1A 1W49A 3THYB 4A82A 3DO6A 1TQDA 2HV8A 2RCNA 1HTWA 1HH4A 2ZYWX 2O0HA 2QAGA 1QDEA 3V00A 4OI0A 1QHHB 4RFVA 4FMCF 2AK2A 3U6KA 2IWRA 4BFWA 2NQ2C 1P4SA 5FUVA 3A1SA 3QKTA 4AC9A 4LJ5A 3THWA 1XCGB 4Q9IA 2PT5A 3QE0A 4YC7A 4BEJA 2F1IA 1G3UA 1MO3A 4M9XA 1W0KD 4A36A 5AK0A 4TLEA 1XJQA 2GCOA 1TQ2A 1WDTA 3EPHA 4RZUA 4Q19A 4LC0A 4GMDA 3RS0A 3LFUA 3U44B 4CEIB 4QM6A 1S2MA 1M6NA
chains in the Genus database with same CATH superfamily
2GK3A 4QT4A 4JP5A 4IJVA 1B14A 1OX6A 1UFVA 1IHPA 1RLOA 2Y76A 5DO9A 3ZHQA 4F3TA 1XBTA 1EFRA 4DNXA 3IO3A 7GPBA 1GL3A 3QG5A 1XLVA 3LPDA 4KN6A 2BJHA 1OR8A 1ZU5A 4D99A 1X7WA 2Z6QA 4Q0MA 4OOEA 3PE4A 1KJYA 5KS2A 2D1RA 1ZH2A 4G65A 4IM7A 3PEYA 1FP7A 1MQSA 2ZI6A 1EI9A 1Q7TA 2OA0A 4BNFA 5JAOA 1HYEA 1PG0A 1XIVA 2ZQZA 4KE8A 3OY7A 1NSYA 3T3PB 4BRWA 1A2OA 3GAMA 4E21A 2FR8C 4II7A 5F7ZA 1NW6A 1MIOB 2N42A 3H1FA 1FZQA 3KOMA 4IIFA 8MHTA 3IE0A 4G26A 4M8LA 5AXBA 2AJTA 1A9TA 4ZZ0A 4BN0A 3SNKA 4OBEA 4ZC1A 2FMXA 2P0YA 3ER9A 2EFYA 3AU9A 5HTKA 5HX7A 2QUZA 4Q9HA 3LOQA 2J48A 1NRWA 1Y6GA 1MABA 2D2IA 3PQ6A 4LYJA 4EG0A 1W85A 4G8BA 4AUMA 2FPPA 1CE8B 4NX2A 1QXSA 3DZHA 3CE9A 5HIJA 2WHRA 2JJMA 3TNLA 4P0QB 2HA0A 3ED5A 3MHPA 1X3SA 3N8KA 1TU0A 3NJ8A 3STTA 3T6KA 3UMGA 4DMRA 1PUXA 4AMUA 4UASA 3UWDA 3ZWVA 3A3PA 1YQXA 3K8OE 4O0LA 2HTFA 4CT0A 1I2DA 1KKMA 1SHZA 4V2IA 4E03A 2J09A 4E14A 4OJKA 5FB3A 3UJPA 4FX5A 2ZVPX 1EB8A 5HS4A 5EQDA 3JWEA 2F43B 1VLVA 2IIQA 4LX0A 4Y2TA 4KACA 4ZI7A 3L05A 5C8YB 5HVNA 1EFKA 2IGBA 3UV7A 3GP8A 3I04A 2WIDA 3E22A 2GPBA 2CCGA 4AS3A 4UREA 1I14A 1M6EX 1Z35A 2BI4A 1GNRA 2ETXA 1HL7A 2L17A 3JVIA 3N76A 4M0MA 4UAJA 1AS3A 1GN9A 2WFZA 3ZYCA 4WXYB 3Q3GE 3Q3EA 4ECEA 2QU7A 5H68A 1VA5A 5B1DA 3KAQA 2AUNA 3LUCA 2ZT6A 3LZDA 2HN9A 3ESRA 4LVCA 4RPLA 4WESA 4X44A 1KZHA 4EPVA 4QZVA 5IM4F 4JT8A 2D3WA 4ZFNA 2VOEA 4NMMA 4ZCIA 4KZPA 4HXYA 1RI3A 4K88A 2EL9A 3KR2A 1CIVA 1ECGA 1PTJC 2C5LA 1IOZA 2GSDA 2YRWA 3F5MA 4H1TA 4CMGA 1XUOA 3G0DA 1IVNA 2VDMB 4JU8A 5BR8B 3KSRA 2CK3A 4W5OA 1MRSA 4PAWA 2QX7A 3MRVA 3AQ4A 4OFXA 3DQQA 4G8CA 1XMVA 5EYPB 3HH8A 1L4EA 1PEDA 4FP9A 2Q5IA 2CDAA 1YIAA 3Q0TA 1JLHA 4MGEA 1CZLA 1WTAA 3OIDA 5DTQA 5LB2A 3T4XA 3NMUF 1CQPA 3ZIAA 4PTZA 4AS1A 3ZD7A 1QJCA 1YS6A 5A7GA 2G80A 2FF5A 2AGVA 2Y0DA 2FXVA 2VG8A 3H1GA 4BLQA 5C34B 1GA6A 2V7GA 5H3LA 1H4SA 2YW2A 2NAPA 1TTTA 1T5BA 4EKGA 2DBVO 2GHQA 2HMSA 2FP4A 5TGDA 2W5UA 2VDNB 4NCXA 2R66A 5J4VA 3WAGA 1PL0A 3B7PA 4MNTA 1Z4OA 4TS4A 1AV7A 1P0IA 2F00A 3LHIA 1F2TB 2QG4A 2Y0BA 5K0BA 2JAPA 4LXQA 1JSRA 1E5XA 2ZUCA 3I6YA 2MMCA 4RE6A 3TLGB 1C0IA 1QH0A 2WKPA 2FSVA 2AC4A 3BTOA 3ONWA 1QTIA 2FY8A 2NU7B 4KMOA 4PTYA 1WXIA 4IRUB 2VAXA 5I9MA 4BO0A 3UCFA 1AHIA 3D3EA 3G2NA 3JYLA 1JEQA 1U5CA 2C78A 2IUFA 1UK9A 4LYFA 5HCIA 4DYDA 4UTZA 2ZM5A 3NOXA 3Q87B 2ODEA 3FB4A 1UEXC 3ASYA 5A7HA 1LTKA 4AZ3A 3SVZA 2HU8A 4CEJB 1MA0A 1E9DA 4NU8X 3RRYA 4P54A 3KJGA 3F6SA 4ND8B 2X5OA 4YRLA 1RBQA 3NPMA 5COQA 3LT0A 3LIPA 4MZDA 3H0CA 1WCIA 2GCOB 3D7NA 5HQJA 4K46A 1ZL2A 1L7VC 1ZNQO 2A9OA 3HWRA 1LRLA 5G0UA 5NLLA 4HDSA 1TF7A 2XSZA 4V1CI 2HRDA 1A69A 1VG9B 5FLXA 4BAUA 2P9TA 5K6AA 3AEKA 4UM9D 1PBNA 1PR9A 2D8AA 4TTPA 4NMXB 5EKSA 1DXYA 1J9GA 4LWZA 4EHJA 2ZSKA 1WKCA 2ZWMA 2JFGA 3MXOA 4L8LA 3K70C 2CB9A 1ICEA 5AVRA 2PRSA 3BC1A 3JCZA 1J70A 3NHYA 3MRSA 3DL7A 1OLSA 3D7MA 4M0KA 4B45A 1JIVA 3IUSA 3GW8A 4GWLA 4H7DA 1BDHA 5IVIA 1D2AA 2WIFA 2J9GA 2BDEA 4YY3B 2ZT5A 1PR1A 2IE8A 1B16A 1P1CA 2Y8EA 1BOOA 1KZ1A 2ZIXB 3MS4A 3OETA 4QOFA 2WWYA 4RHYA 3KZKA 4X92A 4Q39A 1GV0A 1PJ3A 1VOTA 4EVSA 2FUEA 3G6WA 4GLOA 2I1WA 1RKQA 5BSHA 3HDYA 5CLQA 3FKSA 2O2CA 3N3AC 4D44A 5B36A 1MDBA 2YY6A 4CKXA 4UATA 1MBZA 4MYHA 1MO5A 3QE4A 3DLCA 4UD6A 3OWOA 5BQ5A 1G3RA 3WSWA 2I2AA 1E2UA 4Q5IA 5DBGA 1BIFA 1CUYA 1PT7A 2LE0A 3KXIA 1HO3A 4PO9A 1XU9A 2QUIA 5J5VA 1E1RD 1PJCA 4DHEA 2G3YA 2QPTA 2E4VA 1WD7A 3RAGA 3BXPA 3WLQA 2ACWA 3GA5A 1W29A 1QGZA 1VLQA 5GV8A 5TMDA 4BX3A 2C9DA 2W93A 3C8MA 3EHDA 3DPSA 1GAEO 2JARA 1ODIA 3A27A 3I6BA 3M6LA 3PWZA 4IQ8A 1ZUNB 2VRWA 3FBGA 5AT1A 3W2EA 5IVDA 3EW9A 4RQUA 1Z5GA 1NNEA 1BFUA 2IOHA 2JHFA 5CT8A 1J1IA 3TSYA 4EB3A 4NU5A 1JLLA 1OWNA 4BFCA 2VFAA 3BWVA 2BMEA 2HY7A 2VOJA 4YO7A 2IF0A 3VPSA 4MAMA 2Q1XA 1X7XA 2RI1A 1UJ2A 1Y4SA 4JLJA 1SBCA 1YJBA 1SC3A 1XEXB 3ZDDA 3G9XA 4GZMA 3ZHSA 2VHTA 1P77A 1R8JA 4FYMA 2IEBA 2AC7A 3GGCA 1N7GA 2J7PA 5G41A 5P21A 3P32A 2Z4TA 1Y1QA 4JBHA 4MJXA 3ILSA 4TV8A 2ZJ8A 4CT5A 4CLDA 1M7GA 3KXKA 1G3IA 4HG2A 4IUYA 3VVBA 4CM8A 4CTOA 4OH1A 4FILA 3PXDA 1ZISA 3BRQA 4ZN6A 4XQEA 3FVRA 4FOSA 2DLDA 1L5HA 4GVPA 1CBUA 1FQJA 2M98A 3HY6A 3V2HA 1JLSA 2AOUA 4MRAA 1CEQA 1M5RA 3SQXA 5ALUA 1I6LA 2P1DA 3DE0X 4E88A 3H8JA 1L7OA 1NWCA 1WB5A 3JXEA 2D1YA 4OUKX 5LP6C 1ID8A 4O4JF 1VKOA 1QK5A 1QIFA 8LDHA 3TZ6A 4HC4A 3TM4A 3L7AA 3DNFA 3G5TA 4QBKA 1B0UA 1GN8A 2FW9A 1MR3F 3NDJA 4R1PA 1FP4A 5D6OA 5EESA 1UR5A 1DXHA 1IQUA 5GMOA 2INGX 5B3LA 4RK6A 3RAFC 1WZ2A 1I7QB 2C97A 3ZDCA 3TDKA 1CVRA 3VFDA 3FPBA 2D4AA 3ZUGA 3GMSA 5FTKA 4W1PA 5CNMA 4CKWB 3DLBA 3F2VA 4TWZA 3I1JA 2YXLA 4AD8A 3RKRA 2IEZA 1DUIA 1ZD4A 2IDMA 2ZS8A 3EDQA 1UPFA 3ZZTA 1PUIA 3O8LA 2Q6IA 3PKZA 2PJRA 1O94A 4G85A 3RRMA 4NZNA 5DLQC 4HP8A 1SVMA 5CXXA 4WLUA 3KSUA 4B7XA 1SOUA 3KEQA 1B76A 3P4YA 1Z0UA 1QGYA 4W5WA 5LJLA 1DKPA 3FLBA 1UJBA 4RIHA 4ZEWA 3CEMA 4DV2B 3T9DA 2W6ZA 3JD4A 1O0BA 2WAOA 4ZO6A 1JTVA 3PQDA 2P6PA 5BT8A 1PSZA 2EWVA 4OB7A 3EVDA 3SNHA 1G9XA 4HAWA 1A77A 1UUFA 2JH8A 4JROA 4OFBA 3HM9A 1FFYA 3FIUA 4HAUA 4EAAA 4H77A 4HSGA 3E5MA 2LRHA 2X5KO 5KYWB 3CF4G 4RHCA 1DO2A 2G06A 5EEHA 2GM3A 1NG1A 2O2ZA 4M86A 4OHWA 4WFIA 3WGQA 4FHEA 1MENA 1ULHA 1E3SA 2QK4A 4ZHQA 4UHJA 1MTZA 1RMQA 1UMBB 1ABEA 2OO7A 1U8ZA 1IG0A 2FMKA 3MN1A 4OP3A 3OT4A 4JDUA 5F4ZA 4F7WA 3I92A 4E2ZA 1YASA 2XA1A 1J23A 3L02A 3S5JA 3FTQA 2G6BA 4JXJA 5IT9A 4QDTA 1RE1A 2II6A 2O05A 3L0YA 5CD9A 1QNFA 3NU1A 3I5UA 3F7TA 4RFLA 2N0SA 1U7TA 3K3PA 3R6DA 3X2EA 4R9SA 1HF3A 5ANRB 1EA5A 1XRSB 4HWOA 3WWEA 2YNMA 3DOUA 1F8GA 2ORYA 3VU0A 5DI3A 3EARA 3OE7A 1EFPA 2VTBA 3R3ZA 5GJCA 3JYOA 3OCUA 4OGGA 3VR3A 3EG9A 2QV7A 4CRWB 2Q5LA 2JHAA 2XYPA 5TXGA 3L4KA 2EOAA 1XAIA 1AKYA 4HF7A 1G7TA 4MR7B 1CZUA 4LKOA 1YULA 1TLTA 3LWZA 1BW9A 3D8UA 1K6MA 1NTRA 1IN5A 2VDVE 1GQOA 5CIYA 4B09A 2XOKD 3ABRB 3CVXA 3H9JA 3E1SA 4OBWA 2X0EA 4CMAA 4EHBA 5JSUA 1GSHA 1UP4A 2JF0A 3L6OO 3AL3A 3LLMA 4S1OA 1C41A 2PUDA 4L73A 2O3SA 3RVSA 4I50F 2HNKA 2X1VA 2XD9A 1X9IA 3CX3A 3LGAA 3N86A 2HL6A 2JLWA 5C32A 3BGOS 1ULBA 4UEQA 1BWSA 1J1ZA 2HCFA 2WU4A 3JQ9A 2ZSEA 3OKPA 5HF9A 4DCPA 4HNUA 5C5DA 3HU2A 1RQNA 1YDFA 3HKCB 4S1NA 3PUIA 2HHCA 1Z2DA 2B30A 3RSOA 4HUTA 1YZHA 1UOPA 3OU2A 4C7OA 3GEEA 1ORHA 1JVNA 4H7JA 4MR8B 3BHMA 3NATA 1JG3A 1YHZA 2WEKA 3K09C 1JDBC 2AF4C 2FH5B 2HF7A 4MTCA 2EHDA 5NULA 3WL8A 2BFFA 4FOLA 2OQIA 4TYQA 1Q3TA 4TL9A 2XAUA 3DTVD 4MQUA 1IONA 3TW6A 4M7OA 4D2IA 3L8MA 4EJMA 2PEYA 3ED1A 1I3MA 1R4AA 1Y4DE 2SECE 2QTFA 3JQ7A 4OA8A 3ZY4A 2IH4A 1IEVA 3OKFA 3ZNOA 4G0QA 2PRYA 5CM9C 2EAUA 2YZGA 3ZWYA 3R44A 1WV0A 3HJFA 1G5FA 3IR6A 4TX1A 3DC7A 1Y6RA 3D02A 1JXOA 4FGWA 4EMUA 3SYMA 5CXSA 3PHCA 4I6JA 2FRDA 4LF4B 3ZV3A 2YY5A 4TSKA 1HSOA 1T1SA 4R1SA 4AAYA 1T91A 4FFLA 5JS7A 1RCTE 4O2BA 3EC7A 2OPHA 1GNTA 4HTAA 1SCJA 4ZGWA 1TPZA 3IP8A 4NFLA 2CSUA 3Q3VA 1N5KA 3G17A 4KI7A 4N8EA 4MV1A 2EKPA 3E9QA 3HVHA 5K3DA 3ZDQA 3RYIA 1A7KA 1ZA1A 4AKTA 4CWAA 4Y2RA 1AHHA 4EECA 4C0HA 4DA7A 4CXMA 4PRLA 1MC4A 3H13A 4MXDA 4KJZA 2PPLA 2VP0A 2Q99A 3MBOA 3R5FA 4LHZA 5KVVA 1GDTA 1E1YA 2WUVA 3GZ4A 4INZA 4L74A 3W6UA 4MB0A 2F8TA 1KERA 3P9IA 1SQ6A 3QX7A 3WHIA 1RHMA 1HYGA 4DRXB 5JS6A 4RVHA 2IYVA 1U28A 2NSYA 3TINA 4DMUB 4M0LA 3UJ6A 1QTRA 4LI3X 4KYTA 2IGTA 4ZC8A 1SG0A 2ZSHA 4KQCA 3VVLA 2DPHA 3PBKA 1WE2A 3OCCA 2GDZA 1ZHHA 1NQAO 1FJHA 3EZYA 2BFBB 3O4HA 2WNIA 3WIVA 3ZUPA 2A9QA 4B7ZA 1XG5A 2AFIA 4FCTA 5A9TA 2O4UX 3AHHA 5ARDA 4M0EA 3SR0A 1G8FA 1P61B 1MOZA 1WUTA 5A0VA 4BE7B 5ED0A 2KS6A 2LGJA 5LMUB 2J30A 1Q0QA 4H08A 4N5LA 4ETNA 1C1DB 1U0HC 1WDMA 1XQ1A 1YZYA 2HMTA 2PA0A 1NFRA 3IIMA 3SR4A 3A36A 3FROA 3T35A 4BO6A 4IJWA 4UHHA 1GTSA 1Z18A 4L9RA 4PIMA 2VF5X 1OILA 4O4IA 1EFVB 4PAGA 3LLUA 3H4MA 3VUFA 4N01A 3PHGA 4TYWA 2H4YA 3PGVA 4AY5A 4L7VA 4DSZA 2JKYA 4Q3EA 2QTTA 3QFHA 3S7TA 1GJRA 1VMKA 2R751 1CY4A 1V7ZA 4IDNA 3W6NA 1ZH4A 5EVCA 2CVOA 2G7ZA 2IZOA 4L95C 5EE5B 5I8PA 1QIIA 5IZCC 2I9KA 4KFRA 5EEGA 3NTOA 4GS5A 3JASA 3QF4A 2CBGA 2EFDB 2I0FA 5BVHA 2ZIZA 4RAQA 3L77A 2H1VA 2Q4DA 5J2UF 1TIKA 4FR2A 4MX8A 4YUAA 1R1DA 1RSZA 1YB2A 3ABSB 2R1TA 2DLNA 4YRAA 3CB2A 1WP4A 3PCTA 1P3JA 5GJWC 5E0OA 4M9ZA 2AJDA 3RT9A 3Q72A 2ISCA 1IWBB 2QL6A 3VR2D 5I6DA 2XNHA 3AZOA 3DXZA 1J0AA 2D74A 3HZOA 4GX1A 4HS4A 4K86A 2R7KA 4O8CA 2W8BA 4M3NA 1Q7GA 2GLUA 3LCJA 3PTZA 2EBUA 2PSJA 1NZDA 3B2QA 3HY4A 4KPUA 1Z13A 4JL5A 1BCRB 1XNJA 4FFPA 5AKKA 1SG9A 4ZTUB 1LDYA 4OHYA 4JASB 2H4JA 1TM3E 5IANA 3N2KA 5IC6A 3AHGA 2JFUA 2XUPA 3GNSA 2OSBA 2PGOA 1OB5A 1EDDA 5ALGA 1E2HA 1X14A 2OHJA 3INNA 3OQVA 4KRXA 3ZZNA 1CQIA 4TLMB 1L5YA 3E5RA 3KYCA 4RLFA 3RBAA 2C2OA 3Q7SA 1JMYA 4R68A 3GRPA 1RAFA 5HYVA 3RC8A 2YXEA 3BE8A 4B44A 3D2BA 4WSOA 1VRWA 1Z2PX 2VEDA 3DFZA 2JFNA 5ELLA 3L8DA 5TEWA 5CJJA 2R5NA 3MINB 4LHYA 3NHMA 4MWSA 4NATA 2G4LA 2KBFA 4X00A 1IN4A 2I5PO 1QGUA 2YIVX 1SCBA 3BCSA 4J4HA 5BO5A 4GQBA 3DEFA 4L1KA 2CJFA 2R44A 1EBFA 2VATA 3PSHA 9LDTA 2W90A 1JF8A 1PKXA 4GBMA 1P80A 2AFHB 1QH8A 4QOGA 3TKLA 3K0SA 1R3UA 3IRVA 4YAGA 2J4DA 3VPBA 4ZZIA 4IOKA 5BVGA 2E6UX 3ROKA 1Z6AA 1DC5A 3SF8B 5DM4A 1H5QA 4X6YA 1LDBA 4BXOB 3WK7A 3H16A 4QBIA 3UAWA 3GLFA 2RI6A 1Z07A 4MVJF 1DCFA 1GGJA 1QS0A 1T1GA 1E6WA 1WUHS 3EULA 3CH4B 1F3OA 1D4FA 1MD9A 3D8RA 3O26A 4ZARA 3TD6A 1KK0A 4C4RA 4HH0A 1U2SA 4NBUA 5KKNB 2PX4A 2AKYA 2ZI5A 3TB6A 3WDMA 4BTVA 2J3LA 1VLHA 2OK8A 1NDUA 3IVMA 1SU6A 5EXDA 5M3BA 2JGNA 3AFGA 2Q1YA 1JT2A 5TARA 3RHSA 2B0CA 2NUPA 3NGXA 3MWGA 2VXCA 4YR7A 3LVFO 2HJRA 3AT1A 4MHOA 5CFPA 3INTA 5DW3A 4H6VA 4NJOA 4BO3A 1QKJA 3QYJA 2EZUA 3IHWA 3K72B 3K4HA 3T0FA 3CBGA 3V1KA 3BK1A 4UNRA 1IOLA 3ELYA 3RC3A 1KMMA 3N5CA 5KX5A 4R2WA 2XT9A 1CYDA 2WJZB 1M2OA 5DCLA 1R5JA 1TMKA 4JI8B 4D82A 5EMMA 3VSDA 3NM4A 3E2MA 2O7NA 1P72A 1U0LA 2IU0A 3Q9UA 1XGKA 1E5TA 1ORDA 3DAPA 5IHPA 4PS1A 2PJZA 9ABPA 1SK8A 5LXTB 2C2HA 4NAUA 2P9CA 1OJ7A 3WP0A 1Z29A 4CLOB 4B3BA 4J49A 4P7BA 4C78A 5HE8A 2DQYA 3QVLA 2PIAA 4V0QA 3OOJA 3UWOA 4I1OA 3JYPA 4V1CB 3I28A 1G20E 5LZ4A 4LOIA 3ZGNA 2J1LA 1QJ4A 2YWBA 4PBSA 3GPCA 3PHBE 1FYXA 5EL0A 4YONB 5C8XA 5I7RA 1VMAA 2I54A 1I6MA 2AIRA 1XEWY 3JVVA 4PIPA 2Q9AA 4QNRA 4US0R 2X0DA 1O4VA 2X4GA 1WPQA 4JQOA 4M7WA 1IJEA 1RRMA 2YV5A 4IIJA 3CKLA 2PGNA 2Q8QA 2XQKA 3B1XA 3BORA 5HDQA 3Q6NA 4ZPJA 4EP1A 2BF4A 3ZQ4A 4L8FA 2PKWA 2R96A 3RH0A 3VU3A 1FP6A 2WPDD 5K3AA 5D3MA 5E6UA 5JAHA 4URVR 1OKKD 4WY2A 2C2MA 4RMGA 3LQ1A 4BQIA 7MHTA 3OCZA 2ZJZA 5F4BA 2FPGB 3FUUA 4RF3A 4R84A 5EINA 3HDJA 1JU9A 2HAEA 3OD1A 1GG2A 1JILA 1KH1A 1USUA 1N9GB 1STOA 2P2NA 3FYTA 1CG6A 1IZ7A 1FEZA 3LG2A 4N1AA 3KZVA 1S9DA 4MUYA 3P9RA 3NM5A 1KMQA 3FNGA 3X0DA 5IP5A 5JRDS 3H2IA 1MXFA 1QO9A 2ZJAA 2H85A 3IB3A 4EO4A 3QXJA 1T2FA 1YGYA 4RHUA 4BFTA 1ZONA 1JE0A 3B5IA 4E7OA 3IJEB 2VJMB 1KIMA 4XH9B 3TZHA 4J0QA 1QO0A 4XLTA 3R09A 4AJHA 4XYLA 1JU3A 3CKKA 1LDNA 4ZYWA 1D4OA 1Z7WA 2DGDA 2OR3A 4LAFA 2DQSA 2OCKA 4B81A 1R66A 3ANNA 3H2HA 5B30A 3DMRA 1ZJ6A 4CTJA 1YZGA 4QYIB 1EXNA 3CW8X 4B8YA 1RAIA 2V7PA 3KL2A 4BP8A 1ADGA 3RCBA 5CB4B 5REQB 1KYIA 4DR7B 1NV9A 2H07A 3BIFA 2PLWA 1IHYA 1N6PA 3G2KA 1XROA 4MYSA 1P0CA 2F3RA 3LZCA 2XKKA 4AJIA 3WLSA 3U4AA 1XLWA 1RM3A 3BJMA 4L22A 1ZDMA 2Q5CA 4FLMA 3IJRA 4ARSA 5FLKA 5IK2D 3ITDA 3TOSA 2QDXA 2GZMA 5FTNA 3KCQA 4FLEA 1J8QA 1U2EA 4XDZA 1TO1E 1BXRB 5IPFA 2YYZA 1T1EA 1JP7A 1KIFA 2CUZA 5AICA 1P1IA 3WE7A 4K87A 1CNMA 4FSHA 4EB8A 2P90A 3NAQA 4K2HA 4G2NA 1ODFA 4P3KA 3C6MA 3LPAA 4I8DA 3QFCA 4TM7A 3L8HA 3FSEA 1ODKA 3JPWA 4N4AA 1Z0DA 1C0PA 1Z0IA 1UPTA 3SQOA 1O3YA 4G5YA 3QBEA 1EDEA 4MK4A 1TGYA 2C04A 2H51A 2X8BA 4KK4A 4M6WB 3U7GA 4J0IA 4UBOA 4F5WA 3O8CA 2ZTVA 3KVRA 3PT9A 4X85A 3UHOA 4AZSA 1ELOA 1W47A 1VPVA 2RIRA 2Z9DA 3AR8A 3C85A 3D8HA 4J0DA 1RRKA 3PEVA 4P9NA 4YBRA 1FDIA 2H5JA 2HJVA 1WZCA 2ODNA 3INGA 3BH6A 4E4YA 2HWKA 3GPIA 1MHTA 3QVXA 3VSCA 3U3XA 3MQ2A 3WGOA 3I3OA 3LUBA 3KELA 2O5CA 4BMPB 4NK4A 5CYPA 5EXXA 2XOXA 1JEYB 1ZAKA 1XZHA 2GBFA 2GPSA 1V3TA 2WC1A 4PZCA 4D4IA 1EHYA 1SIWA 1T4MA 1QIJA 1EX9A 1FFDA 4H59A 3SSAA 3BMOB 3M5WA 3PQCA 2HDHA 4FHZA 1XEFA 4JEUA 1M0WA 3O90A 1DE0A 2GZ1A 3A9RA 4X0EA 3H97A 4FS3A 5J1TB 3U9LA 3CCFA 1PV1A 1U3CA 3E7PA 4WAUA 3T7AA 2Z2IA 1ILWA 3L9WA 1D0VA 4HUQA 1PJLA 1QOQB 5LP6B 2PD4A 4B87A 3IUQA 1WBBA 2XE4A 3IR7A 3CR3C 4IR7A 4D4MA 4K9MA 4PQYA 2XR1A 3MAJA 3SXJA 5C7YA 2Q45A 1SWVA 3DBLB 2AH5A 1UOOA 2P91A 3ABZA 3QP9A 3AM4A 4H0NA 4U1RA 3WGGA 4B5LA 4JX9A 3OTWA 3OWHA 4OYYA 1YS9A 3BKWA 2PUJA 5EMLA 3F6BX 1A5TA 1WL8A 2BY4A 4HDNB 3DS8A 3HUUA 4XEHA 5DXJA 4MR9A 5JSZB 3TQCA 1L5KA 3N05A 1MNAA 1Y9EA 2OVBA 5C37A 4MYRA 2G4VA 2ZYVX 5D6NA 3CYFA 4ZOLF 1ZH8A 4WNIA 4WLEA 4GI3A 1FNNA 4JUBA 4DLVA 3EUAA 3K9CA 1PZFA 1QVZA 3K05A 4K03A 3ROEA 2ADOA 3V5NA 4B76A 3D6VA 2IV7A 5JZOA 3RUIA 3UMYA 5FAXA 1V6SA 4QO8A 5THXA 3TL6A 4ZRDA 3A58B 4NZMA 5JY6A 2JD0A 2JFQA 1XRQA 1XZFA 3NO4A 4FDTA 2CC2A 1SVSA 1R12A 1TFRA 2PNJA 3DWGA 4WPGA 1R9JA 3UH1A 4BQQA 5ICGA 2FX3A 3QV1A 4WK2B 4YJKA 1TIPA 2PPVA 2MTBA 4I9UA 4IFIA 4N6NA 1NVDA 2IDZA 2OL4A 3Q11A 3TM5A 5AFSA 1G20B 4F46A 3KPJA 3E2IA 3IPAA 4KO1S 4ARZA 2ACKA 3U4HA 3AUYA 3GDOA 1X7WB 4RBNA 3TTTA 4B4OA 3C7CB 3IDAA 3WMXA 1ZIXA 1XO1A 2IHYA 3HU3A 1ZNYA 1HFJA 3L2OB 4XB1A 4CIWA 5H7XA 1Z4PX 3R4VA 3QZUA 3U4QB 1Z8FA 4WXPA 3CNQS 1ADCA 3KZOA 1X86B 4NCKA 3TSWA 3OCWA 3KTOA 2J3IA 4EI2A 4YMLA 8AT1A 2G72A 4CM7A 1U8AA 1R15A 1G63A 1MB0A 1EFUA 1KY2A 1RJGA 4QPNA 1QAOA 4RL4A 1NUAA 4P6VF 5K3CA 5JROA 4TYMA 2WUEA 1UBHS 1TYEB 3MTAA 2A0WA 3L93A 1H0KA 1K5HA 3QVUA 2HDNB 5FTMA 3VZRA 1F7UA 3FKQA 5KREA 3AHCA 1NV8A 1W85B 2AUTA 3SLGA 4AKEA 4DQKA 5CDUA 1DQRA 1GSIA 4WCFC 1SCQA 5CB6A 3WRVA 2H1LA 3ESBA 5DYYA 1J0XO 2OGSA 3U2QA 5A6SA 5K8JB 1IRXA 1G5IA 1JAHA 1EIWA 4PU0A 4UBIA 2XNJA 3JR3A 1FLDA 3IBSA 2VPQA 1XAJA 5IN5A 1RWVA 5EIFA 1FPMA 1ZH6A 4ZICA 2IOFA 1IY0A 2OD7A 2XNDD 3DV2A 1MRNA 3EZLA 3GVIA 5JJ5A 2NXEA 1YR8A 3UMVA 5JCZA 1N5MA 2EJWA 1GPDG 1AZSC 2OBFA 5HFNA 2Y99A 1MEEA 4WY5A 1RQ2A 3ST7A 3IVRA 1S3IA 3E22B 1NP7A 2HLNA 1DRVA 1ZHFA 1SXJD 2CXNA 3L04A 4JUAA 3SFVA 2Z83A 3AIOA 2VA9A 1OWPA 1UZNA 1FLAA 3A05A 4HLUC 2IDJA 2IP2A 1C2TA 3H83A 4UTVA 4N3GA 1L7XA 2EW2A 4N12A 2CHQA 2FZLA 2FWJA 3T38A 2EHJA 4I3HA 2WSIA 3KYJB 1JXMA 2DFVA 4ENTA 4EPTA 4IF4A 2RGNA 3DZ8A 2UZ0A 3CFYA 4JLAA 1P4AA 4JOQA 1KGDA 4RK7A 4W5JA 3L4BA 3WGYA 1FXWA 4IJMA 3GEIA 4TM8A 2C4VA 1TPYA 3HBFA 3S1AA 4W5TA 1OSNA 5IDQA 1H9AA 2J3JA 2SKEA 1E0DA 3QUAA 4HEA6 3ZZ0A 4WBNF 1J21A 1MLDA 5LYJB 3KDSE 4X64B 3ZCUA 3RO7A 2CJWA 3C97A 1B15A 1KP2A 3IO5A 1TL7C 4NCHA 3FI0A 1II9A 4JP1A 3U40A 3ZXIA 4XWTA 4ENRA 4JB2A 3D2CA 4XRGA 1ZXLA 4ZAGA 3V1LA 2WZDA 3T7IA 1P6UA 1W581 2XADA 4Q1VA 2XZDA 3OOEA 1EYZA 4X3OA 3L06A 4H1HA 3GP5A 1U3TA 4MICA 2B3TA 2G9UA 3C3XA 4FHCA 3R3JA 1OBCA 4KH1A 4WCVA 4YRFA 2VJDA 2XWJI 3WLKX 1ECFA 4YQFA 1AMOA 3C1UA 1L5OA 3HZZA 3O6VA 3QU7A 4JBYA 1P2BA 1J42A 1VHTA 1SK9A 3NKFA 3MOSA 2P5TB 4P7FA 4BLUA 3RF7A 1RPJA 4YJGA 4AY3A 1QHYA 4HRAA 3OPQA 3LTEA 2HCJB 3O1JC 2IODA 3R20A 1DWQA 1A98A 2D00A 4MVXA 2OC9A 4HB4A 4DSAA 1ZOPA 3GFTA 3RHZA 1VKHA 5AMXA 1AK9A 3T95A 3PLNA 1SC9A 1C9MA 3U7JA 5AESA 5FR1A 1HLPA 3D8TA 5D86A 3ZU2A 3O4JA 1I01A 1EVQA 4J94A 3REQB 4FDUA 1Y34E 3GEGA 2AEMA 3HBJA 3M2PA 3OBIA 2D7CA 2AF3C 2DFLA 2I71A 4D0GA 4HL6A 2G6TA 2CLEB 1CFJA 1JEQB 1POXA 1P5JA 1YJ5A 1KMCA 2HDWA 3KV1A 4BVGA 4BC0A 3VKFA 3HB9A 3W7VA 3N2IA 5EIXA 1VCNA 5FYDA 1EZZA 1GNSA 1T36A 1YB6A 3PE6A 4UHFA 1P0MA 1RQRA 1WLSA 4M4SA 5DTEA 5EVJA 5TVKA 3GC6A 3W8FA 5CDTA 3GHYA 2H29A 2YBEA 1PL6A 2G08A 4MVJG 3VH3A 1KBQA 1O6GA 1SULA 3A25A 3Q7TA 4MCHA 4AMYA 5JTTA 1G291 5LFAA 3N5KA 1WCIB 5B4TA 5LOVF 4UPVA 5DYWA 1VIAA 3KJEA 4KX5A 4LDZA 1RXEA 4UC0A 4HDSB 3LW7A 5AKEA 2ZJ6A 3NBKA 1UT6A 2ST1A 4G5SA 4O4LF 4QOSA 4BVJA 1UDWA 3EVGA 1J06A 1OE0A 3TIVA 1ZGZA 3AO0B 3LMKA 3W2TA 1U4SA 3HKEA 3CNOA 3M1AA 4R7TA 4BVBA 1U1CA 4NMHA 1S4MA 1YZKA 2QRPA 1YZQA 1V8PA 3BTVA 4PNPA 2H1CA 2C20A 3PNMA 4QATA 5DNVA 4YAOA 2GTIA 1S01A 2Q0QA 5AK3A 2GM9A 4U7PB 4UCXA 5K0LA 1M34A 2E87A 3MOGA 3JS5A 4HN9A 4AK9A 2QTVB 2PGIA 4W5RA 2VHVA 4YRMA 4RTNA 2IX9A 5KDOA 1IPEA 3EGVA 3M4YA 5ENVA 4PS0A 1RXWA 1PFVA 1VGQA 1H22A 2JCVA 3JQGA 2GEFA 4PC3A 1JRLA 3R8FA 1Z88A 2HK8A 2PMKA 3QXHA 4DJAA 4MWBA 1JA1A 2XRZA 1JFSA 3K1AA 3AHEA 3M1LA 1A50B 1DKUA 1W1WA 4BECA 1NKTA 4DDTA 4HFRA 1W87A 5A4DA 1UP6A 1K27A 2D3TA 1J7KA 2I3DA 2PCJA 2WAMA 1OY1A 3OJLA 4GICA 4BP9A 5FV4A 5KSYA 2WJ4A 1VE6A 3IAM1 3IT1A 2ZTSA 2ZWAA 3SJ7A 4C87A 3GLUA 3BB3A 2B21A 1HYQA 1DBWA 3F4KA 2O8EA 3BERA 1K6JA 4PR3A 1XLUA 5C35A 3E9DA 1QZZA 4ITRC 2BR5A 2EF0A 4ESHA 4XWGA 2WU3A 2ZRJA 3CKMA 1CV2A 4PWZA 5DOVA 1UPAA 3OAAA 3WMGA 1JVBA 3GLHA 4ZMRA 2IYUA 5JAMA 4FHDA 3OICA 4AJ4A 2QJRA 1KO5A 1Z47A 3TDMA 4QDZA 4X7PA 3E58A 3O92A 4YQEA 3DMTC 1JLLB 2WE7A 4L51A 4B3TB 2ZE5A 3P20A 4QU8A 1SNYA 5F1OA 3AETA 4QX6A 4N8DA 1OXSC 3CNBA 4NECA 2ENWA 2FZCA 3KIPA 5IWAB 4F5DA 1BE6A 2FWIA 2PR2A 2B0JA 2R6HA 2WHQA 2E4XA 4ZQCB 3OTOB 1ZICA 3G5MA 2P8JA 1K3TA 4KQIA 3NR2A 5ALRA 4B31A 1RLMA 4G5HA 2B1RA 2B8WA 2YZKA 3IH5A 5SYAA 3BZBA 3ZN2A 4CM8B 4EW6A 3DW1X 1WEKA 4WVFA 2FPLA 1E7SA 1LJUA 1WX1A 3PNSA 4CM4B 1S8AA 2FNAA 3KAJA 2Q3EA 3R3UA 4GKBA 1L5HB 2OZKA 4OQMA 3DZDA 3W5HA 1N2BA 1AGXA 4WLNA 1RKUA 2GZDA 2SKDA 2IV2X 3U7QA 4M0DA 1B26A 2OSVA 5ALIA 5BN4B 4Z4GA 2RAFA 4NULA 5DHSA 4RD6A 1Z6TA 1MGPA 1ZBDA 2QZZA 1U0JA 4IYJA 4NDZA 5G0WA 1JN0A 2IYSA 3RR2A 3T4UA 3V1TC 4A7PA 1XD9A 1H1LB 1O87A 2PBFA 1KY4A 4FMBB 1FSPA 4IIEA 3KWLA 4KG7A 1YZTA 2E7ZA 3LUPA 4JJ7A 1HDCA 3KZMA 1OYYA 1FP4B 2EV9A 5CFQA 4UM5A 5C3UA 1BO6A 1OQAA 2EKDA 3S70A 1DJLA 4EELA 3DSRA 1EUDB 5AKIA 5DHRA 3BILA 1ZGBA 3NGMA 1AHNA 4ZOCA 4QEDA 4BPBA 1EA7A 2PS1A 3FMOB 2HO5A 4G5OA 5A7FA 1SCUA 1ZWLA 5FA8A 1GQRA 3A37A 2HBYA 3CJQA 1XPUA 2GNAA 2QRZA 3CONA 3IQEA 1W4LA 3MMPA 1W94A 3CUVA 1U7UA 2FU5C 2QLTA 2WRZA 4OHFA 1SD5A 2G71A 3RG2A 4RS3A 2FE4A 4L6IA 4G63A 4I5FA 4N18A 3FPFA 1TKRA 2Q7XA 1QIMA 5KVCA 2C2KA 4XGKA 3PX7A 4CU5A 1E4OA 4AMBA 1CY1A 4JEHA 3JQAD 4MWOA 4XX0A 5KYKA 4N0EA 2FX5A 5E4TA 1I24A 2IPNA 3M9LA 5AQEA 3VNSA 1DLIA 3ZHCA 3TECE 3KYDA 3FDXA 1KQGA 4OGWA 1J0CA 1ZD9A 2Y0CA 3U16A 4QYMA 1RIFA 1VLZA 1W2HA 4CF6A 3CUTA 4HWKA 2NYRA 4F11A 2FMHA 1N2IA 1W4CA 4YRKA 4KR6A 1GPH1 5KHAA 4D43A 2PFKA 3JAWA 2QQ5A 1A8SA 2YZNA 1BYIA 1V48A 1C7RA 3KL4A