1B2LA

Alcohol dehydrogenase from drosophila lebanonensis: ternary complex with nad-cyclohexanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALCOHOL DEHYDROGENASE
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
total genus 98
structure length 254
sequence length 254
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b2lA00
3MZ0A 2VZ9A 4J7XA 1GPJA 3TSCA 4IJUA 3K2BA 1GV0A 3TDKA 2PLAA 1EQ2A 5I7FA 1ISMA 1ULSA 2YUTA 4OYRA 3U5TA 5COQA 4W82A 2GDZA 1ZNQO 3A1NA 4C7JA 3KLMX 4I5FA 5ICMA 1YO6A 3A14A 4IJVA 1IB6A 1N1GA 3C1TA 1U7HA 1E3IA 4GBJA 5A03A 2DC1A 2OOSA 3JYNA 3PJFA 1BDBA 2UVDA 3U4CA 1NVGA 1SB9A 5F21A 3WNVA 4M89A 4BKRA 3FBGA 4GAEA 4Q3NA 3HDQA 2GN9A 1JW9B 4CQMA 3T4XA 3TZQA 3MOGA 1AHHA 1B3BA 1CEQA 4KTTE 4Y6RA 1EMDA 2EEZA 2OBYA 2CSUA 4EUEA 4UVGA 2FWMX 1IY8A 4K1LA 5BSHA 5L40A 3R1IA 2J3IA 4CODB 2VNSA 2X58A 1DRVA 4Q3AA 4B7UA 5JFOA 3KEQA 1YJ8A 3E9QA 4DC0A 1NP3A 3AU9A 3QVOA 2X0JA 4XIJA 4DLLA 1VJ1A 2CD9A 1RM4A 4OL9A 2G1UA 1ZXLA 2NU7A 5L7TA 2YW9A 2VHYA 3EHEA 4RVFA 1ZMOA 3FSRA 3WMWA 4K28A 4YT5A 3KV3O 1K6XA 1XYGA 3UHAA 3G49A 1N2SA 4R9RA 4K9DA 3ZV4A 2F1KA 3DBRA 2VWPA 4OXNA 1YVEI 5HWSA 1DRWA 2NTJA 1F8GA 1QYVA 9LDTA 4BO9A 3KLPX 1Z7EA 5I8ZA 1Y8QA 3E9MA 4IUYA 2C5EA 1QXSA 3A4VA 5TRTA 4BGUA 1P0FA 5K6AA 2BH9A 2X0NA 1EE9A 4M1QA 3JD3A 5DBFA 4I9NA 3EZYA 4R1SA 1DEHA 4CM1A 1KEWA 4L8VA 4EDFA 3WIDA 1YDWA 2DU8A 4CR8A 3WGZA 2B36A 3RBXA 5A9SA 5LDHA 1P77A 1YOVA 4GX2A 2IZ1A 3BZUA 3EY4A 4PLZA 3TZCA 3NT5A 4U0KA 3ZHZA 4F6CA 5TNXA 3WFIA 5ADHA 1P1FA 3JTMA 3NDIA 4HWKA 4TVOA 1QORA 4E5NA 3MJSA 2JHFA 4HV4A 2HUNA 4BO6A 1C0PA 2WTBA 4AJEA 3F6YA 1T1RA 4DBZA 2HRZA 2WSBA 3ZWPA 3PIDA 4JK3A 3G1TA 4RF4A 3VPGA 2EF1A 4KOAA 4UREA 1VKNA 4Z0HO 1BW9B 2RBEA 4AG3A 3ZWXA 4ALNA 2WE8A 4YT4A 7ADHA 3INRA 4Y8VA 3OEYA 3AUUA 5CDTA 2P5YA 4H7PA 3A28A 3HNPA 1TB4A 4NBUA 1MA0A 4OKNA 4IXWA 4FFPA 2WDZA 3HN2A 1ISGA 3WX0A 1WNTA 3OECA 2AMFA 3C8MA 5A5EA 1NPYA 1HE4A 3OJ0A 2RHRA 1M66A 3WLFA 4E2YA 3ROQA 3FBTA 5DP1A 3JD0A 4ZRNA 4O63O 2D5CA 4R4JA 3VDRA 2H9IA 5GZ3A 1M76A 5B4TA 1PQPA 4WGGA 3E8XA 4HBGA 4GVXA 3H9GA 2BI8A 1DAOA 1R37A 2WWRA 3OFSA 4U7WA 3X2EA 4AJ1A 5GZ1A 5L4NA 5L9AA 1YL5A 5CG2A 2Z5LA 4W9NA 3ITKA 1LI4A 1GV1A 3DOOA 5I9MA 1UAGA 4YPOA 1E92A 4Z9XA 5I9LA 1K2WA 4PLCA 3U4DA 1SBYA 2FZWA 2YQ4A 1CF2O 1DC3A 4DPKA 5IDQA 1B8PA 2JL1A 5CP8A 2PWZA 1BSVA 3F1LA 3HDJA 5L95A 1YKFA 3PHHA 4MKRA 1L7EA 2PV7A 2UV8A 3RBZA 4TVBA 4NJMB 1HZJA 3RSHA 3GRKA 5DT9A 3K31A 3W4KA 3EUWA 4BNKA 3GHHA 3IAHA 3I4FA 3IP1A 1NVMB 4IIVA 5T57A 1FDUA 5THKA 3GFGA 1FF9A 2TMDA 1FDVA 2Y1OA 3GMSA 2Q46A 3E1KA 2ZTMA 3KYCA 2OORA 3LZ6A 4A27A 1KS9A 3ADOA 3GRPA 1ZMTA 5F5LA 5KOIA 1YB1A 4N5NA 4GWKA 5JMPA 3LT4A 4DL9A 1HDRA 4E32A 5EPOA 4O5OA 4TZKA 4Y6SA 2VRCA 1MP0A 2D4AA 4JGBA 3RC7A 3D64A 3KOUA 3D1LA 2Y0CA 2Q1TA 4B4UA 4F46A 4XD2A 2J5RA 4BQRA 4NR0A 4TKLA 2P9CA 2Q2VA 3F46A 3GEMA 2Y1CA 2VTDA 1EEHA 4BNJA 2O3TA 1MG0A 2P4QA 1UXIA 4N5LA 4QSMA 5JAZA 1R6DA 4NQZA 5CEFA 1GDHA 1T25A 4RV9A 5KJ6A 1HYEA 1VL0A 3TFQA 3C3XA 3GMDA 3NT2A 2ZYDA 8ADHA 3P7MA 3RUDA 1LA2A 4E21A 4YAJA 1SAYA 3PVZA 3PHJA 1T2CA 4RF2A 3UKOA 3H9QA 2OP1A 2D3TA 3ZWCA 2X9NA 3OETA 2H63A 3GVCA 3O38A 2I6TA 4FW8A 3DZBA 3K8ZA 2DT5A 2C59A 2D59A 4ZQFA 4L4SA 1Q7CA 2DQ4A 2DTXA 3ANLA 3B1KA 4B4WA 3VTFA 2Y0EA 3FCOA 5T6BA 3UFXA 1YQXA 4EEZA 1MXFA 2NNLD 2GZ2A 1OI7A 2RCYA 4FC7A 2VNAA 4D41A 4RLHA 4DMMA 2PZMA 3IJPA 1P45A 3QWAA 4KUHA 1A7KA 4QXMA 4DUPA 3KXDA 3JYQA 4ITUA 3PGXA 4FS3A 4CV1A 3EVNA 3PJDA 3ZNNA 1TVEA 4IY1A 3QRWA 2JD2A 4I9UA 4R9SA 5GY7A 1HLPA 3RVDA 5BNTA 2JCYA 1BXZA 4D44A 3ENKA 4FQ8A 1Q7GA 5CDGA 2POQX 4NPCA 3W4JA 4YAEA 2JCXA 1E3WB 3GVHA 3PZRA 5CFZA 1QMGA 2FMUA 2B4QA 5KJ1A 1LDEA 2EJWA 4NJOA 1OFGA 1DJQA 3AI2A 2DVMA 1PZGA 3EMKA 3GG2A 4ONEA 3WQRA 4XRRA 4I1IA 3F1KA 3GNQA 1UP6A 4A26A 3DHNA 3PQEA 1U3UA 3NAQA 2WJPA 3W8EA 2E49A 1JKFA 3PIIA 1I0ZA 3NTOA 3W4IA 3VZQA 4KUEA 9LDBA 3OF2A 3D5TA 4B7XA 1BW9A 1PZHA 5KWEA 5A3VA 1DRUA 2Q4EA 1PGPA 5IF3A 2Q2QA 1DIHA 1JA9A 1UDAA 2Y1GA 3OIGA 1VPDA 5A4DA 1Y5MA 4GKBA 4J1QA 4FPXA 2VHZA 2AG8A 1GCOA 1O95A 3C7DB 3H8VA 4FCCA 5CDSA 3C85A 4E5MA 1LBEA 4JIGA 2O23A 1E1MA 2BF7A 3ZWBA 1PR3A 4J6FA 1JKJA 3ZI0A 4J4TA 2V6MA 2NVUB 1LDGA 1XG5A 5JCJA 1D1SA 1NQOA 3D3WB 1E7QA 4RJTA 4YJFB 2X8LA 3L77A 3ZW8A 2DBRA 2QZZA 1JVSA 1EFLA 4I9HA 4CL8A 3DOJA 2VQ3A 4J3FA 3Q2KA 4XCVA 4ZA2A 1O8CA 4J1NA 1N92A 4PFJA 4QFCA 4WLEA 1O5IA 3WGGA 6LDHA 2BGKA 4CMAA 5B12A 4NJMA 3RC1A 3M2PA 5DDIP 1ENZA 1NPTO 4JBHA 5DNAA 2GNAA 1KC3A 4Y6PA 1P1JA 3H2SA 4PRKA 4EUHA 1KYQA 1YJQA 4A03A 1KC1A 3RUFA 2CMDA 3PHGA 4PCVA 4CLXA 3S2GA 1E3JA 4IS3A 3ASUA 3PWSA 2YV1A 5L7YA 3C24A 3ASVA 3HWRA 1ZH8A 3U0BA 1LLQA 1S7CA 2NTVA 4J7UA 1K0UA 3ZU5A 4XA8A 5G0UA 1RM5A 3SC6A 3CINA 3GNTA 2P5UA 2WD8A 2G82A 4BO4A 4UUMA 4A7PA 1GUYA 3UH1A 1DLJA 3W6UA 1R66A 4XQ9A 3GUYA 4IGFA 4WJZA 3DC2A 2EW8A 1D4FA 1WDKA 4RPKA 4CJXA 5HM8A 3HG7A 2NUAA 3T7EA 4CMKA 1J0XO 2WMDA 1QV7A 1W6UA 4IM7A 3W8FA 3WSVA 2CZCA 1PWZA 4QO8A 1RYEA 1PJ2A 1ZSYA 1ZEJA 4KTVE 1EUZA 1W8DA 4ND1A 2OP0A 1Y6JA 1UH5A 3RUAA 2PZKA 1LQUA 5ITWA 3OQ6A 4RORA 1NFRA 2HQ1A 4YRDA 3U62A 2UYYA 2WYVA 1JAXA 4Z0TA 3W1VA 4E31A 4TMFA 4TKMA 1KVTA 4AJHA 4IIUA 4EI2A 1F17A 1U3WA 3WYCA 3ORFA 5H81A 4DWVA 1R4MA 4NNJA 2D1YA 4GKVA 2X6TA 4I5EA 1I8TA 3TF5A 3WGTA 4BB5A 2Q1UA 5KJCA 3DEYX 1I36A 3DMTC 4OHUA 4OXKA 3PFFA 2QQ5A 2J6IA 1ULUA 5J23A 2YHIB 3UGKA 3FNEA 3BA1A 3AFMA 1UZLA 2JJYA 4OSOA 1DFHA 1PIWA 4U6QA 5EQDA 4BNYA 2I3GA 3PGJA 4ZD6A 3L0DA 3ETGA 3JQFA 1HDYA 3SEFA 5IN5A 2J3KA 4ID9A 2EV9A 4AJIA 2D0IA 2B4TO 1EVJA 4L73A 3O8QB 1KETA 2RH8A 1U5CA 1EK5A 1Z75A 2PKQO 5JCJD 4CPDA 4MIYA 4RPHA 2HMTA 4ILKA 3GDOA 1P1IA 3DONA 2DUWA 3RI3A 3HJAA 3E48A 1NWHA 3LF1A 1QSGA 3A06A 1LUAA 2C29D 3Q1LA 3SC4A 1P74A 5G2OA 1A4IA 2HMSA 2VZ0A 3H5NA 3AOEC 4IZIA 1Y8QB 1E3WA 3FRJA 1JN0A 4DPMA 2OFPA 1B26A 3GR6A 1ADFA 2I67A 2PR2A 3DAFA 4IJKA 2NM0A 2NU6A 5A05A 4D3FA 4GQAA 2XOXA 1FJHA 3Q9UA 4PLGA 5TIIA 3OM9A 2ZB4A 4WUVA 3AK4A 1PL7A 1M75A 3HE3A 4XYLA 4Q9NA 4ALIA 1ONNA 4FIZA 1D3AA 2PD6A 2Y1FA 5CDYA 1V3TA 4Z3KA 5JAIA 1PJCA 1EBFA 5TF4A 3NTQA 1DDOA 5KNLA 2AA3A 3ZU2A 1KBZA 4E3ZA 5BSEA 4E6PA 4ND5A 4L74A 5KKCA 3G0OA 1LXCA 2W8ZA 1GTMA 5HS6A 2QW8A 1JDJA 2CDAA 2NACA 4RO0A 3PHIA 2O3JA 2PK3A 1ADBA 2TMGA 3RROA 4FBGA 4KWHA 3GZ4A 4WCFC 3BTOA 2W90A 3WMXA 1WW8A 1RM0A 3H7AA 5IDWA 1R0LA 3IQDB 4PLPA 2DFVA 4E13A 5FI5A 5I7VA 5L3ZA 3WXBA 3OQBA 1UZMA 4EJ6A 1WXDA 1MB4A 5MGBA 3OIDA 5CEEA 5A04A 4CMJA 3UAGA 4KQXA 2E48A 2GF2A 2Z1MA 3RFXA 1V6AA 1EBUA 4FOSA 3ZWAA 5HA5A 2NVUA 4RVDA 1WMBA 1SCUA 2RAFA 3M1LA 3D3WA 1LLCA 2VOEA 4II3A 2CNBA 4DXHA 4YJFA 2ZYAA 3JD2A 1SB8A 2O3QA 2O4CA 1SEPA 2VT2A 2VOJA 4D7AA 3FR7A 4DYDA 1L1FA 2GERA 5KTKA 4IMRA 4WLNA 1V9LA 2FHSA 4BO8A 1FDWA 2JHGA 2B35A 3NX4A 3PZBA 2DUUA 4DQXA 2VUUA 3ROKA 3WFJA 1YGYA 2Y93A 4XDZA 2VRBA 1YRLA 4O6VA 1EZ4A 3RCBA 3GDGA 4QFDA 4KDFA 4YT2A 1OOEA 4BIIA 2EKPA 3UVEA 1SC6A 5B37A 1SZJG 4CUZA 4DREA 3HB4X 4BNHA 1YQGA 3B70A 3D3EA 4XGIA 4J9VA 5ENVA 1XU7A 3UN1A 1U9JA 5KIAA 3QQPA 1YL6A 5C7OO 2ZATA 1G1AA 1YS4A 1UUFA 3H3FA 1PJLA 1NFFA 4BKOA 3RUEA 1MG5A 4JCOA 3KM0A 3V1YA 2I76A 2O7SA 3F47A 2ZB7A 1XKQA 1K5HA 1A71A 2Z95A 2OUIA 1ZEMA 3DBVO 4WLFA 1J4AA 2AXQA 3I9KA 1A5ZA 5IFLA 2LDXA 2VUSA 2GZ1A 1LNQA 4WKGA 3EZLA 1NX6A 3KYCB 2P2SA 3JQDA 1R4NA 1GPDG 4HP8A 5DCYA 3O03A 4WCFA 3L4SO 3PXXA 3AOGA 3INGA 4OM8A 4TZTA 4W7HA 1LDYA 1WZIA 1H2HA 1ZBQA 3UOGA 3ZZNA 1LSSA 2HMUA 2EKQA 3HFGA 4LGVA 4YTEA 1GYQA 5T67A 1VJ0A 5JDCA 3DHEA 2ZK7A 4C7KA 3GGPA 2NLOA 3GQVA 1E7WA 1I33A 1UAYA 3R3JA 2Q4BA 2GCGA 4PLVA 3WYBA 5U4QA 4YJDA 2O2YA 4ZICA 4DQVA 4FJ2A 2CVQA 4GX1A 4R3WA 1ENYA 4QQRA 5L4SA 5C5IA 2ZB3A 3KVOA 4KWIA 4PZCA 4BNGA 1HDCA 3AUTA 4DPLA 1D8AA 5FI3A 2YHIA 4X54A 4HY3A 3IKTA 1IHYA 2EJVA 4MVJA 3H9UA 1E5LA 5EN4A 2PKRA 5IJZA 5TJ9A 2OMEA 4GSLA 5L4LA 2JD0A 3LK7A 4I5GA 4E2WA 1JQBA 1LJ8A 4MJLA 1T2FA 3O8QA 4WLOA 3GK3A 3PEFA 1FDTA 2H5LA 2PH3A 1ZCJA 3IOYA 3I5MA 4JN6B 4YJHB 1E6EA 1Y81A 3IKVA 3JYLA 4G65A 3F5QA 3NTRA 1T1SA 3HN7A 4O1MA 3I9LA 2B83A 2ILTA 1A27A 3K73O 2IXBA 1U3TA 3CMMA 1LSOA 3ETEA 1VRWA 4JBGA 3ON5A 2CY0A 1HDZA 5AXAA 2BI7A 1ONOA 3ULKA 1C3VA 1Z73A 1N7GA 2OO5A 4RL6A 4YRBA 1I2ZA 4JP3A 1GAEO 2IEDA 1ZUD1 4E5KA 1ZW1A 4ESOA 2E37A 4XGNA 3ZGYA 4ZGWA 2X5OA 4YAKA 1NWCA 4W99A 3TNLA 1E7RA 3B20A 4PVDA 2C20A 4NBVA 5TX7A 1V3UA 1NFQA 4HNGA 1PJ3A 4FGSA 4GX0A 4E33A 1YWGO 2AQ8A 3ZDFA 4WCDA 8LDHA 4LK3A 1PGNA 3BTUA 3PFWO 3V1UA 1I2BA 1ORRA 1KY5A 3L6EA 4WOJA 1DOHA 4K6FA 3UCFA 3UUWA 4CMEC 3QVSA 4YB8A 1HLDA 4AJ4A 1Q2XA 2C7GA 5COAA 1E5QA 4FOOA 1T2EA 2RHCA 1NAIA 2X0RA 1LLDA 1H93A 3LF2A 1N1EA 4MVJH 1XELA 3ZWNA 1B15A 4O59O 4K6CA 1R0KA 1MFPA 1R16A 1LC0A 1AXEA 3BTSA 3LLVA 3Q6IA 4PLYA 4BL5A 3U3XA 4DVJA 1G0NA 1I3LA 3PYMA 3CH6A 2VYND 1XHLA 4R1NA 2FP4A 4UUNA 4RZHA 3NDRA 1PU2A 1Q0HA 3MJTA 1P0CA 3JQ7B 2GASA 1VL8A 3DR3A 5ER9A 1Z6ZA 2GPTA 3GUCA 1FMCA 4CMIB 1LRLA 4MVJD 4OQYA 2CFCA 4HFRA 4M87A 4NI5A 3CEAA 4XKJA 3DWFA 3PI7A 5G0TA 1HDOA 2FRDA 5B1YA 4KQWA 2EWMA 1YB5A 2VT3A 3IIEA 4MKXA 4D42A 1DBVO 4NBRA 3QSGA 4P38A 3JCZA 1GCUA 4LRSB 3K2EA 4S3MA 1YXMA 3JQ8A 3UF0A 1NHGA 3BTVA 3H5RA 2VHVA 3B6ZA 1CWUA 3AM3A 4FN4A 4DTIA 4TWRA 1C0KA 4RF3A 1KVSA 1YBAA 2ZCVA 4NMHA 3PJGA 3GEDA 4B8WA 5A06A 5KKAA 3QV1A 4UEKA 4XZ3A 1HE3A 1H9AA 3NGXA 2RH4A 3AU8A 3K30A 4QEDA 3ZCXA 4Z0PA 4EGFA 1NASA 1WP4A 3HSKA 1X13A 1PS0A 1ISFA 4UVIA 3ZNOA 3PQFA 4CMEA 4MVJI 1O94A 4Q3DA 4BNUA 3ANMA 2FSVA 1TEHA 3ST7A 4HFJA 1ENOA 1P31A 1U8XX 3VC7A 4EEXA 2BKAA 3FPCA 4RCVA 4BNVA 1AE1A 2ZCUA 3WYEA 1CQIA 4MPDA 3V2UA 1HDXA 4YVFA 3TZKA 4E30A 1DFIA 5I7EA 2Z1NA 3F3SA 2C82A 4RVGA 4WLVA 1PJBA 1V0JA 3MCVA 5AOVA 2NQ8A 4AJPA 2GYYA 4YYZA 4FFOA 4OQZA 4ALLA 5JC8A 2EERA 3JQAD 3PPIA 4MIEA 4DLAA 2QRJA 5JW6A 3I3OA 2HK7A 3E6AA 3BMQB 2BRUA 2PFGA 4B7CA 4BVAA 4J16A 2QRLA 3SLGA 2PZJA 5GMOA 1PJTA 1PX0A 1R4MB 2YFHA 4M49A 1NAHA 3RUIA 2IZ0A 3U4HA 2VTEA 2X86A 4UVHA 3H2ZA 3PDJA 2AQKA 1ZFNA 3GDFA 5JO0A 2HAEA 3KRTA 4I5DA 3FHLA 5JPIA 3WBBA 3ROMA 3SVTA 3JQCA 5THQA 4EZBA 2AHRA 2P68A 1C0LA 3PLNA 4YJHA 1RM3A 1SMKA 1EK6A 4P22A 3CIFA 3LSYA 3QVWA 4IMPA 5CG1A 2PD3A 4XB1A 1H6BA 2CVZA 3ITDA 5JLAA 1I5RA 4EJ0A 1MFZA 2C07A 4IGEA 3FWZA 4ZHSA 3KETA 3WNQA 3DQPA 3HDHA 1K3TA 3TZ6A 4FB5A 2BMAA 3M2TA 1UXHA 2Y05A 2FR0A 2PGJA 4LN1A 4UVDA 3ZWVA 1QG6A 3L4BC 3ZNQA 5AVOA 3E18A 4IJWA 4E5PA 3PP8A 3ZU3A 2IZZA 3RBVA 4KMSA 4MOWA 4IS2A 4FC6A 3DB2A 3H5AA 3S2EA 4D43A 5KVVA 1ADCA 4UULA 1HSOA 1A4UA 3VZRA 3PWKA 4FJ1A 3T7CA 2HU2A 1GYRA 4GSKA 4XDYA 1R0SA 3Q2IA 4HX5A 2G0TA 3KSUA 4NZ9A 2X22A 4GL4A 5H82A 4M55A 1GQ2A 4IQ8A 1O89A 5ICSA 4B3HA 2GUGA 4AJLA 1B16A 2R6JA 4BMVA 5B4UA 1F06A 5CPFA 4L0QA 2O4UX 3VTZA 1KY4A 3IP3A 1U4SA 3WJAA 3K92A 3ROPA 1QV6A 3FF4A 1WMAA 3STHA 4PN3A 5L53A 2O3UA 4BGVA 5IZ4A 1AUPA 1LC3A 2QIOA 1DC4A 4INAA 1YQDA 2B5VA 1YE3A 3GC6A 4BGEA 2ZB8A 3VKUA 3PWZA 2UUOA 1CIVA 2FZEA 4XQGA 1KVUA 5A9TA 1YL7A 4QT0A 4MVJP 3DZHA 1J6UA 4NH4A 5JO9A 2JCVA 1VSUA 1BTOA 2X5KO 3OJEA 3H6KA 4MO2A 4PG6A 2NADA 2DBQA 3JQ7A 2HKIA 2BLLA 2OGUA 1TI7A 4NIMA 3GGGA 3FI9A 4CMIA 4IDCA 1BMDA 4AL4A 2UAGA 1T4DA 3GH3A 2GLXA 4MDHA 1VM6A 4Y9DA 2RIRA 1GEEA 3P5SA 4A0SA 3WOHA 4OOFA 3NEPX 1Y7TA 3L6DA 4BO3A 4PVCA 3KZVA 4W6ZA 3U49A 3WGYA 4J9UE 2X9VA 4B3IA 1Y9AA 3VH1A 1XDWA 2HDHA 2JAHA 4IZHA 4WE3A 4YAGA 1B8UA 5L7WA 1I24A 5AXBA 4BO7A 4ZVVA 4PLFA 4RPGA 2HJRA 4CM8B 2ZQZA 2ZQYA 3OHSX 2Y99A 3JQ9C 1SNYA 5HS4A 1V35A 4WEOA 1QYDA 4UEJA 4QX6A 4WASA 2C2XA 1GQYA 4LMRA 1JAYA 2B37A 4Z9FA 1Q1NA 2GN6A 2W98A 3R0IA 5FYDA 3LT1A 2FN7A 4BHTA 5ILGA 2I66A 4U6SA 1ZVMA 4PG4A 3UXYA 4HADA 3C1OA 4M86A 2PGLA 3SXPA 3W8DA 4DYVA 3PYXA 4U0JA 1SOVA 3OA2A 4B3JA 3MOIA 1GL3A 4Z6KA 1MXHA 2SCUA 3KSZO 4N18A 4ZRMA 1R12A 4NBWA 3HADA 4CM9D 4UVEA 2D5AA 3KBOA 5BNIA 1D7OA 1SEVA 4ALJA 4BKPA 1R4NB 3E82A 4WCFB 3ICPA 1RYDA 3OJOA 4P4GA 3M6IA 3M1AA 4R5HA 4BO2A 2AE2A 2F00A 3DBLB 3W6ZA 3Q3CA 5IZCC 1YDEA 3I9OA 2WM3A 3ONFA 3ANNA 1JVBA 3N7UA 1J5PA 3DAPA 3OJFA 1A9YA 1U7TA 1DJNA 3BMQA 5T8KC 5CPBA 4HNHA 3RAJA 6ADHA 3HDYA 4Z9YA 4D79A 1HDGO 1T26A 1UXJA 3AW9A 3KYDB 3GEGA 5CDUA 2FY8A 4NBTA 5C7IO 3RFTA 3KHUA 3JQGB 3F4BA 1PZFA 4JJGA 3WBFA 3JQBC 4L4RA 3O26A 3QLJA 4FGWA 4GX5A 4XR9A 1EDZA 5COBA 2GD1O 4FD3A 4R16A 3IMFA 4CV0A 2G76A 1DIGA 1WPQA 1SPXA 5EL0A 3ENNA 1U1IA 2B69A 3NJ8A 4BGIA 3H3JA 3EGOA 5C3MA 4R1UA 2QG4A 4WNIA 2FR1A 4ND2A 5LCXA 3GLQA 3L6OO 5I9NA 2BD0A 4G81A 2YV3A 1E1NA 1T2AA 4TSKA 4EW6A 3DO5A 3LLSA 1RPNA 5JCXA 1JWBB 1TXGA 3CUKA 3K6JA 3Q11A 1W4ZA 3SJ7A 2HRBA 4CL3A 3TWOA 4E2XA 4N5MA 1O6ZA 2PH5A 1QR6A 4MP3A 1EE2A 1BRMA 1TLTA 3TFOA 2HK8A 3TL2A 1KOLA 2NVBA 2G5CA 3WICA 2HLPA 4E12A 3QA9A 5TT0A 1H9BA 4R51A 4WLUA 4Q39A 2VWHA 1PL8A 1X14A 4JQCA 2AG5A 1P9LA 2BFMA 4A73A 4HFMA 2NVWA 3E5RA 1GD1O 5FWNA 5MDHA 5G4KA 1PZEA 3WIEA 4RPLA 1XA0A 3JD1A 4CM3A 5KJFA 1I2CA 2X1HA 2ET6A 2JKVA 3AWDA 4ALMA 4DMLA 3PQDA 2WYUA 5DBGA 1J49A 5L45A 3KEOA 4RDIA 2IEBA 4FJ0A 5IZCA 3H4VA 1XGKA 1PJSA 5I7SA 1ENPA 3GG9A 1DIRA 1NQAO 1ISHA 2GO1A 3K5PA 1M6HA 4DLBA 4XIYA 4XRGA 4CUKA 1E77A 4N7RA 4YXFA 5JS6A 3JQAB 4OGWA 5JAQA 2I99A 3DZGA 2VHWA 4LSWA 4OIMA 1X0VA 5TSDA 3ZNPA 3RKUA 3CZRA 4OJNA 3GAZA 3DMTA 5HBRA 3GNSA 1Y1PA 2IODA 1Z82A 5DULA 2V65A 1F8FA 3S55A 4BB6A 3I83A 3VH2A 1PSDA 2AQHA 4DC1A 5K9ZA 4OO3A 3WQSB 4CLDA 3P19A 4BO5A 4NU6A 4L76A 1X0XA 2EGHA 5BR7A 1C14A 3UICA 4GLLA 4JP2A 4IDBA 3GY0A 3KYBA 5C37A 2GR9A 4J2HA 3FNFA 1Y8RB 3U09A 1GZ4A 3AY6A 1UJMA 4L4XA 1PQWA 2P9EA 3JQ6A 2YDXA 5JSFA 1HTBA 5DBIA 4RDHA 4ALKA 2P9GA 1LRJA 2NQTA 1CETA 2CUKA 4NFYA 5DP2A 1NQ5A 5IXYA 1HKUA 3H9JA 3P2YA 3VPXA 4BO1A 3KB6A 2JFGA 1BHSA 1Z45A 4IQ0A 5TS3A 1K6IA 3MJVA 3WTBA 3ZN2A 5BQFA 3QWBA 1B3RA 4CV3A 1N5DA 3FPLA 4NHEA 2YQ5A 3AOEA 3TL3A 1E0DA 4CM8A 3ZW9A 5KVSA 1VJTA 5F1OA 5KVCA 1YH3A 2DBZA 5CEJA 2IRWA 1I10A 4ZU3A 2O7QA 1P1KA 2Q49A 1ZSNA 1H2BA 1GUFA 3JQ8B 3PLRA 2NU8A 1P1HA 3VHRA 1A9ZA 2PZLA 2J3HA 2B5WA 1JLLA 3N58A 2X23A 4CM5A 2Y0DA 3KO8A 2XXBA 5TT1A 1NBOA 4IBOA 4WECA 1EVYA 4M8SA 2AEFA 3AI3A 1VI2A 5JNLA 2ZYGA 2GN8A 1CYDA 3ZWOA 1IZ0A 1CJCA 3MJEA 4XJSA 4BNTA 2IXAA 4NK5A 1L7DA 2EIHA 3RUCA 5EJ2A 1LSUA 3MWDB 4M54A 1HF3A 3WWYA 4E0BA 3ONEA 2B0JA 3GGOA 1BG6A 1JTVA 1X15A 4CQLB 2YY7A 1PTJA 3DBLA 3VVBA 3VH3A 2W2LD 3OICA 2Q3EA 2VCYA 4XYGA 5K6AC 4WOKA 4H15A 3ETDA 2OHXA 2XPCA 2QX7A 2VYNA 1HYHA 3KYDA 3L07A 4YCAA 4BNIA 1B2LA 3D4OA 4YQZA 1HETA 4QTZA 1F0YA 1TA4A 2Q1SA 1EDOA 3D7LA 3JQGA 4TRRA 2AQIA 3D0OA 5G0SA 5DCUA 3OIFA 1NR1A 5A02A 1LU9A 1UP4A 1QLJA 1EUCA 3IC5A 1NPDA 3EDMA 2VZ8A 5HRUA 5ILOA 1S6YA 1N7HA 1ID1A 1HL3A 3DDNA 2Y1EA 3VZSA 2J8ZA 1YB4A 4DIOA 3SLKA 3BMCA 1B0AA 4NFSA 4RQUA 1ZO8A 2O3SA 4R3NA 3TJRA 3LVFO 3LT2A 4P8RA 2XXJA 4G2NA 1MX3A 1ZK4A 1IPEA 2V6BA 1A72A 2I65A 1AXGA 1N9GA 3OH8A 1C1DA 2B4RO 4J0EA 1H6AA 2BFAA 1T24A 4IDDA 4OOEA 4CMBA 4CUJA 3OSUA 3V2HA 3WJ7A 1QRRA 3BMNB 2UUPA 3SBOA 1NM5A 5TLSA 1JU9A 1GQQA 3A9WA 1E3LA 4IQGA 1I3KA 1K89A 3U4IA 1XLTA 4H16A 3RUHA 3ZH2A 1FK8A 1NVTA 3TPCA 3BHMA 1I01A 3SX2A 1HE5A 2QYSA 4Y67A 1PJQA 2DTEA 2QHXA 4WNCA 3WR5A 4MVJG 1IOLA 1V3VA 2HCTA 2VYVA 1I3MA 3NT4A 4MKZA 1Y9EA 3X2FA 4PZEA 4W9NC 2I9PA 4GVLA 1ML3A 3I9JA 1WZEA 2OL4A 2V6GA 4IDGA 2JFFA 3DZJA 4HFNA 1M67A 5U9CA 3RWBA 1UR5A 2C0CA 1VSVA 4C4OA 4GMFA 4RVUA 4RGBA 3WG9A 1HWYA 4FDAA 4Q3EA 1DB3A 4DQUA 3ZV3A 1T2DA 2WD7B 3GPDG 1IULA 4DGSA 3JQAA 2FR8A 1UXKA 4QUKA 1X7HA 2C5AA 1AGNA 1DFGA 2X7HA 3TQHA 4BKQA 3V5NA 1U5AA 3DFUA 5CHEA 1DPGA 4URFA 2QRKA 4OMUA 5K0ZA 3DBHA 3I1JA 2BGMA 2PNFA 4JBIA 2EG9A 3FNHA 1QKIA 4PG7A 4MP6A 3F9IA 3HB5X 3ZHYA 3I52A 2OZPA 5IDXA 1RJWA 3KTDA 3QWIA 4S1VA 2JFHA 3CE6A 5EINA 3MJ4A 4JJIA 1ZK2A 4FFNA 4D45A 1PGJA 3MEQA 1PJ4A 3QW2A 3LU1A 2H6EA 1Y8RA 1DO8A 1OBFO 4ND3A 5F1KA 4D3DA 4OAQA 5AYVA 5EMHA 1P44A 3I9NA 5FFFA 1X1EA 2VWGA 1H0KA 2HK9A 2D2IA 3F4LA 3B1JA 2DBVO 1E6UA 1RWBA 4PLTA 5IN4A 3ONDA 4CM4B 4J90A 1MGOA 2G17A 1E1LA 1LQTA 1ZKMA 1EQUA 3AY7A 3D4PA 1PWXA 3QY9A 3R6DA 4J43A 4CM6A 5CAEA 1DIAA 3VAZA 4YAIA 4OSPA 1KVRA 1E7YA 4QO7A 4IXTA 2YYYA 4U8GA 3INTA 4CQMD 1LRKA 1PGOA 5T64A 4UAGA 5JDIC 3VZPA 2FPGA 2FPIA 3S1LA 3NUGA 3JYOA 3BHJA 3GAFA 2QZ9A 3FN4A 4FSHA 5JYEA 4D46A 1MC5A 3LC2O 1C1XA 2E4AA 3GVIA 2V7PA 4XYMA 3HUDA 2Q45A 1I30A 4CLRA 2YDYA 4XWYA 2C54A 3GA0A 3ABIA 5JY1A 4J1SA 5TJHA 1HSZA 1KIFA 4BV9A 2FOIA 1NR7A 2CDCA 2EXXA 4YEDA 3GF4A 1W0CA 1AN9A 3NGLA 4TQGA 1NYTA 4PG8A 1RKXA 2AEJA 1U2GA 4OKIA 1BXGA 3S2IA 3VPFA 1LEHA 2A9FA 3CXRA 3V8BA 4LCJA 1DLIA 2C2YA 1PS8A 4YBZA 4RVHA 4CQLA 4ZJUA 1GYPA 2VYVD 2IE0A 3CKYA 1ONPA 3OP4A 1E7SA 5TC4A 3SJUA 5JXWA 3RU7A 1H94A 3QJ5A 4E2ZA 3B1FA 1Z74A 3PRJA 5GZ6A 4XQCA 4MVJM 5AXCA 3NV9A 3BXXA 2DLDA 1UZNA 2R00C 1M6WA 2HMVA 4J4HA 3VDQA 4A5OA 3O9ZA 4AJNA 3AUAA 3TN7A 2LDBA 1YONA 3WWZA 3DZFA 3BMOB 1DHRA 4YJGB 4AJOA 2E82A 4NU5A 2GN4A 3IL2A 2IYPA 4R5MA 2EW2A 3AY3A 3E9NA 4XJTA 4OH1A 3JYPA 4HXYA 3G17A 1KERA 3QVTA 1NHWA 1FXSA 3LC1O 1H6DA 2DTDA 2P4HX 3C7CB 3VPHA 2C7VA 4QECA 4CR7A 1KVQA 4J91A 2DKNA 2X9GA 4JNKA 4XQEA 2I3AA 4XGKA 4XR4A 5LC1A 3RJ9A 3HHPA 3RKRA 4J1TA 4DIFA 1AHIA 3GFBA 3IJRA 4EUFA 4MIOA 1MLDA 4MVJE 4G5HA 5JDIA 4EYEA 2NTNA 1F14A 2PA3A 1LSJA 1I32A 3P2OA 3DMYA 4LMPA 5ITVA 4BOYA 4A10A 1I3NA 3E5MA 1DC6A 2BFPA 3BMNA 3C1AA 4II2A 4BQPA 1IL0A 2W4QA 5BT9A 4BNFA 2AEMA 4LW8A 1MC4A 3S2FA 3AJRA 1TT7A 2Y1DA 3WS7A 2ZJ0A 4IDFA 1ARZA 2NU9A 4IDEA 5C7LO 4OXYA 5IXSA 1HEUA 4FFRA 4GLOA 1TT5B 5KVQA 3RIHA 1IE3A 4AJJA 3LC7O 1B7GO 2DM6A 2OBNA 3OJLA 4JLWA 3G79A 4ZQEA 4TRJA 3WDSA 4CM9A 5JBIA 1FDSA 1MUUA 1XR3A 5AXDA 3BHIA 2WEKA 3NRCA 4WEQA 3ZWMA 4CLHA 2GRAA 4CV2A 1HE2A 4J2OA 3RU9A 2FSSA 4JJFA 2GSDA 3ICCA 2ZTUA 4CLEA 3AUSA 1LLUA 4L75A 5T5QA 2W2KB 3GN2A 1Q0LA 4BMSA 3V2GA 5G4KB 1R15A 3IS3A 2WD7A 2O2SA 3G3EA 4PRLA 5TQVA 4J49A 1MV8A 1DHTA 4MINA 4ZQBA 3OQ1A 4J4BA 1GFSA 1ZK3A 1EUDA 2R00A 1WVGA 2VN8A 3LQFA 4LSMA 3NDJA 3MJCA 4K26A 3FNGA 4L9RA 4F45A 3OMLA 4BNNA 3OA0A 4F3YA 4Z3DA 3VVCA 4AVYA 2YFQA 1LDNA 2O3RA 3RQSA 4YDRA 4RVSA 4GMGA 1BVUA 3QIVA 4YQYA 2X0IA 3WGHA 3AI1A 1LDBA 2BHLA 1T4BA 2Q50A 2PGDA 4LCEA 3Q0EA 3BIOA 1H5QA 2NV6A 4W4TA 2DAPA 2QYTA 4P4LA 4WPGA 5EERA 4BO0A 2JAPA 2BELA 4PZDA 2A92A 1IZ9A 4BNLA 2ZIZA 1DC5A 3FTPA 5U1PA 5FEUA 3KSDO 4CMHA 2EP5A 3PJEA 4YA6A 4CM4A 4RQTA 3KUXA 5TGDA 1GUZA 1VLLA 2VRCD 4PLWA 4YACA 4TRMA 4BNZA 3ZWYA 3LDHA 3ZU4A 2VWQA 1X7DA 2ZTLA 3EAGA 1JWAB 3DTTA 5DZSA 2A94A 2HMWA 3I4CA 4CMGA 3I6QA 1IYZA 4GGOA 4R41A 3RJ5A 3L4BA 3DL2A 1JKIA 1OZAA 1ZJZA 4Q3BA 1IUKA 4KP7A 1LX6A 4Y98A 1VE9A 3GZNB 4IDAA 1ZK0A 1E1KA 1OMOA 4GWGA 2H1SA 1N8KA 1GU7A 2Q1WA 3GT0A 4O0LA 4R54A 5F3RA 1QYWA 2I5PO 4HKTA 4ROSA 3L9XA 1UDBA 2XF8A 3PK0A 4CLOB 2EGGA 3UCEA 3FTNA 3TRIA 3EW7A 4H3VA 1GZ3A 1QLHA 2HSDA 5JMWA 1U2DA 4MVJF 5BSFA 1EVZA 5B4VA 3WGOA 3JQFC 4AJ2A 3AM5A 3MTJA 1NQTA 3ZV5A 2IYOA 1PEDA 3EC7A 4GI2A 1Q7BA 1PR9A 3ADPA 3EYWA 1BDMA 4IPTA 1SO8A 4P4NA 1IPFA 4NG5A 1ADGA 5A3JA 3WLEA 5ES3A 3LYLA 1OC4A 4EBFA 2CF5A 2NWQA 4XB2A 2NSDA 3GOHA 4JROA 3DZKA 4XEHA 4DBVO 4LISA 3UW3A 4BNXA 1K6JA 1VL6A 3QWFA 1O0SA 1X7GA 3D5QA 2VUTA 1C0IA 3IUPA 3CMCO 2CF6A 3PDUA 3DOCA 4RPJA 4D3SA 1DSSG 3BMOA 4YJGA 4MP8A 3L9WA 5A1TA 5JC1A 3GPIA 4CR6A 3IDSA 4PIVA 5JY6A 1GEGA 2ZKLA 3JV7A 4Q3CA 1M2WA 3GHYA 5EESA 1V8BA 2PTGA 3EVTA 4NDNE 5EIOA 5JAMA 4IINA 4UEOA 1WDMA 2XAAA 5IDYA 3RC9A 5IG2A 4FR5A 3VOSA 3WGIA 1U28A 3R3SA 4ZQGA 3S8MA 4XYEA 2D8AA 1KEVA 2ZTVA 3WGQA 2P91A 3WSWA 1HT0A 1QYCA 3WB9A 3I6IA 3TZHA 2PD4A 3LT0A 3VPSA 2AE1A 4AICA 2Q99A 5ENDA 1A7AA 5DF1A 4PG5A 2J3JA 1CRWG 3K96A 3Q9NA 3I23A 1WLYA 4I08A 3JSAA 3C7AA 3H65A 1XQ6A 4I8XA 5H83A 4CQMB 5HTOA 3H9EO 4ZN6A 4A2CA 2WE7A 1E7MA 3BMCB 4AFNA 4AJKA 5JYDA 5I8WA 4TROA 3NJ4A 3ZWWA 3G1UA 3BYZA 4GGPA 4EITA 4YRAA 1HXHA 2Y67A 4CM7A 1UDCA 1ISIA 2FPPA 2BGLA 1NNUA 1N9GB 2Q2WA 3JQ9A 2CVOA 4FFMA 1XIVA 4PLHA 1C1DB 3CSDA 1PS9A 1VKOA 3BAZA 4RF5A 1G6KA 3COSA 4GPD1 4NK4A 3FWNA 2YV2A 4E4YA 1X1TA 1QYXA 1Z7BA 3ZHXA 1TT5A 4YWJA 2DFDA 1XEAA 5ER6A 4LVUA 1BVRA 4W7IA 3CTMA 1ISJA 4D0SA 2HJSA 1IHXA 4LVCA 1LTHR 1Y5RA 4FFLA 1D1TA 3EK2A 4B8ZA 3U9LA 3GVPA 3RC2A 4BMNA 3DXFA 4BUCA 2EKLA 2BFOA 4BNWA 1G0OA 1U3VA 4RLSA 5FF9A 2W2KA 3DBRB 1XU9A 1WWKA 2W2LA 3PHLA 2CDBA 3QP9A 3HFSA 1PQUA 4B79A 5IAAA 4R69A 3WTCA 1OC2A 4YR9A 3CPSA 4KZPA 2EP7A 3DZIA 1YBVA 5KCZA 3FD8A 1SOWA 3VKVA 1GY8A 1HRDA 2JD1A 3QE3A 3WQQA 1UXGA 5JE8A 4DRYA 1CQJA 5G4LA 5T8KA 5L51A 3JD4A 2X5JO 5LDGA 5A9RA 1XCBA 2AW5A 4B4OA 5G0VA 4DIBA 4YT8A 3QWHA 5A9SB 1EFKA 3OBBA 1YOVB 4UUOA 1P33A 3AM4A 5EQFA 2WYWA 1XSEA 3DBHB 4B4VA 1H6CA 3V1TC 3JQBA 2YHUA 3NYWA 1ZXBA 3MTGA 2A35A 4J0FA 1PL6A 1DAPA 2Y66A 2IDZA 4RZIA 3DHYA 5F1PA 3UCXA 4EJMA 1OAAA 1VC2A 1KEPA 4KDEA 2YZ7A 2DPHA 2V6FA 1Q0QA 5DOVA 1B8VA 3NKLA 4BKUA 2E6UX 4N54A 4LRTB 4U5QA 1DXYA 2DPGA 1GADO 1U8FO 3TOZA 3O4RA 3QVXA 4R1TA 3ZHBA 4F6LA 4JX8A 4BNMA 1P3DA 1ZSVA 1BGVA 3VH4A 3MWEB 1PGQA 5KJEA 5JDCC 1XWFA 3RASA 1E6WA 5BSGA 3TOXA 3DAGA 3AFNA 4HUJA 1BWSA 1GR0A 1F12A 5BNFA 1BXKA 2GGSA 4D0RA 2GZ3A 2OXIA 3T4EA 5DN9A 2X4GA 2R2GA 1UP7A 2ZJ1A 3GZNA 3CZMA 4UUPA 3RFVA 1GZ6A 5G0WA 1E3EA 3JQEA 3OEWA 1DIBA 1ZJYA 1HYGA 5A5FA 3FR8A 4CLOA 4NFHA 2O50A 4WK6A 4ZQHA 3E03A 3RD5A 1YBMA 1EVIA 4J7CA 3HZZA 1XQ1A 3IUSA 3I9MA 3K9QO 2PKQP 3GVXA 3QHAA 4PGFA 5AQ1A 1LDMA 1HZZA 3HQ4O 4ND4A 2J5KA 4R68A 1W73A 1ZZEA 5DOZA 2A4KA 2HO5A 1C1XB 1O9BA 3DFZA 2YJZA 4GH5A 4JXKA 3N74A 4BV8A 1CDOA 4CLRB 4CMCA 1P1RA 5F5NA 4KUGA 3PYLA 4BS9A 1KEUA 1B14A 1WDLA 1ZIDA 2VHXA 4DA9A 1QP8A 4TRNA 1U4OA 1BXGB 3D4NA 1E3SA 5DCWA 3F5SA 3GN1A 1NXQA 2UDPA 2EHDA 3ZV6A 7MDHA 4R01A 4XX0A 2Y68A 3PTZA 4XYBA 1ZK1A 4E5YA 2PY6A 1CERA 1NTOA 2O48X 1WAMA 3DTYA 2J5QA
chains in the Genus database with same CATH superfamily
4ZCIA 1UJ2A 1Q92A 4MWZA 1F1BA 4BFWA 2FRVA 2JI4A 3H5TA 4J7XA 1QTQA 1N8SA 3TSCA 2P3LA 3HO6A 4QPCA 5KBYA 2IYSA 3U9TA 2XD9A 3TDKA 2JHPA 5I7FA 1EQ2A 5JXJA 2J9RA 4MV0A 5T41A 5COQA 1W0KA 4W82A 3R9WA 4ZTBA 3KLMX 1CP2A 1PJRA 2BZSA 3F7NA 3OKCA 1N2GA 3CZ9A 4O33A 5JSYA 4F9TA 4P4TA 3A14A 4IJVA 1VFNA 5FWYB 4EYQA 1N1GA 1S8OA 1U7HA 1QZ3A 1WD5A 4LDRA 1FPMA 2OOSA 1M6YA 1KY2A 2OGZA 3KR9A 4CF5A 4FLMA 5E6SB 4DR2B 3ZZTA 4NXNB 5JJKA 3FBGA 4GAEA 1RRPA 2VTKA 2I1VB 3R5FA 3S6JA 4ZYWA 3RRMA 3CLHA 5H0IA 5CJPA 1YASA 1KSFX 4XX1A 4CN9A 3RTEA 4OVKA 1HPLA 1ZN7A 1IU9A 3T4XA 5E2IA 4AYXA 3A6HA 3MOGA 1J00A 4Y6RA 4UTZA 4R6WA 3W3AH 5F9FA 1RAFA 4EKIA 2CSUA 3ENVA 4N8SA 3V4LA 2B1IA 4AKIA 2QN1A 3NORA 3IV6A 4IL5A 5AHOA 5IUKC 2OSVA 5BSHA 1JWLA 2AUMA 3CZAA 2UXCB 1S4MA 2GETA 3R1IA 1YI8A 3T61A 2HNBA 2P6MA 2VNSA 3B60A 4OHKA 1D1QA 4P31A 4BZQA 1L5RA 3VPGA 3R4VA 2F1RA 2BBOA 3TLCA 4DC0A 5J63A 3HP4A 3FLBA 4TXMA 2X0JA 1SR8A 4F04A 4EELA 4QELA 1GU0A 2WTNA 5KX5B 4EK9A 1C3OB 2NU7A 5KYGA 4UHJA 5L7TA 5DM2A 3L05A 1JF8A 1A69A 3Q8XB 5ESWA 3SXUB 3WHIA 5KC8A 1AXRA 2NAPA 4E7PA 3EHEA 4RVFA 5KOJB 2J09A 4F4IA 1RPTA 4YAFA 4UHKA 1G16A 1B74A 2GWRA 3V8QA 5TPZA 4KXUA 2JIZD 2Z6QA 3G49A 3ZXIA 4IDQA 1H22A 3DBRA 4OXNA 2VWPA 4B84A 5HWSA 2XDYA 1DRWA 2ZJFA 4FI3F 4JU8A 5EAIA 3R7LA 1NDHA 1WXGA 2GM5A 3VO9A 2FW8A 5NLLA 2P9JA 4CQJA 2NTJA 4G26A 1F8GA 4YMSA 4LJ8A 1H2RS 1FFAA 2O7VA 1QYVA 1KYWA 3KLPX 1KMHB 3E9EA 5AJWA 1Y8QA 2JGIA 1QFZA 4ZANA 3M6VA 3PEVA 4IIJF 4IUYA 1DUSA 4JLVA 1QXSA 2K2QB 3MUFA 3UJAA 2MIIA 2QI9F 1E9DA 1WUHS 2WU3A 1D7AA 1Z0IA 3R76A 3VR0A 5K6AA 1XF1A 2BH9A 4NMXB 3LUDA 2X0NA 4M1QA 4K6MA 1QQBA 1U2SA 4I9NA 4JUCA 1XZPA 3HWSA 3A37A 1TCBA 2QTBA 1L5MA 2DU8A 5I9TA 4TLEA 2W6MA 1KQFA 3KR2A 2B36A 5A9SA 5LDHA 5ARBA 3WLSA 5JQGF 4EKDA 1USGA 3L8ZA 3EY4A 2GPSA 4PLZA 4LTDA 3I39X 4B6EA 4HH1A 3ND6A 4U0KA 5JAOA 4QOEA 1P0QA 5JSZA 4IOJA 2RJNA 2XNSA 2XGJA 1K4MA 2JIDA 4BP8A 1N8NA 4XARA 3V8MA 4E5NA 4UUAA 2JHFA 3WMGA 4HZUB 5ELMA 4HV4A 2HUNA 3MTDA 3FWPA 4DE5A 2UUCB 1C0PA 4D25A 1TPYA 4IRUB 2PL5A 4V1CI 4DBZA 4RA6A 4DV6B 3KE8A 3MD9A 2WIFA 4INPA 4BFLA 2FZ4A 1DMSA 1JU4A 1BOOA 3DEZA 3IQHX 3PIDA 2WTMA 3R3YA 4JK3A 4LE0A 4Z8YA 3D7KA 2I8LA 3FFTA 3HRHA 4KRXA 5IS2A 1VKNA 1FS5A 2APJA 2JK0A 2WSSA 5BSVA 2VDWB 3PBKA 2N47A 2XH8A 2RBEA 2WIKA 4XM2A 2AN3A 5IT4A 3OIVA 3TSZA 7ADHA 4HXGA 2PT6A 4YO8A 5FO0A 2P5YA 1XTJA 3FTDA 2ACVA 1TAUA 2ZUUA 1YR1A 2RKWA 2WJ3A 3V46A 1MA0A 2WDZA 1GO2A 4FGKA 1P5ZB 1RSZA 5D01A 1HE4A 3BJIC 4X1KA 2WY2D 1WSWA 5I4CA 5K3SA 3WLFA 4XPIA 5LN1A 2VHJA 2W6CX 1LGYA 2Q5FA 1NJSA 3V33A 3LDAA 5DP1A 4O63O 1FVOA 3W0LB 3CO5A 3I6MA 5ARDA 5FADA 4WGGA 4U7WA 3VVMA 4V0LA 5DWQA 5IABA 2A7XA 1P80A 2WWRA 5DLQC 3X2EA 5KUTA 1RAHA 4FFSA 5H7XA 1NULA 5CG2A 1Z34A 1SG9A 1QTRA 1LI4A 4ZI5A 1UAGA 1CD5A 1E92A 2JJQA 1DQYA 1JB9A 1K2WA 2OMKA 3A4IA 3NHMA 2WQ7A 1V11B 3BH0A 4MAAA 4DPKA 1ZN2A 1LPPA 4LDPA 5LKRA 3KS9A 2PWZA 5IRCD 1BSVA 3F1LA 5F33A 4B1FA 4R81A 5L95A 3A70A 1GU1A 1BFUA 4MKRA 4PV7A 3ZLTA 2I1QA 4PQFA 1VE1A 3CLRD 1ECBA 4TVBA 1LCIA 1REQB 3U3MA 1HZJA 1KI4A 1TZ2A 3CW2A 3NIBA 3CEJA 3GRKA 1G4AE 4LXIA 4DDVA 1XNQB 3W4KA 3QLUC 4DILA 5LZ9A 1O54A 1G2IA 4MI9A 2TECE 3GHHA 3IAHA 1BNCA 1DBWA 2C58A 2JFVA 3G0BA 1CZRA 1JMKC 2D1SA 1YZUA 4IDOA 3GFGA 1FF9A 1O96A 1RD4A 4ZYUA 4C9BA 5IEJA 1J9ZA 1DX9A 3AR7A 1JHXA 2Q46A 4A15A 2BYTA 1T5LA 4HL6A 4MB6A 1BIFA 2ZTMA 3NEYA 1GKUB 3PJRA 1VIAA 2MYTA 2BGUA 4OB8A 3LA6A 3NWOA 1ZUIA 4RYLA 1EFHA 5BN3B 2OORA 3LZ6A 5IT5A 5JMOA 1MC8A 4DCCA 2X1VA 1IN5A 5F5LA 3ZBUA 3W7AA 3NWEA 3F96A 4HQ6A 4KW7A 2LCQA 4GWKA 5K0TA 4Y2XA 1AKRA 4DL9A 2NUAB 2EZTA 5JWOA 4Y6SA 3DP7A 4W1SA 5CXUA 2VRNA 5CDFA 4M0FA 1KY3A 1KNQA 1MNQA 2R1TA 5DGXA 2HSEA 4ZO6A 4U9HS 5BVGA 1TM5E 1RHUA 5FRDA 1SOAA 3TUJC 2GJAA 1AK2A 1FY2A 4RD3A 2I6GA 4XD2A 5CH3A 3VNSA 3TS1A 2WFLB 2YMMA 3F98A 2QGNA 2P9CA 1QGUB 3AI7A 3GEMA 3SJZA 2Y1CA 4FMCF 1NKSA 1EEHA 1YDGA 1VZ2A 2ADFA 2O3TA 1WZCA 2CE2X 3N8KA 3U48A 4EMUA 1UXIA 1RI3A 4N5LA 5FJIA 1GNLA 1GGMA 3R3ZA 1G59A 3SMVA 1TNDA 1U5BB 1WV0A 3L7KA 1KJYA 1NV8A 1VL0A 2W2PA 2XJ4A 1JJIA 4MDEA 3AO0B 1GGNA 3P7MA 1F8YA 1L6RA 3AWIA 1VIYA 3M6LA 4Q9LA 4JI8B 4AURA 4YAJA 1SK8A 1SAYA 3PVZA 4HVTA 2C9MA 3RU2A 4RF2A 3NOXA 1FX1A 2D3TA 2G6TA 3SFTA 3OETA 3TUIC 1GARA 3BGIA 3K72B 3DZBA 3K8ZA 1T3TA 3O84A 2D59A 1W7AA 4GGMX 3H13A 3VTFA 3OM8A 2GN1A 1THTA 2AN4A 3HVUA 4Q9JA 1MXFA 4YRGA 3PQ4A 1KWKA 3WAJA 1X9IA 4K3UA 5J4KA 2ISCA 1OI7A 2AMLA 2JHCA 4MW1A 4IIBA 3RSFA 2F17A 4TMTA 4DMMA 2PZMA 1P45A 4ARSA 1EUYA 1XRSB 1POWA 5JBQA 4DUPA 3KXDA 2FMFA 3JYQA 4FE4A 4ITUA 3EVNA 2H8GA 4QJBA 1EXVA 3HTXA 1U9YA 2XWQA 4QNNA 3L0CA 3FETA 4BE9A 1N5MA 5BMOA 5BNTA 2VDLB 5A3SA 3RVDA 4UTPA 1VG0B 2I3BA 4FQ8A 3L8CA 3JTEA 4LA4A 2DHRA 5IYZB 2G9VA 5CDGA 3UWMA 3C5CA 4YCBA 1OXMA 5EE1A 3W4JA 1ZINA 1LTQA 3G85A 3H11A 2BKUA 2JCXA 2UYOA 3FOFC 1SHJA 2P9ZA 2VDVE 3PZRA 5I01A 3R9XA 1QMGA 4N0MA 2B4QA 1ZR4A 2V9CA 2EJWA 3T3IA 4FYMA 1OFGA 5JH7B 1COWD 1PZGA 5AK3A 5EZ6B 4YROA 3EMKA 1V2HE 1W4CA 3AF4A 2CXOA 2GKOA 3GG2A 4P2BA 3W5VA 5HZHA 3PNLA 4ZIRA 4MCAA 1XMJA 4IOKA 4PYKA 2I34A 4BWYA 2PRZA 1OA1A 1WPXA 1UP6A 2FG5A 4ZOLB 5IT0A 4Y6QA 5GPBA 4QGHA 4ZT3A 3DHNA 4R40A 1J8MF 3FX2A 2ARKA 3UB3A 1LWNA 4Q3KA 5DHQA 1I0ZA 4RJLA 4BLOA 5M5BA 1S5PA 4CIWA 1IAVA 2PMEA 3OF2A 3H1AA 3ZGXA 4AKSA 4AXXA 1BW9A 1CUYA 1NSFA 1PZHA 4UARA 3EOBI 5IF3A 5CX1A 1WF3A 1UDAA 2WAAA 1TA0A 2GN2A 4QXAA 2FMKA 4R2IA 4BUZA 1VPDA 3HH8A 5AW5A 1Y5MA 2JFWA 4EF5A 2VJAA 3KDSE 5CDSA 4MR7B 3H8VA 3BIXA 3C85A 4FN5A 1UADA 2A0FA 3VXKA 4C6RA 2O23A 3E81A 3IXQA 3EFHA 2O1WA 3HO8A 2GEJA 1NN0A 3QX7A 3ZWBA 3O73A 3R40A 4O2BA 3HKDB 4XI9A 5IKXA 3RC8A 3RSSA 3S40A 3DL0A 4MYCA 2V6MA 2AOUB 4DCTA 1DTEA 2GAFA 3LGSA 1M10A 2NVUB 4F4FA 3CLVA 4N9QA 1XG5A 3SAJA 4F2WA 3KQHA 5JCJA 4TYYA 4ZZ2A 1E7QA 2R65A 3EXHB 2AEEA 2X8LA 3FMPB 2QMOA 4JZKA 1JG6A 4B87A 2PH1A 1EFLA 2VQ3A 2WBLC 4J3FA 5BYBA 2GKSA 1O8CA 3QTLA 1QZUA 2ZWPA 4J1NA 3T3PB 4EFLA 3IQWA 2VQEB 4PFJA 4QFCA 1KI3A 3VJLA 4LX0A 4ED9A 1O5IA 6LDHA 1E0KA 1PG5A 2YFYA 3ABRB 5E9WA 3ACCA 2F90A 2OYSA 4CMAA 3A9VA 4QG7A 1OCEA 1ZGJA 2BKEA 2H06A 3K35A 4N3GA 1KDZA 3BXZA 4TQAA 3B48A 5BY2A 1KQPA 4I50F 1TTHA 5JHHB 1FP4A 2R96A 3EIQA 1NMQA 5IEBA 4EA6A 4Z2AA 1CDDA 1I4TD 4PZ9A 4U63A 5D51S 4F4HA 3UUGA 1G2PA 4EY3A 1LV7A 4L8WB 2QT9A 2CMDA 4PCVA 4QYXA 1UWCA 4U2BA 4TS9A 4ZT7A 3S2GA 4CLXA 2D0PB 3JRWA 3HP7A 3NB0A 3D54D 3PWSA 4KZKA 3ASVA 5TXGA 1DEOA 4YN3A 1LLQA 1S7CA 3FFWA 3TRHA 4RJTA 3JW8A 4LDQA 3ZU5A 3SE7A 2A58A 3WIOA 2KJQA 3CINA 4E46A 1MAWA 4GC5A 4PTLA 3G8BA 1H66A 2G82A 4QUJA 5D6NA 4KMRA 1ZY2A 2PL9A 4JKIA 4BU0A 4OFXA 3WQHA 1TM3E 3E5HA 3QOFA 4MW5A 3IT2A 4EEKA 2PLFA 4JMPA 1RFLA 5K8LA 4HAOA 1P5JA 3MUEA 4HO1X 4DLTA 3EGWA 3MC1A 5CIQA 1K97A 5DN6D 1JG4A 2HX1A 2WMDA 1QV7A 4FEAA 3ACDA 4L9AA 4IM7A 1HT3A 5AK6A 1P9NA 2HI0A 3W8FA 1WHTA 2FQYA 2HXSA 2YVQA 2GTHA 4QO8A 2HXGA 2KBEA 4HH4A 4FDTA 4KTVE 5HGJA 5D5QA 5KSOA 2J45A 2DOKA 2Z6VA 3GLGB 3HGMA 4RY9A 4HRVA 1CUXA 4MUAA 3L01A 1M7HA 1HG1A 4HB0A 4ZVUA 3RUAA 2PZKA 3F6EX 3LQQA 1U2QA 1QHFA 3GJZA 3MIIA 3OQ6A 3Q5GA 4H7IA 4NCKA 4RORA 3LYUA 2NPIA 2OYCA 2WUGA 1G6Q1 1VTKA 2FNAA 2VJYA 1XU4A 3W1VA 1I7QB 1YA6A 1NY6A 3T3EA 3ZCUA 1B8OA 2QD2A 3WBJA 4XD7D 4YRIA 4AJHA 4IIUA 1OGIA 4U7FA 3I62A 2DX7A 2JJ2A 5B30A 1V8FA 5IJ9B 5F7ZA 3ORFA 5H81A 1FDIA 4HDKB 3TBFA 4ODIA 1H2XA 4YRTA 2QLJA 2D1YA 3JASB 2O2DA 2X6TA 3O92A 4I5EA 3WGTA 2I22A 3CVUA 2Q8NA 2XA2A 5KJCA 2M6KA 4QDJA 4M3NA 4OHUA 2Z04A 3AHCA 1Y4AE 1NNEA 4NAVA 1H2YA 2QQ5A 5FNZA 3DKRA 4ZTUB 1OU4A 1ULUA 3TTTA 1K8XB 2QY9A 5AI4A 5J23A 3FNEA 3S2UA 1E32A 3NYQA 1XRMA 4WKBA 2G0AA 4F4UA 1M1UA 2I3GA 4WSOA 3PGJA 4D9MA 4GI5A 5LJLA 3NDPA 4QOGA 1HDYA 2HA6A 4RQAA 1GGVA 5IN5A 1V5IA 2EV9A 4QU8A 4AJIA 2OQ2A 2ZITA 2X40A 1S8NA 3EFBA 4PHHA 3RRYA 4MIYA 3IELA 4D4GA 3K5WA 1SVWA 1D5CA 2IYLD 4OQDA 3MHPA 2OZLB 2X9LA 3DONA 4ND8A 2AFIE 3HJAA 3E48A 3VISA 3TOVA 1XTKA 2UVPB 2WHXA 1NWHA 3F6SA 3T3MB 3A06A 4LNAA 4ZODA 3UATA 2DKFA 1O0BA 1HQYE 5DCLA 3E2MA 1C3XA 4DUGD 3U7IA 4AT1A 1RAIA 1JQEA 1E3WA 1JN0A 1KHTA 3O4HA 5DHAA 1NL3A 4RW0A 3UV3A 4IHAA 5IMBA 1ADFA 1L9XA 2R6AA 1L4YA 3CONA 3DAFA 3PDCA 2I87A 3UV6A 4D3FA 4EPRA 4C7OB 2W2MA 2OZKA 4GC9A 2OZEA 5DNUA 2QUJA 3AV3A 2E6KA 5FUMA 2VDNB 1D07A 1Q12A 2XIQA 1PRYA 4WUVA 3LCRA 5D3MB 2DQKA 4B35A 1TF5A 5TY0A 3RSLA 2Z2ZA 5ECWA 1S4QA 2PCLA 1V3TA 1T5OA 1MNAA 4EDHA 5LMZA 1PJCA 1QQTA 5IVDA 3L1HA 3OOJA 2Y4NA 4FQ7A 1DDOA 5KNLA 3AR9A 3L6RA 1SRQA 2VAMA 2AA3A 3FVWA 3RVNA 3U44B 3ZU2A 2XZOA 1PEKE 5KKCA 1VBNA 4OF4A 1BA2A 1W9MA 4WFIA 1Z35A 4BTLA 4CF3A 3LYHA 4DUZB 1JDJA 2H11A 1E6MA 2O3JA 2B7LA 1YUMA 3ED1A 4H6XA 1MT3A 2PAFA 1ADBA 4RBNA 4DVGA 1WJGA 2TMGA 3FVRA 1DO0A 3RROA 3VNVA 2GVDC 2BTQA 2ZGVA 3BTOA 3EQ9A 2WF7A 3QEJA 5DM0A 3H7AA 3GPLA 4R84A 4W9MC 4IHJB 1Q20A 2H1CA 1XHFA 5F7JA 2IZ5A 1V37A 3OQBA 1UKCA 1U1CA 3W77A 4RKFA 3OZDA 1N2XA 1UWLA 1ZUNA 3WWCA 2FPWA 1DGQA 3LIPA 2GFQA 3CX3A 1IZYA 5EFZA 4CMJA 4KQXA 2WQZA 4AULA 2GF2A 3ZTTA 5CBKA 3RFXA 5CFNA 1N4DA 5LKAA 4MW4A 3KUUA 4MQ5A 2DFLA 2RG7A 3A27A 1JEQB 3D3WA 2VOEA 3I2FA 2QAJA 2CFIA 3IR7A 3I58A 1UBKS 2J9YB 4GQBA 4XSHA 4YJFA 5ED4A 5EWMB 1M5RA 2PWPA 1SEPA 3DFFA 2VT2A 1USVA 2FRXA 3FR7A 2IP1A 5F1YA 5HILA 3ROGA 1L1FA 4CDNA 3GXOA 3LLCA 1N1DA 4OGFA 4L22A 3FSJX 2JLCA 3VUFA 2JHGA 2B35A 5CURA 4G9BA 3LECA 4HYYA 3ZXXA 1L4LA 3J81k 3LTEA 1GPYA 2J3QA 4DQXA 1BXRA 3ROKA 4X90A 2AZTA 4FZVA 1MMFB 2Y93A 3HEBA 4XDZA 2OWDA 4WZBE 4O6VA 1KU0A 2ZS9A 3RCBA 3QFRA 3JAWA 3VYVA 1HI9A 2F8MA 1OBVA 1YAJA 2OQIA 4QFDA 4YT2A 1Z0DA 1F3LA 4OLHA 3KB8A 2QLNA 4LJYA 4FOLA 4R8LA 3EOZA 3GGSA 5IFKA 2QXUA 1NOJA 3MINB 4Q34A 4CKBB 4F3CA 5F51A 3WLAA 4DREA 1TC1A 1YQGA 5BW8A 1R6VA 1XU7A 2G5PA 4MPPA 3QQPA 1AK1A 3QPUA 5FL3A 3EXEA 4ZPJA 4RJJA 1UUFA 1YR3A 1JALA 1N75A 3FI0A 4X61A 4JCOA 2ZBGA 2F8SA 3RNLA 2V7QD 4WA8A 4C78A 1PT9A 1YBHA 2O7SA 4FOTA 1WNFA 4LKRA 2IPXA 3MTQA 1ULBA 4C6TA 5I6DA 3RVKA 3WLIA 5JUWA 3OM1A 3HYCA 1ESNA 3GRVA 5C4MA 2C98A 4I3FA 4WLFA 1XOIA 3KAJA 3OTQA 1A5ZA 1Y37A 3A4YA 3GGCA 2R1VA 3P52A 2P75A 4KYIB 2VUSA 4Y6LA 3G0HA 2A3NA 3T52A 4RSMA 1I7SB 2MSDB 3UUEA 9MHTA 3QLVC 1R4NA 1GPDG 4URXR 1RXVA 2P6NA 2NT4A 3PXXA 2QRNA 3KT0A 3RW9A 4B3XA 1FSFA 2IYRA 2XBLA 3FGPA 3L43A 4DY4A 5BN4B 2C8KA 1G21E 1A4RA 4RTLA 4AMUA 1AC5A 3IR6A 1RPZA 1U8ZA 1PLJA 5FTLA 2WR8A 2XQFA 3DHEA 2ZK7A 1CQIB 1RKQA 3GGPA 1U94A 2ZROA 3GQVA 3MOSA 3QUQA 1FNMA 1A95A 1NRIA 2PGNA 1W47A 2B8WA 5EY5B 3WYBA 2H17A 5KYNA 3TLMA 2ZAMA 3CG0A 4N8EA 5LP6C 1XQYA 3K71B 5F9MA 2BFDB 3R3WA 3D9QX 3NPAA 4QQRA 4EL5A 1ULTA 1ND5A 2YV4A 5C5IA 2GOYA 4H77A 2WB2A 1ODKA 3D6HA 2EQBA 4PZCA 3MERA 4M0UA 4ZEOA 1P81A 1XZMA 3KDPA 1HNWB 2DHDA 2IS1A 2G1JA 1MGPA 1V16A 3BK7A 4RV5A 1NVWQ 1RHRA 1QFYA 3COJA 4FZ3A 2H1LA 4KKVA 4WZAA 1CZNA 4RK5A 3HCFA 1ZGCA 4IFIA 5IJZA 3TK1A 1P2TA 2D74A 2YXDA 4CDGA 3RO7A 3IEVA 2OMEA 1CRPA 3N7AA 4I5GA 4E2WA 1JQBA 5I4BA 3A1CA 3O8QA 1J39A 3ZHTA 2HMAA 3L0BA 2H5LA 3Q98A 2H1IA 1ZCJA 3GROA 3RANA 1E99A 2LVBA 2ZRQA 2PHZA 3Q1KA 4CG1A 5M29A 4PC3A 1FFDA 3LRTA 1Y81A 1OLXB 1XVAA 3G89A 4DXAA 2X41A 3EY9A 2FEXA 4RL4A 3OZGA 1T1SA 1ZDMA 1UJ6A 4P92A 3GQBB 1C1YA 4JBNA 2QTZA 4CG0A 2L18A 1BWPA 2Q4TA 1GG8A 4JBXA 5IHXA 3LXUX 4GUDA 2X0FA 1HEYA 4JBGA 1C3LA 1HKHA 2E4WA 4XOUA 2EQAA 3DJYA 1RFGE 2FRDC 5BVHB 4DT1A 1OB5A 3ZWQA 1UOOA 3AETB 3S7TA 2R7AA 1C3VA 2PKXA 4I8IA 4M6WA 4QUAA 1W9HA 1Z5PA 2OO5A 4RL6A 4CZ2A 2G71A 5K8TA 1LB1B 3ROZA 4L1KA 4DV7B 2H4WA 1GAEO 1L3BA 3DEAA 2QTLA 1ZUD1 4JP3A 3BDAA 1T6BY 1MIOA 3GAAA 4LPKA 3SDSA 3AL0C 1ZW1A 4W5NA 4V0SA 4YIKA 4AZ3A 1FZQA 2VF2A 1EVEA 4H1TA 4AG5A 3WLTA 1AS3A 2C20A 2BC9A 2BKVA 3QG1A 5TMBA 2A5DA 4W1QA 3GBVA 5CB6A 3THXB 3Q4GA 4JYCA 4CNQA 1V96A 4FGSA 4GX0A 4QUDA 1ODJA 2FUCA 3ZWDA 2O07A 1POXA 2NSLA 2HIMA 1PGNA 4YNBA 3L8FA 3V42A 3BTUA 4BQSA 3V1UA 4EI8A 2TS1A 1XYYA 1U2GC 4K6FA 1LTKA 4TUYF 5IKOA 3UUWA 4NCBA 4CMEC 1WP9A 1H69A 2Q5CA 3LSTA 3PC3A 4QOHA 2Q5HA 2RHCA 3D5EA 1IG0A 4HI0E 2J0UB 5K3OA 4RLFA 1UIRA 3LF2A 5DSTA 1N1EA 3O83A 3RUPA 2QTNA 3D7NA 3PDIA 3BD9A 2RHOA 5A3QA 1NQWA 2QN2A 3QBDA 2P40A 3HU1A 4K6CA 1C8LA 1MEEA 2JVKA 3TSYA 3FKSD 5IT9A 4DCMA 3RABA 3DMGA 4AKHA 1DAIA 2QVXX 1AXEA 1WLSA 4DJJA 2WYIA 2YASA 5KTSA 1BEUB 3ECCA 1OH8A 3ZDQA 4M9RA 2R86A 2FWPA 4MWGA 4BL5A 1Z6GA 1E66A 5C4IA 3CH6A 5EJGA 4TTRA 4A3SA 1AKEA 1TZMA 5HTKA 1LBIA 4F92B 3RTBA 5KHOC 1JEYB 3L92A 4RFLA 4RZHA 2D2XA 1QRTA 3JAKA 1QQAA 3ZJTA 2LWIA 2GBLC 5EIXA 3KSBC 1NVBA 3JQ7B 3NM4A 5DV9A 1EP2B 1UJ4A 4PX5A 2ZRHA 3DR3A 2EX4A 2X1LA 1ZD1A 3GP5A 3MT8A 3GUCA 2GPTA 1CUHA 1XD2A 1FMCA 2AUTA 4BX3A 5LZ7A 3F3YA 2LUOA 2B8NA 1Z08A 1OGJA 4OQYA 5LQSA 2CFCA 3CNEA 4M87A 4HGRA 3N2KA 4IIJB 1ESEA 3KWLA 2X6RA 4GPZA 1K7FB 3S5JA 1ZRMA 3P1JA 1DJPA 1YB5A 1JNYA 2PWBA 1MA3A 5CT9A 4D42A 4Z7OB 4Q7MB 4ZCMA 2RE8A 1X7ZB 4NBRA 1FFXB 3JCZA 4ZO4A 2DWOA 3BB3A 4K9OA 4S3MA 3LBHA 1YXMA 4M1EA 4IVPA 5HUHA 2NUTB 2RBKA 2VHVA 3B6ZA 4DTIA 1ZW6A 3CX8A 5AM3A 1F38A 3TNJA 1GNVA 1SQ6A 3NZEA 1X70A 1KVSA 3NPMA 4ZXPA 4S2EA 1Y4SA 3QYPA 4IIEA 4RIIA 3RADC 3QV1A 2K4MA 4UEKA 5KYWA 1SVIA 3F71A 1H9AA 3OD1A 1MDFA 4AK9A 4QEDA 3FZQA 2YC2C 2XT9A 4G84A 2A1UA 4UATA 1X13A 2XD4A 1XAJA 4Z4GA 3ZJUA 1F2VA 1WEHA 5AVQA 3ENZA 5EP2A 1D2RA 3EODA 4UVIA 4OUDB 2FJPA 3QXSA 3CR8A 4FXOA 5C9ZA 5KNDD 3VA7A 4AI6A 1LNSA 2Q3HA 2V98A 4KMMA 1K5GA 1KAMA 2FSVA 1TEHA 4KO8A 1ENOA 4BN0A 4RA9B 5F2EA 2SCUB 1YZGA 2PLRA 4WY2A 2DXIA 4EEXA 3VX4A 4R7ZA 1QO7A 4RCVA 2Q0QA 3FF1A 1SXJA 2MDTA 3PI6A 3HCWA 4BNVA 2ZCUA 3A1FA 4KGZA 3VPDA 5ITZB 1V7PC 1CUAA 5EXSA 5IKPA 4OQEA 1DXHA 4YVFA 1EFRA 2X5NA 2DH5A 2YZKA 2KLBA 5JNSA 5KPDA 4RVGA 1PJBA 3MCZA 1V0JA 4DFDA 2PX0A 1AZWA 4KVGA 5EZSA 5A3VA 2JEZA 4AY6A 3W04A 4AJPA 3LOUA 4PAGA 4YYZA 2NSJA 4FFOA 2O5VA 5F78A 4ALLA 2O7RA 2A78A 5HZKA 3KBBA 4YBRA 2EERA 1VPEA 1A5SB 3FSGD 3I3OA 4NEHB 3BMQB 4H6WA 3O3CA 2I54A 5HQ3B 1XRJA 4GLFA 1ACJA 3ML1A 1G55A 2NXEA 4V0NA 3RVRA 2VI5A 1JLSA 1M8PA 2ODPA 1NAHA 2YFHA 4M49A 4YHHB 1ZG3A 3G5UA 2VTEA 3C70A 5AJZA 5U4XA 3R8XA 3TX6A 3ER9A 2X86A 1QC5A 1ATIA 3PL5A 1FQKA 1XLUA 4RUKA 4MR8A 1EHCA 2HBRA 4JI1B 2AQKA 3E15A 4I46A 4OHVA 1ZFNA 5A1JA 1P9RA 3K94A 3MBOA 2BJVA 5JO0A 4I5DA 3UNXA 4UTRA 3WBBA 2ORVA 4BVLA 3HXTA 3KT6A 3SYRA 2L0XA 2P68A 4NS1A 4UHCA 3SEAA 5DBOA 3FUWA 3EBOA 1TAGA 3DLHA 2M6SA 3PRKE 3R3XA 5TV2A 3QVWA 5BXYA 3PGVA 4XLLA 2QRVB 2JFQA 2Q27A 4U02A 1W5BA 1ID8A 5J2UF 3PS9A 4HX9A 3BWMA 3UJ6A 1H6BA 3VU8A 4L07A 4HTFA 2H65A 4OHMA 5H68A 4QYSA 2O2XA 3FPFA 2BDTA 3O7MA 5FJJA 1FMJA 1SQ5A 2WTAA 4IGEA 5ALMA 3ER6A 3FWZA 3H8WA 4DA0A 4EY7A 4ZHSA 3DDUA 3NFYA 3HDHA 3VR2D 2N75A 1DT3A 3DTVD 3TZ6A 4DCPA 3QV2A 2Y05A 1O57A 2I55A 1GQRA 1OW3B 3B1ZA 3O47A 3QLTA 4O8CA 3ZWVA 4IQ4A 1ZJ4A 4BLWA 3IXMA 2WPDD 4FT2A 3QYFA 4M9CA 2WUFA 3H5WA 2IS4A 4N0DA 1DUIA 3QVLA 3E18A 2ATIA 1RMTA 1WRBA 1ZIPA 4F1WA 1Y1KE 3FDJA 4DLWA 1WBBA 1U0EA 4Q47A 3DB2A 3S2EA 3TECE 4MS3B 1RCTE 1VP3A 2CHUA 5ALRA 2NU6B 5FUWA 4A2WA 3Q7SA 3T7CA 3W6PA 1F6WA 2BSQA 4L5IA 3ISVA 1T4GA 4YO7A 3N2GB 3FDFA 4HEHA 4LHEA 2FJ0A 5IAKA 3KELA 5H3HA 2VPPA 2G0TA 2HRDA 3KSUA 2A5LA 3O21A 3SYKA 4LXHA 2AI3A 4GL4A 2CNOA 4M55A 2RGBA 4IQ8A 4OK3A 4FX2A 4OXRA 4BX2A 2VTBA 4HXEB 2R8RA 1V48A 2R6JA 4WN9A 3CQ9A 4FMCB 1PP4A 5CPFA 4GLBA 2O4UX 2IEZA 3VTAA 1SQGA 1DTWB 1UT8A 2VYCA 4PC1A 1U4SA 3WJAA 4C6SA 4MLDA 4FEYA 1QVWA 4JT9A 1QV6A 4JC8A 1KJWA 2HH9A 3EXAA 4NZMA 5FI1B 1OAOC 4B6SA 3ZVNA 2J32A 2C95A 2BGJA 4PN3A 4EX6A 2AFRA 2B61A 4K81B 4MQEB 4WXYB 4F5EA 2D1TA 4XIGS 1YQDA 3FVQA 3EA4A 2V7UA 1YS1X 4D4LA 3CB2A 2C78A 4LX8A 1DUVG 5A9TA 1I1QB 5TQ0B 3ME5A 2XCSB 3BB1A 4BX9A 4CGYA 2GZSA 5J5VA 5G53C 3TDMA 3SKYA 4C29A 4DLXA 5BV7A 1U2RA 2JCVA 3MSCA 1BTOA 4PG6A 2J7KA 5FPPA 4RYDA 3U4MA 2XR1A 1SCUB 4KSCA 5HF8A 3D7RA 2OGUA 2Q5LA 3CGGA 1FP6A 2TSYB 3ZVRA 1GPH1 3IXLA 5JADA 2CJXA 3CUEF 3IV9A 4IH1A 3VHLB 2YMLA 4Q16A 2LPMA 4JJ7A 4LNHA 4RNDB 3THYA 3ZE8A 4AL4A 2OCXA 2UAGA 4HDRB 4Y2SA 3ZE9A 1N2CE 3HB7A 5LBUA 1AO0A 1G1MA 3UK7A 5KTPA 1JHZA 2ZT8A 3PKJA 3WOHA 1PT6A 1F0KA 1VOTA 4HUQA 1CVLA 4A0SA 2OD2A 3AMVA 3NHUA 4XLZA 4O5AA 2G72A 2H00A 1HRKA 1KGDA 3U49A 4J9UE 1CY7A 1XDWA 2YWCA 3L7LA 4IZHA 4R2KA 3OJXA 4E4YA 1W36D 1QU3A 3DVSX 3SJAA 2GRJA 4YFVA 1I24A 2JC3A 4OGKA 4BO7A 3QG5A 4C06A 3D6MA 4PLFA 2P2YA 5IWAB 4DF3A 2HJRA 4BKUA 2H0RA 2OC9A 2ZQZA 2ZQYA 1QJ4A 1G8HA 2KM1A 2Y99A 2YZNA 1LPAB 3JQ9C 5FI0B 3UTCA 3HYTA 3ZIAD 4L6CA 2PX3A 4NF2A 3HZRA 3CRQA 3L8HA 3HZHA 3VR5D 1ZS9A 1QYDA 4WASA 2C2XA 3BIWA 1L8XA 3P9CA 3A3PA 1FP2A 4LDJA 1G38A 1L4EA 2EKBA 1QX4A 4IMIB 4M8IA 4G0OA 1H3FA 3JALB 5HGXA 2VDQB 1H05A 4EHHA 1AHNA 1A9SA 1VJ5A 5A71A 1KWGA 1E1CB 2BUAA 4PG4A 1YBFA 4Z99A 1PE0A 1JLLB 2FX3A 3C1OA 4M86A 3OZ7A 2OHVA 2HIHA 1EIWA 1E5TA 3PYXA 2XDQA 2PH7A 4P36A 1SOVA 3OA2A 4UOZA 2BEUA 3MOIA 4PX3A 2AL7A 1AKYA 1WXQA 3DMHA 3KYIB 1FEZA 5DW0A 1P7YA 2J30A 2XMBA 1RQ7A 3LBYA 2JGLA 5ARCA 4CM9D 5AIBA 5BNIA 5JR3A 1D7OA 3EHDA 1SEVA 1VKZA 3U16A 2I91A 5IUNC 4MKIA 1L4MA 1V41E 4LZWA 3F3MA 2W11A 4KH0A 4ARIA 4RHEA 5LMCA 3C98A 1RYDA 2FWAA 3OJOA 5ALWA 2BFFB 3QU4A 3M6IA 4MEAA 3T9DA 3K0FB 4H35A 1MO6A 3VO2A 1F4VA 3W6ZA 1X86B 1C9NA 2HNAA 3GX1A 5CDFE 1VPTA 3ONFA 3R7WB 5HIKA 1EI9A 3G7SA 1J5PA 4K87A 1CVRA 3DAPA 3K1YA 4DCUA 4O3MA 2AOTB 1U7TA 2M6LA 4CU5A 3KTAB 2XLBA 4DNOA 6ADHA 1ZM9A 3RAJA 4MQ4A 2CBZA 1W88B 1RJEA 2QIPA 4EFNA 2NYRA 3AW9A 4Y2GA 2Y2UA 3GEGA 3RVLA 4KHZA 4Z1OA 2FAXA 3PKZA 5JALA 3FDIA 3HL4A 1T0JB 2ODNA 5DX1A 4MK4A 3W79A 2CFTA 3QEKA 2QTGA 4US0R 4DLVA 4QHYA 4PS1A 4EHKA 1PZFA 4ILEA 5ALNA 4DJFC 3OTIA 3JQBC 3AEUA 2PAAA 4XSVA 1AB5A 4BVHA 4MB0A 4DCVA 2GD1O 5FUQA 3STTA 2A30A 4LRQA 4R16A 1I4OA 1G2QA 4CV0A 2W43A 1SOUA 4PIMA 1DIGA 2GM4A 1OIWA 1CF4A 1NT2A 3A6FA 1I4WA 1WPQA 3TO5A 1JT2A 3ENNA 3FM9A 3KC2A 4I50B 3H3JA 3EGOA 1KQ3A 3O95A 4RAOA 1O4VA 2CL6X 2QG4A 1C4OA 3DBIA 1QUFA 4NE7A 5FBHA 3AL2A 5BQXA 5J4YA 4RTPA 1WMDA 5G1PA 2I2FA 4C0AC 1YB2A 8ABPA 1L7XA 1UFKA 5B36A 4ARZA 3DO5A 3LLSA 4HVLA 1RPNA 3OC0A 1XV5A 4X91A 2VFAA 1L5KA 2O19A 4TLBA 1FSZA 4NU8X 3L6UA 4YI5A 4AG6A 4FJ2A 1K1EA 1W4ZA 4KRGA 1YJXA 4QOSA 4ZO8A 2IWRA 4OP1A 4OK6A 1Z0KA 5AP9A 1YR7A 1OVGA 4MP3A 1BRMA 1ZA1A 3MFQA 4LOIA 4QTTB 5DSXA 2HK8A 3RYIB 5I9SA 2Y6UA 1KOLA 4TYQA 4E7OA 2NVBA 2WJVA 5B55A 4E12A 5TT0A 1U8EA 4Z4EA 4WLUA 5FCDA 4IJ5A 2WTUA 1PL8A 4MRNA 4Y2RA 1TU4A 1P9LA 1DBPA 2AG5A 3FXAA 3G2HA 4HFMA 4A73A 4CCAA 4HG2A 4MS1A 4E1AA 5FWNA 2CT8A 1PZEA 2WJAA 3EUAA 3KJZA 5DPMA 2H2DA 5BQOA 5EJ6A 2GJ4A 1U8CB 4OM7A 3RFCA 3GFFA 3JD1A 1NXWA 3O8LA 1I2CA 2KPOA 2X1HA 3UXHA 3LX8A 3UWOA 3U7QA 4KR3A 4RS3A 3KEOA 4IDHA 2IEBA 4EHLA 5IZCA 3T7JA 3UAZA 5I7SA 3LHSA 2BGTA 3MCWA 1JE0A 2IH4A 4EKYA 5SZKB 2GZRA 4LYJA 2XITA 3FW1A 5I5EA 1QIFA 4HXFB 3H16A 1DCKA 4RIFA 4XIYA 3SIXA 1E77A 1X2EA 2WA1A 3WA6A 4DMGA 1Q11A 4BAGA 3UT6A 4F71A 2FLWA 2I99A 2XEXA 3DZGA 2MSCB 3HB0A 1XZDA 4OATA 1CB7A 2YS7A 2MYNA 4C3UA 4MI3A 4OV6B 4GR4A 1ABBA 2XB4A 1G9XA 3BCHA 2BW0A 4D9KA 3EQ8A 3DMTA 1NLMA 2JZNA 1Y1PA 3JPWA 3Q3JB 5HBRA 3X3HA 4GOND 2AOWA 1RQRA 3I83A 2AQHA 2AJDA 4KDEA 4YLGA 4IR7A 1KH1A 4CLDA 3P19A 1JHOA 3MPOA 4L76A 2JEYA 3E2IA 1C14A 3UICA 4K9SA 4PC2A 4JP2A 3SQXA 2I2CA 2H2WA 3GY0A 3KYBA 1LI5A 2UYGA 2CJFA 4D0GA 4F0JA 1GZ4A 1P5FA 1JQKA 1W8IA 4TS3A 3T0FA 1UMBB 4Y1GA 1JDBC 1HTBA 5DBIA 5KYYB 2P9GA 5DEOA 2R66A 5DIFA 1CETA 4OP2A 4EI9A 3RVMA 2GESA 4KFRA 1D6JA 1P7CA 2C2MA 1I0IA 3P2YA 4KDCA 4MPRA 4REQA 4BP1A 4C4PA 3FCXA 4BO1A 2O7NA 3MGAA 2GD0A 1K6IA 2H3EA 3MJVA 2XMGA 3TEJA 1BDJA 5E0OA 1NNI1 2JGJA 3EFOB 4O4IA 4US1R 3EIXA 3FHJA 1E0DA 1IWOA 1PG2A 4DBLE 3PC8A 3ZW9A 5ED0A 5E3HA 5KVSA 5BSUA 1GGKA 4DKJA 1LX7A 3BUSA 1I10A 2EX1A 5LQCA 2WABA 4PAQA 3C14C 4ZU3A 4C14A 2HPHA 1FQOA 1TUBA 2B5OA 2FPIB 3ELDA 1UT6A 3I9V