1B2LA

Alcohol dehydrogenase from drosophila lebanonensis: ternary complex with nad-cyclohexanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
254
structure length
254
Chain Sequence
b'MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCOHOL DEHYDROGENASE
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 98
structure length 254
sequence length 254
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b2lA00
3O03A 1H94A 3ZWPA 2QYSA 3GNTA 2E37A 1E7MA 1ID1A 2V6BA 3H6KA 4IJKA 4BKPA 1VSVA 3OQ6A 3FNHA 5FFFA 3ZWXA 4P4NA 3DBRB 4GX2A 4GSKA 1LDNA 4W82A 4CUZA 5AOVA 3WXBA 4MOWA 6ADHA 3WNQA 2NWQA 4AFNA 9LDBA 1PJLA 3DAGA 3ROKA 5G0UA 3PHJA 3DOCA 2G17A 1ZK3A 3H5RA 4M54A 4WLVA 5TSDA 6LDHA 1SPXA 2X7HA 1ZNQO 2EEZA 3F5QA 3GZ4A 3AU9A 4OIMA 5L7YA 2D8AA 2DPGA 1P1KA 2HQ1A 3WWZA 3PYLA 1N8KA 1NVTA 2E4AA 3EK2A 4H15A 4TROA 3V2UA 1GCOA 1VJTA 5F1KA 1TT5A 1I10A 2PGJA 2GPTA 1ZSYA 3KLPX 3AUSA 4PZCA 3E82A 3RUAA 1HE4A 4D7AA 3E9MA 1YOVB 4J4TA 4OMUA 4PLWA 2EGGA 5DCWA 2AHRA 4U8GA 1OC4A 1Q0LA 3NGXA 1XQ1A 1TB4A 3EUWA 1GUYA 5JS6A 5JE8A 3ZNOA 4DLBA 5IN4A 1I3MA 4YTEA 1NR1A 1Z75A 4RF5A 3WMXA 3WGOA 1P3DA 1HYEA 1NFQA 3L9WA 2QQ5A 1H93A 1T4DA 4XGNA 3DHNA 4ZGWA 2B4QA 2VN8A 1NWHA 3I1JA 4R54A 1KVQA 2GCGA 2DUUA 3RUFA 4XZ3A 4PCVA 3ZWMA 2HDHA 5JNLA 1LRJA 4J4HA 3JQ6A 1JLLA 3JD1A 1OMOA 1IB6A 1YGYA 3E8XA 2IEDA 1BRMA 1QKIA 3L6DA 1ENZA 1BXGB 3T7CA 3PFFA 1YBMA 3BZUA 1KEWA 1DIAA 3AOEA 1UDCA 2GZ2A 3PHLA 3K2BA 1GPJA 4BGUA 2Y1OA 2B5WA 2P5UA 1LC3A 3Q9NA 1DIBA 5DBFA 5EJ2A 1BHSA 3T4XA 3W4JA 1HEUA 1O9BA 2NADA 1VM6A 2JD2A 4GI2A 2GO1A 2ZB4A 4GGOA 4K6FA 3GF4A 2DVMA 3DBHB 2NM0A 2X8LA 3BXXA 4NBRA 3EMKA 3KXDA 2P9GA 4NH4A 1AGNA 2PH3A 1OI7A 2Y93A 1PGQA 2Q1WA 3NJ8A 3QSGA 4W4TA 5A3JA 3GNSA 1C0KA 1PS8A 5L95A 3DOJA 1XA0A 3COSA 3FPLA 1VSUA 3Q11A 4ZD6A 1MFPA 4R9RA 2PKQP 3CZRA 5FI5A 4BGVA 1MGOA 4DBZA 2WYVA 1NVMB 3TFOA 3KYDB 3R3SA 3RASA 3WWYA 4BO4A 4BNLA 2FP4A 3NDJA 1BXKA 4YJGA 3U62A 3UAGA 3NEPX 5K0ZA 4KWIA 1Q2XA 1E7QA 2VCYA 4XQEA 1E7WA 2X4GA 1CEQA 3TL3A 4YJHB 5IXSA 1BVUA 1T1SA 4R1NA 1PZEA 4CM1A 4TQGA 5AXDA 3VH1A 2ZQZA 1GEGA 5KJFA 1O94A 2Y66A 5KVSA 4BKQA 2NLOA 1YQGA 2GERA 2DTXA 4WEQA 3ZWOA 4O59O 2X5KO 5EERA 4BNFA 1NASA 2VYVD 4BMVA 4XD2A 1QLJA 2QG4A 3K30A 2VUSA 2UV8A 3Q1LA 4YAIA 4YBZA 1WLYA 1ZK4A 1ADGA 1PWZA 3WS7A 2F1KA 2P5YA 1CWUA 3L0DA 4CL8A 1IPEA 2A4KA 1DRUA 1A71A 4OSPA 4MVJD 5I9LA 1DFIA 3FI9A 1UP7A 4PG7A 4I1IA 4CMJA 2Q2QA 4XWYA 3GG2A 5IDWA 1CIVA 4BO0A 3SVTA 1PIWA 1TI7A 1PGOA 3UUWA 3LC1O 2FR0A 2JCVA 2HUNA 2ZQYA 3WR5A 4E2WA 1HRDA 1VC2A 3KRTA 4NNJA 1WZEA 3G1TA 1PJ4A 1LDMA 1R66A 1XELA 3OA0A 5B4UA 4J2HA 4MVJG 4RVDA 2HLPA 4WLEA 4WE3A 3HE3A 4BNNA 3NT4A 4GGPA 3PVZA 4FBGA 3DONA 3GZNB 3SXPA 2PD4A 1I0ZA 2JFHA 1EZ4A 4FIZA 4PLFA 4JNKA 1Y5RA 3OQBA 3OJFA 5IDQA 1LLUA 1VKNA 1X7DA 3ENNA 4EEZA 1BXZA 1Y5MA 4ALMA 4RZIA 3Q2IA 1H5QA 4D42A 4YT2A 1CDOA 2IXAA 5C5IA 2R00C 4IJUA 2XXBA 2Z5LA 4R01A 1MFZA 1LLQA 3I4CA 1GV1A 1ONOA 2UYYA 4FFMA 4UUNA 2NVBA 2O7SA 1ONPA 4CLRA 3C7AA 4CM7A 2IZZA 5IG2A 1GQ2A 5I9MA 3E03A 1LRLA 1KEVA 4KP7A 2VHVA 4H16A 2O3RA 3AWDA 3NKLA 4XB1A 3KTDA 3GGGA 1GEEA 4JXKA 3F4LA 3DXFA 4HFRA 4HADA 2IDZA 2W90A 1F12A 3ZU3A 2VYND 3PPIA 1GUZA 4Q3AA 3OJ0A 1JAXA 3OIFA 3M6IA 4B4UA 1PTJA 1ZJYA 3B6ZA 3KEOA 1K89A 2WDZA 4E5YA 2JFFA 3PLRA 1Z7EA 2IZ0A 1PZGA 2OP0A 3PQDA 4QO7A 5A9SB 3VOSA 4CMIB 4PFJA 4FJ0A 1UP6A 5GZ1A 3VZRA 2WMDA 3LU1A 2J6IA 1HSZA 3ONDA 1J4AA 1EFKA 1VPDA 3E5MA 4TVBA 3EAGA 3SEFA 1FDUA 4J43A 1CERA 1EBFA 4OJNA 1XCBA 3AY6A 5A9TA 1MC5A 2CNBA 4EITA 3MOIA 2VRCA 1T2EA 5ES3A 2PWZA 1SO8A 2CY0A 3GK3A 3PHHA 4GLLA 4ALLA 1ZO8A 3C24A 5JAMA 4F6CA 3VC7A 4CLDA 2IRWA 1QSGA 4CM6A 4CMGA 3FCOA 3JQ7A 2EF1A 1T24A 1N7GA 3GPDG 3RUHA 4XDYA 4J0EA 3NTOA 3BMCA 3S2GA 4GVLA 4QECA 1VI2A 4ZQBA 4ND5A 3ZV5A 9LDTA 2FMUA 3PXXA 2GASA 3RC7A 4RVSA 1GPDG 2PNFA 2VWHA 4YJFA 5TT0A 1MC4A 3O9ZA 4BIIA 2OL4A 1GQQA 2JHGA 3RUEA 2EGHA 2G0TA 4II3A 5EL0A 4PG5A 2DBZA 1Y8RA 1DIRA 1Z6ZA 3GR6A 5JDIC 1PEDA 1ULUA 3F5SA 3JSAA 3JYNA 4LVCA 4WOKA 3ZWAA 3HADA 3BA1A 3EGOA 1U5CA 1LI4A 1GD1O 5JSFA 3FWZA 1G0OA 3ICCA 3JYQA 4PZDA 4BB5A 4B7UA 3V1UA 5CEFA 4ZQEA 2PFGA 1OBFO 5CG1A 4D3DA 3RC9A 2YQ4A 4GVXA 1JW9B 2VZ9A 4D79A 4Q3DA 5ICMA 2X9NA 5L9AA 4Q3BA 3WFIA 5DCYA 3D1LA 4AG3A 4CM3A 5J23A 2D1YA 4KQWA 4NHEA 1K0UA 4E5MA 4K6CA 5COAA 2YUTA 3ICPA 1N92A 2O4CA 4I9UA 4TSKA 3RVDA 4O0LA 4Z9XA 1YH3A 1JQBA 2PKQO 3L4BC 1B0AA 4L75A 2Q45A 3DZIA 2O2SA 3W4KA 2FR8A 4XA8A 3NT5A 3QW2A 1KVTA 1KY4A 1PJTA 4LCJA 1U7HA 4P8RA 3H2SA 4DPMA 4YR9A 3PHGA 1R4NA 3D64A 4J7UA 5IZCC 4MVJH 1XQ6A 3ITDA 1EQUA 2GN8A 1ZSNA 3INTA 4Y67A 4DL9A 3OP4A 4PRLA 3PI7A 1HETA 3RUIA 3ZV6A 2CUKA 4YT8A 1H6BA 4HKTA 1Z73A 4ALNA 1NYTA 4RLSA 1I3KA 1NQ5A 3TDKA 3SBOA 4WCFA 4NU6A 5CAEA 1P33A 3GUCA 3AM3A 1EDOA 2VRCD 5CEEA 4XR4A 3S2EA 4E5PA 1EVZA 1CQIA 1V3UA 2J8ZA 4QEDA 1KIFA 2QZ9A 5FYDA 3E6AA 3WJAA 5ILOA 1HDCA 1DC4A 1FDSA 3DAFA 3ORFA 3DZBA 3GMSA 1VL0A 4IMRA 4YB8A 5JBIA 2WE7A 3NAQA 1RM3A 4EZBA 4BKRA 2VUTA 2JHFA 4J9VA 3TPCA 4E5KA 4WGGA 4YA6A 2NNLD 3PZRA 4JCOA 1W0CA 4CM4A 4JJGA 4JP2A 2RH4A 3EC7A 3ZV4A 4RV9A 2A9FA 2FPGA 2C5EA 4IGFA 1GL3A 1E7RA 4IDCA 2RBEA 4P22A 3ZWNA 4DQXA 4OOEA 3RROA 3WGQA 3P7MA 3OJEA 4KOAA 5CPBA 1R12A 4NJMB 3CMCO 3UKOA 1E1LA 1XG5A 1MA0A 3K6JA 4E0BA 1HLPA 4BV8A 1LEHA 5JDIA 3GEDA 4OKNA 3GGOA 4GWGA 5GY7A 4A0SA 3KETA 1A4IA 3IQDB 2FRDA 1PGPA 1IZ9A 1GR0A 3HB5X 1J6UA 5CDSA 2B4RO 1ML3A 2C7GA 3AY7A 4M55A 4EBFA 3H65A 1HE2A 1QYXA 4HV4A 4M1QA 3IL2A 2NU9A 3ZW9A 2J5RA 1V3VA 1YONA 3RFVA 1U9JA 4FCCA 4KDFA 5ILGA 5I7FA 2IODA 1KYQA 3EY4A 4A03A 4J7XA 4EUFA 1ZCJA 1W6UA 3WB9A 2ZCVA 1R15A 1H6DA 1OAAA 1YO6A 2WD8A 3NYWA 4MPDA 3ZHBA 1ZZEA 2X86A 1MX3A 3A9WA 3OM9A 4QO8A 4B4VA 4CQMA 2AE2A 4BGEA 5TT1A 5A02A 4IDGA 2BF7A 3GVPA 1U8XX 2VNSA 4B3IA 3A4VA 1SEVA 4LN1A 1M76A 1G0NA 2GN4A 3WQRA 1YBAA 1P1RA 1U1IA 4WLNA 3WNVA 4PN3A 2A94A 4A27A 3ANLA 3FN4A 1P44A 3CE6A 5IZCA 3Q9UA 2AG8A 4I9NA 4WEOA 3OIDA 1JWBB 1R37A 1L7DA 2CD9A 5CFZA 1EVIA 4AJJA 4EJMA 3F1LA 1NBOA 3VKVA 2VOJA 3NUGA 2RIRA 4RGBA 2AEJA 2GUGA 2NTNA 4XB2A 3L6OO 4CUKA 2Y0CA 2VTEA 1SB8A 3OETA 2FZWA 4RVFA 3VKUA 1FMCA 3OF2A 5TF4A 4U6SA 4CL3A 2C5AA 1F8FA 4ZQGA 2EP7A 4HXYA 1SEPA 3LT4A 3GC6A 4ND4A 3HZZA 3AI2A 1ISFA 3D0OA 4LISA 1TA4A 1E1MA 2OHXA 5K9ZA 2ILTA 4PVDA 4IDAA 2XAAA 3O38A 3JYOA 1MB4A 3EVTA 2O50A 3L9XA 3G1UA 4NJOA 3RKRA 2Q50A 5HA5A 3UXYA 1P0CA 2Y1CA 2NVUB 3ZDFA 5IDYA 3RQSA 1A9ZA 4Q9NA 5G4LA 2YZ7A 2J3KA 4FW8A 4A2CA 4DBVO 3D3WB 1GU7A 3R0IA 1S7CA 2YFHA 2X9VA 5JC8A 2VWPA 3JQ9A 1J5PA 3H9GA 1YB1A 2HAEA 3E9QA 1GYRA 5TGDA 2EW2A 1PS0A 2HCTA 3CEAA 3W8FA 4C4OA 5IF3A 2Y05A 5KKCA 1T2AA 3GUYA 4ND1A 4CODB 4Q3NA 1KETA 2IE0A 3KSUA 4OYRA 2JAHA 4Z3KA 4BB6A 3NV9A 4ZRMA 2CDCA 4RCVA 5I9NA 1VE9A 1QLHA 3FPCA 1PX0A 4ALIA 1BMDA 1KVSA 1ARZA 4TMFA 4MIYA 5FI3A 4XYEA 1AHIA 1EE2A 1KEUA 3KLMX 1PQPA 5KJEA 4Z6KA 2BH9A 3DFZA 4OOFA 4J1QA 2XF8A 3HNPA 1JU9A 5KKAA 4RPGA 4DIBA 5U4QA 2DBQA 3GHHA 3H9QA 3Q6IA 2YQ5A 4LW8A 5BR7A 4CR8A 5BSFA 4ND2A 3LF2A 5A03A 3GAZA 3U5TA 1ZW1A 2EJVA 4CQMD 1V6AA 2ZK7A 3IIEA 1B2LA 3PDJA 2Z95A 3OMLA 5CG2A 3RCBA 1YS4A 4IINA 1VRWA 4BNIA 5A1TA 2O3JA 4GX5A 4JBIA 2GGSA 2PZKA 3JD3A 3H3FA 3MJ4A 1I8TA 4IDFA 4BNMA 2AW5A 2CDAA 3MCVA 5G0VA 1L7EA 3DBLA 3E1KA 5DZSA 2PZLA 3MWEB 3DZKA 1I01A 2YDYA 2I67A 4FFLA 3CTMA 1LDGA 5KVVA 1C1XA 2UVDA 4BQPA 3JQBA 4K1LA 4R9SA 1A27A 3PHIA 1HDZA 3JQFA 3K73O 1LC0A 1LQUA 4FGSA 3QRWA 2V6GA 4ALJA 3ON5A 4MP6A 1RYDA 4ZU3A 3WIEA 2G82A 5JC1A 3ABIA 4L4SA 5ENVA 4LGVA 3V5NA 2X5JO 2YFQA 2NU7A 4PLVA 3JQEA 5JAQA 3OQ1A 2O48X 1X0VA 4NZ9A 1GDHA 1RYEA 1Q7BA 4MDHA 3GMDA 2C7VA 3MTJA 5DT9A 5HS4A 1T2FA 3RBZA 1MLDA 3O26A 2DM6A 1SOVA 1HYHA 4L4RA 4XJSA 3FSRA 3RBXA 4QXMA 4YVFA 4WLFA 4I08A 3H4VA 4NQZA 4Y8VA 4EUHA 5A9RA 5EN4A 3N74A 1CF2O 1RM4A 2W4QA 3KO8A 2VYVA 3I9JA 3ASUA 4ND3A 1H0KA 2CSUA 4GMFA 4QUKA 4U5QA 4ZRNA 4XGKA 1NVGA 2DPHA 4IDDA 1PU2A 1B15A 1F14A 3INRA 3MJSA 4ZQFA 1A7AA 3WSWA 2EWMA 1LSOA 4MVJA 4BO3A 2CFCA 3DTYA 1NXQA 3ETGA 5C7OO 3FTPA 2G76A 2H6EA 3A14A 4W7HA 2GRAA 1SMKA 2AE1A 4E5NA 4NI5A 1QYVA 2W2KB 5L40A 2VZ8A 3RKUA 3VH2A 3IJPA 3UFXA 4CMHA 1I5RA 3IP1A 1XIVA 4TKMA 8LDHA 2YW9A 4YDRA 4A10A 3ENKA 1GADO 1I2ZA 3PRJA 1EEHA 1GFSA 4OH1A 3DBRA 4RF3A 1IPFA 2HMUA 2ZIZA 2IYPA 3BMQB 1KERA 4IXTA 4DYDA 2D4AA 4RJTA 5IJZA 1E3EA 1Q1NA 1KS9A 1HLDA 5GZ6A 1DBVO 2DC1A 1P1HA 4M86A 4KQXA 5L3ZA 3FBGA 4ZJUA 3HDQA 4CQLB 4YCAA 2I6TA 4AJ1A 5H82A 3EW7A 3I3OA 4C7JA 4D3FA 2OP1A 3DWFA 1ENYA 1QORA 4UUMA 5G0SA 4BNTA 2ZTMA 1D1SA 1GCUA 5C7LO 3RJ9A 1XSEA 2CVOA 4MVJI 1X13A 4U0KA 4QTZA 4BNKA 4AJNA 1TLTA 4XQ9A 3Q3CA 3BYZA 5KJ1A 5CDTA 1DC6A 1P1IA 3IKTA 3IJRA 5IN5A 3UCEA 4YAJA 2ZTLA 4J91A 1YOVA 5DP1A 2VZ0A 1HE3A 1E3WB 1N9GA 1NAIA 2DAPA 3JQGB 3KOUA 2AG5A 3LYLA 5I8ZA 5DDIP 5B1YA 3AU8A 1AHHA 1F06A 1E6UA 1PGNA 4GSLA 3ZWVA 4UVDA 3ZWWA 3GFBA 1E6EA 2FPIA 3AUUA 1ZFNA 1R0LA 3KM0A 2E6UX 3VPGA 4DRYA 2VYNA 2Q4BA 4PVCA 3NDIA 2WEKA 4I5FA 2EKPA 1Y6JA 4TWRA 3TZKA 3WBFA 1QXSA 1BDMA 4E6PA 4OSOA 3PJDA 4QT0A 1BDBA 1EDZA 4AJ4A 3WMWA 4DC1A 1DEHA 3Q2KA 5L7TA 1B8VA 4DLAA 3ITKA 1F8GA 3PFWO 1B7GO 2HO5A 3H3JA 1YVEI 4E12A 4BKOA 5HWSA 3DO5A 2VUUA 1GYPA 4FPXA 5G4KA 2P4HX 4MP3A 3ULKA 1WZIA 4RQUA 4AJIA 3GN1A 5KNLA 4IPTA 5EESA 3DBHA 1Q7CA 3FNEA 4LRSB 3D7LA 4DC0A 4Y6PA 4F6LA 4BMNA 3JYLA 4ZHSA 1C3VA 1D8AA 3QWIA 2YYYA 3VH4A 4CV1A 5T5QA 2HJSA 5DN9A 2FOIA 1Z7BA 2JD1A 1G6KA 3OJOA 5CDYA 3WTCA 1DHTA 2JL1A 3E18A 3C1OA 5KVQA 1LDBA 4RPHA 4CR6A 5GMOA 3CXRA 4UEOA 3KYDA 2X23A 4P4LA 4XYMA 2WD7A 1A5ZA 4PIVA 2W8ZA 3ONEA 1HYGA 2CZCA 3V2HA 1ZK2A 2X9GA 1DFGA 4FS3A 4P4GA 5JYDA 5LDGA 2PD3A 3BHIA 4K9DA 3ZV3A 4YJHA 2P4QA 1HWYA 3DL2A 4PLHA 4E2ZA 1NHGA 1M75A 2VNAA 4D46A 5L7WA 1V8BA 1KY5A 1NFRA 1XU9A 4TRRA 4MIEA 4CLEA 1Q7GA 1I36A 2X0NA 2SCUA 3U4IA 3FHLA 2UAGA 2YV2A 2D2IA 3TSCA 4AJEA 3KV3O 2ET6A 4FFNA 4XX0A 1QMGA 4D41A 4D0SA 1PJ3A 2AEMA 4EI2A 3JQAB 1R0SA 3AUAA 1I2CA 3PYMA 5DOVA 4NFYA 4K28A 4LMPA 2RH8A 3QWBA 2NUAA 3TOZA 1O6ZA 7MDHA 5T64A 3PEFA 4GX0A 2HSDA 3DDNA 1QV6A 1RPNA 3GRKA 1CRWG 1LA2A 5C3MA 2BI7A 4WNIA 3UGKA 2Q2VA 3MJTA 1RKXA 4NDNE 4MKXA 3VPSA 3V1YA 1W4ZA 1NQTA 2G1UA 3D4NA 3OFSA 4YAEA 3GGPA 2FY8A 5KCZA 1E1KA 2X0JA 3SJ7A 5K6AC 3VDQA 1X15A 1Z74A 3F4BA 4YWJA 4CPDA 2C59A 4R3NA 2FHSA 4GL4A 1KOLA 5A04A 3VH3A 4GAEA 3DC2A 3TZQA 3DMYA 3WGYA 1ADFA 1U4OA 4LK3A 3UCFA 3DR3A 3U4CA 3PJEA 4ZICA 4BO8A 3O8QA 3QVTA 4BO5A 2Y1DA 3BMCB 4WCFC 3UCXA 2EV9A 2DFVA 3K5PA 2PZMA 1WMBA 2ZJ0A 1P0FA 2FR1A 1T2CA 2BMAA 3HUDA 4XRRA 5EPOA 1KC3A 2UUOA 2D0IA 4I5DA 3GDOA 2X5OA 4G65A 4L0QA 4RF4A 1GUFA 4M89A 2JJYA 3PYXA 3ZCXA 4WUVA 1PJCA 4J1NA 4WECA 2Y0DA 3K9QO 4AJKA 4L9RA 5A05A 2BD0A 3TRIA 2PV7A 3GEMA 4B4OA 4YXFA 4FC7A 1Y9EA 2C2XA 3ETDA 4Q3EA 5F1PA 3AM5A 2OFPA 5B12A 4PLYA 1PL7A 1UAGA 5HS6A 1NHWA 4J49A 4H7PA 4NPCA 1S6YA 2J3JA 3KUXA 5DP2A 4BNUA 4FQ8A 5IFLA 4GH5A 3IMFA 1XDWA 3WOHA 3ZHYA 4TVOA 4IQ0A 3F46A 1NR7A 1OZAA 1ZK1A 2OZPA 3HJAA 1GYQA 2BFAA 5JFOA 2YJZA 3B1FA 1B3RA 4KDEA 2BHLA 3DTTA 5JPIA 4BNYA 2PLAA 4KTVE 1U3UA 2YY7A 4KZPA 5B4VA 4YRBA 3T4EA 3NX4A 5A9SA 3AUTA 5AVOA 1P9LA 1E92A 3W8EA 4CMIA 1H6AA 1M66A 5CEJA 5IXYA 3W4IA 3INGA 1R4NB 1UUFA 2QRJA 3K96A 1ISIA 3JD0A 4E2XA 1N1GA 5TNXA 2NTJA 1WVGA 1ZSVA 4TKLA 2D59A 4ZN6A 4HNGA 4MINA 1VKOA 3LC2O 4JX8A 1BVRA 1PQUA 3DB2A 3GDGA 1CYDA 1P77A 5DOZA 3ZNPA 2DFDA 5TQVA 2B4TO 2I99A 3G49A 2VHWA 1Y7TA 2AA3A 3I9OA 3IDSA 3DHEA 5T6BA 1DRVA 4R69A 4IMPA 3DZGA 2Y0EA 3EZYA 3SC6A 3HDHA 4FOOA 5L45A 3I9MA 2VT2A 4IUYA 2C82A 1U2GA 2R6JA 4G2NA 2QRLA 1XKQA 3EYWA 5BNIA 1E0DA 3DFUA 1ZJZA 3RSHA 3OEWA 3NRCA 3RI3A 1X7HA 1DIGA 1JWAB 4AICA 2BGMA 4CV3A 5K6AA 3H5NA 4PG6A 3KYCA 2JCXA 4PLGA 3S1LA 2HK7A 3L6EA 4AL4A 3NDRA 4GBJA 5A5FA 1P1JA 2ZATA 5L4SA 3BMOB 2X58A 3SLGA 2FPPA 4BGIA 1ZMTA 2CVZA 4XIJA 4XYLA 2NTVA 4FR5A 4RF2A 2P68A 1IZ0A 4IJVA 4YJDA 4BO6A 2DTEA 1DPGA 4NBTA 1T1RA 2O3TA 4TZTA 3JQAD 1LSJA 1YXMA 3HB4X 3HSKA 4O1MA 3KEQA 2G5CA 3C7DB 3CPSA 5IZ4A 4CM9D 1SCUA 4F46A 4OQYA 2YDXA 4FJ2A 3QP9A 3I9LA 2QYTA 1LX6A 3I4FA 1PL6A 2PGDA 4IDEA 4Q3CA 3NTRA 1ZBQA 1QYWA 4IJWA 1YL6A 2WTBA 4NK4A 1R0KA 4S1VA 4AVYA 2AXQA 4IXWA 1HDXA 3JQ9C 2I65A 4OXNA 1E5QA 1JAYA 3FRJA 3MJCA 4CMBA 5KJ6A 4MP8A 4D45A 1BG6A 1U3VA 4EYEA 4A5OA 4IBOA 3M1LA 4M87A 4D3SA 1HE5A 4HBGA 1ENOA 2VT3A 2EW8A 3GA0A 1BGVA 3IAHA 4MKZA 3C1AA 3F9IA 1Q0QA 2OGUA 3BHMA 5G2OA 1D1TA 4R5MA 1HXHA 2ZYDA 2Q1SA 4OO3A 2VRBA 3IKVA 3AI1A 2C2YA 1C1DB 3CUKA 4XKJA 3WGZA 4FD3A 1N5DA 2V6FA 3H7AA 5DCUA 1XGKA 2PZJA 1F17A 3ROPA 5JW6A 2XPCA 3A28A 5BSHA 4PLZA 1FDVA 5BNTA 3H9UA 2J3HA 4URFA 3D5QA 1WW8A 2VOEA 1UDAA 4E4YA 5TJ9A 3KBOA 3OJLA 3QIVA 7ADHA 1PJBA 1X7GA 2DT5A 3MZ0A 3QVOA 2Y68A 3JD4A 3GEGA 4EGFA 1PZHA 2P9EA 1UXIA 4CMAA 2QIOA 1HT0A 4Y6RA 3S55A 1NFFA 1JN0A 4UEKA 5TC4A 2DTDA 3PIDA 1LU9A 4L74A 4XYGA 4JJFA 1R4MB 2HMSA 4FFPA 3K92A 3ROMA 1LSSA 3G79A 4P38A 4RDHA 4BO7A 3A06A 2ZB3A 3ZU2A 3KHUA 4INAA 3TZCA 2Y67A 2GDZA 3HFGA 4DYVA 5LC1A 1U3TA 1NQOA 3OICA 4X54A 4IQGA 1IE3A 3VDRA 4UAGA 4YAKA 4GMGA 5LCXA 4OQZA 1QRRA 4B4WA 1YBVA 3JQBC 1EUDA 3QQPA 3JQFC 4KUEA 4IGEA 4NJMA 3MJEA 3G3EA 1KEPA 2VHYA 1BW9A 1R6DA 1K3TA 1PJQA 5F5LA 4GKBA 4XEHA 2Q3EA 2DU8A 1SBYA 5G0TA 4HP8A 5CP8A 3RFXA 3ASVA 2DKNA 3BTVA 4YRDA 2B35A 4UUPA 2J5QA 1O5IA 3U4DA 4Y6SA 4QFDA 1O95A 1DO8A 3QVSA 3U3XA 1SB9A 5AXAA 1GQYA 4GWKA 3L07A 2OO5A 4CM8A 4W99A 4CLOB 5H81A 3GNQA 2C0CA 1DXYA 1GZ3A 1KVRA 4DPLA 3ZNQA 1HL3A 2HRBA 3G0OA 5HRUA 3GLQA 5G0WA 2Q49A 1NM5A 3B70A 1I24A 4WKGA 4A26A 5A5EA 1YQXA 2YHIB 3RAJA 3BHJA 1LDYA 4RVHA 2ZTUA 1L1FA 3S8MA 1PR9A 1QV7A 3JV7A 1ULSA 2B0JA 3LT1A 1ADCA 5JYEA 2WWRA 3PTZA 4ZVVA 4Z9YA 4A7PA 1AXGA 2X0RA 2DBRA 3F47A 3OBBA 1U4SA 1YKFA 4MVJP 3S2FA 5JO0A 3GHYA 4B7CA 1ISGA 3GFGA 2Y1EA 4HY3A 1DC5A 1XEAA 2GN9A 1E3JA 4BO9A 3A1NA 3OECA 4MO2A 4HFMA 3RU9A 1GZ6A 4M8SA 1IL0A 3JD2A 4HNHA 2GYYA 4U0JA 1DJQA 1W8DA 4N18A 2ZCUA 1Q0HA 3WLFA 3ZZNA 4J1SA 5L4LA 3LZ6A 3I52A 1FJHA 2BFMA 1JVBA 2C20A 5ADHA 4BNWA 2W2LD 4C7KA 1UAYA 5JCJA 3AW9A 3GVCA 3W8DA 3EHEA 4R51A 2H5LA 3KZVA 4BNXA 4CLHA 4R3WA 3DQPA 1H9BA 1YB4A 5I7EA 3H9EO 2HMVA 1DAPA 3QWFA 1A9YA 4E33A 2A35A 4GQAA 3WFJA 2NVUA 1Y9AA 2VWQA 1HKUA 2GLXA 4AJLA 4JP3A 4I5GA 1JKFA 3D3WA 3VAZA 1HDRA 3ROQA 1U7TA 2B5VA 2FSVA 4L76A 1Y8QA 4FGWA 8ADHA 2WE8A 3HG7A 1B16A 1FF9A 1YL5A 3PJFA 1B8PA 3RUDA 5AYVA 4RVGA 1T26A 3ANNA 2LDBA 2JCYA 4OXKA 1V3TA 1CQJA 2C07A 3JTMA 4J7CA 1UZNA 4XDZA 3RC1A 4BNHA 5L53A 1A72A 5JCXA 2X22A 4OL9A 1TT5B 4GKVA 3IP3A 4R5HA 4CV2A 1HF3A 2YV1A 1RM5A 1IUKA 3ZHXA 3ST7A 3TF5A 3UOGA 5DULA 1X0XA 1PJ2A 2B69A 1YJ8A 5AXBA 3FR7A 3H2ZA 3UICA 2WSBA 1QR6A 4NG5A 3MEQA 1LLCA 1C14A 5A4DA 2BI8A 5CHEA 3M2PA 3SX2A 4LRTB 2E82A 5BT9A 1ZMOA 2BRUA 4XIYA 1OOEA 3DEYX 4LCEA 3CMMA 3JQ8A 2IYOA 2QW8A 4WLOA 5F3RA 1I2BA 1ZKMA 4Z9FA 2EXXA 2PD6A 3NGLA 4J90A 2EP5A 1NX6A 1A4UA 4K26A 4DTIA 2RAFA 1Y81A 4DLLA 2GF2A 3MOGA 2WM3A 3U9LA 1HZZA 1NAHA 4WNCA 4CUJA 3R1IA 1C0IA 1DRWA 4YT5A 3TL2A 3TNLA 5JDCA 1WAMA 1ZEMA 1EUCA 3DOOA 3FNGA 5TX7A 3TQHA 2PR2A 5AXCA 1XR3A 4CMCA 2HU2A 3OHSX 3WGIA 1LNQA 4YYZA 3EDMA 4PG4A 4F45A 2J3IA 2H63A 1WDLA 3FBTA 4IY1A 3LVFO 4R1UA 3PP8A 2NSDA 3ZGYA 1GV0A 1WPQA 3BMNA 5TJHA 1V35A 4J3FA 4LSMA 2GN6A 3AY3A 1YJQA 2DQ4A 2V7PA 4AJOA 3C85A 3I6QA 5AQ1A 1RWBA 4W9NA 2ZKLA 1HTBA 3ZN2A 4IIUA 4DA9A 2AQHA 3NT2A 3UW3A 1BWSA 1TEHA 5JCJD 1YRLA 3ZNNA 4YT4A 4BNJA 4BMSA 1HDOA 1N9GB 3C1TA 4DIFA 2RHRA 2UDPA 1UZMA 2GSDA 1UXGA 3WGHA 4PLPA 4JJIA 1Z82A 2B37A 2C54A 1UH5A 4R4JA 1LSUA 2I76A 1MV8A 3CIFA 4YJGB 5H83A 1XWFA 1B8UA 3CINA 1EVJA 3NTQA 2NQ8A 3OA2A 2P2SA 4RORA 5T67A 5KIAA 3IS3A 1EQ2A 2Q1UA 4DQUA 2YV3A 3N7UA 4TRNA 1J49A 3ONFA 3LLVA 1YQDA 1LRKA 1E3LA 2OMEA 4J4BA 5GZ3A 4OGWA 1WDKA 3LC7O 4N5LA 4RLHA 5JMPA 2VHZA 2O2YA 3I83A 3LF1A 4B7XA 1LUAA 4CMEC 3I6IA 4GX1A 4ESOA 4EJ6A 1QYDA 3WIDA 4YACA 2HK8A 2UUPA 1YL7A 2BLLA 1IHYA 3U4HA 2D5CA 4IQ8A 4GLOA 3SC4A 3SJUA 4UREA 4XRGA 1ONNA 1ADBA 5KWEA 3D5TA 1ENPA 5G4KB 3QE3A 1I3NA 1GTMA 4LMRA 4JGBA 3W1VA 2W2KA 3GPIA 4L73A 2C29D 2OBNA 3B1JA 4AJPA 4BNVA 4YQYA 2HKIA 1XU7A 1K6IA 1VLLA 4ZQHA 1C0LA 4FJ1A 3HN7A 4RQTA 4IZIA 3WICA 5ITVA 4BV9A 3RU7A 4L4XA 3TZHA 1WMAA 3N58A 5TRTA 3BMQA 3QY9A 4Z0PA 1VL6A 3PDUA 5FF9A 2FSSA 1DHRA 4IDBA 3JYPA 4XJTA 3LQFA 4DMMA 3I9KA 1BXGA 1ZK0A 5ITWA 2WD7B 4CQLA 3CH6A 2OBYA 3ZU4A 1J0XO 3QWAA 2NVWA 4Z0HO 1SC6A 2I9PA 5EINA 3PGJA 1DJNA 4TRJA 1P74A 1FDWA 4YPOA 5T57A 3STHA 4ID9A 1AUPA 3B1KA 3M2TA 5T8KC 2ZTVA 3FF4A 2TMDA 3AOGA 3TZ6A 3CSDA 1HDYA 2LDXA 4BKUA 5CDGA 2JAPA 3PQEA 4Q39A 4UVIA 3W6UA 1LJ8A 1E3IA 1BTOA 3AFNA 5F1OA 4CLXA 3QWHA 4XGIA 4O5OA 5A06A 4ILKA 3KSDO 1V0JA 2AMFA 4RPJA 3M1AA 1E3WA 2QHXA 3JQGA 2JD0A 4E3ZA 2I3GA 2BGLA 4QQRA 1KBZA 4CLRB 4B8WA 1C0PA 3BTUA 3PIIA 5ICSA 2W98A 4BHTA 1MXHA 3RUCA 3TOXA 3H8VA 2WJPA 1WDMA 3FTNA 5JAIA 4OM8A 4J6FA 1PWXA 4N7RA 4W7IA 2HMTA 3FWNA 5BNFA 3ZW8A 3KB6A 3U49A 1DB3A 3DZHA 1YDEA 4B8ZA 5B4TA 1O8CA 5I7SA 5CDUA 4KTTE 4FSHA 2O23A 1NQAO 3P2OA 4MJLA 5C7IO 2GR9A 4D43A 1N7HA 4BOYA 3HFSA 1JA9A 5BSEA 4W6ZA 2TMGA 1NNUA 1UZLA 2H1SA 2VHXA 3GN2A 3HDJA 3TN7A 1PSDA 3LT2A 2BKAA 3BTSA 1HSOA 3MJVA 4XCVA 3O8QB 1UXHA 1LBEA 5THKA 3AK4A 3D3EA 2A92A 1IOLA 1MP0A 3GVXA 2ZB8A 3PWKA 1N2SA 4JBGA 3ZWYA 3RD5A 4CMEA 5DBGA 2FWMX 5JXWA 2IXBA 4JK3A 4B79A 1PR3A 1DIHA 1GZ4A 2DLDA 3EVNA 4NU5A 4OKIA 4DIOA 1M6WA 1NPTO 2ZB7A 4HFNA 4E21A 3TFQA 2RHCA 3R3JA 3WG9A 1K6XA 4BO1A 1PQWA 5L4NA 1ZXLA 1U2DA 1VL8A 1NP3A 5IAAA 2R2GA 3VZSA 3OIGA 1JTVA 1EVYA 1U5AA 2X0IA 3JQ7B 5COQA 3KYBA 4R16A 3RC2A 5MDHA 2EERA 2Z1MA 2I5PO 4NBUA 4CM5A 3GZNA 2NQTA 4PLCA 3U09A 3F6YA 1GAEO 1ORRA 3GOHA 5DBIA 4YJFB 1OC2A 5B37A 4IS2A 3WJ7A 1ZH8A 4DXHA 3IUSA 5EMHA 1KC1A 1Y8RB 1EUZA 4WCDA 4HWKA 1PS9A 1YWGO 3D4PA 3JQAA 3QVWA 1SNYA 3F3SA 5T8KA 2AQ8A 4J1TA 2E49A 3L77A 1E1NA 4CM9A 2CMDA 4Y9DA 2WYWA 4I8XA 3GY0A 3C7CB 3C3XA 4F3YA 2PTGA 5JY1A 4PG8A 3DAPA 4U7WA 3GVHA 3I23A 2BGKA 4I5EA 2FZEA 5DF1A 1VJ1A 3UH1A 1SOWA 2XXJA 3V2GA 1M67A 1FDTA 1SZJG 3D4OA 3GG9A 3H9JA 3U0BA 4R1SA 2Z1NA 4NFSA 5HBRA 4WPGA 3DZFA 2AQIA 4G81A 4CJXA 4MVJM 4BS9A 4U6QA 3WQQA 1B14A 4A73A 1DSSG 3PGXA 2I66A 2JKVA 1H2HA 4BUCA 2NACA 3DHYA 2H9IA 1XHLA 4J0FA 1OFGA 4XR9A 3OEYA 2X6TA 4NMHA 3H5AA 3PLNA 4LSWA 1V9LA 3KYCB 4WJZA 3VTFA 1JKIA 1YE3A 5HM8A 3VTZA 2X1HA 1PL8A 2EJWA 2J5KA 4JN6B 4WLUA 4XQCA 4HX5A 4IS3A 3UF0A 3PZBA 2VTDA 2EIHA 4WCFB 3WBBA 1UR5A 5BQFA 3S2IA 4EDFA 2CVQA 1ISJA 1R16A 2O3QA 2Y99A 3ETEA 3WYEA 3CZMA 3PK0A 4CR7A 5ER9A 1JKJA 2QX7A 1FXSA 5JO9A 3X2FA 1QG6A 4N5MA 1WP4A 2R00A 3OH8A 2PK3A 4QFCA 4KUGA 1W73A 5F21A 3PWZA 4DWVA 4YRAA 3LLSA 1UDBA 3KSZO 4TRMA 1U8FO 1WXDA 4OXYA 2IZ1A 3ZWCA 3HWRA 4ONEA 4R41A 2D3TA 2QRKA 4DREA 1X1TA 3GVIA 3PJGA 2OXIA 2PY6A 4CM4B 4NFHA 4GPD1 1XYGA 3Q0EA 3FR8A 2Y1GA 4G5HA 1IY8A 1E77A 4JBHA 4XYBA 3GRPA 4N5NA 3I5MA 1MXFA 4IZHA 2VQ3A 1JVSA 3V8BA 1KVUA 3P2YA 3MTGA 3QVXA 4KMSA 1CETA 4ZA2A 1P1FA 4JROA 4KUHA 3K31A 1EMDA 2HJRA 5JAZA 2FN7A 3KVOA 3K8ZA 4OAQA 4I9HA 2NV6A 4J9UE 4PRKA 1YB5A 1IYZA 3IUPA 3GDFA 3QV1A 5DNAA 1QP8A 2JFGA 5EQDA 3WTBA 1SAYA 2WYUA 2EG9A 2I3AA 4FDAA 2HRZA 2P91A 3RFTA 1DOHA 3AM4A 4FFOA 5KVCA 2AQKA 2DUWA 3DMTC 1YDWA 3JQDA 3AJRA 2B36A 3ZU5A 4FOSA 1IHXA 2OORA 1MG5A 1P45A 2NU6A 1EE9A 1O0SA 1K6JA 2RCYA 3WDSA 5JY6A 5JLAA 4CQMB 3JCZA 4QSMA 3LSYA 4R68A 3JQCA 5U1PA 4E31A 1MUUA 4D0RA 2GNAA 1TVEA 4E2YA 4RPKA 1UXJA 5FEUA 1E7YA 2F00A 3BAZA 4HFJA 4L8VA 4FC6A 4FN4A 1DC3A 4PZEA 3BMOA 2BFOA 2E48A 1F0YA 1LQTA 1NWCA 3EZLA 1U3WA 3CKYA 4NIMA 4RVUA 5HTOA 4PLTA 4BO2A 3RBVA 1HZJA 2Q99A 1ISHA 1H6CA 1ZUD1 4FFRA 4B3JA 5KOIA 2V65A 3T7EA 4QX6A 4MKRA 1BW9B 1EK6A 1LXCA 4UVHA 3UN1A 4J16A 1ISMA 1QYCA 1DFHA 5MGBA 1DAOA 2ZYAA 4NBVA 5L51A 3DZJA 2W2LA 2PA3A 5JMWA 5TIIA 3E9NA 4BQRA 4AJHA 1MG0A 4N54A 3G17A 2NU8A 3LK7A 5FWNA 5KJCA 1U28A 1HDGO 1CJCA 3VPHA 3VZPA 3ZWBA 1WNTA 1EFLA 3P5SA 5CPFA 4EUEA 4CM8B 1IULA 1NTOA 5BSGA 2GZ3A 1I30A 1H2BA 2Q46A 5THQA 3WYBA 3W6ZA 2B83A 1NPYA 2OOSA 1PJSA 4NK5A 2PGLA 2EHDA 1TXGA 2PKRA 4E32A 1GY8A 1NPDA 4S3MA 3AI3A 3WSVA 1DDOA 5LDHA 2GD1O 3WLEA 3L4BA 1X14A 2Q4EA 4YEDA 3WGGA 4E30A 3LDHA 4JQCA 4BNZA 1UXKA 3L4SO 2HMWA 3BIOA 2GZ1A 1C1DA 2Y1FA 1ZVMA 1TT7A 3VPFA 1K2WA 3K2EA 4MVJF 3X2EA 5TS3A 1FK8A 3GAFA 4LVUA 1ZIDA 1RJWA 1AE1A 1LTHR 3GT0A 3ADOA 2VWGA 2P9CA 4Z3DA 1M6HA 1PGJA 4PGFA 3PWSA 1E7SA 1M2WA 3HHPA 4M49A 4RO0A 3UVEA 3HDYA 4UULA 3SLKA 3E48A 4NBWA 4DQVA 1N1EA 1T4BA 1ZXBA 4EEXA 3TWOA 4E13A 3GQVA 1I32A 4D44A 4O63O 1B26A 5JDCC 4HUJA 2OUIA 3VVCA 4CV0A 4J2OA 1P31A 3FD8A 1I33A 1LLDA 4DMLA 3HQ4O 1R4MA 5COBA 4ITUA 3DMTA 4BVAA 1E3SA 3ZHZA 3I9NA 3BTOA 2O4UX 2PH5A 1ZEJA 3QLJA 4IM7A 1AXEA 3AFMA 4R1TA 2ZJ1A 4OHUA 4XQGA 4BL5A 2V6MA 5A3VA 1DLJA 4WK6A 4WASA 2D5AA 2AEFA 2IEBA 1EBUA 4TZKA 5I8WA 2XOXA 3IC5A 4ROSA 2BELA 3FNFA 1K5HA 4JIGA 4II2A 1H9AA 1Y8QB 4Z0TA 3ANMA 4DPKA 2HK9A 3C8MA 1BSVA 3RIHA 3NJ4A 4RPLA 3RJ5A 2YHUA 4W9NC 1UJMA 3DBLB 4DGSA 5KTKA 3P19A 4IIVA 2EKLA 2CF5A 3B20A 1X1EA 1DLIA 3QHAA 5F5NA 1C1XB 1XLTA 3QJ5A 5TLSA 4UUOA 1G1AA 3VPXA 1I3LA 3WGTA 3ZH2A 4BNGA 5U9CA 4CLOA 3VVBA 2POQX 2O7QA 3F1KA 1WWKA 2Q1TA 4KWHA 4UEJA 3TJRA 3WQSB 4RL6A 1AN9A 3MWDB 4MVJE 3RWBA 2EKQA 2YHIA 4NR0A 4JLWA 5I7VA 1T25A 1EK5A 3GH3A 4FB5A 1D4FA 3R6DA 3OSUA 1B3BA 1Z45A 3HN2A 3JQ8B 4UVEA 4RDIA 1D3AA 1D7OA 4YQZA 4RZHA 2BFPA 4CMKA 5ER6A 3QA9A 3AOEC 5EQFA 2CDBA 1VJ0A 5C37A 3LT0A 4DUPA 3V1TC 1E5LA 3UHAA 1A7KA 1PZFA 3O4RA 4UVGA 4EW6A 1RM0A 2Q2WA 1LDEA 3DBVO 3WYCA 5ENDA 4ALKA 4WOJA 5IDXA 4YAGA 3E5RA 3IOYA 1T2DA 4AJ2A 2O3SA 3VZQA 4B3HA 2DBVO 1JDJA 1UP4A 3ZI0A 1O89A 4DVJA 4MIOA 4EJ0A 1Y1PA 3VHRA 1E6WA 3ADPA 4O6VA 4H3VA 2ZYGA 2QZZA 2O3UA 4Y98A 3WX0A 3PQFA 5EIOA 3BMNB 2CF6A
chains in the Genus database with same CATH superfamily
3O03A 621PA 4EB8A 2O1XA 3K35A 2VJNA 1DBSA 4I7EA 5CJ2A 4GRIA 4YI5A 3UJCA 5IBCA 2XDQA 3M8KA 5LP6A 2E37A 1ID1A 3PRHA 3D6VA 1VIAA 2PKCA 3H6KA 4V1CA 2CE2X 3X1WA 5CLIA 1SPBS 2OFXA 1NT2A 3FNHA 3OQ6A 3K70B 2PZ8A 2VBFA 4GP7A 4NKRA 3DBRB 3HXTA 4G0PA 2I7TA 1B93A 2YVUA 4GSKA 4JQZA 5BUCA 4YAUA 3OQOA 2YFYA 1CJSA 2R1ZA 1G3UA 4JP5A 4ZXPA 2MIIA 2ZBVA 4R0VA 4Z1OA 2FSIA 4M6WA 6ADHA 2WPDD 2XXAA 2BFBB 1E5VA 2QNRA 3ROKA 4BX8A 4FZ3A 3CLTD 4F2WA 3ND8A 3PUZA 6LDHA 3U1BA 4JFAA 4YDSA 5J4KA 3LQYA 3S70A 2H5IA 1IAQA 4HF7A 3CQ9A 1GA1A 2EEZA 4LRQA 1T34A 3FAZA 3IH5A 1P1KA 2GSWA 3WWZA 4WL0A 3BZWA 4DXAA 1NVTA 4TROA 3V2UA 4EHIA 2A4MA 2JGNA 4REMA 3AKYA 3A6EA 2YMPA 2GF0A 5FOTA 3IAM1 2BW0A 5HUJA 3ND6A 2GKSA 1P3JA 3TS1A 3DMNA 1TK2A 5BN4B 3I6ZA 1P7WA 4KO3S 3AL0C 2JCGA 4Y9UA 4QM7A 1TAQA 3W2GA 1S3IA 5DNCA 1F9AA 3MAJA 4OXRA 4PLWA 2QM3A 1Q0LA 2ZRPA 1A76A 1SKAA 1C8BA 2HIGA 4AF8A 2F1HA 1FRZA 1UPBA 4L2IB 1B8OA 1I3MA 4EPVA 4WK4B 4EIWA 1YFLA 1NR1A 1B0ZA 1R8YA 1Z75A 4KSCA 3LCMA 3TLZA 2GVDC 2ONCA 1P3DA 1AHNA 3BH7A 3SAJA 2DLNA 5HKAA 3L9WA 1K6MA 3UMGA 1T4DA 4XGNA 4I50B 1UJNA 3DHNA 4ZREA 1NONA 1WSWA 2QX9A 3I1JA 4R54A 4UJ5A 5AKLA 3ZBTA 2PGAA 1VG9B 3HLYA 2QU7A 4JI3B 3TI7A 1FU8A 2BHNA 2PRSA 3JTEA 5KHAA 2O8EA 3DT8A 2HDHA 5B6JA 4C88A 1LRJA 2RHWA 2C2BA 3JQ6A 1E2HA 4BZXA 3R2JA 1OMOA 2P77A 4TMXA 2C5LA 4IJMA 4XIIA 1YGYA 3E8XA 4M0MA 1VYUA 2JHCA 3BWBA 2FUEA 3QA3E 2HI0A 4WOCA 3UG7A 1BXGB 2B2NA 5IBRA 3MUEA 1KEWA 3CEJA 1AKEA 1UDCA 3WIOA 4Y2QA 5F7JA 1JDBB 5DXAA 1JJ7A 2RMKA 3K2BA 1QF9A 3PHLA 4XDHA 5FLKA 4OFWA 5E1MA 2FJPA 2QUHA 1HC7A 3W2EA 4W9MC 3AR2A 2IHUA 2HYIC 4NONA 5K2MA 3Q9NA 4G0OA 1VB5A 5DBFA 5EJ2A 5KNCD 3W4JA 4GI5A 1NUAA 1U3FA 1VM6A 3A7EA 3T34A 3TO5A 3VO2A 3UQYS 3MB8A 4Y2PA 3T4PA 2DVMA 2ZIFA 4NBRA 3KZ1E 2L19A 3BXXA 4R9NA 3EMKA 1FYFA 1PG2A 3KJNA 2PTHA 1AGNA 2PH3A 4RANA 5CNMA 2GH1A 5A3JA 1GGHA 3HY6A 3NIBA 5L95A 1KGSA 1U8AA 3DLPX 1YOBA 3Q11A 4PINA 1MFPA 3PJRA 3C7KA 4IDPA 3ENWA 4LRYA 5BWLA 2CCJA 1DAEA 1DCFA 4L7VA 3GA7A 5BXQC 4DBZA 4HH3C 3AL2A 3JPWA 1G2OA 1W25A 2AOVA 3EVFA 3L7OA 3R3SA 3RASA 4BO4A 4BZWA 1Z5PA 4QJ3A 2IYNA 3U62A 3MVEA 1J0EA 2YZGA 2G04A 3NBQA 4ZHQF 4OV6B 4MYRA 1EFRA 4QNMA 1Q2XA 3BD7A 2WAOA 1MRSA 1E7WA 5LKAA 4TT3D 5DWDA 1RBYA 2NXJA 3TL3A 3BRQA 3GEHA 1BVUA 2J85A 5CX4A 1PZEA 3NU1A 3ZZTA 4DUGA 4ZTUB 4QM6A 3KQLA 1ZG3A 1IEWA 4F4DA 1BROA 4X60A 4EDHA 5BURA 2BUBA 1CHNA 3RHTA 2NLOA 2JLCA 1YQGA 4H7KA 3MW8A 5FNZA 2SCUB 5G3YA 3FY4A 4JA0A 4BAGA 3DM9B 2VAVA 4WEQA 3ZWOA 2XNKA 4O59O 4XX0B 4B6RA 3GJ0A 3R44A 4CKCA 1PK8A 1YK1A 2CFTA 2IXDA 2X3UA 2VUSA 3KQTA 5EIBC 5B7GA 4YAIA 2WAMA 1P7ZA 1PWZA 1V96A 5DTEA 2FG5A 3CEPB 1S4MA 3C7TA 2F1KA 1CUSA 2YVKA 3OOWA 3WS7A 2P0EA 4EB0A 3LL7A 1DTEA 1KYYA 5DNWA 3URMA 1A71A 3LO8A 4D9FA 5JH7A 3PXBA 5AKXA 4B73A 1BFDA 5J58A 2DZDA 2HIMA 3GP8A 2ENUA 1DFIA 1E20A 2WZQA 1NRJB 2WTMA 3K0AB 4I1IA 4C2TA 4OK6A 2RGUA 4NP6A 1CKEA 2HWXA 3AILA 4C6TA 5JARA 1ECPA 4BO0A 4RACA 2EVWX 3SVTA 1NF3A 1PIWA 2ODNA 2ZQYA 3OCXA 2HUNA 4E2WA 3IDFA 2RGNC 1HRDA 2FG7C 2VP9A 3OZFA 4Y9RA 4B48A 4DILA 4M7WA 2EDCA 3G2LA 1X1CA 1ACLA 1PJ4A 4HVTA 3P0EA 1ZW6A 2EYUA 4JVNA 1R66A 3MELA 1SGWA 1Q3TA 2R7NA 3HTXA 4WLEA 2IBMA 3HY3A 1G2PA 3C6YA 3WIUA 2HPAA 5IAGA 2PX4A 3B6JA 4GGPA 2JVIA 3L1IA 4CTJA 4GBMA 3S68A 1EFVB 4NE2A 2ZPTX 2PD4A 4EY8A 2XVZA 1EZ4A 3UHOA 1YQEA 1GT91 4PLFA 4A9AA 3FF1A 1Z35A 4DDHA 3DPSA 3OQBA 4KE7A 3A8TA 1VKNA 3ENNA 4EA9A 1ZHFA 1IEQA 3OX4A 3MCTA 3Q2IA 4HAOA 4JC5A 3RK0A 2O2XA 4Q7EA 2VJCA 3IX7A 3FYDA 2PJUA 3BGVA 3EF1A 4R01A 4P58A 6YASA 1W36D 1XL0A 3ZXSA 1JHVA 3OF5A 4DKJA 1JEYA 2W6IA 3P2EA 2LPMA 2ZRKA 4MS4B 4FFMA 4W8OA 3C6MA 4I3GA 2NVBA 1ONPA 3FG9A 2F7SA 3C7AA 4HATA 2CGEA 5GJWC 4CLRA 1KDRA 2PLRA 4BX9A 1UF9A 1EWRA 1G5HA 1JIIA 1MRZA 3BK7A 5I9MA 4H4CA 1ZESA 4R83A 2VHVA 4H1TA 2J1LA 2WTEA 4B83A 4M1WA 1U90A 3EVGA 5A4FS 1CUYA 3L7JA 2FR8C 4PR0A 2ZITA 1Q17A 2XODA 1RLMA 2C0PA 3A4TA 3E35A 2EGUA 3ORHA 1UEJA 4LQCA 1E96A 3TAUA 3WFZA 3AB7A 3DXFA 3YASA 3UA3A 5F2OA 1OREA 3K7EA 1PNRA 4Z4GA 1YTLA 3TB4A 3BS4A 1YVPA 4OXIA 4PAMA 1DMRA 4A16A 1QC5A 2E87A 4Q4DA 2PRYA 1RAEA 1W0KA 4F56A 1JAXA 1XCGB 2ZYRA 4B4UA 5K3FA 1OLSA 3KEOA 1O94D 2OZEA 1K89A 3DWIA 3N0TA 1KZHA 4ZHQB 1V8FA 4H27A 1SN7A 4OMCA 4CMIB 1PD1A 4R2WA 3KKMA 4NFLA 3EVBA 2PWBA 3O90A 5KAPA 2WKPA 4AXBA 5GZ1A 5HZMA 2F1OA 5KYUA 2QXYA 3FVWA 1BS2A 2D5BA 2WMDA 3LU1A 2J6IA 1KJWA 3U7FB 2GTIA 2NOAA 3TW8B 2XE8A 1ZJJA 1PR2A 3IURA 3FMFA 3R6TA 4BKMA 3E5MA 4MV8A 1TLFA 4J43A 5BWCA 1L7NA 5P21A 2BP7B 4MTCA 2Q5CA 4AG5A 4C89A 2XCRB 1MC5A 2GEJA 2IF0A 3M5WA 1KE1A 5IJ0A 2A0XA 2CNBA 3MOIA 3LQ1A 3H87A 1D9XA 1SO8A 3KV1A 2WHPA 2X0FA 2E1RA 4EI8A 1MVLA 3LIIA 5E9JA 2O6LA 3ILSA 1XQVA 2BR5A 3K32A 4Q03A 1AB6A 2B8WA 3VU3A 1BEZA 3F2VA 2ZBGA 1JLHA 1N0HA 1G8FA 1E2NA 3VPDA 4CM6A 4MQFB 4CMGA 3TQCA 3JQ7A 1DUVG 2XDWA 1T24A 4D56A 2HF9A 3LVBA 3NTOA 4I4TF 4KAAA 1YBHA 3BMCA 3RRXA 2VF5X 3DYIA 3HP1A 1A88A 4JDPA 2JIOA 3CKKA 4AZVA 1NMZA 1V47A 2GASA 4R2JA 4WVFA 1GPDG 4XPZA 5BVGB 1Y6ZA 1ZL0A 2VWHA 3SC2B 3WBKA 5TT0A 1MC4A 4BIIA 5EJ6A 3RSSA 2OL4A 3EWIA 4QATA 1RQNA 1PLKA 4YIKA 1SC9A 1P9RA 2Z8ZA 2PUBA 2IIBA 4PU0A 1Y8RA 3D8NA 3HKDB 3IRVA 4W6QA 5UKDA 4OBWA 5BQOA 3RTAA 3JYNA 1LI7A 3QITA 1FA9A 1IU9A 3T3EA 1Y7IA 3BA1A 1HQDA 4UEQA 1LI4A 2JAQA 4XB6B 1MIOB 1QGDA 2YRFA 1TF2A 3FWZA 4BMXA 1A9QA 3ICCA 2GZRA 1U2EA 4WKCA 4B7UA 4QQNA 4BB5A 1SRRA 4C4SA 2FPUA 2PGXA 2PFGA 2ZR8A 4C4PA 4CKWB 4D81A 1H8EA 2JJ1A 3TIXB 3DS8A 4MGYR 3RC9A 1LPBB 3I2HA 4MR7B 4D3DA 1E6KA 1TAUA 1U0GA 1Z8FA 3W5UA 4QGFA 5L9AA 1ZICA 1JR3A 3D1LA 3LOUA 3FPAA 4QD3A 4YREA 4CM3A 3K9WA 2GCNA 1C7QA 4QJIA 5C51B 2JLXA 5JNRA 4LZZA 1K0UA 4EG0A 5IDVA 4K6CA 4MLDA 2J59A 3R74A 2YUTA 3ICPA 4I9UA 2O4CA 3EB9A 3RVDA 4KXVA 5DLEA 2QRNA 1PFGA 2PKQO 3FETA 5H3LA 3F7OA 1KDTA 3OAAA 4KK4A 3O31A 4RXUA 3T94A 1FP4B 2C7QA 3W4KA 1SKUA 2FR8A 3UMFA 1KY4A 3EISA 2XMZA 1PKXA 4KREA 1X94A 2W6ZA 3V7UA 4DPMA 4N3CA 4YR9A 4AKIA 4FQ5A 1R4NA 2PBZA 4B6OA 4MVJH 2H31A 3MGKA 4BDTA 2O19A 1P4JA 1EQUA 3I5XA 1ZSNA 3GRCA 4IIBA 5IJAA 1VPWA 1TW3A 3HBAA 4Y67A 4ECEA 4BEWA 1WUHS 2JCSA 1FNBA 4HLDA 4PRLA 3VVMA 3PI7A 1HETA 1P29A 2WU3A 3RUIA 3WRVA 4AKSA 4CTNA 2ZPAA 3LY8A 1G9XA 1Z73A 4HMPA 4ALNA 4ESHA 4ZALA 1NYTA 3A70A 4RLSA 1DAIA 3FB1A 4B1FA 1NQ5A 2XUIA 4G1MB 5K3CA 5C5CA 3SBOA 2W43A 4WCVA 5CAEA 4IEIA 4GUAA 2H7VA 4ARSA 3OQIA 2CJPA 3GUCA 3RSQA 1T2UA 3F6SA 3M7IA 4GXTA 3BJMA 1R4ZA 1S2NA 3QUAA 3S2EA 4E5PA 1EVZA 2IQ5A 2N42A 3CR8A 1U8CB 1NW9B 2W48A 4U2BA 3L0IB 2QP4A 1NU6A 4KEAA 2QW0X 2XUOA 3M6UA 3E6AA 3WJAA 4M21A 4YAWA 1Q1QA 1GGNA 2WU1A 2IIQA 3NAQA 4L5CA 2FSPA 3MJHA 5KSPA 4BKRA 2VUTA 4ZO4A 1LV8A 5EGNA 1GSOA 1ZIOA 4ER0A 5FL7A 1W581 1NRXA 4E5KA 4ARBA 1J70A 2C4TA 2NNLD 3PZRA 4IVPA 4JP1A 4MRRA 2WFZA 2RH4A 5C4GB 1VTKA 5K45A 4LF9B 4RV9A 1RKUA 4ZYZA 2C5EA 5K6RA 4IGFA 5LM3A 4ZIRB 5REQB 4DV1B 3W3AD 1E7RA 4KBFA 2I1LA 4ARIA 4PGHA 2WSSA 4I4TB 2MSWA 3NP9A 5FTLA 5JEEA 1EKXA 1UC5B 1PT5A 1XLTC 4DSNA 1P73A 2QAGC 3WGQA 3OJEA 3ZLJA 3RS4A 5CPBA 3E9ZA 1POWA 3V4LA 1V1MB 1EU1A 1T5SA 1VI6A 5EG5A 3SZOA 2ECQA 3I12A 5IX8A 2JFUA 4ENVA 4JWKA 2Y0PA 5LJIA 5LYYA 3K6JA 3OZEA 4NV3A 1HLPA 2D0OB 3CR7A 1KE2A 4Q01A 2EU8A 4OKNA 2FAXA 3O4IA 5GY7A 1Z29A 2Q3MA 4URVR 3RJTA 4BRSA 2VI5A 1A4IA 1PHPA 1PGPA 4O0MA 1NTRA 3OFVA 3SZUA 4J0JA 4RA9B 4GI1A 1ML3A 1PP4A 2YFKA 1V5GA 4M55A 2YXBA 4EBFA 1QYXA 4HV4A 5EKSA 3B12A 3ZW9A 2BEKA 2J5RA 3H16A 3OOSA 1RACA 2QZ4A 3RYCA 2BPOA 4MRAA 2IODA 3B5IA 2VNJA 3OPYA 4H3SA 3D6TB 1DC8A 1NJ6A 1MRNA 5DTQA 3H2KA 4DDUA 5CBPB 2OXCA 3U0VA 1R15A 2OCPA 3NATA 1H6DA 4FMDF 2MHCA 2IPLA 2R25B 3VZDA 5LU9A 4Q1EA 3ZHBA 1A77A 1XD2B 2JK1A 4X94A 3TR6A 3AVWA 5JWHA 1MX3A 4QO8A 2OVFA 3EMVA 4GNRA 3NBMA 4LXHA 4BGEA 4GM4A 2BZSA 2XB8A 1GKIA 3FZEA 4P84A 5DGIA 1QVVA 2I4MA 1PV4A 4ATNA 1BDHA 3RBAA 4B3IA 4UQPA 3A4VA 3LKDA 4LN1A 1M76A 3RAPR 1UBTS 1N6NA 1G64A 3EY9A 3WNVA 4ZCMA 2A94A 4EYKA 5ESDA 4Y2SA 1OLOA 3MT9A 4QHTA 2AG8A 3G5UA 2P2NA 4I9NA 4TXNA 3IT1A 5FTNA 4W1PA 4NICA 4B40A 5BW5A 2ZUSA 1M8JA 1K3FA 4DY4A 4J76A 3F1LA 1JX6A 1NBOA 2J67A 1SU4A 5EWMA 1QGUB 3AUYA 4RGBA 2AEJA 2XA9A 5EWJB 2XCOA 3KAKA 4XB2A 2XZDA 1LK7A 3L6OO 2QLFA 2YNMA 2XZLA 4GR9A 4CUKA 5DV9A 3BOSA 1R8JA 2Y0CA 2HCFA 2HO4A 3OETA 5DRYA 1U3CA 4U9HS 1FMCA 3OF2A 4JUIA 2JB9A 3R5TA 4U6SA 4WN9A 1C7JA 2FWNA 2EP7A 5IU6A 3GC6A 3VR4D 1JF8A 1V43A 1WCXA 4Q4HA 3AR8A 4GXQA 4D1YA 3ZY2A 4IDAA 4GOXA 3TNYA 4JT2A 1AQYA 1MB4A 1U0FA 2O50A 2QX8A 3FCXA 2C8LA 1SVKA 3L9XA 4NBKA 5ILQA 5EJ7A 1YB2A 5FBZA 2WPDA 3FB4A 4L50A 5HA5A 1E89A 3DFMA 1P0CA 5A6SA 2ERYA 4ZEWA 1NLMA 5LBIA 4A2CA 4DBVO 1MABA 1GU7A 4MPPA 1N6RA 1S7CA 4EX6A 5JC8A 1ZISA 3QXHA 3GJ3A 2RGDA 1J5PA 1MVNA 3JQ9A 4HDSA 5JD4A 2VQDA 4E5DA 3IP7A 3W04A 5JG7A 3KZOA 2CV0A 2XRMA 3E9QA 3EN0A 5TY0A 4CKBA 3CEAA 2KE5A 2H4WA 4BCBA 2NO9A 4WHMA 2QTNA 4BLSA 2A1TS 2XD4A 4XUGB 2HF7A 3ZCQA 3WYNA 2DLCX 1WUYA 4DR6B 4Z5XA 4HRYA 4OU4A 3LPAA 1KP3A 2WTAA 1EFDN 1QHEA 5IH3A 4EBBA 1ZMRA 2JAHA 4US1R 3NV9A 4L6CA 2VJMB 1Q1ZA 1QE0A 1THGA 1BMFD 5I9NA 1ZM2A 3D59A 3KX2A 3FPCA 4EFMA 1CQZA 1LBTA 4F3NA 1PDVA 2H51A 1BMDA 3DW1X 3K6SA 1RI3A 4G8BA 4RUKA 4TMFA 1Z36A 3IEVA 2H17A 4MB0A 3X1DA 1R00A 3ECAA 2CLSA 4FE7A 1JFLA 1KEUA 4RLFA 1PF7E 1VCIA 3E4DA 5T41A 2VDUE 2OKGA 2BH9A 4ZO7A 4BQPA 4N40A 2XF8A 4H7IA 3UAVA 5BN3A 1JU9A 2AFIA 3ICWA 4KAFA 3OOHA 5DM1A 3H9QA 4BLWA 4X20B 3Q6IA 1CRLA 4RD3A 3USCS 2C8KA 3K1YA 4B74A 3JYHA 1TM1E 2BMFA 4OATA 3GAMA 3QVGB 1NW7A 1RIFA 3DM5A 1P18A 2D62A 2QSUA 3ROZA 1PFVA 3GAZA 1ZI6A 5DSZA 1SWWA 4NZZA 1V6AA 2ZK7A 1VPTA 2V45A 2J0SA 2Q28A 1TEXA 2B1GA 2QGFA 2ZBFA 1VIVA 3JASA 3OMLA 2M1XA 3SR4A 4XWOA 4GBGA 3HYCA 1YS4A 2GPSA 1CDZA 1W76A 1XYYA 1MA3A 2GGSA 2BIFA 5IH7A 1QQ7A 4JITA 4ZYUA 5HKBA 2WZCA 3H3FA 4ZVLA 4PZPA 4IDFA 2AW5A 2CDAA 2OV6A 3ZDQA 1W36C 4I9FA 1CNFA 1DPFA 2H8GA 4ZYXA 1RYHA 1XMPA 2G28A 3O8OA 1AZWA 3E1KA 4FX5A 4XGRA 1TJ4A 4YCDA 2WLTA 3VZBA 2TSYB 2YDYA 3QOYA 3GD7A 2I4IA 1MOQA 4KQ6A 5E9QA 5FA8A 4EL5A 1LDGA 4N9QA 1CUFA 2CC2A 1SCAA 2UVDA 2XRYA 5CLQA 1EXVA 4R9SA 3JQFA 3RT1A 2BE7A 2FOLA 3QRWA 4RTSA 4FTWA 5FUVA 1H3NA 4MP6A 3WIEA 1VJDA 2G82A 3LRXA 1O95D 2BT4A 4LJ7A 5ENVA 5SYMA 2Q7OE 1EGMB 5AM3A 1U7UA 1AKVA 1AZTA 3CLVA 4ARAA 4PLVA 5T6MA 3JQEA 2MSEB 1X92A 1QZUA 1GDHA 3CRMA 4XWWA 2IITA 3N2EA 3OZRA 4HGRA 1M0EA 4MULA 5DT9A 2CK3D 1M74A 1O94C 5IM4A 3K0FA 4ZAWA 1XL1A 2DT8A 5EHQA 1KA9H 3CUSA 4P81A 4Q1BA 4TT3A 3ZQ6A 3ZLUA 5LSAA 4OQEA 5JT1A 1FSPA 1QIEA 2DM6A 4OI0A 1QO7A 3VTKA 3WK4A 2FGKA 3CRQA 4MUFA 3AO0B 3HCNA 4UOZA 3AIOA 4YJ3B 4KO8A 2FW8A 1OCEA 3P9PA 4KXLA 3DVAA 1ZL2A 3SXJA 3CWQA 1U99A 4Y8VA 1WBDA 3AI7A 5A9RA 2ECKA 3K05A 4E88A 3K6RA 1VFPA 3PWTA 4J0KA 3TAHA 3N74A 1CF2O 4FNAA 2YINC 3KO8A 5DH9A 1G17A 1KJ8A 5D85A 5EZ6B 3G9UA 1Y5LA 1Q2UA 3AEQA 3QYFA 4LV6A 1M33A 1D2AA 5H9WA 2XKAA 3AHJA 3C15C 1C0EA 1T1IA 2RJOA 4MYDA 4TTTS 4B47A 3DOIA 4JC8A 2DJIA 4MICA 1NG1A 1PU2A 1B15A 3INRA 3TRHA 2FEOA 2H1VA 3OFKA 1LSOA 4V1CI 3WLTA 1U0OC 4BO3A 3DDZX 3ISVA 1W5FA 2FWJA 1OYOA 4V0RA 2ZJOA 3NBXX 5I7HA 4W7HA 5E6RA 2ZSJA 1ESMA 1FU7A 1MR3F 1GAQA 2GB4A 2E2WA 5EVJA 2FQXA 3A1TA 2W2KB 2QN6A 3RKUA 3VH2A 2PRKA 1M7HA 4KFTA 3SF0A 3G85A 4N0MA 4FGUA 3UFXA 2IPAB 3DQQA 5A7FA 9GPBA 4FI3C 3WRYC 4HWSA 5KQLA 3ESZA 3N7TA 3C45A 4JUCA 4R84A 4YDRA 1H2ZA 1M1YA 4A10A 8ATCA 1KFEB 1LB1B 1QWOA 3FDZB 3PRJA 3TLJA 1GFSA 3FZYA 4KFUA 4FXPA 4JEUA 2I7CA 4NJEB 2XMDA 4DYDA 1OR8A 1Y1QA 2D4AA 1MQAA 5KB3A 1F0KA 2JFBA 4MJ3A 5BQ3A 1I1HA 1CZUA 1HLDA 5GZ6A 1UFOA 1NZJA 2H7CA 2MSCB 1P1HA 1U8YA 2P9FA 1YV9A 1W4CA 4M86A 5AK3A 5CW1A 3V2IA 1A8SA 1N8TA 3JATB 3O8CA 1KDVA 3UWMA 4IUBS 4C6HA 3WJ1A 1NSYA 2IOQA 5JOQA 4Z4EA 4C7JA 4QULA 2OPHA 1PR6A 2FZGA 2BR3A 3O3OB 3NWEA 1FCJA 4NDZA 4BNTA 3V8PA 1R0ZA 5C1PA 3FTEA 3HYNA 4MVJI 1XZAA 1RXVA 4KV9A 3N8IA 3QKIA 1J8YF 4ASUD 4BNKA 1TLTA 4YMGA 3VPAA 1DC6A 1L8AA 2Z09A 2HT6A 3L5OA 3OCYA 3UTDA 5IN5A 4CQNA 1C9EA 4FR2A 4JLSA 4G26A 4U9UA 1YOVA 4G0UA 1MDBA 3JWHA 2IVFA 1NV9A 2DAPA 1NAIA 3HO6A 3JQGB 3E0XA 1L4MA 1IJFA 5AI0A 5MN4A 3ER8A 2AG5A 1I94B 3PEYA 3UHPA 4CGYA 3WGUA 5L3SB 1F06A 1TUBB 2UYGA 3PRKE 1Q74A 2BSAA 1JEEA 3SMVA 1VE7A 3PR1A 1C9KA 3ZWWA 5EHGA 4PRYA 3UT5B 1E32A 4D8WA 5GONF 1YACA 1Z34A 1DP4A 4XDGA 4PSDA 2EKPA 4I66A 5EWLA 2Q6KA 4YCBA 4JXJA 1QXSA 2Y2UA 1BDMA 1N7JA 4YUXA 2FOXA 3FLEA 3FYSA 1U6IA 2QRVB 4QT0A 2QN9A 4HVCA 1BDBA 2YN4A 5TPWA 2WZDA 5L3RA 3EVCA 1GU0A 1N2JA 2VATA 3Q87B 4YAFA 5HZHA 1HUQA 2HHCA 4LJAA 1N0VC 4U2CA 1J5XA 4MA4A 5HRCA 3U56A 3B7PA 6ABPA 3ACCA 1YFZA 2R87A 1YUMA 2OENG 3Q1KA 4J07A 4TKVB 2AD5A 2V8BA 4EG3A 1B7GO 3RPEA 4B6PA 4OG2A 1WHTA 5CB4A 1E59A 3ZZ1A 4FSDA 1MC1A 1H2FA 2HXGA 1ULBA 2JGLA 2QM0A 1RSZA 5G4KA 1P5FA 3NM4A 3RRFA 3VHLB 2HU5A 3CX8A 5SZKB 4AJIA 5CXUA 4KI7A 2P40A 1NW3A 3HZHA 4PM4A 2H1OA 2R6HA 5EESA 2DUMA 2UUAB 2I2WA 4GC9A 4UM8B 2GJSA 4PNZA 1J2JA 3M34A 2I9KA 4QXPA 1FDOA 4BMNA 1TU3A 1GPH1 2YYYA 4D9KA 1CPYA 4D82A 1G3QA 1NURA 4TQ9A 5EI5A 4X6UA 4Q4CA 1O3YA 1FUEA 3GLVA 4QQKA 3RVRA 2Y8EA 1JTEA 3X1XA 4E22A 4YCNA 3K70D 2X23A 3AM1A 4XYMA 2ZUFA 4DV3B 3BXZA 1CR2A 4S2EA 1A5ZA 1FE8A 2W8ZA 3ONEA 1HYGA 2VA8A 2X9GA 3LLCA 4FS3A 4H35A 3ESAA 5LA6A 5FFMA 4C4RA 2WOOA 3LUDA 1GA6A 1QGOA 2QG6A 4P4GA 2WDPA 4JLMA 1R8QA 1XTRA 4P36A 1E1RD 3DL2A 4RC9A 4PFQA 2EYQA 3ZJTA 1T3SA 1NA5A 5FT9A 3RKRA 5PNTA 2XKKA 1KY5A 1XU9A 4TRRA 4QRIA 4ZO8A 4BTEA 4B2PA 4DCGA 2F6RA 3IBYA 1IOZA 2FU5C 1WPRA 1WSDA 2EJCA 2XB4A 3N2KB 4G0MA 4MIEA 4MI3A 1G8PA 1IPHA 4ANFA 2BMEA 1B43A 2CLEB 4R71A 4QUJA 3C0KA 3TSCA 1RXCA 2G25A 4RAOA 4FFNA 2ET6A 4IIYA 4A6PA 2B9EA 4IFTA 4WESA 5FBRB 1PJ3A 3USZA 4QUHA 1NI4A 2AOWA 3AUAA 3I92A 4TSRA 4CEIB 3DLAA 3EXAA 4WXHA 5DOVA 4XVCA 4RY8A 4D99A 2AN9A 5NULA 2RH8A 1RKBA 4ETIA 3SR3A 4AQ7A 3N0WA 1S7GA 1Y9DA 1CB7A 4JSYA 5DHPA 4DS3A 5B64A 4EMUA 4BAUA 3VMMA 2HSDA 2X6QA 4LHZA 2XTMA 1JB9A 1RPNA 3CZQA 3GRKA 5C3MA 1F2UA 1RI4A 2WAYA 1UBJS 4J0CA 5AESA 3JR3A 2CVPA 4M7RA 1RKXA 2BCJQ 2QTZA 1U1DA 2XUJA 5CYPA 5K0TA 4WXEA 3V1YA 1W4ZA 1Q0RA 3ZLBA 3D6JA 2D1QA 2IIPA 3TJMA 3OT4A 2A9QA 4E70A 5ES4B 1ILEA 2L82A 2FY8A 2PMDA 3KQPA 4RV4A 5ABPA 2QRUA 1W48A 3V4VB 1HM5A 4YLGA 4IWXA 3ZBPA 5K6AC 2DFNA 1AKWA 3ZVMA 3TBFA 2C5FA 2FHSA 3DZDA 4Y2TA 5A04A 1VBNA 5DYWA 1TTTA 1M7GA 3U4QA 5MHTA 3DDWA 3VSBA 2IUEA 1E8MA 1UBHS 4ZODA 2F1JA 1P80A 1ADFA 3BJEA 3OURA 4XPIA 3V7YA 1PDOA 2I54A 2J9FA 5GONB 2B7BA 2PWAA 1FFWA 3PJEA 3RYIA 4ZICA 5FLXA 2QBYB 1WU7A 1SQGA 1YDFA 2RB5A 3GJ4A 3Q10A 1SUEA 4WCFC 2I87A 3EQZA 5SV2A 2EV9A 3RH0A 4B82A 4IQ4A 5LQKA 2BEUB 2PZMA 5F73A 2ZJ0A 3WLQA 2EDAA 3MT7A 4EFDA 2FR1A 1A50B 3DVQX 3V4ZA 1J00A 1YJCA 4MUAA 2CYAA 5EPOA 3UJHA 2Y2VA 2UUOA 1BA2A 4C03A 1C3JA 3HBNA 3SBDA 3E4CA 5A5GA 1SCNE 4M89A 5JZOA 3P9IA 2V96A 3HXOA 4WECA 1E3MA 2H4YA 3WO1A 4TTSA 1GN9A 3K9QO 3LP5A 1KRXA 3F49S 5A05A 5CCEA 2P2LA 2BD0A 1CZLA 4I36A 4OI2A 5LMZA 3T9FA 2C2XA 1FX0A 2A5GA 3ETDA 4HNSA 2H1CA 4Q3EA 3WL5A 4Z4QA 1K9SA 1X70A 1M7BA 3G88A 4NY1A 4DMRA 4ZI7B 3AEYA 1GKKA 3DT6A 1RADA 4GXNA 2H2HA 2NO7A 4PLYA 2FMTA 5J2TB 2GJ8A 2RK4A 5F4BA 1L7VC 1ZH2A 5JSZB 4FILA 2X77A 5FOQA 4FQ8A 5IFLA 4FHEA 2FEKA 4LNAA 4YX9A 3ZGNA 3P9KA 1MOZA 5FWXA 5A4AA 3LC0A 4IQ0A 2NYRA 3FGNA 1OX4B 4PCUA 2QEQA 3HJAA 2BFAA 3TL6A 4PHFA 2GBCA 1CSEE 2YJZA 3KR9A 4BVHA 1Z5OA 4MWBA 4KDEA 4DA0A 5JPIA 5HR5A 2PLAA 4KTVE 2YY7A 4ZWNA 2UYCA 2WIAA 3EAQA 3PUYA 1ZPDA 2G8NA 4TWZA 2EJTA 1UQTA 3NX4A 5A9SA 4O2AA 3AUTA 1P9LA 1D5WA 2PXHA 4K9PA 3W8EA 3SHFA 5T7BA 1M66A 4JT4A 1PYDA 4I3HA 3TTSA 2EP8A 5IXYA 3CB2A 4TLDA 3K96A 4EY4A 2IQIA 1YA8A 3JD0A 4IV5A 1QH9A 2NTJA 3GU3A 3MLBA 4EUSA 1ZSVA 1RE0A 4M0LA 4P3NA 4YJ2F 2AN4A 1JTFA 3SFVA 4K9QA 4Y3UA 1CE8B 4UEWA 3FIJA 3LC2O 4M1MA 7YASA 2WSLA 1LJUA 3C14C 1JG2A 2IPNA 1X42A 4P0TA 3MK31 3QPWA 4LGMA 2P35A 2YYZA 3DB2A 1P72A 3EZ9A 3GDGA 3P0RA 4D6YA 2OCDA 2P9YA 3GJYA 4OTZA 5TQVA 3HJGA 3ZUGA 2B4TO 4BU0A 4JIMA 4QAJA 1Z7WA 2I99A 3NBFA 4KQCA 3ZTYA 4CG2A 1AO0A 1EVQA 2AA3A 3IDSA 4ZDJA 1FZTA 3DL4A 2P78A 2A1UA 3PFNA 1J20A 2FVXA 2HSJA 1WTCA 2HHLA 2L17A 2MSDB 2Y0EA 3DEAA 3EZYA 3FVTA 3KAJA 5CR9A 4Z9AA 3SC6A 4EWLA 2XEXA 3HDHA 4FOOA 3GRAA 4W8HA 5L45A 4JS0A 1FTGA 4YBRA 5GP1A 3OZCA 2IEAA 4JGGA 4N8EA 4FQ7A 2QX6A 3EYWA 3I2JA 1PHRA 1E0DA 4MVCA 2FRXA 2WWWA 3NRCA 2C83A 4KR2A 3FHTA 2AKYA 5AK5A 1W30A 1X7HA 1JWAB 1P7VA 1MPXA 1SU8A 2PMWB 3H5NA 1NW8A 3U81A 5K6AA 1W5BA 3KYCA 1Z37A 3BERA 4DGQA 2Y27A 4RZ3A 1LFDB 4KR3A 3L6EA 4AL4A 4JY7A 5A5FA 1OD6A 3K4PA 5H3HA 2LE0A 1AKUA 5L4SA 3RYHA 3EJ6A 4GRDA 1N6PA 2IA5A 4B87A 2G4LA 3NG1A 2XSZD 1V16B 3RGWS 4WZBE 4E4RA 4F84A 1B4DA 3Q7PA 3UO8B 4BFSA 1FFDA 3ETCA 4YJDA 4BO6A 1UBCA 2VDWB 3EXG1 4I8DA 5JZMA 3GWGA 4L5IA 2E0IA 5DTIA 3GLKA 5HG0A 2PBLA 3JQAD 3CH7A 4MK4A 1CDEA 4O1MA 4XLTA 2JBAB 3MQFA 4HK4A 1WEKA 3C7DB 3GEPA 4KG7A 1T5HX 4OAPA 4OFBA 3RS8A 1SCUA 1Y1TA 4B81A 4CM9D 3VR4A 2YDXA 4FJ2A 1AGRA 1AKQA 4K86A 4LTNA 2HMYB 2E4YA 4YHBA 4IDEA 4R3UC 3W6OA 4UPDA 3NTRA 5I5GA 1GL9B 4P5PA 4G97A 1ZBQA 3OC0A 3TZBA 1ZOIA 5CLJA 1IQ0A 1SUFA 2WTBA 4NK4A 4IR7A 1R0KA 4Q21A 2AXQA 4OUDA 4Y2XA 1COWA 2OY0A 5AVZA 2VQSA 1GUBA 1E5QA 4EF6A 2ZRHA 3SG0A 1W5TA 4FFWA 3MJCA 4HB3A 3FZQA 5IYZF 3UMMA 4IHJF 1XTJA 1ZIPA 4AY4A 1HG0A 2QMQA 2XKBA 3R6WA 2FDXA 4FDLA 4KQIA 2PSHA 2OGSA 1F8YA 2NG1A 2PJZA 2R4TA 3DCYA 3HJBA 1NN1A 4JI1B 4MKZA 4DA6A 1U6KA 3ET4A 4ZZIA 2BMVA 2REQA 1Q0QA 3ZVLA 1VMDA 3B3QA 1WMDA 1DKNA 2H2AA 1D1TA 3BHMA 4R5MA 1HXHA 2ZYDA 3PG5A 4TVSA 2FN9A 4L5AA 4R7GA 4ZT3A 4IVQA 5G1OA 1AK9A 2AMYA 2C2YA 3AI1A 3HYTA 3OHMA 2XT9A 3SN6A 1ZUHA 3KPVA 1L5WA 4FM9A 2O07A 3I30X 4LZJA 2LUOA 3THYA 2CBGA 3MPOA 4FD3A 4TUYB 5E4YA 4MWCA 4EELA 1RCTE 3F8TA 3OT5A 5DCUA 2W4MA 5SZIA 5EJMA 1K7XB 1R6BX 4LE0A 3A28A 4ZV4A 1HLFA 2V7WA 1SURA 3BIFA 3H9UA 3QYAA 2DPYA 5LQSA 4Q47A 4OLAA 5TQJA 4B5LA 3EQ8A 2B2XA 2FLVA 2B0CA 3FYUC 4E4YA 4MR9B 1HQYE 2EZ8A 2G9UA 3QIVA 4YJ2B 5BT8A 2DT5A 4EGFA 4IWNA 3GEGA 3CKMA 3HSSA 4JODA 2WZBA 2VP3A 3O3NB 2XCQA 4MW7A 1CFZA 1WCV1 2RKBA 4UEKA 4XI9A 5CD9A 3G2NA 4B35A 3HUUA 4V38A 4UC0A 3NTVA 2B8EA 2GBPA 4L74A 5KQMA 4XYGA 1P75A 3E3LA 5B3JC 2ANCA 1DC7A 1WZCA 1R4MB 1YQTA 2HMSA 4FFPA 3SDSA 1QB7A 3R8XA 4JJ8A 5HNKA 2DBYA 4LY6A 3HYLA 5HF8A 5K3EA 5ANRB 4L57A 2XWPA 3HFGA 4IQGA 1ZR2A 1QFJA 1SCQA 1TQ6A 1SCIA 4RWZA 3T0FA 4QPNA 1NV8A 2K2WA 4OQZA 4YRIA 2JJMA 4B4WA 4B84A 3HJCA 1EUDA 3E05A 2XZTA 4JYBA 3C87A 4KUEA 5P8WA 3TIFA 4ENRA 3G3EA 2B94A 2FX3A 1R6DA 1H0SA 4XE5A 3I6YA 3PNVA 1PJQA 5F5LA 1MO5A 3CF2A 5JAUA 2A0YA 1O9GA 1SBYA 4I1YA 4JBXA 1OILA 5CP8A 3AGPA 3LBNA 1AUVA 2DKNA 3OPYI 3HEMA 3WMFA 5KC8A 1QIJA 2B35A 3D43A 3DGFC 3TZLA 3WGKA 4Y6SA 4QFDA 1SIUA 2ACWA 1O95A 1WUIS 2M2IA 3L5KA 4YALA 3VU1A 4GR5A 1A95A 1SHKA 4RHEA 1SCDA 1T9AA 3A1WA 1L4LA 3H1EA 1Q0PA 3ZHSA 1AK1A 4ITVA 3QZUA 1HL3A 1GZHB 2F3QA 4KQMA 3L0ZA 2V9ZA 3ZD7A 5FBLB 5HDQA 4A26A 4IIJB 5J1TB 1U0NA 3J7TA 5E7JA 3EVAA 3IBTA 3E22A 1OPRA 1R1DA 3CURA 3IELA 3ODPA 3Q3GE 4KV7A 5A4IS 4KRGA 3W2HA 4EI9A 2ZTUA 1L1FA 1PR9A 1SVNA 1ULSA 2WP8J 4UPEA 1ADCA 2ETVA 3PTZA 1QX3A 2TMKA 2NPOA 2WHRA 1CZNA 2C03A 3S2UA 1AXGA 3GLFA 3PGMA 1U4SA 3THXA 3WYFA 4DDKA 1J90A 3L92A 2Y1EA 4HY3A 2WR8A 1UEIA 1IY9A 1E3JA 1ZUIA 2A3RA 2QB5A 1GSIA 3ESRA 3PDIB 4WVLA 3HVRA 2N47A 3F0TA 4HFMA 3RU9A 2IWRA 2BGGA 4M8SA 4NC9A 3VC1A 3SIRA 2A67A 3NWPA 1NDHA 2R8ZA 3NC1C 2ZBDA 3AGQA 3OT1B 3TEFA 5DGXA 2XTJA 3PB3A 3ZXUB 1ZM3A 2G5PA 4N18A 1FEZA 1VI5A 1Q0HA 2ZCUA 2AZTA 1LCIA 3ZZNA 2FPKA 1FJHA 2ZAIA 4W5JA 5FULA 1MZPA 4ECAA 5JQGA 2BN4A 3EXFA 2HU7A 3CH5A 4M1TA 1R88A 4MYTA 1Z07A 1ZH0A 3M1IA 1CUXA 4Y1FA 1UAYA 5CRIA 5JCJA 3WYAA 4BV2A 2EC5A 3BJRA 3H1FA 4MVXA 2X4LA 4OJKA 1Z6TA 4UM5A 4NCBA 3KZVA 1KQOA 4W5NA 2V7GA 2OQVA 3ICQB 4LFAB 3DQPA 3BSSA 3FAKA 5I7EA 4XVUA 5JVDF</