1B2LA

Alcohol dehydrogenase from drosophila lebanonensis: ternary complex with nad-cyclohexanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCOHOL DEHYDROGENASE
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 98
structure length 254
sequence length 254
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b2lA00
2DBVO 4TZTA 2OBNA 4FOOA 3EW7A 4CMBA 2PZMA 1Y8QA 1U3TA 4OKNA 3IAHA 2Z5LA 1A7KA 3WJAA 4OQZA 3PXXA 4PLYA 1U3VA 5IZ4A 4P4LA 1V3UA 3I9LA 2AE2A 4B3HA 2DQ4A 5JAIA 3HN7A 5IDYA 2V6FA 3G79A 4MP3A 3T7EA 3PHHA 1LNQA 2DFDA 4CLRB 1HYGA 4JJGA 4BNIA 1EE2A 1ZMOA 2GLXA 4LSWA 4Q3EA 4E13A 3W8FA 1BXGA 4GLOA 3TFOA 2B37A 1BTOA 4UUMA 4CMJA 5JAZA 1NXQA 4FS3A 4WLVA 3CH6A 5KJ6A 2ZTMA 1EMDA 4XYEA 4OM8A 1C3VA 3GHYA 3UCEA 4PG4A 5AXDA 2IXAA 1EFKA 2NACA 3WIDA 4CQLA 1JU9A 2PD3A 2XXJA 2A92A 3PYMA 1QXSA 1PZGA 1IL0A 1ZJZA 2R6JA 1ZSYA 1B8UA 2AEFA 2CUKA 3RJ9A 2GDZA 5KNLA 5DBFA 3DOCA 5ADHA 3F3SA 3LLSA 4DQUA 2P2SA 1E3IA 2QW8A 3DR3A 4G81A 3TWOA 1UZNA 3L77A 2VTDA 5BSFA 4RF2A 4BO0A 1J0XO 3V1YA 5ILOA 3GEDA 4UVEA 2A4KA 5CDSA 4P38A 4A0SA 3UGKA 4DLAA 2EW8A 3DHYA 4FCCA 4J90A 1UDCA 1PL6A 1MLDA 1ENZA 4ZA2A 2ZTVA 3WR5A 4TKLA 2HMTA 3JQFC 3L0DA 5THQA 3FR7A 2IZ0A 1Y6JA 2BGLA 3FSRA 2FRDA 5F21A 5LCXA 2DPGA 4IDGA 3RJ5A 1P31A 1TVEA 4BNXA 1ONNA 4U0KA 3U0BA 4BQPA 1YL6A 3RC7A 3AM3A 5ICMA 4F6CA 1P1HA 2FP4A 3IL2A 3DTYA 5F1KA 2DTXA 1WNTA 4D3SA 2RHRA 4MKXA 4TRRA 1B15A 1SZJG 4AJKA 2JCYA 1XDWA 1GQ2A 5ENVA 3MWDB 4BUCA 4KUHA 2HLPA 1JW9B 4L9RA 4XR9A 4E21A 2B5VA 2Q49A 5I9MA 3ZWCA 3D5QA 2HAEA 3HADA 2EW2A 3I52A 4H7PA 4U6QA 3V1TC 3ZU5A 1PWXA 4Q3CA 1QYXA 3TRIA 4B79A 2PZLA 4MKZA 4E12A 3BMOB 3RU9A 1QRRA 2IXBA 4QEDA 2ZTUA 1N2SA 3TZ6A 3JD0A 5ES3A 2O2SA 1XKQA 4UVDA 4YJHA 1ARZA 5AXAA 2Q50A 3EZYA 6LDHA 1BDMA 4XYMA 4CQMD 2YJZA 2B4TO 3C85A 2OORA 3VC7A 1E3WB 4RVDA 4NIMA 2PD6A 4TZKA 3WYBA 2I67A 3GG9A 3DBRA 4GH5A 3W6ZA 4LISA 1IHYA 1FXSA 1J6UA 2B83A 4CQMA 3AUSA 1EDZA 1HKUA 3JD2A 1ZK3A 2BFOA 1IPFA 3WB9A 4J9UE 1CETA 1DJNA 5EINA 2I65A 2FPIA 1N1EA 1YVEI 4J7CA 4WCFA 4LMRA 5CP8A 3ZW8A 3A4VA 1PL7A 2WTBA 4DIFA 1AXGA 1R16A 3BMQB 4EW6A 2D4AA 1L1FA 4QTZA 1H6AA 1JWBB 3PJEA 1Q0HA 1Z6ZA 3LT4A 3I9KA 1TI7A 1FDWA 2D2IA 2QG4A 5T57A 4B4VA 1E1MA 3ICPA 1ZCJA 4PIVA 4D42A 3WJ7A 1S7CA 3UKOA 2CDCA 1E6UA 1DDOA 3UICA 2Y67A 1C0KA 2B36A 2YQ4A 1GPDG 2HJSA 2E49A 3KSUA 4XCVA 5ENDA 3WTCA 5JSFA 5KJFA 1C0PA 3K8ZA 5F5NA 3Q11A 3CKYA 2NTNA 5IDXA 3Q1LA 3K30A 1NPTO 4IQ0A 2TMDA 3DB2A 3BTUA 3S8MA 4GX1A 1GEGA 1PL8A 2P68A 1A9YA 3ETGA 4D3FA 2Y68A 3KB6A 4YJGA 2P9EA 2GO1A 2UVDA 1I3LA 1NTOA 2AMFA 1YOVB 2AW5A 4GKVA 1T1SA 1P1JA 4QSMA 4BMVA 1H6CA 1LRKA 3I23A 4ESOA 2ZQYA 3AOEC 1XR3A 3V2GA 3NTOA 5DOVA 5L40A 2G0TA 1LSUA 5BSGA 1YDWA 3W4IA 4CMCA 2B35A 3EK2A 3QVTA 1YH3A 3AI3A 2I9PA 3VVCA 3V1UA 2NTVA 5L7WA 3ANLA 4XIJA 3GG2A 1PS8A 1UP6A 3HN2A 4E2ZA 4EI2A 4NG5A 5T64A 3FNHA 4J4TA 1GZ6A 4ONEA 3BA1A 3OETA 4WLUA 1NBOA 1LRLA 1H5QA 2D8AA 4IIUA 1JAXA 3H8VA 3PQFA 2PH3A 2V6GA 1I2ZA 2J5KA 1K6JA 3GA0A 4CM8A 3H65A 1DFHA 2PKQP 3TZCA 1BVUA 3VPHA 3AUAA 3VTFA 2ZIZA 4ALKA 4S3MA 1N9GA 3C8MA 1M67A 3DOOA 1UZMA 5I8WA 2ILTA 2PWZA 4MVJF 4ALMA 2GCGA 4CLHA 1ZUD1 5FF9A 1D7OA 3I6QA 4HFRA 4Z9FA 1O94A 3BIOA 3FPCA 1M6WA 4MVJE 1YXMA 4ZD6A 3VZPA 4E6PA 1PJ2A 4YB8A 1H2BA 2TMGA 2J3KA 1VI2A 4ZQFA 1HWYA 1PQPA 3KYDA 1AUPA 1R4NB 3DBHA 4O59O 1Q7GA 1PJTA 4IIVA 4AJ1A 2HMWA 3HFSA 3CZRA 4CUJA 2OP1A 2QX7A 2WSBA 4W9NC 4R4JA 3ONEA 1YONA 4JBGA 5F3RA 3F1KA 5EPOA 3F46A 4J9VA 1HXHA 1ZIDA 2WE7A 3E5MA 4N54A 4IQGA 3GF4A 3OF2A 4GQAA 1PGOA 3JCZA 3RCBA 4TVOA 3ZHBA 2O3RA 3U4HA 3TN7A 3INGA 2ET6A 3GY0A 4I5FA 3E48A 3QVWA 1BXZA 3V2UA 1ADFA 1Q1NA 2O3QA 2CDAA 4E4YA 1A4IA 2IYOA 3GQVA 1WLYA 3OJLA 3ADOA 3PTZA 1VLLA 4HV4A 3CIFA 3UCFA 3TPCA 3JQAD 1RM3A 1F14A 1EK5A 1P1KA 4BGUA 1ZEJA 1MXFA 1L7EA 3GAFA 1K89A 3OEWA 3WSWA 3NT4A 1SOVA 2VWPA 4J4BA 2X9GA 3TFQA 1AHIA 4DWVA 2NVUA 2D5CA 1EDOA 2FHSA 4XGNA 3PI7A 2Y1OA 5A3VA 3QIVA 5A9SA 5KKCA 1UJMA 3PHIA 3JQ9A 3CTMA 3OECA 2J8ZA 1HL3A 3JYNA 4BNHA 3W8DA 4II3A 4CMAA 2DU8A 2VHWA 5DT9A 4HADA 2OOSA 4XGKA 4L4XA 1LU9A 4WLFA 1SOWA 1ENOA 4PVDA 4AICA 1O95A 2RAFA 2G1UA 3K96A 4NFSA 2D59A 3E9MA 1KC3A 4RF4A 3WMWA 1C1DA 4PVCA 3HB5X 4DL9A 4BKOA 1M6HA 5TGDA 1X7DA 4E5KA 3S2GA 4FGSA 4L8VA 2NU8A 3U49A 3IUSA 1B3RA 1PJCA 3IP1A 3L6OO 5G4KA 1RM5A 4WUVA 5TNXA 4D79A 4IQ8A 4JLWA 5AXCA 4W6ZA 3I5MA 4MKRA 3FCOA 4AFNA 4YEDA 3PGXA 1OMOA 1C1XA 5C3MA 1FDUA 4QO7A 4E0BA 4DPMA 1DFIA 1ZMTA 4X54A 1R0KA 3JD1A 3I3OA 2CFCA 2IDZA 2R00A 6ADHA 2PLAA 4R1NA 3KTDA 2PGDA 2IZZA 4JGBA 4Y6RA 5KTKA 3TL3A 2H6EA 2VWHA 5DBGA 3IMFA 3OJOA 1DHTA 1CQIA 1YB4A 5L95A 2NWQA 2WWRA 3KSZO 3L4BA 4R9RA 2EGGA 4EDFA 1LC3A 2PK3A 4IDEA 4U5QA 4BNFA 1KVTA 1VE9A 3K92A 4WPGA 4EJ6A 5CDUA 1LSSA 2YZ7A 5CEJA 3D4PA 2EERA 4L75A 4ALJA 4JJFA 3KUXA 5FWNA 2WYUA 2BMAA 5CG2A 3BAZA 1IUKA 1F8GA 1JKIA 1SBYA 4GLLA 4DPLA 4RLSA 2GPTA 4EITA 5KVQA 4I08A 3AJRA 4FFOA 5G2OA 1ISMA 3DBVO 2ZJ0A 2X86A 1KVRA 1GCOA 5F5LA 4R3WA 5HRUA 3GVCA 4CMEC 3GUYA 2P9GA 1T25A 3HQ4O 1YDEA 1HSOA 1UH5A 2XF8A 4B3IA 5L4LA 1ISIA 2D1YA 2WDZA 3PZRA 5U1PA 5I7FA 2VRCA 1E1LA 4Y6SA 2FZWA 3GNTA 3AFNA 4M54A 3GVIA 3RKRA 3RVDA 1JQBA 5AOVA 3EVNA 2PKQO 1TT5B 5FEUA 3CMCO 2OFPA 5DBIA 4Q9NA 3A06A 3GDFA 1X0XA 1KERA 5COBA 1HETA 3T7CA 1EUCA 3GZNB 2X7HA 4YR9A 1DC3A 1UAYA 1E6WA 1ORRA 2Y05A 4Y9DA 4EZBA 5IZCC 1F12A 2HUNA 1UAGA 4NJMA 4UVGA 1NVTA 2AE1A 2VUSA 3FHLA 1MFPA 4RQTA 1Q7CA 5IDQA 1GV0A 2I66A 5KKAA 3VPGA 3RROA 2GGSA 1H9BA 2PV7A 1NR7A 3SC6A 5A5FA 4UAGA 3SLKA 1ZZEA 1GFSA 3KRTA 4UULA 4Y98A 3MTGA 5HS4A 2BLLA 3DONA 5I7SA 1DLJA 5A4DA 2GN6A 3F5QA 4HX5A 4NK4A 3W4KA 1NWHA 4K1LA 3JV7A 1OBFO 3H3FA 3DFUA 1Y8RB 4U6SA 4WEQA 5L7TA 1JKJA 3WGIA 4R68A 5JDIC 2DUUA 1BSVA 1A71A 4J0FA 4IDFA 1SB8A 2DKNA 3T4EA 3WBBA 4BGVA 4RDIA 5B4VA 1AE1A 4XD2A 2ZTLA 2NNLD 4CV2A 3LC1O 4QECA 5AVOA 1GADO 4PG6A 3KBOA 2O48X 4Z6KA 3H9QA 5K6AA 4HKTA 4WCDA 2HO5A 4NH4A 3UW3A 5A02A 3PYLA 3ZNNA 4DLBA 1HDZA 1HEUA 3INRA 3HDYA 4NJOA 3VOSA 5BSEA 4AJ2A 3RQSA 3ZWYA 3DMTC 3GGOA 5TF4A 4DBVO 5KVVA 3IUPA 4R5HA 2X4GA 4I9HA 2UAGA 3LZ6A 1X13A 5F1PA 4NI5A 3ZHZA 2ZYAA 5TX7A 4DPKA 1HTBA 1SC6A 1DRUA 3H3JA 3M2PA 3OSUA 1U5CA 4BNYA 1XEAA 3OFSA 1X7HA 3MCVA 5L3ZA 2B69A 4D7AA 3WIEA 4JIGA 5DCYA 2W2KA 5T67A 3CUKA 1CJCA 3UH1A 1K0UA 4LN1A 1XSEA 3CMMA 4MO2A 1BW9B 5BT9A 2DTDA 3QV1A 1ZK1A 4IS2A 3RD5A 3GUCA 1Y5MA 3NKLA 4XWYA 4CV0A 3JD3A 1R0LA 1LDBA 3MJSA 1E5LA 1EK6A 3H5NA 4GSKA 4W7HA 8ADHA 1SMKA 1WMAA 1D1SA 5JDCC 5K9ZA 3WMXA 1D8AA 1PSDA 3WGHA 2HCTA 5IFLA 5JMWA 1C0LA 3GAZA 1O89A 1O8CA 1VJTA 5JAQA 3WWYA 1EVIA 2WEKA 3ZWOA 4I5EA 5FI3A 2GZ3A 1Y7TA 3U4IA 2DBQA 2HK9A 5T6BA 4QFCA 1UXHA 2YQ5A 5IJZA 4A5OA 4EUFA 3L6EA 3TZQA 1VSVA 1D1TA 1P33A 1GZ4A 5HBRA 1QP8A 3D1LA 2GASA 4MIYA 3H5RA 1Z82A 1ULUA 1H6DA 1BXGB 4IJVA 3GPDG 4CLOA 2Y0EA 2SCUA 3GRKA 1HDXA 3PDJA 1PR3A 4BKQA 3ZGYA 1VL0A 1XWFA 2DUWA 3GDGA 3H5AA 1B0AA 3GFGA 1CWUA 4E5PA 1GUFA 2X22A 4RGBA 4CQLB 1E3LA 1DO8A 3EY4A 2CSUA 3QWHA 1KBZA 4HFMA 4MVJI 3K5PA 2Y0CA 3UN1A 1R4MA 5KJ1A 2C59A 2NADA 1YBMA 1HT0A 3ONFA 3PP8A 3U09A 1DC6A 2LDBA 4BVAA 4I1IA 3INTA 5TS3A 3K2EA 1Y9EA 4YYZA 1KC1A 2O7QA 4BKPA 3JQDA 4W7IA 1NYTA 4MIOA 3SJ7A 3AY7A 5HA5A 2X0IA 1UZLA 3B20A 4KTVE 1MG0A 4OGWA 2HSDA 3AU8A 1ONOA 1QMGA 2BKAA 3FD8A 1B7GO 2GSDA 2QZZA 3OM9A 3LC7O 1GY8A 5IXSA 2FOIA 3K31A 5L9AA 4IINA 3W6UA 1U2GA 1LX6A 5A3JA 4BO9A 4RPKA 4CLEA 5A5EA 1Q0QA 3DZBA 2J5RA 3FNFA 4A2CA 3F4LA 3IS3A 3AY3A 4PLTA 3WTBA 2NV6A 1B26A 1I3NA 4CUZA 2HKIA 2YFQA 2O2YA 5JBIA 5EQFA 4GX5A 2HMVA 4KWIA 3ZHYA 9LDBA 3D3WA 3S55A 3D64A 1YB1A 4NBWA 1XELA 3UHAA 1YRLA 3WICA 3GMDA 3DZKA 4KDEA 4LMPA 4PZCA 5JS6A 3LF2A 1E7QA 5ITWA 4XZ3A 4FQ8A 2E48A 3PZBA 3P7MA 4P4NA 4PLVA 2Q99A 4YRDA 1LTHR 1C14A 2B5WA 4QO8A 3DHNA 1UUFA 5KVSA 2O3SA 1LJ8A 3WLFA 1Y81A 1I0ZA 4R1TA 2VN8A 3O03A 2ZJ1A 2BFMA 3UAGA 2NU6A 2DFVA 3RUDA 2JAPA 3MWEB 5C7LO 5JE8A 4GVXA 2O23A 1T2FA 4URFA 1V35A 4ZRNA 1I33A 2YUTA 2EKLA 2VHYA 3WOHA 3DBRB 5BR7A 1GUZA 5DNAA 3RUFA 3L6DA 4PLWA 5G4LA 4YJFA 4CQMB 4H3VA 1XA0A 2OO5A 2Y99A 4CM5A 1LDYA 3OIGA 2C07A 3MEQA 5COQA 1KVSA 4DQVA 3ZWMA 2YYYA 1M76A 3M2TA 5COAA 4ND4A 4E32A 4HFNA 1V3VA 5ER6A 3NUGA 4OIMA 2OBYA 4WCFB 4DXHA 5U9CA 3A9WA 4E5YA 3K73O 3GN1A 3JQEA 2QIOA 5H83A 1HYEA 3NDJA 4GGOA 4ID9A 1DXYA 2Q2WA 3BTOA 4NBUA 2I3AA 4HY3A 3GPIA 3ZU4A 3GMSA 3C1OA 3H2ZA 4EJMA 4K28A 1G1AA 3VTZA 2H63A 3NGLA 1YKFA 4R16A 3HJAA 1N92A 4R9SA 4WGGA 3ROQA 3VZRA 3WGYA 1T2DA 2I6TA 2VHVA 5A05A 3RI3A 3ZWVA 2YHUA 1YBAA 3AI1A 4CV1A 2Q46A 1O6ZA 2RBEA 3BZUA 3MJ4A 3ROPA 2CNBA 3ZHXA 3IOYA 1FDSA 3IC5A 4NU6A 3LC2O 4WCFC 4YXFA 4WKGA 4PZDA 5EN4A 3PWKA 3QSGA 3JTMA 2C2YA 4B4WA 1ZSVA 4K9DA 1LLQA 3K9QO 4YJGB 2CVZA 1CQJA 2P5YA 4ILKA 2P91A 1DC5A 2HK7A 4R51A 4Y67A 3PK0A 2DPHA 1HE2A 3GK3A 4TRMA 1WDKA 1TEHA 2GN9A 2VOEA 5KWEA 1I10A 3M1LA 1ZW1A 3K6JA 4CM9D 3PRJA 1NHWA 4YCAA 4FB5A 3JQCA 1DIRA 4D0SA 1JAYA 4HP8A 2VUTA 5JXWA 5CDTA 4IXTA 4M89A 2V6BA 5CG1A 1DJQA 1MFZA 5A1TA 4EUEA 4CM9A 3UCXA 1V0JA 3L9XA 1RYEA 3AOGA 1Y9AA 3JQFA 1UXIA 2ZK7A 3AWDA 4FC6A 4K26A 1KY5A 4RVUA 2IEBA 2J6IA 1QR6A 4IGEA 4CM8B 3BHMA 3RC9A 3JQ8A 1DRVA 2BGKA 3RIHA 3N74A 3C7CB 1TB4A 5KJCA 4JROA 1N9GB 1XLTA 4PG7A 2Z95A 4R3NA 2ZCVA 1XQ1A 3JQBA 4GPD1 4XEHA 3PGJA 1VJ0A 4DUPA 3VHRA 1I30A 4OOFA 4TQGA 3PHLA 2UDPA 5BNIA 3KSDO 3QE3A 1VKOA 2NVBA 2GRAA 2NSDA 2HRBA 1NFQA 1ZSNA 3NYWA 3W8EA 1YJ8A 1H93A 2JL1A 4RDHA 5DP2A 1LLUA 2AQHA 4MVJH 3PHJA 3KYDB 4EUHA 3FN4A 2HMUA 2BGMA 3G0OA 3DBHB 3BTVA 3EZLA 4UEOA 3GDOA 4MVJD 4OYRA 4Z0HO 3DWFA 4QX6A 2I76A 1E1NA 2BH9A 3QWFA 1NVMB 1WMBA 3NJ4A 1LDGA 3WXBA 4M1QA 4RZIA 1R12A 1J4AA 2EIHA 4MOWA 3D5TA 3ZWBA 3EVTA 4YAJA 3OQ6A 1KEVA 4IM7A 4RVSA 4LCJA 2RH4A 1IOLA 4IDAA 5DF1A 4A27A 1F0YA 3RBZA 3H9GA 3ICCA 3I83A 4ZICA 4I9NA 3OJEA 4J1SA 4IZHA 3DFZA 1E1KA 3E8XA 1WDMA 1LQTA 1M2WA 4XIYA 3S2FA 2VCYA 1NFFA 3BMOA 3OBBA 5LDGA 3ZV5A 4I5DA 3MOGA 3ZH2A 4LCEA 2VZ9A 1ZXBA 4DTIA 3VZSA 1AN9A 1BVRA 3DO5A 4XA8A 1P1FA 1H9AA 2JJYA 7ADHA 1HSZA 4W82A 2H5LA 3WG9A 5EIOA 2JCXA 4C4OA 3EGOA 4OMUA 4UUPA 2NVUB 4GVLA 3GH3A 2EP5A 5T8KC 1VC2A 5A9SB 3BXXA 5T5QA 1DOHA 4B4UA 3ZZNA 3RBXA 5DULA 4L74A 4FBGA 4DQXA 1RYDA 2XAAA 2JFHA 4NU5A 4XQ9A 4BNZA 5C7OO 5BQFA 2DLDA 1NNUA 1FDVA 4LRSB 1Q7BA 3NJ8A 3FRJA 1FK8A 3ZV6A 5JCJD 4WLOA 1U1IA 2CZCA 3PJFA 1X1EA 4PLGA 4I8XA 3WGGA 1WZIA 4CMKA 4CM7A 4IUYA 1C1DB 1PX0A 3NT5A 1QORA 3WYEA 3O8QA 4LRTB 4WLEA 5FI5A 5JCJA 2F00A 1NX6A 1P74A 1Y1PA 3KXDA 5G4KB 4Z0TA 1E7MA 1EUDA 1NQ5A 2QHXA 3JQ9C 3ROKA 1I2BA 4NFYA 2DAPA 4J49A 2YHIA 1C1XB 4P4GA 2G76A 3P5SA 2Q2QA 3VZQA 4BV9A 1UP4A 3JQ7A 4N5NA 1T4BA 2NU9A 1LDEA 1U3WA 1BWSA 1LDNA 2G82A 3IKVA 4FIZA 1IULA 2NUAA 2Y66A 2WD7A 1X1TA 4FFRA 4WJZA 1K5HA 1NHGA 1PU2A 4L73A 3WFIA 4XYLA 1PZEA 4PLCA 3WNQA 2HU2A 1I32A 3FTPA 4OSPA 4MVJG 2RCYA 5H82A 3KVOA 4XJSA 1H94A 4B3JA 1GYPA 4EEXA 3GNSA 3H2SA 3O4RA 2H1SA 4GI2A 3JQAA 2QRKA 1VL6A 3UOGA 3E5RA 1YWGO 2X0JA 4KTTE 3UF0A 4L4RA 2C20A 1D3AA 5HS6A 1Q0LA 2EP7A 3IDSA 4DC0A 5JYDA 3PYXA 3WQQA 3ZV4A 3KZVA 3MOIA 4XGIA 5MGBA 2DTEA 3L4BC 3KYCA 1OFGA 3LYLA 4BNLA 2VYVD 3P19A 2ZQZA 3S2IA 4WOKA 4ALIA 1PS0A 4E30A 4P8RA 2EKPA 4Z9YA 1V9LA 3QVXA 4ND1A 4W9NA 3WGZA 2UUPA 2UV8A 4OOEA 1MUUA 9LDTA 4EBFA 4JX8A 2IZ1A 4DBZA 7MDHA 4IJKA 4AJ4A 2W2LD 2VRBA 1P1RA 3WX0A 4BO1A 3HDJA 3R3JA 4ZVVA 1W0CA 3ZV3A 4BO8A 8LDHA 1PJ4A 3ZWXA 4NJMB 1RM0A 3GEGA 4M86A 3KOUA 2CMDA 2W2LA 1LXCA 2GF2A 1LUAA 2O3UA 3DBLA 1ISFA 3GFBA 2QRJA 1PZFA 3RASA 3WBFA 3RFVA 2P9CA 1PQUA 4AJNA 1N5DA 3DEYX 5A04A 3FNGA 2VYND 3JQGA 2FPGA 1A7AA 4FGWA 1U28A 3CE6A 4ROSA 3GEMA 1VPDA 1IYZA 2HMSA 3OEYA 1YL7A 3ZNOA 2XXBA 4J3FA 1P77A 1V6AA 4II2A 4NBRA 4Z0PA 2Q4BA 2FZEA 3C7DB 3IQDB 2X5KO 4BKUA 1R6DA 3F47A 2VZ8A 1FDTA 3EAGA 3HDQA 4PCVA 1Z74A 3MTJA 3TOZA 2VYNA 3AM4A 2OZPA 4KZPA 5JFOA 1N7GA 1PJSA 5G0WA 4D44A 4CPDA 3E18A 4D43A 2DT5A 5IG2A 1DHRA 5CEFA 3OJ0A 5LDHA 4AG3A 1W4ZA 4J1QA 4TWRA 3WNVA 4Y8VA 4WNIA 2JAHA 4YQZA 4YACA 2FSVA 4DLLA 4OHUA 4BIIA 3WLEA 4FSHA 3FPLA 2JFGA 5JCXA 3OICA 3JYOA 1TLTA 5EESA 3BMNA 3WGTA 3SC4A 2J3JA 4J91A 3X2EA 4G2NA 2Y93A 3Q2KA 3F5SA 2Q2VA 5TJHA 2GYYA 3RWBA 3U5TA 3ETEA 2NVWA 2Q1UA 3RUHA 1PR9A 3OP4A 1R66A 3H9UA 3BHJA 4PFJA 1WWKA 3JSAA 4DYDA 3WQRA 2W2KB 5G0SA 1A9ZA 5K6AC 2C7GA 4YBZA 4XYGA 2AQ8A 4OKIA 1KIFA 3LQFA 4LK3A 1ZEMA 4ZQHA 1K3TA 1EQ2A 4QXMA 5I9NA 3K2BA 3ANNA 2P5UA 3GHHA 5CAEA 4ITUA 1I5RA 1LSJA 3H4VA 1KS9A 2FR0A 2FN7A 3JYPA 4BV8A 1U2DA 2O4CA 3PLRA 1JVSA 4DVJA 1HE5A 4NMHA 1VKNA 2A35A 2IRWA 4LVUA 3SX2A 5ICSA 3LVFO 4B7UA 1LI4A 1EEHA 1SAYA 4CR6A 1ADBA 2HQ1A 1UXKA 4JBHA 4TSKA 4XQCA 2JFFA 3V8BA 1XQ6A 3DOJA 3RFXA 5IXYA 2EJWA 1M75A 2W98A 2BFAA 1ISGA 3ZCXA 1E7SA 3LDHA 4PRLA 5KOIA 1FF9A 5KJEA 2ZB8A 3KM0A 2YFHA 1PJBA 3A1NA 3QY9A 4CMEA 2WYVA 1N1GA 4PGFA 1PGNA 1EUZA 2PZJA 4GWKA 2CD9A 1WPQA 2V7PA 4IY1A 4CLOB 4QQRA 4ZGWA 5GY7A 2I5PO 4RLHA 4CMIA 4IS3A 4MP6A 1UR5A 1KETA 3R6DA 4RJTA 4IGFA 4JN6B 3RBVA 3KETA 3GVHA 1DRWA 3RUAA 4M87A 4GWGA 5GZ3A 1NAIA 4YTEA 3NV9A 2J3HA 3OQBA 4R41A 1GR0A 1OAAA 4B7XA 4GX2A 1Y5RA 4O0LA 4WECA 3DAFA 1SEVA 1I3MA 1A27A 3IP3A 2Q45A 4R5MA 4Q3NA 2EHDA 3M6IA 5DN9A 1GQYA 3OH8A 5TQVA 1HDGO 2CF5A 1MC5A 3NT2A 4CM4A 3ETDA 4UEKA 3RAJA 1Q2XA 4H15A 3TZHA 4JJIA 2IE0A 3UFXA 4RPGA 1YQXA 1Z45A 1WP4A 4AJJA 5JLAA 2AEMA 1WW8A 2QYSA 4PLPA 4J1TA 3DL2A 1QYCA 4RQUA 3ONDA 3TF5A 4BNUA 1WZEA 5JC1A 5MDHA 3SJUA 3VKUA 2BF7A 3KHUA 3CEAA 3OJFA 4NFHA 3C7AA 4R01A 5EMHA 4J43A 1Z75A 4JQCA 4C7JA 4RO0A 5IAAA 5JY6A 3HUDA 3MJVA 2Q3EA 3B70A 1Z73A 2JD2A 3HHPA 3D0OA 1DB3A 1Y8QB 1WVGA 4ND5A 5JDIA 5DCWA 3DQPA 2ZB7A 3KYBA 4DYVA 2ZCUA 1YL5A 2VNSA 1CERA 1T24A 2E6UX 4IMRA 3QP9A 3ITKA 2WE8A 1HYHA 3GOHA 3PHGA 4YQYA 3V5NA 3D3WB 1U4SA 4GBJA 4JCOA 4G65A 1GUYA 1ULSA 2C0CA 1XGKA 1T26A 1HDCA 4CM1A 3D7LA 3SVTA 2VUUA 2FR1A 3NDRA 4HFJA 1I24A 1IE3A 4IJUA 4Q3BA 1IZ0A 2O3JA 3HG7A 1JVBA 3QQPA 5BNFA 1VJ1A 4DGSA 4F3YA 2IODA 3DZFA 3ULKA 1IHXA 2HJRA 3VKVA 1O0SA 2O50A 4L4SA 1MP0A 1YS4A 1J49A 1O5IA 2VNAA 4Q3AA 1QV7A 1JN0A 3OHSX 1LA2A 4BNGA 3QVSA 4ZQGA 1QSGA 1MXHA 2HK8A 4PLHA 3ZNPA 3F9IA 1GU7A 3Q6IA 4XB1A 4NDNE 4YJFB 4BNTA 3DAGA 3HWRA 1U9JA 3FI9A 4QT0A 2YY7A 4AJIA 1YJQA 4TKMA 1A5ZA 2AHRA 2DBRA 2X9VA 1DFGA 4TRNA 4F6LA 3RUCA 3ABIA 3FTNA 5I7VA 3NEPX 4E2YA 5JO0A 4GMGA 1ADCA 1SEPA 4OL9A 5IF3A 3OIDA 4XYBA 5JDCA 2V6MA 4MINA 1VSUA 3I4CA 4I5GA 2D5AA 4KMSA 3EC7A 1PGQA 4OXKA 4YAGA 3ADPA 2CF6A 1N8KA 3O38A 3CZMA 1ZK4A 5K0ZA 4U7WA 5DCUA 2UYYA 4OSOA 2I99A 3NAQA 2JKVA 3QHAA 3TOXA 1B2LA 3I9MA 1H2HA 4O63O 4RPJA 3C24A 1KOLA 1X7GA 2HDHA 4FJ1A 1PS9A 5TT0A 2W8ZA 3RUIA 4CL3A 4UUNA 2X1HA 4BGIA 4F46A 1TT7A 2X9NA 1GZ3A 4YJDA 4E33A 1EVJA 2POQX 2Y1CA 4BO3A 4EEZA 2X8LA 3QWAA 2NQ8A 2Z1NA 3HFGA 1E7RA 2BD0A 2OP0A 1L7DA 2RIRA 4AJLA 4J0EA 2C5EA 4XRRA 4YJHB 4WASA 2PY6A 5TT1A 2YDYA 1LLDA 4A10A 4TVBA 4B4OA 1BHSA 1SO8A 1PWZA 1JTVA 2Y1FA 3IJRA 4CLDA 1DIBA 5LC1A 5BNTA 1P0FA 3HNPA 1BG6A 4RCVA 3GT0A 3TL2A 4CR8A 2VOJA 4CLXA 4XQEA 1E5QA 1ZFNA 4YT5A 1OOEA 1QLJA 3TDKA 1XU7A 4BMNA 2RHCA 5B1YA 1AHHA 4FJ0A 1RKXA 1DSSG 2DM6A 4N5LA 1WAMA 4N18A 5C37A 4R1SA 2CVOA 2R2GA 4M49A 3PQDA 4BNWA 4AJPA 1T2EA 5B4UA 1MB4A 2JD1A 1R15A 5HTOA 3PJDA 4RF3A 1LBEA 4H16A 4CODB 2NTJA 1CF2O 1MA0A 2J3IA 4N5MA 1LC0A 2C7VA 1ZO8A 3E9NA 3JQ8B 3AY6A 4FD3A 4IXWA 4BNVA 4MDHA 1T2CA 2B4QA 4OXNA 1E0DA 3NDIA 4QFDA 4XDZA 1UDAA 2BI8A 3DZGA 1B3BA 2YDXA 2Y1DA 3DZHA 2YV1A 4GAEA 1DBVO 3EDMA 4ZRMA 1AGNA 1XCBA 4UEJA 5B12A 3PEFA 2FY8A 4NK5A 3RFTA 3ORFA 5L51A 1X15A 4RPHA 4BMSA 3Q0EA 1TXGA 4FR5A 4J4HA 4Z3DA 2C2XA 2ZKLA 3BMCA 4IDCA 1GV1A 1KEUA 3AU9A 4ND2A 2IYPA 2OUIA 1NQTA 2PZKA 3KV3O 4AJOA 2JCVA 2ZB4A 4KQWA 4RVFA 1FJHA 3JQBC 4YVFA 1ISJA 4JK3A 2EJVA 3JQ6A 2P4HX 3VPSA 2P4QA 4J6FA 4DRYA 3NGXA 3CINA 3PWSA 4KWHA 3ZWAA 4ZU3A 4BS9A 2D0IA 2EEZA 2GN8A 2CVQA 2WM3A 1E6EA 4XJTA 4ALNA 1OZAA 4CLRA 2EKQA 4WE3A 2OXIA 4FJ2A 1XU9A 4L0QA 1QV6A 3LF1A 1P0CA 2GZ1A 5IN5A 3I9JA 3LU1A 3UVEA 4AJEA 2D3TA 3ZI0A 4BO2A 4B7CA 1LEHA 4K6FA 4ND3A 3F4BA 4IJWA 4KUEA 3ZWPA 3WQSB 1PJQA 2PR2A 5EERA 1SNYA 1M66A 3RU7A 1IPEA 3N7UA 2EV9A 4INAA 5JY1A 1E3SA 2PGLA 4TRJA 1D4FA 1J5PA 3ZU3A 5C5IA 5JC8A 3L07A 4KUGA 4GMFA 1QYVA 4KOAA 2GNAA 4PG5A 1PIWA 3TSCA 1DIAA 3AK4A 2G17A 3AM5A 1W6UA 1BMDA 4ZN6A 2AQKA 3O26A 4MIEA 3JD4A 3F6YA 3MJTA 2YV3A 4JXKA 3VH3A 1I01A 3GGPA 3O8QB 1KY4A 1R37A 5H81A 1ENPA 3GR6A 3WGQA 3ZU2A 1NVGA 3G3EA 1F06A 4WK6A 3G1UA 2ZB3A 3GVXA 3H9JA 4DIOA 4MVJA 1SCUA 2GD1O 4BB5A 2BHLA 5TRTA 3Q9NA 2YHIB 4IBOA 2Y1EA 2VQ3A 3PIIA 1CYDA 1MV8A 1QLHA 4OAQA 1GTMA 1ID1A 3PJGA 3JQ7B 3TZKA 4DREA 2VWQA 3C1AA 1Z7BA 2EWMA 4R69A 4BGEA 3OA0A 1DIGA 3S2EA 4J16A 2OHXA 1JDJA 4FC7A 4PLFA 1EVZA 5JMPA 3A14A 3I1JA 5GZ6A 4HXYA 4J1NA 4NZ9A 1K6XA 2WD7B 1DAPA 5JW6A 3PWZA 2BELA 4CMHA 1X0VA 2NU7A 1GD1O 2CY0A 3MJEA 5CPFA 5TLSA 3HZZA 3AI2A 1YE3A 4E3ZA 1NQAO 4K6CA 4FPXA 3O9ZA 4J2HA 5DP1A 3UXYA 5CDGA 3I9OA 3GC6A 3OQ1A 5L7YA 3DXFA 3GNQA 3U4DA 4M55A 1V8BA 5AYVA 3WSVA 1BRMA 4Y6PA 1E3WA 2PH5A 5C7IO 4B8WA 1IZ9A 3JQAB 3WYCA 3VAZA 4FFPA 2ZYDA 3D3EA 3FBTA 5EQDA 2PNFA 4BOYA 4ZHSA 3T4XA 1X14A 5EJ2A 4GGPA 5TIIA 3AW9A 4A03A 3NX4A 4XDYA 2BRUA 4D45A 4EGFA 5FFFA 1EBFA 2FPPA 3GZ4A 2PTGA 1DLIA 5DZSA 5GZ1A 3KYCB 4W4TA 1IY8A 1TA4A 3LLVA 2PGJA 3BMQA 1KEWA 2VWGA 1DC4A 1H0KA 1RJWA 3VDRA 2EF1A 5A9RA 2Q1TA 3IKTA 1KVUA 4LGVA 4D0RA 2PD4A 1HE3A 1JWAB 4RVHA 3RC2A 4UREA 3DHEA 4EYEA 1HF3A 3DTTA 3HSKA 2GUGA 4YAKA 4BNMA 1GCUA 1ONPA 3ASVA 4YT2A 1KVQA 5JNLA 3WFJA 3RKUA 2AXQA 1BGVA 3JYQA 2Y0DA 3NTRA 1NFRA 3I6IA 2GN4A 1YBVA 3AOEA 2AEJA 1ZJYA 3LT1A 2OL4A 4JP2A 5ILGA 3QA9A 1HDOA 3V2HA 4BB6A 4HUJA 3P2YA 4YRBA 2X0NA 3GRPA 1I2CA 1GQQA 3DBLB 3E9QA 3S1LA 4MPDA 2XPCA 4JBIA 3DMYA 4RPLA 1PJLA 4RV9A 3FBGA 4NPCA 3H6KA 5A03A 1RPNA 2AG5A 2HRZA 4GSLA 3ROMA 3JQGB 5B4TA 2QQ5A 4Q3DA 5HWSA 2ZATA 3KLPX 3FR8A 3HB4X 4Q39A 3ASUA 2VTEA 3CXRA 3R3SA 4RVGA 1NAHA 4TMFA 2DC1A 5CHEA 1YOVA 1H6BA 3ZN2A 3PLNA 3DZJA 3LT2A 3GLQA 1YQGA 2AG8A 5T8KA 4BQRA 1LSOA 3ZWNA 1JKFA 1E92A 4HNGA 3LSYA 5I9LA 4GKBA 1FMCA 4KDFA 5JPIA 4N7RA 4IDDA 3QJ5A 1KYQA 2DVMA 2R00C 3U4CA 1BDBA 4Z3KA 4RL6A 5A06A 4LVCA 4E5MA 4M8SA 4NBTA 1HLPA 3NTQA 4P22A 4BKRA 2E4AA 1S6YA 4J2OA 3L4SO 4LW8A 4NBVA 4UUOA 2X58A 4E2XA 4BNJA 2LDXA 3B1KA 4DMMA 1ZBQA 1HDRA 1I3KA 1GL3A 3H7AA 4BNKA 1ZK0A 3W4JA 4FDAA 3HE3A 3BMNB 3AFMA 1NM5A 3G49A 1NASA 4XR4A 3CPSA 2VT3A 1A72A 1NP3A 4BHTA 5G0UA 3TJRA 5KIAA 2AQIA 2VYVA 2OMEA 3RUEA 4U8GA 3WWZA 1ADGA 3PPIA 2GR9A 1EBUA 3U62A 4E2WA 1XIVA 1LDMA 3KEOA 3Q3CA 2DBZA 5CPBA 2C82A 1PEDA 2YW9A 3I9NA 4ALLA 2NQTA 5F1OA 4CJXA 3HDHA 1OI7A 3F1LA 4BNNA 2W4QA 3C3XA 1R4NA 3KO8A 3QVOA 5DOZA 1EE9A 1RM4A 1YQDA 4WEOA 4FFNA 4CL8A 1PZHA 3VH1A 1I8TA 5G0TA 3MZ0A 5JYEA 1AXEA 5EL0A 2A94A 2GERA 2PA3A 4DIBA 1MG5A 3VVBA 4HBGA 2FSSA 1N7HA 3N58A 2JHFA 1UDBA 3RC1A 1QYWA 5ITVA 1ENYA 3U3XA 5TC4A 4FN4A 4O1MA 1QYDA 4Z9XA 4L76A 1HDYA 2E37A 2GZ2A 1T1RA 1EFLA 1XYGA 3ON5A 5JO9A 5CFZA 1U5AA 3PVZA 4WOJA 2EXXA 4ZQBA 1NPYA 1NPDA 3RSHA 1F8FA 4CMGA 4F45A 2B0JA 4YT8A 1NR1A 3OA2A 1SB9A 1F17A 2Q1SA 3GN2A 1HZZA 4WNCA 2VT2A 3MJCA 3QWBA 4CMIB 5AQ1A 5A9TA 5JAMA 1BXKA 4FFMA 4XX0A 4O5OA 1NQOA 4LSMA 1PQWA 1YGYA 2X5OA 2QRLA 1VRWA 1ZNQO 3EUWA 1ZKMA 2WD8A 5FYDA 4JP3A 3KEQA 4CUKA 2F1KA 5L4SA 3QRWA 3OMLA 4MVJM 2VRCD 1GYRA 1PGPA 4CM4B 1A4UA 2VHXA 1VL8A 1WDLA 1PGJA 3PIDA 3PQEA 5J23A 1JLLA 1E77A 2X6TA 5THKA 1IB6A 5IN4A 1B16A 3P2OA 4XQGA 1G0NA 1PJ3A 2Q4EA 4MJLA 1QKIA 4O6VA 3E82A 2Q1WA 4R1UA 3X2FA 3DC2A 4PRKA 4AL4A 4RF5A 4CR7A 1EQUA 3AUTA 1R0SA 3M1AA 3E03A 4GL4A 4CM6A 2WMDA 2NM0A 1U8XX 4BO5A 1YB5A 4OO3A 1T2AA 3AUUA 3B1JA 3SXPA 1SPXA 4J7XA 4MP8A 2A9FA 1NWCA 4AVYA 3ENKA 3G1TA 2QZ9A 3WGOA 4IMPA 1U3UA 4PN3A 5CEEA 2W90A 1WXDA 1P1IA 4YAIA 1GYQA 1U7HA 3DAPA 3LK7A 3LT0A 4YDRA 1P3DA 1ML3A 1K6IA 4HWKA 1KEPA 2C29D 4C7KA 3BHIA 3EYWA 3GGGA 4JNKA 5I8ZA 3B6ZA 4XB2A 4YA6A 1RWBA 2CDBA 3ITDA 3KLMX 2JD0A 4D41A 2WYWA 3E6AA 4GX0A 3QW2A 4B8ZA 1YO6A 2OGUA 4FFLA 4FW8A 3BYZA 1E3EA 2O3TA 3SLGA 1G0OA 1DEHA 3ST7A 4OH1A 4BO6A 4KQXA 5B37A 3Q2IA 1ZXLA 2BFPA 4UVHA 4BO4A 3UUWA 1EZ4A 3FNEA 3WDSA 1R4MB 1UP7A 2QYTA 5IZCA 2FWMX 4D46A 1CEQA 2YV2A 3FF4A 5AXBA 1GDHA 4WLNA 1E3JA 2PKRA 4PLZA 3L9WA 4DC1A 2B4RO 1JA9A 1Z7EA 2WJPA 1K2WA 5L4NA 3EHEA 1LQUA 1V3TA 3CSDA 2IEDA 1HLDA 4BL5A 5TJ9A 3Q9UA 4EJ0A 3SBOA 2NLOA 2O7SA 1GEEA 1C0IA 4OJNA 4A26A 1U8FO 3A28A 1TT5A 1ZVMA 3COSA 4FOSA 1G6KA 4NNJA 1XHLA 2Z1MA 2O4UX 4IZIA 1CDOA 1I36A 1LLCA 4YT4A 3D4OA 3GZNA 4YRAA 4IDBA 4W99A 1B14A 2VHZA 1EVYA 3TQHA 3PDUA 1MGOA 4S1VA 2RH8A 4OQYA 1LRJA 1PTJA 3U9LA 1U7TA 2E82A 1VM6A 1E7YA 3H9EO 3VH2A 3ZDFA 4YPOA 3ANMA 2H9IA 3BTSA 3OIFA 1CRWG 1DPGA 4NR0A 1T4DA 1HRDA 1B8PA 4OXYA 5KVCA 3E1KA 4RZHA 1B8VA 4J7UA 1UXJA 1MX3A 3ZW9A 5IDWA 3ENNA 1W8DA 1W73A 4QUKA 5U4QA 4G5HA 2C54A 3R1IA 5TSDA 3STHA 4AJHA 2UUOA 1OC2A 5CDYA 4BO7A 4HNHA 2PFGA 4NHEA 4YWJA 3DMTA 1Y8RA 5G0VA 1QG6A 3VH4A 5BSHA 2FMUA 2XOXA 4MVJP 1P45A 2JHGA 3SEFA 2EGHA 4PZEA 1MC4A 1CIVA 2C5AA 2G5CA 3DZIA 4YAEA 5ER9A 4E31A 5L45A 5L53A 2AA3A 3TNLA 3DDNA 1ZH8A 4ZQEA 4IPTA 1DAOA 3ZNQA 2J5QA 3FWZA 4A73A 1O9BA 3PFFA 2X5JO 3B1FA 3ZWWA 4XRGA 1P9LA 3VPFA 4E5NA 1P44A 3QLJA 3FWNA 1OC4A 4I9UA 4D3DA 5KCZA 1ISHA 4UVIA 4NQZA 4R54A 4A7PA 4CM3A 3EMKA 2V65A 2Y1GA 1HZJA 2ZYGA 1DIHA 1U4OA 2FR8A 2BI7A 3W1VA 4ZJUA 3D4NA 2X23A 5I7EA 1HE4A 1UXGA 3PFWO 5GMOA 5HM8A 3VDQA 3I4FA 3G17A 1GPJA 3WS7A 4DMLA 3R0IA 4CV3A 2I3GA 3NRCA 4PG8A 4U0JA 3C1TA 1BW9A 3VPXA 5DDIP 3GVPA 4RORA 1GAEO 2X0RA 4TROA 2EG9A 3QWIA 3IJPA 1ZK2A 4XKJA 1XG5A 3JYLA 2VZ0A 3BMCB 3IIEA 1E7WA 4KP7A 4DA9A
chains in the Genus database with same CATH superfamily
4QFBA 3ZYZA 4FOOA 3RARA 4GC9A 3IBFA 3WL8A 1Y8QA 1LF0A 4B3SB 2G1PA 1KKLA 4JQZA 4U2BA 3U17A 3IAHA 4B1FA 2HN9A 1MN6A 3IRVA 5HIKA 2XUZA 2VJYA 2KYRA 2OV2A 2WIAA 4JEMA 2W2NA 1UZAA 2ODTX 1K4YA 3GLVA 1OAKA 5AR1A 5FV4A 2IHNA 3AO0B 3ZDYB 2GBGA 3ZZ1A 2WPNA 3G79A 3T7EA 5FBKA 3MRVA 3R3WA 2D2FA 1S4MA 1EWYA 1N0WA 4ZOCA 5D5HA 4G4JA 5FPTA 1ZMOA 4Q3EA 5KSYA 2GYUA 4IGKA 4XTCS 5JBQA 4AKIA 1BXGA 2E55A 4LGMA 2ZOSA 1ZESA 2AR7A 1FB5A 2CJYA 2QMEA 4KN8A 5DLPA 4FS3A 2JFUA 5ALRA 3Q7QA 4Y2PA 3TXYA 2ISQA 3QLTA 4Z2YA 3CH6A 2RC6A 4PBSA 4YI5A 2ZTMA 3U37A 2CMGA 3HRIA 3VYUB 4OM8A 4TKVB 4AI6A 1RHQA 1KSFX 4Q12A 4EAQA 2IXAA 1EFKA 2VYQA 3JVUA 5K4AA 1O6BA 2VPIA 3SZRA 4BMOB 2OAEA 4L5BA 1VHJA 5HF5A 3SHQA 4UHDA 1SKYB 1L3IA 2PGOA 2C42A 4DKJA 3M49A 2P2SA 3DPSA 5DM60 1M33A 2YCBA 4XE5A 3TNFA 2GCIA 2I2BA 5NULA 3QEOA 4YUZA 1EQAA 1V4VA 5C8XA 1UM9A 3L77A 3TEMA 4P3NA 4Q37A 4V3BA 3QUTA 4Q24A 1OIXA 4JA0A 4R6XA 2Y8EA 4HWPA 2OSVA 1PYOA 1ZM2A 3GEDA 1P9NA 4NCIA 3EC1A 3L7OA 4FYVA 1UK8A 2R1VB 4IG4A 1RYNA 4TLDA 4YHBA 2VJBA 3KPYA 1L5HB 1OXBB 1DZIA 1GVHA 4P38A 1Q1EA 5CDSA 4DLAA 2P4UA 4RKYA 2BC9A 5J2TA 4BN5A 1UDCA 1VI5A 1PL6A 1OTHA 3WR5A 2BZ0A 4TKLA 5B2EA 1FCJA 3DA8A 4KQ1A 4FHCA 4ZWNA 2G0AA 3L0DA 2XZOA 1M1YB 3E3LA 3CFYA 2ZANA 3O74A 1RFGE 3A3NA 1NVKA 3V8MA 3S1SA 5KTSA 5F21A 1IBSA 1OQAA 2HJ9A 3MB8A 4PX3A 3RJ5A 1J21A 4HYYA 5DRYA 1AK9A 2IUTA 1MTZA 5LVAA 4OLAA 2O1XA 1PFWA 3NVAA 2OK7A 1RI2A 3BK1A 5EZQA 3K0CC 4ETWA 2XRFA 4YJ3B 4R98A 4DCMA 1IDN1 5JIBA 4DCJA 3GLUA 5LMUB 5F1KA 2R97A 1NXTA 1WNTA 1Z0JA 4AJKA 1B15A 4TSFD 3R6TA 2BGWA 1SRQA 3K2IA 2P5SA 1LGYA 3DJYA 3MWDB 4TKUB 4BUCA 4KUHA 5HW0A 4TVSA 1EEXB 4XR9A 4EGCB 3D5QA 3LDFA 2BJWA 3DMHA 2ZBPA 3PNQA 2QTFA 1QYXA 3STVA 4KXQA 4DRZA 1FFCA 3G0CA 3PFHA 4KMRA 1CRZA 1IAQA 1RC0A 4IHJA 3RU9A 3H9CA 3RSQA 4HWGA 2NU7B 1W85A 5ES3A 2PUBA 2Q5JA 3QU4A 4AWBA 1DTWA 2Y2UA 2KWIA 3WYDA 4RULA 4PNPA 4YJHA 2Y9MB 1ARZA 1RJGA 4EHIA 3B1YA 1UL1X 2PDAA 2E4UA 2GKGA 3SF0A 1M2VA 1NDHA 4AXXA 1QZZA 4IKPA 4DS3A 4B4KA 5KB3A 1XNJA 4GT1A 1RVV1 1E9BA 3WL6A 5A5DA 1PZMA 1R50A 5AFSA 4W5OA 1LWOA 1C30A 2WLTA 4TZKA 5H3HA 4OHYA 3WYBA 4L5IA 3GG9A 1XK7A 2ZI3A 4GH5A 4LZJA 4A0HA 4LISA 1KMIY 1FXSA 4QUDA 1SHUX 4RGYA 1EDZA 2H0AA 5CIWA 1XYYA 3N05A 1ZK3A 2DR3A 1IPFA 4GICA 1QRUA 2FCRA 1NW7A 2BKVA 1FFYA 2C8JA 2W7TA 2FPPB 4ITRC 3BDIA 3LBHA 1AB6A 4UATA 3PUHA 4J7CA 4ENRA 2W8BB 3PNOA 3HH8A 3ZW8A 2WTBA 1SOAA 2WT9A 4FP9A 1KI1A 4POAA 2D4AA 2IEYA 4EW6A 3KEMA 4QTZA 1H6AA 4UMDA 4F1JA 9GPBA 2P9TA 1Q0HA 4K6OA 1Z6ZA 2J9ZB 1BO6A 1H22A 3FVQA 4BY9E 3DLHA 2D2IA 1H3FA 2JIRA 2NZUG 5T57A 3ICPA 4EX6A 3IR6A 1ZCJA 2QTRA 4U3JA 3NM5A 3AUKA 4BMYA 1WTCA 1WBJB 3PEUA 4QBKA 3UKOA 1PFYA 3IQHX 1SELA 1Q15A 4G25A 4P83A 2BMEA 4TLBA 2GHIA 1BQ4A 2B36A 2FA9A 3JZDA 4MTCA 3CY6A 3G5TA 2HJSA 2ZWOA 3AY0A 1X1RA 3MRSA 4DLXA 3U7GA 3MG9A 3NHPA 3JARB 5KJFA 2BEVB 5D7NA 1KRXA 3LYHA 4M1MA 3OCXA 1D2NA 3OEHA 5F5NA 1EX6A 1ZNWA 2XKJE 5DFAA 3K30A 1NPTO 5ARCA 1HI9A 3EZGA 4IGAA 2R86A 2TMDA 1P9OA 5GWXA 4ZV4A 1WCYA 1LI5A 3S8MA 3AIOA 1PL8A 2P68A 4OJQA 3DL7A 4UHEA 2YYSA 4D3FA 2IY8A 3KB6A 2IT1A 4QEKA 2APJA 2GCOB 5B36A 1NTOA 2AMFA 2R5NA 4TGLA 1I7SB 5JZVA 3MN1A 2XKBA 5TQ2B 5K8JB 1WHTB 2OFXA 4BMVA 1H6CA 4BB9A 2IY9A 3N3AC 3RHZA 2CLMB 5AM5A 4F8EA 5JFTA 2AOTA 5ULLA 2RH5A 3NTOA 5EHGA 5LYYA 1SXJB 1W2GA 3HZRA 1HR0B 1TKCA 5LXTB 4OI4A 4TS3A 5FJJA 5LJLA 1NG9A 3EK2A 1H05A 2PGIA 1YH3A 3OJWA 4MQ6A 2WF6A 3PT5A 5CW1A 3VVCA 4DMKA 4LHZA 3AKZA 3FDIA 3ANLA 2IDJA 2FRVA 2NXEA 3GG2A 1UP6A 3HN2A 3SF8B 5CXUA 4Q3LA 4JJZA 4PZYA 4NG5A 5T64A 3FNHA 3UNXA 1GM5A 1GZ6A 4MW7A 1SQSA 4WLUA 1LRLA 1NW5A 2IUFA 4F93B 1T4CA 1E2LA 4Q1BA 4PAWA 2PH3A 1TQHA 3BG5A 5DGXA 1QONA 1I2ZA 2A0UA 2J5KA 3GQBA 3N8NA 5CXQA 1N57A 2C95A 5KZMB 4CM8A 3K5WA 3EY9A 2PKQP 3VPHA 4D4HA 2JIMA 2ZUBA 3OZSA 3VTFA 1XDBA 1K3UB 1HC7A 1XLUA 3EARA 4K2AA 4S3MA 1N9GA 3D1VA 5KINB 1P4GA 2WJZB 2WV7A 4P3YA 2PWZA 1MNQA 1PRYA 2GCGA 2RCNA 4MLCA 3PPXA 5ALUA 5FF9A 4DADA 1D7OA 4HQ6A 2F3UA 2QXYA 1K8YB 1O94A 4OFXA 5A2GA 4MVJE 1YXMA 5ABPA 1O2DA 5ECYA 4E6PA 4QIHA 2WKPA 3I72A 1COZA 2QUJA 3P9NA 1RIIA 1HWYA 5ADVA 2TS1A 2F1RA 2IDKA 3CB2A 4G09A 4EP1A 1RPAA 3DT9A 2ZCJA 4CQNA 5BWMA 1JGTA 1Q7GA 4O59O 3OOJA 3Q3EA 1WOMA 3EVCA 5EQJB 4G01B 2XD9A 1E3QA 4QRIA 3DE5X 2QDXA 3CW9A 4LHSA 5HRAA 1S3FA 2H52A 3CZRA 5EJIA 3RSFA 3SKVA 1YNSA 3JVVA 4I1UA 2EOAA 3DZCA 5EMMA 1Q0SA 2WSBA 3OOEA 4WT7A 4B83A 3CVXA 4JUBA 3OOYA 1FTQA 3PF9A 3EVAA 4K9MA 2Z04A 3SDSA 2REOA 4RS3A 3SSMA 1BWPA 3BKWA 1G3IA 1WSWA 1OT3A 3F1KA 5EPOA 1Z0IA 2DR0A 2DH6A 3E5MA 5GJBA 2BMDA 5JHGB 3ITNA 2V8BA 4TVOA 3LFHA 4DZRA 3TLAA 5EMLA 1QGYA 3AP3A 3KQHA 4I5FA 2ET6A 3GY0A 4PPYA 4HLUC 1IXZA 3JASA 1ADFA 2O3QA 2WNSA 2HFKA 4Z0NA 5BN1A 5FLXA 4TT3A 4UU0A 4BFSA 3R5KA 2RK4A 4L8WB 3KQLA 2N75A 3MA0A 1OFTA 2X6QA 1Z17A 3ADOA 3AQIA 4NX2A 1W29A 3UUGA 1CUCA 2VCHA 3JQAD 2F8SA 1QHGA 1WO8A 1F14A 4RY8A 2EZ9A 4WJKB 3WYGA 1TU0A 1NP7A 1G20E 3NYIA 1I6LA 4L9AA 1L7EA 1P5ZB 2W2PA 1PWYE 4HEA6 4M9CA 4XX0B 2ZRQA 1K89A 3BXZA 3OEWA 1DINA 3NT4A 2QLFA 2VWPA 4HAUA 4I7EA 4J4BA 5I5EA 3ISJA 2IH2A 2NVUA 1QR2A 3SCZA 2FHSA 1O4WA 2Y1OA 3KHTA 2DP4E 4GPZA 3SJBA 1I4TD 2I7TA 4HJRA 1UJMA 1EJ0A 1II8A 2J8ZA 3CTMA 5F2OA 3T5TA 2DHEA 4BNHA 1B6RA 1JSXA 3W8DA 4LBVA 3S6JA 4I55F 3BE6A 4G0MA 3OT5A 2ZRIA 4KPUA 4M1YA 1CUSA 4AZ0A 4HADA 5H1YA 3DOHA 4HATA 1K8RA 1J09A 2FMKA 1ENOA 1XZCA 2ID9A 4P98A 2RAFA 2JAWA 1OB5A 1WOYA 3K96A 3DCNA 3K8OE 2V7WA 3DWGA 3E61A 3UJCA 1DJPA 2BFEB 2CNKA 5M7EA 3E9MA 1VP3A 1XRSB 4RF4A 1Z39A 3U16A 1S01A 1C1DA 4PVCA 2OUKA 4JXJA 4NH0A 4KX5A 1CUFA 1M6HA 2JK0A 1ZI8A 4L8VA 3IA2A 1MIHA 4UNNA 4JOCA 4M1KA 1UBEA 2ZYHA 4H7HA 1B3RA 4RHUA 3IP1A 1U8AA 2DCUA 3L6OO 1RM5A 3QE2A 4WUVA 2ADOA 2PQ0A 6REQB 4G1MB 4W6ZA 3PQ6A 4AFNA 3IGFA 4AS1A 1E99A 1NVEA 1OMOA 4QO7A 5DK6A 2HADA 2HMYB 3HSSA 3C3CA 1X1CA 5DXFA 4BWFB 4E0BA 3TLJA 1W36D 5LYJA 1R0KA 1RZVA 3I3OA 4MQLA 2R00A 5SY6A 3B5EA 1UJNA 2HU5A 2Z3VA 2ZRAA 4KNYA 4S2UA 4HXGA 1LV8A 4MZXA 4N65A 4RHEA 4WOPA 4F4HA 4NXNB 3VBEA 3RYCA 1C8KA 1HMYA 3G0DA 3KZNA 1WXHA 5DBGA 3ZS8A 3S8YA 1YB4A 2F1OA 1SQGA 4V03A 5L95A 5FJIA 1W4BA 1ZGBA 1XZMA 4R9RA 1U1GA 3O75A 1TM4E 3HLYA 3HACA 5JJ5A 1ZN7A 1ZOLA 1N8NA 1J06A 5F77A 1HQKA 1V96A 1XYVA 1GTSA 1KVTA 3K92A 4EJ6A 3S68A 4CKBB 3FYHA 2P2GA 5BSRA 2AD1A 3AF3A 2W71A 3A0RB 3WWDA 2EERA 1OLSA 2PBZA 2WMOB 4JJFA 2XCSB 4NTZA 1A7JA 4D6PA 3MINB 4MR8A 2YCLA 1IUKA 3BAZA 3ZEAA 4Z7OB 1WB9A 2COUA 3CBGA 4Q4HA 4RLSA 1Z6XA 3WFZA 4QTYA 4I08A 2V6JA 3N8GA 4FFOA 5DTJA 3SR3A 1NLYA 1Z6TA 3EH2A 5EA2A 5F7ZA 3LYAA 1GCOA 1TW3A 1G63A 1I6KA 2H85A 2FWBA 1TUBA 4R3WA 2HA2A 2H07A 3ZJ4A 5FRDA 5CCXA 1H1DA 1WXEA 3WK4A 4AQ7A 2H11A 1T3LA 5E9JA 3LLMA 3R75A 2QN8A 5EJ9A 4XCQA 3UMCA 4B3IA 5LD2B 1ISIA 1JHMA 2D1YA 4HL6A 3SAJA 4DMGA 4LV8B 6ABPA 2BJVA 4AS3A 3GNTA 4MYRA 5AVZA 1JJAA 2G40A 3OZIA 4KLCA 3RKRA 3QKWA 3EVNA 1R0WA 2N1BA 3P20A 2OFPA 4MR7A 4ZYXA 5FEUA 1GQRA 4Q9NA 3GDFA 3NVDA 4HLNA 4BWGA 3RTBA 3VNAA 1G1MA 1XEFA 3JRXA 2C9BA 3OE1A 3T7CA 5JAPA 2P40A 4YR9A 1XP5A 3DW1X 1HEYA 3UGJA 2AKYA 1D07A 4PZUA 5IWCA 5BN3B 3AIMA 1W5FA 4H4CA 4OQEA 5CX1A 4RZSA 4BTLA 1JSZA 3DTNA 1F0PA 4EW1A 2HUNA 5HE8A 5IZCC 3PWTA 2OQ2A 3C14C 5HRCA 3D1JA 3LX4A 4UVGA 3TRHA 2AE1A 2BE9A 2QMUA 4GI7A 1MFPA 4RQTA 2O0KA 3A9CA 2HPAA 5KKAA 1H3EA 1QVRA 3WK5A 2NN3C 4M2LA 2AI2A 4UAGA 4V0LA 2YZMA 3O1LA 2ZIXA 4DILA 2ICAA 1KJNA 3UC9A 1QP0A 4QOJA 5HS4A 3DONA 3VV2A 1DTSA 3DCIA 4JB3A 4NOMA 2FDXA 4ZVOA 4KXWA 4I6GA 1OR8A 4NK4A 2MR5A 3W4KA 2YZGA 1MJGA 1NWHA 1YASA 4RV5A 3B2QA 3L8HA 1G8HA 1N3LA 3TCXB 3VR3D 3LMKA 3CVWA 3PE6A 3MJHA 4KOEC 3DFUA 2V7XA 4HJXA 1JKJA 5DTRA 2ECQA 2X3UA 4JL5A 5DJ5A 5F2KA 5FUWA 2WB4A 4EFNA 5JDIC 4JI3B 3WGIA 3FTEA 5C51B 1SB8A 3TLMA 5E7QA 3MK31 5B4VA 1MB9A 4MA5A 4CV2A 1RXEA 2XYQA 1ZP6A 3R44A 3WGLA 1TO2E 3DGFC 1Z8FA 4RX1A 5CBPA 3HC7A 3FY4A 3M33A 3WZMA 2XUHA 3KR9A 1AHPA 1FS4A 4BBJA 2FLVA 2QXUA 1FRVA 4KXFB 3OO0A 1ZNXA 2HXGA 1ZBDA 3NH6A 2IWHA 4HKTA 3TKAA 4WCDA 1QWSA 1SKQA 1ZS9A 3A6JA 4YH1A 3PYLA 3VR2D 5I8PA 4U00A 2DGDA 1GPUA 5FLKA 5BSVA 2J30A 1GSHA 4RNDB 4NJOA 1QHHB 3EGDA 3HDYA 4K9OA 2VJLA 2HWYA 1DC7A 3DMTC 5KVVA 5J4KA 3THXB 4KR2A 3IUPA 2E9SA 2I71A 3HLKA 4IRUB 4JEHA 2X4GA 2ZRPA 2UAGA 3LZ6A 3ZHZA 1QRDA 1HYQA 2HEIA 2BEKA 4K81B 1GPWB 1M2GA 1L7OA 1PFKA 1SC6A 4D9KA 1DRUA 4Q7JB 3K0KA 2X76A 1C2TA 3OSUA 1BEUB 3GCDA 1NATA 3NU1A 2G9RA 2I2AA 3NFRA 2G77B 4XX1A 4R2JA 5HQ3B 4IH4A 4RJLA 1O0BA 2ZR8A 4TXJA 2R87A 5DCYA 2QSUA 3AR8A 1PNVA 2CB9A 2ZYIA 1CJCA 5EZ6B 1K0UA 1R3DA 4IXDA 1VCIA 4LN1A 5LQKA 3D6NB 3T34A 1BW9B 3ICOA 1S9HA 2DTDA 1ZK1A 3RD5A 1L4BA 3WGNA 421PA 5IM5A 3NKLA 3F7OA 3MERA 4XWYA 3OIVA 3UK1A 3S44A 3QPWA 4HAOA 4PS1A 4X95A 1F9EA 3H5NA 4W7HA 1V7CA 2O20A 2NSJA 1SMKA 2O8NA 3ECAA 5K9ZA 2JI9A 3SI7A 3WMXA 2VBIA 1PSDA 5JMWA 4GIBA 1NF9A 1C0LA 2GA8A 2WWFA 3GAZA 5CHYA 2GZRA 1DX4A 2DQSA 2YJ3A 3TX6A 3WLJA 3TGLA 1XP8A 1KAHA 1M34E 5LQMA 3ZWOA 3EA5A 3ZGXA 4I5EA 1QIFA 5FI3A 1AX9A 1NC1A 5B3JC 2F4VB 4JYZA 2QX6A 3ZK7A 1CNMA 3CX3A 3QIAA 3BFKA 3EDOA 4AUKA 5T6BA 2CFIA 5IJZA 3L6EA 3FOEC 3TZQA 5CB0A 2LW7A 4NEQA 3IBTA 1D1TA 1NRIA 2MSKA 1EM8A 4G97A 1RYMA 2FXIA 1FYWA 2R6FA 2GASA 4RZQA 3RGGA 1GDTA 4ZODA 2CWDA 4H7JA 1BXGB 1TQ8A 3HJRA 3OUUA 4BKMA 2XUGA 2Y0EA 3VJMA 1HDXA 4RLQA 4GRAA 4TTSA 1Y5NA 2XE7A 3Q3VA 4LK2A 3UB3A 3ZGYA 1DWQA 1RRFA 2XKAA 3H5AA 5CTAA 4DXDA 3UPTA 1N1MA 3IV7A 1R4AA 3OZBA 3ZQUA 2ZRDA 4QG3A 1PFUA 1CYEA 2X22A 4RGBA 1E3LA 1DO8A 3D4IA 4NU8X 3PX2A 3D9QX 1CT9A 3UMMA 2RGXA 4JY7A 3THYA 2Y0CA 2VJDA 3UN1A 2A0KA 4EGSA 4QUEA 5BSKA 4YUYA 3B2NA 5IMSA 1QVZA 2BBOA 1W93A 2V7QD 4XGQA 1G5RA 2P9FA 3TW0A 3A4YA 1J56A 4OV6B 3AIIA 3G2JA 2NADA 2BUBA 2E1RA 1C29B 1DELA 1HT0A 4E1VA 1BZYA 1DC6A 2C5FA 3RG2A 1QU3A 1UM9B 1LK0A 1CY1A 2GCEA 1CULC 3KUDA 3NWBA 3VOTA 5A6VA 1KMNA 4JFAA 1Y9EA 2FK7A 3QBVA 4QDOA 5A4JA 1HY3A 5K3BA 3TKYA 1P29A 2BTEA 1IMOA 2O7QA 4ARAA 3P2IA 3RSCA 4R8MA 2BDTA 3L7DA 3D54D 4TTAA 1UQRA 1JDVA 1N2ZA 4PO9A 4W5HA 5HA5A 2PCJA 2PS0A 2Q0XA 2X0IA 3AFIA 4MKFA 4C6HA 5LSAA 4O2AA 5J2TB 5HEKA 2VTBA 4QUHA 2BKAA 1V5WA 1EXVA 1JXQA 4C0JA 2AX4A 1Z6AA 4FUTA 4AY5A 1I2AA 1TTTA 1C81A 4GPEA 1KKMA 1L1RA 2J0EA 3NHAA 1A50B 3PDCA 3EAQA 3BIXA 3S40A 5ERXA 4HZUA 4AM8A 2O6LA 4RPKA 4CKEA 5A5EA 4B5LA 3C6ZA 5BOSA 5CU7A 3RLFA 3DZBA 2GPNA 4WY8A 1EFAA 1RQ2A 1U8ZA 1G38A 4AZVA 2O06A 3ENVA 3DBOB 3F4LA 4PLTA 4RGVA 3WTBA 4N7BA 1GWNA 1OZGA 2HKIA 2YFQA 1V8FA 1RP1A 5ALZA 4GX5A 5EQFA 3ZHYA 1CR4A 9LDBA 3D3WA 4PE5B 2D3WA 3UHAA 2K7FA 4YREA 4JFRA 3E0QA 3I6BA 2BIFA 3DZKA 4KDEA 4PZCA 3AF2A 3LY8A 1QO9A 2B7BA 3DCJA 4ZK2A 4XZ3A 1P72A 5ITWA 1DCTA 3P7MA 1RHKA 1DG9A 3CWQA 4IHJB 1O03A 1C14A 2B5WA 2L2QA 1W85B 4OBEA 1DTWB 3CGWA 4Y2HA 4QPPA 2A8YA 1LJ8A 4EHLA 2GNPA 1W2WB 3L8DA 2FSUA 4US0R 5ALHA 5DNWA 2VYCA 3UAGA 3WYAA 4G26A 1M2VB 1DMRA 1Q12A 1YZFA 4CFSA 5JD5A 1BMFD 4GPIB 2O23A 1T2FA 4URFA 4HNAA 4ZOAA 1BA3A 1Z38A 2ANBA 2WRZA 1E4VA 3KJQA 3NWPA 4M0PA 3ZV7A 2EKLA 3NALA 1C30B 4LV6A 3LQQA 4KDRA 3W3ZB 3P9IA 5BR7A 5J1SB 1E5DA 1R8QA 4LGCA 2OO5A 4MPTA 3P45A 1KIAA 2JJ1A 5HUQA 1H2RS 3ZWMA 1JAZA 1CP2A 1Y33E 4HFNA 1V3VA 5K3DA 5ER6A 5GONA 2OBYA 4Y9RA 2YRFA 4DZTA 4LY6A 2LXNA 3F6PA 3SZMA 2AKAB 2J85A 3A9WA 2WWIA 1QAMA 1YCDA 2ETVA 2QI9C 4E5YA 2ZJ5A 2P0AA 2PM8A 2QIOA 2V9ZA 5H83A 1HYEA 1N5JA 1NXXA 1JQKA 1U6JA 1ULBA 1J8DA 3GZTB 3MT8A 4ID9A 4WKBA 4XH9B 5CLIA 3B8EA 3HYNA 1W5AA 3A1FA 4MVCA 5J47A 4B74A 4HY3A 3C1OA 2I22A 3ZCVA 4K28A 4U3JB 3VTZA 3B36A 2P1ZA 2VDPB 3NGLA 1JP7A 4WGGA 4KMMA 2AG6A 4BX2A 3ROQA 2JIOA 1UFQA 4UZSA 3NBUA 1CHDA 2VHVA 4XCXA 4UBOA 3ZWVA 1TF2A 3AI1A 4B6JA 2UUCB 1KJQA 3BWEA 1CF4A 1O6ZA 3BCHA 2ZBRA 2R8XA 3UG7A 1KZ4A 1AGRA 2WA2A 5E7IA 1MVOA 5DRTA 3MJ4A 4R2IA 2AHOA 2CNBA 1G8SA 1FDSA 2D7CA 4RAQA 4NU6A 3SMQA 4C4PA 1QAQA 4KDCA 3F67A 4YXFA 2J0SA 5A0FA 3KLBA 1X39A 3A0UA 3REOA 4F0JA 4UCXA 1GG2A 1V8DA 1JI0A 1NMSA 1TW2A 2FPLA 1U2QA 4B40A 1FP2A 4K9DA 1JDBC 4QDXA 1CQJA 1MDFA 2P5YA 2P91A 3MAAC 4ILKA 3ORHA 3LHSA 5D3QA 3DUWA 3IRUA 1EGQA 1TTQB 1ZD5A 1WKVA 1XCMA 3GK3A 3LQ1A 4IW3B 2L18A 1CVRA 4I6EA 4UNPA 2PT7A 1N34B 1TEHA 3RYTC 2C99A 2OESA 2QPLA 4TLCA 1T5IA 1H0HA 2AOTB 2W6JD 2BVNA 2WLSA 3HGMA 3IQWA 1KQOA 3W6PA 3U4GA 4DA7A 1FRFS 2QMHA 3V2IA 2FVXA 1NMZA 2EU8A 3BJIC 1SR8A 1IWOA 1V45E 4FB5A 4CT4B 2IIQA 4CDRA 2JJMA 3N75A 4JZKA 1JAYA 2VUTA 1W96A 4ZVUA 2F9MA 2W83A 4R8SA 3OJCA 3GP8A 1VRVA 3GW8A 3ICEA 3BN3A 4A8TA 3ZDZB 1ODLA 4CM9A 3UCXA 5IKMA 1X9GA 1OWPA 1V0JA 3LHDA 2BHTA 4EENA 4F4DA 4QVIA 3I28A 1T4CB 3AOGA 3UHJA 4D82A 1PV1A 1JQLB 1UXIA 4K26A 5CVDA 1KY5A 3GQBB 3FGOA 2M98A 4RVUA 5KYNA 2CNOA 4IGEA 2O6HA 4CM8B 2O07A 5JAUA 3MAJA 3RIHA 4TTQA 1EX1A 3QJGA 1T2NA 4URXR 1N9GB 2VQFB 1XLTA 1V25A 2Z95A 4XEHA 1UKVY 2ZCVA 3JQBA 3UMJA 3V00A 3VR5D 4MJ3A 2B8TA 4DUPA 2Z2JA 3IPAA 1VKOA 2NVBA 3OPYA 4PZLA 4ZVRA 1NFQA 4JR1A 4P93A 2MR6A 3B48A 4R40A 1O96A 1U0OC 5E9WA 4HC4A 5AHOA 3TOCA 1S1MA 3QKIA 3AXSA 2QN9A 3KFLA 4RSGA 3NAMA 3FN4A 3SS9X 2C2GA 1QG2A 2BGMA 2F3TA 1DI0A 3EZLA 4UEOA 4EMTA 4QJ5A 3GDOA 1QE3A 2ZE5A 3KK0A 3BL5A 3TMAA 2Z8ZA 5IJWA 1BEEA 1PK8A 2WFZA 2I76A 2RDMA 3DWFA 3C74A 4QX6A 3C6KA 4NYJR 2ZYVX 1NVMB 4QPNA 1JDPA 3NJ4A 4KPEC 1CUAA 5A5VA 5EIAA 3IOMA 3W79A 3HTXA 5H68A 2XGMA 3R9KA 3KT0A 4RQAA 2AR0A 5D1HA 3ZWBA 5EJ4A 3EVTA 2HL6A 3AFOA 4JVSB 4M8IA 4Y2UA 3SBDA 3FXAA 5I4IA 4ZCPA 2YC2C 1KEVA 3WQBA 1OXTA 4RVSA 4LCJA 5D3MA 4LHWA 1IOLA 2WIDA 5DF1A 4OGLA 3HXOA 1G4AE 1N1DA 1RLTA 3UGQA 4JOBA 4A27A 1LB1B 3ICCA 3I83A 3FRHA 3JASB 2IP2A 3DOIA 4FW9A 2NO6A 4H35A 4J1SA 4OBXA 1E2EA 2GJ9A 4DR7B 2B25A 3S2FA 1JEJA 3FVRA 3LGXA 2M6SA 4UDYX 3OBBA 3E9CA 1OPRA 1UK7A 1T1GA 3P9PA 3H2HA 3UK2A 1HNZB 3MJDA 2Q3CA 3KKOA 4IDOA 1Z25A 3QEMA 4RY9A 3S99A 2SNIE 1V47A 1XXLA 3GLRA 4QVKA 3VZSA 6AT1A 1IZYA 3D2CA 4PSAA 5GADl 1ID8A 1H9AA 7ADHA 5EKXA 4W82A 2QA5A 1JFTA 4GZMA 3BF8A 1U3CA 1K06A 2JCXA 3DM9B 5EIOA 3X1JA 2NVUB 2H7YA 1SJ9A 2XECA 2Z0MA 4C2BA 1OH7A 1A8PA 3GH3A 2EP5A 4TVKA 1VC2A 4Y30A 1XDSA 2HV9A 2PWBA 3RJTA 1FQOA 3DNPA 2BHNA 3FHOA 1II8B 2VDJA 4K9NA 1DS6A 2X8WA 1SXJC 4FBGA 3H86A 5GINE 4OMDA 1P7CA 2MJLA 3REGA 2CJPA 4AU1A 4XQ9A 4EG1A 4BNZA 2OKGA 3BJZA 5F33A 3LM8A 4F4IA 4KPUB 2X77A 1K3FA 2AZ4A 4L5JA 4AZ0B 1FK8A 2WICA 3HY3A 4M0KA 2J6CA 2XB4A 5JXGA 2CSXA 5IT5A 1ULAA 2CZCA 2P0EA 3N8DA 3V3TA 4DLNA 1X1EA 3WGGA 4I8XA 2V3CC 4M9XA 3S2SA 1N5RA 4ICIA 2XYVA 4S35A 1H69A 5JWRA 3FMGA 1ECCA 1C1DB 4XVCA 2G9VA 1W4AA 3NT5A 1G6HA 2CHVA 1NLFA 3ZCQA 3C41J 3D4BA 2BH2A 3AB7A 2RH9B 5SZJA 1B4DA 4NFYA 5F1YA 3F9CA 3FYTA 1M2JA 3PA6A 5DMHA 3TLYA 3G5AA 4D26A 3QTBA 3K1JA 3UTCA 1IM5A 3HI4A 3F90A 5LYJB 3BKXA 3C3BA 3EPPA 3DE2X 4EHHA 1WEHA 2NU9A 5JWHA 3T7IA 4AQYB 1EWQA 2CJFA 1BRTA 2XBMA 1DKMA 2P27A 2Z5VA 3PUJA 4TTIA 1DJLA 2OMKA 3IKVA 4I9GA 1KYYA 4BNDA 2MYTA 3A36A 5HVNA 3RYCB 1ZJ6A 2Y66A 2WD7A 1J2UA 1X1TA 2DQKA 3G8CA 1XTUA 3LTEA 1NHGA 1NP6A 1PU2A 1VGRA 2BKXA 4FFRA 3U7JA 3WRXC 5FBQB 1JR4A 1JEAA 4RCZA 2MMCA 1RI4A 3LKVA 3UK0A 3CNQS 4IEFB 3WNQA 2HU2A 1P91A 5DASA 4MVJG 4QBHA 3ZIAA 4D97A 2QYOA 1GCAA 4RXMA 3WZLA 5JCOC 4FYXA 1ITZA 1GYPA 4EEXA 1OLSB 2UVPB 1GNQA 1SN7A 3VNSA 3WK9A 1TUIA 1D2EA 2ZUUA 4MR8B 4ABTA 3EBPA 2RIPA 4Q4HB 4CIYA 4NF2A 1DEKA 4AUEA 4D4KA 2X0JA 3AJ9A 1HK7A 2JGMA 2NXCA 3RSOA 4RY2A 1TUBB 5JYDA 3FYDA 1XNQB 3MAGA 4EA8A 1JLLB 4G4GA 5BY2A 1T9ZA 1V1JA 3ILVA 3ACCA 1S2DA 3GLHE 3N59A 4XGIA 3X1YA 4B4DA 3V46A 1FUIA 2LUOA 1O08A 2CLCX 4G8DA 4HSGA 4PQEA 4U9IS 3ZYCA 4AUNA 1P6QA 1FNSA 3LYLA 4DAOA 5F52A 2VYVD 4F21A 2QTBA 2ZQZA 3UH0A 3GEHA 1GT6A 1ZRSA 1JT9A 2I9KA 3U2QA 3HPRA 1BX3A 5KTPA 3ND8A 4LF4B 4MR7B 3WGZA 4E3WA 2JDID 1GQFA 4M9RA 2Q07A 2WM9B 4O25A 2RHBA 2UV8A 1T9CA 4OOEA 1W94A 4DBZA 3VHQA 2FEMA 2Y71A 2OWDA 3DHWC 4UNQA 3RS7A 2C78A 3DOFA 4NHOA 5HCIA 4FR0A 2W2LD 4EL0A 2YUIA 1QZTA 1KI8A 5CX1B 2H1RA 2XVYA 3T5PA 2GILA 1JEDA 2ZBFA 1SKAA 1DKNA 1JJ7A 4I1RA 2UZAA 4KQ6A 2D54A 2P90A 3I76A 5H4HA 1LXCA 2GF2A 5KYGA 1U63A 4O3FA 2RKBA 3GFBA 2IOHA 3ECSA 3B8HA 4Q9AA 3EXAA 3RASA 3WBFA 2R0QC 2ZIXB 1PQUA 1CLUA 4KXMA 2D4HA 1MORA 4UBKA 2JCSA 3OLYA 1QCDA 3DZDA 3PNLA 1TU3A 5G02A 3WK6A 3GEMA 1NQUA 1MAUA 4FHGA 1ZW6A 5SY9A 2XXBA 4J3FA 2WNHA 4JJ8A 3ZNOA 3L1HA 4ASUA 4FI3F 3ZZMA 2Q4BA 1N6KA 2QTGA 4G1UC 4ZVNA 2XODA 4BKUA 1CEEA 2VZ8A 5DM2A 4RVOA 5IT4A 1KS2A 1JKJB 2WY2D 5BV8A 3MTJA 3TOZA 2VYNA 2OZPA 2CYCA 4IQ4A 4KGDA 2Z83A 5HFNA 3CPJB 5G0WA 3E2IA 1IK4A 1X2EA 3B82A 4MI3A 4JH0A 4H9GA 4D43A 4TTJA 2XZPA 1ACMA 2DT5A 4ZRDA 5CBPB 2ZG6A 5CEFA 5IG2A 3HL4A 3TSAA 1DEXA 2OC9A 3KJEA 4NP6A 1XQ9A 5CD9A 5LDHA 3A4MA 4DNPA 3I58A 4JU9A 5FR1A 2JAHA 3TXAA 4CI9A 4A15A 1RZRD 1S7GA 4ERXA 2X3YA 2AMVA 2H4ZA 3PRKE 2KI5A 4OJKA 4BIIA 3CZ5A 3MMXA 1YZKA 3BH7A 5D1NA 3WNDA 4PFQA 4DN6A 3D59A 4M1SA 4X7BA 3GUZA 1TLTA 1JLKA 1W30A 2RARA 3LX6A 2DBYA 3BMNA 4A0RA 4D8YA 1IN4A 2J3JA 4J91A 5HP4A 2FU5C 4G2NA 3DO6A 3TZBA 1O9GA 1PFVA 3RTDA 2WYHA 3Q2KA 2MSCB 5BQ5A 3G88A 2AUNA 1XB2A 1EFUA 2COKA 1MRZA 3CR8A 3TDNA 3G0HA 3TVDA 3RWBA 3ETEA 2NVWA 4QWWA 4DUZB 4Z7NB 1YC5A 1R66A 3H9UA 2I4IA 3BHJA 4L5CA 4P4SA 3WA6A 1F2TA 4DLWA 1W1UA 5I4BA 3V42A 2I6UA 5FPKA 3JSAA 3AHCA 1YHYA 5LYJF 1U4NA 2PYDA 1Y8ZA 1A9ZA 1I4EB 3DYVA 1SVIA 2DKFA 1Y6QA 5TMBA 1P2UA 3LQFA 1ZICA 4HEA1 2J0QA 1FX0A 1EQ2A 4QXMA 5LD2C 4UFNA 4YR7A 1A76A 3ZK9A 2CC2A 4X92A 1LSJA 1NG1A 2WIGA 1KS9A 2JFZA 2FN7A 3JYPA 4BV8A 1JHZA 4IRMA 5TPZD 2OV6A 3PTLA 2B78A 5CURA 1D9ZA 1KQNA 4MUXA 1X1SA 1FRZA 4JSRA 3BIFA 5DM4A 4WWHA 3SIRA 1B6TA 3SX2A 5H02A 1IUNA 1EXMA 4B7UA 1RWPA 1ADBA 1UXKA 3W5SA 2YWBA 5IXYA 3O94A 3RFXA 2PT9A 1HRKA 3IXQA 1QQAA 3F9RA 1I3OA 2V74B 2JIPA 2ATVA 2Z2YA 2XA9A 3D7MA 4FKMA 4HVTA 4DLZA 3R3UA 4DMUB 4C7OA 4LQDA 2FUKA 1Q14A 2E4YA 3HKBA 2FAXA 4Z1MD 2VH2A 5B64A 4HH1A 2CXPA 3KM0A 2YFHA 5AJWA 1EM8B 2BFDA 4G0QA 4GE0A 4KITB 3ANYB 4R1QA 3EAFA 4RTRA 1Y4ZA 5E6RB 5BW5A 1R6XA 2Z30A 1N1GA 5K7SA 4RTSA 2EX0A 2CD9A 3RS4A 4GL2A 1YIOA 1YS9A 2ODPA 5GY7A 3H83A 1X74A 3CRMA 3ZHRA 3L4JA 4IS3A 2W6MA 1OWMA 2GSWA 2A5FA 1AF7A 3LA8A 1H0SA 4D3ZA 2JGFA 4YS6A 5BQOA 3RBVA 2R62A 1JXMA 1K88A 4F3RA 4F84A 1FLDA 1IY9A 2Z3WA 4YTEA 4B7XA 1R6TA 1CRQA 4MITA 4WECA 3STUA 1D4AA 3IP3A 1I3MA 1KK3A 2G4CA 1RP7A 3VC2A 4AZSA 3THYB 1Y37A 5AKJA 5DISB 3O8CA 1K9SA 2AMLA 4P4TA 5L8VA 1OH6A 2BE7A 1U0SY 3OH8A 3QJYA 4RD2A 4QRHA 2CF5A 2GPYA 2EZTA 3LECA 1NSYA 4H7FA 4L72A 1GUBA 1BE8A 3TDMA 3SC3A 2PEYA 3ETDA 4AY3A 3LUDA 3L5KA 1OE0A 2QAIA 2UZIR 3BB1A 3DW3X 4GBGA 4U7JA 4D8XA 1MJHA 5IVPA 4OI0A 1KYWA 1H3NA 1VSTA 4G8BA 3T9CA 1CUDA 3PGA1 2F9LA 5C1OA 1WW8A 2QYSA 4TL9A 4XPIA 2MYUA 2YBEA 3DL2A 3DNMA 3FWHA 1EWVA 1GFIA 2H7XA 2QSZA 2WIJA 3FX2A 4P54A 1IK6A 5AJYA 1WZEA 5AJUA 4ZT5A 3W05A 1E3DA 5MDHA 3VKUA 4C04A 2BF7A 5F4BA 3B89A 4O2AB 2VTBB 4J43A 1VGQA 1C50A 4RO0A 1RE1A 1Z6YA 3BD6A 3HYTA 4UAJA 5EY5B 2Z43A 1IOVA 3MJVA 2JD2A 1V8ZA 4HZUB 5HIMA 5DCWA 1ZCFA 4PNHA 5AHXA 3VNBA 4CKEB 5BOSB 3HNOA 5D3KA 5E9QA 3CVUA 4RWEA 2R751 3MFQA 1SBZA 3IBCA 2E6UX 3O95A 3F3YA 1W0JD 3QP9A 4QU9A 3COPA 3QXJA 1BFKA 4G6ZA 4YUWA 1N2EA 3NHBA 4ES6A 4YMSA 3D3WB 5BWLA 3N6VA 2ZJ2A 4C07A 2C57A 1ADYA 2I1QA 1GUYA 4G65A 4DMRA 3HCAA 4UKDA 2GK7A 4C43A 1PD0A 2RC5A 4GGMX 4D1YA 1YFJA 4RV4A 5TMDA 3PNSA 1C7FA 4Y0AA 5I6DA 1T5DX 2CBXA 3N2NA 3TR6A 1U2PA 3DXXA 3W7VA 3NDRA 1L4KA 3CLRC 1KU0A 5A4FS 4W5QA 3UEOA 1UK6A 2X42A 1H85A 4IJUA 1IZ0A 1QVVA 3HG7A 3O0DA 3QQPA 3WLOA 5JVDF 5D7BA 3TVTA 1IEXA 2VF8A 3DZFA 1TCVA 1IHXA 4XLZA 4M7OA 4D02A 2HJRA 3DF9A 3HN6A 3A9TA 3UIEA 4BVKA 4HNAB 5HNKA 1QV7A 1YIAA 1BH2A 1QRAA 3S5JA 2CXNA 1O97C 1A69A 3CPHA 4PLHA 3ZNPA 4L7VA 3F9IA 4BNTA 4MIKA 3NTUA 3BE4A 3ELUA 3FI9A 4FXPA 3QXXA 3R77A 5FFMA 1BH6A 4AG6A 4IFEA 1TZJA 2DBRA 4UM5A 3WO0A 2IYLD 4K3VA 3KUUA 3RUCA 1CXZA