3V46A

Crystal structure of yeast cdc73 c-terminal domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
160
Chain Sequence
PRKDPIILIPSAASSILTVANIKQFLLESKYVNPRNLPSVPNGLVNIEKNFERISRPIRFIIVDNTRMFTKPEYWDRVVAIFTTGHTWQFNNYQWNSPQELFQRCKGYYFHFAGDSVPQHVQQWNVEKVELDKNKRFKDVEVVRYFWHSLEKELISRGYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Cell division control protein 73
publication title Cdc73 subunit of Paf1 complex contains C-terminal Ras-like domain that promotes association of Paf1 complex with chromatin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 39
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05179 CDC73_C RNA pol II accessory factor, Cdc73 family, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11990 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v46A00
3V46A 4DM4A
chains in the Genus database with same CATH superfamily
1L4BA 1IZ9A 2HCRA 4KQGA 2QN3A 4PZEA 3UOWA 3DSRA 4ZDIA 1YS2X 2F9FA 3F6PA 3ZJTA 5FH9A 1E58A 1UK7A 1WVIA 3K0CA 1CIPA 2LVBA 1IB0A 5CX4A 3UT6A 3L6EA 5KTNA 5LQKA 2UUPA 2PR2A 3DAHA 3HHEA 5CLHA 4Q9AA 2BE7A 4X66B 1OIXA 2QF7A 5DSZA 5HRAA 2ZYRA 1XDBA 2IA5A 4N39A 5EYPB 5A0FA 5BVGB 4FMDF 1PN3A 3UXEA 5JYBA 3REFA 4NQZA 2QVGA 2Q3MA 3CF0A 1M83A 4M0EA 5L3QA 3JD1A 3L1VA 5LP6A 3M49A 4RZ3A 1UMBA 3WISA 5K4AA 2CY0A 2NU7B 1KIAA 3KTDA 5DO9A 1URPA 1IUNA 4AX8A 3I5MA 4EYEA 2G9NA 3B9BA 5KWIA 2NMVA 5CLQA 5E4YA 1I7PA 4J7UA 4S05A 4MQ6A 3EPJA 2ZU6A 2ZEJA 3FCSB 3WLNA 2XADA 1WCYA 3RSZA 3MPOA 5DB4A 4C7BA 4II7A 1SXJC 2IF2A 2XUAA 3PQ6A 5GONA 2OTCA 2BHSA 3QVOA 4RCYA 5DHSA 2REQA 2IOQA 4BE7B 4FQ5A 2EIXA 4HGPA 2J0UB 3L84A 4ODIA 3KT3A 2JKVA 3EA5A 3OEEA 4EYOA 2VP2A 1J21A 1QFYA 2QQEA 1E64A 3Q3EA 4FWIB 2JFQA 4OMFG 1IHOA 2X0FA 3RFVA 3SEQA 5IANA 3LQ4A 1VIVA 1WWKA 3FPEA 3GGOA 3U39A 1YJXA 4I50F 4JB8A 2YOGA 3PFIA 1N5RA 4TLCA 1BFUA 1TECE 2AXQA 2H5EA 4JI7B 1WUKS 1K92A 1Y6QA 3PITA 1W5SA 1QCCA 3OE7D 2FG6C 1H0KA 4G3XA 5CYPA 1JWBB 4F5DA 5KOJA 5H83A 1JLRA 1Q21A 3ABOB 2GQ0A 1IHDA 4ZQHA 5AVTA 2AZXA 2VK8A 1K0UA 2QD1A 5A7HA 4G4GA 1D6JA 1UPBA 3QHQA 4J75A 3LQRA 3OJWA 4W63A 1DLJA 2ORWA 3SVLA 1DC3A 2X22A 3NP7A 2OZEA 2H06A 4CEIA 5AUNB 3I6IA 3ORHA 2QI9F 3UZUA 1NVKA 1T34A 1GUAA 3HDGA 3PQ7A 4PSAA 4BFXA 3VO1A 3TM4A 1NR5A 5DVZA 4IJUA 1VI6A 1Z2PX 2HCJB 2HFKA 4RTKA 1QB8A 1YZYA 5KTSA 3FPBA 1U5BA 1UT5A 3R9WA 4ND7A 3D8BA 1XMIA 2PN1A 3GRUA 1H4SA 1N6PA 5K8JB 3RVOA 1V96A 3HUUA 2GETA 1PS9A 3NZEA 3W7VA 3ZC3A 4BVHA 1MX1A 1X86B 3KKKA 4M8KA 4NCXA 4BRWA 5JBIA 4DV5B 1Z5VA 2G1UA 3BMCB 1M2JA 2DVMA 1W4AA 3NOXA 3L1UA 4OQQA 4DQXA 2Q3BA 3QXSA 1VCNA 1T15A 1B0ZA 2OUIA 3FDIA 4JROA 3BMQA 3NHWA 1KQ3A 2NUTB 2EFEB 3FGOA 4F06A 2AJTA 4HAUA 4OHYA 4Y9RA 3HNPA 2BSXA 3CA8A 3CF2A 1E6CA 4ZI3A 5JAUA 2P9FA 5KYXB 1QAQA 2PMKA 3I53A 3M83A 1U8ZA 1N9KA 2XE8A 5C18A 1M6WA 2UYYA 5CG1A 4HF7A 4PHFA 1RJFA 1Z7WA 3JW8A 1BE1A 4G0YA 4OHWA 1NVMB 4GD3Q 1J8YF 2VPPA 1MJHA 2G9VA 1V8BA 1GZHB 3P94A 4EO4A 1B23P 3EVZA 2LTAA 1WUHS 4KITB 3FMIA 1HR0B 2XE6A 3Q6IA 4ZZ3A 2HREA 3NYWA 1A8HA 2AC4A 1YE3A 4ZVOA 1DOHA 5BUZA 3TZCA 4MYRA 3A1NA 1M1YA 1GPYA 1W5BA 3HH8A 4HNQA 4MI6A 2WVJA 2B3TA 3SP1A 2HQRA 1ZKMA 2JZCA 2NU8A 1Z63A 2BFMA 3I1IA 2V54A 4GMFA 1DAEA 4ZD6A 2VZ8A 4CQLB 1P6QA 4XAQA 3LCMA 3WDKA 4E22A 2HD4A 4QTUB 1UP4A 2G4CA 3FMOB 3PA6A 2EU8A 4KFSA 3E9QA 4AJ9A 2C0QA 1N2CA 1I2CA 1U8AA 1YVEI 3U13A 2NTVA 2ZS9A 4FMPA 5H02A 4J1TC 3DL0A 3OBIA 1FJXA 5B6IA 1CEQA 3AIMA 3OQMA 4TL8A 2PLAA 3CE6A 2HSWA 3L9WA 1BHSA 3P96A 3T5CA 3WIEA 4ZJYA 2YWGA 4EFLA 3BCUA 1PKXA 4O59O 1LBIA 5K0BA 2O8DB 5JFTA 4MV9A 2XXAA 4CQMA 2C7GA 3NQ41 1P2SA 3A04A 3AHDA 2X3YA 4A3SA 3J7AC 3KU4A 2PUVA 2VNSA 1E4EA 3B8EA 2V0CA 4Y2XA 4ZOQI 3MZ0A 2CJYA 3KPVA 1OTYA 4RNDB 3B7WA 4TYQA 2RSLA 2YV1A 4CHGA 4HVLA 3NBMA 2VXOA 5LA6B 4YRIA 3GN1A 1HYEA 4PN7A 2Q21A 1U5AA 3MM4A 3W79A 4MKZA 5BOSB 5CDHA 5KVSA 5CFNA 1DIBA 2NW6A 4DCPA 4E21A 721PA 1IU9A 3GJ6A 2WM9B 5KDDA 4WNAB 4XPZA 3RKSA 4AUKA 4BMXA 4EEZA 4P3OA 5ELMA 5K0ZA 2DH6A 1TTTA 4FJ2A 2QTAA 1R0SA 1OAOA 1XNHA 2WU0A 3ISVA 4HEA6 4JCOA 4C0BA 2ONYA 3G6KA 3B53X 3HFSA 4ARBA 3PZBA 1T2FA 2HF2A 4UVDA 4LRYA 4XGKA 1VIAA 3KUDA 1QK5A 2A0YA 3I5YA 1VGRA 4W99A 3C5WP 1L7OA 4RAOA 4CF5A 4QBGB 4QE3A 1IK4A 3H97A 3KOXA 5H3LA 3TFWA 2G5CA 2MSWA 1HO3A 4XX0A 1M2OA 1BWQA 5CFPA 2J5KA 1Z8DA 2Q1XA 2JA1A 3AB7A 4HSGA 3V7WA 2FPMA 3W9SA 3HKDA 4BLWA 4EF5A 3BIJA 3K0AB 2QDKA 1E89A 4LRUA 5LBTA 2HLNA 4O02B 3URKA 1O7JA 4M1OA 3W6ZA 1QZTA 2HB6A 2FWIA 1K27A 1R9MA 4ALMA 4I5GA 4GDFA 4AKEA 4HQLA 4AJJA 3F1LA 1WXIA 3JR3A 3W1WA 1TIKA 2JZOA 4O33A 3VC1A 2CCGA 4QUJA 1AY0A 4TTVA 2QJTA 3KDSE 2BFDB 4GVLA 1OWLA 5GPBA 1R0WA 3EN0A 1CUZA 1N2XA 4ZI7F 2XNKA 5J4HA 1F7VA 1I30A 4DEYA 1U4NA 4NG5A 4OHUA 1PNOA 1G6HA 5AI5A 3UANA 2P27A 2XWPA 1BJKA 2NV6A 3GA5A 4MUMA 1AQJA 1KZ4A 1S9DA 2VDLB 4RO0A 1WMAA 1WD7A 2ZSEA 4QULA 1BXGB 4C4XA 2X9QA 1LDMA 3UMYA 2LZ0A 3L6UA 4QT0A 3JY6A 4JVNA 1PFYA 2NNLD 1SCIA 5I7UA 3PDIB 4PHGA 1TMOA 3ZWOA 3S4YA 4BVFA 4F46A 1V8DA 2D06A 2Q5LA 1PSZA 1USVA 1IBCA 3FNEA 5ARCA 1UC8A 2B4AA 4TKMA 1XMVA 1G8FA 5HXAA 4GMKA 2B5WA 3B89A 1J4AA 2G3YA 1TRKA 4M7PA 4RYLA 3S1LA 4X85A 3IAFA 1DQZA 1OW3B 3G9TA 1QHSA 4W5JA 4P53A 5LYJA 4D26A 3HE3A 1SOMA 3DF7A 2GPWA 4L0DA 4Y67A 2IOYA 4KQIA 2JAPA 3HJBA 3T1YB 5AKLA 2WWFA 3U49A 5C5CA 1FVOA 4O4IF 4XE5A 2WQ7A 1PW5A 2PQ6A 2Q6IA 3JS5A 4BP9A 4JH0A 4RQAA 4DA9A 1PSWA 4NBWA 3E22B 1W5EA 3GT3A 1OV4A 1XJQA 4ZEWA 4BFCA 2VTBA 1QP7A 4ZCSA 3W2IA 4V1CI 1QTNA 2ZUFA 3RREA 4JR0A 4R2WA 3AEKB 2E4UA 1YZGA 4HEHA 5ES4B 4F4UA 1R4ZA 4AN4A 2X0RA 4L0CA 3ZVMA 1PKEA 4PBSA 4C6TB 5ALQA 4KIGA 3QE2A 1XXHB 2PO7A 2J5QA 5H5JA 2HQSA 4M9SA 1FU4A 2AG0A 1C8BA 1YQXA 3CU5A 3GUCA 4XYBA 5ETJA 4RDXA 3S8MA 1XXHE 3STXA 1DKQA 3N2GB 2P6MA 4RULA 4LDAA 1QRTA 4GQBA 4WNYA 3UW1A 3KWJA 1A0OA 3KL2A 3LPCA 4MLPA 4RY8A 1RBQA 3VR0A 2VF4X 1YO6A 2WE8A 2GPJA 2WM2A 4BVBA 4IAOA 1TQHA 5AM4A 5JS7A 4U8HA 5KYUA 2YWDA 3AI2A 4U02A 1XALA 4IX9A 3Q6NA 5BW6B 2VDPB 3OT1B 1KZHA 2XQGA 2YC2C 2X4IA 5HMLA 2B1QA 4AI6A 4LJRA 2E18A 5JAOA 1JHQA 1G21B 1PZFA 2ARKA 3OKAA 1Y1LA 1ZL2A 5IS2A 1FDIA 4NJMB 5JAQA 2RB5A 1CUWA 1ESEA 1S6YA 4WOBA 1MH9A 4AZ0A 5ADVA 2VQFB 4WVLA 1G21E 1GQSA 1CIVA 4DY6A 1QXSA 4BGIA 3GLFB 1IXRC 2RGGA 4MP3A 2HGSA 1SQ5A 3D3QA 4EG7A 5AVZA 4ISCA 4ZO8A 4M0UA 1HURA 4AFNA 2AJCA 1MQ8B 1GL3A 3RGGA 2UZIR 3QWFA 4NKRA 3GLFE 1WDLA 2ZUUA 1R00A 4D9FA 1NBWB 2UUCB 2NAPA 4DR7B 3U4MA 1U1EA 3OF2A 4YPVA 4CI0B 4MB6A 1KPIA 3DVLA 2I78A 3SPXA 5BW5A 4AS3A 4DL9A 3ZDBA 4UTZA 2C2HA 4JASB 4REOA 1L4KA 2AT1A 1J1UA 1AHHA 4GIBA 1I1QB 4NDNE 5JU6A 1FDUA 4HDAA 2BAGA 4BNNA 3QOFA 4B3CA 3IELA 1IUOA 3OTWA 2NQ2C 2GPTA 5B4VA 4AJHA 3EZ2A 4J29A 3FVWA 3F74A 1C8LA 4QOSA 4R8RA 5EIHA 3TX2A 4EYQA 4L5CA 4KL8S 3DUFA 4ZV9A 5HIMA 1CF2O 4FMDB 1LTHR 1HRKA 4MKGA 4F3RA 5CX1B 5LWHA 3DDOA 2PH5A 5DTMA 3P9NA 5GGXA 1CR1A 4KQ1A 1QYDA 3LRPA 1ORIA 5D87A 5GM1A 2FFBA 2XNJA 3AONB 5FP0A 3UTCA 3SR4A 3K70D 3MAGA 4ZOLA 3WGKA 1LY1A 2JAOA 1OC2A 1KI1A 3CVUA 1GKLA 1GY8A 2V4ZA 1E2DA 4NCIA 3VPDA 4FFRA 1P1BA 5BV1A 3NPAA 2R6HA 2ROQA 4GUDA 4LXYA 4TWRA 4UZEA 4FC6A 3ROMA 4DSTA 3CY6A 3P2MA 4YRNA 2BBSA 3NVKI 1B8OA 3CCCA 1T9KA 4KE9A 2BP7B 1QGUB 1AZWA 4RF3A 4XJVA 1MJNA 1JG4A 5JNTA 1FIUA 5A9SB 3GRVA 2JEYA 4JU9A 3Q85A 3T99A 3A1VA 1RKXA 2OCAA 1ZD2P 3U0VA 1R37A 4HDMB 4I50B 3WGHA 2DEUA 4PG7A 1TO6A 3GZNA 3WIDA 3R7SA 1VLLA 5C52B 3HZHA 5DFAA 1XEFA 3UKOA 2R6R1 4HDRB 2CHEA 4YRRA 2GH1A 3EHEA 5AP9A 1BXZA 3H1TA 1U2PA 1UANA 3FHLA 4LISA 1JLHA 5KU1A 2Z2XA 1NYQA 3R3YA 3ZY3A 1VFNA 2GNPA 2BLLA 4P6VF 3ILYA 3IV7A 2C58A 3UJ6A 1JKJB 1A7JA 1RWQA 5BR7A 1XC7A 3GLTA 2VNAA 5E2IA 2VDWB 3SZUA 1N7IA 3R3UA 4LQDA 3VR6H 4DQ0A 1JQ5A 2ACVA 4JLNA 4KV7A 4MULA 4Q66C 4RIGA 3LZDA 1H65A 3G2KA 4HGZA 3A4LA 5CMLA 4M9CA 4ZMBA 3DKVA 4A0FA 1H2FA 2G28A 1DBIA 2H00A 2W43A 3AETB 2B8NA 1F17A 3OCYA 5EP4A 4IVNA 5IU6A 1E8DA 1QGYA 1SCQA 4NYJQ 1Z29A 1E1MA 3DCIA 4D3FA 2Q1YA 2O20A 2V5VA 1GZ5A 3OEED 4TVSA 3WNZA 3OQNA 2A14A 2APJA 1J2JA 1U3GA 4IDCA 1GEGA 3DLTA 2PD6A 3EUEA 4MRPA 1ZVVA 1PCXA 4M60A 1YBFA 3OCZA 5CK5A 4OFBA 1DQNA 1NYLA 1LK5A 3IBSA 3IKJA 4KX5A 3GT4A 2O48X 3LDGA 4WW0A 4LXGA 4DMUB 4MA4A 4R5MA 4C4YA 1KDRA 3A1SA 4E14A 3I1JA 4NTZA 1J09A 3USCS 4WLEA 3W3AH 1LLDA 3M3PA 1VJRA 2C83A 5HUQA 1QC5A 2M2IA 3TECE 1HDXA 2ZYTX 4A27A 5ARBA 2C07A 3FYSA 5IAKA 2AG6A 1UEXC 4WFKA 3JQFC 4Y6GB 5J4LA 1F6DA 1RC0A 2H4JA 3S40A 4AU1A 2HMSA 2IE0A 5JCXA 4IFEA 3HJCA 2NTJA 3DZGA 3HMKA 2X19A 3OM0A 3P52A 4QEKA 3O9VA 1RZ3A 1P45A 1JL3A 1DTSA 1TZJA 3COZA 3JYQA 3SSOA 5EZYA 1SQ0A 1P1RA 4DLYA 2J3JA 1Q92A 1OU0A 3E61A 1PJRA 3GLGE 1KAGA 1A2BA 1G8SA 1PVDA 1Z4OA 2NVWA 2B92A 4MKXA 5FPYA 3ZLVA 1EFVA 1PWXA 3DHVA 3VR3A 3B51X 4XIJA 4CM7A 4EPVA 5L95A 4UOEA 3S0JA 3PFWO 3B20A 4X45A 5E3JA 4CF3A 1QFMA 3TTWA 3BWVA 5DLYA 1DHTA 4ZCPA 3RRYA 1LB1B 2XOEA 2AWNA 2C77A 4TGLA 1D7AA 1FQJA 2E4VA 5JS1A 4KQCA 4NBTA 1NXVA 4B8ZA 1VPDA 3AXTA 3G7UA 4EW6A 3DNFA 3S8EA 1J42A 2FYTA 3FPHA 3S70A 3KJFA 5LM3A 1A3CA 1NF2A 1G3QA 4TKUB 1A4UA 5PGMA 5ICGA 2LDBA 1KARA 3CURA 3Q7IA 2RGAA 1ESNA 1W59A 3K1YA 5C5IA 4ZYXA 1U3CA 1R6DA 2NN3C 1OI4A 3LCVB 1SKUA 4DLRA 1H0SA 1U8FO 1WTCA 4P3PA 4E5PA 3ICQB 2ZIZA 3FTDA 4K6CA 5KJCA 5EWMB 2UZAA 3ZH9B 5K09A 4RK7A 1JPUA 3QLJA 2PT7A 4D41A 4YMGA 1E4VA 1PS0A 2FPWA 3I4FA 4PPGA 3IKLA 4X24A 4HDOB 3X3HA 4J4BA 2FQYA 5J43A 1ISFA 2E5FA 4I5DA 3N8HA 4HWRA 3UBMA 4B87A 2Z83A 4OPMA 4Z0PA 3UMRA 3UAXA 2NPIA 2I7VA 3BE5A 3CLTC 4D0SA 2B1GA 1RJ9A 4DLBA 4UHCA 1F3LA 1MAAA 1OYVA 2HWYA 3ANMA 3Q5DA 4GXQA 3L0IB 3MBKA 3T7SA 5BPHA 1FX0A 2C54A 2PTHA 3P45A 2JL1A 4H4DA 4EI8A 1GTVA 4PWYA 2Y1OA 4P0PB 3WGQA 1QCDA 3L7IA 3FFBA 4LJAA 5C32A 3MJSA 3MS2A 2IIQA 3IC5A 3T1QA 3ELWA 7GPBA 3SQNA 3GFPA 4TLEA 3EZGA 3V7YA 5J5VA 4C05A 1UZUA 1VCOA 3R3WA 5L8VA 1OILA 3D3KA 2E5LB 1UKAA 3V4SA 5LZ8A 2NNWB 3U3MA 4Q4JB 5AK5A 4HQKA 2Y1LA 2PT5A 2A1TR 1X42A 2DC1A 2NXEA 2H4ZA 3F8SA 3QENA 4HLUA 2IX3A 1QPZA 1G7RA 1L9KA 4GU5A 2FW9A 4A7PA 4BGUA 2XUDA 4NICA 4WASA 4EB6A 3KQQA 4EJ6A 4AECA 3HYLA 4UAGA 1FMFA 1UC5B 2AOUB 1Z7BA 2TYSB 2XTMA 4HXGA 4XD2A 1DJQA 2RH8A 3C5VA 2QTVA 2BM9A 5T5QA 1GFIA 1G5IA 1HEIA 3OMXA 2JVKA 5AT1A 5K0LA 4MGEA 1GGEA 1CZOA 3HSKA 3OA0A 1I7QB 2Z58A 3HUTA 3FPAA 4RKWA 1E2GA 5D5QA 1E5VA 3PGJA 4PM4A 5I45A 3L7MA 1JFLA 1MGOA 1L5QA 2CL0X 1REQA 3O2SB 4X6XA 1Q7GA 1GRRA 2W2NA 3QYAA 4RX1A 1TA0A 5G4KA 2QL6A 1SUIA 2X0JA 3MEQA 5ERGB 2OV3A 1DSSG 2XIJA 2J3QA 5K0JA 1SH7A 2FUKA 4RORA 5LZ2A 3TBHA 4DJ5X 1BROA 5IT4A 4N3GA 4B3JA 3B38A 1Z2CA 3ZLTA 1DFGA 2D5BA 1T36B 2AFHB 2B2CA 3JAWA 4OUDA 5KC9A 2Y1WA 4N5HX 4WMLA 3WLMA 2TMDA 4HDNA 1KVSA 1D6NA 1R4AA 1BSVA 1SA0A 2XYRA 3D4LA 5LQSA 3OZDA 5B4TA 1PD1A 3GGCA 3K1TA 5IG2A 2YICA 2HSJA 1K7XB 4NF2A 3G2NA 3VV3A 1CJTC 5C35A 3K0KA 1E92A 4NNOA 1OAKA 5K1ZA 1NQAO 3KNZA 4EHJA 2QAJA 1RLUA 3WO0A 4ALIA 4TKLA 3LL7A 3WBFA 5AKZA 3S7TA 4AY3A 2Y77A 3UK7A 4EY6A 3T3OA 3JD4A 2DPYA 2QB5A 1ZD5A 3DR3A 4O4IB 5ILQA 1DQSA 3A14A 4X8OA 1LBTA 1IHPA 4D92A 1MAWA 2G63A 2JCYA 2GEBA 4QTXA 1G20A 2GEDA 4IMRA 4XSHA 5H82A 5JSYA 3R8XA 1OI3A 1SELA 3D3JA 4WE3A 2E55A 2G83A 5JAHA 1PQ4A 2DWCA 1RCUA 4L4SA 1GNQA 3DBHB 1FMCA 3IJ5A 2IV7A 4U7FA 3CISA 1X7ZB 2JFPA 3FWKA 4KI0A 4LTNA 4C22A 1Z74A 4LPKA 3D6TB 3ET4A 4BJHB 3TOSA 3S2YA 3CX7A 5ALMA 2V98A 1WZEA 3DOUA 3NYIA 4LJYA 5NULA 2OFFA 1CRWG 2F3QA 2VKQA 3CLUD 1H5QA 4X71A 1ODFA 4LV8B 2R11A 5DYGA 4FDVA 1JQDA 3JQ7A 1SCKA 4ZDKA 5ITVA 3THSA 4EI7A 4C3UA 1P9OA 3NYQA 1WXEA 2W2KA 5JUWA 1I33A 4RD4A 4GR5A 1OH8A 1RLTA 1JDUA 1JIJA 1XYYA 5A05A 3WJAA 2P11A 4YUVA 3U1VA 6ABPA 5M29A 1XVVA 1BIFA 8OHMA 1CEXA 3FLMA 3WRVA 2QZZA 4F2DA 2V7QA 4RA9B 4M83A 3U6BA 3MD9A 1I4LD 2D0PB 2GD2A 2LCIA 2Y0PA 3OIUA 3QH4A 4UCQA 4LOLA 3D4IA 3ETCA 4QWMA 3B8HA 2V4MA 2YFHA 3LQ1A 4P36A 1ZESA 1UEIA 2I1WA 3H4TA 4FLFA 1R3DA 2ZRLA 4B3HA 5FUYA 3JSXA 3QOXA 4OBBA 5KSPA 3T7KA 4B3BA 3FHOA 4BU0A 4P7BA 1RPZA 5JZMA 2AR7A 5JSKA 4W8GA 4ML3A 4ZVSA 2XZDA 5IF3A 5JXHA 3I9LA 4OK5A 1U28A 4UBKA 5DYTA 2QRVB 1B0PA 3BSWA 3NGMA 3TEJA 1AE1A 4EGJA 2IS1A 4CU5A 1NW8A 1A76A 4CL2A 2EKQA 2VWHA 4QELA 1Q6ZA 3OX3A 1QK3A 2NVBA 3PPYA 1ZMRA 3DPUA 4QWWA 1U02A 4PC2A 3J80A 1RABA 4I14A 3N9IA 3LCRA 1USKA 1YXMA 3VXKA 1SD1A 3F4BA 1PYGA 2FPGB 5KB3A 2GI4A 2BE9A 4W8OA 5DXAA 5TEVA 3ZS8A 1K08A 3A36A 3ZDYB 4F3KA 2O8NA 4XDZA 4F9FA 5MGBA 2Q3EA 2WD7A 5IEBA 3J81k 3REQA 1MXHA 2DBQA 1MP0A 4Y9UA 4B48A 1S9HA 4D7AA 2ZWAA 3A6LA 4CQNA 3R75A 3KETA 3PL1A 2BMFA 4ZOCA 1GFWA 3LBHA 1OXBB 1UT8A 4NR0A 4B43A 4UFNA 1JR3E 3EH1A 3IPRA 3WGLA 5JSFA 2YWFA 2DJ5A 2FG7C 3IIKA 2Q29A 4EHHA 1GGVA 3FPGA 3DMNA 4CETA 2IH2A 4B7AA 3F5FA 4WOCA 4KXMA 2HA7A 4YRBA 1E9RA 3H86A 1YZ3A 5F1YA 2QK4A 2O7VA 4LC1A 1LVGA 2CBZA 2WNIA 3DM5A 4FWTA 2EZ9A 1T9BA 1H66A 4FUTA 1DTEA 3V42A 4L07A 1H05A 1SU4A 1UZMA 2MYNA 4MYCA 1L9XA 2ZJ1A 1AN9A 3O3OB 3I3OA 4O25A 4Q3LA 4RGYA 4C07A 1L6IA 3C14C 3FTQA 4TYNA 1ZOLA 3D8UA 3NHPA 4EOGA 2BM1A 1JVBA 5FXMA 1BZYA 3SZ3A 4DDKA 2OAEA 4TV8B 4B4WA 1LRLA 3EULA 3PDUA 5IM4A 3PGLA 1FXWF 3AEXA 3KL4A 2DF8A 2CF5A 4PNZA 3URMA 1GL6A 3MJFA 5A6SA 2ZZMA 3FPLA 1I4OA 2I3AA 5EIAA 3SOPA 1EGVB 4B6GA 1EUDA 2QTHA 4G09A 2HWWA 4F5YA 1CZHA 3L7NA 2VYND 2G8LA 1GAQA 4KAXA 2Q5IA 2JK1A 5CNIA 3X2EA 2HUPA 3A3PA 5C3UA 3CUVA 5HZGA 4KPYA 3EGOA 1FDVA 2EJUA 4EX7A 3U44A 5C8DA 2WJIA 3DOEA 2XXJA 4LNUA 3UJ7A 2GTIA 3RASA 3D3NA 2X5XA 3PHBE 4G0PA 4KXVA 2DQSA 2WICA 1I5RA 3ORFA 4ALNA 3OJXA 4G26A 1IN1A 4MW1A 5HP4A 4XYGA 1K9SA 4A16A 3KSUA 3OEYA 5E1OA 2G7MC 1XIVA 2PVPA 3MINA 4V3BA 3IQXA 3UWSA 3L8FA 1NBHA 3I9MA 3U3JA 1ZCJA 3LY8A 2ZGVA 5HZMA 2IGTA 1B1CA 1R7RA 2UYHA 1CB0A 1BH2A 3I76A 4B6EA 3Q4GA 3RU7A 5TIIA 3BXFA 3OLYA 5LJLA 4A03A 4G0OA 2PMCA 3OWOA 4R0VA 3GVCA 3C4QA 4D8VA 3U1TA 2WYVA 3NBZC 4WZ6A 4YDQA 1YVUA 4AJPA 5LP6F 4O0MA 4IGAA 2W0MA 2R7MA 3AR2A 3ECSA 2UVPB 1W93A 1Z9BA 3RIGA 2XT6A 4CV0A 2WWWA 3OJEA 1BO6A 2DHDA 1UBJS 2P2GA 4MS1A 5EIOA 6NULA 2XGJA 1TUIA 4TLDA 1W96A 3TZQA 1GN9A 1NUTA 1W2GA 3TI9A 2BEVA 3WLFA 4TRRA 5JPIA 2RAUA 1GV0A 1WU7A 2FXVA 3M8KA 4J6EA 4OD0A 5GONF 2F59A 2G1JA 3SE7A 3WQBA 4RTRA 2DWOA 1OYYA 1V7ZA 4F9TA 1NIJA 3OHPA 4L9WA 3HFGA 3I8OA 5HF6A 3RIXA 1RRMA 5K0SA 1GYPA 1YB2A 2OHFA 4HVTA 4WCDA 4ZPXA 4K2AA 3KQUA 3DULA 4YP6A 5H68A 2XDWA 5U4XA 3VH3A 1HG0A 1OFGA 2HK9A 4KVFA 4WN3A 1UZAA 2Z0MA 3GBSA 4FYXA 5I7FA 4IV8A 4IQGA 2V1UA 2WNSA 4PPFA 2O7SA 1US8A 2AN5A 3HCFA 3HB7A 2VA8A 4Z7JA 2FR0A 3N3AC 3U19A 4DKXA 5K6TA 2ACKA 4K6OA 2OOSA 4LGYA 2RHMA 3OIVA 1R6XA 1K8RA 1T29A 3D6NB 4QPCA 5ECWA 4M54A 3HA7A 4DR4B 3GJ4A 1ZD1A 1FFXA 2I22A 3PWTA 5ALUA 3ZIUA 1JHMA 3LYUA 3AV3A 4HC4A 1OGIA 3ZHVA 1GQRA 1U7DA 5DYIA 1Y81A 3H5AA 4DCVA 2WKWA 3K16A 5CB6A 3COJA 3EQ9A 4JLAA 1I3CA 3W2HA 2LV8A 5CFRA 1U8CB 3FH0A 5I9BA 2ODTX 1PL0A 4DWJA 2Q5FA 1C41A 2PGNA 3CRZA 3E0XA 1D2AA 1OKKA 1ZOSA 5L7YA 3QM1A 2HJHA 3G59A 2IHKA 2J0EA 1JG2A 2EQ5A 4FNGA 1KY3A 1E1LA 3OECA 2CCKA 1Y80A 3HZRA 2FXIA 1NBMA 3QZUA 2VOJA 2ZDGA 1EFAA 3LGSA 1QF7A 3LQQA 4XGQA 4KQFA 1ENZA 3MRSA 3VVLA 4XX1A 3HDYA 3IXQA 4NONA 3IUPA 4CLRB 1SKYB 1XMXA 5EUCA 1F2UB 3F5DA 3VHXB 2ZIAA 3P9XA 1JE0A 1VKRA 3ADCA 1SKYE 3PE3A 3JTEA 3GP5A 4LUCA 1YMUA 1G5QA 1RRFA 5THXA 4RD3A 1YVDA 2ECKA 4FVTA 4J8PA 3N2IA 2B8WA 4OHZA 3BWMA 1SBTA 5DM70 4K9DA 2FFRA 4BATA 1MOPA 1T3LA 3AZPA 3R7LA 4BNJA 2B1RA 4N3AA 1VDMA 2DBYA 3MWGA 3I04A 4I6EA 4I1RA 4BAGA 5JS8A 1C1XB 3CZ5A 1GL7A 4FHDA 3QMVA 4TV9A 4ZP1A 3U09A 5JQGA 4OJNA 5CCEA 1V5IA 1VYTA 1HE1C 3SCZA 3HCNA 1Y8RA 5KVQA 3W8RA 1DUVG 1CUVA 1NATA 3GFSA 2EBWA 3ASZA 1JXAA 1ZM4A 2AIRA 1UM9B 2XH8A 5GM2A 1NJSA 4FNMA 5LQRA 4QYIB 1KL7A 2MSEB 3HJGA 3AFOA 3Q9NA 4BO5A 4CLEA 4EHDA 2PV7A 2WBLC 2BKXA 4L15A 3QY0A 3SHTA 4QDKA 1OBCA 3UKJA 1EEHA 3H1BA 4LWQA 2BM8A 5G0SA 3GWGA 2FP3A 3H1FA 4WBNA 4DV7B 4RKQA 4KR9A 5BRNA 3UPUA 2QPLA 4ZT7A 2DLDA 2HKIA 3CKYA 1OTXA 5A5EA 2FWPA 2PHZA 2XAUA 4GI3A 1DTWA 1P61B 5LQJA 2WT4A 5A03A 3HU2A 4F2HA 4D9EA 2X40A 4IOLA 1YHZA 3KPUA 5JDIC 2PL5A 1KFBB 3LA6A 1ZQ9A 3KQKA 4MR8A 1EG2A 1PFWA 3VOSA 4FYYA 4MRSA 1YQQA 4UE3S 3TMAA 3GLIE 1L8LA 2VPXA 3FA2A 1M6HA 3N7UA 1Z3IX 3Q8XB 2A84A 4E2FA 4ZIRB 2D00A 3THYB 1G5PA 2RGDA 4O8CA 5HFNA 3NM6B 2VPQA 4I4TA 4C0AC 2WWTA 1YFLA 4D5EA 1FTSA 3T6KA 3THOA 1GYRA 1S96A 2FLWA 2HBQA 4JU8A 4PLFA 3KQHA 3ZGZA 4KQKA 2QTWB 5SYMA 4YRJA 1JP7A 3NBAA 4IRUB 1ZH6A 4UCFA 1KMHB 3LGXA 3O94A 4XUDA 4EA8A 4V38A 4DNOA 1Z2DA 4F97A 1MGPA 1NU8A 4JXXA 4WKNA 2JDID 4IS2A 2WF7A 3D4NA 1T5LA 1YOBA 1VPVA 1WVMA 2IV2X 1CUCA 1X2BA 2IFTA 3TEMA 4EUFA 1RLOA 1I10A 4FDTA 4PZ9A 1Z7YA 4D4GA 1JJAA 3BFVA 3T3IA 5L7TA 3PWZA 4H15A 3EFHA 3PEUA 3IBGA 3ICPA 4KQMA 4Q1VA 4X0EA 4ALJA 4EGFA 5FX2A 3AINA 1E1CB 1JPNA 2GTPA 2I03A 4MRMB 3CMMA 3PYMA 3M4JA 2GVZC 4UDOA 4EW2A 3VSDA 4J1NA 3PJEA 4M22A 4AL4A 1PFUA 4HV4A 2VJQA 1QG4A 3FJYA 3SXUA 4XVCA 5COQA 3ZK8A 1LSJA 3N6XA 2IZ6A 3JRNA 4QFDA 2ZBQA 1J00A 1CHNA 3MTQA 4J0QA 2VCYA 4JQCA 2HBZA 1OFIA 3EZXA 4ZAGA 2KX7A 3G8YA 1AXEA 4BJ5A 3U7QB 3FW1A 3Q3CA 2NO0A 4BQPA 1TYEB 4ND8A 3RJMA 3QWBA 1GKIA 4JBXA 4JBHA 3L4BC 4F60A 4V3CA 2J3HA 1OGJA 3DMYA 5KHLB 3CW9A 3TXYA 5I51A 4AG6A 5CPBA 3BMOA 4A0HA 1GGMA 3QEJA 1ODJA 3RJ5A 2GZRA 2ID8A 4CL0A 2ZVQX 1VLZA 5K99A 1U7OA 1DP4A 3O75A 3FM9A 3H7AA 3O8OB 4YT8A 1VJ1A 2B6HA 3LG2A 2VAVA 4YPOA 2AD5A 4C7KA 3FD8A 4Y0NA 3W5SA 4BVJA 2JJMA 1C4WA 1M6YA 2J45A 3BF7A 4B17A 3GI1A 2LKDA 1OX4A 1JHUA 3IBCA 3VUEA 5FL7A 1JFVA 5K0FA 2IDMA 1Q1EA 4LFCB 3L0DA 4LGCA 1G55A 3E18A 1RAGA 1C30B 3I45A 3U4IA 4FHEA 1LXCA 3UFBA 2B2NA 2I6SA 1XCPA 1ETHA 5ALFA 3T61A 3U81A 2HMYB 5LYJF 2AWOA 1VFPA 2J3IA 4H27A 5KAMA 1VYVA 1N92A 1L4FA 2J5BA 3F6EX 3RBXA 4R3UC 5CAEA 3W4KA 3E27A 4Z86A 1XGKA 5BT9A 1J5XA 1NMZA 4LX0A 4PGHA 1BMQA 3MJTA 2EWVA 3P9PA 5ULLA 3A3KA 1CEEA 1SCBA 3U4DA 2R87A 4WKPA 2PG3A 2RC6A 3QTBA 4YBRA 2JRCA 2H1WA 2ZQ5A 1LKZA 4GMXA 5FRDA 1Z2NX 3FF4A 4IWXA 4LTMA 3TNFA 3BSYA 4PC1A 4CDNA 4QUGA 4G97A 2XCRB 1F6BA 2BFEB 4FINA 4EECA 2F55A 1N6NA 2B3DA 1YZNA 1NYTA 4GT1A 4N7MA 3YASA 1GZ3A 1KDOA 2HBYA 4P32A 5EWLB 5BQFA 2BZSA 1Q57A 2AH5A 1JEYA 1N2GA 3GAFA 3L79A 4A2WA 3ILVA 1RYHA 5BV7A 3C1UA 2P2YA 2QLJA 3CRMA 3GOHA 3AQ4A 4IM7A 4B2IA 2XB2A 4K28A 4MTCA 4Y2TA 2EYUA 1I1OA 1JLLB 2QVXX 1Y3FE 1PJSA 1U2QA 3G0GA 3GOQA 3JZIA 5CDFE 2OQIA 3T54A 3R5JA 1F2TB 1YZHA 2V7WA 3VU1A 4EG8A 4BQQA 1Q3KA 2XVYA 4WL0A 3JSAA 3IPCA 1M1ZA 3E35A 3LXMA 3OQ6A 4MUHA 4KUEA 4PQEA 3R74A 1XXLA 3K4PA 1KKMA 3RR2A 4DYHA 1L7AA 2Q3CA 3ZBTA 5J2UA 1U63A 2CCJA 3W8EA 3FR7A 4PYOA 4OLFA 1ZISA 4XGNA 1ZAYA 3AHGA 2QU8A 4YAEA 2AYXA 3LLVA 3TIFA 4GI1A 4G9EA 3H6GA 3GX1A 4MJXA 3EAGA 5I9IA 1NVXQ 4FZ5A 3BHMA 4PLYA 3KQMA 2GF2A 2IUEA 5CXSA 5E8JA 2LCQA 3RFCA 3B6ZA 4Y2HA 4D82A 2DUWA 2ZI7A 3K70B 4DPLA 3WB9A 5JEDA 4PCLA 3GLHA 4KNWA 5K0EA 2O8BB 5D3QA 3KQLA 3BXXA 4D4MA 4EABA 4EW1A 3PZRA 4IJMA 4KTVE 4BNIA 3EOZA 1YVRA 5JZVA 5FV4A 1GSHA 1EK0A 2VZ9A 3U9SA 3VKWA 1ZJ5A 3H3JA 3RAEC 3M1LA 4Q00A 1XZBA 2J3LA 2NYAA 4IFTA 4MUYA 1ZYUA 4Q9LA 4A8JA 4KP7A 3X1MA 4MV0A 1CR4A 1OAAA 1XTPA 3AVPA 3NHZA 2X2EA 2WC1A 4RIFA 4UDYX 2HLHA 3QLTA 4F4FA 4RZIA 5AK4A 4CMGA 3FNFA 1II0A 2QUHA 2GXUA 2B1IA 2FPSA 3T0GA 3VR5D 2Y2UA 4I9FA 3A06A 3EGXA 1VSQA 3K9HA 3O6VA 4R2KA 4YACA 1P7YA 4B31A 4X62B 4YTEA 3AUFA 5A5GA 3JQPA 3D6HA 4YLGA 3VPBA 3TWOA 2N47A 2RGXA 2OBBA 5LP6B 2I0FA 2JPDA 1ZNYA 2OOKA 3H8SA 1UMBB 2QE7A 4ZVNA 3GLGA 4LBYA 1ZRNA 1ISRA 5G3ZA 1IG0A 2DBVO 4MJLA 3RJTA 4ZOLF 1MT3A 1YMQA 3Q7QA 5FPSA 2P90A 2P9TA 2AJBA 3V1LA 5ESWA 2E1RA 1WDWB 4B71A 4XD7D 1JQEA 5CT5A 1LI4A 4KEAA 5KYVA 3EZYA 1YR8A 1SUPA 5GONB 1KJJA 4D4LA 4IV0A 2RGRA 3V46A 1ORDA 4N01A 3PC8A 5DM60 1ZP6A 1XCLA 3DEIA 1M1UA 2H4FA 1MW8X 1GG8A 2JI7A 4H08A 1YL7A 1I4EB 4HYQA 4EG1A 1FRNA 1OFTA 2Q2WA 4H16A 4CM9D 5F5XA 1QHNA 1CUGA 2WD9A 1MB2A 3O1HB 3UMSA 3KFVA 3RKRA 4CTJA 4EQ6A 5KJ1A 3MUEA 1LV8A 4DLTA 1T0BA 3C8HA 4GSKA 2YRWA 4J7AA 4JOBA 1Z33A 2O57A 3RUCA 1N9GA 3S2IA 1A1VA 5TQ2B 4I2VA 3AK4A 4MZXA 5C4IA 3VHLB 2VYVA 3L7LA 2ZW9A 2HU7A 1RXIA 4KLCA 4Q1EA 4BN5A 2VRNA 2Q1TA 2IW3A 4A6PA 3H2KA 2H1LA 4YCAA 4CEIB 1MQAA 3TH5A 4G8CA 1HSZA 1PQWA 2I6XA 1KPHA 3GG9A 2EX1A 4WCFB 3DMGA 1UBGA 4MYDA 2XUGA 1NVEA 1SCAA 1U5BB 1LTQA 2PS0A 2ZRBA 5AXCA 1VYUA 1RLIA 3FDFA 4TM7A 4HKTA 2V6IA 3MMNA 1RRCA 1MMFB 5A5DA 3L6OO 4X20A 4Z3OA 1QPBA 1RLJA 4QREA 1CHDA 4PRKA 2D74A 4Q7LA 3W7BA 2GFIA 1JPVA 1WB5A 1Z5PA 3M5PA 2M6LA 1RQLA 3AEUA 1YZUA 2XWQA 5I7VA 4DMFA 5JJ5A 4BX3A 1RJEA 3GEBA 3BMQB 4JFAA 4R9RA 4C2TA 3IPYA 1IOLA 1E94E 2V8BA 1MJ5A 5FORA 1Q0LA 5HCUA 1KZGB 1LBEA 1U31A 1VJ5A 3AHFA 3I6QA 2PZ8A 3B6MA 3HB9A 4G2TA 4AJ1A 3KJQA 1EFPA 3TKAA 5L9AA 3UQZA 2GCOA 2CVHA 3A9UA 3AUYA 4R0MA 2OV4A 2ZXFA 1M2GA 1ZQ1A 3N53A 3P2IA 3F49S 4MVJD 1L5HB 2RHOA 3E9DA 4NU6A 3NTLA 1LNZA 3V1NA 4KR7A 2IZ0A 4MR7A 1I3OA 1T5OA 1N3BA 2Z4TA 4LYAA 5F12A 1XMQB 2A5FA 1AN0A 2GXSA 2BI7A 2SCUB 1LD3A 1Z06A 2DULA 1KEWA 4JBLA 3WZLA 2QUJA 1VE7A 1BX3A 3NBUA 1S01A 4ZREA 3T3EA 2IP4A 3I1FA 4JEHA 1DIOB 4JQZA 3C8DA 4FOLA 1AKVA 1M1YB 3KXPA 4M0KA 5EPUA 4ADSG 4PQFA 5EZYF 2NU8B 2YJ6A 3G8DA 4KXXA 5LZ4A 3CZQA 2UZ0A 4DKJA 4EK9A 3UMCA 1M1YE 4FOTA 4BFWA 4MVXA 2ASEA 1TFUA 3LI2A 1XYVA 5LQMA 5ICMA 4DR1B 4KWCA 4UBJA 2FMXA 4Y1GA 4JXZA 1HEUA 2X3FA 3AM1A 1YZVA 2YNMD 3BL5A 3WIBA 2GEJA 1EFRA 1OBHA 4J9UE 1N0WA 1N2CB 1RQ2A 2BHTA 1BEUB 3E7PA 5CCXA 2EBHX 2Z8YM 1ZM9A 2PKEA 3ZIAD 1N2CE 2WI8A 3ZQ6A 3BD7A 3VYTB 1ECJA 4KXUA 1NXWA 2FN8A 1KNXA 1XCJA 3V1TC 7YASA 4I1OA 4Q16A 5IDQA 1JI0A 1PZHA 3WL7A 4OLBA 1PR1A 1M54A 1WMEA 2BCEA 2Y2VA 5AQ1A 4N9WA 1XNJA 1DIAA 1E4EB 1T1GA 1UADA 2GFQA 4D44A 4E51A 4GP7A 4AJNA 1T1JA 2DZDA 1T26A 1I2ZA 1UBUS 1ORHA 3WHPA 1VJTA 4FD3A 4BDSA 4KFCA 1XPOA 1XJ5A 2QY6A 3I9FA 3NOQA 3NP9A 5T67A 4EELA 4LCBA 5ALSA 1GRNA 2HBRA 3DAYA 3OCXA 4Z2AA 3MMSA 4G4JA 1DO2A 1EJ2A 1LRJA 5ES3A 4CMEA 1I2DA 3GJTA 1XWWA 1KJQA 5D6OA 2HNBA 2W6ZA 3U3DA 1FX1A 3NHBA 1RACA 2CVOA 3D4OA 4CT0A 4H17A 3SEFA 1L1RA 4Q4CA 2Y1GA 5KPDA 1EDBA 2FI1A 2HIHA 3WP0A 1CZRA 1ONSA 2FKNA 4Y2GA 1DDIA 3CRVA 3ZK9A 2PXXA 5IW8A 1Q1NA 4XDGA 4LMAA 1M2OB 2KBFA 3GNLA 2G1AA 4GC5A 4N5DA 3OPXA 4XCVA 2ZIVB 5E8RA 1J2UA 2X0KA 3HKDB 3SBXA 2BOVA 2PK3A 3K73O 3EFEA 1RQPA 3KPWA 3VVCA 1A7AA 5CDFA 1YBMA 3HCAA 1A5TA 2AQHA 1AUQA 2XB9A 3JWHA 4ZPJA 2IWRA 2VA9A 5L4SA 1CPYA 2VP3A 1HK7A 3BCHA 2Q7DA 1RBYA 4G07A 5ERYA 3CH4B 1T4BA 2WJ4A 1NSTA 5FNVA 3G2IA 2J4DA 4G1UC 4PN3A 4NIMA 2UVQA 2O2CA 3AG6A 4FOOA 3MW8A 3UVEA 3AVOA 1JT9A 1JHRA 3NIWA 3HJNA 2B8JA 1W0KD 3CUWA 1N57A 5JD6A 3NMUF 1DWUA 3UPDA 2HA4A 4PNPA 4XWTA 2CNDA 2SKDA 2WILA 4MB0A 1GCGA 3H8JA 3GPBA 3L4SO 2RH9B 5JSQA 3NLLA 1JA1A 1Q0QA 4IIFA 1K75A 1P3DA 3LCJA 4ARCA 4Q12A 2BH2A 4IW3B 1FTQA 4KWTA 1O6GA 3ILXA 5JXGA 3ZXSA 4Q34A 1GNPA 3BJIC 4R68A 4A2QA 4F1JA 3VYSB 1NOKA 3IFSA 4J0EA 4X6LA 1SG6A 5DHQA 2J7PA 4ZQCB 1GZDA 3E9NA 2D0DA 4FP9A 2FX5A 1SM4A 1B0AA 5GZ1A 3ZD7A 1XPRA 3WYCA 5EHQA 3DZHA 5CW1A 4A8TA 3KPJA 1MW9X 3DNMA 3E05A 4BC1A 5LYJB 5LMUB 1NV8A 2DHRA 2IC5A 2CJWA 2OLKA 4QRDA 5I9SA 3H04A 3I28A 1IN7A 2FPUA 5JBQA 3PUXA 4MPJA 5FT9A 4IIJA 2C9OA 4GMHA 4R1NA 3U4AA 1FFSA 4TTJA 3EEFA 2X7HA 4PLPA 2HF8A 2HAEA 1STOA 2G67A 3EIUA 3N2ZB 5EGSA 3VR4H 3EDQA 1YI0A 4A0GA 5BUQA 2WTMA 1Z25A 1SG0A 4NJEA 4XRRA 4Y1EA 3W78A 4E33A 5JISA 2R4QA 1E9EA 1VL1A 3AI1A 1CT9A 3K53A 2AF3C 3DYIA 1SXHA 3KTAA 3MF4A 2AFVA 5T4EA 4RSRA 5ELXA 4CR8A 3OMWA 3K0FA 4R1PA 2ESRA 3LY7A 4K40A 4YXWD 2AB0A 1DARA 4BCDA 2QV7A 1A97A 2ZJYA 2HFJA 1MBZA 1BN6A 1K8QA 1N33B 3CR8A 4R40A 4XB6B 1EHYA 3TLKA 3ZKWB 3G49A 5F7ZA 2Q41A 4LA4A 3ZXXA 4DQVA 4RM3A 3AM3A 1LV7A 3IE0A 1PD0A 3C5HA 4M1SA 5JTTA 2L19A 3U7JA 2PUTA 4B3RB 2XT0A 3ENNA 1XNRB 1X92A 1AD2A 1Y9DA 1PJTA 1CUDA 1XKLA 2YCBA 3BUSA 3I8SA 4TXMA 2HNAA 2WP0A 3T41A 5JBNA 5FI5A 1T4CA 1ZN8A 4KIFA 4E2WA 1XFAA 4UU7A 1QAMA 2YIMA 1JHXA 3SM9A 1A4XA 3R6DA 3VSBA 3MAAC 3STVA 5KYUB 4KQ9A 2A1UA 5F7XA 1P2DA 1TCAA 3C41J 4ZZIA 2NSHA 5GMOA 2YY5A 4QXOA 1YR2A 1FDRA 1AO0A 1BS2A 2F48A 2OGUA 3EVTA 1QU2A 2XMCA 2ZKLA 2KLBA 1RU3A 1V2HE 3NHAA 4IVPA 4U00A 1RYEA 4DG9A 3ERCA 5JROA 1QHGA 3CPJB 4UDXX 3PNVA 4YP7A 2B4TO 3FOZA 1Z5GA 2KBEA 1RJDA 3PHIA 1NKTA 3LDAA 5I7HA 3RFTA 4BGEA 2B36A 1L7PA 5FUQA 3R3JA 2F00A 1IPFA 2H1SA 3OG9A 1DZIA 3SC2B 1WUTA 1D1SA 2YVUA 3II6X 1GG9A 2F4VB 1QIFA 4HGOA 4PYNA 3RS0A 3LWNA 5BNWA 3HB1A 3UV6A 1ZI6A 3QELA 3IJPA 3MWKA 3OLVA 4Q6WA 1R2QA 4B7CA 8ATCA 1XHFA 1R0RE 3D4BA 1E59A 3O26A 3Q0EA 4IS3A 3TGLA 2XRZA 3BGVA 2GYWA 2QSYA 3OJFA 3ASVA 1JEDA 3OTQA 3WV4A 4QLBA 5AW8A 2Q5JA 4BX2A 3I72A 3EXG1 5EJ7A 5KEIA 1RKUA 2ANCA 2DOKA 4E5KA 2Y05A 4MEJA 4KBFA 5EMNA 2BGGA 1VCMA 1Y3CE 1UP7A 3AHJA 2WHXA 4ZQFA 2CF6A 2CXHA 4H7HA 2P0AA 1X80B 4IKPA 3FCYA 5KX5B 1TPZA 1RKQA 4GPD1 1Z62A 4CT4B 5CK4A 4PS1A 1KXZA 3SSNA 1KYZA 4N49A 3K6SB 4HLDA 5HR5A 2OLJA 1N5IA 1PZXA 2F2TA 4ZODA 4XEUA 3H5TA 2C9ZA 3DDWA 3L4EA 5FBKA 5AVUA 2BGJA 2KSQA 2GBPA 3NVDA 4MW2A 1QPGA 1DFHA 2BC9A 3LWZA 2P3LA 4YUXA 2IPNA 1PGOA 3BFPA 3G2QA 2ZSHA 4YT4A 2Q6OA 4N76A 2IEYA 1T5TA 1CY1A 2QZ9A 2A0FA 4K8RB 2P69A 1XG5A 4HYYA 1ULBA 2RDMA 1A5SB 1NFFA 2WT8A 4CJXA 5AK3A 1U0JA 3O90A 3OU6A 1O9HA 1K3FA 1CQZA 3P4UA 4ZC8A 2AKEA 3R3HA 4EMBA 2BCJQ 4FI3F 2CDRA 1QIIA 2WV7A 2P2DA 5ALVA 1GFZA 3IPAA 3A0RB 1ZC4A 5BSRA 3CBGA 3GZNB 4MPRA 2OXTA 1E0SA 4I4CA 1HE4A 4HX9A 1BMFD 3VH2A 1D0VA 4GL4A 4ZQIA 4Q6BA 4RJIA 3B9PA 3JQBA 4L4XA 5FA6A 3EEOA 4QLAA 3QE3A 4US0R 3G5MA 5IM4F 5FI3A 3A4YA 2AKYA 2QE7D 5SZKB 4QG7A 3D64A 4YPFA 2BCGY 4QVKA 3ZDAA 4HNGA 1U7XA 1VPEA 1EA5A 4XQ9A 3VOBA 1DPGA 1ILWA 4AKIA 2PLWA 5HYVA 1YRHA 3P9SA 1HE3A 1XD2A 3CJQA 3A2KA 3PXCX 4OHCA 1U7PA 1VPTA 5K01A 2W8BA 4QASA 3WGGA 4RE5A 4FB5A 3D5QA 3LZ6A 5EZSA 1B4DA 3NALA 4EVRA 3U4QB 2YZNA 4JCCA 2IHYA 3KQSA 1C81A 1JGTA 4MH0R 1ZU4A 1N2JA 1FLAA 2D2FA 3V7FA 1C7ZA 4QDXA 2ZSJA 2RJOA 5DSTA 2ZR7A 3QLVC 1LZKA 3EAFA 4ZT4A 2DKOA 2GKSA 1JSCA 4E6PA 1MDFA 1ZSYA 1X7WA 4RLSA 2UUOA 4MZDA 2CNOA 3U5TA 4LGMA 4G01B 3K6JA 3MJCA 4PXYA 3H16A 5I01A 4D9MA 4CF7A 4KO2S 4IOMA 2GVDC 2PQ0A 4B2LA 3MLEA 5AUOB 2AQ8A 2RARA 3AIIA 1QC5B 5BN3A 4DV2B 3C2QA 4DV3B 3OPMA 2W71A 1TZ2A 4D8TA 2AEFA 3BILA 4PPQA 1G19A 1E2IA 2PGXA 2YHBA 3IO5A 3JQ8A 4L75A 1EXNA 1BGWA 2QX4A 1O95A 4E2YA 1T3GA 1D3AA 3DR5A 3HDQA 1X0VA 4IDOA 1E0DA 4PYRA 3WDSA 2NSYA 3ACCA 3LYLA 4ZCMA 1FBTA 1IEXA 1K3TA 3OCWA 2OHGA 3EY4A 1YA6A 3B1ZA 4GW3A 1Z47A 2GCGA 2OXEA 2QAIA 3LTEA 5EZYB 3T9EA 1U1CA 2J8ZA 4ZQEA 2HA6A 4CDMA 3NANA 2XVMA 3EGDA 4C08A 2PLFA 5G0UA 3RU2A 1E5LA 1UDXA 5J2TA 3DB2A 3L8ZA 1EFVB 1YDHA 3BULA 1L8AA 2QDXA 3OZAA 4Q1AA 4QNMA 5DGDA 4DW8A 1KBQA 3HB4X 1H2YA 1MF7A 2I29A 1W30A 1TJPB 1SVOA 3HGMA 2G8NA 3OPQA 3DTTA 1UOPA 1JJFA 5TSDA 4YLYA 1SD2A 2ZRPA 4G5XA 4J0GA 1RWWA 2ZYIA 4W5WA 5IDYA 4EVQA 1Z82A 4C01A 5K6AA 2P2CA 1IVNA 3GD5A 3WL5A 1GRCA 2Q45A 4JSTA 4RK6A 1MPXA 3L6CA 1M8FA 3UJHA 1ZFNA 4HGQA 3IOMA 3S7ZA 1WF6A 4C6RA 5KNDA 1I7DA 2F3UA 2MU1A 1WZIA 2FW6A 5FPPA 5LBIA 4MVJM 3BSFA 3I5XA 2GA8A 2WPDA 1KDTA 4TZKA 5CA1A 3PQEA 1R6AA 3BWDD 1W94A 3L01A 3HNOA 3K5HA 3ZZNA 4YRQA 5BQ3A 5KYNA 4Z9FA 4F5EA 4RS4A 3F3SA 5JSZA 3HKCA 2LPMA 2QR3A 3HY3A 1W0JA 4OI1A 2AGVA 3E82A 2WD8A 1JQJC 2OVBA 1C3EA 4RHUA 1V4NA 2C57A 1XCOA 1OFUX 2QROA 2ZWIA 1Q7CA 3J7TA 3KUUA 3UJ9A 4B47A 3PR3A 3IQWA 4AUNA 5KOHB 1FTGA 3JCZA 1OQAA 1VKJA 3PNYA 1Q0ZA 1SQ6A 2PCLA 1N1EA 4EUKA 4JUAA 1RJ9B 3DLPX 5E2BA 1Q91A 2H4YA 3ZY6A 1QDLB 1F6WA 1E2MA 2E1PA 2Q3HA 3R7FA 3F3KA 3IOBA 1ZJWA 1NZFA 4ZCQA 1NTOA 2ZRIA 4U3JA 4EJSC 2G5TA 3CPHA 3DDCA 4W82A 4DCJA 4DCCA 5JCZA 2PY6A 2C99A 4OFXA 1MA3A 4WNIA 1K6XA 1M10A 1V1RB 3BD6A 3F98A 5DCYA 1LH0A 3UB4A 1SCJA 2HU8A 5BN5A 3ZV5A 1IJKA 3ZWVA 5FTLA 4EJSB 2AZTA 3GJRA 2GNAA 1XZKA 1Q15A 2FN3A 3L46A 1QM5A 1ZN7A 1KDPA 3HCWA 3I04M 3H8WA 5K2MA 5AW5A 2PBRA 3QFSA 4EB6B 3C3JA 4TV9F 3WIVA 2WUEA 4HPWA 5JQGF 1E9DA 4MQBA 4MDYA 4J1QA 3ZHUA 4ZYLA 4XTRA 1MVLA 4QYSA 2ZJ4A 3FETA 2ZJOA 1AKQA 1PFKA 3LKVA 4GNRA 3U4GA 1TJ4A 1YBAA 3FCAA 5FO0A 1V7PC 9MHTA 4TLMB 4PO8A 2FPOA 1UEJA 3KHKA 3H9QA 3P9IA 3ZWMA 3V1YA 2AR9A 4HYEA 3EY9A 1F0PA 4IF6A 1REQB 4UTXA 4WBNF 4D96A 2QRUA 3KUXA 3OHSX 2GD6A 3ZQ4A 3ZE6A 4CTOA 2J6BA 4MCIA 1SAYA 2RAVA 3PTAA 4EKIA 4IDEA 2QVZX 4Y8VA 1KAQA 1KSHA 3MS4A 2F1OA 2IH5A 1UJNA 2W37A 3EPRA 2FZ5A 3Q10A 1BN7A 3JAWB 1HNNA 4JWKA 1NY6A 4OUDB 5DHRA 4Z4HA 1VKZA 1MRZA 5LC1A 1P9WA 2ZAGA 4ZT6A 1EBUA 1RPNA 4HDNB 4BEWA 1SA0B 2GAJA 4IZHA 4JLPA 4ROSA 2EX4A 4XYLA 2WTAA 1U3DA 4X5OA 4JI3B 3OP4A 1V8ZA 3C7TA 2OKGA 3AZOA 1KNQA 1XE3A 3F6SA 4X8HA 4B3IA 2F90A 2WWHA 3DP7A 1YRLA 2O5RA 4LZZA 5HFJA 3R7AA 4I4TF 4N7JA 5K3FB 1UAAA 5I7OA 1Q0TA 3V2UA 4JWTA 1DU4A 1SUFA 4G0UA 1GPAA 4OYYA 5B57C 6ADHA 4EAQA 4MYHA 2JCSA 3STHA 1P31A 2JJQA 3Q11A 2OECA 1G20B 3H75A 4OK6A 1TZBA 2V65A 1ML4A 3V8EA 4RVUA 1G20E 5KSZA 2VJBA 3PHLA 3EIHA 4QOJA 5IJAA 1HZZA 4D80A 3KYIB 1IM2A 1UPXA 1F4PA 3ZE7A 3BFJA 3BH7A 2H6EA 4KV9A 2DTEA 3DUWA 3FUWA 4BQRA 1DDGA 2M6SA 4FE3A 3WI7A 3D8NA 4XWKA 3UCEA 1X15A 4FNAA 1OIWA 3PI6A 2YW2A 4NMWA 5LWQA 4FN4A 2HGZA 4CT5A 4NESA 1W2WB 3HL0A 3HSSA 2ZYGA 3IQEA 1QRRA 3HL4A 1Y1SA 2VYQA 4RABA 5M3BA 3T5PA 3JQ7B 2JLZA 2REOA 1U2GA 2FZGA 1RYMA 1DJOA 3HVIA 3MGKA 3OIDA 4GZ5A 4IJ5A 5DNVA 5SZJA 4J3JA 4X90A 3LT1A 5IJ0A 4AY6A 1T6NA 3S1SA 4EZBA 1VCHA 2O8FA 1JWAB 2B9VA 4D0LB 1CYEA 1RYBA 2HHJA 5EN4A 3TRJA 1FOEB 1CG6A 1ZBDA 3ET5A 3WYBA 1ZNWA 1XRPA 3L7YA 4PO9A 1YOVB 2K2WA 4NYIQ 2ZBPA 4QXQA 1O6FA 1RYNA 5LUBA 1TKCA 2H59A 2J9GA 2YN0A 3H83A 2GO7A 3K2QA 3L9XA 4GXTA 5IHPA 5JATA 4KAJA 3AF3A 1N2SA 5E4TA 1X7DA 2I54A 3EMKA 2RJNA 4FFWA 1GPUA 4P2BA 4EF4A 1SVWA 4X91A 1WIWA 4KE6A 4HUJA 5E6RA 1OYOA 3OZXA 3VPAA 4GPIB 4HBZA 5KTRA 1UBNA 1WQ3A 2ZJ6A 5HSGA 3HVKA 1NJGA 3TZHA 1GM5A 4XVQA 1SD5A 3I9NA 3UW3A 4JOCA 5ARDA 2UXCB 3QSYA 5CW2A 1FVFA 2YYZA 1M6VA 3EIXA 5TR9A 2ATIA 1F1JA 3IAXA 4HB4A 1GPH1 3K9CA 3TQRA 1B76A 1NNUA 2WTEA 3D0QA 4CKBB 1QSGA 3W3ZB 2NYRA 1SHJA 1L2TA 4LI0A 1T4DA 3CG0A 1PL6A 1QO0A 2DFVA 5DCLA 4HN9A 1TCCA 2JFXA 2OZPA 3P4XA 4UXJA 2J9RA 3C70A 2JIRA 4P54A 1PJ2A 3Q7SA 5BUSA 4AQYB 1FP2A 3ZDZB 5T6MA 3EQ2A 2OPHA 4UAJA 4KO3S 2WD7B 3IP8A 2BTQA 4Y2YA 2OP0A 3REQB 2HMUA 3PLRA 4CM1A 2GTHA 2KS6A 4Q3CA 2Q8NA 1QLHA 1DXQA 1E6MA 1SIUA 3IILA 3UO8B 2YQ4A 1MAUA 2PL1A 3BM5A 2OXCA 3B6JA 4C3VA 4FC7A 1GDDA 2P4HX 4QJIA 4ZHSA 4MGZR 1CRPA 3GBVA 3I4CA 2BF7A 1NPYA 4ZFNA 4MW6A 2VJAA 3G5LA 4Q4AA 4U2DA 3CS3A 2EFJA 3CNNA 3TEFA 1E0AA 1YZFA 3F2VA 2HEGA 2C5AA 2MR6A 3TQTA 3SE0A 1SN7A 5TPZA 3T38A 4A92A 5KVAA 3LYHA 1ULZA 4C14A 1MENA 1WXFA 1Q2UA 5GV8A 1Z15A 1GLVA 2D1YA 3FRJA 3UAYA 5BXYA 2E6UX 3Q9LA 1ZIOA 1QCYA 4MGKR 4MKFA 3ER9A 3S81A 221PA 2C9MA 3F0TA 3T5GA 5A2QA 1EP3B 1WP9A 2JGEA 2RGWA 3BRQA 4EGSA 5J2UF 4GPAA 5FUMA 2C29D 1RQ7A 1AKUA 4UTPA 2AEJA 16PKA 1HG1A 3DLIA 4KGVA 3T3GA 3QE9Y 3VKGA 4D42A 2AN3A 1VLJA 3A6FA 3SF0A 1MFZA 4KO1S 2EV9A 3O92A 2Z1DA 2EFGA 3ED5A 5A6SB 1DS6A 4BXOA 3KJHA 3MVEA 2B35A 2YWBA 3E9RA 4E32A 5TF4A 3CT6A 3GJ5A 3PGVA 1V6CA 4Y6RA 4LOAA 2BFBB 1OV6A 1ZSVA 5JNSA 4CLOA 2VZEA 3BK7A 2VSOA 4LJ7A 1ZEMA 2HYDA 5A4IS 5BWNA 3EWNA 4D25A 3KSRA 4LX8A 1H6AA 1XTSA 3VJKA 4BB6A 1V5EA 2GWHA 1L5RA 4LNUB 2R25B 1T5SA 2IKQA 1TF2A 3C6QA 1ULAA 2Q07A 4M9XA 1O5TA 1IJBA 3Q12A 4KN8A 4ZYZA 2XXBA 3ZHSA 5C81A 1DRUA 4JGGA 2QVCA 1YASA 2G9RA 3MINB 2RJ3A 3GZJA 4GLLA 3CWCA 3I30X 5KQRA 4YRSA 3AHEA 3EGWA 3T4PA 4K9MA 3VZCA 1O5IA 2C20A 2VQ6A 4Q05A 2HU5A 1TADA 3ZHXA 1HDEA 4JELA 1WCWA 1OVGA 4YJ2A 4FR2A 2H31A 1A8SA 1XAJA 1UC9A 1LNSA 1J2RA 2YV3A 4LHVA 5EP1A 5EMMA 1XVLA 1TU0A 1EWTA 3FSRA 3KZXA 4Q39A 3PK0A 5EQJB 3QVTA 3JQEA 3WB0A 2FLKA 1XQVA 3ZCUA 2B98A 1Q74A 2PX3A 4B9EA 4FFBA 3PUZA 1E9AA 1PTJA 4QU5A 5LLDA 1IXYA 4JL5A 3O8CA 2O5EA 3KEFA 1MB4A 4NFSA 4AWBA 1T9AA 3UK6A 1BVRA 5DGXA 3M6VA 1ZM3A 2BEVB 3K4QA 5B5SA 4TZ6A 3U3OA 3TGWA 3TYXA 3FMGA 4NU5A 1TQDA 1ZBQA 3DT8A 2GPBA 3DWEX 1HFEL 3E3LA 3OCVA 4Q1CA 1AMOA 2MIIA 3A6JA 4H1TA 3AJ8A 4R6WA 2OC9A 4B40A 2O7QA 3ELYA 1CD5A 4AK9A 2BFPA 1LEHA 2GJ8A 3K70C 1QIKA 1TMKA 3INNA 3AFIA 5DBEX 5H3HA 2N75A 2P0EA 3GF4A 4M53A 5C4GB 2K2QB 2ZE6A 3IDZA 5FFMA 4D5GA 2GPAA 4QA9A 3W6OA 4B6FA 1KH3A 1GQ2A 3JZMA 1W87A 1DJMA 2LNDA 1TC1A 2HEIA 2W4MA 3TVTA 3K2EA 3UJPA 4B44A 2BRUC 1NX9A 2O2DA 1PV1A 4PYQA 4YWHA 4TYYA 4PYLA 2BTEA 3MBIA 1K1EA 5EINA 1MN6A 3AR6A 4DMGA 4XIGS 2HWUA 2HWXA 3GH1A 4GOOD 3ZNPA 2XDQA 2WVGA 5B2FA 3G6WA 1FFXB 2WAYA 1V11B 1SKBA 1XK6A 1ZVMA 3DCNA 4MVJE 1G0OA 2C8VA 3PLAE 2WSLA 1SBCA 3HPRA 4PIPA 1C7RA 3RC2A 5KREA 4BJ6A 3IP1A 3TSYA 3HYTA 3DVQX 1C9NA 1FP1D 1VTKA 3AO0B 4Q82A 4ZI2A 5BXQC 3PLNA 4CKZA 3EZ7A 3JQAA 3PX7A 2BELA 5LOVA 1T8UA 4KQHA 5TEWA 2C4WA 5DXFA 5EHXA 1X94A 1D4FA 1ZC3A 1QHHB 3O8LA 5LP6C 1A9XA 1L7XA 2KB0A 2Z9CA 2ZAIA 4HS4A 2QX9A 4FZJA 1KPGA 2IGBA 5KWVA 1ZU5A 1T0JB 3Q5GA 3FGNA 2JI9A 1XZHA 2YVLA 4IQ4A 3DL4A 3RU3A 4AN1A 4ZHQA 5J4VA 4JVMA 4MP8A 4DA0A 5AVKA 2DFNA 5IBPA 4FJ1A 5IKMA 1LA2A 2JI4A 1KJ9A 1TB4A 4JDUA 1AMUA 4MROA 4Q24A 4TPKA 3RS9A 3UAOA 1OWMA 4YX9A 3GP8A 4R1UA 5HUHA 1SRQA 3ZE8A 3DKPA 3R7NA 3ZDQA 1KR2A 4G37A 3SWWA 2YIJA 4FE4A 2I80A 5DH9A 5P8WA 1KP9A 4I1SA 2PUDA 2YXBA 1EVJA 1EIWA 1ZGGA 1ZA2A 2YIDA 1QIGA 1XJWA 2X8AA 3IUMA 4GX5A 1SEVA 3WG9A 3IMEA 8GPBA 1V26A 4ZEXA 2V58A 4HB3A 1W0JD 1XT6A 3IMFA 1GU1A 1MB3A 3JASA 1ZL0A 3JRWA 4TV9B 3I42A 1EQAA 4CLXA 5JQGB 3NRBA 4A0QA 4UQLA 1NNI1 3OJCA 3R9XA 1XKXA 1Y8RB 3H5VA 5KSYA 2D1QA 3NATA 4ZAFA 1TEVA 5E1BA 4PYJA 2DERA 4JYBA 2ZI9A 1X7YB 2H7XA 4GPTA 4CR6A 1CB7A 2DKFA 2Y76A 3A10A 4LFAB 1PEKE 2P9QA 1MOSA 2PS9A 5DNAA 1O8CA 4XUGB 5JNVA 5HFAA 2VF2A 3NM5A 1PE0A 4LOKA 4OQYA 3Q40A 3KLOA 4PCAA 4WCFC 3RU9A 2XD4A 2JGRA 3CUUA 3GJQA 1EVIA 1U4OA 4WN9A 1GRQA 3UMJA 4CZ2A 5B3LA 5HTOA 1C3JA 2Y1XA 3W2FA 5IAJA 2FPKA 1DTWB 2C5FA 1P2VA 5JAZA 1I4WA 1Z5NA 4OJMX 2ICAA 2VXYA 3QITA 3S29A 1S2DA 1F14A 3U60B 4PZUA 1DIGA 3NR2A 4ZAXA 4BO4A 2WT9A 1NP7A 1JECA 1FMJA 1H85A 4E31A 1KMNA 2QWXA 3A1WA 3BGSA 4Q3DA 4WKGA 1NBAA 2WKSA 2ODNA 3PYLA 5JE8A 1U0RA 4MIKA 4CU2A 4CKEA 3W5IA 1HETA 3D5TA 4JHXA 2PH7A 3PWSA 1VHJA 2GZ2A 2KMLA 1ISSA 3PEEA 4ZMRA 4BX8A 2FSHA 4QVGA 2JFOA 5CVUA 4NP6A 2Y68A 4I4TB 3TD2A 3RYHA 3WNQA 1ZR4A 3IDQA 3ABQB 3GDWA 2TSYB 5AOAA 4KZKA 4BEBA 3SVTA 1CNFA 3BZUA 5GQSA 2VBGA 1MZPA 2XITA 2H5IA 2YDYA 1KVRA 2FOXA 4DLVA 2AE1A 2ZPUA 3LZCA 4QVIA 3AB3A 2WF8A 3D4PA 3WSTA 1MC5A 3E5RA 2W2QA 2R6GA 1J9GA 3GUZA 4WZZA 2JLYA 3T7JA 3CLRD 3EWAA 1E8MA 5JALA 2Y71A 1UDWA 2QSJA 2R84A 3HB0A 4BYMA 3LHDA 4DE5A 4JIMA 3NORA 4UZFA 1X2EA 4ZVLA 4KE8A 3F7OA 4GKVA 1L7QA 3PD7A 4X1YB 3K05A 2C84A 4RF2A 2W6QA 5IULC 2CLOB 2VUSA 3W05A 4N3BA 4FYPA 3MJHA 1RWMA 3D0KA 4Y0VA 1ZIYA 4WLVA 4QBKA 2JGLA 2OV2A 5K0CA 3CINA 1JQAA 3LDFA 3WIUA 3KAPA 1Z5UA 3R09A 1FRFS 2EERA 1ZMBA 4JSRA 5T64A 1EG7A 3AL0C 3QI7A 2ZTSA 5CXUA 5HUJA 1CUIA 5F5LA 3E58A 1JNYA 2X9VA 2ERXA 3NDIA 4FD2A 4DLNA 2RIPA 1JIIA 2OV6A 3EVFA 3I6BA 4IBOA 4OQEA 3K5PA 2IYTA 1V5WA 3L1HA 1F5NA 2J4FA 1JF8A 3F7MA 4L8GA 1KU6A 3IA7A 1QO9A 5DYWA 1UM8A 2XRYA 4FCWA 1WSDA 3JU3A 4TS4A 2VPZA 3DH0A 3O2QB 5CXQA 4AKGA 2WG1A 1BYUA 4HWGA 3MRXA 5I48A 4YMTA 3MWEB 1O6BA 4V24A 4HXFB 4AZVA 3RANA 4FX5A 4JKIA 4AW9A 3LMKA 1TTQB 4JVOA 1I24A 2D1TA 3E3OA 1H6DA 4PFKA 5AM5A 2OSVA 5EP3A 3JPYA 4RMJA 3SKXA 3MC1A 1RVDA 2AR0A 2GHIA 1ESZA 4LOJA 3BKWA 5JMPA 3BGDA 5DI9A 8ADHA 2G36A 3IDOA 1UBOS 1XRNA 2AK2A 2JFHA 1TU3A 4RDHA 3C6XA 2ZIFA 1EJ0A 2QTTA 3AJRA 3C4VA 1LCIA 4IIJF 2CL5A 4KLRA 2QBYA 5C5EA 3D6UA 5EZ5A 3ROGA 3LCCA 4R8MA 3WK6A 3QU7A 1KKLA 2BF4A 3I58A 1WZ2A 1ZGCA 3D81A 1A98A 1JH9A 2W98A 4L7VA 4D9NA 3EIWA 2RH4A 4QQRA 4WXRA 4EFDA 4P92A 4ZICA 1NLFA 1KY2A 2XE4A 1T8YA 2OILA 3QOYA 4BFSA 4HB0A 4MQLA 1E2UA 3COSA 1PZNA 4EHLA 4DHWA 4HMQA 3QWHA 4EG4A 3W2EA 4X1OA 2C5BA 3TI7A 4PCUA 3FCUB 4C7VA 2IYFA 1FFAA 4C7MA 3ZCQA 1DFIA 3SHFA 3E7XA 3OM1A 4HFMA 4KJZA 2G1KA 3QGMA 1X39A 1TM4E 5B1EA 4C30A 1EZ1A 4RXTA 5E95A 3I83A 4H35A 1YB6A 4J0JA 4HNRA 4KREA 1J24A 1DAHA 2CHGA 1J70A 1U8XX 1IFXA 2FUEA 3N0WA 2FSVA 4V0SA 2PGJA 1UBMS 3I5AA 3PT5A 2WU4A 1RADA 1N2ZA 1ZZEA 2C3MA 1S3IA 3FDJA 3HYRA 4L8YA 5AXAA 3QWIA 1RWNA 1RAHA 1TQ6A 4I3HA 4BVEA 3LK6A 1U1DA 3TDMA 2W6JA 2FK8A 1OZGA 1YUNA 4MEAA 3ZWKA 1R8YA 2O5CA 5J2UB 3H3XA 2IZ5A 1Y4SA 2GKGA 1CUHA 3CLUC 2IUUA 3BB4A 1O4VA 1KO8A 4I8XA 3N0TA 5KVVA 1FQOA 1I14A 1MO5A 2GLUA 1Q0RA 4O4HA 5D84A 3VISA 3WTCA 4HNUA 1N75A 1Z2OX 1NMYA 3O7MA 1D1QA 5JO0A 2VCHA 4X3PA 5BSTA 4N6NA 2XUHA 1PI3A 5BSUA 1Y3IA 3VPGA 3WKEA 3ZWQA 4TLAA 2AI3A 5GAJA 2QZ4A 4MV5A 3R1IA 2Y66A 3BRWA 3BCRA 3NV9A 3PNKA 3WGTA 4C2UA 5IYZF 1IPHA 4Z4EA 5EFZA 2VDRB 3MGCA 3G5UA 1W36D 4MDFA 2A88A 3GLHB 4E5NA 4MKIA 4EHFA 1FDOA 2W6IA 1SJ9A 3GFBA 3FSJX 2BFWA 3GLHE 2PUAA 4UAVA 5TPZD 4G4IA 1E7WA 1SHKA 2XV1A 2R8EA 2J87A 2ZE7A 3PIIA 3PPIA 5EJIA 3WDLA 3RTGA 4EJ2A 2YY7A 3QLUA 3AEQA 3FBGA 4AQ7A 3GXOA 1D2HA 4HMPA 4Y1RA 4BMCA 1HFWA 5HKOA 3TOVA 3VKHA 2V6MA 3PICA 5MN5A 3HXPA 4F9GA 4JT2A 3MHTA 1V4VA 3FFXA 3GVXA 3HC7A 5D3ZA 3EGXB 1QQ5A 3M5CA 4FS3A 4XIYA 5FLKA 3TNYA 5JT1A 3FTFA 4RXUA 5B37A 1OZ0A 2NWQA 5I8PA 4FOSA 3M1AA 1FDTA 1TEZA 1KC1A 2OAGA 3M6LA 2W70A 4BQNA 2R7AA 2O54A 1M2HA 2J9YB 3H13A 1O0SA 3MWJA 1L7BA 4PHTA 5DYYA 2HF9A 3RT1A 1L4NA 2C61A 1ZITA 5ECGC 5JXIA 3GQBB 1IY9A 2LGJA 2QMQA 2IYWA 1N6OA 2XMPA 3EYWA 3WMFA 1TM3E 1LPPA 2A67A 4L02A 3G89A 1W34A 3KZ1E 3TIIA 4MVWA 1QJCA 3GGPA 1J07A 1DL5A 2CXNA 4YV7A 4LJ4A 2XGOA 4WCVA 5BORA 1ACLA 2EHJA 1B26A 4QHTA 4K05A 4OSEA 3DOHA 3IHKA 3OKPA 2GN6A 3FUCA 4KH0A 4O2AB 3PRJA 1R64A 2J67A 1THGA 3KLNA 3VM6A 3JD3A 1EUYA 2EEZA 3ZY2A 1KERA 4IUYA 3EEYA 4GWGA 3SU8A 4OHMA 5IX8A 1Q1GA 4B34A 4MJ7A 2JC3A 4HQRA 4OGGA 3K7EA 4INPA 4R31A 5DASA 5AJHA 5AESA 5EXTA 4ZVMA 3VOTA 4DADA 4GLBA 1I1HA 2UZ1A 3DONA 4NY1A 5FWAA 2VK2A 1MEOA 4ECAA 1AJEA 1G3IA 3CH5A 4QBIA 3H2YA 2WWIA 2XTJA 4GSYA 4MWDA 1M2WA 4MMYB 4YJFA 5ICEA 3Q8MA 2HJWA 1LSSA 2A5LA 3N74A 3OQHA 5EJ9A 2J1LA 1B15A 3JARB 5BN4B 4ND6A 4O4LA 4KWIA 4AMGA 1FYWA 1E3WA 1H93A 4C7OA 2VHTA 3O7WA 4PX9A 3EJWA 4MOWA 3CG4A 1FDSA 4GWLA 1WPXA 7AT1A 5CITA 4L8WB 4N0PA 2WIGA 1W48A 3GMDA 4L8VA 1MT0A 3GW8A 4Q4HB 2DY0A 2GAIA 2DPXA 3AEUB 3FVTA 4GR9A 3NRJA 2P75A 2Q0SA 1FVHA 2XYHA 1IY0A 2OZKA 3FI0A 5DHUA 2GLXA 4ZVKA 1ELOA 2DT5A 2OC4A 3GPIA 4J3NA 4YGXB 4JI5B 1EVKA 1Z8FA 1HKHA 2QJWA 3AKZA 1NP3A 1CY0A 1DEKA 1EFPB 3M6FA 3PCRB 1TK9A 4LZAA 3SICE 4S1OA 4C0LA 4EB8A 4YWJA 3S1AB 3SJBA 5G40A 3UYLA 1Q22A 1B42A 2LE0A 1OOEA 2D13A 4IQFA 1O94D 3ON5A 1DEOA 3TSOA 2NVUA 2PRJA 3DKRA 3KYDA 4NAVA 4U2BA 3RSFA 2MINA 4L78A 2UYOA 3HCDA 2XEXA 5UKDA 4RTMA 1P1FA 3CZAA 3F73A 2HV8A 4G23A 4M1MA 1F8GA 5J9FA 3G1WA 2JVJA 4JD5A 2O1WA 1V8FA 2PKRA 1ZMXA 3AUAA 3ZVLA 4FUQA 1YB4A 4H31A 3V7NA 4F8YA 3DOIA 3S5UA 3ITKA 3NJ4A 1B8PA 3BB3A 4W9NC 4W5NA 2UZ3A 5J2TF 1UDBA 4KZPA 2SICE 4KSYA 1ENOA 5HILA 3MQ2A 3PS9A 4JLOA 2BPOA 3EZNA 4Z9AA 4A26A 4ZTUB 3KVOA 4I4LA 4HN2A 5ED0A 3AR8A 3KIPA 1UF9A 4FYHA 2YZMA 3UGTA 5JVDA 4JI8B 4DT1A 1WMSA 1Y7HA 3E9EA 3T3PB 3TCXB 4F9EA 2FN4A 2OBFA 2NZJA 2RFLA 5BSKA 5LL6P 3WADA 1PU2A 1LGYA 2CHQA 4LFBB 3DEKA 3MUOA 3IBTA 3GDFA 3T9DA 1C29B 3RCBA 3UAVA 1N3YA 3IQGX 4HAWA 2IYZA 4D6XA 4XPIA 1A95A 2BLNA 1I0ZA 3RT9A 3N2LA 4KODA 3TLEA 4LMPA 4NBUA 5E38A 3OICA 3WKBA 3JR7A 1DRKA 1K68A 1FSSA 2FOLA 4IJQA 4YS6A 3RM3A 2ZE8A 3ZCTA 2EKBA 2GM5A 3D3WA 4BQEA 3TINA 1FVXA 3RWMB 1CULC 2LRHA 4G89A 2QTBA 5IP5A 3WNDA 4LYFA 3C98A 3BWYA 3OC0A 4PFQA 3T3MB 1QTIA 4E4RA 5JSUA 1NI4B 5CTAA 1WR8A 5DSXA 2I2DA 4OY3A 1O57A 1XTRA 1FYDA 2H2AA 2OL4A 2QLBA 1U9JA 5DGHA 5IMSA 3GY0A 1QLWA 2OM2A 3DT6A 2CLIB 2BEJA 4QGBA 3DM9B 5EFOA 2D62A 1ODKA 2NSDA 5AW2A 3R6WA 1KGDA 2JCGA 2WMDA 4X6UA 5BPFA 4KOAA 1EXDA 5TJ9A 4IDFA 2XQVA 4DLLA 3VSEA 2WINI 4L6CA 5TNXA 3EMBA 3TNDA 5IZCA 1FS6A 3EZLA 1P44A 2R5NA 4S12A 4MUGA 2BYTA 2X1VA 4HFJA 3S6JA 3WR5A 1CJCA 3QV2A 1E6EA 1KI9A 1IN4A 3OOSA 3UGJA 2DH5A 1U0LA 1U3WA 3FFWA 3TJRA 2HZ7A 3G2OA 1G8KA 2E5WA 3HO8A 4U7WA 4LQ4A 3FDZB 1DZ3A 3RQIA 1XLUA 4PRLA 3KJXA 4K3UA 2Q7OE 4B73A 1RXUA 1T5HX 4KC0A 1QV6A 3GCZA 4L16A 4D3ZA 4CUZA 5IUJC 1HNXB 4LBWA 4F86A 1KVTA 3CSDA 3O4IA 1VBNA 2WKQA 3QU9A 2NIPA 3F6CA 2JD0A 2BJVA 3B2EA 4LWZA 4R54A 4K88A 2C3UA 4MVJI 3N70A 3TPFA 2DFPA 4BO2A 4N9QA 4BFLA 4R71A 3H99A 2DT8A 3HRKA 3LUPA 1Y9AA 4I46A 4PTZA 1EM8B 2R4TA 2A6PA 5K3BA 3FFAA 3OFVA 1A82A 1ODLA 1X87A 2OZLA 2Y1KA 3AKYA 4ZVVA 4EI9A 4KDEA 2ZYUX 3GLKA 4KIJA 4BB0A 4W5TA 4KJXA 1VDZA 2ZE5A 2D2XA 4X3OA 5DNDA 1EFLA 2ZI4A 1KFJB 2EKDA 4KG7A 1KXJA 4NEHB 4M3NA 1DQYA 5AI6A 3JAKA 5JC8A 3O4HA 3L0ZA 3OQOA 3O91A 5JTUA 1PHPA 3CW2A 4MQ5A 2V4UA 3P9CA 1H1DA 5EKTA 3G3EA 5LDGA 3RO7A 3FYUA 2H52A 2GMWA 3NIFB 4RVOA 4BCCA 3KSMA 4DNPA 1NTRA 4HAIA 4OP3A 3SQLA 3WRXC 1WXGA 1A8PA 2OUKA 1K63A 2GSDA 4PG8A 4HTFA 4BUJA 3R24A 2JLVA 1LBQA 1QK4A 3TNJA 2QGNA 5BSWA 2HA3A 1QTQA 3B1JA 3DE6X 4UAUA 4ECEA 1XZPA 2R8YA 5ICCA 1T1EA 2BONA 2SKCA 1LJUA 3A2MA 3IMGA 5FO1A 5T4FA 3VNAA 1ULSA 2GBLA 4CG2A 3FTEA 4HDKA 1AQUA 4MI1A 1V25A 2QN9A 1MNAA 5DK6A 3DDZX 4B3MB 4C76A 2C2GA 1C9EA 2QRKA 4X61A 3IPLA 5H70A 4F21A 2E4YA 4NCNA 1HWYA 1TGVA 1TO1E 4YAFA 4HS9A 3RBAA 4W7SA 1Z4NA 4DC9A 1Q20A 2Q4EA 1EDDA 3DP9A 2PKWA 3D59A 1W8DA 4KH1A 1MRNA 4REQA 4KUGA 3VGJA 4DMCA 3KZOA 5FFNA 5DT9A 1CW2B 1XRLA 3FVQA 4PLWA 3TR5A 3UUEA 1FNCA 3MMZA 5EJ2A 3I3SR 1BCRA 4HGNA 1WOMA 4LYHA 4QSMA 1T4CB 2DHCA 5AUPB 3WQSB 1BRMA 5KO2A 4MGYR 3MILA 1AZTA 1BOOA 1DADA 4H6XA 1YR3A 4Q7QA 2CZQA 1L5VA 4YCLA 3AEZA 3AGQA 2WJ3A 1FCJA 2GDJA 2B4QA 1R1DA 2D4AA 3OZBA 4K6KA 3T7IA 2P91A 1W581 4K2HA 1A2KC 5E6UA 1NWHA 3SHWA 2HUNA 1E18A 2PGIA 3VUFA 3BTSA 2VI5A 2VFAA 3DBVO 3ZZUA 1LI7A 1QQTA 3V9AA 3ZBPA 3B3QA 5IUKC 1YI1A 2HV9A 2MMCA 4OYHA 1I0LA 2RI0A 4U1RA 2GR9A 1XZFA 5AM0A 2RGBA 1XVUA 4LCEA 4QARA 4V0ME 2CEKA 1KK0A 3K94A 5TJHA 1ABBA 2W9XA 4INAA 1ZWKA 2O0HA 4F92B 3B36A 3O21A 1XZIA 5C1PA 2Q62A 1PDWA 1JHYA 4QQKA 3WRYC 3WYEA 1YE5A 3UICA 1V9LA 3KKLA 5IYZB 1KHHA 3EWIA 1ZZGA 1FYFA 3D6JA 2WWYA 3SJAA 2HXSA 5EE5B 2VJOA 1M73E 2A3RA 1DKNA 4MITA 4DBZA 1CJMA 4RQBA 3WJ1A 1IRXA 2A9KA 4KFRA 5IK2A 1NVAA 3H5RA 4QYWA 2W2MA 2XLCA 2UVDA 3M3HA 4CN8A 1CVLA 1H8HD 2C2BA 4YI5A 3WO1A 4WA7A 3OZEA 3PEFA 5FD8A 2K4MA 4CYMA 1DE0A 1QZZA 1G5HA 3F5SA 3NEPX 3K8ZA 2FNAA 3TAXA 1QYWA 1XLVA 4MCJA 4GPEA 1RI5A 3DBLA 1TF5A