1B2LA

Alcohol dehydrogenase from drosophila lebanonensis: ternary complex with nad-cyclohexanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ALCOHOL DEHYDROGENASE
total genus 98
structure length 254
sequence length 254
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b2lA00
3QVWA 5DP2A 4BGVA 1X7GA 2POQX 5FWNA 1T2EA 2ZB8A 4CR7A 4A2CA 2GN9A 3NGXA 3JYOA 1OC4A 3LT2A 1KY4A 1ZK1A 1W8DA 1ZK0A 1NASA 4NIMA 4E2ZA 5ADHA 2H5LA 3A06A 5BSGA 1NPDA 3WWYA 2B5VA 1E3WB 3TOZA 1U9JA 2E4AA 5ILGA 3ETEA 1A72A 3ZGYA 1VI2A 1YL5A 3FD8A 1H0KA 4BO2A 3F4LA 1QLJA 3SLKA 1PJBA 1WDKA 3TZKA 4NQZA 4DUPA 4EUFA 1CYDA 5TSDA 4FDAA 5CDTA 2YUTA 2WDZA 4Y67A 5A5EA 2Q3EA 2NADA 3KRTA 3QWIA 2D0IA 4YWJA 5TLSA 1AHHA 2UUPA 4MKRA 4LCJA 4MIYA 4KP7A 4BO5A 2JFHA 3WGIA 4UUNA 1BGVA 2Q1WA 5F21A 3TL3A 3ONEA 3DAFA 4UVGA 4E2XA 1BWSA 5GZ3A 1P1HA 1QXSA 1EZ4A 1JW9B 2V6MA 3OJLA 3DBLB 4DBVO 2FMUA 3BIOA 3ZNOA 3D5TA 1UAYA 2DUUA 4J91A 2Z1NA 1AXGA 5THKA 5T5QA 5JW6A 3AU8A 4CM9D 5A02A 5A04A 3H9EO 5B1YA 3PI7A 3CIFA 3AFMA 3RI3A 4UAGA 4IZIA 2P5YA 1LSUA 2P4QA 2WM3A 3DZBA 2PFGA 4A7PA 1U5CA 3HFGA 4D79A 3SX2A 2C7GA 3QRWA 4MP6A 3LC7O 1NBOA 4JP2A 3UVEA 1ZNQO 1K0UA 2WD7B 3A9WA 1ISJA 2HRBA 4EUHA 4XIJA 4NFHA 3VH4A 4BV8A 1I3LA 3L4BA 1V0JA 3MJSA 1CERA 4EGFA 3E8XA 5LDHA 4HFMA 2ZKLA 1LSOA 1ZMTA 4LMPA 4B8ZA 4IQ0A 4OAQA 3KHUA 3AUTA 1BXGA 4GVLA 1GYRA 2PD4A 3UCXA 3BMQA 1V9LA 2PKRA 4FW8A 1CQIA 1I5RA 2GN4A 5JY1A 4YRAA 1DC5A 4INAA 1B8VA 3WTBA 1FF9A 4IJVA 4R69A 4R41A 1CIVA 2Y67A 4BNJA 3WDSA 3PWZA 2DTDA 4GGPA 1MV8A 3GPIA 3F1LA 3PYXA 1YDWA 3ZWOA 2EHDA 3E5RA 5HM8A 5L53A 4IS3A 1MA0A 5G0SA 1DRUA 2DBRA 4TVBA 2YDYA 4IS2A 1I8TA 4PG8A 1QMGA 4KMSA 4WUVA 1GUYA 3MJTA 2BFMA 1OZAA 8LDHA 2ET6A 4TRRA 1UDBA 1KVRA 2JFFA 4DYVA 4ZU3A 1XELA 2O23A 4XIYA 1H9AA 4GX1A 3GQVA 3UFXA 3GEGA 3WLEA 3DOCA 4ALLA 5T8KA 4CQLA 1YONA 1X1TA 1GZ6A 2QX7A 4B3HA 2X22A 2EGGA 1P1JA 4JX8A 1E5QA 3DEYX 4QEDA 5T64A 3ZWXA 2ZQZA 4ZHSA 4OQYA 4LW8A 3T7CA 4DL9A 1KC1A 3UUWA 4RGBA 2QHXA 3OEWA 4XYEA 5HBRA 4CM8B 5FYDA 3KV3O 2PNFA 1ISHA 3K9QO 1CEQA 3GNQA 5JCJD 1NFRA 1VM6A 1I32A 3FWZA 3WIEA 5L7WA 3EAGA 2BHLA 5L95A 4KDEA 4IQ8A 3WWZA 4MVJG 2UYYA 4GLLA 4BNXA 4BO7A 1YQDA 1VJ1A 1O94A 3GZ4A 4CMAA 1LC0A 2PGLA 5DF1A 3PDUA 3UGKA 5BSEA 2J5QA 1UZLA 2GF2A 3AI2A 3ZWPA 5BSFA 1D1TA 1QORA 3L6OO 3PHJA 3S2FA 1D3AA 4E5NA 3RKRA 1TT5A 4KZPA 3JD0A 3F9IA 1MXHA 3GUYA 2BFOA 4RF3A 5I7SA 2HUNA 2JHGA 2O4CA 1PEDA 1E77A 2RH8A 3JQCA 4I5DA 1I3KA 4RJTA 3MJCA 3V2GA 5JYDA 2GDZA 3AUUA 4N5MA 3VPGA 4RDHA 1C3VA 4NK4A 4CV2A 1YH3A 4BO0A 4O63O 5FI3A 2DQ4A 4EBFA 5I8WA 1NWCA 1E3JA 1Q2XA 1LI4A 1EQ2A 4TWRA 4O59O 3VAZA 4JCOA 2YHUA 4Z9XA 3RBXA 2D59A 1C1DA 4J1NA 5T67A 3KUXA 1MC4A 1J0XO 2YZ7A 1TLTA 4ZQGA 2VYNA 5L4NA 3U4DA 2YW9A 1G6KA 1EVYA 2O4UX 1HSOA 3VKVA 1U3WA 1LQUA 2YHIB 1DC3A 2EEZA 3OJOA 4XYGA 3NT4A 4XYLA 4BGIA 4DIFA 1GZ4A 2AEJA 1E7YA 3HN2A 4JBIA 3ZNNA 1ZFNA 1AN9A 2DKNA 3AJRA 3PHHA 4GI2A 1B16A 2X9VA 5COQA 2HO5A 1A9YA 4YEDA 1TXGA 2C5EA 5U1PA 5JS6A 1LUAA 1HZZA 4UEKA 1C14A 1N9GA 2NU6A 1QRRA 1I3NA 2O2YA 3QLJA 3ZDFA 3AM3A 4XD2A 1E3LA 1XG5A 4AJJA 3BA1A 5JC8A 1IYZA 1PGQA 2OUIA 2YV3A 3W4JA 1EVIA 4BHTA 4CMJA 4EJ6A 4JK3A 7ADHA 5HA5A 2WD8A 4YYZA 2VN8A 1VE9A 1PGPA 2IYPA 4LSWA 5I9NA 1OC2A 3C1OA 5CEEA 4DRYA 1U1IA 3OETA 2A92A 4UVIA 1DIGA 2BKAA 4BNHA 1LLDA 3BHIA 1BTOA 3JSAA 4ONEA 4Y6RA 3HFSA 4PN3A 3IP1A 2HQ1A 2EKPA 3TNLA 4BQRA 5DBFA 3S1LA 1E3IA 4FC7A 2NNLD 2G17A 4HFNA 1AUPA 5IJZA 1ZK2A 4UEJA 4F46A 1IB6A 3ORFA 3PQEA 4R1SA 3IQDB 1O8CA 2D3TA 3PRJA 4HBGA 4E31A 2NVWA 3E03A 3E9NA 2PR2A 4MOWA 4UEOA 1OFGA 4YACA 4BS9A 1PQWA 2JCYA 3O03A 3G1UA 5CDYA 5EESA 2AW5A 3RU9A 3MWEB 2Q2WA 3OP4A 4UREA 4D41A 4M8SA 1VSUA 1PJQA 1VL6A 3GNSA 4TRMA 2VOJA 4MIEA 4CLEA 2W98A 2ZATA 3RSHA 3U3XA 4Z9FA 1B7GO 1DAPA 4C4OA 5DZSA 5U9CA 2YV2A 3R1IA 3AM4A 1Z45A 2HJRA 3OHSX 3TPCA 3OJ0A 5B4TA 5JDIA 1CDOA 1VKOA 1KBZA 4AJIA 4BNUA 3JQ9C 1EFKA 1GR0A 1Y81A 1Y1PA 2DLDA 3E5MA 4RPGA 3CUKA 3GVHA 3OQ6A 3TDKA 1W73A 2AQHA 3TL2A 3EGOA 3IJPA 1SPXA 3HDQA 5G0WA 3JQAA 4NJOA 4J49A 1SOVA 3GVCA 2TMGA 1P31A 4CL8A 1R37A 2HK8A 4Z3DA 3PTZA 5TS3A 3S55A 1E92A 4JBGA 2WD7A 2RCYA 3ZWAA 4RVFA 3ZU4A 4RPKA 1XCBA 3ZWYA 4U5QA 2GERA 3I9OA 4DTIA 3ROKA 4I9NA 5BNFA 4J43A 4CV3A 1TI7A 4GWGA 2DFVA 4NU6A 1JKIA 1PGJA 1KIFA 4PLWA 1H2HA 1VL8A 4B8WA 2W90A 1E3EA 3V1UA 3UCFA 2IDZA 3AOGA 4P8RA 2EKLA 3F4BA 1CWUA 3AW9A 3I1JA 3RUHA 2OP1A 4BB6A 3K30A 4ZGWA 4GKVA 4NDNE 1W4ZA 1M66A 2E37A 3ZW9A 1HTBA 4FQ8A 1DIAA 2Y66A 3OF2A 4F6LA 3ONFA 1MB4A 4K28A 2VHXA 3WFIA 2PK3A 4BNFA 3NYWA 3ROPA 4DGSA 4FS3A 1ENYA 2Y1FA 4E5KA 3JQ7B 3H3FA 4GKBA 3C85A 3G1TA 3I83A 4WNCA 4ALJA 3JQ7A 1NVTA 1B15A 3P19A 2HCTA 4EZBA 3O9ZA 3PHGA 4ITUA 5DCWA 4BIIA 1YBAA 1YKFA 1O5IA 1PU2A 2P9GA 2Y1GA 4JJGA 4XJSA 3QE3A 4FD3A 4PLPA 4XKJA 5G0TA 4BNNA 2OGUA 3JV7A 4PIVA 2CD9A 2ZTUA 4O5OA 1K89A 1KEUA 3KXDA 4BGUA 3F6YA 1Y7TA 4YR9A 5ENVA 2NM0A 5I7FA 3DBHB 1LEHA 3LK7A 2CFCA 3MOIA 1IOLA 5H81A 1H6BA 3RC9A 3TSCA 4OGWA 3FNEA 3FHLA 1PJLA 2Q1TA 4KWIA 2P9EA 1LQTA 4GPD1 2B83A 1R4NA 2GR9A 3I9KA 3QY9A 4P4GA 3DTTA 3N58A 5EN4A 4PLVA 4GLOA 1JN0A 2E82A 2FOIA 3EVNA 1Q1NA 1DLIA 1FMCA 1UH5A 3U4CA 1NM5A 2UAGA 1P1RA 3C7DB 5TT1A 2D1YA 2X6TA 1B8UA 1UXIA 2X8LA 1YQGA 1TT5B 4M86A 4AJPA 4ZRNA 1SEVA 3FNGA 2FSSA 4URFA 4MVJA 2NTJA 2FR0A 2ZB7A 5A3JA 4KQWA 1RM5A 3IDSA 3P2OA 3JQGA 2Q1SA 4CQMD 3JQ8B 4B79A 1ZXBA 1IUKA 3WJAA 2Z1MA 3KB6A 4NFYA 4HNGA 4JBHA 3T4EA 2Q50A 2G76A 4PCVA 1ARZA 1K3TA 3PJEA 4CM4A 2C59A 1ZUD1 4UVHA 2O3UA 4II2A 3ADOA 1H9BA 5JDIC 1R66A 4ALIA 1NFFA 1PL7A 1Q0LA 4FOSA 1GEEA 4NBUA 3AWDA 4CMKA 4LCEA 1C0IA 3DB2A 1NAHA 5DBIA 1GDHA 3P7MA 5JCJA 4BO4A 4DC0A 3RJ9A 5ICSA 1D4FA 5KKCA 1Q7GA 5EMHA 4ND5A 4BKOA 3GVIA 1HF3A 1ID1A 3NT2A 2JFGA 3SJ7A 1JAXA 3DBRA 3W8FA 4GMFA 3RBZA 5L7TA 4RLSA 4YAJA 3RUDA 1E1MA 2QYSA 1SZJG 2J5RA 5FF9A 3I3OA 3IJRA 3S8MA 5EERA 1NR1A 4BKQA 1CF2O 2P9CA 3CEAA 3V2HA 4MIOA 2O7SA 3H5NA 2CVQA 4B4UA 3EUWA 5CAEA 1JDJA 1UR5A 5DT9A 1GPJA 1X13A 3DWFA 1HYEA 5A3VA 1HLPA 3VH2A 3OIGA 5LC1A 1T2DA 4D46A 4WLOA 4Z9YA 4BNLA 3IUSA 1EK5A 4OKNA 3BYZA 2A9FA 1MUUA 3OFSA 1DHRA 4GSLA 2A94A 1VSVA 3JTMA 4DPLA 3ZZNA 1A9ZA 4CV1A 1GV1A 4U6SA 2VRBA 3BTUA 1UP7A 1A4UA 1N2SA 5KVQA 1NQTA 3QIVA 3KYCB 3WMWA 2JHFA 1P33A 2YQ5A 1MC5A 1KC3A 4Z3KA 4FFMA 1ISMA 2XXJA 3BMCB 1I36A 1ONPA 4GMGA 3K96A 3FPLA 4KTVE 4GBJA 4NFSA 2VQ3A 1BHSA 2HMWA 4RV9A 4J2HA 2JD0A 3TRIA 2PH3A 5A5FA 1ADCA 4DLBA 5MDHA 1Y8RA 3CMCO 1ADGA 3TZQA 3V2UA 1BW9B 3WQQA 1F8GA 2VZ8A 3AY6A 3GNTA 1JAYA 3GGGA 3GK3A 4Q3DA 1D7OA 4D43A 5H82A 3S2EA 3ROQA 3V1TC 2FY8A 1LA2A 3QW2A 3NUGA 4CUJA 4HWKA 2UV8A 4Q9NA 3T4XA 1V3TA 2Q45A 4QECA 5JAZA 2DT5A 5BSHA 3EC7A 4NBTA 5JDCC 1ONNA 4BMVA 2C5AA 1LX6A 1KERA 4CPDA 5I7VA 5JSFA 1E3WA 2I66A 2Y05A 4I08A 4PVDA 1A7KA 2BF7A 2ZTLA 4WOJA 4IDAA 3DZGA 2VWGA 1JWBB 5IDYA 1H6AA 3ZU2A 2DTEA 1E7MA 4XRRA 5BR7A 2GCGA 3ZHBA 1NX6A 5IAAA 5JLAA 4ESOA 3R3SA 1P9LA 3JD2A 3D4PA 3G79A 4TZTA 5EQFA 4YPOA 3CXRA 4R5MA 4EJ0A 4K6CA 5CDGA 1VPDA 4CJXA 3I23A 1EBUA 1U8XX 5KOIA 1T24A 4UVDA 1NPTO 1JVBA 4DMLA 1UUFA 3QJ5A 4Y8VA 3LDHA 4GQAA 3E9QA 2H6EA 1I30A 5I9MA 4CM5A 2TMDA 1Q7CA 1SB8A 4XYBA 1E7RA 5TX7A 4AFNA 4J3FA 2J5KA 4R4JA 1F06A 2D4AA 3PXXA 4XA8A 3ZN2A 4XJTA 4J4BA 1YRLA 1E6WA 2HJSA 2AE2A 4J90A 4BB5A 4D45A 2Q46A 1NR7A 1HL3A 5C7LO 2W2LA 3QHAA 1MX3A 5TT0A 2OL4A 3LT1A 2BLLA 1HE5A 4DIBA 3RASA 1QKIA 2W2KA 4ZQBA 3H2SA 4X54A 1ZMOA 2GO1A 3HUDA 3U09A 1QYXA 1T2AA 4IUYA 4MVJE 3U9LA 3OH8A 5FEUA 4IBOA 4TROA 4E0BA 3LVFO 2P4HX 2Q4EA 4I1IA 4J6FA 4ALMA 3FBTA 4MO2A 3Q11A 4I9HA 2GPTA 2BD0A 3U5TA 1T2FA 2A35A 4DREA 2B69A 3M1LA 1EBFA 1DBVO 2GSDA 4N18A 4KQXA 1KEVA 2FR8A 2DBZA 4R68A 4ALNA 4XQ9A 2VOEA 2VUSA 4OOFA 3NDIA 1W0CA 3JYLA 4O1MA 1L7DA 3LYLA 3I4CA 3MJ4A 3TZ6A 4E32A 3H5RA 4J4HA 4EITA 1DLJA 1ZEMA 2QRKA 1LBEA 1ML3A 1PIWA 4GX5A 1YB4A 1YVEI 2I3GA 3K8ZA 4FFOA 2FPGA 2WWRA 1U2GA 2SCUA 2QYTA 2B4QA 4FGSA 5IZCC 5ITVA 4R1NA 3WBBA 2G0TA 4WLVA 5JC1A 4NJMA 3OICA 3DDNA 3HDJA 3LC2O 3V1YA 2D5AA 4MVJD 4OQZA 1M67A 1HE3A 2O2SA 2C0CA 1WMBA 4YJFA 1VKNA 3V5NA 3DHEA 4CQMA 2PTGA 4PRKA 1NQOA 2IYOA 4E21A 3O8QA 5G4KB 4BL5A 2UDPA 4H3VA 5IF3A 3I9JA 3Q3CA 3UKOA 2HSDA 1T4DA 1XSEA 5TIIA 3TOXA 1HYHA 3UW3A 4CR8A 2H63A 1NVMB 1DXYA 4A26A 2CY0A 5JBIA 4ZVVA 2VWHA 3U49A 4CLOA 5F1OA 1EUCA 2Y0EA 5A06A 1N9GB 4CLRA 3N7UA 5JDCA 2GZ1A 3HB5X 4WLUA 2FPIA 4YVFA 3A1NA 4WOKA 4MKZA 4OXYA 4YT4A 1QR6A 3IKTA 1GQQA 1P77A 3GR6A 1GUZA 2VYVD 2D5CA 2CDCA 1C1XA 1ADFA 3PZRA 5CDUA 2AG8A 3DO5A 4CUZA 3VZPA 4FN4A 1I2ZA 2DAPA 3FBGA 2AXQA 3OA2A 3W1VA 3QSGA 4UUMA 2D2IA 4AVYA 2I67A 2X23A 3JQ6A 3L4SO 2OOSA 1FK8A 5JNLA 2ZYGA 4WKGA 4NH4A 1X7HA 3H8VA 3IOYA 4XQGA 3JQBA 1P0FA 1Z7BA 3JQAD 1VLLA 2IXBA 3C3XA 4JP3A 3N74A 5CDSA 3DZHA 1E7QA 3GDGA 2PV7A 2FP4A 1UP6A 9LDTA 1IULA 1C0KA 1D8AA 1EUZA 3H65A 4P22A 2E6UX 1PJTA 5GMOA 4LN1A 2VYND 3GHYA 4IDDA 2NVUA 1SEPA 4OJNA 4CLDA 2Z5LA 4FPXA 1IPEA 4M54A 3GN2A 5CG2A 3PGXA 1OMOA 4RQTA 1M6WA 2IZZA 3I52A 4RF5A 4NJMB 1PZGA 3W6UA 3SEFA 1JVSA 5TC4A 2J6IA 1LLQA 3DBLA 1I2BA 4OH1A 3SC4A 4TKLA 1DAOA 4DIOA 1Z73A 2V6GA 1P44A 3D3WA 3D4NA 1WDMA 2R6JA 3INGA 3W4KA 1QYWA 2Q1UA 1KVSA 5C5IA 2QZ9A 1MGOA 4MINA 1B26A 1LTHR 4F3YA 2X86A 4R01A 4WEOA 3TF5A 2IRWA 1Y8QA 2FN7A 2VUUA 1DDOA 3JQAB 3NDJA 5TJHA 2Y99A 4PZCA 4XB2A 5FI5A 4PVCA 3VZSA 4XWYA 1V3UA 3WOHA 3ZWBA 1QV7A 1UXHA 2VRCA 3D4OA 2O3JA 5G0UA 4FCCA 1JU9A 1YJ8A 2LDBA 1PL8A 2RBEA 2CSUA 3NAQA 3OSUA 5EINA 4DQXA 1DFHA 4YJDA 1NP3A 3FWNA 4Y6PA 5JE8A 1M2WA 4YJFB 3Q2IA 1PZFA 5T6BA 3PLNA 2XXBA 5F1PA 4O6VA 1QLHA 4R9SA 3UN1A 5KJ6A 4BNZA 4U6QA 5CHEA 5TRTA 1KS9A 4EDFA 3P5SA 5KVVA 1PJSA 2JD2A 2X9GA 5I8ZA 1LXCA 1RYDA 1PWZA 4J7UA 2VHZA 4B4WA 2O48X 4G81A 3OBBA 5DN9A 1U3UA 1KETA 2QRLA 1WWKA 2VHYA 4XDYA 1KYQA 1HDGO 3NRCA 4OL9A 3R6DA 3F47A 3OMLA 1JQBA 2I9PA 3KSDO 1DHTA 4XB1A 3WGGA 3G0OA 3QWHA 5J23A 1R12A 1EK6A 4GL4A 4Q39A 4IQGA 2AG5A 5L51A 4ND1A 3BXXA 2D8AA 1EQUA 4CM1A 1PJ3A 1YOVA 1VJTA 5B4VA 1DIHA 1BXKA 5DDIP 5L4LA 4YA6A 1XGKA 3NJ4A 4K1LA 5A9TA 1N8KA 1B2LA 4K6FA 4L0QA 5KKAA 4EUEA 1BDBA 1LU9A 4C7KA 1Q0HA 3JYNA 3STHA 4BUCA 4A03A 3MWDB 4U0KA 3VPHA 1T4BA 5A1TA 4KTTE 3OECA 3JQFC 4E30A 2C7VA 4MVJM 2W4QA 3U62A 4Z0TA 3GPDG 2I5PO 4A10A 1SBYA 1H6DA 3HZZA 4D7AA 1K6JA 1MXFA 1UDAA 2RHCA 4DXHA 3RC1A 3TQHA 1T1SA 1KVQA 3RQSA 5COBA 3DHYA 4FJ1A 2I99A 1U2DA 4LRTB 5F5LA 1F12A 2G1UA 4OHUA 4TSKA 4PG4A 3MTGA 6LDHA 1DJQA 3GVXA 4IMPA 5KJCA 4JROA 1BMDA 4NR0A 2GZ2A 3G17A 3WGTA 4E2WA 3DAPA 4ID9A 2V7PA 4CMCA 4WLEA 3WG9A 4C7JA 4E6PA 2JCXA 2V65A 3GFGA 2YHIA 4FJ2A 2C20A 2HAEA 5A9RA 3D1LA 5IDQA 1QYCA 1SOWA 1B3BA 3C1AA 1LDGA 3K2EA 1ULSA 3LT4A 1GUFA 4NI5A 3B70A 2OZPA 3ICPA 3BMNA 4YAKA 2X5KO 3AUSA 4RVDA 4W82A 1HETA 1U7HA 1UP4A 3C7AA 5LCXA 3W8DA 4AJNA 4L4SA 1RKXA 4W6ZA 5B12A 2ZYDA 4CM4B 3E18A 4RPHA 4PLFA 1E1NA 4PG6A 3RCBA 3WBFA 5CP8A 1GYPA 3V8BA 5AVOA 1LDMA 1M75A 4RORA 5TGDA 3MJEA 1E5LA 2OO5A 4CLHA 1JWAB 2HK9A 4D42A 4HFJA 1PR3A 3K92A 4IXWA 3WICA 3GG2A 4IXTA 4RLHA 3KVOA 1WZEA 1DRVA 3K5PA 3LSYA 4AJ2A 3ITDA 1DC6A 3Q9NA 3B1FA 4TKMA 1NQAO 4LVCA 4RPLA 4R5HA 1FDSA 1FXSA 4E4YA 4L4XA 3WXBA 4IINA 3E1KA 2ZTMA 2EG9A 1EFLA 3Q9UA 3VPXA 2VRCD 3E6AA 2B0JA 3FI9A 1YXMA 5KVCA 1DC4A 3DBVO 2B4TO 4GGOA 2PKQP 3CZMA 2JD1A 1WMAA 2JAPA 3KEOA 3JCZA 3RD5A 4BNTA 1YGYA 4R3WA 4RZIA 3SLGA 2HKIA 2JJYA 2PZJA 4FIZA 4H7PA 2PH5A 5HRUA 2FZEA 1SNYA 3DQPA 4HXYA 1ULUA 5G2OA 2PD6A 3PGJA 4QSMA 2EV9A 3IL2A 1XIVA 3WGZA 2X0IA 1XWFA 5ICMA 4B7XA 4XGKA 4XRGA 4E13A 3U0BA 5GZ6A 2O50A 3AY3A 1E6UA 2ZJ1A 4IDBA 3KZVA 4PRLA 5DOZA 4BKRA 3F3SA 1Y5MA 3QVTA 4WLNA 1WVGA 5K6AA 4XEHA 2VHWA 5EIOA 2X4GA 1RPNA 3HB4X 4R1TA 4W7IA 4P38A 4JNKA 4E5PA 5CPBA 1LDYA 1ZKMA 2FPPA 1MG0A 4I9UA 5IFLA 3D5QA 4MP8A 2ZCVA 4FBGA 3AOEC 3UOGA 4W7HA 1PZEA 3JD1A 3GMSA 3HQ4O 1Y5RA 4PLCA 4BNMA 4XR9A 5L4SA 3I4FA 1H94A 4YAGA 2WE8A 1GL3A 2XF8A 3BTOA 1GV0A 1ZCJA 3IMFA 4JGBA 5AXCA 3RWBA 1SC6A 3NTOA 3C8MA 3U4IA 3JQFA 1SCUA 3Q2KA 1ORRA 3AI3A 4MVJF 4AL4A 2BH9A 4OMUA 4BMNA 4YBZA 1XYGA 3RUCA 3DOJA 3SBOA 3RUFA 3BMQB 1B8PA 4Z0PA 2CVZA 3WYCA 4E12A 4Z6KA 1ZK3A 1J6UA 1BSVA 3BHMA 1V8BA 4Y9DA 1UDCA 2ZB4A 3WMXA 1G1AA 2OHXA 5DCUA 4BO3A 2BGMA 2FR1A 3JQ9A 2J3JA 1BRMA 4J9UE 4BV9A 2NU8A 1H2BA 1P1FA 1T2CA 1OOEA 3D0OA 5KJEA 2QRJA 4MPDA 3WQRA 3IS3A 2ZIZA 4NBRA 1U3TA 3PHLA 2NACA 3FRJA 5L7YA 1P0CA 2ZTVA 3RUEA 1U4OA 4NK5A 4TZKA 3RFVA 2OBYA 4JXKA 2WE7A 4J4TA 3QVSA 1QG6A 1SO8A 2Y68A 4WCFC 4E5MA 2BI7A 4GWKA 1UAGA 1WZIA 2DBVO 5IN4A 1VC2A 4ND3A 1YJQA 4KWHA 4Z0HO 3RIHA 3WX0A 4GX0A 3FTPA 3PJFA 4KUGA 3H9QA 4L75A 4RF4A 3NJ8A 3I9LA 4YJGB 2AE1A 4KDFA 3CSDA 4WCDA 4YRDA 5G0VA 2WJPA 3K31A 1PGNA 2GZ3A 3ZWNA 2E48A 4IIUA 2VUTA 5DULA 5EPOA 4II3A 3FF4A 4FFRA 1PWXA 2JCVA 4CMBA 3A14A 2NU7A 4QXMA 5KJ1A 1LDNA 1WNTA 4J0EA 1O0SA 2W2KB 3OIDA 1RM0A 1Z7EA 3RUAA 3ZU3A 4Q3BA 3OQ1A 1VJ0A 4R16A 1AE1A 3DOOA 1HT0A 3VH1A 1IZ0A 3VDRA 2VT2A 2VWQA 1ZJYA 3O26A 1R16A 3WGOA 3EHEA 5A03A 1Y9EA 1WDLA 3TFQA 5KWEA 2BGKA 1LJ8A 2EP7A 3MCVA 4W99A 3ETGA 4QX6A 3CINA 4HY3A 4XQEA 1RYEA 2ZB3A 1PJCA 5I7EA 4HUJA 3KYBA 1GTMA 1LRKA 4CM7A 4HFRA 3RBVA 3W8EA 2YYYA 3BMCA 3GN1A 4GVXA 4B3IA 1YBVA 4IJWA 5HS6A 3HJAA 2O3SA 2BFPA 4RZHA 4IDGA 5TNXA 4OM8A 3ZWWA 2RIRA 2FHSA 2ZCUA 3GGOA 4LK3A 3WS7A 2AA3A 2CNBA 1HE4A 1Z75A 2QQ5A 4IGEA 4W9NC 2VYVA 3SJUA 4LMRA 3QWAA 4OSOA 5L45A 1F0YA 1CRWG 2XOXA 1WAMA 3C24A 1LLCA 3AM5A 1EUDA 3VKUA 3I6IA 4NBVA 2GN6A 5GZ1A 1GADO 5DOVA 4FSHA 1WPQA 1ZK4A 1KY5A 3GRPA 1YO6A 2QZZA 4AICA 2EWMA 3A28A 3ANLA 3AOEA 2VHVA 2O3QA 1KEWA 4RCVA 4ZJUA 2X5JO 5IZ4A 1UXKA 1Y8QB 1DPGA 4R54A 4W9NA 1PQPA 4M55A 1LNQA 1E7SA 4BNKA 4R51A 4WEQA 4TVOA 4R1UA 4PGFA 1FDVA 3A4VA 4OIMA 1ONOA 5KTKA 5ILOA 1P3DA 1EEHA 2DU8A 1F8FA 2YQ4A 4I8XA 2PWZA 1X14A 1T25A 3NDRA 1LDEA 2P91A 4J7XA 4XDZA 5EJ2A 1U7TA 4PLHA 2QG4A 1OBFO 3JQDA 3HWRA 9LDBA 4AJHA 2Z95A 3ASVA 4ZQFA 2B35A 5IXYA 4PZEA 3OIFA 3GDFA 5K9ZA 1BG6A 1ENZA 2Y1DA 3INRA 3HN7A 5G4LA 4DYDA 5JO0A 3X2EA 3OEYA 1K2WA 4OOEA 4PZDA 4JIGA 4FB5A 4RVGA 5BT9A 4AJEA 1MFZA 3QWFA 3TJRA 2ZK7A 4LSMA 4CM6A 1NHGA 2C2XA 4AJ4A 1I24A 4DLLA 3ZV5A 1NVGA 4YXFA 3ZU5A 2ILTA 4CL3A 3GZNA 3KLMX 3BHJA 2QIOA 3CMMA 1A71A 3INTA 3L0DA 1U8FO 3JD3A 3OJFA 5HS4A 2Y1CA 1YWGO 4R9RA 3WQSB 1XQ1A 4IZHA 1NFQA 2F00A 2Q99A 5BQFA 4AJKA 1ISGA 5B4UA 5IZCA 3LT0A 3WGYA 2J8ZA 3HADA 4YRBA 3FNFA 1BVRA 1UXJA 4MKXA 1F14A 1IHYA 4RPJA 4YT5A 3DR3A 2UVDA 5THQA 1GZ3A 4BGEA 1XU7A 4I5GA 4PG7A 4A27A 4XX0A 4WE3A 3WGQA 2EGHA 1QP8A 1HLDA 5U4QA 1A4IA 1N7GA 1R4MB 3LZ6A 1AXEA 1HKUA 2C2YA 5HWSA 1JKFA 1UJMA 1MG5A 2HMTA 1TT7A 4D0SA 3ZV6A 2VZ9A 2FWMX 1ENPA 1CQJA 1NHWA 4J2OA 5A4DA 1AHIA 4NG5A 1LSSA 3KLPX 3EZLA 1O89A 5F3RA 1SMKA 3ZH2A 4BMSA 7MDHA 1LSJA 1PQUA 4M87A 3RAJA 4E2YA 3VC7A 4QT0A 3UCEA 3UAGA 4WASA 4DWVA 2P2SA 4OO3A 5CPFA 1M76A 1R0SA 1J4AA 2O3TA 1JKJA 4Y6SA 4DQVA 3ZWCA 1I3MA 1Y8RB 4IIVA 2CF6A 2PZMA 1IHXA 4CQLB 4EEXA 5T8KC 2EP5A 3H5AA 1MLDA 3PK0A 4DBZA 3GH3A 2EJVA 2GYYA 2Q49A 4Y98A 1XR3A 2B4RO 5TQVA 5MGBA 4G2NA 3VH3A 4YQZA 1ZO8A 5JAMA 1GU7A 3DZKA 3KO8A 3KYDB 2DPGA 5BNIA 3VZQA 3DXFA 3WJ7A 1KVTA 5JAIA 5L40A 4FC6A 1RJWA 1XA0A 3CKYA 1B3RA 4YTEA 3DTYA 3JQBC 1DFIA 1IL0A 3DC2A 1B0AA 2WSBA 3KOUA 4I5EA 2DVMA 3QWBA 1DRWA 1RM3A 2VNSA 4J1TA 3IIEA 4KOAA 2E49A 4U8GA 4P4LA 1HDRA 3RFTA 3RROA 5IG2A 3M2TA 4K9DA 3HDYA 2EKQA 2NQ8A 2AQKA 3F1KA 4EI2A 1DO8A 2JKVA 4BQPA 3QVXA 1YOVB 3NEPX 1E1LA 4ZA2A 2G82A 3AUAA 3VVBA 5FFFA 1NTOA 3WGHA 4ZICA 2DTXA 3EVTA 3Q1LA 5ES3A 3DBRB 2WTBA 1ZSNA 2WYWA 2FZWA 3VPSA 3NX4A 3CZRA 3PVZA 1XQ6A 3DAGA 2PLAA 2X0JA 1CJCA 1EE9A 3K73O 4DMMA 3OA0A 4IM7A 1KEPA 4D3DA 5KNLA 2VTDA 3ICCA 4CMEA 3DBHA 3WIDA 4J7CA 5AXDA 1IY8A 2HK7A 2P68A 3F46A 1SAYA 2NSDA 3DZJA 3L77A 3G49A 1G0OA 2UUOA 4FFPA 4ROSA 4A73A 1ZBQA 2BFAA 1FDWA 2CDAA 2EERA 4TQGA 5DCYA 3FR7A 4RO0A 5ER6A 5ITWA 1K5HA 3D7LA 4PG5A 3TZCA 4IDCA 2RHRA 1WW8A 3TN7A 3HE3A 4OYRA 4XZ3A 3AI1A 2OXIA 4CMEC 4DLAA 3TFOA 2B36A 1E3SA 4BOYA 1EVZA 4PLGA 1TVEA 3WNQA 2Y0DA 2C82A 1GY8A 1YS4A 2HU2A 4L73A 3DZIA 3KYDA 2AQIA 1TA4A 1W6UA 4YJHA 1RM4A 4N54A 4U7WA 1XDWA 2H9IA 3GUCA 3QA9A 1HDOA 4UUPA 1HYGA 4XGIA 1H6CA 1NYTA 3BMOB 4MVJP 1PSDA 1ZSYA 5AXBA 3WFJA 3GY0A 1ZXLA 1Z6ZA 3WTCA 2PY6A 1GD1O 3KTDA 2I3AA 2C07A 2F1KA 1EDZA 1N5DA 3ASUA 4HADA 1T1RA 4D44A 1O9BA 1PZHA 4H15A 2C54A 3KETA 4PFJA 2I6TA 3PPIA 2VT3A 4N7RA 1B14A 3NT5A 5T57A 3H9GA 4CMIB 2J3IA 3ITKA 1IE3A 1MFPA 2I65A 2CDBA 3PLRA 3CTMA 4D3SA 4BNGA 2YFQA 3PWKA 4DVJA 3LU1A 1YL6A 3HSKA 5C7OO 4W4TA 3W6ZA 2B37A 3GZNB 3O8QB 5G4KA 5EQDA 4BKPA 3VZRA 3H3JA 4MJLA 2IXAA 2RH4A 4DA9A 1YDEA 2YDXA 3PZBA 1ISIA 4UULA 3ZCXA 2ZYAA 3RVDA 3KSZO 5JPIA 4R3NA 3D64A 3FSRA 1R0KA 5I9LA 3QQPA 2P5UA 1GQ2A 1L1FA 1HDCA 5TJ9A 3L6EA 3ETDA 5HTOA 4XCVA 5L9AA 3LQFA 1A5ZA 3DFUA 2XPCA 4IJKA 2GUGA 1Y9AA 2OFPA 4H16A 5DP1A 4E3ZA 2CF5A 2GASA 2BI8A 3E82A 4XYMA 1HSZA 2CVOA 1YB1A 1LDBA 2OP0A 1HRDA 1PJ4A 1PS9A 3EMKA 3I9NA 1ISFA 2AEMA 1KVUA 4MDHA 1FJHA 4BKUA 2BELA 1WXDA 2FRDA 3MOGA 1LC3A 1HEUA 1ZH8A 5GY7A 2HLPA 4WECA 1I10A 4B7UA 1VL0A 2CZCA 4Q3EA 1JLLA 3AFNA 2NU9A 1ZEJA 1ZSVA 3K2BA 1Z74A 2DUWA 4NU5A 3VPFA 2W8ZA 3LC1O 4YDRA 4HNHA 3SXPA 3B1JA 3GAZA 3PHIA 5BNTA 1GQYA 1HXHA 4BNVA 3ZHXA 1X7DA 4L8VA 1LRJA 3FCOA 1GAEO 1QYVA 2O7QA 4Q3AA 4BNYA 3L9WA 5IDWA 1ENOA 1U3VA 5TF4A 4WNIA 5JXWA 4GH5A 1U28A 3PYLA 2GGSA 1ZW1A 3LLVA 3OM9A 3ZW8A 4FFLA 6ADHA 1XEAA 1XLTA 3L9XA 4A5OA 1NPYA 1PX0A 2IEBA 2EIHA 3G3EA 4KUHA 4ZRMA 1C1DB 4JJFA 2IEDA 4YJHB 5L3ZA 4JJIA 3JD4A 5F1KA 4E33A 3IP3A 3BMNB 1R0LA 4P4NA 3O38A 4GAEA 1K6IA 1ZJZA 2Y0CA 1GPDG 4CM9A 3I9MA 3EW7A 4PLTA 1M6HA 1QV6A 3H7AA 3KBOA 1LRLA 2YV1A 4K26A 1R15A 3GLQA 2B5WA 1HDZA 1PL6A 4DPMA 4NZ9A 2GLXA 5DBGA 4J1QA 5CEFA 4JLWA 1AGNA 2AMFA 3B1KA 1A7AA 1X15A 3NV9A 2PGDA 4IDFA 1UXGA 1JTVA 3H4VA 3NTQA 2QW8A 4U0JA 3RC7A 4TRJA 3WLFA 2X0RA 2NWQA 4LISA 4YB8A 4BVAA 1J5PA 1Q7BA 4DQUA 3PDJA 1NWHA 4UUOA 5A05A 3GEMA 2W2LD 4WK6A 3M6IA 2JAHA 3UXYA 3ST7A 3DMTC 1FDUA 3U4HA 2YJZA 2DM6A 2HMVA 5CFZA 2GRAA 3PWSA 1YQXA 3ZV4A 3I5MA 1GFSA 2I76A 5A9SA 4HKTA 3Q0EA 3ZI0A 4UVEA 3MEQA 1DEHA 4CM8A 5JCXA 2Y1OA 3C7CB 3GDOA 2X9NA 1ZIDA 4LRSB 4IJUA 3GA0A 4CR6A 5CEJA 4J1SA 4ILKA 1BXZA 3LF2A 4G5HA 1C0PA 4D0RA 3EDMA 4MP3A 3DMTA 3WYEA 4BO1A 3I6QA 1QYDA 4IPTA 3MZ0A 2X1HA 4EEZA 3H2ZA 2X0NA 3ULKA 4IGFA 3EK2A 2ZQYA 3VTFA 3FR8A 3PQDA 2PZLA 2Y93A 2YY7A 3PYMA 2NTVA 3M1AA 3F5SA 4QFCA 1J49A 4HP8A 4L9RA 2JL1A 2C29D 3WNVA 1NNUA 1DOHA 1Z82A 3ZNQA 3T7EA 3ENNA 1LLUA 3JQGB 3QVOA 1HZJA 1FDTA 4FR5A 4M89A 2V6BA 2HDHA 3JYQA 2R2GA 3ENKA 3PFFA 3DZFA 4M49A 4RF2A 3UHAA 2VNAA 2DBQA 4F45A 3P2YA 1P1KA 1S7CA 1XHLA 2IZ1A 1IZ9A 4BNWA 3ABIA 3EZYA 3ADPA 3NKLA 1RWBA 2GN8A 3NGLA 4L74A 5H83A 2NVUB 4AG3A 2EXXA 4S1VA 3S2GA 2R00C 1BVUA 1BXGB 4CV0A 2Q4BA 1PS0A 1C0LA 1R4MA 3H9UA 1DIRA 3CE6A 3LF1A 4J9VA 3HNPA 4OXNA 5JO9A 1YB5A 3UF0A 3BTSA 3DONA 1V3VA 1WP4A 2VTEA 5C37A 3GG9A 2EJWA 3ON5A 1GYQA 4CQMB 5JY6A 1YE3A 2O3RA 3ANNA 1EVJA 1G0NA 1U4SA 5KJFA 2R00A 3IC5A 2X58A 3CPSA 1P1IA 2IODA 2ZJ0A 4RVHA 4PLZA 3GOHA 1P74A 3BMOA 1E6EA 5A9SB 3BTVA 5CG1A 3GHHA 1GCUA 2BGLA 1OAAA 5IXSA 2OMEA 1EE2A 3AU9A 4DC1A 3E9MA 3WSWA 5ENDA 4TRNA 3TWOA 3HHPA 2HRZA 4OKIA 3SC6A 2Y1EA 1PS8A 1E0DA 4FGWA 4RL6A 4AJ1A 3GRKA 5F5NA 1S6YA 1HE2A 2AHRA 2V6FA 4BO6A 3UH1A 1T26A 2PA3A 3DFZA 3KYCA 4BNIA 1WLYA 4FFNA 3IAHA 1N92A 3ONDA 3IKVA 4OSPA 1U5AA 4A0SA 5JYEA 2PD3A 2VZ0A 1PJ2A 2DPHA 1H5QA 4IY1A 4F6CA 2VWPA 4ZQEA 5B37A 3GEDA 2CMDA 3D3EA 2CUKA 2Q2VA 4YQYA 4GX2A 1TB4A 1SB9A 3L6DA 3MJVA 2X7HA 1I33A 1D1SA 5AYVA 4YAEA 4EYEA 4HV4A 4AJOA 1EDOA 1XKQA 1DB3A 2Q2QA 4CLXA 4NNJA 4WCFB 3RC2A 4NPCA 1F17A 3RU7A 1V6AA 3IUPA 1DFGA 1UZNA 2OORA 2IE0A 3PFWO 3WB9A 5KIAA 1Q0QA 4S3MA 1PTJA 1GEGA 4XR4A 3RKUA 1DIBA 4N5NA 1HDXA 4DPKA 2XAAA 4GSKA 5EL0A 3S2IA 3WR5A 4XQCA 4QQRA 4HX5A 4Q3CA 3VDQA 1K6XA 5K6AC 3D3WB 1TEHA 4IMRA 4ND4A 5JMPA 3NTRA 2A4KA 4LGVA 2FSVA 4WJZA 1NQ5A 4YCAA 4CM3A 3VVCA 4RQUA 2OBNA 5DNAA 1R4NB 2PGJA 3EY4A 2EF1A 1ADBA 3FTNA 1NAIA 3WSVA 5IN5A 1YBMA 1N1EA 1Y6JA 4G65A 3COSA 1BW9A 4NBWA 1O95A 3AY7A 2HMUA 2H1SA 4CMHA 3ZNPA 3ANMA 3GFBA 3ZV3A 4B4OA 4EJMA 2G5CA 4PLYA 3FN4A 1XU9A 4I5FA 4L4RA 4B7CA 3UICA 4M1QA 2WYVA 2NVBA 5AQ1A 3DHNA 3BZUA 1PGOA 4CUKA 3OJEA 4D3FA 4QTZA 4CMIA 4NHEA 5AOVA 3VHRA 4QUKA 5C3MA 5JMWA 1V35A 2IZ0A 1EMDA 2PZKA 3JQ8A 1DJNA 2VCYA 5KVSA 3HDHA 2WMDA 3PEFA 4KUEA 4FJ0A 4IDEA 3ZWVA 1HDYA 4CLOB 2AQ8A 3LLSA 1I0ZA 4E5YA 1X0VA 1GCOA 3O4RA 4RDIA 3SVTA 1I2CA 3GT0A 5AXAA 4ZN6A 3K6JA 4CMGA 1O6ZA 3JYPA 1ZVMA 3WYBA 1H93A 3E48A 3DL2A 1C1XB 3Q6IA 1CETA 2BRUA 5ER9A 1OI7A 2HMSA 4J0FA 4N5LA 4QO7A 4WCFA 4WPGA 1BDMA 3FPCA 4YT2A 3FNHA 3BAZA 2WEKA 4JN6B 1X0XA 2DFDA 3RFXA 3MTJA 3ROMA 2DC1A 4NMHA 3GAFA 1E1KA 1N7HA 4MVJH 3GVPA 4YJGA 3KM0A 3PP8A 3L4BC 4OXKA 3DMYA 3CH6A 4YAIA 2NUAA 2WYUA 3GMDA 4MVJI 3R0IA 3C1TA 4WLFA 2X5OA 5COAA 3GF4A 3EYWA 1NXQA 2NV6A 2BMAA 4QO8A 4CODB 3H6KA 1HWYA 2GNAA 2NTNA 4ZQHA 1PR9A 1YL7A 3PQFA 1X1EA 4ZD6A 1VRWA 1MP0A 4LVUA 3X2FA 3RJ5A 1DSSG 3QV1A 4RVUA 4WGGA 2J3HA 4B4VA 1I01A 3KEQA 5JAQA 4QFDA 2NQTA 2LDXA 4BO9A 4O0LA 2EW8A 4J16A 1N1GA 3B6ZA 3GC6A 3R3JA 8ADHA 3AK4A 4FOOA 3TZHA 3B20A 2AEFA 3KSUA 2PKQO 4L76A 4ND2A 4RVSA 3PIIA 2YFHA 3QP9A 4BO8A 3GGPA 5JFOA 3M2PA 1IPFA 3L07A 4ALKA 4XGNA 1ZZEA 5KCZA 2RAFA 1P45A 3VOSA 3H9JA 1JA9A 2EW2A 3PJDA 2GD1O 3F5QA 5LDGA 3ZHYA 2NLOA 3VTZA 4YT8A 4Q3NA 1KOLA 1A27A 3HG7A 1L7EA 4AJLA 5C7IO 3ZHZA 3W4IA 1QSGA 4JQCA 4TMFA 1E7WA 1UZMA 3ZWMA 5K0ZA 3JQEA 3OQBA 3PIDA 3RUIA 4EW6A 5IDXA 2J3KA 3PJGA 1R6DA 4CLRB 4B3JA
chains in the Genus database with same CATH superfamily
2ORIA 4HMQA 4QOJA 4B2LA 2UZ1B 3NR2A 4L9AA 1NVBA 3RSGA 1T2EA 4P7BA 1REQA 1VIDA 2ZI7A 2GM5A 3OQIA 2EBHX 2CLFB 2YIJA 3K0CA 4QBIA 4A2CA 1M72A 1TRKA 3JYOA 1REQB 3R3ZA 2VUHB 5JI2E 1OC4A 3LT2A 3OTQA 4WFJA 4G6ZA 3RWMB 4DCOA 4RHUA 1TCUA 4NIMA 2A1IA 3BRWD 2FF5A 4G1VA 1T36A 1X1BA 2H2IA 1VCNA 4EF6A 4CKCA 2JH8A 3GJYA 4UC0A 3W5BA 2B5VA 5C8DA 4K6OA 5GONF 1L1RA 3SFVA 1Z0UA 3ETCA 1OPXA 2XLBA 1RHJA 4LOKA 2RHDA 1HORA 5BPHA 4MRRA 3ETEA 4FP9A 4D96A 5DH9A 3VHQA 3ZGYA 1UBNA 1H0KA 2D1RA 4AWAA 2WOJA 1QLJA 4M2LA 4M22A 1XQXA 3SLKA 4LXQA 3TOSA 2GWRA 1LPSA 1MB0A 1UBOS 4NQZA 4LYDA 4EUFA 4L02A 4F9TA 3STYA 2OGWA 2F1OA 1CYDA 3Q8XB 1V5IA 3ZDQA 1QG4A 2IEAA 1HUQA 2GZDA 4AY5A 5CDTA 2YUTA 2WDZA 3F6PA 5BWCA 2Q3EA 2NADA 1FE8A 1IB0A 3KRTA 1OX4B 3QWIA 4DDKA 2D0IA 2B30A 2KLBA 4LCJA 3TVDA 1CNMA 3BXPA 3C5EA 5DHUA 5EQTA 3UMSA 3G0HA 1ZJ4A 3U6BA 3TL3A 4YRQA 1E61A 3VBCA 4ENWA 3I9FA 1XZFA 4E2XA 5GZ3A 4MDYA 4K8RB 2ODAA 3DEFA 2C7RA 3L8DA 3C3KA 3C7TA 4LI0A 5ALKA 4ZCQA 5J4KA 4UEQA 3STWA 3H75A 1P7YA 3DBLB 3WRXC 1KIAA 4BEVA 2DUUA 4RK4A 3PNYA 3QVVA 4KV7A 1AK1A 3KZXA 4J91A 5TSDA 3ZHVA 2FXVA 4BLTA 1QZUA 3D6TB 5THKA 3CC8A 1GVNB 5T5QA 1Q44A 3AU8A 5JW6A 5A02A 2EFGA 3H9EO 4BDSA 2K87A 3U1BA 4PPYA 4PCAA 3EC1A 1J33A 1N6LA 2GEDA 4P0TA 4DCNA 4JCCA 3RI3A 2Z6UA 5JMOA 2WJ3A 3ZJUA 3EG5A 1RZ3A 2P5YA 1LSUA 1NX9A 4WBNB 1Y5LA 1U5CA 2NO0A 2VPTA 4NCBA 5E4FA 5C52B 1G8GA 4F4HA 1OV6A 4JT4A 4LZNA 4OHMA 1QS0A 1AA6A 1EXDA 3UJ3X 5EZQA 2AOUA 4HNAB 3GZTB 3I04A 3HO6A 5D86A 3RANA 3G2IA 1ISJA 1X92A 2R6HA 4RD6A 1A88A 4EUHA 4Z4GA 2GESA 4RXUA 4NFHA 4BV8A 2PIAA 1I3LA 1KDRA 1CERA 4QQFA 3MS7A 4AB1A 4M9UA 4HFMA 2ZKLA 1LSOA 2C3PA 4JC0A 4MYDA 4LMPA 4RD1A 1O08A 3OPYI 3ZVNA 3KHUA 4I1SA 1N5KA 3G5MA 3WLIA 1KMHB 3S3TA 1GYRA 3E7FA 5E4TA 3UJPA 3U6KA 3UCXA 1ECCA 1H5NA 1V9LA 1V8ZA 2FU5C 1Z8DA 3BMQA 3E70C 2AMLA 4Y0VA 4YRAA 5JY1A 1TU4A 3D7KA 3M8KA 4INAA 4Z2YA 1KZHA 3OEEA 1FF9A 3OP1A 1PDVA 4R69A 5DX1A 5JSHA 2BGUA 2ZBPA 1UBJS 1Y1SA 2DTDA 3KPYA 4GGPA 4MW1A 4QJ5A 4WACA 1MV8A 2V96A 3SJBA 3ZD9A 3OQNA 5KYXB 4H1HA 2EHDA 2QTZA 3E5RA 3SNHA 4FDVA 1Z4JA 3BK1A 3GJ8A 1P3JA 2C97A 5ITZA 4AYTA 2UZ0A 1WY7A 2I7DA 1Y3BE 4UHHA 3KXPA 4BTVA 1QMGA 4H7HA 5J4VA 1GUYA 5KYVA 3EIQA 4BVJA 2BFMA 4HVAA 5EKXA 4TRRA 3H5VA 3RUPA 1YE8A 1VBKA 2QN8A 3DD5A 3I39X 4PCUA 4C01A 1OSNA 4L72A 1B93A 4DYVA 5K99A 3F5DA 2BGGA 1KL7A 1E0SA 4GX1A 1T9GS 3GEGA 5SYMA 3I12A 1B74A 4LGYA 3GH1A 4PYRA 1K9VF 4AX8A 3ZXYA 4CFZA 1GZ6A 2AB0A 1QFMA 2QX7A 3D4LA 2PLFA 3Q6NA 4B3HA 4JKIA 2Q21A 4JX8A 1OYWA 5CTAA 3IRUA 1Q0TA 2AG1A 1FU8A 1ZCBA 3HDVA 4ZHSA 4LW8A 3T7CA 3KKNA 2EL7A 3VR3D 5CXQA 4PSDA 4XOIA 5LYYA 1GNRA 2J0EA 2IPMA 2QHXA 3KQSA 5E1BA 1FMJA 5EIHA 3FHJA 1CEQA 3AB7A 3E3NA 3LQ4A 5JCJD 4JB0A 1VM6A 1EA5A 2QM0A 1VMKA 3MG9A 3QVMA 4M0KA 5J5CA 1RIFA 4WKPA 4BLVA 5L95A 1DKUA 3EXHC 5EUBA 3WKDA 2FEKA 3OZIA 3LUJA 7GPBA 4M1YA 3DLAA 1FS4A 1GUDA 4MVJG 1P19A 4WBNA 2JLZA 4LHZA 4ETMA 4R84A 4LF6B 1YQDA 1L1EA 1VJ1A 1O94A 3W7VA 3GZ4A 4JU8A 1LC0A 2PV0A 2EQAA 2ZYTX 3HJNA 3Q85A 1XALA 1TRHA 2VS1A 1NL3A 4FZRA 1H1TA 2IYEA 1M34E 3HJRA 2D2XA 4K81B 4LA4A 5H4HA 5DBHX 4A36A 3ZWPA 4OXQA 2C9MA 1R4AA 2JLUA 1QORA 1UWKA 4I6GA 3W3ZB 4KN6A 5JS7A 4NENA 4JB2A 2ZI4A 3IUBA 1TT5A 1UPTA 4KZPA 5KX5A 5FPKA 3MUEA 2XCRB 1KO1A 3F9IA 2YJ3A 2G9NA 3ELDA 1Y48E 2VATA 1A8IA 3P8ZA 3A4MA 2E55A 2HUNA 2QR3A 3MCZA 1O94C 3AJDA 3JQCA 4I5DA 1GGEA 2A7XA 1D2EA 2WJWA 2G7MC 3AMVA 6Q21A 2Z8XA 4TMXA 1I3KA 1RVV1 3MJCA 2ZTSA 3V2GA 2GDZA 2PGIA 4LDPA 1G7TA 3VPGA 2LUOA 4RDHA 3CUWA 1KBQA 1ICEA 1C80A 1Q74A 2CNLA 2ECFA 2FX5A 2VIIA 2QMOA 3HCDA 5A0FA 1Z35A 3BWVA 5FCDA 3HR7A 5NLLA 5F76A 3IEPA 4KDCA 3B52X 2SCUB 3L0PA 2GS9A 1VL1A 1CYEA 1OLXB 3OZWA 3HUEA 4U2BA 5EYPB 4C7OA 1V16A 1VOTA 1LVUA 4NL4H 4Z9XA 1V16B 4BRWA 5C4IA 5BVHA 3D6FA 1QHFA 1J0XO 3E9CA 1KAHA 1N0IA 2HHJA 4HWTA 5F2OA 1WMFA 3QPWA 5TMPA 1ZX1A 1UPFA 5L4NA 3U4DA 1A9PA 5ELMA 3UV3A 3AP3A 2YW9A 1CUIA 1G6KA 2IYNA 3H2HA 1WB4A 1ZLXA 2WFAA 2O4UX 1KDZA 3CSSA 5MHTA 2QTWB 4WN9A 5EIEA 5DYIA 1GUBA 4M7WA 4ZDIA 3OJOA 4LXTA 1ABBA 1XEFA 4X1IA 3NT4A 4XYLA 1FUYB 5EIWA 1VB3A 4M0LA 4P82A 4JBIA 3EVEA 2B2CA 1PEAA 4EMSA 3FOBA 1UPXA 2A86A 4RKRA 1AS3A 3IT3A 1G6Q1 4NABA 1ZONA 5COQA 4BN0A 4YEDA 1TXGA 3P0JA 5JS6A 5F2NA 1PG5A 1LUAA 1RAIA 3PU6A 2R65A 1XZAA 2F3TA 3OPMA 1JEQB 4CFSA 4W5WA 2CLEB 3K1ZA 4QBFA 2WTEA 4UBNA 1MAUA 3IVGA 4FE7A 1VL5A 1VJ5A 3EISA 1PGQA 3HCNA 4ECEA 1G2IA 2GAAA 4KVZA 4DLWA 5F9HA 5L3SA 2XE8A 4O2BB 4JK3A 5HCNA 4LRYA 5J47A 2IS6A 2BFNA 2QENA 3AUYA 4NDZA 5JAPA 2BFCB 1IAVA 1VE9A 5HF9A 2ZIGA 3ZQUA 1JNYA 1M73E 5K01A 4LSWA 4PO3X 4ZT2A 3V46A 4PANA 4TTVA 3MMSA 2HIGA 3H5LA 3OETA 3EAFA 1YDHA 3TLMA 1A8PA 2PBLA 1BTOA 4D8TA 4LJ9A 5DXFA 2X0FA 2E0IA 2QX9A 1CK4A 1C8LA 1S2GA 2JFYA 4Y7CA 3H17A 2FMXA 1VCIA 2EKPA 1QH8B 4N0QA 5CYFA 3H6GA 5KU1A 1O03A 2QAIA 2C83A 4CF7A 4OUDA 1AUPA 3VVMA 1ZPDA 5HRAA 1IB6A 1Z8NA 2RHTA 3ORFA 4R1SA 3IQDB 1O8CA 4HBGA 2O2GA 3PUJA 4YRPA 2NVWA 4L0DA 5BN4B 3E03A 3G9UA 4RA6A 1KPIA 4MOWA 5CNIA 3QFFA 4Q4JB 4UEOA 2WC1A 4J76A 5GV8A 2GXQA 5JJIA 1ZRSA 4L0CA 4QJ3A 3VKHA 2ZYHA 5EJ6A 2GH1A 4DV0B 2Z58A 3RU9A 5HJ2A 7REQB 4B34A 4MVCA 4UREA 1VL6A 1H5UA 2VF4X 3CLSC 3E35A 2ZSEA 2B20A 4XQ0A 3L6RA 1WQ3A 4UHKA 4BVFA 3UBMA 2XQGA 3HK2A 2IWHA 4KLCA 3RSHA 4X6UA 5ANRB 1KJNA 1UXOA 2GILA 5HF8A 1A95A 2NPIA 3ZQ4A 3A2NA 1COWD 1JLRA 2HB6A 3EXIB 3GFRA 3MFYA 4C4OA 2OHGA 3SU8A 5CCEA 5KSOA 2PUDA 4UHDA 5CJJA 4MTCA 4OLAA 5HYVA 3SEAA 3SFZA 1M2FA 1PZXA 1ZN9A 3HKDB 1MJGM 1JFFB 5I9IA 1OFUA 4AJIA 2PA0A 2ZQ5A 1IJEA 3RS9A 2G71A 2JGKA 3TDKA 2PJRA 1W73A 3ELWA 2AQHA 2R8XA 2GHQA 3I3SR 3TL2A 1OH7A 3R9WA 1K4YA 1GPAA 2ZRFA 1SPXA 5DYYA 3SF8B 2AI1A 3CZAA 3O4JA 4Q03A 1Q84A 2Q3JA 1J22A 2FE4A 3L6BA 1E2GA 1STOA 1OB5A 1OJ7A 3ND5A 2H5JA 1L5QA 2QM7A 2R6R1 3F78A 3OF5A 4GRAA 4TYPA 3K70D 3VYTB 4EPWA 4M99A 5GJVC 4ZI7B 2G5GX 4FDLA 1KAEA 1TVKA 1PK9A 1XCBA 3ZWYA 4DCUA 1DWPA 3I9OA 4DTIA 4I9NA 2ZBVA 2OZLA 1W5FA 1XQYA 1CXZA 4D4KA 1QGOA 3FDZA 2HPVA 4NU6A 2NP7A 3UWOA 3D31A 1SGWA 1YS6A 4YMSA 1H2HA 5J43A 1II8A 4I4IA 1N2JA 1E3EA 1ESNA 1NBHA 3UCFA 5K0BA 3EJ6A 3F4BA 3H2BA 3I1JA 1TM1E 1QHNA 2BKVA 4QE3A 3LCVB 1RJEA 4M21A 4R2LA 2OP1A 1SUEA 1K6EA 1E0JA 3A4IA 4TXJA 1R9MA 4AZTA 4WNAA 2V7EA 4BB6A 1GPLA 4C6HA 3DHVA 2IX9A 1BHO1 4UHBA 1HTBA 2BR5A 1WZCA 1C4XA 4JLNA 4F6LA 3WB0A 4W1QA 3P32A 4LJ4A 3WK8A 3I0NA 5FL3A 1G21B 1GXSB 4AQDA 5KYUB 1YJAA 2PK3A 4DGSA 1JT2A 5AVKA 4F2DA 2SKEA 3JQ7B 1Z88A 4ZVLA 2BONA 1QHSA 3QVKA 3I83A 3JQ7A 1NVTA 2AYYA 4MUJA 3ZH9B 1Y4ZA 3NCTA 3O9ZA 3PHGA 1N5RA 2WMOB 1SC9A 1PU2A 2P9GA 4RMHA 1S9HA 4RS3A 4X8OA 4PLPA 5G0TA 3RVJA 2X6RA 1Z5PA 3ZD8A 2ZIXA 2WTXA 4RSHA 3H83A 3KQHA 1AF7A 5HKLA 2CD9A 1FRNA 3L8FA 3K0HA 2WKPA 3F6YA 4NS1A 5BPFA 1NJSA 1SG6A 3WLNA 2WHPA 1LK5A 3DV0A 5KI6A 3KQKA 2D2VA 4TZ6A 2FN9A 2Q5HA 2QGFA 2DB3A 1VGRA 2HV8A 1R9GA 3MOIA 5KU7A 1ZD3A 3GLSA 2V7TA 1E2NA 3ILYA 3OX3A 2B9VA 2M6LA 3R6LA 1U04A 4IHKA 1P60A 3CGWA 4DEXA 4OGWA 3PNQA 2QVBA 1CDDA 3IR5A 2Q1TA 3FSGA 3JATA 3PGMA 5IFKA 1QTIA 5DTMA 1LQTA 2A6PA 4GPD1 2H92A 3DF9A 1ID8A 3D1VA 2PRIA 3I9KA 3OTIA 4P4GA 5EN4A 2OLJA 2AUMA 4LYFA 2LR0A 1J8VA 4NYIQ 1XCMA 2E82A 3EVNA 3JZAA 3V4ZA 2EFCB 3AH8A 1EP9A 2QYOA 2XB9A 5FA8A 1NF3A 3ABZA 1G5IA 1P1RA 3A6FA 5TT1A 1V25A 4RBNA 2QJFA 2VHCA 4PFKA 2C5HA 2V98A 3BZWA 3AONB 4DSUA 2FEMA 3O8BA 3ISTA 1K8ZB 1GA6A 2VP9A 1UJNA 4M86A 3G8DA 4AJPA 2BGWA 4EY5A 4W9RA 2R47A 4URFA 5AJZA 3IKLA 4MVJA 2I03A 2NTJA 4FK8A 4MMZB 4DDVA 1BN7A 3HBAA 4BLPA 5LFAA 4XM2A 1J00A 2O2HA 3JQGA 4F4CA 5IH3A 1ICIA 1YR8A 4CQMD 3SHVA 3QK7A 1ZCFA 3S81A 2RGRA 2Z1MA 3KB6A 2HM7A 3S40A 1FCJA 1MEOA 1T2UA 3DXYA 4HNGA 4MA4A 3OEHD 4WESA 2RG1A 2G76A 2YS6A 4EYOA 4NCJA 3ROXA 2W2PA 1QRTA 1ARZA 2ZXEA 4QDKA 1Y4UA 1BVHA 2COUA 2Y9MB 2PE5A 2B6NA 4YROA 2O3UA 4B5LA 3A0RB 3N8HA 4GPTA 3WDKA 4KHPB 1R0WA 1Z56C 2HPAA 2IS4A 4OV6B 4GBMA 4G5QA 2HYDA 3BD8A 4KIJA 3OIWA 4Q15A 1BNCA 3C14C 4DNQA 5JDIC 3N2ZB 1RYHA 1R66A 4ALIA 1NFFA 3EFHA 1SULA 1H3NA 3F96A 3LBHA 3V7UA 4FOSA 5JZSA 4O4JF 3RE1A 4F72A 3E7WA 1Z6XA 3W2GA 1KI6B 1NW9B 1ZVKA 1CUJA 4QKQA 2H1CA 3P7MA 5CLLA 3PXUA 4LQCA 1N2OA 3D43A 5JCJA 5ICSA 1E64A 3NQ41 3NXSA 1HE1C 4BAZA 4DC0A 2I7VA 1XXHB 4G25A 4KE7A 4EB0A 1XTZA 3D7RA 1BJKA 3GVIA 4MICA 3THOA 2BKUA 1RI5A 3Q8LA 3T1QA 4KO8A 3AEQA 1E1MA 4O8CA 3RJMA 1PVDA 2HMAA 4FMCB 2IL1A 1N0UA 3NWJA 1CIPA 4LBWA 3A3KA 2OBMA 5KTYA 2JLRA 4QDOA 3G7NA 3C3CA 4MIOA 1NOIA 2CVQA 2QAGA 5IAJA 3EUWA 4HMOA 3QBDA 5JBQA 5DT9A 3G0DA 1J20A 1X13A 5A3VA 2ZAGA 3VH2A 1QB7A 2XTMA 5F1PA 1N2EA 1T2DA 2JLCA 5LC1A 2J9RA 4Z9YA 4DR6B 2C92A 2IHBA 5TQ2B 1D8TA 1IUNA 3QTBA 1ZG3A 2GCNA 4OKNA 3HA5A 3LKDA 3QBEA 4YMGA 3DE6X 1Y5IA 3ZZNA 1A9ZA 1GPKA 1DJMA 4Z5XA 2C9OA 2HA4A 4D81A 1LTQA 2CWDA 1GV1A 3BTUA 2FW9A 1JFFA 1XRPA 1A4UA 3P26A 1KA9H 5B1DA 1H1LB 1WSWA 5F52A 3WMWA 2JHFA 1WTAA 3CX8A 3VOTA 3EPRA 1C3OB 2PRKA 1KC3A 2F7SA 4KE8A 3NBAA 5IARA 4ZVSA 3OOHA 1ISMA 1M2VB 1H66A 3BMCB 3HI4A 5ALNA 1I36A 2Q6KA 5CT4A 5G1NA 4GMGA 4Q19A 4C4YA 5BYAA 4MS4B 5JVDF 2WB4A 1WX1A 3AF5A 1DAEA 4R98A 5D2CA 1Y4DE 3TRIA 3ZDXB 1ADCA 1CLUA 1L8QA 1T6BY 2E7ZA 2XVXA 3BCHA 3GLKA 1KF0A 3GLUA 3CMCO 3O0DA 1ADGA 5JAHA 4FXOA 3WQQA 3GBSA 4F1WA 1X1QA 3S8EA 4X24A 4MWCA 2WT9A 2XZTA 1JAYA 5I6DA 3GGGA 4M9RA 4ZKEA 1D7OA 2OE2A 3LOQA 4AYWA 4EB6B 3NNSA 3F3KA 1GTZA 2NO9A 4RD2A 5T3UA 3I2HA 2QRHA 1ZUHA 4EY4A 5GPBA 4F3CA 1Y6FA 1F7UA 2VI5A 1SRQA 4XDGA 4C78A 3T4XA 1AKMA 4F1JA 2UXCB 2Q45A 4M60A 4YP7A 4URHA 4J0HA 2VJOA 3IIMA 1YNOA 3LQYA 5ALWA 4WXEA 1AN0A 3UJ6A 5BSHA 4BX0A 2C5AA 2D8MA 3MD0A 2W5UA 1NC3A 1KO7A 2I66A 5D1NA 3ZYCA 4FB4A 3LBAA 1RPZA 4IOJA 2O0MA 4V2IA 1A7KA 1W8IA 3HVRA 1VPVA 3DZGA 1DEKA 2J0UB 3NC0C 5IDYA 2PM8A 3U56A 2VNKA 3V1NA 1QRDA 5IAAA 3NNDA 4ESOA 3AF6A 1EA7A 3R3SA 3AY0A 4TZTA 1EGHA 4X8HA 4D4GA 2XODA 3A8TA 4G0QA 1E2UA 4LZJA 2IKQA 4GPAA 3PUWA 2NO7A 4J75A 3E9QA 5I9MA 2C95A 1FL9A 1KH3A 1Q7CA 1EX1A 5AHOA 3RS4A 1E7RA 2OM2A 4S0XA 1GHTA 4GI1A 3IAS1 2J5KA 4ZEOA 4XWWA 1FLDA 1JE0A 1F06A 2TSYB 4L8GA 4R4JA 3ROZA 3ZN2A 1YRLA 1ZD1A 1U2ZA 5TVKA 5LR6A 2CFSA 2CUZA 3EG9B 3NWPA 1YQEA 4M0CA 4MEBA 4RIEA 1I5OA 4YJ2A 5EIXA 1NR7A 2PKXA 4KGDA 4N8EA 5IU6A 3OSZA 5CFRA 3K72B 3ESDA 2ANBA 3QHAA 3K35A 4JLDA 1DC8A 3UMFA 3MVEA 5LB2A 1L4HA 1TA0A 3DE3X 3KKOA 4JA0A 1JLLB 5LPNA 1QG2A 1ZRHA 5CH8A 1EWQA 5ALEA 5KUTA 5LNK1 2ZSKA 3OCJA 3USCS 1ZMOA 3OZRA 3MN1A 2BHTA 1JG4A 3OFNA 4GR4A 4IUYA 3U9LA 5ES4B 2OV3A 2W2VA 4FHFA 4LPSA 4UCWA 1HMPA 4E0BA 1M10A 3FUXA 5EXPA 1T0PA 3T1NA 1U0JA 2PMKA 4D9GA 4QBGB 2GPTA 2YVUA 2OK7A 1RQPA 2R6CA 2AUNA 4J2TA 1KJ8A 4HX9A 1WETA 2B69A 1HYQA 3OX2A 4BCCA 3HVUA 4Z2AA 3U80A 3AEYA 1KYYA 1EBFA 3KBBA 1DBVO 2GSDA 4DMFA 2R85A 4B40A 2NVOA 5AFSA 3A2MA 4XQ9A 2Z2KA 1BH6A 2HADA 2OBXA 3MIIA 3EWNA 2GEVA 2P9HA 3BIJA 3BRSA 4OOFA 1W0CA 5B57C 3QA3E 1P7WA 1TMYA 4G41A 2RGDA 2PX5A 3G2LA 5CUQA 3RARA 4TUYF 1MRZA 2JBHA 2A9KA 2RGNA 1DE0A 3ETHA 3SHQA 3RK1A 3TZ6A 2VAVA 3F6BX 4LK2A 3RVQA 1HLFA 3RK4A 1DLJA 4HL6A 2REXB 3AX6A 4IG4A 1QAOA 3QELB 3ZX5A 3QX3A 1PIWA 1YB4A 1YUBA 3TBHA 1YVEI 2I3GA 1N2ZA 4CF5A 1QFXA 3DKKA 4I3GA 2FPGA 4Q9AA 3SXUA 3I5XA 4H0CA 1FNDA 1HMYA 1J0EA 1OLSA 3LWNA 3QKSB 4P9NA 4FGSA 3A1EA 5ITVA 4MV1A 4R1NA 3UJ8A 4AK9A 1WCYA 2QPOA 4TX1A 4BAUA 3EZ7A 2RC5A 2FW6A 5BQOA 5ALZA 3IHKA 3OICA 1PR4A 1P2DA 1OXVA 2C57A 5AM0A 4DCCA 3LGSA 4OQZA 2HIMA 1O97C 2XUFA 4HH1A 2O2SA 4M0FA 4S0ZA 1WMBA 5JS2A 5I48A 4RJIA 2JAOA 3LOUA 2X3FA 1BJRE 4U5XA 4QTYA 4L5IA 1NQOA 3GCGA 4FX5A 3HR8A 3L1JA 4JT2A 5G4KB 1QF7A 2IZ7A 1GLNA 2Z57A 4BL5A 4YCMA 1WXEA 1PT7A 3I9JA 3UKOA 2ZZKA 2IOFK 1GTSA 5DWQA 4ZK6A 4KMRA 1O9GA 1MGPA 1Z4OA 2OLEA 1TCVA 5DK6A 1YU6A 3JWJA 1DXYA 1KHTA 3ML1A 1ECGA 3TB4A 5I7OA 4W63A 1DCTA 2P78A 3SZRA 4WH0A 3EIUA 1FQWA 2WJZB 4WESB 2C31A 4CU2A 5SZHB 4DCJA 1NP6A 1QH0A 2Y0EA 1N9GB 2GCOA 4HEA1 5JDCA 1P2TA 2GT1A 2GZ1A 4V0KA 4QT4A 1VE5A 4YVFA 4ED9A 1Z63A 2FTKE 3JALA 4MKZA 2H2HA 4RIGA 4OXYA 3SP1A 3BGSA 1GQQA 1CD5A 4MYTA 1R6AA 4QOFA 4XFKA 1P77A 3G9XA 1AIPA 4YHBA 1TAGA 1C1XA 1FZQA 2FUEA 3PB3A 3PZRA 2AG8A 4YUAA 1GTRA 2IS2A 2X6QA 3TCXB 2V6JA 5TV2A 3UB2A 3VZPA 1I2ZA 4D02A 1BX0A 1DBPA 5FR1A 3OA2A 3QSGA 2O8VA 3I6ZA 3RBAA 3IB6A 2LXNA 5B2FA 3R0ZA 2I3ZA 1FK8A 2OOSA 3RJZA 4QJIA 3W9BA 5BMOA 5TPZD 4MWGA 4DRXB 3TUZC 3IOYA 2OV2A 3JQAD 4MYSA 2G8NA 3B1XA 3N74A 4DMHA 3KPUA 3DZHA 5CDSA 3IJ5A 1WL8A 2WTUA 4IR7A 3AVUA 4AMVA 3MYRA 2JJ1A 1IM5A 4Y2TA 1IK6A 1H2RS 3KE8A 3NATA 4M1WA 4L85A 5CCDA 3UKDA 1H23A 5BWOA 2D2EA 4P22A 4YV2A 3A36A 3LXMA 1GNVA 4X6YA 4OJQA 5I7HA 1PJTA 2P77A 4XVHA 4YRLA 4FMPA 1SEPA 3TX2A 5F7XA 2Z5LA 1IPEA 1RMYA 5FTNA 5DTRA 3AO0B 3NEYA 3T94A 3KXIA 4UD6A 1XZGA 1PZGA 1FX1A 1M34A 1TQ6A 1XD8A 1HKHA 1Z5UA 2ZE8A 3IUQA 4IDNA 5H70A 3WRXA 3RK0A 3QPUA 4FGKA 1UWLA 3CWCA 5E6UB 4TKLA 2QR5A 1VE3A 1FUIA 3EXAA 1FYWA 1P44A 3D3WA 2VH2A 5E6UA 1P5FA 1WDMA 3LAWA 4RHFA 1Z4QA 1JILA 3DE0X 4OHPA 4WMLA 1ZM2A 2QZ9A 3I09A 3P97A 5F12A 2CNDA 4GPZA 2BFEB 2PS0A 4F3YA 1SRRA 3TLXA 4X1IB 1K98A 2ISCA 4HAVA 4R01A 3NASA 1F48A 4X54A 1Z7WA 2ZULA 4KI7A 4P53A 3NDJA 4E08A 2VUUA 3JQAB 2LE0A 4JZKA 3URKA 4V1CB 5EJ4A 3NJRA 2Y99A 3T7IA 4PZCA 2HGSA 1ZVVA 3CLHA 5FUMA 3D6MA 1TYAE 4Z1MA 4BASA 3AUKA 4DUYB 4ZODA 3H4IA 2UYCA 1JG1A 5ECDA 3WNDA 5KBYA 3LDGA 2RG7A 1N6HA 1JR4A 2PG3A 2VRCA 4PYIA 3TDMA 5EHNA 4AP9A 1CUUA 4FCCA 1JU9A 1K7YA 1YJ8A 2LDBA 4FYWA 4ETIA 1PL8A 1I4TD 1COZA 1N7JA 5A7HA 2CSUA 3OSUA 2CV1A 4CEIB 2Y1KA 3KVNA 4YJDA 4Q01A 3FUVA 5JE8A 3Q2IA 4KLNA 3E3OA 1PZFA 1Z4NA 3LCMA 3T3GA 4EQZA 2Z8YA 2ADMA 2VJMB 2WJAA 1OD6A 4R9SA 5CA0A 4ZHQB 4JD5A 1ZM4A 5KJ6A 2IBMA 1QIIA 3OFJA 4U6QA 5TRTA 4M8KA 4D8UA 2Q3DA 2VJMA 5IASA 1DG1G 5M29A 4QYIA 5KVVA 4B44A 4JYPA 5I8ZA 1EUYA 4I1VA 4J7UA 4MCHA 3AR8A 2IJGX 3S2SA 2XKBA 3ZQ6A 4PICA 3OLWA 1DTWB 1I7QB 3HHEA 4GM1A 2BWJA 4WDRA 4XDYA 2FP3A 1KYQA 5HPYB 4HGQA 1FX0A 1QX3A 4LTDA 3OMLA 2JGFA 1S0UA 1ZDMA 3IP7A 3G0OA 4DIEA 2QTTA 3H0CA 1R12A 1RWVA 4EAAA 3PXEA 3AR4A 4GL4A 3BE5A 5LMNB 3E8MA 3KUKA 2JFOA 3BCUA 5EZYB 5LVAA 3HEMA 1T3GA 4PAGA 2W70A 3UANA 4PGGA 1MB2A 3BXXA 3R7AA 1V5GA 2D8AA 4FS8A 3HO1A 4ZJZA 1YOBA 2DFKB 3RFFA 3L7BA 4TKUB 1VBMA 4G0XA 4GI7A 2OBFA 5TVGA 4CM1A 3ILVA 1VJTA 4LZZA 4PZZA 4AD8A 1OY1A 5DDIP 2A5LA 4R8MA 1XGKA 1E98A 2BKLA 4K1LA 1WF3A 4LJYA 5FLYA 3TI9A 3B3JA 1NZJA 3WL5A 4B6SA 1YVDA 4LKRA 2VK4A 3ZK8A 1BDBA 1QJCA 2DHEA 3LG2A 3NAMA 5GADl 2ZROA 3O82A 2RAPA 1NU6A 3E53A 4UTZA 2WFLA 5JYBA 3JYNA 4KR6A 4G0PA 4A03A 4LNUB 3GCXA 4TXNA 1N2BA 1N2GA 1T4BA 2DHDA 3EPJA 1PCXA 1KQOA 4KTTE 3QFCA 1FP7A 4TMVA 2WIJA 1YULA 3JQFC 2Y2VA 3U62A 3CR7A 3FCXA 1U94A 4Q4JA 2O8FA 3ZIUA 4N12A 3TQIA 2XMDA 2YCLA 3M1IA 4XW2A 1J5XA 4A8PA 2AX4A 4D74A 1MXFA 1UDAA 2RHCA 2XI4A 2Y3IA 3IX7A 3QKSA 1I1QB 4F12A 5COBA 3DHYA 2M1ZA 4DJFC 3FMPB 3MTGA 1T9AA 3VR6A 4BZZA 2JGNA 3VYVA 1FXWF 1BKYA 3F0TA 3GVXA 4IMPA 1ZXXA 3V00A 2VDRB 2FVYA 2AJCA 1KK3A 4NR0A 4XH9B 5AHWA 5DM1A 3EZ6A 3DAPA 1DBIA 3WGTA 2KLHA 2V7PA 3FLAA 4WLEA 2ZI5A 3U4QA 5EP3A 1DMRA 1IQPA 3CLVA 5DBEX 3V4PB 3WYGA 2BR4A 2GD0A 2YHIA 1YQ9A 4FJ2A 3RVLA 4EFKA 5JLJA 2QT9A 2RONA 4IQFA 4RGQA 2E18A 2G67A 4Q9IA 4EQ6A 3F67A 3WADA 1PSZA 1ACLA 5IDQA 2IP1A 5LOVB 3WZ2A 3UOWA 1W85B 1XCGB 5AKXA 2GPSA 4TV8B 2JLYA 3DDWA 3WK7A 4IDQA 4YAKA 2X8BA 2YNMD 4P7GA 4UMFA 5FYQA 4F4DA 1SHTX 3PE6A 1HETA 1U7HA 3EUFA 1R0RE 1RQXA 3FUWA 4JQYA 1YFKA 4LS3A 2NU6B 1RKXA 1KTVA 5B12A 2X3UA 1IFXA 2A1UB 4CM4B 1HR0B 4S1OA 5HR5A 4QGAA 2ADFA 3E22B 1G7RA 3EXEB 1GYPA 3V8BA 3IP5A 3ZBUA 5D00A 3B5IA 4ATNA 4RPIA 1WPXA 4GMXA 1EQAA 3ETNA 4PXSA 4UUBA 5TGDA 4G26A 3K3PA 2OO5A 5KYWA 4JU9A 1BE1A 4L9WA 4D42A 1JIKA 3W79A 5LM3A 3LZDA 3WICA 1YZYA 3GG2A 5HDQA 4G84A 4OQPA 3WE7A 3P9QA 1C7FA 1OE0A 3MJDA 3P9SA 4RLHA 3PL5A 3VO8A 4ERXA 2V7QD 7YASA 1DRVA 2IXEA 5D6OA 2P30A 4BMCA 2XITA 5HE9A 3B1FA 3H3XA 4WJLA 2OZVA 1HQCA 4OK3A 2AMVA 3G6KA 1NQAO 2PVPA 3ASYA 4EKNB 1IZ8A 1QYIA 4R5HA 5ALGA 3U7RA 1SUDA 3WXBA 1JIUA 5FAKA 2YMQA 2C4MA 4H0FA 3I8OA 4IINA 4WINA 2ZTMA 1N6KA 3VPXA 1W93A 2YJGA 2DRIA 4EX6A 2HJWA 2XB8A 1JLSA 2ZDQA 3PC3A 4IUCS 4KHZA 3VC3A 5KVCA 2I1VB 3ZW7A 4EENA 1V95A 2B4TO 1AKNA 1JIJA 2IHJA 2ID4A 1U2PA 2RFLA 4J94A 3DDUA 2FPOA 2PKQP 2QW0X 3CZMA 3UJAA 5KQRA 2JD1A 1WMAA 5SY6A 3T9CA 2VH5R 3DGFC 3ZDZB 4Z4CA 5B1EA 4DY6A 2CUNA 1YGYA 2QX8A 4LMAA 3GRCA 4B43A 4BRZA 4PYOA 1TFUA 2PZJA 3LWDA 2O8FB 4H7PA 1V43A 4GYWA 4X3CA 2X4DA 4B80A 3Q12A 3FCCA 5AI0A 5DHTA 2PT9A 3DQPA 4ZVKA 3EEIA 4MLDA 1Y0BA 2FZKA 5DT2A 3W6PA 3DPUA 4F8EA 5GIOE 2XSZA 4MMXB 1J23A 5DN6A 3R7BA 3C3AA 5JATA 2I6QA 4N39A 4YUYA 3F73A 5CDHA 2XX3A 3CH7A 2V97A 2O7RA 4E13A 1NJGA 3TLYA 1AV7A 5DM60 2FWIA 4LDAA 1JUDA 1FB5A 2BEJA 5ALRA 4KH0A 2BEVB 1B8OA 1S02A 1VYTA 4DMCA 2JAUA 5H02A 3F2IA 3W0LB 5I9BA 5KTPA 3QFTA 1O4WA 3FGOA 4XEHA 5KPDA 4PONA 1RPNA 4U1RA 3NONA 3DAOA 3B5JA 3GFVA 5K3DA 1YZFA 2FZGA 3L7KA 1RCFA 1M1ZA 2O20A 3KELA 2DOKA 4J0QA 5HSGA 1V5WA 1O77A 3PDWA 4YPFA 2EC5A 1T2VA 3GRZA 2VF8A 1NVXQ 3CUVA 5E0KB 1BMQA 4YP9A 2HBQA 1E60A 5BOVA 5E9JA 2VT7A 4JYAB 3GMSA 1Z4KA 2IYLD 1QZ3A 4X91A 4JT8A 5L4SA 1P9OA 1ZH6A 3F3MA 3HU1A 3I4FA 3BTOA 5AKYA 4B6RA 1MAVA 2ZEJA 3Q7EA 1L5LA 3C8MA 3LNTA 5D84A 1SCUA 4E7PA 4N76A 3Q2KA 4QUJA 5JASA 4EJFA 1NBWB 3HTXA 3AI3A 1TIKA 3ZYZA 2DPMA 4HNUA 5J3JA 2I8LA 4BMNA 4HH4A 2XUPA 1XYGA 3C5VA 4B73A 1FP4A 3L8EA 4JLVA 1O6GA 3ANXA 3TIIA 5BV8A 1V9CA 3WYCA 2D62A 1I1NA 1UFQA 1APBA 5DFAA 2H1OA 2MT9A 2PUGA 5DM2A 2D5BA 3G1WA 3KOXA 1V8BA 4H1TA 2N3ZA 3KVVA 3OPNA 4JLPA 2OPHA 2VQEB 4XE5A 1G1AA 3TE6A 4BO3A 3BCRA 2FR1A 4HDMB 4CCYB 5LU9A 5LZ4A 1BRMA 2VQDA 3KKLA 3VPDA 4J9UE 3TG2A 2YYSA 3ZCVA 5GIPE 3OTHA 4UASA 4OJMX 4B45A 2NZ2A 1MEEA 4OP1A 5EPUA 2G63A 3WQRA 4MMYB 5EE9A 4LQLA 4MDEA 1GL9B 4JXXA 3BWBA 3TNJA 1OWNA 3TBFA 4TLBA 4JXKA 2BUAA 1XQWA 1AUXA 4J4TA 1NMEA 1LLFA 1NN5A 4N7MA 2N42A 4YP5A 1IOZA 4CKCB 3IVMA 2Q3CA 1DS6A 1UAGA 3AL2A 2A9JA 5EE5B 5IN4A 2X77A 3W5DA 2CXPA 3N8KA 4ND3A 4ANFA 5C8YF 4RTPA 1VG0B 3PV0A 4OI0A 1QE5A 3PJFA 1J1IA 4GP9A 1PHPA 5DSZA 4RZUA 3N2EA 1FVHA 2NYVA 3GW8A 2AE1A 1M2OB 1Q20A 2YY5A 3BG5A 4H2DA 3RRXA 2Q3FA 1AH2A 4WRRA 9ABPA 1SY7A 3K31A 2GZ3A 3AERB 4NYMR 2BN4A 2Z4SA 3BX1A 3N0RA 4IIUA 3UXHA 2VUTA 5BV0A 5AVUA 1A50B 2C0PA 3II6X 2J7KA 4XVUA 5MFPA 3KYJB 2WAAA 3N39C 4M1MA 4G86A 1KAQA 2IV3A 1PWXA 4YASA 1FMTA 3FXAA 3RF6A 1NE7A 5SY9A 2P69A 3IQEA 5CAEB 3A14A 4FM9A 1VPWA 2DJIA 1HOTA 2NU7A 4QXMA 4W5JA 1XTVA 1PBNA 1WNTA 5EFOA 2XZLA 2CUTA 1KK0A 2KBEA 1RM0A 5F2EA 3OQ1A 3BF8A 4LWQA 1AE1A 4R16A 1Y1LA 3O4IA 1HT0A 3WLAA 4B9AA 3VH1A 1JS1X 3VDRA 1H65A 2VWQA 1W29A 1P5JA 2BGJA 3EZ9A 1R16A 3WGOA 2VLBA 2QRUA 1WDLA 2XHZA 3C16C 3LQQA 3Q87B 1YK0A 2J9FB 4G4JA 4LBYA 4DF3A 1G5TA 1LF0A 4PINA 5D51S 2HLNA 1WJGA 3OM1A 4UAJA 2QY6A 2CEAA 5HZMA 1BYIA 4X20B 3ABSB 1PJCA 5I7EA 1FFYA 4R2JA 4UU0A 3IA2A 4M98A 2P9ZA 1RS0A 4CM7A 4MLCA 3HRKA 1NVWQ 4EHBA 3W8EA 3OOWA 1WB9A 1JHOA 1P4SA 1UODA 2H65A 1M2VA 3BMCA 3GN1A 4PTYA 4B3IA 3R20A 1Y6GA 2B0CA 3TEJA 3U13A 2G83A 4P92A 2X8JA 3K0SA 1GRRA 3P9IA 1P7VA 4TL8A 4RZHA 5ADWA 4HAUA 1IN8A 4IDGA 1YVPA 4OM8A 2LNDA 3B1ZA 4IH1A 1SVOA 4N8SA 1BOFA 5FLEX 5AVSA 2RIRA 3GGOA 4LK3A 3V9AA 3CVUA 2HA5A 2AA3A 4ARVA 1EDBA 4CTJA 4E3WA 3CKMA 4FYMA 3SF0A 3KJFA 1N34B 3MNFA 1VIVA 3A6LA 4HPWA 4R8RA 3SJUA 4R1QA 4F2WA 1R0YA 4ZYZA 1VPTA 4D92A 2JGLA 3TSZA 2BTEA 5DRYA 5DSTA 2WLTA 4Z9BA 3DO8A 1I51A 5CFMA 4E5SA 2H1LA 2G77B 5DOVA 4C7BA 4M9XA 1KY5A 4CWAA 1YO6A 3LUBA 3H1PA 4ND8A 5AUOB 2FPKA 2A9VA 4A0RA 4CTOA 2FG7C 1SQSA 2VHVA 1CF4A 2O3QA 2FF7A 1KEWA 3CISA 5CDFA 4ZJUA 2EDAA 1RI1A 2HU7A 1UXKA 5C1PA 4PTZA 4B32A 4YLEA 1OX5A 1Y8QB 3LFHA 3MRSA 5CH5A 2PLWA 4M55A 2O1XA 3HYTA 1UMCA 3SF8A 4BNKA 1VTKA 3QKWA 3UW1A 1PEYA 4HQ0A 1R8YA 1C0EA 4N1AA