1AUQA

A1 domain of von willebrand factor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
208
structure length
208
Chain Sequence
DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Willebrand
molecule keywords A1 DOMAIN OF VON WILLEBRAND FACTOR
publication title Crystal structure of the von Willebrand Factor A1 domain and implications for the binding of platelet glycoprotein Ib.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 1997-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1auqA00
2IUEA 1N9ZA 3E2MA 1LFAA 4BJ3A 5KYNA 2QTVA 1ZOOA 3EGDB 3TCXB 4CN8A 3F78A 4HQKA 3ZQKA 3NIGB 5HGJA 1MF7A 2NUTA 3VI4B 5KYYB 4UM9D 4WK2B 4Z7NB 4F1KA 1JEQA 2VC2B 3EFOB 5LN1A 3ZDXB 4A0QA 3K6SB 1V7PC 1MHPA 2NUPB 4G1EB 3PPWA 1JEYB 3EOAI 3K72B 5E6RA 3EOBI 4MMYB 5E6UA 2XGGA 3BN3A 1U0NA 1M2VB 3HXOA 4CNBA 1IDOA 2I91A 4WK0B 4M76B 1JLMA 3FCUB 3T3MB 5HJ2A 1RTKA 1RD4A 1Q0PA 5BV8A 2VDNB 3EG9B 1SHTX 4HQOA 5KYXA 5KYWA 1DZIA 1CQPA 3RAGA 3NIDB 4CN9A 5KYUB 3EGXB 4UM8B 1AUQA 4Z7OB 3TW0A 3VI3B 5ES4B 1PD1A 3HXQA 1QC5A 1AOXA 4IXDA 3K71B 2NUTB 3N2NA 3T3PB 3HI6A 5E6SA 4C29A 3Q3GE 1IDN1 1UEXC 2I6SA 4HQFA 4WJKB 1MJNA 4DMUB 2ICAA 4XW2A 1T6BY 2X5NA 4IHKA 2ADFA 1M1UA 4IGIA 1U8CB 1FE8A 1QCYA 1ATZA 1XDGA 1XDDA 1AO3A 3BQMB 4O02B 5E6RB 5E6UB 1SQ0A 4NENB 1CK4A 1DGQA 4G1MB 2VDLB 2VDQB 2ODPA 1M2OA 3PPYA 1JEYA 3FCSB 3PPXA 3ZE0B 3V4PB 3V4VB 4PN7A 1IJKA 2ODQA 1YVPA 4WK4B 4FX5A 1M10A 1ZONA 4Z7QB 1MQ9A 5KYUA 5HDBB 3PPVA 3EH2A 2VDPB 4C2BA 4NEHB 2I6QA 4C2AA 3EH1A 1RRKA 1YVRA 1JEQB 2WINI 1RS0A 3EG9A 1QC5B 3EGDA 3EGXA 3BQNB 3M6FA 1BHQ1 3IBSA 1BHO1 1FNSA 4HQNA 4MMXB 4WFQA 5E6SB 4UM9B 5KYYA 1XUOA 4JDUA 1PCXA 3ZDYB 1MQ8B 1ZOPA 3EFOA 2M32A 3K6SA 1N3YA 2WW8A 2XWBF 2VDRB 2NUPA 1IJBA 3TVYA 1NA5A 1M1XB 5KYXB 3IJEB 4MMZB 2VDKB 1OAKA 4HQLA 4F1JA 1M2VA 1U0OC 1T0PA 1L5GB 3QA3E 5KYWB 3GXBA 1MQAA 3ZDZB 2O7NA 4NENA 2NVOA 3TXAA 1SHUX 3NIFB 2VDOB 1PD0A 3F74A 3ZE2B 3ZE1B 2B2XA 1JV2B 1TYEB 2XWJI 2VDMB 1PT6A
chains in the Genus database with same CATH superfamily
1YDFA 5ED4A 4YJHB 1B23P 4Y1RB 4JUAA 1WHTA 2JI6A 4GFDA 2CDNA 2HMAA 3CR7A 3VDMA 1GTSA 1K89A 1QQBA 3IR7A 4DNFA 4PS1A 1EK6A 5HZKA 2JLCA 3T5CA 4Z7NB 3SG0A 1PIWA 3GGPA 1HKUA 3E4CA 2V54A 4LJ6A 3RFUA 1R2QA 1W93A 3ZY6A 1KFEB 2PMBA 1YMVA 5I9IA 4B3XA 1UDWA 4HY3A 1JFVA 4LZPA 3S2FA 3ZU4A 3X1YA 4TV9A 2ODEA 3C3XA 1A8SA 4G5OA 2Y0CA 2VHUA 3Q2IA 4BAGA 3SC4A 1MB4A 5HBGA 1OLXA 3W6NA 1CBUA 1RVV1 1L5HA 1XO1A 4YCCA 3RYCA 2PLRA 3A1EA 3COVA 5CUQA 2EGUA 2HADA 3EAQA 3F1LA 4YR7A 1UKAA 2RGCA 4OO3A 4AJKA 4ZMRA 3W5AA 1SKBA 3C8ZA 2QPOA 1Q0HA 1NTOA 2XE6A 4LHEA 4M0EA 5EXEA 5HJ2A 3G8YA 3WHKA 4AMUA 5I7RA 1IBLB 3RUIA 4RH3A 1W96A 3BA1A 3RYHB 1IOWA 2CYBA 2VQDA 5AJZA 1T0IA 5FADA 2B1IA 2R5FA 5FD8A 4B81A 2FF5A 3WSWA 1NOJA 1DCKA 1JEAA 3A1FA 5IJXA 1W5EA 2RG7A 5KHAA 3FOFC 4IZIA 3PCRB 5ESXA 2BM8A 2AS0A 3F3KA 3G1TA 3FN4A 2VR1A 3K4HA 1XQYA 3BGWA 3TNLA 2V3WA 4DZZA 2C2MA 3SS8A 3WYNA 1CJTC 2XV1A 3OIUA 4TTJA 2UYHA 2RBKA 2PS0A 1T0JB 4FINA 2P30A 3O21A 4JZYA 4D0SA 2ZCJA 1JI0A 1S9DA 2Q8PA 2JH8A 4E5YA 3BJEA 4R98A 3A3OA 1ML3A 2OO5C 2FF7A 2PZGA 4XEHA 3Q7RA 3RU2A 5JQGB 4V39A 4DNPA 1Z88A 3L1HA 3OY7A 4XVCA 1PR2A 4LWOA 2QTGA 1XXLA 4WNAB 1Z4IA 4W7IA 1IQPA 1CJMA 2BMJA 3JPWA 4FQ8A 1B8OA 4QQRA 2AXQA 4ZT4A 1V45E 3ET5A 5BMVA 2VNKA 2G04A 1O87A 2F6RA 4F5ZA 3NGLA 5D5PA 2VUIB 4FHZA 3S8MA 3QVMA 7MDHA 1U7ZA 4FR5A 2QBYA 5LCXA 2VF5X 2NVUA 4HLQB 1HLGA 2Q4TA 4QYWA 1NF2A 1RS0A 1DV2A 3L1JA 2KLBA 2X41A 3HBMA 3KT8A 3O3OB 4LHVA 5FA5A 4E08A 2AZXA 4XH9B 1YMQA 3N2EA 10MHA 2G9NA 3SX4A 1NBIA 2EHJA 4HMPA 4JP1A 4XPIB 3ZHYA 4NL4H 2VLBA 4E1BA 3U4QA 4PLZA 2FFBA 3OTWA 1NLFA 2PBZA 4OXNA 2QE7D 4RK4A 4NV3A 3ZXXA 5LP6A 3PXXA 5BWMA 1MAVA 1CDEA 2REBA 2RAFA 3R7WA 3P2MA 4PZYA 4F4DA 3VKWA 3G0OA 4WCFB 2H2FA 3OFVA 1JIVA 3RC9A 3WGGA 4OKNA 4BZZA 2JAWA 4D3FA 2ZM5A 1Y4DE 2L42A 4F4IA 5EY5B 3T38A 4CL3A 2W2QA 1N8TA 1C7IA 4NJEA 4DY4A 2C0PA 3HYRA 3ZW8A 5JRZA 4UMDA 4RHEA 3LCCA 2Y1DA 5IKMA 5JQGF 1YQXA 3O92A 2V3VA 2NV6A 3EVEA 3WFZA 1EFPB 2QF7A 2HLNA 3QHQA 3MJTA 3ND5A 1ZMOA 4HGYA 2PGAA 4TZ6A 1Y98A 4K03A 5BR1A 3HKEB 2HNKA 4N18A 2AKAB 5JE8A 3OAAA 1SB8A 5A7GA 3HNRA 1F3OA 3QNUA 1P6UA 4QECA 1YZFA 4G0VA 2IOQA 2C3UA 1XD2B 1ODIA 4MVJG 1M6YA 3STVA 3VI4B 4D9FA 3SXPA 1B73A 2WG2A 5CU7A 3STXA 3PXBA 1QG2A 5AYVA 4QGHA 4FUTA 4JK3A 4OK6A 3HDQA 4Q82A 4GIBA 4PVCA 4RHXA 4RE6A 1V2HE 2VWPA 5DIZA 4UAVA 3DMTA 1XLWA 1VXOA 4D0NA 4HGPA 5SICE 4AS3A 4H9GA 1JEYB 3U09A 3FOCA 4NKRA 5E6UA 4YUWA 2NSYA 1CXZA 2ZJOA 1HWYA 5KMGB 2NAFA 1D1TA 1MTZA 1HA3A 1P44A 2C78A 1CY7A 3BX1A 3EUFA 2AG0A 3G8CA 2CXQA 4KPGA 5EG5A 4CDNA 2YMPA 2DWCA 2QTFA 3MILA 1HG1A 1WOMA 1JHPA 4ENSA 4MB6A 2A4MA 1OHHA 3BXPA 4DABA 2VP3A 3I39X 1UCFA 1X94A 1T34A 1JG7A 1MPXA 1YKGA 3L0PA 4IGFA 3VPFA 3WO0A 2XCIA 4TZ0A 1SCKA 2G40A 1A8UA 4J1NA 4HNVA 1VP3A 5BORA 4MR7A 3C4JA 1RYFA 3EUWA 4INPA 5AKKA 3B1XA 4I6JA 1MDBA 3H5IA 3LXRA 2WD9A 5FF9A 2FQXA 2ZYSA 2IYSA 4NEGA 1MB2A 1WSDA 5EE9A 1PWXA 2FFJA 3AVUA 2KE5A 2VS1A 2J7PA 2YDYA 1DB3A 1TU0A 1OZGA 3C3WA 4Q12A 3OC0A 3RREA 1SRQA 2BE9A 2A5YB 2OVBA 1XJ5A 2J3HA 1PHPA 3CGWA 1Q3HA 3NOVA 4HQFA 3RSLA 4CQLB 4QATA 3WISA 1U2DC 1ZIYA 2N42A 4RVFA 1Y6RA 2HIHA 2ZI7A 4E4RA 2NNWB 4KHZA 4DPMA 2O7QA 3FHCB 2JAXA 1P6QA 1MRNA 4CDRA 1TK9A 3R77A 3L0SA 1T1RA 1S8AA 3KPWA 3O3CA 3OH8A 1R9MA 1CV2A 4KR0A 4DLAA 2VFAA 4C30A 2PUCA 4A0SA 1KZHA 4INOA 1IM5A 3BJRA 3HXKA 1E9SA 4HD8A 3T9FA 4OQPA 3DHVA 3GRRA 3ESYA 1F0NA 4GECA 3V48A 3OZXA 3MJFA 2HCJB 4U7WA 5GGYA 3RUAA 3OOHA 3QG1A 2J9YB 4TYYA 1AN0A 5KNCD 2CMHA 2VJQA 2Q6KA 5F7JA 1CY1A 2BTEA 1W0KA 3TW4A 1OBOA 4RKFA 4ALKA 4F5YA 1Y4AE 4Y2UA 1UM9B 4EMUA 1I1QB 4I36A 2GKGA 1T0BA 4R69A 1K7FB 4H27A 2GN2A 2L69A 1OGYA 3Q7PA 5EXDA 3AP1A 4NFSA 4ZDKA 5EKSA 5IM5A 3HJGA 4GMDA 1H6BA 2QQGA 1U0OC 4UVHA 3WDKA 5F1KA 2H9YA 3A6PC 3R44A 3I9OA 4OXRA 1K66A 2XEDA 4X1IA 3U3KA 4QM6A 2G82A 3JYQA 1DWPA 4LV6A 2Y71A 1K75A 3HUUA 3I5MA 3V1MA 3V1LA 4LC9A 1MO2A 3K6KA 1XRLA 3QITA 1ZL2A 5DNUA 2HCRA 4KUHA 4AFNA 2YTZA 1BDHA 1Z6XA 3RSFA 3TCXB 1DNPA 1E3WA 5CDSA 2JS7A 2BCJQ 4G24A 3OJ0A 4Y1GA 4CG0A 4EUFA 2AFIE 1U2EA 2PKQP 3B82A 2EJBA 4FLMA 4GYWA 4Y0NA 3FFBA 4BU0A 5KTRA 1MCZA 1XRRA 2PKRA 4MIOA 3P26A 3SZMA 3X1KA 1VIAA 4KPUB 2OHJA 2Y1FA 1W76A 4ME6A 4PNZA 2GPTA 1T6ZA 1RLMA 1UK7A 1T9ZA 1D7AA 3R3UA 1QU3A 2QLJA 5IPFA 1CUVA 3HACA 1GGEA 2B7BA 2RC5A 2HL6A 3EXEB 2R62A 3KJXA 3QKIA 1VYVA 3DW3X 5DYYA 2RKWA 2GFQA 2HUNA 5BNFA 1HE4A 1U11A 1YDEA 1K6EA 2IEAA 3DVQX 3IESA 3GLHB 1LZKA 1V7CA 1NMZA 2HBZA 3QWIA 4V24A 3V9AA 3WWPA 3RAJA 2D0PB 2GEDA 4KNYA 1E1QA 2F8TA 3K0HA 5KINB 2PM8A 3HU3A 5C35A 4FTWA 3GLFB 5JBNA 2IXFA 4N7JA 2ZG6A 3UKJA 4LFAB 3OU2A 2EFEB 1KZGB 4DEYA 4DJFC 4EFDA 4MAFA 1WXQA 2V6MA 2UUCB 2QTVB 1XAGA 2AEEA 5K3DA 2JFBA 4R9RA 3TIIA 5ALPA 2ECKA 1EGAA 1XP8A 2JCXA 2JLAA 3F90A 1ZKMA 5CYPA 1QAQA 1JDTA 2F3UA 3TVDA 3WLPA 4ZICA 1GA6A 4KODA 4LRWA 3RIGA 4JL6A 4OUKX 3MINA 3H16A 3AHDA 3VMFA 4QX6A 5DTRA 2GEFA 1FRZA 3DAGA 4ZEXA 1CP3A 1T4CB 2ZVJA 1SKYE 3IRVA 2DZDA 1JUDA 2B5OA 3DP9A 5DGIA 5KKAA 3ZHBA 5B5SA 2QE6A 2BBTA 4KFRA 1SELA 3K5PA 3OJOA 3DBLA 3ILSA 2ODPA 2E2WA 3QFFA 1TMYA 2K5UA 4IO0A 5D51S 2Y4NA 4HVAA 4RGQA 1N8NA 1KPHA 3FGPA 4WXYB 3L82B 3LWDA 3OCXA 4O25A 5E3IA 1S1MA 3WADA 5C8DA 1U0GA 3HMQA 2JIPA 4JLSA 1MOSA 3IUSA 3PUYA 5DBHX 3NRJA 5C4IA 4L78A 1NZJA 2D54A 1H69A 3O26A 1DJOA 4PLHA 1CUHA 1WMFA 4RPGA 5HR5A 2A59A 1ONNA 5A4JA 3BIJA 4O8ZA 2YZNA 4IW3B 3GBVA 4AJ4A 1QQTA 1X1RA 3JQ7B 2C2WA 3PLRA 5LB4A 2G17A 5CNMA 1LZLA 4ND7A 4Q19A 5E38A 1FU4A 3BTSA 1NC3A 4U7GA 1OPXA 1R9NA 5K0LA 3U5TA 1OYYA 2IEZA 2YX1A 1G5PA 4BQNA 1Q19A 2O50A 2G5CA 4MWZA 2C7RA 1MT3A 1FVOA 1AV7A 1T5DX 2C4VA 2MYUA 3EBPA 3GJRA 3QLEA 4TXLA 5FTNA 3QPVA 3ROGA 3E58A 3SF8B 1UIRA 3VAZA 4ZMBA 1KR5A 3FRHA 1OU4A 5FEUA 2DE0X 3D3WA 2QGZA 4G8CA 4ZCSA 1GRQA 3HKDA 1W85A 2XT9A 5KYWB 3GN1A 3RM3A 1OI4A 4G8JA 2O8CA 3B53X 3FCCA 3ZVMA 3CEJA 1ZVVA 3W78A 2UUPA 5H0IA 4K9OA 3TI7A 3AEUA 3ZU6A 5E9WA 3IE0A 4FWTA 3LQRA 3TB6A 2D13A 3LTEA 3G5LA 5JCXA 2ZYHA 3UXMA 4B2IA 4F3NA 3DVLA 4JYMA 4UM5A 2BH2A 5CTJA 1L9KA 1LFAA 3C6KA 4CLOA 1HDCA 4G86A 2ZZKA 4Y8VA 2PZAA 4ICIA 4RKRA 1ZA2A 4XSVA 4YNBA 1DBWA 4TTPA 2FPPA 1E5XA 1IY1A 1Z82A 4B3DA 3T54A 1V39A 3ZY2A 1ZD9A 1V96A 5AUOB 4KX3A 1HC7A 2FP4B 5FFNA 3CW8X 4BMXA 3EXG1 5BNWA 3E9RA 2H57A 4A0QA 3ND6A 3PHCA 1E1YA 3UJNA 4H15A 4QLAA 1JYSA 3LG2A 3MGGA 5AM3A 4DCSA 3MT0A 4ZQGA 2O2ZA 2FHSA 1X7DA 4R7GA 1A77A 1WMAA 1X1BA 2JFXA 3ANXA 3LT4A 3KEQA 1R4MA 3QUSA 2DY0A 2QUZA 3BWVA 3HO6A 1YCFA 3CWCA 5B55A 1DFIA 3S2IA 5KSYA 1G6OA 2X23A 1SIWA 2ZU0C 3CUYA 4GPD1 3F9CA 4AIIA 5C80A 2IU3A 1K5PA 3KJQA 3TECE 1BKYA 5LL6P 3TKLA 4LFBB 3RUPA 4KWTA 2ZRDA 2MWMA 4GX1A 4JP3A 4UUBA 4ENVA 1K88A 1AT1A 2EWVA 2GWRA 2ZUFA 2WJPA 4ZI7A 4LG1A 2V7TA 5K8TA 2HBRA 3EF0A 3GUHA 1YE3A 4HTFA 4XTCS 2WA1A 2O8BB 3FKSD 1SVWA 1WS6A 3PNMA 3FTPA 3K71B 1MUUA 1VMEA 2JLZA 3UA3A 3V4SA 5I51A 4D43A 2IPNA 2J0EA 3RLIA 4C29A 1N0VC 4IXNA 4IMIB 3OIYA 4L8WB 4TKVB 1UEIA 5I9LA 1OASA 1ELOA 1IHXA 4HEJA 4ZEOA 1UPAA 3C3JA 2G5GX 2HT6A 2QRLA 4YDRA 4J4BA 4KLAA 3L46A 3BQMB 3ER6A 3GLTA 1IHYA 3R6TA 4OQYA 5E6RB 1Y5LA 5CCXA 4NENB 1ISGA 2A67A 1ICEA 1M34A 1Y3DE 2R9VA 2ATCA 2XTNA 3D0QA 4LHZA 2X6RA 3PUJA 2R5WA 2VDQB 4I46A 3CT4A 3HJHA 2XMCA 2C31A 2RHLA 4K9RA 5GWXA 5TMEA 1ND5A 3U3XA 4NMMA 4KVAA 3KQYA 1RZVA 2WPNA 3ETGA 1Y33E 3A70A 1YZKA 3GRUA 1C0IA 3EIOA 3FPKA 2QTCA 1NUTA 3PFKA 1ZHFA 1TE2A 1P5FA 4ZEWA 4E7PA 3TOSA 1NVAA 1EFDN 2DHCA 4GP7A 5CRIA 4E03A 5TLSA 1LC3A 2IS2A 2VNIA 2W2LD 1Y3BE 4EB8A 3GJQA 1A1SA 5ICMA 4LAFA 2ZJZA 3A6KA 1UPCA 1E4EB 1SNYA 1FBNA 2BFDA 3DZBA 4G0OA 4Q9LA 4X3CA 3A1WA 4L57A 4WADA 4YLEA 1SBCA 2AVDA 1GZDA 1WIWA 8ABPA 2E6KA 1F8UA 2ZUSA 2VDRB 3F2IA 1CUIA 1V8OA 1WVMA 3KHUA 3LGXA 4HGZA 5DYTA 3U37A 1FP1D 3M1AA 4HH3C 4K6FA 3WWDA 4NE2A 3EPPA 2C9ZA 4Q02A 4MRMA 4Q3NA 2WWHA 3EOZA 3TZHA 2C7BA 4M3NA 4KV7A 3K70D 1E6WA 2QYHA 3WA6A 2XUIA 2OC9A 1H3EA 4RE5A 3A6GA 4KAAA 1N2XA 1C8VB 1K3UB 3WIDA 3QVJA 5DPMA 5GP1A 1BXZA 1U3UA 3NIFB 5IWCA 2E4UA 1JDBC 5CB4F 1GNQA 1HT0A 1SUFA 1JPNA 1YK0A 1Y9DA 1LSSA 2JFHA 2QT1A 3IAFA 1OX6A 3IO5A 4H4EA 4MP3A 2H2GA 4Y2PA 1IJFA 1XZPA 4ER0A 4IL5A 2V98A 2IYAA 5ALSA 2GYYA 1XQ9A 2C9DA 5KWIA 3PQDA 1N3IA 5ICEA 3Q9LA 3QUBA 4RMJA 2WMDA 2JVJA 3KHKA 5AO9A 3DHWC 4N7MA 3TX6A 3U7QB 3ZJUA 3OEYA 2CMKA 1ZD8A 5CX4A 1V7PC 3KLOA 2I9KA 1L7DA 2Z1MA 5BUSA 2PJRA 1Z7YA 5KJ1A 2NU9A 3ICWA 5B1DA 3UWDA 2HRDA 1GTMA 2P5YA 3QY0A 1KJYA 2ZR0A 1P45A 2QROA 3M2PA 4LW8A 4PONA 3TQIA 1LLCA 1ZK2A 1SGWA 2FPSA 5A3RA 2WT8A 2CNKA 3D6UA 4CLRA 2F3RA 4MVJM 4QXMA 2ZS9A 1IZ0A 5FOUA 2D2EA 2PS3A 4B32A 1U2RA 2PFGA 4JYAB 3LSYA 1GV0A 1L5YA 1UK9A 4DV5B 1GT6A 4AZ0B 2Z9BA 3THYB 5JYBA 1A69A 4C0HA 4YMTA 3K31A 5CR9A 2CEAA 5D5HA 2J1LA 3N2KB 1GO2A 2KMLA 2OM2A 3SJ7A 1SC6A 3EGEA 3T3GA 3V2HA 4DJ5X 3OTOB 1QC5A 3OOEA 4NQRA 1OLUA 3CRRA 3KT3A 4RKQA 3R0QA 4JBGA 3H17A 3R7FA 3SSAA 2FEMA 4BZQA 4N41A 3AZPA 2RK4A 1W6RA 3P9RA 4OREX 5IBRA 1AX9A 1E5QA 3SZ3A 4J3NA 1NOKA 5MN6A 4FYPA 1CQXA 2ISSD 5BO5A 3UXYA 5B2FA 1OUMA 1OPRA 1T9CA 4UEWA 1J5XA 4P4SB 4GMKA 1K8YB 1XNJA 3GLIA 4RABA 3JD0A 4LC1A 3UY4A 2YHUA 2X9LA 1WMSA 2I03A 3CCCA 4IKEA 5DWDA 4RLHA 2Y0BA 1BWSA 4MB0A 5H81A 1VCMA 3ONDA 3RWBA 3UOAB 4EPTA 4YMSA 1B6TA 2ZXUA 1N2OA 8AT1A 2FUCA 1F2TA 2V6GA 1PQYA 3NC4A 4C1BA 4KMSA 2ZRLA 3SM3A 1NTRA 4KN9S 5BN4A 5CDGA 1Z83A 4LXYA 4JI5B 3LBHA 3CVOA 4L5JA 1PYOA 1BNCA 1G5TA 2I4OA 2OV8A 2ZSUA 3CZMA 3THSA 1LWNA 4CM8A 3F71A 4ARZB 4QDOA 1VFNA 2XXBA 2CEKA 1AQIA 3K53A 1RQ2A 2IYFA 4WZBE 4YHBA 4B40A 2OCPA 3IURA 1AGYA 1L4KA 4UHHA 3STWA 1GGVA 1SQ5A 5LP6C 4MWEA 4PAQA 3R40A 1K7YA 1A5AB 1PCXA 3L1UA 4JLDA 4F4JA 4ZIRB 1LVUA 3ISTA 1DEAA 4FOLA 1HUQA 3WMEA 5DXAA 3WMWA 1T2NA 2O57A 2Y0DA 1E8NA 4BNLA 5F4ZA 4URWR 1DIBA 5EMNA 1WV0A 4ZOLA 3PUKA 4TMTA 4L85A 2DHQA 2YWBA 2IX3A 2AYYA 4G0WA 3Q41A 2CNDA 2HGZA 3SAJA 4EY8A 4G5SA 1IN8A 3CY6A 4G97A 4UTNA 3EW7A 3NEPX 3H6KA 4KE9A 3NORA 1VHDA 3TXAA 1SHUX 4LRUA 3ITDA 4MV0A 4DV0B 2RCNA 4K0KB 5F5NA 5FB3A 1NJSA 4XWAA 3WQQA 3GRPA 5K6RA 1I0ZA 1YRBA 3UC9A 2BGWA 1M54A 3FRJA 1DFGA 1Z4MA 3LWBA 3JR3A 5EIHA 1YU6A 4WK6A 4B73A 3QEBZ 4B4OA 1YULA 4UASA 4M46A 2P0EA 2WM2A 4R83A 5TV2A 1HQDA 3PNKA 1ESDA 4AKHA 1W581 4I50B 3ZYZA 1KZ9A 3C3MA 3A0UA 3SXUA 1JHZA 1OYOA 1QP8A 3P0FA 4IEFB 4LUCA 3F98A 1P1JA 3LA6A 3PDIB 3W0LB 1SU8A 5A3VA 3BRQA 1B93A 4JXJA 1L7XA 3OHPA 3CZ5A 1X7WA 4DLWA 2JEZA 4A8PA 1AKEA 1JNYA 4HOYA 1WETA 1XALA 3D6JA 4LHYA 5M3BA 5IZ4A 2GPBA 2HZBA 4IPTA 5ALNA 1L5NA 4C4YA 1GZHB 5IVHA 3WBBA 2A7QA 4Q21A 1KJ8A 3BA6A 1V2GA 2VG8A 5C8YF 4HWSA 1DX4A 1GPDG 1JDSA 3PNPA 5CT5A 1UJBA 3SOPA 3VBCA 5A2QA 4XWGA 3ZZ0A 4IUBS 5JWRA 3ASVA 1NVFA 4NYIR 1TUIA 2GAOA 3U7FB 2Z2IA 2X0FA 1D9XA 4NBKA 3E7WA 1JAYA 2XMBA 4DDMA 1D0VA 1I2AA 3DB1A 4WN9B 5JAZA 3MEQA 5IDYA 2WZCA 4C4XA 4ZO8A 5EINA 1TU3A 1PL6A 4LOHA 1GNLA 1MIOA 3PC4A 2Y1KA 5JNWA 4ZTUB 5TT1A 4BO1A 2PCJA 2LIPA 3ZLTA 1AUPA 1TD1A 3IE1A 5FYQA 3U7EB 2P11A 4CM4B 3H4MA 3RVJA 2C99A 5EIOA 2C83A 3WMRA 5DBEX 3SJCA 3WAGA 1ZK4A 2RARA 4BIIA 4KN8A 4K6MA 4D3SA 1H2YA 2G63A 3PYLA 1KYZA 2ONKA 1RZRD 1P5JA 2QX6A 1F1JA 3FSGD 4XB1A 1ZCAA 3VNAA 2F43B 4YJDA 3W3ZB 2FRVA 1Y9AA 2XY4A 4H3VA 3BEOA 3PLNA 4ZOAA 2PPVA 1B43A 1T2UA 1Y8QA 2JCGA 1SBHA 3PFHA 4LHXA 4WQMA 4NZYA 3EH1A 3AXTA 1XCLA 2F1RA 3HEBA 4DCJA 1T8WA 1EHCA 5F1YA 3RJZA 1EESA 2GM9A 1EIWA 2FPIA 2Q49A 1I4WA 4UHKA 5DHUA 3DMDA 3U4CA 1DIGA 1P18A 4FNMA 4EQ6A 1OREA 1N9GB 1XAJA 2IYVA 2X3YA 1GXSA 2HIMA 5G3YA 5BNTA 5CD1A 4GPAA 3QSYA 1U8YA 3MTDA 3EDRA 4MQEA 4XVQA 1EUDB 4BXOB 3M34A 3QYJA 3W1EA 3T7EA 1O96B 3IOCA 4PS0A 3M2TA 2XWBF 5AVSA 2R8RA 3E61A 3KL4A 5FOTA 3TSCA 3TL3A 1RPAA 2GK3A 4C7VA 2XA2A 3EBLA 3KVOA 2PUGA 2HA6A 1ZCBA 3TB4A 4AUKA 2V5UA 3GY0A 4BWFB 5L3SA 1UBRS 3GJTA 1NQXA 2G70A 2NZUG 5CA0B 4KO3S 1YDHA 3FYUC 1KO8A 1KOFA 4LHSA 4NU0A 4PQRA 4RVNA 2B8WA 4KXVA 1OJ7A 4XLLA 5IC5A 1TGYA 5IT9A 4EEKA 1P4AA 1UKEA 4H1VA 2UV8A 1Q0RA 3LHFA 1ISSA 2QM3A 2FSVC 3Q98A 2Q2NA 2R2AA 4JEHA 4RHTA 3OIWA 1R8XA 3NWEA 3RVOA 4Y9DA 4HH4A 3ZXUB 2WHPA 1TM5E 2D4AA 4NI5A 1KFBB 2OYCA 2HD4A 2I7DA 5G0TA 3QA9A 2IEYA 4C06A 1ZN8A 1YB2A 2E7ZA 1PVDA 3CLHA 3O9MA 4FHEA 3UM9A 5BN1A 2A88A 2FZVA 3IDAA 3M6WA 3TLMA 4C0SA 4QSMA 2AOVA 4JVLA 3CM0A 3FJOA 3FYCA 4I9FA 3EVFA 2JI4A 4WV3A 1V25A 1A2BA 3N39C 4AN4A 3WHLA 3EIHA 3FNQA 2YJ5A 3I2HA 2YBDA 2YQZA 1G21E 2HYDA 3SC2B 2X5KO 3DOJA 3QBDA 4JR0A 1TGVA 2H11A 4MINA 3VPXA 1TCBA 4FFBA 5KDLA 5IUJC 1HO3A 5A9RA 4S04A 4JP5A 3K0KA 3GRFA 4Z2AA 1PFWA 2EKZA 1U3FA 1U7WA 2WA2A 1U3VA 3L7LA 3OCYA 2B4YA 1SQSA 2WVAA 5CA0F 3VNBA 2G8LA 4IDGA 3M9WA 5KBYA 4BRUA 4AK9A 4RZUA 2A5LA 3TBFA 5KYUB 1U3TA 2ETVA 2NTYC 2F00A 1LK0A 2R65A 3B9BA 2YWXA 2YWRA 1DC7A 3LK6A 4EJ2A 3LF2A 3OUUA 1ZK1A 4OSOA 1TKCA 1JL3A 4LK3A 4ETMA 2C58A 1R0SA 1UXGA 1WCIB 2CY0A 4ZV7A 1LDGA 1PJAA 3UJ7A 3WBJA 4CMCA 4G07A 2GCOB 4UJ3A 4NDAA 5ALIA 3L4EA 1QO7A 2XE7A 3ON5A 3RKSA 4C89A 2CJPA 2X9NA 3HR8A 4NBLA 2WF6A 2LIVA 2AGVA 4U1RA 5DBIA 3JY6A 3UVEA 1RI5A 2P6RA 4M0CA 1EG2A 5JDCC 3PHJA 4QUEA 4QUJA 5LQAA 1FS6A 1OX4A 4GYYA 5EVCA 3VNQA 3MTQA 1YCGA 4QRHA 1TO2E 3GDFA 4QJBA 3V4PB 4FEYA 3ZZMA 1Q3TA 3VZRA 4DA9A 3OZWA 3BYZA 3NIWA 4QARA 1C50A 3K15A 1QIEA 3UFXA 3KYJB 4ABYA 6YASA 3DL0A 3ZWKA 1TJPB 3BRCA 3Q5DA 4KR3A 4A36A 2ZT6A 5I8WA 4NDNE 1FUYB 5L4NA 1QIKA 2QW8A 4U2GA 3HZRA 2Q5HA 1NVGA 1KXJA 3WNDA 4CI0B 1FDTA 3LSTA 1JR3E 2ZIUB 2Z09A 4FUQA 3ZIAD 4ZI2A 1H4VB 1XUOA 2XAAA 1LPSA 5CCEA 5HYVA 1E9FA 3KXDA 4LE2A 2PUHA 1W88B 2HNAA 4FN4A 1X14A 4HDSB 4RY8A 3AF2A 1E2KA 4RF3A 3UT5B 1USUA 1LC0A 3U3ZA 1DHRA 2ZS7A 4C0QC 5IS2A 4KOAA 5FWXB 4UE2A 1ZL0A 5LMNB 3ECSA 4CF5A 2B94A 1IZ8A 1O6BA 5AHWA 2Z95A 4HWTA 4O4IA 1OH5A 3D64A 3EWIA 3SBXA 4B82A 3DZCA 5FO0A 3UBTA 1UAYA 2WWTA 5JO0A 3KTDA 5LZ7A 3U5ZB 3QQPA 2ZIVB 4JHXA 3EA0A 3G49A 1YL7A 4M1QA 4N49A 2KBFA 1NV9A 4LJ5A 1VLVA 4WGGA 3MHTA 2DB3A 4DR4B 4DYVA 1L4GA 5KX5B 3SQXA 4FSHA 2GAJA 4S1OA 2BGRA 4HQKA 5AKYA 3E81A 1V6CA 4DR6B 3UCFA 3UKOA 4BX3A 4O2RA 1T5LA 3H97A 4W82A 1XTZA 3BE8A 1ZLXA 1FUKA 1X7GA 5H70A 2G4VA 5BQPA 4Y1FA 1PNQA 2IA5A 4BFSA 4R1LA 4WOCA 2PUDA 1RFGE 4PO1A 4IWXA 1CUFA 1ORVA 2I6FA 2WWIA 2X3UA 3ZI7A 3ZCTA 2CJWB 3QKWA 1YH3A 3KM0A 1WF6A 3AW9A 5H16A 5GINE 4L0CA 3ZHTA 2CWDA 3WLHA 1RI3A 3MB5A 1Z17A 5DSZA 3DLTA 2HMTA 4HEHA 2WC1A 4D6PA 3WRWA 2ONZA 1H0RA 2FFHA 5BN5B 1PZMA 1TKBA 3SQMA 1JLHA 3DWGA 3SF0A 3PUWA 3WTCA 3WYDA 4KX5A 1JEOA 1NQAO 4EABA 4OB8A 5EJ9A 3CRW1 5HSGA 3GNQA 1GKIA 1IZZA 3PNSA 4IIUA 3SN6A 3TSOA 5HOQA 2DPLA 1EXMA 1R6UA 1C4KA 2G1KA 1YFLA 1W0KD 3H86A 1W19A 1FYDA 4R1SA 1KYTA 3CMMA 2AXEA 4RTLA 4K0RA 5DLPA 5KX5F 1X7XA 1BO6A 2ON6A 3DULA 3IKTA 4NMWA 4FCTA 2AMVA 2FWMX 4Y67A 4GNKA 2CCJA 8LDHA 5CK4A 4BNTA 1EDBA 1LTHR 2ADFA 2ZAYA 4IIJA 1WUKS 3MWEA 3AJEA 1HURA 1MXHA 2XYQA 3EULA 1C8KA 2A9RA 3GQBB 3K6JA 5ELMA 3WLKX 4H7KA 4YCAA 5KTSA 4IIBA 1SQGA 2GUWA 3TCKA 3NTLA 2CD7A 5LJIA 5ALQA 4K3UA 3G0HA 2VYNA 2G1UA 4UCXA 1J1IA 3F5FA 3T6KA 1NSYA 4MICA 4ABTA 4DGQA 2QMUA 3DTVA 1T2VA 1ZJ5A 2QNBA 4ND2A 5CX1B 1BYUA 9ABPA 1M5RA 3FHTA 4MUKA 1FCJA 2RJOA 2W11A 2Y1CA 3A36A 2VPZA 3TRFA 1L8OA 3U7HB 1A97A 1JB1A 1XMSA 1KI1A 2EAUA 4D98A 4M9QA 1LDMA 3HRKA 1GR1A 1PBTA 3HVUA 4IZOA 4DDUA 2IS1A 2N9UA 1TKRA 1CUJA 3FMIA 3FUCA 5I4IA 2BOVA 4DMHA 1H94A 2Q6OA 4FLFA 1NVWQ 1MAAA 5KTTA 1OX5A 1O9GA 1W2WB 4UTOA 3DEHA 3UG7A 5AJWA 3VVLA 5GV7A 1U9IC 2P65A 1ODJA 2YUIA 5K4AA 4CU5A 3UB2A 1BXRB 1HOTA 1Z62A 2V1XA 1Y5NA 3OEHD 2CFCA 3RCBA 1OH7A 3HDHA 5HDQA 1CZLA 1DT3A 3H2ZA 3VFDA 5KKCA 3DDSA 1WEHA 2DHEA 2OGZA 2VHZA 1PI3A 2GZSA 3K8YA 3GCZA 4HLUA 3RU7A 3DUFA 2ZAGA 2OECA 4N01A 1OT3A 1E1QD 1H05A 4NE9A 4UHDA 2IH4A 4BP8A 4J7AA 3EQ7A 2CL5A 1FYFA 2WEKA 1VI6A 4MDYA 2PZBA 4WDQA 3L1IA 1S0UA 2AA3A 4X20B 2IYZA 3RAPR 5JZBA 3NTQA 4J7UA 4XR4A 4P31A 3ITKA 2WG1A 5AKHA 5JPCA 1ODTC 4BMNA 3RSHA 4DN6A 2C7GA 4RVUA 5EXPA 1OI7A 2Z2XA 4E5KA 3ACBA 3WQRA 2WYWA 2C04A 2YIDA 4OF4A 4D2IA 3OTQA 3RHTA 4F1KA 2PBRA 2XF2A 3WGJA 5DHAA 1R10A 1VLZA 2XUZA 4RPIA 4S24A 4BQFA 2VYFA 4O2AF 5H3CA 4YRNA 2JJYA 2CV0A 1CIPA 3MW8A 2YY5A 5HCNA 4EW2A 4LDZA 2JGMA 4YT4A 4LXUA 1R0RE 4KQ2A 2MMGA 3CVYA 2JLWA 2E1PA 4JITA 4GZ5A 4QVIA 1J0AA 4EY6A 3V8EA 2D5IA 1DO0A 3ABOB 3DTYA 1CJBA 2PVPA 3VX4A 4AURA 3AVPA 3H9UA 3UENA 1MBZA 2JZNA 1A76A 4ZA2A 3FIUA 1H4QA 2GA8A 3DNFA 3K8ZA 4CEJB 2QHXA 3ABRB 4KQGA 4EHAA 1OWOA 2YCLA 4L73A 1UDAA 5EZYB 5F3RA 3E3AA 3HY6A 2P8SA 5LU8A 1D9ZA 4AKSA 4IIDA 2YYSA 1SD2A 1F6DA 3QSGA 1PSZA 1BEEA 5HF5A 4P34A 4L76A 1EPUA 4RLFA 4Z3DA 3OX3A 2JASA 4MYUA 3QMPA 4J3FA 4RD6A 3EVAA 2HLHA 3AR9A 2TSYB 2HHHB 4TS3A 2NO4A 1EP1B 3TZQA 4NU8X 4IHJA 1Y9EA 2QSJA 3FFTA 3PF8A 4HATA 1DRJA 2RHDA 2PRSA 2XMGA 2QMZA 3L4SO 5BWLA 5KOIA 2QN3A 2QRZA 3KYIB 5DU2A 1YQQA 2LR0A 2WTMA 2FAXA 5A0TA 2WOOA 3H2IA 3QF4A 2CMFA 4BQPA 4EG8A 2ZUEA 1O5OA 2ESRA 2H16A 4AI6A 3WYCA 2NX2A 2O6HA 1F9EA 3D8RA 2WB2A 1XU9A 2QMHA 3UQYS 5BV7A 2W6QA 2GPNA 4YCDA 3MWJA 4Z0HO 4IRXA 4EPRA 1L5MA 3RS3A 2FFAA 1ZM4A 1AK9A 2PZFA 1CQJA 1F2VA 1FYEA 1Y1QA 3DBHA 3R75A 2DETA 1D6JA 4DLUA 1L5VA 4GL2A 2OXTA 1RACA 3DZ8A 3I05A 1G55A 1JIIA 2WINI 3DOHA 5F12A 4CTKA 4DDVA 1BEUB 3O3MB 2G9UA 3FB1A 5KYYA 3EODA 4E5PA 3HY3A 1LS6A 1S5PA 3RFVA 2B35A 4NARA 2AMJA 1E2UA 3BMQB 1E2QA 3AZOA 5IJ0A 1V1RA 2PLNA 4L8YA 4ZGBA 2HEGA 4OMUA 3GDHA 2A5JA 2WWGA 3KSRA 1N2JA 2IIBA 2IQIA 3DZDA 1BXKA 3G9QA 4XWWA 3A9CA 4QBTA 4JAVC 4KWCA 4OAOA 1FXWF 2Z6VA 1NVUQ 1QFZA 2OLJA 4LISA 4FKMA 2BFCA 1J07A 3THRA 4OX9B 1HG0A 2HPHA 2HQOA 3ZWDA 1Y81A 5KREA 5LD2C 4POAA 1JFFB 3J81A 2GJKA 3ZLJA 1J24A 1L7BA 6REQB 4WCFC 4QULA 3HMKA 4K8RB 3EFHA 4F84A 1DV1A 1LI7A 1W5BA 3FTDA 2R1TB 2GYVA 4UBJA 3DT9A 2IX9A 2I76A 4UTPA 5DKFA 2HXGA 4CLHA 1ENOA 1R5NA 3G0CA 3NBKA 1B0ZA 5D2CA 4IQ4A 1ZUHA 4WHMA 5AVQA 2P68A 4MPDA 5AVKA 1EEXB 1PEDA 1KFJB 5FV4A 3DOIA 1U31A 2YVQA 2X5XA 3ELWA 4MYHA 4PHTA 3KTFA 3EAGA 3BMCB 3B48A 3IP5A 3LPNA 3HSSA 5AI0A 4Y9RA 3M0EA 1WF3A 2N75A 1QFJA 4GOJA 2OCKA 3AZQA 4MLCA 1M2VB 1VPDA 2C4NA 2JHAA 3F4LA 2EJWA 4OCZA 4QXPA 3ZH9B 2IL1A 1DX9A 1ONBA 2D59A 4P83A 2QDKA 3JQPA 3DE6X 4M8IA 4F1WA 2D7JA 4JFAA 1U02A 2J32A 5A5FA 5IRCD 2ALJA 4HMOA 2NO0A 4U7JA 2YN2A 4OP3A 1UKVY 1G63A 1L4MA 1PFKA 4ZYWA 1FFXA 1JZQA 4ADSG 5FR1A 4OSEA 5B3AA 5J2UA 4OGKA 1Z39A 4F56A 4NCBA 3HM9A 1R00A 3OZVA 5EGNA 1CZNA 3UUEA 3WWOA 2WUWE 1TYZA 1K86A 4R2XA 3WB1A 2FW0A 4CGYA 4WN3A 3K9BA 4PHFA 4LZJA 1M6EX 1R37A 4LXQA 2FJPA 5A9SA 1J23A 4O4HB 4QFCA 1YQGA 2XDQB 2E4YA 1FSPA 1CQIA 4WLVA 4YBZA 3FSJX 4PYIA 1I7SB 2HCBA 1Z4KA 2AYZA 1MRSA 4ZHSA 1GUZA 3KU4A 5FOWA 2FWAA 4A2QA 4I5GA 5JYCA 4IX9A 3TW6A 4FHDA 3IL2A 2BR3A 2AFIB 3PVSA 5ELXA 4XZ3A 4YJ3A 2QV7A 4R8VA 5GPBA 5BRNA 1M5UA 4IHAA 1V3QE 1BOFA 1P7PA 3BPSA 4A0HA 2WAMA 3H83A 3P9QA 1YIOA 3DQZA 4CTMA 4OHKA 3FNFA 4AMVA 4FX5A 2ZVQX 4ECEA 2O8DA 1GCIA 1NW5A 1CEQA 1P0FA 1WZEA 2GEBA 2YC2C 3DS8A 3GGCA 4MEAA 3IQZA 5G4KB 2OGSA 3Q5GA 4YCSA 4AIRA 5FLXA 4J76A 2V7GA 5JI3E 1A2KC 1AB5A 1NY6A 2HH9A 1AO0A 1KOJA 3GA0A 4AYXA 3NPAA 2H06A 2ZSEA 4C05A 4EYKA 1BMQA 2GN8A 2Z58A 3SPXA 2PUBA 3QK7A 2IHZA 3IBSA 2FXIA 3REQA 5CJ2A 5GY7A 5TGTA 3I5UA 3QVVA 5ERYA 4P3XA 1VBMA 4MEJA 3R9KA 4D8WA 3K6RA 4RORA 3BTVA 3EXG2 5HKKD 2GD1O 4O4HF 5D1HA 1M76A 1VHQA 1OYVA 2R96A 4GX2A 2WPDA 4HNAB 4V0SA 1WPRA 4TYPA 13PKA 3MLEA 1QTRA 1R18A 3O0TA 1EWRA 3LC1O 4FYIA 4HN9A 4M53A 2JJ2A 4Z7JA 2J0SA 1TEVA 3INTA 4KB5A 1M1YE 5EPUA 4Z0TA 3V7FA 4ALLA 4AG5A 3FWZA 1VHTA 4Q4CA 3LCJA 1AXRA 1NXTA 3I37X 1P2VA 4MJLA 4YECA 1U1EA 2CZQA 3W05A 1SKYB 3OO1A 4UBOA 1NQVA 3DVSX 5EJ7A 2P3QA 3JAKA 4KBGA 3L41A 2ERYA 3LWZA 4HDCA 2JHPA 2P6PA 3C6ZA 1CB7A 1P5RA 3OURA 4RSMA 3P2EA 3GCWA 5ANRB 1KMHA 1WR8A 4RH0A 2OSBA 4F46A 4MKHA 1EUCA 5DTEA 4ESEA 1KKMA 3EHEA 4DCCA 3DDHA 3GD5A 5AVJA 3T0GA 2GF9A 4YPVA 2I4RA 2P67A 1Y7LA 2L17A 3H2KA 3NHMA 1AQJA 2YY7A 3D4NA 1S7GA 1SXHA 1P17A 4L0DA 4KL8S 4H0NA 2OHIA 4G4SP 3TS1A 1EIZA 4ETWA 1UXOA 1WWKA 4ZOCA 3MA0A 5DGTA 3WX0A 2QG4A 2VSNA 4FKZA 4KFUA 4FFOA 1GPLA 1FFSA 4UHBA 3HJUA 2C1XA 4PC6A 3HCPA 5M04A 3STYA 3EIUA 1PT8A 4NPCA 4RYLA 1L7OA 1XTRA 2PYDA 3GZ4A 3NM6B 5DI3A 3AI1A 4R3NA 2AEMA 2UVPB 4QG7A 2Y2UA 3WR5A 4C2UA 2GHIA 2VSOA 3M5PA 4CKBA 1P8JA 4QTXA 4UQLA 4PRZA 5SY6A 3T5TA 1B3RA 1YVUA 2H1SA 2GVZC 2PQ2A 2ZUBA 4WW0A 4YRBA 5IG2A 1N2EA 4O4JA 2FRDA 4R81A 2X4GA 2WSYB 4II3A 1V35A 3EIQA 2H1RA 1GFWA 3HZHA 4WXRA 2A84A 3M7IA 3GMIA 3MJEA 3V8PA 3MN1A 1FK8A 3Q3GE 3T9EA 1GNSA 2IK8A 1YFJA 2X14A 1CY6A 1PZXA 1Z5VA 4GW3A 1FP2A 4D82A 3W2HA 2XGOA 4E2YA 1X1DA 4W5QA 1L0BA 1Z5NA 4O3MA 1Y3IA 4XX0A 4JLPA 4TWJA 2JLXA 7ABPA 1S6YA 1WDLA 2H1LA 2VDLB 3FPBA 3LXUX 1XBTA 2QYSA 1E3MA 4PSCA 3PPYA 3ZDQA 3GRVA 3GVCA 3PPXA 4PLGA 2XHZA 1DEXA 1T5TA 1LB1B 3KPJA 4G23A 3VU9B 2NNLD 2A0FA 2J8ZA 4Q3KA 2XJ4A 2Q45A 4BVHA 2ERCA 2EFGA 2PV0A 1WKVA 1L4HA 2ZK7A 1GOTA 3KKEA 2VT3A 4WXPA 2FOLA 3U44B 2WD8A 4I4NA 1NW4A 1W47A 4JQCA 1QIJA 3IOBA 3OEWA 5KI6A 3VKHA 1UFVA 2BMWA 2IYNA 3TQCA 1D09A 1T3LA 3DMYA 3V97A 5ALJA 2BP7B 1DQRA 4K81B 5GGXA 4C7OA 4J16C 1JHOA 2AI1A 3BXHA 4DY6A 3SGLA 1LBTA 3H6HA 3V1NA 1XF1A 2EOAA 3N7TA 4JN6B 4NNPA 2JCVA 3PX7A 2RD2A 5MN5A 1N5IA 4PNEA 3T9CA 2P2ZA 4KNWA 4CEIB 3IIMA 2FW6A 1O7JA 1GGNA 4F11A 1MC5A 1GCAA 1TT5B 1N2BA 4PSAA 4IH9A 3TNYA 1C81A 2BKLA 2ZYWX 3CF4G 4ZANA 1R9GA 2AZMA 2YZKA 3T7KA 1KAGA 2XB8A 1ZXBA 4JI0B 4M49A 1R4AA 1YL5A 1JTVA 2BEKA 5HQ3B 5L95A 4NZMA 4D02A 4IFEA 1SBYA 2GRAA 1WZCA 2QRQA 5AKZA 5ERGB 3RKUA 5DXFA 4KGXA 5DM1A 5H80A 1NKSA 2HMSA 3OJCA 3EX7C 4BNJA 2Y27A 3OOYA 3RASA 2ONCA 2XQFA 4OYHA 2EYUA 4QNNA 5EN4A 2G72A 4GAEA 3LKDA 1Q21A 2JGDB 2XNJA 4CL2A 1U1IA 5L8VA 2X5JO 3TAHA 5LYJA 1UFRA 3KDAA 3LPCA 2ENWA 1QH8A 1LI5A 4RFLA 1SURA 2I2DA 2RG1A 4YCMA 3DFIA 4O59O 1Y8ZA 1KS2A 1T8YA 2H9AA 4CHTA 1E1NA 4F72A 5BVGB 3GNSA 4UVIA 1GAJA 4RF4A 2XEXA 3M1IA 4BMDA 1RWWA 3NHUA 4G2NA 2Y9PB 3UCEA 5C9ZA 1TFUA 3I8XA 8GPBA 1EFVB 2VA9A 1YHZA 2DVMA 2SKCA 3GFRA 5EFOA 1AQNA 3HXOA 1I7LA 1CUBA 3C3EA 4HH1A 3RTBA 3VZQA 4EUHA 4P35A 3WZ2A 5JTTA 4GD3Q 4I19A 3WBKA 2VKTA 1NHWA 4B83A 2VJBA 3OF2A 1BE1A 3KKNA 3GJYA 4WVFA 2R1VA 5AOCA 4FZVA 4MRAA 4QUDA 1CS0B 2FWPA 3MPUA 1EFUA 2FI1A 3DTTA 4NNJA 4TLAA 4Q48A 5A7FA 2PUJA 3TW0A 1QGYA 4TRRA 5LMCA 2BYTA 4OQNA 3H0KA 2VCEA 5AM5A 1EBUA 4A5OA 4ZYZA 4FJ1A 4NJMA 2KSQA 2O2SA 1JFTA 3PUZA 3Q0TA 4LGMA 3EDOA 2F1HA 2QRGA 1DOHA 4YI5A 1Z5ZA 1WBDA 5DBGA 1QHNA 1II9A 3OTHA 1Q2UA 3ZKWA 3RAEC 1OWMA 1QGUB 2PU7A 2YS7A 3KTOA 4LQ4A 4UE3S 3N5KA 4D97A 3W2FA 2Q8QA 2ZVPX 1D2GA 3EIEA 3VXKA 2CHUA 2ZEJA 2QS9A 1Q14A 3PL5A 4M0DA 3S44A 4OA5A 2QUHA 3WGKA 2BHSA 5JNVA 4KLNA 4GLJA 3AEXA 3GFSA 3TW8B 3NBQA 2R66A 4FK8A 4M2LA 1M2EA 1TUBB 3NS7A 4EVRA 1JALA 4EY3A 1EYZA 3JQFA 1ECFA 1P7VA 2BFFB 6ABPA 4XKJA 4BVFA 1P7ZA 2D7CA 3O38A 1KC3A 6Q21A 5C18A 3OCVA 1TCCA 3N8IA 1N5LA 3G1WA 1S8FA 2YOFA 3CHYA 1JA1A 1GAEO 1T3SA 3G68A 3LVFO 4W5OA 1Z22A 4HEQA 4ZT5A 2GCPA 3R4VA 3GEEA 2XRYA 1LS1A 2O4CA 4X45A 1PWHA 1ZRSA 2IZOA 3CLUC 4LJKA 3SE7A 3AKCA 3S5JA 4QT4A 3UMBA 4AJNA 5EIAA 1BTOA 4GI3A 4MLZA 2GETA 3K7EA 3GJZA 4R5MA 4M88A 4JI4B 2VCHA 1FDOA 1GDDA 4REQA 2OFWA 4RV5A 3LFHA 4MQFA 4HN2A 1EVKA 3FDFA 1DJPA 5AVVA 4IF4A 5FTWA 4RPHA 1KOLA 3L8MA 3MIIA 1QIFA 1KAHA 2C07A 2J9XB 3CUVA 4TVKA 1PS0A 5E4YA 2DCMA 3GGSA 3PIIA 5EQTA 3M6XA 1T2AA 1I14A 3HN6A 3QVKA 3GJXC 3NANA 1N1GA 3HY4A 1Z2CA 3JQAD 4ZVOA 1Q1ZA 3PGJA 2Q5EA 3G0IA 1WUYA 4Z1OA 1JWAB 3ICPA 1T8RA 4N7RA 3CX8A 2ZJ2A 3IUMA 5HIIA 2CNOA 2BKEA 3U7GA 1SD1A 4HPJB 3TTUA 3FOEC 3I01M 4LQCA 4RVGA 2Q9BA 5HJ7A 1P81A 3TIGA 1SC9A 3A1NA 3K09A 2MSCB 1UEJA 3IDOA 1Z6QA 3C14C 1QVAA 3E9NA 2JB9A 3SQLA 1MF7A 5K0CA 1WUHS 1LBEA 4YQEA 3GT3A 4HDAA 3K1AB 1EX9A 4RA6A 3F4KA 2WHQA 2RMKA 1V5FA 5BSEA 1VGVA 1Z2PX 1XDBA 1M1NB 3OJFA 2VUSA 4PG8A 1G8SA 1ODSA 3AEKA 4JBWA 5KNDA 4WZBB 2A9VA 2VT6A 5JRJA 4HUQA 2D4HA 4GMXA 1Z0DA 3I6MA 5LIPA 2P9FA 2V4ZA 4MA0A 1XZQA 3GF4A 1GFIA 4CQMA 1NQ5A 5KYTA 3N2ZB 4CMHA 1NUPA 3HRIA 4Q4LA 1V3TA 5A4KA 3KJFA 4K9NA 1JPVA 4LRYA 4G1BA 4LF9B 3CVJA 1V37A 1SBZA 4JYCA 4EYOA 3W5VA 2QAJA 3QFRA 4QPCA 1UPFA 4GGPA 3GARA 2C5AA 4CIYA 3IRUA 4J29A 4CE6A 4B80A 4Q4JA 3HNPA 1QBGA 3ZY3A 4X71A 1O57A 5BW6B 4HAVA 4CT4B 4CIAA 1LQ2A 2QXUA 3R0IA 1Z45A 1T1GA 1L7AA 2B5VA 2EYQA 3EXIB 4CKYA 4TQ9A 4JD5A 5CLJA 4BP9A 2IXEA 3Q40A 4CMAA 1MJNA 3A8TA 4XOUA 5T6MA 2PG3A 1UOQA 2CB0A 4ER6A 4X8HA 1Z6AA 1VL0A 2C96A 1AGRA 2HQRA 3QLVC 4HXEB 1V1MB 1VBKA 2HF7A 4M1ZA 1AO3A 3V7UA 4F97A 5AM2A 2HIGA 4MS1B 1ESEA 2DM6A 4D7AA 1NW8A 4GL4A 5AOAA 1R9JA 3QMMA 4YREA 3DOOA 4QJ3A 3U4HA 4U0JA 1G8KA 1EXVA 4PN3A 5K05A 1F12A 3B3QA 5BOVA 3BAFA 5E9AA 1JXOA 1IC6A 3ERCA 1I6MA 4YUAA 1GD1O 3GLGE 5DHRA 3EZNA 5DHSA 1E6CA 1D3AA 4DHWA 2GOYA 5DW0A 3A1SA 1USKA 1KAQA 2VDWA 2MR5A 3FLMA 4JYPA 1BHJA 2AC7A 5LQUA 2OXCA 4QUHA 3ZWNA 2VAVA 4A6XA 3VMMA 4DLPA 5L7WA 1K7SN 2ODWA 3W9SA 4EWLA 4DNOA 3JWHA 4N48A 4EBBA 4LE0A 4YEDA 5JSZA 1E7QA 3HJTA 2PUFA 4EKEA 1FNSA 1XVVA 1N7IA 1R8SA 1ULSA 4H6PA 4ERNA 3ES9A 4EUSA 5KYGA 3R09A 3TFQA 3IDFA 1T43A 3OLCX 4JI7B 2GLUA 5H9VA 4C7JA 3OPNA 4GPEA 3L4JA 4Q01A 3C48A 3DM9B 3HSYA 1UFKA 5K0JA 4J0DA 4DVJA 5A4IS 4POOA 3SSOA 1T2FA 4MUXA 3FG9A 1ADFA 4PTLA 5ALWA 1C29B 5JC1A 3ZGOA 1A0OA 1BQ3A 4QVGA 1RWPA 1RE1A 4S1VA 1WXHA 4OQFA 2HWYA 1IWOA 1A9XA 1COWA 3VR5H 2IOYA 2NWQA 1LRLA 2PUWA 2ZFUA 3BMOB 3R24A 4NFYA 3RPEA 3V8BA 5AQ1A 3S81A 3FTQA 4LJ7A 3CV3A 4ED9A 3TLAA 3PTAA 2D5AA 4QELA 1E3TA 2ZJ0A 2VIIA 1NMSA 1H9AA 1QO0A 5HRUA 2ZRAA 1IVSA 4J90A 2AVNA 3DBRB 2BFEB 4TWIA 1ABFA 2ZWVA 3RVPA 5TPZD 1UL1X 1R0XA 2D2IA 4A1OA 1DO8A 1GPWB 4LGVA 4B35A 1PR9A 3ILXA 1O4WA 1WW8A 2XKJE 5CXXA 5C1IA 4B7AA 5GZ1A 1LDBA 2F1KA 5EIEA 2AUNA 5KWEA 3LP8A 4EHIA 2P75A 2WJVA 2BD0A 4ER5A 3ZZ1A 4CV3A 1YRYE 3DO6A 5ECYA 4K2AA 3R4CA 3BDVA 3FVRA 3OJWA 1Y3HA 2OPHA 3ZDAA 5TQ2B 1TZMA 2OBXA 2VYND 4YWJA 3MTEA 5KZMB 1QSGA 4CWAA 5TX7A 1FUUA 2V6FA 1ZCJA 1U0FA 2JIOA 3DTVD 4R2WA 4QYSA 4XE5A 2JH3A 4MB2A 4KSBA 3CSDA 3WP1B 4A5SA 4DR1B 3FLAA 2Q4RA 1IPFA 4PINA 4PYQA 3SNHA 1RFLA 5K5EA 1UDRA 3DTNA 2W42A 4GEGA 3STHA 1RJEA 4MULA 3MQ4A 3CLVA 3IMEA 4OFWA 4HI0E 1ZMTA 2YW2A 3UICA 2FXVA 5K3FA 1KYIA 1P2FA 4H7FA 3OX1A 1E7RA 1QPGA 2NXNA 3U31A 3A05A 3AOEA 5DRYA 2QRUA 3FPFA 2IBTA 3TE7A 1WZNA 4P5DA 5LDDC 1FTGA 1HEYA 1OLSA 4GNRA 1WM1A 4TKUB 4F45A 1UC5B 1OT5A 2CNWA 2QZ9A 1T8SA 1PN3A 4L51A 3JVUA 2C00A 5IKOA 1J8FA 3OJLA 4MJ7A 4BRSA 3K1TA 3SZOA 4UBMA 3BG5A 2QPTA 5DGHA 2ZBFA 3WLOA 1Z28A 4QDXA 4DGSA 2W5UA 4PX2A 1D0IA 3Q3HA 1F4VA 3QHPA 4FGLA 1K7CA 2H1CA 3K0AB 3QMVA 1YVPA 4YV1A 1R74A 2XCUA 3HG7A 2E89A 3QEKA 1G21B 1T91A 3N5CA 2PH7A 5I7EA 1DAFA 4N9WA 1XNHA 4HEA6 2D3TA 4A6EA 1ZH4A 2I1QA 3OIGA 4QUGA 1P60A 2DG2A 4YP9A 1UMBA 1XCPA 3UWKA 5IN5A 4DDHA 1F8GA 5C2JB 2IBSA 2A4KA 2XA9A 4UJ5A 3KZXA 5JOQA 5CFLA 2C61A 4NHOA 2YXLA 1JQAA 2B9EA 1GNRA 5DOZA 5AVWA 5JH7A 4Z4IA 1BHQ1 4MMXB 3I64A 1G59A 1PFGA 4U5XA 1ZGZA 3PKJA 2GZDA 3E9CA 4JDUA 2Q3LA 5DHPA 3ZHUA 4CM6A 2M6RA 4Z4GA 3S5UA 5IF9A 4RD2A 4L4YA 1IXRC 1I3CA 1X70A 2P8JA 3M4NA 4IXWA 4E11A 1NLYA 3H75A 2QL7A 3OLYA 3Q0EA 1WMDA 3D7NA 2WIDA 4XDYA 3EG5A 5FAXA 3PGXA 3VKFA 4DF3A 5MFZA 2EIXA 4U5QA 3X1ZA 3ML1A 2CFIA 2PS1A 1ZUWA 1QH9A 1U2QA 4D8TA 3N2GA 4I9NA 3O8QB 4CZ2A 1U0LA 3RUCA 4RF5A 1IXYA 3CNBA 1GUDA 4OQLA 4QQ8A 4IWYA 3I6ZA 4HF7A 3VNSA 4EX7A 3ZCXA 4YMLA 1H42A 3E3OA 4LNUB 2ZU6A 2PX2A 3R5JA 2FKAA 3TBHA 4JQZA 1PJSA 1SIBE 1EP2B 4XQGA 4HDRA 2OC4A 5C1OA 2Y6UA 1ZBQA 5AOBA 3F9RA 2PT6A 1PS9A 4BV2A 1KVTA 3A4TA 1S7CA 2QSYA 2Q1YA 2YXDA 4XJXA 1P2TA 4INAA 3BHJA 5F52A 5LMZA 4KAJA 2NXCA 1KRWA 1VKRA 2XOEA 4AMZA 1W8DA 3HC7A 3ISJA 5ERXA 4BLSA 3KTAA 1JMYA 1YZNA 3R3YA 1AH2A 1L7RA 4FFVA 3G2OA 3IVGA 4PF1A 1QDUA 3SLGA 1BD4A 1YJ5A 2VT7A 2B2CA 4KMMA 3P2KA 3VZSA 2I62A 1MZVA 4D1YA 1NRIA 2QRJA 3KQOA 4NZNA 4O2BB 5KHOC 2JPDA 1DXHA 2BR5A 4TL6A 4DT1B 3GXOA 3BS4A 4MP6A 2GNOA 1BEZA 1L7VC 3FR7A 1H3NA 1ZA1A 1O0BA 4WFKA 1SKAA 3SIRA 1JQEA 2W6CX 1OTXA 1XROA 2HUPA 1RNLA 1RWMA 3PKZA 2VXOA 3WK9A 5DM2A 2Q5IA 1Y1KE 1ZBDA 2WYHA 4DEXA 1WXEA 5AXBA 1ZUIA 1D7OA 1I4LD 2EC5A 3Q2OA 2H4XA 3V2UA 4G8DA 4QT0A 3O9VA 4DEVA 2HA7A 3AG6A 1BVUA 3WGYA 2JI8A 5J23A 1TVCA 2GM4A 2H51A 1YA6A 3FCXA 2O8FB 5C1PA 2XYVA 3LD9A 2ZJ8A 5G53C 1EXDA 4HPWA 2CVHA 3LIIA 3UK7A 4DJEC 1W5FA 2JZOA 3H9QA 4MRVA 4RK0A 4FOPA 5JECA 5F2NA 1ZRNA 3QBEA 1P1KA 4MV5A 4MW2A 3MJ4A 1SUBA 2OD7A 3UT6A 5TVKA 3ORYA 1WAMA 4KPFC 1HE1C 3HCCA 4O2BF 4MQUA 5CPBA 3F96A 2HMUA 1SHKA 2VTVA 5CEJA 1T1JA 1SG9A 1NVTA 1DJNA 1NIPA 1NI4A 3GJ0A 3MCAA 3T34A 4X8LA 4AJ1A 3EIFA 4B4UA 4C2AA 4YJHA 5IEJA 4Y1RA 3HA5A 4LBYA 2PVCA 4Z1MD 3LHSA 4KYIB 2G6BA 1DWOA 2EZ9A 2I4LA 1YS7A 2QSZA 4BMVA 4KTTE 5B12A 5KPDA 2G77B 2WLSA 1GGJA 2DBVO 3X2SA 4AXBA 1YZGA 5PGMA 4EY5A 2VUUA 1SUPA 1WSBA 2O0HA 2VQFB 1BGWA 2POCA 2QZ4A 1EE9A 1I9GA 5H3LA 2JAHA 1VSVA 2QI9F 3EEFA 3L9WA 4BN0A 1TJ3A 2AZDA 1C7JA 2EX4A 1NWCA 1BMFA 3KX2A 4FMBB 4JOSA 4MGZR 4UMFA 3ZVLA 4TKMA 2KS6A 1LI4A 1A04A 3A58B 3H8VA 3I6BA 2I6UA 4JA0A 1L5ZA 3VTZA 4WA7A 5C8VA 3THXB 1JAIA 4KQIA 3B6JA 3AKEA 3ELDA 4IS3A 4PLVA 3RT9A 2CXNA 3D7LA 1PGJA 2FPGA 2OO3A 3A9UA 4YBRA 5AVZA 4PSUA 3Q7IA 3VHLB 5DN6D 1YQDA 1Z5PA 5L4SA 2CC2A 4WLUA 5LVAA 4U7TB 2Z2ZA 5KJCA 3PC8A 1OJLA 2NZ8A 4UXHA 3HB9A 3K16A 3L1VA 5DNEA 1VE3A 3PEYA 5CVDA 1PZFA 2P91A 1O94A 2B78A 1HEIA 4Q9IA 1GVNB 4XTRA 2JLSA 3KSAC 1ZI9A 1RHQA 3ZHOA 2C8KA 3V4ZA 1F9AA 2F3QA 4PRYA 1G8HA 4AKEA 4M8NE 1DBPA 2Q8NA 4I3HA 1SHJA 2RGAA 3KJEA 2DLDA 3I5XA 1UUFA 5G40A 3WQBA 3DWEX 3N07A 3TUZC 5JQGA 4IMRA 4R84A 5I9MA 3UWMA 1LPMA 3O4IA 1MNQA 4DW8A 3WIBA 2DUJA 5C34B 1KDZA 4MW9A 5IJ9B 3KG2A 4ZV9A 1JQ5A 4AZWA 1I3MA 4E1VA 5IK2D 1D2AA 4YRJA 1FRFS 4ZU1X 4JCOA 1H2BA 3PWKA 2DFTA 1Y4ZA 1CWUA 2VDUE 4QHSA 5BSUA 1PFQA 1XKLA 3DDOA 1RI1A 1JIJA 4B7XA 1AIPA 1N0WA 1J0DA 1COZA 1KEVA 3HDJA 4TRMA 5CLIA 4YYEA 4TM7A 4DJTA 4PYMA 2NYUA 4CL0A 4GQAA 2Z4SA 4FHCA 1FQJA 1PVVA 3MC1A 1GV1A 4EJ0A 4Q34A 3T5DA 3UYLA 1NNEA 1OW3B 1I01A 2J41A 3UW3A 2OORA 1QV7A 2ZSFA 3LW7A 5KNBA 2WWFA 1LU9A 4BGVA 4LY3A 1TPYA 1GFZA 2BZ0A 1OBFO 2ZIAA 4NFHA 4L50A 5FKJA 1H4SA 2WPDD 4UCFA 3PFGA 2E4WA 1DQSA 4K6OA 1DIRA 2W0MA 2ZBQA 2JIBA 2JIZD 3SDZA 2AQ8A 1I10A 3HWRA 4ZT6A 1JGTA 2VL7A 2BDEA 3H5RA 1RC8A 1PZGA 5DT9A 5EZ5A 5J4KA 5AVUA 4N5HX 6ADHA 2A57A 1QZXA 2BH9A 4E46A 4L1KA 5T7BA 2FWJA 2BBSA 3HPRA 1EFPA 2PLFA 4M9XA 1CY8A 3GUCA 2NVWA 3A28A 3NFRA 2M2IA 5BWCA 5FNVF 3ADOA 1G5RA 1TVEA 3GPDG 3HKEA 4MZXA 2AC2A 2D06A 2J87A 1J06A 1QHEA 1XDZA 2JNWA 3NH9A 1DTWB 4K05A 2WMOB 4FM9A 3ZNOA 2PL5A 2AYXA 1JXAA 3AL3A 3LX8A 4G4JA 3N0WA 5JSYA 4LTMA 4ZVSA 2I1LA 1AB6A 3Q12A 1LV7A 2OFOA 1O6ZA 1T3GA 5EJIA 2FK7A 1GGHA 2YJ4A 1Z0UA 1QFYA 2ZSKA 2OPBA 3IP3A 1XLTC 3EQ8A 3ZWCA 3ZCUA 4BPRA 4C5AA 2NSDA 4TTTS 5A4MS 4F4CA 3HR4A 3T9BA 3GOHA 1L7EA 1E79A 2V7QA 3DCNA 1V9CA 1RHMA 5CW1A 5T4EA 3OUZA 1Q6ZA 3WGTA 2O8VA 4DAOA 1U98A 4DR3B 1LPAB 1FUEA 1TTQB 4FMPA 1PKEA 1S2NA 4PGGA 4IGAA 2A1IA 4NFLA 5H02A 5AW9A 1U2TA 2TMYA 3MLAA 3SNKA 1D1SA 3AY0A 2K2QB 1DBQA 3UHOA 2XCTB 1N9ZA 2R7KA 4HLNA 2GQ0A 4TVOA 5DH9A 1M8GA 1Z2NX 3L6RA 4R7TA 4AY5A 3B7GA 1WTCA 1TAQA 3F5QA 3GFPA 3M6UA 4Y30A 5CM9C 3I23A 2PFKA 3C3DA 3O2SB 4C9BA 1ZOIA 5HQTA 1MX9A 2UU9B 3ETDA 2LDXA 4A1FA 1DKRA 3QX3A 1YQWA 2YWFA 4KMOA 1U2GA 3F67A 5EWMB 5E4FA 2ZJBA 3JATA 5CBPB 3PRJA 4CQLA 2YW9A 3AL0C 4QYMA 3ZW7A 4DUPA 3NONA 2VJOA 4PICA 2XNKA 3BWBA 4GOLD 3LZCA 4BE7B 4IOKA 4YJFB 1CR1A 3TQFA 5KTNA 4RVSA 4RVOA 1AZTA 3AIOA 5I7OA 4X1KA 2QTNA 1ULUA 1V8FA 4PSDA 2IYQA 4GVXA 4C76A 5DWVA 2W6OA 5EP1A 1W46A 3DJFA 3KD2A 4IY1A 4KBFA 4QNMA 1ZXLA 2ACEA 1Q1BA 2JAUA 4RMGA 1IZ9A 1P3DA 1Q44A 1NJ5A 3QRWA 2OHGA 3OFND 3PX3A 4RJ2A 4ZO4A 3RAGA 2VZEA 2YJTD 5GM2A 3PQFA 1VLLA 3LUDA 2WYIA 1W1WA 1QNFA 1YAJA 2AN1A 3I45A 5DK4A 5KU7A 1N2CB 3BWYA 1C80A 3UK6A 4Y0AA 3IUNA 2I0FA 4H2DA 2CHGA 1M8PA 4JGIA 2NUTB 4FVTA 4UZFA 3G3EA 2W6ZA 4EA8A 2LNDA 3DDCA 1KAOA 2JIQA 1UM9A 2UZAA 3MGBA 2FVYA 3NI2A 1K6JA 2I4NA 1Y6GA 3BIFA 4ZVPA 1X0XA 3HYNA 2ZAOA 3TN7A 1P39A 4IHKA 2R4UA 3JQ9C 4JR1A 1I9CA 4NS4A 1IIRA 1UJNA 4UD6A 2YV2A 2O2YA 4IXTA 2KHZA 3F3YA 1NE7A 5J2TA 1KQOA 3ROKA 1XTKA 4OKSA 1HQCA 4ZAXA 1JJVA 4ENPA 5I01A 1XF9A 3A4IA 4MQMA 2WOJA 3BFPA 1R8JA 1MX5A 1QZUA 1UOOA 3JCZA 4A91A 3ZWBA 4E31A 3TLXA 2BKAA 2FZLA 4BFXA 3GIWA 3GCXA 1WCYA 5ALYA 1K4YA 3PHLA 4TSKA 4I9HA 4HHEA 1X7ZB 1UBNA 5L3RA 3VTFA 4CKWA 4ZALA 5L3VA 3B3GA 1C3XA 5ER9A 5C0OE 1CD5A 2C9CA 2NUAB 4BNGA 3IC5A 2C5LA 5JDIC 2OR3A 1MT0A 1CDZA 1HFWA 4D9BA 3BSFA 2IDZA 1O0CA 1IWPB 2W4QA 2Z6QA 1D04A 3CTPA 5KQGA 3AOGA 3C43A 3NWOA 1UR5A 2RHGB 4MMZB 4RCVA 2GJSA 4P7GA 1C9KA 4UPDA 1QB8A 1KEPA 2HJHA 4FIZA 4PSVA 4I08A 4REOA 5EQDA 1RLJA 1ECPA 3GLHA 5BYJA 5AI4A 3ADDA 3TTTA 3D6AA 1JAZA 2P9CA 5AOVA 1FLAA 5BURA 1JR6A 4RCZA 1W4CA 3PWZA 1HLDA 2C20A 1F4PA 3OESA 3OM9A 3GLFA 4YRIA 1TQ2A 2IXGA 1ND6A 1JV2B 2YFKA 4DIOA 5K2OA 3ZQ4A 1QGED 1V7QA 1VKOA 4BRWA 4RZHA 5A5VA 2MMCA 1U7PA 3MXTA 4MA5A 2QTVA 3UK0A 3NJRA 3A4YA 3GJ7A 2IUUA 1H1DA 3F5SA 4E7OA 2HA4A 5AIAA 2HEIA 1TCVA 5B4TA 4OLJA 4UVGA 2ZXEA 4AJEA 1KEUA 2YQ5A 4TM8A 5EZSA 3T3HA 3BL8A 2BGKA 3RSGA 1KVSA 1W25A 2O5RA 4D8YA 1V9LA 5ARDA 4YMVA 1NN3A 2X7XA 1T4CA 3K0FB 5JISA 4KREA 3H2HA 1F6WA 3MJVA 1ZIOA 1JWLA 2GRUA 3SOZA 4B87A 2ODBA 4PZ0A 4JJ7A 3DPIA 4HNTA 3KLMX 3ACDA 3JASB 1HF3A 4YRMA 1I3OA 1M6VB 1N5MA 1XJ0A 1U04A 4Q7KA 3RD5A 4AUMA 5AI5A 4URVR 4ENTA 3BD6A 5AW1A 4LKRA 4F7WA 4MYRA 1E9CA 4E0BA 3V34A 2NSJA 4CLEA 4Y2RA 1DZIA 1CUAA 3GPBA 1Z18A 1A9ZA 1QANA 3BB4A 3FDXA 3FGZA 3OIFA 4OXQA 4OM7A 4LOKA 1TMGE 3EY9A 3UBMA 3E0XA 3GZJA 3L18A 3VSCA 2W83A 3ZR4B 3NVKI 2WU0A 1R4ZA 4MA4A 2QN1A 2ZWMA 4WSOA 1L7MA 1RZ3A 2RGDA 4YV0A 3GEBA 4B5LA 3ESBA 3JYLA 3JQ7A 1MB3A 1O5TA 3OP4A 1HE3A 1P5HA 4JJIA 1GLVA 1RKBA 2DPMA 5J1SB 5C52B 4GGOA 4NATA 4BE4A 1DQNA 1RPJA 1AK2A 3JWPA 5KNCH 3PSHA 1PNVA 3QYPA 2A0YA 3T7TA 1EFKA 3B1ZA 1FTYA 3HB5X 3AEZA 4JB0A 4U6QA 2WIAA 4DV3B 4EIWA 2QUAA 2XE4A 4MDFA 4B9AA 5TS2A 1BWQA 3SF8A 4BJ6A 1KK3A 4D44A 5HIAA 4ISBA 3QZUA 3EXHB 1AHNA 2HREA 2PXCA 2UVDA 2EFJA 2QW1A 1GCGA 1KIFA 2VPYA 3IVMA 3JQGB 4X95A 5KVCA 2IU6A 1YS6A 5G0VA 1M7HA 4BX8A 1YK1A 2AOTB 3GA5A 1P2BA 1XR3A 1AG9A 3CNLA 3GUUA 2NO6A 1NJFA 3LJKA 4S2UA 5FHQA 2A2ZA 4F4HA 1A7JA 1ESCA 1VKJA 2YHAA 4DR5B 2HMVA 3WV4A 4JBXA 3OY2A 1LW7A 4P53A 1C1XB 2O4UX 3EE6A 3IHLA 1Q91A 1AA9A 1LBIA 2BCGY 1KHHA 1SVNA 2VJPA 4X63A 5ULLA 3NYIA 4J7CA 621PA 4F3TA 1NQWA 1OXSC 5KQPA 1B2LA 3IPRA 3NW9A 4Z86A 3WGVA 4GLLA 2HDHA 4JWKA 3MT7A 1RABA 3AESB 1E2MA 2IZ7A 2EXXA 3PXGA 3UV7A 3KKQA 2FP4A 2W2KB 2GO1A 2XI4A 3FDIA 2W43A 2IYXA 3QEOA 1ZOPA 1VCOA 4FYKA 4HQRA 5FJIA 4I5IA 1N3YA 2XWQA 3FYSA 4XDHA 3FCAA 4RZXA 1PJ2A 4YFVA 4JIMA 4EA9A 4XWKA 4FWBA 2AOUB 5CK5A 5KNDD 4ZARA 1EVEA 2BZ1A 1PTJC 2ZTLA 3B5EA 1GQYA 4KAFA 3Q11A 5B6JA 3CLSD 3EF3A 3ZS9A 1B8PA 1EA7A 4W7SA 3QA3E 3M6MD 5DP1A 2NO5A 3AHIA 3GH1A 4Q3OA 4BVJA 4MDEA 2CFSA 3B6KA 4ZU6X 3TM5A 1SXJB 3M3HA 4BFYA 3SHOA 1Q92A 3GW8A 1QGDA 1MNAA 3Q1KA 5E7IA 2R6FA 2RI6A 1XWFA 3KFLA 3QOYA 1ADYA 2BHNA 2DSTA 2ILTA 3O2NA 2C8JA 3HYTA 3OP1A 3R23A 4QYXA 5BNZA 1DOAA 4I1OA 4WZAB 1NFFA 2V03A 3LV8A 3R1IA 3NYQA 2O8BA 4HGRA 2YJ3A 2VQEB 5J40A 1MJGM 5E2BA 4MQLA 1A72A 3CLKA 3N6XA 4UM9D 4B9EA 4PVDA 3AJ9A 4L15A 2WWYA 4JVNA 1KU0A 1SHZA 2IH2A 4TKVA 1QX3A 4QTUB 2OCIA 3VR2D 3O84A 4W5NA 1R3DA 4WE3A 3W3AA 2FV8A 5TGZA 2I87A 1E1DA 3BWDD 2V65A 2YMLA 4EG0A 5E6RA 1JSZA 2V1UA 4B09A 5JXGA 3NRCA 2J6HA 4RKEA 4DWWA 4EHHA 3IILA 5BSKA 2OP0A 1DEHA 2WJJA 3VH4A 1VJ1A 2PHZA 3A0RB 3GX1A 2G6TA 3DDNA 4DUZB 3DEJA 3FZNA 1XVAA 2F62A 1JWBB 3H5AA 1X80B 4NYIQ 1AGXA 2AJDA 5EXSA 1PRYA 2Q07A 4LEIA 1TJNA 3DL4A 5EMMA 4R1UA 4CIVA 1PGQA 2E9SA 2WTXA 4X0EA 2IHNA 2O5EA 3KB2A 4IWNA 6CHYA 3HB0A 3UUWA 4OXYA 3QPBA 2JARA 3COJA 6AT1A 4KACA 3KCQA 4HAWA 5IM4A 2ATIA 2JCBA 2CHFA 1FLVA 2EZTA 4DA7A 2BCEA 1ZM9A 3EIXA 1I0LA 3OZCA 1JMVA 4NPHA 1LV8A 3L8ZA 5ALOA 2DEUA 2P90A 5AUQA 5L45A 3OT4A 1P62B 4WJKB 4XQEA 1RWQA 3L07A 5DEIA 5HRAA 2B9VA 3FAZA 2Q6VA 4HQ6A 3HPQA 2QLFA 1CIJA 2GCEA 3NEYA 4MVJE 4QEDA 4RZ3A 4BGUA 2IIQA 4CFYA 2PMFA 2ZSJA 1O95A 3KR1A 4GGMX 2IKQA 3FH0A 4EI9A 3BRWD 1E94E 4IUYA 3OA2A 1YWGO 3CE9A 3DD1A 3QVGB 4H7JA 4IIFA 3UF0A 4CKEB 4HNUA 1A8HA 3H8SA 2P62A 5SZHB 1COWD 2FGKA 4H4CA 1LJLA 4FP9A 2NQTA 2G9QA 1GJRA 1FNDA 5IC4A 3R5SA 4IDAA 4KQWA 4IMJB 4BO6A 2I78A 2QY9A 2RSLA 3AY7A 3BTUA 1NHGA 1TQDA 2PSDA 4R1OA 1ULZA 3AXSA 5B1IA 4H4DA 4ENUA 4G0YA 1E2DA 1JHQA 3HXQA 1UT8A 2V59A 1YZQA 2ZLBA 3LNTA 3RR2A 1T9HA 2O59A 3QX9A 4W9NA 1NW9B 4RL6A 1UBOS 4HDNB 2AXPA 3QNMA 1VG1A 1ZJ6A 3RQSA 4BWGA 3BHMA 1EM8B 2CGEA 3A6FA 1DIAA 2A1TS 3U7QA 3ZJ5A 1KAMA 3I9NA 4RXMA 4NY1A 2H17A 2SCUB 3PT9A 4EMTA 1GTZA 1EJ2A 3MB8A 1QG6A 3CFYA 1A9OA 5HZGA 2QG6A 3MOIA 4EEXA 5IVPA 3H5WA 4BHTA 1BC5A 4GPZA 1NNUA 4DQKA 4N65A 3LE8A 2QK4A 4A7PA 1E3LA 3ND9A 4DXAA 4DKJA 4QU0A 5K1ZA 2FE1A 1NU8A 3VU8A 3M49A 4XVHA 1OFTA 4IJUA 1MB9A 1PJLA 1NV8A 2Y9MB 4OGLA 4UKDA 3MAGA 4GOND 5DMXA 1Y82A 4AZ0A 1SQ0A 4A27A 4P36A 3THYA 1W6UA 2QJTA 3N70A 3O6VA 1M5TA 4OOEA 1NBEA 3MBOA 5GM1A 2AH5A 4AP6A 1GU1A 2XF8A 1SWWA 1E6EA 3LKVA 4Q1AA 4QXRA 1B0AA 2GBLA 2CXSA 5EP3A 1W0CA 1CF4A 2QN2A 3ZTWA 2YYAA 3HU1A 1BU5A 3JD2A 1KQFA 1U1GA 3ER8A 3OZAA 4RJIA 2FOIA 4NYMR 5HIMA 3EVZA 5KU1A 4NOJA 2G09A 4P7KA 4WJLA 3HJNA 4DXHA 2B21A 5DEOA 1L1EA 4P4SA 4JBIA 1XVIA 3PPWA 4RENA 2D5CA 2WJ4A 1UWKA 1PQUA 2WSSD 3HJFA 2G9RA 4V0OA 3J81k 4GC9A 4NCNA 3PFCA 4HDKB 1LTKA 3U9TA 1BCRB 1K4KA 5JWHA 4G6ZA 5BVHB 3FUXA 4KXWA 1GSHA 4D4LA 2B7LA 3MZ0A 3OLVA 4JLAA 4Z0NA 5JCPA 4J0FA 4HSGA 4EB6B 4PO3X 5AXAA 4YAKA 2B99A 1PAUA 2WUEA 2YWCA 3IEKA 4W99A 3SKXA 3P4XA 4DIMA 1GRRA 4WECA 1IL0A 1JSCA 2VH1A 1JECA 1LLDA 4JX8A 3OF5A 4MWCA 2QRVA 5DP2A 4P3OA 3WNZA 3CN7A 1PG2A 2I3AA 1YR8A 3NIDB 4JP2A 3TDMA 1UDCA 3IAAA 3RNLA 3GRZA 1QDEA 4BWYA 1OXVA 1I13A 2HV8A 1QYWA 2RCYA 4ARZA 2V5VA 3LDGA 3C8HA 3H2YA 4CM1A 1MW8X 1EBBA 2EKQA 5JZSA 5CH8A 1Y8RB 4CM9A 2BMVA 3RHZA 3H1GA 1THMA 1GQQA 3IJ5A 1NM5C 2VOJA 3NTVA 4JC8A 1II0A 4D99A 1AKYA 1NVMB 3E1GA 2XUGA 4EW3A 1BXGB 1QO9A 4OSPA 3SS9X 3T5AA 4RADA 1NZFA 4LXHA 3EY4A 1W59A 4X7PA 4E21A 3E8XA 3QKRB 4MVJD 4Q6BA 2P41A 1L5OA 1D4OA 4WT7A 3GFBA 3G5MA 4X7RA 1RQRA 2XUAA 2NW6A 1B00A 3CIFA 3FCSB 3QVUA 3UMMA 5K6AA 1KJ9A 3MERA 2XHEA 2J3JA 2WJWA 3FDZB 5B3JC 3REFA 5FDFA 3NLLA 4YRPA 1WSAA 4P93A 1NUHA 2JFPA 5HDBB 1XMIA 1ZM2A 3AR2A 1A4RA 1NT4A 2XMSA 5G1OA 2KWIA 3A6LA 5AKLA 2HN9A 2B7CA 4YK7A 2JFYA 4Q7EA 3KXKA 4PX3A 5FOXA 4BFCA 1NQTA 1OU0A 4XQCA 5ILGA 3NXSA 2XGSA 4LX8A 3SSMA 1U8ZA 3K92A 4KO1S 1NONA 2XJ9A 3DAYA 4I50A 3JYOA 3HUTA 1RCTE 4MUJA 5JXHA 3PDIA 3OE4A 5FIUA 5CT4A 1YR7A 3MM4A 4R41A 4RIEA 5FBKA 2IGBA 1I4TD 2WHRA 4B43A 3D8TA 2VQ3A 4XIFA 2G0TA 4L4UA 5EA2A 3RG8A 5JNSA 1TK3A 3L8CA 4GLOA 2LW7A 1HM5A 2WV9A 3Q1LA 4G0XA 4MCAA 4Y6QA 2ZRFA 4UU1A 4ZQCB 2WY2D 2EVWX 3MFQA 3CURA 4L95C 4MS4B 4OHYA 3DE3X 2PLWA 4E88A 4V1CI 1NDHA 4JSRA 2F3PA 3OSZA 2AX3A 3DWFA 5KHLB 1O1YA 3G2NA 3KEOA 2DQZA 4N0QA 4R71A 3JQCA 1LRJA 2C9BA 4O1HA 3IV7A 2GCIA 3BFJA 4WN9A 1X7HA 5H9WA 1KYXA 4HYQA 3S3TA 4TS4A 3SSNA 2QSUA 1Y8AA 2VK1A 2JVIA 2R8PA 3Q15C 3DNMA 3PXAA 4Z8YA 3GLGB 3IDSA 4KQEA 3O2QB 4MCJA 1GAXA 3AVTA 1H85A 3QTLA 4I2NA 4L75A 2XDYA 3ZU5A 4B6JA 1IQ0A 2V9ZA 4J7XA 4IJQA 3P96A 1W9MA 2B30A 2H63A 3T1QA 4DQLA 1ZJZA 1GEEA 3M81A 3NWJA 1UDBA 3QP9A 3MVEA 1QHYA 4CM4A 3VPSA 5F2OA 1TC1A 4K6CA 4LZLA 4I1UA 1A2QA 2I29A 2QB5A 4D46A 3NUGA 1N57A 2UVQA 2PWBA 3VKUA 3Q10A 3IEPA 3NOQA 1REQB 1Q15A 1JHUA 5F21A 4X44A 4RD0A 5EHNA 4KIGA 3AU9A 5DB4A 2F43A 5DE3A 1FNMA 3IH5A 4ESOA 5FAKA 4D0GA 3OZFA 1HZZA 2VRNA 2X6QA 1LD3A 3OSUA 3ZDFA 3ZTTA 4A9AA 5AK6A 2JATA 5FWAA 3A2MA 1DC5A 1EZ4A 1PZEA 1UBFA 3KV1A 4HB4A 1N9GA 3UAYA 4XRGA 1E3EA 1GR0A 3VSAA 3W8FA 1KYVA 2YKGA 1SUEA 2YFQA