1AUQA

A1 domain of von willebrand factor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
208
structure length
208
Chain Sequence
DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the von Willebrand Factor A1 domain and implications for the binding of platelet glycoprotein Ib.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Willebrand
molecule keywords A1 DOMAIN OF VON WILLEBRAND FACTOR
total genus 75
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 1997-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1auqA00
3VI3B 3HI6A 1IJBA 3HXQA 3PPYA 5HJ2A 3NIFB 3T3PB 3PPVA 5KYYB 1FE8A 1U8CB 1L5GB 2VDOB 3EFOA 1N3YA 4C29A 2ODQA 4XW2A 3ZQKA 5KYXA 2VC2B 3EOAI 3Q3GE 1MQ8B 5E6SB 1XDGA 1JEYA 4WFQA 1RRKA 2XGGA 3K72B 4DMUB 4Z7QB 3TVYA 3TCXB 3M6FA 1FNSA 4Z7NB 1V7PC 2WINI 4HQLA 1DGQA 1PD0A 5E6SA 2VDKB 3K71B 1JEQA 3ZE2B 1U0NA 1ZOPA 2M32A 1SQ0A 4HQFA 1M1XB 4WK0B 1JV2B 1AUQA 1YVPA 3RAGA 4M76B 1BHQ1 3NIGB 5E6RA 1ZOOA 1OAKA 3EH1A 4UM8B 3EG9B 4IHKA 2VDNB 1BHO1 1ATZA 5KYYA 3GXBA 3EGDA 1M1UA 1SHUX 1IJKA 2NUTB 3FCSB 4HQOA 1SHTX 2VDMB 3V4VB 1DZIA 4IXDA 1IDN1 1T6BY 4HQKA 5E6UA 1MQ9A 1XDDA 1CK4A 1ZONA 2NUTA 3EFOB 4MMYB 2X5NA 4MMXB 1Q0PA 3ZDYB 1MHPA 1M2OA 5HGJA 3ZE1B 5KYUB 3EG9A 1YVRA 2XWBF 4NENA 1XUOA 1RTKA 3BN3A 4PN7A 5LN1A 2NUPB 1NA5A 1AOXA 1LFAA 4A0QA 4G1EB 4CN9A 4O02B 4WK2B 3ZE0B 4G1MB 3PPWA 1RS0A 2O7NA 3V4PB 3HXOA 1PD1A 2NUPA 2VDLB 3E2MA 3EGDB 3T3MB 3BQNB 4C2BA 5BV8A 2ODPA 3F74A 4NENB 1TYEB 4F1JA 2ICAA 3N2NA 3ZDZB 1M10A 1N9ZA 5E6RB 4F1KA 3IBSA 3NIDB 2IUEA 1QC5B 2NVOA 5KYWA 1JLMA 2VDRB 3QA3E 4WJKB 4NEHB 3PPXA 3EOBI 1JEQB 3FCUB 4UM9D 3K6SA 1M2VB 1PT6A 2QTVA 4IGIA 3EGXB 2VDQB 1PCXA 5ES4B 3K6SB 1JEYB 2I91A 3IJEB 1U0OC 3BQMB 3EH2A 4UM9B 5KYWB 5KYXB 1CQPA 5HDBB 4MMZB 1IDOA 2B2XA 1T0PA 3F78A 1QCYA 3EGXA 1MJNA 5KYUA 4FX5A 1M2VA 3TW0A 3VI4B 4C2AA 2I6QA 5E6UB 1RD4A 1UEXC 4WK4B 1QC5A 2VDPB 2XWJI 1MF7A 3TXAA 4BJ3A 1AO3A 2WW8A 1MQAA 4Z7OB 4CN8A 3ZDXB 4CNBA 2I6SA 5KYNA 4HQNA 4JDUA 2ADFA
chains in the Genus database with same CATH superfamily
2H4WA 3O3NB 3VYUB 1G1AA 3K0HA 1JEJA 1PYOA 1FXWF 2O3JA 1VXRA 2GMWA 3D8BA 5JQGB 1NE2A 4RDCA 5L6LB 1YR2A 1ZH0A 4MP6A 1OWOA 4NCJA 1ESZA 4QU8A 2W2XA 3DE0X 5TR9A 1U7UA 3AWDA 3R3VA 1J2TA 3U4QB 4U2BA 3CUWA 4LZZA 2HA7A 2G6BA 4CIAA 4QQRA 4HDSA 4MIYA 2LR0A 2HRBA 4RXMA 4WUVA 6ABPA 5CTAA 1MD9A 5ELMA 3IKJA 4P58A 2QQ5A 3VTKA 4B6QA 1HPLA 2FP3A 3UUEA 2G6TA 1I1QB 3FPEA 4FCTA 1Z07A 4TN1A 1RPAA 2ODBA 1E2LA 2QX6A 4F06A 2WIKA 3O8QA 1HYGA 4BAUA 3SDBA 2PGAA 3NNDA 3MWLA 2FFAA 4FGJA 1CF4A 2HIHA 1ZOSA 3VFDA 4FXPA 3FUXA 3JYQA 2J5QA 1YVPA 5DTEA 1FDRA 3BSFA 5EOVA 3QIVA 4A6EA 2WJYA 2PZGA 3LSYA 4DLXA 3DOOA 2QJFA 5IYZF 3VPDA 3FTEA 1LW6E 3TX2A 3ICOA 1JPJA 3LDHA 5D8DA 4F5WA 5ICSA 3EVCA 4HAWA 4JGBA 5AW0A 2GHTA 1F3OA 4QASA 3UT6A 5B5SA 2XMCA 4TLEA 4N0PA 1FX0A 3DOJA 3ELBA 4ND2A 4ZMBA 1CIVA 1TKRA 2A58A 5EZYB 3EDOA 3O93A 4LVNA 5JJ5A 2YL2A 5LP1A 3SY8A 1UIRA 3VKUA 3AHFA 1XE3A 3TB4A 2GXAA 1CFJA 2A9PA 4FMPA 4Y6SA 4JOCA 4KL8S 2B8TA 1I7PA 2X13A 4Z1MA 4MJLA 2I9PA 3RC3A 3TRKA 3G0CA 3IDAA 4KLNA 4LCEA 2I7XA 3TVDA 2R5FA 3LF1A 4BKPA 4AJIA 2AZ4A 1S8NA 1MBZA 3TR0A 5AUOB 4MW4A 3VNSA 4D0NA 4G4SO 2PMDA 1W52X 5KTKA 2JK0A 3DDOA 3U0BA 4GGOA 4JC5A 1ZWLA 5I9IA 2BOVA 3B51X 4EA6A 2WVAA 1DDIA 1HMPA 2DH6A 2J3HA 5KVCA 1CUUA 2YY5A 4B81A 4LGCA 2GRAA 4PZ9A 4YIHA 1BGXT 4CL0A 4YECA 5CB0A 4RXUA 2GCNA 3CSDA 2QI9F 3CUEF 2DWQA 1UJ5A 4B33A 3AUAA 4XX0B 3DUFB 1Y7LA 5JAMA 1KY5A 1H3NA 1U3UA 2RSLA 2C5EA 3P9PA 4Q24A 5HQ3A 3KB8A 5EGNA 1X7WA 3RU9A 4UCFA 4AUMA 3A4MA 3LIPA 4W7SA 2WSLA 2A0YA 3FWPA 2P5UA 2ZUVA 3Q87B 4KRGA 3VOBA 3GLFA 3P4UA 2WFLB 1MUUA 4RZSA 3SP1A 3WLOA 4C6RA 5K8UA 4KDCA 5EJMA 1F5SA 4BHTA 4OBXA 1XSEA 4MW2A 3FWNA 3HCBA 5LDGA 3CX7A 2QJWA 2O8FB 3S8MA 4AZSA 1Y33E 4RK7A 4HZIA 1W88B 4XDYA 3VV3A 2ET6A 3HJHA 4DN6A 3FN4A 4P4NA 1ZXLA 1L5GB 1K7CA 3GI1A 1EINA 4ND5A 4QOFA 1N3YA 2C9CA 1NPDA 2ASEA 2QYHA 3NWEA 1JBEA 1TKCA 4KLCA 1GPAA 1SURA 1EE9A 1Y5NA 2MR6A 3C6KA 4GZ3A 4IQ0A 3WBFA 1LRKA 2PRIA 3C1TA 4MQ5A 2RG7A 5E6SB 1THZA 4K3UA 2UZ0A 2W2QA 4MYTA 2PANA 2VYVA 5H16A 3RFXA 3ZHXA 1FNSA 2O05A 2FUG6 3T5MA 4H0CA 4GLOA 4JOBA 2WWWA 4PLCA 2O57A 3I76A 4KPFC 1DKLA 5EWMA 5BUZA 5LMCA 4ASUD 4JEHA 3ZD9A 5B3LA 4FMCB 4KWIA 5BXQC 3M6UA 2WJZB 1HC7A 4NOJA 5J3JA 2M9MA 3W8FA 3ZNNA 1M74A 3UMSA 4LDJA 2FHPA 3VR4A 4LGMA 1OLSB 3A9RA 5JPIA 4XM1A 2O8BA 4KN9S 4M8SA 1P0PA 3P0JA 3CRMA 4JHXA 4GYJA 4I50A 4E12A 1AKWA 2IYVA 4JXZA 2GH1A 4DKJA 4GC9A 3A4VA 4GICA 4BFUA 1R8YA 3H7IA 1UWKA 4YDRA 3RKUA 2XBUA 3WL4A 4HB0A 4IVNA 2A9OA 1YZHA 3P2OA 5KC8A 1XVUA 3CIOA 1NOKA 4J1TA 4YWHA 3ZU5A 2RKOA 3D0RA 3EB9A 3KOOA 3PZRA 4NBLA 4BYGA 3EA4A 4NQZA 4NNPA 4WZAA 1KJQA 2IA5A 3A7EA 3EEFA 4EW2A 4FHCA 2FXVA 4MV0A 2ZVQX 2FX2A 2W6NA 3M6LA 4MITA 1HNWB 3QUQA 1X7XA 2VR1A 4HTFB 3P4YA 2GAAA 3HADA 4B1FA 3CGGA 1EX9A 3O4FA 3MLAA 3VM6A 2KQUA 4OHFA 4H7FA 3HH8A 3W05A 4QUHA 1TA9A 3NWJA 2LV8A 5EXXA 3KT3A 4RVFA 3VSCA 3E3NA 4YJFB 3L41A 3DMFA 3E27A 4LAFA 4F9FA 2V5VA 3ETCA 4X00A 4G63A 3U31A 4JLUA 4MINA 2JIPA 2GHRA 2YNMD 3WRXA 4BKRA 2VTVA 3IJEB 5JJKA 4DPLA 3EIUA 4RLFA 4R7ZA 5ER6A 5HVNA 3M0EA 2WICA 4UCQA 1O6FA 2B78A 3B89A 2BM9A 4RWEA 1J20A 5KKNB 5LBUA 3PKZA 1ONSA 3P0IA 4IIUA 5IAKA 3TRJA 3CCBA 5BW5A 2ZR8A 1RDFA 1KI3A 4P7BA 4CGYA 4AWXA 2XQGA 1D3AA 2ECOA 4OU4A 5C52B 1UDWA 1DZ3A 4NYIR 1CY4A 3BTSA 3L7JA 2R0QC 3DE2X 1IN8A 1CZOA 5IT0A 1Z4PX 1G20E 3FY4A 4U9HS 2XRZA 3RJ9A 4M60A 1F20A 4IHJA 2GZRA 1TM3E 1KAQA 4HGPA 2CJYA 5E7IA 5C34B 3ENNA 2W37A 3SWWA 3B9PA 2P8JA 3MGCA 4M1MA 3N2EA 4NS4A 1Y7PA 2F8MA 3TBKA 3T94A 1FUKA 4PRYA 1RMQA 3KCQA 1EE1A 3E6AA 3AJRA 3E2IA 1K7YA 1NASA 3K9GA 4R68A 3P4XA 3QV1A 2H1RA 2WHPB 5ALRA 5E1BA 1WVGA 2W11A 3EXFB 2PS1A 2IL1A 4X90A 1T34A 3TK1A 2EGUA 4EHDA 3TEMA 2V7PA 3GUCA 1HNZB 1QPGA 4UATA 1B0UA 5DM70 4NWIA 3W8RA 2CFCA 2QORA 4DLYA 1TLFA 3GD5A 3QK7A 1JHYA 5CURA 3RSOA 3VMFA 2P75A 4BOYA 1GJRA 1CYEA 3HLYA 1QIKA 3TTVA 4EF6A 4I3GA 1T1IA 3DDNA 1QXSA 1NN3A 2QENA 1I3OA 4WN9B 5DEIA 2AFVA 1DC8A 2FUEA 3K6JA 4O4IA 1UMBA 2HBZA 2O7RA 4OPMA 4OQDA 2QSJA 4FN5A 5EVCA 3MRXA 4PR3A 4U7PB 2VWPA 2OD2A 3L7CA 4G3XA 3ROPA 1AB5A 4MR7A 2XGMA 3K4PA 3ZHVA 1M8PA 3URMA 4LBZA 1M3SA 2GN4A 2OP0A 4FUTA 3P71T 5G1OA 1ZXBA 2WE7A 1E2IA 3IDQA 1E5LA 5BQXA 4WBSA 1XNHA 5IYZA 1KYQA 4X7PA 3KP1A 2VAXA 2DTXA 2O2CA 4MP3A 4NEGA 4YCNA 3B12A 4MRMA 4XFJA 1GFZA 4ARUA 4M9XA 3B78A 2W43A 2VS1A 4K05A 3RS0A 4J0EA 3UA3A 4POOA 4NYJR 1R9JA 1XJWA 3D4PA 1EWRA 2O7NA 1M8JA 5AK4A 3O8NA 5EPOA 1NHWA 3DZJA 1PJRA 5BNZA 4AQYB 1U7WA 3GEDA 2C0QA 4JUBA 3WIVA 2I2WA 1R6AA 3CKMA 3ETJA 2D7DA 5BW6B 3DBRA 2X8JB 3ISTA 3MJ4A 3HJNA 5H4HA 2WWFA 4NBSA 4B82A 1NLFA 4A0SA 3D3QA 2P9JA 1T4BA 3FCUB 3L6DA 1UXHA 5TF4A 5D5HA 3T15A 1R6UA 4TV9B 3EGXB 9ABPA 3RI3A 3VPFA 1XRSB 5JH7F 2F3PA 2JLWA 5H68A 2FQ1A 1U1GA 3RBVA 1ULTA 2FQYA 2JGRA 3QVKA 3S99A 1V7ZA 1ZLYA 1IAVA 5CLFA 4PYJA 2H07A 1ID8A 3RU3A 2SCUA 1J6UA 1OLUA 1E77A 3E8XA 4Q1EA 4RQUA 2IV3A 4BVLA 3C85A 3EVGA 5B57C 5JV5A 2BGKA 4PEVA 4NK5A 1KZ4A 1PJZA 3PZBA 5D85A 5ICCA 1EXVA 4LC0A 1FTGA 3OQBA 1O95C 3SDSA 1IQ0A 1VE9A 1WZIA 3Q9LA 5ELLA 3R5JA 4PLGA 4Z0NA 4BP9A 4ER6A 1FDIA 5C8ZA 4MGZR 1GTSA 1FFCA 1YZQA 2X5OA 2O2HA 2C7PA 2XAUA 3M6WA 3SLRA 3AVPA 3UAYA 5EJ9A 1UEXC 4MRRA 2XMSA 1B15A 2RHWA 3LLVA 2B1JA 3C16C 3S1SA 1Z4QA 1O3YA 4M6WB 2CXNA 5DWQA 3ND5A 1DLJA 2QE6A 3IB3A 2LDBA 4C87A 3PUJA 1OZHA 4J8PA 3DS8A 2C7QA 3MW8A 2ZPUA 4C14A 1TECE 1C0LA 4JMPA 4Z4GA 2OBFA 4OXKA 4C5AA 3Q10A 4A6DA 2Y1DA 2QIOA 2DUWA 2UZIR 4A8HA 1ADJA 16PKA 2FMXA 2Q1YA 3V4LA 4MXDA 3PFIA 4MV8A 4RK0A 4Q9IA 4XR9A 3KQVA 5SZJA 3AYXB 3L43A 3C6XA 4BV2A 1HEIA 1UP4A 2Z4TA 3MJVA 4KB5A 2BFFA 1Y6RA 1XTQA 3BXOA 1SKBA 1OFIA 4F21A 4YT2A 5BQOA 4RMGA 2RBGA 4ABYA 4O1IA 3HB5X 4O2LA 1B14A 4NBUA 3Q6NA 4RH3A 3FOZA 1EFAA 3UICA 5KPDA 3A14A 2NG1A 2JD2A 4OKNA 1HQKA 4KNYA 4I1RA 2Y68A 2ZRJA 4Y2JA 3A7DA 2F3TA 2GJSA 3W8NA 2H1HA 5BWCA 2M32A 3WSWA 2G8NA 3TIVA 1D6SA 1PG2A 3JW8A 1TZCA 1VA5A 1M1XB 4GMHA 4LDZA 3R7BA 3RSZA 3ZJUA 3OCVA 4FDVA 2Q29A 1YRWA 3IP3A 3KT6A 4RULA 1B6RA 4NZNA 1RBZA 4MI6A 4QQ8A 5KNCA 3K5PA 4OIFA 1KDYA 5HHTA 3OPVA 2CUZA 5CLLA 4XWGA 3TR5A 3U9LA 1X8KA 1NC1A 2KMLA 1TE2A 4IFEA 4Z3DA 3IURA 2D13A 1YI0A 3HZRA 1LPAB 3AI2A 1LDMA 4HEHA 3ZDYB 1AUVA 5AWFC 2K5UA 5DGIA 5G0WA 3RSCA 2W6OA 1J9EA 1ZMXA 5F1KA 4QJ5A 2P6RA 2JI6A 1YC5A 3E2PA 5HW0A 1BRMA 1L8AA 5K1ZA 1P4HA 2ZR9A 1QTNA 4QO8A 2PUGA 1YE8A 1EFCA 3GLRA 1GQRA 4MUHA 4P4TA 4W7IA 1IUPA 1FX0B 1H8EA 1NLUA 2RH8A 1MENA 3OAAD 4S1PA 1FFHA 1PWXA 2P9CA 2BGWA 3W5AA 1E5QA 4MX8A 4G89A 4EYEA 1E0JA 1MAWA 3AF1A 2PVSA 3AHCA 1AM4D 1PZHA 2HJRA 3AEUB 4NFHA 1NUPA 4IEEA 4JELA 1Z29A 4Z8YA 5HG0A 3WMEA 1KTIA 3EPJA 4H31A 3NGXA 3VO9A 1DXQA 1U2ZA 4UTRA 2N1BA 3MWYW 3R6GA 4ARIA 3FKQA 2W2LA 1G2PA 3AGQA 5BPFA 1J23A 3HQ4O 4IFTA 4G37A 2PHZA 1OHHA 2IPOA 4L8FA 1RYFA 2PX6A 1Y6ZA 1ZESA 1WXQA 3MHPA 2ZWPA 1ZIYA 2A0WA 2YZMA 3AHGA 4RFSB 5T3UA 4BLPA 3CFYA 1OKKD 2RC6A 2WG1A 3LLMA 4PICA 5DFAA 1KWGA 2HIMA 1HLDA 3AHEA 2C84A 3FSJX 3Q4GA 1V1MA 4DARA 1OGIA 1ORHA 1VB3A 4D0GA 4KQWA 5LWHA 3ECCA 2ZJ2A 4UZSA 1K8QA 1OR8A 1RJ9A 3U1BA 1TU3A 1AT1A 4UFPA 4JHLA 4DUGA 1O0CA 4QXAA 1TT5A 1YJ8A 4QO7A 4BATA 3KLPX 1U8XX 1Z3IX 2C8LA 4XWKA 1JR3E 2R00A 4R3WA 2IITA 3ZQ6A 3WLTA 3NWOA 2C4TA 2GBLC 1R27A 1N8TA 3LKBA 1CE8B 5L4SA 2EIXA 3GJQA 1TPYA 1TLLA 2RHOA 1VJCA 4FJ0A 4I8DA 1W2WB 1R37A 1GPMA 2D0PB 2QVBA 1JTEA 3MAAC 4BC1A 1JP7A 2PWBA 4MGEA 4XX1A 2O6HA 1YA8A 1Z8DA 3H3FA 3SF8B 2LWIA 3TOCA 4WT7A 5MDHA 1WDKA 1KMHB 5MF6A 4YMGA 1W36D 4I4IA 2BFCA 2HPVA 4UBMA 4Z1MD 3U09A 3L7BA 1F51E 1D1QA 2Q99A 5ICGA 2ZIEA 1OIXA 2QAGA 3A4LA 2G7ZA 4W5JA 4TUYA 3EQ7A 5IJZA 2GJKA 4DMUB 4Z7QB 2IOHA 4P8RA 1YCHA 3QUCA 5AM0A 1JA9A 3THXA 2XQFA 4BGEA 5KQSA 1KAMA 3L0IB 5HMMA 4EPWA 3GJ0A 3GYBA 1NQAO 3FR8A 3JQ8B 1U5BB 5B1IA 5LNK1 2FW9A 1LPMA 1O1YA 1QORA 3CG0A 2A86A 3MS7A 1Q7CA 3CF0A 5CFLA 2UYHA 3UWKA 1BCSB 4EP1A 4Q6WA 3UFXB 3ZHBA 1XKTA 4N82A 2VYQA 3OEEA 4HH0A 4Q3EA 3IUJA 4HNUA 5KYYA 4P3OA 3AV0B 2OENG 4DCOA 3CW2A 1IJKA 1C0EA 2Q2NA 4PQFA 4RCYA 1TCCA 3LGSA 1F0YA 3NBMA 1X7WB 4E0BA 2X6RA 4C01A 5JXHA 3IODA 3O94A 5C8YA 3U6BA 2BI8A 2XTZA 5A4DA 3MZ0A 1IEXA 3PFBA 1YJAA 2ZU6A 1D2NA 1K8RA 2WZDA 1OX6A 5LFAA 2X3YA 2V7VA 1TAGA 5FTWA 3BMCA 1Z2PX 5AHOA 4AMVA 5I3ZA 4ZI5A 3TI9A 3BWMA 4QLOA 4IWNA 4M9RA 3THSA 2R1TB 1EUYA 4GMXA 2IPAB 3UBTA 1M2OB 3DEFA 2YV5A 1SQFA 3C1UA 3DZIA 5HIIA 1AF4A 1EGVB 1L5ZA 2P6PA 3JAWA 3MCTA 4OHOA 4OHMA 1VMIA 3WLQA 1Y80A 4MQ6A 4M0EA 1VL0A 3F90A 1DS6A 4LX0A 4F3RA 1NQVA 1ONBA 5CBPA 2ZUBA 1H4QA 4AN0A 3VPXA 2CNWD 2X8WA 3BGDA 1TCBA 3HRHA 3KZOA 1NRJB 3ZXYA 1NNEA 3WE7A 1U2SA 3OTIA 2GPWA 1ZUD1 2ZFUA 1CUZA 2ENUA 1Z34A 5LVAA 2YHIB 3H1AA 3OFJA 3PHCA 5D3KA 4US1R 2R7AA 3ZG6A 4PFSA 4Q66C 4BB6A 4BX9A 1P4GA 1U7HA 1EFKA 4KXYA 2VJMA 2Q5EA 4LNHA 2B37A 4UM5A 1Y89A 5M04A 5A0TA 3E9RA 1P0CA 1NZDA 2PEYA 2GD1O 3T99A 2DTDA 2CEKA 5E6UB 1AKYA 2XUJA 5HM6A 1OHHD 2EBWA 3PQ8A 3U4CA 3DEIA 4J0FA 1M6VA 4P83A 4MWSA 3ABSB 1RPTA 3OU7A 3RYFA 2NYRA 4CU2A 3UJ3X 2J45A 3KKEA 3PJDA 1CQWA 5A9RA 1OXVA 4Q48A 2HQOA 1XMVA 2IS1A 1JDSA 4GQAA 2FDRA 3I01A 2WHQA 4JLOA 4IICA 2FMIA 1PL6A 2IEGA 2Q6OA 1CJCA 3QPVA 4D44A 3HYRA 2NVUB 7ABPA 1ZM2A 1KYZA 3EXHC 1BYIA 1SWVA 3D8HA 3I5UA 1O87A 2JGEA 3AOEC 4ME6A 3VJLA 1QX4A 3RLFA 3ZC3A 1UXOA 5D6OA 1FFSA 3B1YA 4W8HA 2VPIA 2ATCA 3LDUA 1LX6A 3DLTA 2NZWA 3OPMA 2ZB2A 1SXJD 3DDUA 3LXUX 2ZYUX 2LCFA 4QJ4A 3U80A 1OKKA 3NTVA 3UEOA 3Q3GE 1QDEA 5DSZA 4AX8A 5HS6A 1T8YA 4OXQA 4FTWA 1V0JA 1L5LA 3GOHA 3UAXA 5K99A 5KYTA 1U8ZA 3OPXA 2WVJA 4BFYA 3PRYA 2ZULA 3OZSA 3D2LA 3Q85A 1J2JA 1T2UA 3D8UA 9LDBA 1H9AA 3SF8A 2QTLA 2P79A 5GOTA 2P5YA 2Y77A 3CH6A 3DTVD 3COJA 1I0ZA 1YOBA 5BVHB 4UW9A 4F86A 1FVHA 3AUKA 1ELOA 1KK0A 2F62A 3T7RA 1CBUA 5J1TB 5T4BA 5A9SB 4N3CA 4D98A 4K9QA 2EEZA 4CMIB 1RYDA 4G65A 3FVVA 3TRDA 3PUHA 3TGPA 4L5IA 4INAA 1EJ2A 2PUBA 2HMYB 2YQZA 2G36A 1V3UA 2J9GA 3H5AA 3SQXA 4R0VA 3ETLA 2BEUB 1UBKS 2PYDA 4AZVA 4X6LA 1R6XA 1GPNA 4DWJA 5AT1A 3OE1A 1YE5A 4MOWA 2RHGB 1L5KA 1ZK0A 2G9ZA 1EUZA 2CXPA 2PX3A 2QRGA 4M54A 2IXFA 2VWHA 3IMKA 4QOIA 3OUTA 2WP0A 2O07A 3NR2A 4Y9DA 2X4GA 2ZDHA 3QPBA 2TMKA 2XNDD 3RC2A 4FWTA 1N2IA 4L2IA 5IEBA 3W6NA 4YV7A 2X4DA 3MJEA 3MA0A 4M87A 4W82A 4LS3A 4ANFA 1OVMA 4R1SA 2BR3A 2GDJA 4D0LB 4BECA 3U37A 5BUSA 2I54A 4TQGA 1DSSG 3UMBA 4DAOA 3NIDB 2H52A 4J2HA 3F9RA 5LR6A 2PO5A 4EJSB 3DHNA 1C5KA 3NJ8A 1X7ZB 2ZSEA 5CDGA 3WWDA 2SKDA 4B5KA 3SZRA 4B6PA 3BK2A 1Z56C 4A4DA 5CXUA 1Z62A 2UAGA 2C0CA 3UJAA 3ZTTA 2GLUA 4V24A 2GYYA 3TIXB 3HYLA 1YVUA 3BKWA 1NFRA 3D7RA 1V11A 2JFQA 2XKBA 1NVFA 3HYCA 3R41A 5SYMA 3VDXA 2ECFA 3O7MA 4K6HA 1JAIA 1Q22A 4IJUA 2F7SA 3W3AA 1KO1A 4RJ2A 3M3HA 1LGYA 1J8FA 2SKEA 4MW9A 3ZIAD 4RTRA 4BGVA 1YR9A 3QFFA 4KQGA 2ZM5A 3N2GB 1EQAA 3KJHA 3ONDA 3WLLA 2I0FA 1ZLXA 5A02A 4MVJM 1Y9JA 2EZTA 3NKVA 2ZEJA 5FF9A 3E81A 3ZTYA 5FULA 3X1JA 1L5QA 3BWCA 4EK9A 1UBEA 1EJ0A 1ETHA 2VNIA 4FB5A 2G82A 2RDMA 1N2GA 1UBOS 4ZQEA 3I8XA 4YDQA 2OXCA 2P2SA 5LLSA 3B7PA 4A2CA 3NTLA 3KZ1E 1HBJA 1NJFA 1GHTA 2VOEA 4OHVA 4HI0E 1W48A 3MTJA 4IGFA 1T9ZA 4UHKA 5GPBA 4YBZA 1MJHA 1C7JA 1GT6A 1V6AA 2QZ4A 3LYUA 3W5SA 3JD1A 3IDSA 2J1LA 2AN3A 2GCGA 2H00A 4L28A 5LL6P 2VYFA 1EEXB 5EUCA 2BE9A 2J30A 4LISA 1P1RA 4LYGA 3L7OA 2DSNA 3MM4A 4ZAXA 2RARA 3P0RA 5I4CA 3UHJA 2V7QA 4CBVA 2NAFA 3FH0A 2AK3A 4B4VA 3R09A 3LL7A 1FZQA 4KMRA 2ZYSA 1OQAA 3KB6A 1NN5A 4FHFA 4CKEB 4DQVA 4WERA 2YYSA 3GFVA 1T3TA 5A6SA 4F6RB 5KYXA 1P9NA 2B30A 2OCYC 4JB8A 621PA 3SZUA 1FPQA 1Z33A 1PT9A 3EDRA 1FSSA 2XRYA 2YHSA 3CU5A 1F4VA 1J0AA 2ZVDA 3IPLA 3L6OO 3G88A 3LUDA 2R8XA 2J0UB 3OIYA 1CDZA 4OYRA 5TX7A 5KPJA 4LJRA 3VTFA 2IYLD 3KELA 3HZZA 4HB2A 2IEDA 4TSFA 1JYSA 3MGKA 1NF8A 2FMFA 4MYRA 4WXRA 1A8SA 1GTMA 3CRNA 1ZOPA 4XWWA 2EP5A 1DUVG 2EARA 4OXIA 1OGYA 5CT4A 4JFRA 4ZGGA 5CNMA 1QV7A 5HTOA 1VE6A 4HADA 1PV2A 4EQZA 3QOYA 2INGX 1R0ZA 1GQFA 2QVYX 5TB5A 5TC4A 1TZ2A 5JSQA 4X9XA 1NJGA 1G3RA 4K6FA 2JGKA 2QM8A 2ZYRA 3HR8A 3R5XA 4NZZA 2FLWA 3ML1A 5FPTA 1SUAA 5DN6A 1VBNA 2B82A 1EXMA 3W5JA 3ZN2A 1U4SA 1F8XA 3T9EA 3UV7A 2GGSA 3CSSA 3EZLA 4G8CA 2QLTA 4RS4A 3OLZA 2ZJBA 4U7TB 2UZAA 3NC1C 4QJBA 4D3ZA 4DMKA 2PFKA 1C7FA 4QOJA 5DX0A 2P78A 3C24A 1D6JA 5CRIA 2A7QA 4W5HA 1CZUA 3AKZA 2DJIA 2G1AA 3ZE0B 3NDJA 3A10A 2WY2D 2UU9B 2QR5A 3BXHA 4PY2A 4TM8A 4YUVA 2JAWA 1YTUA 4B7UA 4E5NA 4I5GA 4PWZA 4RO0A 3OLQA 1N5RA 2I4MA 1RQXA 1KK2A 2X5XA 4ND3A 1LBSA 1P72A 2OHOA 1QFSA 4RABA 2HOQA 1M34A 3JTEA 3D02A 4KXLA 5K6TA 1L7XA 1M6HA 1PR6A 4C0WA 2BTQA 1NUQA 2I6GA 4PQEA 4R1TA 2HKIA 1Y3BE 2JKYA 3C6MA 4U7FA 2J4FA 4JP8A 4CF4A 2I6XA 4ESHA 3AX6A 1BA2A 1F48A 1W88A 2X1HA 3PE6A 1F7UA 1UPBA 2B83A 1L7AA 2H1LA 2AQ8A 1ILEA 4DLUA 2FF7A 1M5UA 3O91A 3CZ9A 3GX1A 1BD4A 1EQ2A 2F1OA 4G5OA 5AOCA 1E9VA 2OXIA 4FILA 4J16A 2WG2A 1DKUA 3TW0A 1HYHA 3G2HA 3NKFA 3OQHA 4CZ2A 2GHIA 5TEVA 1RE1A 4R2KA 3W7VA 3K92A 4REOA 1FBTA 5JUWA 2A4MA 4MV7A 2A0XA 4AJNA 4BJ5A 4MLZA 4I8IA 1ZD5A 2YYZA 5JVDA 2CHUA 2E5LB 5I45A 4ZRMA 3SXUA 1KYYA 1WCWA 3LNCA 4OMDA 5FFNA 5AW9A 4KRFA 1L4LA 4P5PA 4NOMA 4QQNA 3R9XB 3E1KA 4W99A 4TYYA 3W8DA 1NRIA 2XHEA 3S2SA 4B32A 2LP4Y 4EI7A 2FZEA 5ER9A 3M9WA 1SCNE 1UK9A 4JL6A 2ODAA 4B17A 3IVAA 1R0XA 3ND8A 1FE8A 1P31A 4TWZA 2V6JA 1EDOA 4WX2B 4PSUA 1RZVA 3HDJA 4MH0R 1EFHA 2JLCA 2B94A 5B2FA 3T38A 4C4XA 2R79A 3JQBC 4JP2A 4TL8A 3H87A 1KFJB 5EKXA 4WFQA 3IT0A 1Z2DA 1FFXB 3WMRA 4WRRA 2QU7A 3AY7A 3RT1A 2BH9A 4H4DA 2HD4A 4XEHA 1T9CA 5F1YA 1S0UA 2PH3A 13PKA 2CWWA 2HSJA 1CB7A 5GINE 3OF3A 3W6PA 4QG3A 1VL2A 2DPMA 3EK2A 3H8SA 1HQDA 4BB9A 5GJBA 1UFVA 3JQPA 3KXPA 1J70A 1YGYA 1CU1A 1J90A 2O8EA 4Y9TA 3PXDA 3RU7A 4EUHA 3KKQA 2EJTA 4R16A 2VG8A 4N6OA 3JZMA 2VDNB 5K20A 2IPXA 3HA2A 3OZBA 1LVUA 5DBEX 2J6CA 4X64B 4O4JA 1U3GA 1ZKDA 4J4HA 3RQSA 1ZJJA 2YVUA 1NQ5A 3ORHA 4KFUA 6ADHA 3B85A 3COPA 2PZAA 2R8YA 4QGFA 3O31A 2PGOA 1MB4A 4TZTA 4YXWD 4A27A 1E0DA 4M1EA 1G3IA 1I4LD 2H92A 4JXJA 2JJYA 4QFMA 3U4IA 2YHUA 1KYTA 3H8JA 4MVJI 3I61A 3O75A 5AJZA 1RYEA 1JQLB 3EPRA 3I42A 2PD6A 1O57A 4QC2A 5ILOA 1SBTA 5DCYA 1JPUA 2CBZA 3INTA 5LP6C 3RJMA 3ZHSA 3OOJA 3AQIA 4X3PA 2VCYA 5LP6B 2GHQA 3G2NA 3A1VA 3A1WA 5LYYA 3A58B 1XPOA 5LM3A 3TZKA 2QYSA 4G0WA 2PSFA 2ANCA 2Y0PA 5GM2A 1G20B 1KVQA 2AN5A 2WWGA 4NEHB 3TJRA 2EDAA 1G291 3U3OA 2O4CA 3ZW8A 3CVWA 5FP0A 4OAQA 1LJ8A 2JAPA 3PD0A 4OLFA 3UJ6A 1DVRA 1LVGA 2VK1A 1PJCA 4Z4CA 1RTTA 3TRIA 5IANA 1Y42X 4TRJA 3CMMA 1QAOA 4DQLA 1CUHA 3FWZA 5JANA 4S04A 3QWIA 4AY4A 1E6WA 1PJSA 2GA8A 2QDKA 3GPDG 3QFSA 4CM8B 5JECA 2CVZA 4MJ7A 4OFWA 1QB8A 1RKQA 5LLTA 2G08A 2VP5A 1Z0DA 2PZFA 4UHFA 1IDOA 1SCUB 1RQRA 4R40A 3TB6A 5JI3E 3N9IA 2D8AA 5LJLA 4R0MA 4S05A 5FXMA 1K1EA 3LCMA 2EBUA 2YRXA 4JENA 5TS3A 4DJEC 1VRWA 3IEUA 2Q3EA 3I9OA 4F2WA 1TF5A 3PNLA 2GAOA 1MC5A 4FSXA 3KL4A 3PX3A 1CUWA 4O1MA 3NHWA 1WXEA 5IT5A 3QYAA 1MP0A 1WMDA 2EYUA 3M1AA 4EYOA 3NTXA 3TQFA 3ZVRA 2WPDD 3VU1A 3IPAA 2A33A 1DTEA 2M6SA 3D59A 1BQ4A 4W6QA 4WESA 5C5IA 1UBHS 2DY1A 1M73E 3EFEA 2Z8XA 4IDOA 4X45A 3GGDA 4A1FA 4IXWA 4GZLA 1UJCA 2YJGA 4IUCS 4WFKA 4FDLA 5BURA 5AI4A 3E70C 2OHFA 2OV8A 1IN1A 1WD7A 1VE7A 4NJOA 4YCCA 2REOA 1LRJA 1M9NA 1RJDA 4GOXA 1UFKA 3FWHA 4EB8A 3AF6A 1SR8A 2B4YA 4TWJA 4UBLA 3EG5A 1JUDA 5H3LA 4XASA 3LO8A 4KPUA 3G82C 4M0CA 5FUXA 2OD9A 1WXIA 5EKSA 1S2LA 1Z06A 2SHKA 4QGHA 1L1EA 1UF9A 2GT1A 1TMGE 1JEQA 2JFYA 5KTSA 3ORRA 1C50A 2QL5A 1DKRA 2PQ2A 1GNPA 2CFIA 4DQ0A 1VE1A 3IJ5A 4CMBA 2J07A 2PXHA 2JPDA 3LZ6A 5HFJA 3ZHTA 4YONB 1T35A 1WKCA 3B1VA 3PT9A 1B00A 3RHFA 1GYRA 1G8FA 4H15A 2GCPA 1XMJA 3EC7A 4TLLB 1G4AE 1Z4KA 3IAEA 4GXNA 2LKCA 3E9ZA 2JLAA 3DF9A 5E6UA 3UMMA 10MHA 1FUUA 5KSZA 4MDFA 2AOUB 3KPUA 1KNXA 4NDNE 3TTSA 1T25A 2VQDA 3VSAA 4IXTA 1WPQA 4U39A 4YRJA 3KSZO 3TLKA 1C9MA 3ZIAA 1P7CA 4QTTB 3B9QA 2XZPA 1JDNA 2XD4A 1OWNA 1OLOA 1RLJA 1HV8A 3R0ZA 4H3KB 4Q9LA 2DETA 1P6UA 1YB1A 1QBGA 2PJZA 3O8OB 3ADBA 4LRQA 1BGVA 3FJOA 1RWWA 3GPIA 3ZJVA 2XE4A 1Z5NA 1PGJA 2JIBA 5E4JA 2J5XA 2XSZD 1S96A 3FTNA 4ZOEA 2QTAA 5HCIA 5D3ZA 5KZMB 4ZEVA 2W58A 1UPTA 3GEHA 2H4XA 2RBEA 2Z5VA 3DFFA 3TUIC 3SHWA 3NC0C 3AW8A 4DGQA 1MU0A 3U61B 5AM1A 3WLAA 2EFCB 2CK3A 3H9QA 2APJA 3TN7A 2PUVA 5EPUA 4RVGA 2LXNA 3DFZA 3OURA 4A16A 5HRAA 1T2EA 2AH5A 1IM8A 3H4TA 5EIHA 1LI5A 3M81A 3OMWA 1L7RA 1PZGA 4MAAA 1VMAA 3KZXA 4UARA 5EMLA 3CB4A 4MQEB 4BRUA 1SB8A 2J33A 2WILA 2JI7A 4DR3B 1P5HA 2WP8J 3MN1A 2GBGA 2RG1A 1YJQA 3PCXA 4OJMX 3SEQA 1ZMRA 2FQQA 2PZKA 5JO9A 3FNBA 1DNPA 3BF8A 2DPLA 2AR9A 1U1DA 2CMKA 1GZSA 2V0CA 4L16A 1M2WA 4QSHA 1NNUA 3OIUA 3OQ6A 4W4TA 4P0QB 5LYJB 2DZDA 1H2YA 3IIJA 2DPXA 1A97A 3G13A 1Y3DE 3HBLA 5ERGB 3RFTA 4GO1A 1ZDMA 1E7RA 3VUFA 4BNIA 5IN4A 5KEIA 4KXWA 4Z4FA 2NX2A 1CYDA 1M66A 2HREA 3O73A 4ZQHA 1G64A 5DULA 4LV6A 3K9LA 1TTQB 4DADA 4DTIA 2ONZA 4AFNA 1AGXA 4ERXA 2C7VA 3M82A 4JGIA 1AV6A 2DR0A 4U2FA 2E4WA 4G2TA 1B73A 1RAEA 2BMJA 3OG9A 3RVLA 3ZCXA 1R4MB 2C7BA 1G63A 3FLAA 3IVGA 3O1JC 3HCRA 3T12A 3V8NA 3T9CA 4FP9A 4DR5B 2REQB 3L93A 4IYJA 3PQ6A 1GN9A 2O2GA 3R7SA 2Q6TA 4EUKA 1SXPA 4D9EA 1GO2A 1W25A 3P9XA 2CLOB 1H65A 1RT9A 2X2FA 2ZT7A 1Z5VA 2PLAA 1FQKA 4JXXA 3RS2A 4KXVA 5EXSA 5KTTA 3EDCA 3MOSA 3OP4A 3LCCA 2P9YA 3L8HA 3OZVA 4LQ4A 5F77A 4YMUA 3OHMA 1PNRA 3C2QA 4WOCA 3T1VA 2WINI 3VR3A 1P7WA 4KE9A 4DBZA 2ONKA 2VDWA 3P2KA 1EFLA 3IAM6 1CDOA 1W19A 3KKPA 3QUTA 4FQ5A 4A92A 4HYEA 4EUSA 1YBHA 3PC3A 4AF6A 2PSHA 2BFFB 1RPNA 3GRCA 3IR7A 1E7SA 1HRKA 3CRQA 3SYKA 1ST2A 4XH9B 4ESVA 4UPVA 3OT4A 1QK5A 1DO8A 3FHCB 3GHHA 1N0HA 2XE7A 1CY7A 1XZQA 5BN4A 5PGMA 3ZHOA 1JFRA 2OM2A 4TV8A 5BXYA 3H4MA 4EJ6A 3L8ZA 4O2BF 1DRKA 3Q41A 2FYTA 1GUYA 2XYPA 1JWBB 2Y3IA 1CWUA 1F2UA 3B2NA 1LKZA 1MB3A 3PL5A 5IHPA 2JHGA 3C3EA 4ZV4A 1E3WA 2OQRA 3OIVA 1JT2A 4IDDA 1CC1S 1KEWA 3NU1A 5KVAA 4L6CA 2X23A 4HB3A 4CIXA 2OGTA 4YRCA 1RIIA 4BFLA 3X1XA 5BVGB 1XUOA 5K45A 2F3SA 1OYWA 3AR4A 1CQJA 3RFUA 1UKYA 1YS9A 3DONA 5DI9A 1J1IA 4MR8B 1JIJA 4NESA 4QPPA 3IERA 3ZK9A 5KJ1A 1JEAA 5BV0A 2E0IA 3PTAA 3QXJA 2ZE5A 2Z2IA 3BQNB 1OU0A 3ESXA 5TE9A 1LK7A 2WMYA 1ESMA 3KQQA 3PNBA 4HCJA 1P74A 4DQKA 1PR1A 2BI4A 2FK8A 5E6RB 3U7IA 1Q0TA 1TXGA 4IP0A 5IG2A 1TZKA 4HEA1 2VJDA 1MX9A 3E3AA 2LNDA 4XB2A 5G1PA 4G0QA 1WXGA 4LVOA 4MW6A 1X1AA 4UFOA 4XUCA 4F6RA 1A8IA 2CV1A 4ZVPA 2OBXA 4F4JA 3H11B 4OTZA 2B34A 2J0EA 2QJRA 1XZJA 4HFRA 3JQAB 5AW4A 3B2QA 1B43A 3AM3A 4C0QC 8MHTA 4P5EA 2RHRA 2X15A 3U5TA 4X6XA 2E6KA 3O3MB 4P3YA 4KX5A 2V7GA 3HO6A 4FE7A 1TEXA 3L7DA 2Q3BA 1XXHB 1P2TA 2AMYA 1XV5A 1X7ZA 2FH5B 3BAFA 3DV0B 3CNEA 3WAKA 4XCQA 3VH1A 3LOUA 2W2NA 3RTBA 4CW7A 1NYTA 4TYPA 1U9CA 1K8ZB 2P41A 1KDRA 3HVRA 2DFNA 1FP1D 1JXMA 2GSWA 3LFHA 4FFSA 4M21A 4XVQA 1RLOA 3WGHA 4AX4A 3QOFA 5JFTA 3I58A 2CLEB 5D1NA 1Z0FA 1TIBA 2G4CA 4HJXA 1SU4A 3BORA 4NYMR 1WL8A 4RACA 1YS4A 3HLTA 4RE5A 5REQA 5AM3A 1K66A 4M1KA 1RXVA 2QA5A 5B1DA 3FFXA 1BDJA 3R9KA 5KU1A 1FK8A 4EFNA 1E0KA 1PN3A 4CLOB 4ZZ2A 1EA7A 1AHHA 1PSZA 2AG5A 2DFVA 2AYXA 4PFQA 4J3NA 1LDEA 2ZBRA 3K2BA 4NOKA 1YCDA 3EVZA 2WJHA 3NHFA 3MINA 1TADA 4NOLA 5F23A 2ZRQA 4F2HA 2PFSA 1LPSA 3FCEA 1CJUC 4FIZA 4YRZA 1D2HA 1VLVA 3A2LA 3P45A 3QV2A 4GRDA 3W7AA 5KWVA 3M5DA 3FYCA 3TNYA 4URXR 3KEGA 5KWIA 2FG5A 1JR2A 4GI5A 4QEKA 1NJ2A 3D2AA 1FFXA 2HY7A 2WSIA 5JMWA 1D0SA 2PYIA 2ODQA 3VJRA 3H2BA 1ZM3A 2Z83A 4J0IA 4AW9A 1IUKA 5C5EA 1XZLA 4L9WA 3PFWO 5JNVA 4DV7B 5K3CA 1DJOA 4QRDA 4GI1A 3LYLA 4GNRA 4QG7A 3INGA 2UZ3A 3EULA 4YGXB 2KB0A 3AHIA 1A4IA 4EJSC 5L3SB 2QX9A 1L2TA 1PD0A 3KAKA 2DGDA 3EW7A 3SHTA 4HLUA 3CVOA 1YOVA 1EUDB 1U0SY 4BO6A 1MABB 1MC4A 4W9MC 3HY3A 4RS3A 4BIMA 1BAPA 3RKRA 1G5QA 2Q1WA 3GK3A 2H8GA 2WZBA 4ZKEA 2H9YA 4EI2A 1BHQ1 3CC8A 1BX1A 4DM7A 3ANYB 4WW0A 1UDRA 5HIMA 1ENOA 1ST3A 4IJMA 3VYTB 2RHHA 3D31A 1L7NA 1TRKA 3HY6A 1NW6A 2COEA 3VR4H 4WJLA 1QIEA 2H29A 3ESRA 2V9CA 4D3YA 4F2PA 2HPHA 4ZZ0A 1SVKA 1SHTX 3HCEA 3GRYA 4IRXA 3KDSE 2UDPA 3B6KA 4JKOA 1PS9A 4QXQA 4YVFA 2DQKA 2ZE6A 2ZXFA 5I5GA 5BSFA 1XQVA 1I1NA 3EE6A 5BWLA 1P80A 1MHPA 2XB4A 3N7AA 4UFNA 1RHKA 3RSQA 2IY7A 4PIPA 5IYZB 2ZWMA 3QVWA 4G25A 4PM4A 2C9ZA 4PU0A 4PYIA 4CV3A 1C1XB 2OC4A 2WK1A 3V1LA 1YR1A 4FZJA 2X9GA 4MAFA 4YN3A 4BB0A 2WAAA 3E2MA 2GESA 4YAUA 2J3MA 3EARA 3IH5A 3N2YA 4HL6A 4V0SA 5FBRB 2Z5LA 2VAVA 4MWTA 3A3YA 2QTGA 5DBOA 3SJZA 1P7ZA 2P2GA 3UZUA 2WE8A 2YV1A 4LV8B 5T8KC 4OHZA 5IDWA 4B47A 3DZHA 1TZMA 5DTRA 5JXGA 1J5XA 4B3DA 3PPXA 4FS3A 1EFTA 3UO8B 2QRZA 2EJCA 5C2JB 2N75A 5DK6A 4BGDA 5IEJA 2VPZA 2L2QA 4EW1A 5LQCA 2PDAA 2OSVA 2H54A 1XAGA 2Z2ZA 3I9V6 4JB0A 1WCV1 3CX6A 3R1IA 4LNUB 4O63O 4UZFA 4WY5A 1F3LA 1E64A 5TPZD 3ZWDA 4BQEA 4Z5XA 2JRLA 3PGKA 1CJBA 1OBFO 3UXMA 4E5KA 4R2MA 3NORA 3K20A 3ES9A 1G60A 3C7CB 4DV6B 3PG5A 4OSOA 2RGNC 4ZO9A 1RJEA 3VPSA 1GGMA 2GEJA 1QCZA 4ALJA 2WIBA 1E9FA 4EG8A 1HT2E 2P67A 2Q27A 3A6GA 5A4MS 2O7VA 4O4LA 3I2IA 1NIPA 1QK4A 3IUMA 1JFFB 3BD6A 5F9HA 1RXUA 3IEKA 3DAOA 2I71A 1R4MA 2DKFA 2YC2C 3IDZA 3L0YA 4H6XA 1FEZA 4HRVA 4M6WA 4RD6A 2IPMA 4Z1OA 1BMDA 3RS9A 3IT2A 2VJBA 1QH9A 2GRUA 4ZAZA 4BP3A 4NXNB 4UE3S 4LWZA 5YASA 5C1DA 3JQ7B 3AXTA 3C3WA 1XF9A 1XKQA 3AF3A 4AWBA 2YY6A 3FUUA 5DW3A 1FP6A 3WGGA 1J0DA 2IU4A 3Q6IA 1XVTA 3D0QA 3G2IA 4RHCA 4JNKA 4NV0A 3BKXA 1AK9A 4EA7A 3OBIA 2W00A 3RVJA 2Z8YA 3IEXA 2C78A 1KS2A 4OHKA 5IZ4A 4J3JA 4ZQGA 3TIIA 1K6JA 3G2JA 3BOSA 1AU9A 1YHNA 1IBRA 4KIFA 4XX0A 1YD7A 4DSUA 1SGWA 4IJQA 1DCTA 5EEGA 2D2VA 5HSGA 2FSSA 4Q39A 2AUMA 4JN6B 3VU9B 4L15A 2CE7A 1KZ9A 1T5BA 1PLLA 2P7HA 3CY6A 4D57A 3HBMA 1XMPA 3HKBA 1ZCZA 4Q3KA 3DKKA 2PT9A 3LDGA 1NR5A 4JROA 2ZSFA 4KQXA 4LF4B 2PZ8A 1JXOA 1NU6A 1GZ7A 1Z5WA 4MROA 4GX1A 1PR3A 1WCYA 2C8JA 2G8LA 2BF7A 4C22A 4GL4A 3QH4A 3ZGNA 1DZIA 2R68A 3I30X 1T1RA 3DCYA 3KOXA 1E6MA 1QDUA 2HRCA 1U65A 1QH8B 2VHCA 4OGKA 2GD6A 2FLKA 2XB8A 3WL8A 1J5PA 2GXQA 4KQHA 4M9SA 1DXOA 4PO1A 4IM7A 4EBBA 2FR8C 4IXNA 4JLWA 4LE0A 4JKYA 1KC3A 2KBEA 4CT5A 5K0SA 1OAAA 4UHEA 2P9BA 3DTTA 5LQJA 1M0EA 2DG2A 1UBMS 4QICA 2O19A 4O02B 2ZW9A 4Y7CA 1TVKA 1N6PA 2HK6A 2IEIA 4HUTA 3AF2A 3V80A 4GIBA 1E9BA 4LXGA 3CVJA 2J9XB 4UVIA 1JHDA 2JGIA 4HNHA 2HT1A 4L5BA 2VSFA 3H1TA 3F5MA 2PWPA 1Q44A 2W8BB 2W2TA 4RMJA 4TS3A 1L4MA 5HK9A 4GNKA 4ZO6A 4LNAA 4JBIA 4NPAA 4F9EA 4B80A 5G0SA 3BWDD 1Y48E 3FHJA 2JH3A 4LKOA 3RS4A 2D0OB 2O14A 1LS1A 2KBFA 3L1VA 4NTZA 5LKRA 2FGKA 4XYEA 1NVKA 3KFVA 4JUDX 1V43A 2HHAA 3P9RA 1XTJA 4O1HA 1R2QA 3USCS 1AK2A 1U6KA 3U4AA 3E1SA 2OQIA 1E3JA 4J75A 4BE4A 1XZHA 2P1DA 3PC6A 5EIXA 3K05A 121PA 1Q7GA 2NU9A 1L3IA 1PZXA 1KGSA 1GDDA 1JKFA 4QYMA 5CX1B 2NXWA 1G2IA 3NPAA 1KFEB 2YIVX 3NPMA 4ZPJA 3W3AH 3U56A 1KZYC 4NCAA 1AQNA 1USWA 2E87A 2VPTA 3VI4B 5THKA 3I32A 1X70A 1DFIA 2VPQA 3HG7A 1YXMA 5AVWA 3FDFA 2IOFA 4OI2A 4BBJA 3PC4A 1Y5MA 4AP6A 1I14A 2I8CA 3IBFA 2HHJA 5JD4A 2VHJA 1QJCA 2VHWA 2BKAA 5M3BA 2Q49A 5ALTA 4MJXA 2JFFA 5I9LA 2EKZA 2QZPA 5AKZA 3QRWA 5GTDA 1WULS 2P8SA 3CCCA 2JNWA 1Z39A 3RSGA 3DL0A 7MHTA 3K8YA 1RYHA 2F1RA 1U2EA 2W6JD 3QE4A 2Q62A 4HFNA 3R20A 1C3OA 2IZ7A 3DYIA 1ONOA 2PRJA 1ZH2A 4AUNA 3G23A 3TLGA 1CJTC 2R9VA 2HDNB 5I9NA 4C4AA 4XI9A 4MUNA 1T29A 2AWNA 2XJ4A 1VBKA 5CLHA 4ZO8A 3ZY6A 1XHLA 5EJ5A 3GJ8A 2EQBA 3EDYA 1VGVA 1QMGA 2I22A 1PR2A 3LVFO 3MJSA 3TCKA 2GPBA 2R7NA 2HV8A 1WA5A 4LJAA 4S1WA 4AJEA 5BN5A 4CKWB 4YQYA 3T7EA 1PSWA 2QL7A 4Z53A 3M6FA 4CHTA 1NRWA 2AFHA 1Q1NA 2N42A 4O4IF 1DRVA 1O08A 1NWCA 2HAEA 1OH7A 3OZAA 4UEWA 2E9SA 2VDKB 1C3VA 4LSMA 2Z6AA 5AJWA 1YWGO 1NP3A 3FYUC 3S55A 2WB4A 4UULA 5EJAA 1WPRA 1ZVKA 1NTRA 2FRVA 1UBRS 3FYUB 2C29D 2DRIA 4C0LA 3DW3X 5CB8A 1W1UA 3CUTA 5TSDA 1PJAA 3QITA 4EY6A 1KKLA 3DXZA 3COVA 2RJOA 3OFNA 2OILA 1SU8A 1CPYA 2ARKA 1U98A 2VDMB 3F1KA 1KRWA 4MUMA 4YH1A 3M3DA 1CQJB 3M33A 3PICA 4PSCA 4MMYB 1CERA 3T0IA 5JASA 1AKRA 3UXHA 1Z6GA 5CVCA 1WBJB 4GU5A 3ENZA 1LNZA 5ALSA 3IBCA 3N0TA 4B6GA 2OCPA 4IR7A 4ZCIA 1MT3A 1HI9A 4DIOA 4AY2A 1XX6A 2CLCX 2ZJ4A 4JI6B 2C98A 2X2PA 4KFSA 4P93A 4WK2B 3RFVA 4BS9A 4G1MB 5IJ9B 3TG2A 4KN8A 2HBRA 3A9WA 4I5IA 3ESYA 4ZO7A 2XAAA 3Q3VA 1QWSA 4BNXA 3EUFA 5IUNC 2BF4A 3P9KA 2XB9A 1YR6A 2C54A 1RC8A 5DCUA 5C4IA 4R1PA 5JCPA 1W581 4H0NA 5JARA 4Q1AA 2VAPA 3FNQA 4RIGA 1GVNB 4XSVA 3TLYA 3AM4A 5KWSA 4CM9A 3BZUA 4K9DA 4WJKB 4NF2A 4P53A 1KRXA 1IY0A 1L1QA 2JFVA 3ABRB 4AO7A 7ADHA 1OAOC 2W2MA 4GOJA 1D5CA 3O1LA 1NUAA 4R1QA 3EZFA 1T8UA 1LXCA 3GEMA 5FR2A 1AQ6A 2Y1GA 4NCKA 4PC7A 1JVNA 3AJDA 5P8WA 5A06A 1OA1A 1NYLA 3K4QA 3LSTA 4B43A 3RAFC 2AN4A 1U5AA 1V96A 2QMQA 3IKMB 3JY6A 3PXCX 3ZYZA 2DR3A 1NSYA 5GVRA 3PD1A 5CD9A 1KETA 1K7EB 3OIFA 3P8ZA 1J0XO 2WUWE 3MGAA 3NBZC 2ORYA 2IF0A 1KI9A 1KE1A 4PZAA 3HU5A 4MPJA 3B3FA 4DRZA 3RS3A 4C78A 1P73A 2WJPA 1QIMA 2FZ4A 3K9BA 2RGDA 3G17A 1ZM7A 4GPTA 2IVFA 5CXSA 4IS2A 5J9FA 2VSYA 1N2ZA 1QZUA 1DP4A 2IDMA 4TXJA 1WUIS 1J2YA 3FNEA 1P61B 5A0FA 4B5LA 1IXYA 4YMIA 2KX7A 1HG0A 5JLAA 3OF5A 4RKYA 3ZCPA 4JT2A 4O33A 1W5EA 4FUQA 2NP7A 1KJZA 5FWXA 3D8RA 3ZR4B 3WB2A 3AUJB 3WGOA 5CEJA 1DU4A 2ZRPA 2ZT5A 2QEQA 2VP6A 4WA8A 3LPAA 4M1YA 2AGVA 3EOAI 4Q3DA 3SIWA 1N7JA 2OD7A 3BXFA 2DEUA 1DOZA 3IA7A 2UVQA 3OJXA 3VRHA 2BI7A 4N4AA 3ZCUA 3UWPA 1WKVA 3AF4A 4R6WA 1LSSA 4ZCPA 1SHJA 2A5GA 1T4CA 3BGWA 3LPMA 2OBBA 1IQRA 1XWFA 2E82A 3CZPA 4K2HA 4BLQA 4DQUA 3KOZA 4TZ0A 5LIRA 2JCVA 2LW7A 3EXFA 4RGYA 4BPRA 3E03A 3Q0IA 5IARA 2BTEA 4GMDA 1PK7A 3ZQJA 3T1QA 1WXWA 3A8TA 1FB5A 2ZR0A 3GCDA 1UOPA 4OSEA 4PZCA 1Z68A 4B74A 2H08A 2UYQA 1YQ9A 4L73A 1GP2A 2E3JA 3EEQA 1ZI9A 3LUFA 5DWVA 2B6HA 3WHIA 1KAHA 1XU9A 1O6GA 2HK8A 3DLIA 3ZDFA 1CZNA 2EL9A 4M22A 5F51A 4C76A 4MRAA 5HUQA 3RADC 4AD8A 1KL7A 2PUWA 1D2GA 2WT8A 2D7CA 3IAUA 1OFUX 2O52A 1GNSA 3PEWA 5C8YB 3KQYA 4MWZA 4MJ3A 5CT6A 2AG6A 5ALEA 1U1IA 4IDPA 1BOFA 1DOAA 2QB5A 3C48A 3EASA 4AZTA 3L1IA 2QN9A 2CK3D 3NWBA 3RYIA 1BCRA 1EE2A 4LRSB 4OG2A 1ORVA 1UZAA 3D1JA 2EZ9A 1LVHA 3TRFA 1DADA 3EGWA 2JAQA 3A1SA 1HDYA 1RJFA 5K0NA 4H7PA 2IPNA 1APBA 4XWYA 2YHBA 1UUFA 3WHPA 3KG2A 4NV1A 3RGWS 1FJXA 5ABPA 4O4HB 2ZITA 5HEKA 1FFEA 3TLMA 1P0QA 3NIBA 3DHEA 4KE6A 3MRTA 1YIAA 1THGA 1YDMA 1KO4A 3TZEA 2ZYHA 1AHIA 2QTVB 4JH0A 2YWJA 3P0EA 3KL2A 4KDEA 4FGWA 5D6NA 4ASUA 4IZ6A 1GRNA 5A5EA 5KTPA 4ZV7A 3LW8A 4YUWA 4CLXA 3ZV7A 1CUJA 5EQDA 3BBPA 4DREA 2B2XA 4YR7A 3O95A 3F78A 4NJMA 1PVDA 2XTJA 4TYWA 3QYJA 4XFKA 5ALIA 3DMYA 4JI5B 3SNHA 1VZ2A 1IZZA 1SKMA 1YMVA 4G5FA 4XLLA 4U5QA 3RAJA 1U2GA 2QUHA 2WPNA 1E92A 1VG1A 1YDGA 3KR2A 4B6OA 2VUUA 2Q5IA 3FTFA 3DL7A 1OFGA 1YKSA 1GRRA 4INZA 4TTIA 4DG9A 3FMFA 3A4IA 2CUNA 1E1MA 4TS9A 2GF9A 2RKBA 3K5WA 1KI8A 4LGYA 3SJCA 2YOHA 1OJLA 3BL5A 1ZOIA 4QWMA 5H3HA 3SGLA 3FMIA 4XVCA 1H1LB 1J0CA 1KJIA 2GUWA 3F3YA 3A6HA 1N2XA 3FHTA 2P0YA 2VHZA 2AJ8A 4KWTA 2VH2A 4R41A 1AY0A 3FZNA 1D7OA 3AVOA 4R6XA 1QUFA 1FMJA 3IVRA 1ENYA 5JQGF 1C0KA 4DR2B 4JQZA 5BNWA 1Q19A 1YL5A 1A5SB 4IIYA 3TLAA 5BN3A 4FEYA 4G8BA 3AERA 4EWLA 1YQUA 1AKNA 3CR8A 2EKPA 3CLTD 4IMIB 4IDNA 3I9MA 2Q3CA 3NBFA 3LVRE 4WVFA 5EQTA 4KUGA 4ZEWA 1N1MA 3A28A 2L18A 5EFOA 1J8VA 3RS7A 3WWOA 1CR2A 1GVHA 1JECA 4WFJA 5HYVA 4FB4A 3AIOA 3H5OA 3ZWAA 5JIBA 1RRKA 4LCJA 1J21A 1VCNA 1UBJS 1WDTA 2NM0A 3D8TA 4QUKA 1MO5A 5IVHA 2H3HA 4F3KA 1EVJA 5DLYA 4B85A 4LY0A 1XA0A 4F91B 1M33A 3GJ7A 3NNNA 3QVSA 3E5MA 4RZHA 3ROKA 3COZA 2J7PA 4D6XA 2COKA 5LDHA 4J0CA 3FR7A 3IJRA 2Y1CA 1BRTA 4AKGA 3R9XA 3IULA 4BP1A 4BO5A 4L51A 2DBRA 3HL4A 4D1YA 1T9KA 2HSZA 1GSIA 1Y6FA 3OBBA 4RZ2A 4HRXA 4WCFA 1U7DA 3EGDA 3H6KA 3TO5A 4ARAA 3R3HA 1ONNA 1MPXA 3H8VA 2QR3A 3Q15C 2HJVA 3PGA1 1MAVA 3T4XA 4D8TA 2Q3DA 4U7WA 3TEFA 3JALA 1FYWA 1N57A 1ZCAA 3NM6B 1U0JA 2WOJA 2BEKA 1H0SA 3L0ZA 4U7JA 5BMVF 3K1AB 3RVPA 1B41A 4WIAA 1YAJA 3WYBA 4EJFA 5KNDA 2YOGA 3NHUA 4AZ0B 3TTYA 1U81A 4V03A 2XVYA 2YIJA 3DVLA 3UF0A 4ZJZA 2AW5A 2Z3VA 4HXEB 1DAFA 3ICCA 3PDJA 3WKEA 2BJHA 5IJ0B 5B58C 4ABTA 1UPFA 2PZBA 5HR5A 3RW9A 3MRVA 3Q2KA 3JRXA 3SI7A 4REQB 2B4RO 5AOBA 4CMEA 3R0IA 1X9GA 4E11A 3QX3A 3N8HA 3IBSA 1HGXA 2EF0A 2IF2A 3KLNA 3NOQA 5HZGA 3HXLA 2ZE8A 4WBNB 2ORED 2XRFA 1I3LA 2E4XA 2ODWA 4QBHA 4C4ZA 1RLIA 4HUQB 1NY6A 4XYGA 4KN5A 1KJ9A 1JG2A 3WFJA 3MRSA 1E3QA 4G01B 1GT91 4PHTA 4OYLA 1IEVA 1KH1A 1FSGA 3WWZA 3C3MA 1OFVA 2WB2A 4EA8A 3WGZA 3CIFA 3ZI4A 5HA5A 5A6SB 3A6KA 5KYXB 4HAYA 2PS9A 3G89A 4DA8A 2EFEB 1X1QA 4KMSA 4CQJA 4XIGS 5GGYA 2F67A 3ITNA 4EZIA 3EEYA 2BBSA 3EGXA 3MTAA 1M2VA 4OP3A 5DYTA 5IK2D 1CVLA 3QVTA 1QP7A 3IAS1 3KSRA 4IQ8A 2OA0A 1JZTA 1W4ZA 2C2OA 1NMEA 3BE4A 4UD6A 4MVXA 4MAMA 5DHTA 1OF1A 5C9ZA 1H5QA 5BSUA 1JMVA 4FYJA 1GPUA 2DYKA 5HQTA 2FEPA 5I3CA 5LZ2A 3F4BA 5CFQA 5G0VA 4WCFB 4GZMA 4Z7OB 2NPIA 3SFTA 1RVV1 2VJNA 4E46A 4HHEA 3T4UA 4UU7A 4WCFC 2LD4A 3ACCA 3RNOA 2IQ5A 4JVNA 1Z38A 6REQB 3NOXA 2IC5A 4OGLA 4RHUA 3ZWYA 5DBIA 4B3GA 5F7OA 1HXHA 1MZVA 2IU6A 3QLVC 3W77A 3X3HA 3TOXA 1RPJA 1JLLB 2YZ2A 5IWAB 4YMLA 3WL7A 2OCXA 4US2R 1KOFA 1U8UA 4DJAA 5C18A 2QWXA 1DAIA 3EZ9A 4KTTE 2RK6A 5FBWB 2JLUA 3H5VA 5EQFA 4NH4A 1JW9B 5AW1A 4NAVA 2C8KA 1AF7A 2RAVA 3DAPA 4R81A 4GX5A 2DBQA 2JIMA 3OM9A 5DGHA 3WL6A 3RT9A 1YDFA 3G0IA 1XXHA 3DV0A 5E7QA 1Z28A 2D1SA 1ORRA 3VC2A 3IHKA 4Q7QA 4PIVA 3T5AA 3MT0A 5JI2E 2Y1WA 4IRMA 3BCSA 3GG2A 1UBFA 3AH8A 3OEYA 1KOLA 1SIOA 1XHFA 4MKFA 2IBMA 3P2MA 5GY7A 1WZ2A 5JAZA 5CHYA 4Z99A 2Y1EA 3QU2A 4QAJA 3FVTA 1FXUA 3TW4A 5DYGA 1DKPA 3IO5A 3SHVA 3S7TA 4NMXB 1E2QA 7GPBA 3OQNA 3U17A 3EWSA 1CUBA 5EYPB 821PA 1UP7A 4DNXA 3D7NA 2WAMA 5AKKA 3FRHA 1G3MA 3GXOA 4YAJA 4ZVLA 5B3KA 2J5BA 4L8GA 3I1IA 4B40A 4ZODA 4E15A 4HZGA 3GHYA 2FN4A 1VPVA 4WESB 2GTIA 2VA9A 4HH3C 3HPRA 2A5FA 1JX6A 3ESAA 1HYQA 4X6UA 4PS1A 1F2TB 1OBOA 1ZRMA 1VSQA 2ZS9A 4F5DA 4AAYA 4ENQA 4UMDA 1H3FA 1X9HA 1TM5E 4HT3B 4CFSA 1JB1A 2QMEA 3K7EA 5H7XA 2D4HA 3DC7A 2CFSA 1U2GC 2EGHA 2FJ0A 3DAGA 1KPHA 3DBHB 2ZCUA 3HE3A 3M1LA 4KVAA 4NDZA 3USES 4BU1A 4YAKA 5JC8A 2Q3JA 3IVXA 3IQEA 4QT0A 2FX5A 5IPFA 4JD5A 1SUBA 2N47A 2WUVA 1I51A 1B0AA 2VNSA 4L8YA 4R1UA 2ZRDA 3IQIX 4WL0A 1G66A 1OX4B 4D99A 3QUAA 4XGNA 5HBRA 2BELA 2CNDA 1K92A 1PAUA 3QUSA 1IJEA 4U1RA 3OT1A 2GZAA 3K5HA 2JIDA 3P2JA 4M0KA 4MULA 1Z6PA 4OGWA 3TL2A 4D8WA 4I9GA 1XMIA 2QPAA 4LTMA 1Y3HA 4RF5A 1K89A 5HDQA 1DHTA 4X8MA 3BSYA 3GRZA 5ILGA 2E6UX 2YIDA 4OHRA 1I30A 2OKGA 1UAGA 4RYLA 1ZSYA 3QFHA 1L5WA 3R3SA 4XIIA 3FCXA 5JBIA 1OAOA 4PAOA 1E1YA 1ML4A 2EW8A 3K9HA 2OAP1 4PNHA 5KTOA 2CYCA 5D3MA 2ETVA 4RTJA 2CSXA 3HJCA 1E3TA 2WSMA 1ZISA 5CVEA 4FFBA 2NU8A 1EXDA 1U3TA 3T7SA 4GOND 4XIYA 3TSWA 3R3YA 3H3JA 4FC7A 1P29A 3JYNA 5B37A 4KHPB 4Q3OA 2JGDB 1BMTA 2UVPA 3N2IA 3RKSA 1QE3A 4HS9A 5CYOA 5KKAA 1NI3A 3NIWA 2MWMA 2VHEA 2ALJA 3ZUGA 2KLHA 2RGUA 4TXLA 2DQSA 4BMYA 4EW6A 1L5HB 3MLBA 4DV2B 1G38A 1ZUNA 2I1QA 2B92A 1ZOLA 3UTDA 1O8CA 3N8DA 5I9TA 4ZJPA 4YO7A 1TVKB 3QUBA 2ACEA 4NSNA 1SA0A 2FZ5A 1U4NA 4M8NE 4FHEA 4OP1A 3T06B 4CNBA 3VKGA 4PFJA 3ZY3A 2VCEA 2XB6A 2HZBA 3TJMA 4BLRA 3THOA 1KEKA 1Y0BA 2HWWA 3DOEA 3NHRA 4K3VA 3QI2A 4QEDA 4NAHA 4C9BA 5AD1A 4QDUA 4S12A 5CA1A 1ACJA 3GGJA 5HZHA 1JU4A 1KF0A 3T4PA 5KYYB 4QVGA 1IULA 3IAXA 1P2SA 3LHIA 2P11A 2CHQA 5F4BA 4YXWA 4BQRA 4ZEXA 1G16A 1NVWQ 1ORIA 2VDVE 3FYUA 2OWDA 3KDAA 4C3VA 4LG1A 2YMQA 4EY5A 4RTPA 3N6RA 3B82A 5FBLB 5SV2A 2QMYA 2Q9BA 4CM6A 2BFDB 5JZ9A 5D3QA 1EHYA 2C9MA 2JCGA 2QRNA 4GYWA 5AVSA 2CHFA 1VKNA 4U0JA 3WMWA 3HU3A 1E59A 3MTGA 1U80A 3E3LA 3O3OB 4Z7NB 4Z4IA 1OCEA 5GOZA 3VPCA 8ATCA 3I6MA 3FYHA 5CTJA 2ZIFA 3C6BA 3VBCA 2AEEA 1Q7BA 3Q88A 4I7EA 3V9AA 2H2DA 3OEWA 1LI7A 2WYIA 1NHGA 1QGUA 2NNWB 4K6KA 4QLAA 2NN3C 1CZHA 4R9UC 4AF7A 3DYVA 4KHZA 3V1UA 1LTHR 2V98A 5K7SA 3E9QA 1SVOA 3EH1A 3JSXA 3KPJA 5JMTA 3OZGA 2W42A 2DPYA 5FEMA 3ZV3A 3GLFB 3LQ4A 3K1TA 4L4RA 2KSQA 1ZK3A 3P9NA 3PDUA 4MUAA 4X66B 4JAVC 1OASA 5EMMA 4I1OA 5DBFA 1TM4E 1TYDE 2BP7B 2J41A 2P9TA 1W5AA 3MINB 1HZZA 1QTIA 3QU4A 4BMPB 3M83A 1N9GB 5IF9A 1ZNZA 4C0SA 2IEBA 4XGRA 2A88A 2JLRA 4HDMB 5TQVA 1F1BA 3FOCA 3MJRA 4YAEA 3ZWCA 3Q7PA 4BNFA 1LF0A 3I2GA 3H9JA 5EYPA 1MW8X 3AVWA 1UXJA 2O1XA 5JFOA 4U8HA 4IZOA 5JZMA 3FGOA 1L8XA 4J29A 1WS6A 3PPWA 4BO3A 4EB3A 2I4IA 1IBKB 3IQDB 4TN5A 2PCJA 3QWHA 3T1OA 3WL3A 4WVLA 3BXZA 1JH9A 3E4CA 4ZCQA 2A0UA 3T6KA 5LMNB 2QTFA 2WJ4A 2VYNA 4QWWA 4EL5A 5C32A 4O3MA 1F6BA 4RKRA 4L9AA 5IXSA 4UUPA 4RKQA 4Q7KA 4UEJA 2HR1A 1G9TA 3JAKB 5CK4A 5FWYA 2YHAA 3DFKA 4KFTA 1XD9A 3DF7A 4YCMA 2Q21A 1E9DA 3OJOA 5LA6A 2ZRLA 2QMZA 3RO7A 2QLJA 2VHXA 3IV9A 4AKTA 3IP9A 2I5PO 1NQTA 1U28A 3F5DA 4PVDA 2YS6A 4Q4DA 5EP4A 1D8AA 2FZCA 1Y6GA 3S28A 1IWOA 4P4LA 2PKQO 1HH4A 4BZPA 4KYUA 4Z3OA 5BSRA 5IBCA 1D9ZA 4JU8A 3WGIA 1GARA 5EE1A 3NRBA 1T15A 4ZTBA 2QRPA 2WKRA 4MI9A 3DDCA 4YP7A 5LZ7A 4CPDA 1JR3D 1JJAA 3TF5A 4BVHA 1ZNWA 2ZBVA 1RKVA 5L3ZA 1M54A 3PQ4A 3JQBA 1E6KA 4EZBA 1L6IA 1R8JA 3TL3A 2GKGA 2O0LA 1DWPA 1R0BA 1XZFA 1NBWB 1ADYA 2YQ5A 5HKKA 1BXKA 2HLNA 1TNDA 1Z37A 2B0JA 3TAXA 4BVFA 1Z6XA 2JCYA 1E1LA 1ZEMA 3P2YA 4OKIA 2AG0A 3ZDXB 2F1IA 4O4JF 3CPEA 3WZLA 1PFGA 3DP7A 4GRIA 5JPDA 1SOUA 1IAQA 1Q77A 3HI6A 3ZHQA 4QKQA 1RI3A 2BFAA 2ZROA 1E1QD 1SFRA 1ISMA 2JGLA 4KQ6A 3LYHA 5DM2A 2WTUA 3FTQA 3L49A 4PZ0A 5B3AA 1SIBE 3EJ6A 4GE0A 3SD7A 4CKBB 1BOOA 3A9UA 4XAQA 1OROA 1IHXA 2P69A 2QI9C 3E7PA 2G0TA 4IIGA 2OQVA 1MB0A 3A2NA 1KO7A 1SQSA 3FDJA 3GJ5A 4J4TA 3OU2A 5EIEA 1OE0A 2BMEA 2X6QA 3MUEA 3N2KB 5DNWA 2VC2B 5KSYA 4DL9A 5FYDA 3T3HA 4P32A 4TRNA 1W85A 3EAGA 3OLWA 5ALMA 3VR0A 2DFPA 3GPCA 1DG9A 3JQRA 3I2HA 4C30A 1FJHA 5A2QA 1C4XA 2VKQA 4FR5A 3UK7A 4D6PA 5KVSA 1J09A 2X0DA 3JAKA 2AQKA 5FWYB 3ZE9A 4C0AC 2XNCA 1SVWA 5IM4A 5LQSA 3EC2A 1BD3A 1YB4A 1SOMA 1RADA 1U9IA 3U7QA 1RNLA 2Z5FA 3GRPA 1OREA 3CV3A 4WKOA 4WKBA 1FW8A 2AFHB 3B1ZA 3EG9B 4N3AA 2E18A 2XRMA 3C3XA 3CPJB 2YX1A 4G5RA 1V25A 2IH4A 2GVZC 2ZUUA 3FIJA 4IFIA 1JJFA 3FCAA 1RCUA 4PPGA 3CLSC 5L6MB 1G5PA 2O8CA 3MSXA 3E18A 3AFIA 4RTQA 2HRDA 2TMDA 1ZH6A 5F7ZA 4UNQA 2BFCB 2EKLA 4OLAA 2QNIA 2GVNA 3B3JA 3EZ7A 4MDHA 4AKSA 1ISFA 2I99A 2AJDA 4EVIA 2Q2QA 2XEXA 1P2VA 3H2SA 4RIFA 1T6NA 5IP5A 2IUUA 2R4TA 1XK7A 2XDQB 4N47A 2IS6A 1EPUA 1EKXA 3AW9A 1H0RA 4OUKX 1UKZA 3ZPXA 1BROA 1BGWA 4RVNA 4BQOA 3HKCB 2G9VA 1U7PA 1NJSA 3TW8B 2NYUA 3F8TA 2DLNA 5TT1A 2G76A 2QG6A 1QIIA 3RUIA 3GBVA 3VYRB 4CMJA 1RAAA 2HHLA 3UV6A 4CMKA 1A2KC 1SXJE 3HCAA 3RV3A 4YUXA 3GR6A 4KXUA 4KLZA 1IMJA 4H7JA 2PNJA 5HS4A 5JZVA 3KYCA 3FMGA 4JZYA 2UXBB 4QM7A 1JR4A 1FDUA 2YN2A 1U0LA 1KZ6A 3N5CA 3EMVA 3AEYA 3P94A 4CG2A 4DIBA 1R8QA 4WHMA 4K6CA 3EH2A 1C30A 3UAGA 5AVVA 1KIMA 2E55A 2FFJA 1JDBC 3JQGB 2NMVA 1RRMA 4DDVA 1YQTA 1JAYA 2EF1A 2OGUA 4ZT6A 2H85A 2DLDA 5G0UA 1F8FA 3LCJA 2IGTA 2EYQA 1CVRA 2OG1A 1G1MA 3LBYA 3ZDRA 3ZH9B 2ODTX 3GT3A 5LJIA 5DW0A 2BGJA 2CVHA 4XCXA 4TV8F 5JADA 1QR2A 3D3EA 2NACA 3WRVA 3WTCA 3IEVA 2ZJ1A 1J24A 1R64A 3OF2A 4H08A 5G53C 4KPEC 5J59A 4DBVO 3BICA 2UV8A 3LUHA 1EWKA 2FNAA 1KO8A 4TTSA 1T4GA 1P19A 1WU7A 1DWUA 2C97A 2DF8A 2PKYX 5EE3A 1IH8A 1FVXA 1V41E 5DXJA 2H1OA 1YRHA 3HL0A 1HZZC 2BZ1A 2WSBA 4GP7A 3V55A 4TROA 2GJ4A 1KZHA 2P4UA 3PWKA 3PUIA 1PR9A 4JJ8A 4XIJA 5LBTA 5A4JA 1CR0A 1S1MA 4LPKA 4OHCA 5JDCA 5FBVB 1N1DA 1K98A 4GVXA 3H9GA 5GAJA 1LLQA 4FFPA 2ILTA 3KKMA 3DEYX 1N6NA 3LUJA 4RVSA 4BQPA 1Q11A 4MA5A 2OBNA 1B2RA 2G28A 1ENPA 2RGGA 2IHKA 3HRKA 2GUGA 3KZCA 3TIFA 1DGQA 1MOPA 2H1FA 2IUFA 1RXCA 1PWEA 2X8LA 3NX4A 1E2NA 1S6YA 4RM3A 4DWVA 3WADA 3IV6A 1CQXA 3H5TA 4L2IB 2HC9A 3OTOB 5HQJA 4NX2A 4Q1VA 1J9ZA 5HJEA 5CLGA 3UC5A 2E49A 1PUXA 5TF0A 2EKBA 3QLJA 1EK0A 3QXGA 2IE0A 4OQ4A 4Q3NA 2AEMA 2A1TR 3TZ6A 4I1UA 1XQ9A 2NUTB 4OQNA 5DRTA 3ZJYA 3VYSB 1E63A 1E7WA 1ZH8A 3QELB 1PS0A 3IXLA 4FFDA 1MJGA 1W1IA 3T1TA 2R66A 1L7QA 2A3RA 2XYRA 3QVXA 1MX1A 2X5NA 3GAMA 3OO1A 4L4ZA 2ZBQA 2XYGA 3REQB 4EHBA 5KYUB 4DDHA 3G5LA 1QZZA 2CJXA 2A5YB 2W6JA 3ZKWB 2XXAA 1CHNA 1KBQA 2V3VA 2WC1A 2OO7A 2Q45A 2CVQA 2C2GA 1YVEI 3WJ1A 5SYNA 3WQHA 4F0JA 4FFVA 2IS2A 4EY3A 3NYIA 3OC6A 4DSTA 2QVGA 4MGYR 3QI7A 2D2IA 3U4GA 1ID1A 1GYPA 4G0ZA 4ONEA 5HKAA 2F8TA 3NYRA 4BMNA 3AYZB 2AE1A 2J3LA 3EZNA 4QHSA 4ENRA 4P6VF 4TLAA 1Y5LA 2FPMA 2GPYA 4MQEA 4AMUA 2EQ5A 4Q1BA 1PE0A 4EGJA 3HJFA 2CLMB 4OJKA 1NQUA 3JATB 3KYDB 4MGKR 4YI3A 1W46A 1W4AA 4QTYA 4UM9D 4ZVTA 2RAUA 2FZKA 3HYSA 3LX5A 2FPGA 4ATNA 5IMSA 4ID3A 4PLTA 4P2BA 1M72A 3OQPA 3QFCA 2OHXA 1LV8A 5J2UB 2YNMC 5EINA 1NXQA 4U00A 3SZOA 1T4DA 3UIEA 1MVNA 3K94A 5E9QA 2OKCA 3MWEB 3GEBA 1YS1X 3GVHA 1GG5A 1YZKA 4RGQA 5KYWB 1I33A 4TMTA 2I87A 1STOA 3E7DA 3EA0A 3NAZA 2CCKA 1MLDA 5JH7A 1AQIA 4Y0AA 1P7VA 1TM2A 3S27A 5C46F 4QAQA 1VSUA 1UC9A 4WZAB 4YMSA 5IVDA 3UOAB 3RREA 3HO8A 3URKA 5F5XA 2QX8A 1OJ7A 5AVKA 3MT7A 3L1HA 2DAPA 4Q4HB 2QUKA 2B5WA 3KVVA 3FZQA 3P9CA 1Z0KA 3SSMA 1C1DB 4E1AA 5J2UF 1PT5A 3IBGA 1UK8A 2FE1A 2FDXA 1VPDA 3D6JA 3AVVA 4KBGA 4BUCA 1RPZA 4H77A 4RSGA 5EKDA 4CR7A 2NU6B 3A0UA 3H1PA 2GD0A 1WW8A 1ZGGA 4IEIA 1QGOA 4UU0A 4CCYB 2O3QA 3PIDA 3HDGA 3R7WB 3JRNA 5TQ0A 5JJBA 3KHSA 5G4KA 4ZYUA 1WCIA 4P34A 2BEUA 2GXUA 3VH3A 3U4MA 4KIWA 1DLIA 1XN1A 4JA0A 4W1RA 1NBHA 5AXDA 1L5OA 1OOEA 3BREA 3UMGA 3ZKWA 2XXAB 2KLBA 2OB1A 4V0KA 5LNK6 1NMSA 1E2FA 3ZWNA 2OVFA 2ATEA 3UAOA 1H9BA 1X14A 2XBLA 3D2BA 5ALNA 3VHLB 3IR6A 2QTNA 2O3TA 3DT9A 4BN0A 1I5EA 1FUIA 4ECAA 1JFSA 5EWMB 4TLMB 1FNCA 1XF1A 3QWBA 4B9AA 2ZIVB 1M8FA 1LBHA 3TKAA 3MVEA 4URHA 1N8SA 4PN3A 5IC6A 1A3CA 3T3NA 4D43A 2J7PD 1FNDA 2ZTSA 2K87A 4ZVKA 5IWCA 1EVLA 3EDMA 3GGPA 3DT8A 1Q1GA 3NNSA 4HVAA 4FYKA 3GDGA 3WA7A 2ETXA 1VTKA 1B93A 1LPOA 2ODNA 5G02A 3KUDA 1UMDA 4Y0NA 1FDWA 1MT0A 3ENWA 4M38A 2KI5A 2FQXA 1WB4A 2XUOA 3GXBA 1MHTA 1P1CA 4MWDA 2V6IA 4R1MA 1FRQA 2ID4A 3GYGA 5AQ1A 4C0KA 1GR1A 4PINA 1RQGA 2C20A 2V7QD 4HQKA 4LWQA 1QLHA 4UHDA 2CXSA 3I0MA 3F9IA 1II8B 1R6BX 5C4MA 2CD9A 4B0OA 4NENA 1M8GA 3ZDCA 1OGJA 1N5LA 3UKJA 1BSVA 3GUHA 3ROEA 3SIXA 1TEVA 3LS2A 3IRVA 1ZRHA 4GECA 4H6VA 5CAEB 2D06A 3HJBA 3MCUA 1Q12A 3RCBA 4TGLA 4CUKA 1L7BA 1UQRA 2OFXA 2NUPA 5JNLA 2FWPA 2DHCA 2Q41A 1VG8A 1GEEA 1RJGA 4C08A 4OK6A 3MT9A 2VPPA 1KQFA 3OP1A 1RHUA 1LLFA 1TZBA 1U0FA 4RY8A 4H3HB 4X1IA 2EG9A 3EUWA 5HOEA 2GO1A 3HO1A 3HK2A 1VBMA 3S2ZA 1UBSB 1LX7A 1PJBA 4J1SA 3WFZA 4LQDA 2GCOA 3CR3C 2PKRA 3LH5A 1SUFA 4BY9E 4HLNA 2JI4A 3KB2A 4CMCA 1XQ1A 1OWLA 3THYB 1PQUA 3H1EA 5K0ZA 2HADA 4JUCA 6LDHA 2VXCA 3ZJ5A 2VNAA 1V71A 1H6BA 2HQBA 4FBGA 3UCXA 1CQPA 2ORVA 3JWJA 5IZCC 3KUKA 4KW7A 2VOJA 5KAMA 4LFBB 1EP3B 4HGZA 3NONA 2QD2A 1A4RA 2RHDA 2VHQA 5KJCA 1T5IA 3W34A 4DBLC 3GZNA 1Q0QA 4KSCA 3N70A 3SICE 1QFXA 1K5HA 2OXEA 3GNLA 1QBKC 2F8SA 4PPQA 4NJEA 3HDQA 1UQTA 2QVXX 1WZEA 2M98A 1G19A 4M1TA 1XEFA 4N0DA 2W6PA 3DMHA 1W8DA 3FRIA 1LD3A 1CVIA 1ODLA 1OYYA 4GBGA 3KKZA 4QRHA 2O59A 1CEYA 5B64A 4KGZA 3PE3A 3M4XA 3JD3A 4AG3A 1A9XA 5CVTA 5AVZA 3PNQA 3M1IA 4MA0A 2W48A 1T6YA 4PBTA 1H8HD 3B1WA 3GWGA 4LRXA 1XLUA 1Y7HA 4AJKA 1X1CA 1KXZA 1XXHE 1CQIB 4L8WB 3NZEA 5DP2A 3HP4A 2HSGA 2DLCX 2W2OA 5KX5F 1W85B 3O0TA 4FC6A 3TOVA 4FT2A 1QRRA 2IT1A 2W98A 4WBXC 4H7EA 1GSOA 4H17A 1QP0A 1KP9A 3I04A 3MJHA 1TUIA 4PG5A 2J3EA 2F4VB 2J08A 3I9LA 4KI0A 4H4EA 3AIMA 3RVSA 5IVPA 3N3AC 4P7FA 2CHVA 1DAMA 1MXFA 3B53X 1SBIA 4YX9A 4J0QA 4PQRA 3TW6A 4L8LA 5J4LA 5TNXA 2WF7A 1H9CA 2NYVA 2W6MA 2JFHA 3TDMA 3T3IA 5AKJA 5HFNA 1X1BA 1I4DD 2UXCB 4U2GA 1NVGA 4ILEA 1I3MA 1AKUA 4UUBA 1Y5RA 4KQ2A 4G1UC 2PIAA 5JSUA 1L4EA 5I7AA 4V2IA 4CL8A 1UDXA 1K63A 5DEOA 2GN6A 2X2OA 3VTZA 1Y9EA 2X0JA 2ZYVX 5M5BA 1ZEJA 2DT5A 3ENKA 3ER6A 3L05A 4B45A 4CXMA 2IP1A 1TVEA 2IIVA 1IZ9A 1SC3A 4HWSA 3NDBB 4CF5A 2PGJA 4EVSA 4ZPXA 5HGJA 3FI0A 1Z6QA 2IWHA 3WSTA 4RZXA 1RTKA 2FPPB 2B35A 2YMLA 2Z30A 2BBTA 3L0CA 5J23A 5KDDA 4PYOA 2VHTA 2GEBA 2PRSA 3ET5A 1TQHA 3PUXA 2J4CA 2VH1A 4WTOA 2Z57A 4EUFA 4MEAA 1NN0A 2V6FA 1PG5A 1ZHOA 4IIJB 2I9KA 2V3CC 2V9ZA 3SEZA 4TYQA 1TI7A 4K81B 4IINA 4U9UA 3QG5A 4TVSA 3DBHA 1NI4A 2R62A 3GFBA 4R01A 4JNCA 5FUBA 2YJ3A 1H1DA 3FSGA