4YBZA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
463
structure length
462
Chain Sequence
NDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 178
structure length 462
sequence length 463
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4ybzA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4ybzA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ybzA01
1ENPA 4J49A 4N5NA 1WXDA 2CMDA 4CM1A 3SLKA 1U7HA 3K6JA 3IMFA 4CMHA 5KVVA 4YVFA 4DRYA 1XDWA 3GPIA 1KC1A 3UUWA 2J3JA 1ZK1A 1ZK0A 2NV6A 4NJMA 1QG6A 2DTXA 2GASA 2C5AA 2F1KA 1U28A 3ANLA 4XGNA 5LDGA 4XCVA 5EINA 1JKJB 2GNAA 3DO5A 2OBNA 5AOVA 1KVRA 3O8QA 1EK5A 1PJSA 2ZB3A 1N5DA 4C7JA 1E7QA 4TVOA 4J1TA 3WTCA 4CLRB 5FI3A 2ZJ1A 4B3IA 2FP4B 3MWEA 2JHFA 3F4BA 4UUMA 2DFVA 2DUWA 1LLQA 3GK3A 3PQDA 4XGIA 4J2OA 1MA0A 2Y05A 2WD7B 1SBYA 4DXHA 5EQFA 3RJ5A 3GNSA 3HFSA 2PD6A 5H81A 1EUDA 4J0EA 4TRJA 1T25A 4WK6A 4FFLA 4BOYA 3TN7A 1D1SA 1KY5A 3GPDG 1YRLA 3OQ6A 3RWBA 3BMOB 2CZCA 3D3WB 5H82A 4PLPA 1SEPA 2HK7A 2V6BA 1ENOA 3VZRA 3CZRA 2GZ3A 1M2WA 4RF3A 2GSDA 1PEDA 1PL6A 3C85A 2GUGA 1P44A 3L77A 3RUAA 3VH4A 1JKFA 3T7CA 2J3KA 3I4CA 4Z0TA 2IE0A 4EBFA 1H5QA 2HMVA 4RLSA 3UCXA 1KOLA 3VC7A 3U4DA 3CIFA 1WVGA 1MP0A 3GOHA 1XSEA 1E5QA 3DZHA 4FQ8A 1M66A 4Z6KA 3RQSA 3KLMX 1NP3A 3LZ6A 1Y5MA 3F1KA 2AXQA 1MFPA 3JD2A 1JDJA 4BNIA 3ZV4A 2Z1NA 3GAFA 4YT4A 3SVTA 1PJ2A 2FPPA 4YDRA 2OFPA 1B15A 1BXGA 4J7CA 4HBGA 1Y8QB 1R4NB 5I9LA 2Q46A 2SCUA 5IG2A 2PY6A 3OBBA 1Y8RA 3VPGA 1R37A 2NU8B 2D5AA 2P2SA 2OOSA 3ZI0A 2B5VA 1XWFA 4E2YA 5A04A 4QUKA 2PNFA 2PV7A 1Y9AA 1DFHA 4WCFA 5G0UA 3GQVA 4D42A 2XXJA 4A7PA 2DLDA 4O5OA 2D3TA 3G17A 5DN9A 5DF1A 4YJGB 1LQUA 4PG5A 4NFYA 3MJCA 3RC7A 4LVUA 4CQMA 1HLPA 3ONEA 4QQRA 2ZK7A 1I3LA 1LDGA 1DOHA 1ZNQO 3DEYX 3GNTA 5JO9A 3ST7A 3TZCA 4E3ZA 5L45A 5T5QA 1U4SA 2EKLA 3ZU4A 1GADO 4EI2A 5ITWA 3AI2A 5A9TA 2QW8A 2Y0EA 4AJLA 3JV7A 2Q99A 3WB9A 4NPCA 4RPGA 1K5HA 4DREA 1FDUA 2JAPA 4NBRA 3NDRA 3WIEA 1FDVA 3CZMA 4W9NC 2X9GA 1B14A 1ZJYA 4BQPA 2B83A 1NPYA 3OHSX 2VT2A 1AHIA 3GVCA 4LCEA 1E3IA 1I24A 4AJKA 2BMAA 5G0VA 2EG9A 2FR0A 4HFNA 4XQGA 4ZVVA 3FNHA 2C0CA 4CMIB 3ENNA 2WSBA 1Q7BA 3Q9UA 4J4TA 1CRWG 1MXHA 2BGLA 4GH5A 5ILOA 2X7HA 3JQFC 5DOVA 1HEUA 3E6AA 4FN4A 1D3AA 4I9UA 4E4YA 2IZ0A 2VN8A 3ITDA 2JD2A 3KYCA 3QJ5A 5DDIP 1HLDA 2EGGA 1X0XA 2AE2A 3RAJA 1ZXLA 4PLCA 3DBVO 3GHHA 2IDZA 3WGQA 4MVJD 4XRGA 1DRWA 2W2KB 4L4XA 3ZV3A 1I10A 5MGBA 2ZQZA 4R1NA 5DBIA 2I3AA 4J9VA 3RD5A 2O3QA 4XEHA 3GG9A 4IDFA 2DU8A 3H9UA 3MCVA 5MDHA 1W8DA 3DR3A 4CM8A 5ITVA 3G0OA 3EZLA 3SBOA 1ZUD1 3FI9A 1U3UA 4R3WA 3HUDA 1LU9A 2CNBA 3KHUA 2WYVA 4IDEA 2NUAA 3EYWA 1UUFA 3UICA 3GGPA 1I2BA 2B36A 3ABIA 5JNLA 2DAPA 3EGOA 1C3VA 4R5MA 1F14A 4HWKA 2QRLA 3PIDA 1JLLB 4BB6A 1IE3A 3GT0A 1ID1A 1T2AA 4TRMA 3WYEA 3DAFA 1E7WA 3QWAA 3HG7A 4JLWA 4ND5A 4MP6A 3SEFA 4R69A 1HDYA 1JWAB 4XIYA 4MDHA 3H5AA 1I5RA 2HDHA 1AXGA 4FCCA 4QTZA 3KLPX 3HADA 5TJHA 4ALKA 1R6DA 3P19A 5I9NA 3GAZA 3T4EA 4DC1A 4WNCA 1X1EA 2J3IA 1W0CA 1GQ2A 4BO0A 5KOIA 4A27A 2GD1O 1WWKA 5A4DA 3GDGA 2AEMA 3GC6A 2VUSA 5DZSA 3U4HA 1VLLA 2DPHA 3U5TA 3RFVA 1T2EA 4NFSA 4RVGA 3VDQA 3ETDA 1WMBA 3UCFA 8ADHA 2DBVO 5COQA 4B7XA 2NADA 3STHA 1DHTA 1VC2A 4BNZA 4J4BA 1H6AA 2FPGA 1YJ8A 2HRZA 3UAGA 4CLDA 3CMMA 1GCUA 1H93A 4LRTB 1K6JA 3RKRA 2J6IA 1R15A 1DIGA 4KP7A 1X13A 4P38A 2G82A 1ISGA 4I5GA 4ZN6A 1K0UA 2X1HA 4KQXA 1NHGA 5KJ1A 2CUKA 3H9QA 3JQAB 4TRNA 4D79A 1YB4A 5A5FA 2AMFA 4XDZA 2CF6A 4DC0A 2DPGA 2VTEA 4E2WA 3H9GA 5KNLA 3RUHA 8LDHA 4PCVA 1E7RA 1U2GA 4YPOA 2X0NA 4PLVA 3A14A 3QLJA 2Q2WA 3WFIA 1NASA 4CMAA 4JROA 1L7DA 1WPQA 1CETA 4XIJA 2GDZA 1KVTA 3K73O 1BVUA 1B8VA 5AVOA 5G2OA 3JQ9C 1NPDA 4U7WA 1PWXA 4PN3A 2JFHA 3AUAA 2XF8A 3I6IA 1C14A 4GL4A 5G0TA 1XLTA 2Y68A 1HE4A 4JGBA 2FWMX 1IULA 5L53A 5JXWA 4ALMA 3IC5A 5GMOA 1G1AA 1BRMA 3AW9A 3JYOA 4Z0HO 2EXXA 1MV8A 3IOYA 3PLRA 1P1IA 4XYGA 1MFZA 2UUPA 4CM9D 1QMGA 2Y1OA 3TJRA 1AHHA 4B4VA 4DMLA 2W2LA 1E1LA 1L1FA 1KS9A 1E7MA 4FW8A 4XKJA 4W7HA 5F1KA 3Q11A 4IQ8A 5CEEA 1B2LA 4DLLA 4RPJA 1P31A 1HDRA 1H9AA 2VHWA 3VH2A 4YAIA 1B3BA 2I3GA 3V2HA 1UAYA 2I9PA 4BS9A 4M89A 2C7VA 3K2EA 1HYEA 1GQYA 2FR8A 3HDHA 3JD0A 1HZZA 2P91A 2EJVA 4RDHA 3TF5A 1HYHA 4CV1A 4J3FA 1B8PA 1H0KA 2IXBA 4GSKA 5BT9A 1KEWA 2W90A 4CMEA 1YO6A 2WYUA 3PHLA 4IMPA 4WOKA 3LT1A 4L9RA 4P4LA 5L7TA 4CQLA 2OL4A 4BNUA 2Y99A 1D8AA 5EERA 1N1EA 4WNIA 3WSWA 1ZSYA 3OIGA 5B4TA 2GYYA 2FRDA 1BTOA 3DBLA 1A72A 2PGLA 4EITA 5ICSA 4GX1A 3RUFA 1BW9A 3O03A 2PZLA 2J5RA 2VYND 4BNMA 2JCXA 3MJ4A 4XB2A 3WJ7A 1TA4A 1YKFA 1U8XX 4PLHA 3PWSA 5DCYA 4ZA2A 1NR7A 1L7EA 2VCYA 4RVUA 2PKRA 5KVSA 2O2YA 4AJ4A 4J43A 5CDTA 4OXYA 5K0ZA 1E0DA 4UEOA 4YAEA 1UAGA 2E48A 3ZN2A 3ZW9A 3M2TA 4ZQEA 2AG8A 4FPXA 2NVUB 2I66A 1SCUB 3BMQB 3PQFA 2HCTA 4J6FA 3KXDA 2GRAA 1SMKA 3BTSA 3OECA 4R16A 3ZV6A 3I9LA 3KRTA 3KBOA 2RHRA 4HNGA 3KUXA 4EJ6A 2EV9A 1GPJA 1BG6A 3I9KA 2IYOA 1PGNA 3SX2A 5DP2A 2VT3A 4GBJA 5HTOA 4N7RA 3TNLA 5TIIA 3QHAA 2HSDA 4Q3CA 5TT1A 2R6JA 5JDIA 1YDWA 5HWSA 4ND3A 4LSWA 3PYXA 4IINA 3V2GA 4GAEA 2C82A 3TZHA 3Q6IA 4BKOA 3E03A 3PPIA 3F5QA 3GNQA 3FR8A 3LDHA 3D4NA 3RC2A 1QYVA 4M86A 4DYDA 3S2FA 4E32A 4FFNA 1BHSA 1JU9A 3DBHA 4NBWA 3OA2A 3I3OA 1LDEA 4PGFA 4JP3A 4IXWA 5TQVA 2BFAA 4HFRA 2PKQP 1DFIA 1BDMA 1R66A 4B8WA 4KDFA 2NU9B 3I9OA 4CLRA 4XYLA 4L4RA 3WYBA 2WTBA 1JN0A 1PS9A 4RPHA 4KOAA 3W8DA 4INAA 3PYLA 5JCJA 4P8RA 3DAPA 1UJMA 4NK4A 4NJOA 4DUPA 2YFQA 3GG2A 3QV1A 2OP0A 3I9NA 1J5PA 4IZHA 5G4KB 2O3SA 2CDCA 2EJWA 3BMOA 4NIMA 3WQSB 3OIFA 4WKGA 1LLCA 2IEDA 3M6IA 4A10A 2JL1A 2VRCA 3ZWYA 4QX6A 1ONNA 5F5NA 1I8TA 4DGSA 3BMNA 1YOVB 4WCFC 1PZGA 1WW8A 3FWNA 3ROQA 1J6UA 3L4SO 2FY8A 2IEBA 2PH3A 4FGWA 3PFWO 2OP1A 4IDDA 5JLAA 4W82A 4BUCA 1KBZA 4IQGA 1A7KA 3ANNA 5BSGA 1V35A 2CVZA 4EUHA 3IJPA 4WOJA 2A35A 3WNVA 3AOGA 1N92A 1U3TA 1FMCA 1X7HA 4IY1A 1C1DB 3C24A 3FTPA 2FPIB 3D5QA 3B1JA 3WMXA 3NUGA 5IZ4A 1E6WA 3HE3A 4YT8A 4PZEA 4E13A 2C2YA 4RPKA 3EDMA 5T57A 3L4BA 5F1OA 2HKIA 1LEHA 3U0BA 4FJ1A 5JBIA 1Z74A 2HK8A 4NK5A 3WLEA 3KEOA 4E6PA 4O63O 1CF2O 1U9JA 2HK9A 4M1QA 3E9NA 2OMEA 4TZKA 4U0JA 3DFUA 1Y8QA 3S1LA 2JKVA 3PJFA 2HLPA 3A1NA 1R4NA 2NU6B 4BHTA 3GDOA 3GN1A 3WWYA 1E3SA 2Q45A 3QVTA 3CXRA 3GVPA 3U9LA 2NU8A 3D0OA 5HS6A 5I7SA 2XAAA 4XRRA 3F9IA 1A27A 3OJLA 3GF4A 2EP5A 1NAIA 3B6ZA 3L07A 2VOEA 3VPHA 4LN1A 5DT9A 3ZNPA 1GR0A 5J23A 1ORRA 3TFOA 4MPDA 1HT0A 3I52A 1TEHA 3H5NA 3ADPA 3EMKA 3I83A 4RCVA 3PWZA 3L6DA 2GN8A 2ZB7A 4KUHA 3VH3A 3C7AA 1YS4A 4KWIA 2PKQO 3GZNA 1PGPA 3IJRA 5JW6A 2FZWA 4B7CA 2WEKA 4BKPA 3WQQA 3AJRA 3OIDA 3DTTA 1ULSA 1FJHA 1VI2A 4DLAA 3ZNQA 4MJLA 1MLDA 1KVQA 3PJEA 4PZCA 4QFCA 2ZATA 4PG6A 4RF5A 4YT2A 2VOJA 3S8MA 5TNXA 1AN9A 4FFRA 1LRJA 1NFRA 3M2PA 4UVIA 4TRRA 2H63A 2A9FA 4AJ2A 1RKXA 4PLWA 1P1KA 3WFJA 6ADHA 2RH4A 3ANMA 3FCOA 2ZTLA 5H83A 4D46A 4GKBA 2CVQA 2XPCA 1ONOA 1T4DA 1HSOA 4U5QA 4UREA 5U4QA 4ZGWA 4EZBA 1WZIA 3Q3CA 2Q2QA 3GVHA 1EVYA 3OFSA 3RUDA 3SLGA 2JAHA 4CMGA 1ONPA 1H2BA 1R4MB 4ZRMA 1QLJA 4OIMA 4MKRA 5EQDA 1HDZA 1NX6A 4LCJA 2YFHA 4IM7A 4BNYA 4CLOB 2E37A 3E5MA 5CP8A 3INGA 1IYZA 3H9JA 4L73A 4Y8VA 4NDNE 1QLHA 1CQJB 3UKOA 3DL2A 2WYWA 4FS3A 5JPIA 2B5WA 3JQGB 3AM4A 1E1MA 2E49A 5A5EA 2O7SA 3C1OA 3E1KA 1UXJA 2QZZA 1ADFA 1KEVA 4MP3A 4CL8A 3NT4A 5EESA 1GTMA 4FR5A 3BMCA 2B37A 2EP7A 5L4NA 2QYSA 1FDWA 1FDTA 3GEGA 3RKUA 1VSVA 1TXGA 2PK3A 4MKXA 1Z6ZA 3ROMA 3QIVA 3ZHBA 5ADHA 1JLLA 1NQTA 1ZKMA 4E30A 5KJ6A 2DTEA 4P4NA 2CVOA 1HRDA 3ULKA 3DC2A 4YJHA 4FD3A 2VWHA 4BO3A 1GUYA 1DXYA 1YH3A 4IDAA 1Y6JA 4BNVA 1XKQA 1R0SA 5EN4A 4KZPA 2AQ8A 2X0IA 4Q9NA 4ZU3A 3IDSA 5L4SA 1D7OA 2VHXA 2QX7A 5CAEB 1TVEA 3HDJA 1Q0HA 3INRA 1EUCA 2Y0DA 3K96A 1VE9A 4BKQA 2GR9A 1VL0A 2ZYAA 5IN4A 4JJFA 5DOZA 3V5NA 4B4UA 4OXKA 2QIOA 5LC1A 4LSMA 3WGOA 3JQ7B 3DZBA 3MJEA 1H6DA 1E1NA 2PZMA 3O9ZA 3QSGA 4S3MA 3ON5A 4TVBA 3CSDA 3HSKA 3VVCA 1E6UA 3AU9A 3UW3A 3OP4A 4UVGA 1UZMA 3GHYA 1VSUA 5ER6A 5KKCA 3AWDA 3LC7O 4D41A 4YRAA 4C7KA 3MOIA 1U2DA 3BXXA 4KTVE 4CQMD 4DMMA 1GY8A 3DDNA 2VYVA 4DA9A 3GVIA 3U4CA 3L6OO 1A4IA 2R2GA 2PD4A 1XYGA 4E5KA 1O9BA 1DJNA 2VUUA 1YQXA 4H3VA 4XJSA 4W7IA 3PVZA 4FC7A 2HMTA 1SEVA 3ETEA 3PHIA 3PK0A 1QYCA 3WX0A 2PD3A 3MWDA 2FOIA 3FBGA 4FB5A 2VUTA 2VZ8A 4IDGA 4D3SA 2Q4EA 3VPFA 2YW9A 3AU8A 4ALJA 1I30A 5A9SB 5TT0A 2Y1EA 1NVGA 3RBZA 3RU7A 4O1MA 4YACA 5C7LO 3S2EA 4CM4A 5AXDA 5IN5A 4F45A 4LGVA 4R51A 3DFZA 1CJCA 1LDMA 2I67A 4ESOA 3LLSA 4HP8A 4URFA 4ND2A 1YONA 2CDAA 1EQUA 1B0AA 3KYBA 3ORFA 1LDYA 2NLOA 3DHEA 1EVIA 3GN2A 3ONDA 4XDYA 4BO5A 3W8FA 3DZFA 2NVWA 1JAXA 4KUEA 1NM5A 3V8BA 2D8AA 1XEAA 5L4LA 3K31A 1Y9EA 4Q3BA 2IODA 1LQTA 2ZKLA 1GL3A 5C3MA 1S7CA 4WLVA 3PGJA 1U5CA 1LC3A 1YVEI 2AA3A 3OICA 3BA1A 3GMDA 4CMEC 4DWVA 5JAZA 3IKTA 3KETA 1BXZA 1CQIB 4D44A 3TL3A 2BFPA 1W6UA 1PJCA 4GLOA 4WE3A 3KYDB 5JMPA 3WXBA 4DIFA 2B35A 4N5MA 4H16A 2V6GA 2GN4A 3U4IA 2NTVA 2HMUA 3LT2A 1PJ3A 4FGSA 5FF9A 1DIRA 1TI7A 1DAPA 4YQYA 3QWHA 3PIIA 3BYZA 2GO1A 2GGSA 3O38A 4WPGA 4ZICA 4BV8A 3UFXB 3QY9A 1O5IA 3RC9A 1PTJA 2BRUA 3PHGA 2ZTVA 4L74A 2CY0A 2FSVA 4QXMA 1M76A 3PLNA 5JY6A 5JMWA 1DB3A 4IUYA 3T7EA 1U7TA 5EL0A 1C0KA 2YV1A 1E1KA 1W4ZA 3FF4A 3H9EO 1KVSA 3IP3A 1ZSVA 4R41A 2O4CA 2D5CA 1R12A 3I5MA 4XX0A 2OZPA 1YJQA 1GPDG 1PZHA 2O4UX 3FPLA 2V6MA 3FN4A 3HN2A 4IJKA 1PL7A 3Q2IA 5KVQA 5JDIC 5U9CA 1ZO8A 5T64A 3N74A 4OO3A 3OM9A 2RHCA 5IZCA 3W6ZA 4MIYA 5A1TA 3FHLA 3RBVA 3W6UA 3LVFO 3DBRB 2R00A 1ZVMA 1GD1O 1PS8A 2PFGA 1K2WA 2BGMA 1T26A 3DOCA 3NJ4A 3PGXA 4GVXA 1EK6A 4BL5A 1KY4A 2YHIB 4GGPA 1XU7A 1GZ4A 1IHYA 2V65A 1WDMA 4NQZA 5K9ZA 1BVRA 4YJFB 4CMKA 3EVTA 5JC1A 1ZFNA 4CM3A 5CDSA 3LT0A 4IXTA 3VVBA 1JVBA 3JQ8B 3GVXA 2HMSA 3DAGA 1VL8A 2EWMA 1T1RA 1LRKA 1QKIA 4O0LA 3S2IA 4MVJG 3SJ7A 3AUSA 1GAEO 1S6YA 3DTYA 4CUJA 4B8ZA 1C1XB 5JAQA 1QSGA 4K6CA 3DXFA 2HO5A 1PIWA 3PRJA 4OOEA 3G3EA 2GZ1A 2X22A 3G1TA 4HNHA 1SC6A 1E3WA 5JFOA 4ND1A 5JS6A 2IZZA 4DQXA 5DNAA 1QP8A 5K6AA 2Y67A 5AXBA 3QA9A 3QP9A 1MB4A 2D59A 2D1YA 3E5RA 4CLXA 1SOVA 2YDYA 4GQAA 1GEGA 4JXKA 2H9IA 4TQGA 2ZIZA 3MTGA 5KVCA 4IDCA 4IQ0A 5TRTA 4U0KA 3W8EA 3DHNA 3IIEA 4FFPA 1FK8A 2D4AA 1P0FA 1VM6A 1VL6A 1TT5A 3E9QA 1YQGA 4RQUA 4W4TA 5BR7A 4R68A 1ZXBA 4NJMB 4BKUA 2WM3A 4R1UA 5TF4A 2Z5LA 3L4BC 2NU9A 3TSCA 4AICA 5B4UA 3OJFA 2X5JO 2RH8A 5IJZA 1O89A 3O8QB 1P74A 3ZU5A 1QXSA 3G1UA 5T67A 1WP4A 2AG5A 3RC1A 4DBVO 4BO4A 1R16A 1J4AA 4I8XA 3BHIA 4XA8A 2G1UA 4XYEA 2Q1TA 2ZCUA 3MWEB 4E5NA 1ADCA 5CDYA 2BELA 2NM0A 3HB5X 1EBFA 3NDJA 4D0SA 5G4KA 2GN9A 3K8ZA 1UZLA 1ENZA 2C59A 2CSUA 2WMDA 3KB6A 3NV9A 4L0QA 5CPBA 1EUDB 4HFMA 3KTDA 5B37A 2W2LD 3B70A 4JBIA 3RUEA 3F46A 4IJWA 1GU7A 3A4VA 2ZJ0A 1LDNA 3D64A 4OYRA 4BGUA 4R1TA 4R3NA 1XR3A 1GYQA 4C4OA 1A4UA 1BGVA 1ZSNA 2WJPA 3CE6A 4AJOA 3B1KA 1Z7EA 4CLHA 2DTDA 2YY7A 2I76A 3E18A 4A73A 1O8CA 3TPCA 4A2CA 4JN6B 2NU7A 3WGZA 1HE3A 1V3VA 1FF9A 2E4AA 3RUIA 2QZ9A 1EVJA 1D1TA 4AL4A 5ENVA 5L95A 3QVOA 3VPSA 4NI5A 5L9AA 4J7XA 3PHJA 2FPPB 1H2HA 1KERA 4BNHA 3WR5A 3AM3A 4L76A 2RIRA 1I32A 1N9GA 5HS4A 2SCUB 2JHGA 1VJTA 4H15A 4KMSA 4PLTA 4BO2A 5TLSA 4B3HA 1Y8RB 4QO8A 1E3LA 5F3RA 4BMSA 4Q3AA 2Y93A 3ZNNA 5JC8A 3M1AA 3ENKA 3IAHA 3ROPA 4YB8A 2PR2A 2UV8A 1EZ4A 1EVZA 1U8FO 3DZGA 4WCFB 1SZJG 3X2EA 3CH6A 2CDBA 1RYEA 3BHMA 5JCXA 1MC4A 4ZD6A 3EAGA 2IXAA 3OMLA 4Z0PA 4Y98A 5DP1A 1YBVA 2VZ0A 2DVMA 3MJTA 3BHJA 2UVDA 3EHEA 5IDYA 3F5SA 3FWZA 3DB2A 1ZCJA 3DOJA 4RGBA 1XG5A 4TKLA 3SC4A 2Q1SA 2BFMA 2O48X 4GX2A 2ZTUA 4Y6PA 3VTFA 2VRBA 1M6WA 3EVNA 2UUOA 2RBEA 1GUZA 2H6EA 3LSYA 4YAKA 1DRUA 4B3JA 4DL9A 1P0CA 1XA0A 1SPXA 1DLIA 1P1RA 2FMUA 1SB8A 4E12A 2J3HA 4RLHA 5IXSA 2YJZA 5L3ZA 3V1YA 3U49A 2OORA 2Z95A 1AGNA 4XJTA 4Y9DA 4WLEA 4WLFA 5CDUA 4PFJA 2CD9A 4U6QA 1LNQA 3ASVA 1UH5A 5IDXA 1EEHA 1PJ4A 1KC3A 1OZAA 1UP6A 1ZK4A 3JTMA 4NNJA 3JD4A 1SO8A 5EIOA 4BV9A 4OHUA 1ISHA 5JCJD 2VHVA 3IL2A 3O26A 4OOFA 2XOXA 1RM4A 1QORA 5DCUA 2B4QA 3S55A 3WG9A 4BGIA 3AI3A 1HWYA 2W4QA 3OJOA 3H3FA 3KSDO 1ISFA 3RFTA 3H6KA 1CQJA 3BZUA 3R6DA 3A06A 5T8KA 1HE2A 2VRCD 4DIBA 4IJUA 4Y6SA 2E82A 2YHUA 3A28A 1GYPA 1R0KA 4MVJF 1DO8A 1RM3A 4AG3A 3P2YA 1UDCA 4OSOA 5I8ZA 3VOSA 1QYDA 2O3RA 4XYBA 4CM8B 4ND4A 3VKVA 1O6ZA 3NAQA 4EUFA 2YYYA 3D7LA 4QEDA 3LF2A 4AJEA 1F8FA 3GLQA 5CFZA 2FSSA 1PQUA 4IBOA 3C7CB 4GGOA 4E21A 3ZWPA 1RM5A 1PJQA 4J90A 4DBZA 2EIHA 4JJIA 3MJSA 4R9SA 1U3VA 4B4WA 1UXGA 1O0SA 1JKJA 3JYLA 2PZKA 1XQ6A 3LU1A 4I5DA 3V1UA 2ZQYA 4E2XA 1F12A 3C1TA 3B1FA 2X5OA 1IZ0A 2BLLA 3NTOA 4F6LA 2BGKA 4BO9A 3WTBA 2EKQA 5KTKA 2FP4A 2C2XA 3HWRA 1NVMB 2J5QA 4GWKA 2YDXA 1NTOA 4J91A 4LW8A 2J8ZA 4MVJP 4D0RA 2AQHA 5I7FA 2EEZA 3OJ0A 3GUYA 3DMTA 1X14A 2WD7A 3JQ7A 1IZ9A 2G5CA 1PS0A 2JJYA 4A26A 1GFSA 1P1FA 1PGJA 3GUCA 4P22A 1Z45A 3IUPA 3F1LA 1NQOA 1YBMA 4R9RA 3ZV5A 4IS3A 1UXKA 2FZEA 1XCBA 4JBHA 3D3WA 4BGEA 4YRBA 4PZDA 5B4VA 3LLVA 3QVXA 3F3SA 1WDLA 2HMWA 3H4VA 5ER9A 3TDKA 1IPFA 1QRRA 1JVSA 1XHLA 3PDJA 1T1SA 3KZVA 4K1LA 2B69A 4BNTA 2G17A 3TZQA 1ZW1A 1NWCA 2VHZA 3EY4A 5KJEA 5BSHA 4RPLA 1BMDA 1PSDA 3PEFA 1IHXA 1PZFA 4BNXA 5JDCA 1NR1A 3DHYA 1ULUA 1LA2A 3WMWA 3LF1A 4YQZA 5C37A 4DLBA 2FPGB 4Z9FA 5BQFA 2AE1A 4I9HA 1P45A 3AUTA 3W1VA 2O23A 2XXBA 4UVHA 2Q4BA 2P4HX 2ZCVA 4EEXA 1HSZA 1VJ1A 2PLAA 2RAFA 3ZWBA 1IPEA 1Z82A 2ET6A 4PIVA 5EPOA 5BSEA 3EW7A 1J0XO 3NEPX 3MJVA 2I65A 2GERA 4LK3A 4FSHA 4R4JA 1G0NA 3I6QA 2EF1A 1IOLA 1VKOA 6LDHA 3JQ6A 3WIDA 4OKIA 4II3A 2ZB4A 5L7YA 1I01A 3VH1A 3PP8A 1EE2A 4TMFA 4E2ZA 1LSSA 3ZWVA 3AFMA 3ZWCA 3C3XA 3FD8A 3WOHA 4YJGA 5IZCC 3NJ8A 2IRWA 1LX6A 1TLTA 3PDUA 1EBUA 2R00C 3WWZA 3AOEA 5C7IO 3AI1A 4W99A 1PQWA 3JSAA 4BNFA 4O59O 4RVHA 1DFGA 4MVJM 3DZJA 4KQWA 2TMGA 1P1HA 2D0IA 4TROA 1K89A 2P9GA 3IP1A 4WCDA 4IJVA 5IFLA 4RO0A 2O3UA 3GR6A 1U3WA 1XGKA 2PA3A 3CMCO 3JYNA 5B1YA 1BSVA 3HB4X 4MVJE 4J4HA 2PGDA 1NVTA 1PR3A 4ZQHA 1LSJA 4QSMA 1ZJZA 1B16A 4I08A 2X8LA 1VRWA 3DZKA 4IZIA 5GY7A 1NFFA 1DRVA 2OO5A 3AY6A 4U8GA 5JAIA 1MUUA 1CEQA 3FBTA 2PGJA 1XQ1A 3H2SA 3Q9NA 4M49A 1MX3A 2WDZA 3BTVA 3VZPA 3R3JA 5IAAA 4CMIA 2P9EA 4J1QA 1HYGA 4RVDA 5KJFA 2OGUA 1R0LA 1GDHA 3R3SA 2GCGA 5FFFA 3LYLA 4CM6A 3MZ0A 3SC6A 5EJ2A 3C8MA 2X6TA 4LMRA 4QFDA 1B7GO 1DDOA 4GI2A 3E8XA 4WUVA 2BHLA 4YR9A 3EK2A 2G76A 4JJGA 4RL6A 5K6AC 3WYCA 3I4FA 3GFGA 4CQLB 5ICMA 1PX0A 3GRPA 5F5LA 4RVFA 3ZWAA 1HTBA 2W2KA 2YHIA 2Q2VA 5CG2A 1BWSA 1ISMA 4YJFA 2GF2A 4AVYA 1BW9B 5A06A 1ZEMA 3TOXA 4CV0A 4GKVA 4B4OA 5CEJA 4D3FA 2W8ZA 1E7YA 3GGOA 2PTGA 4L75A 2ZYGA 2HJRA 4M87A 4FOOA 5G0WA 3I9JA 3QWFA 1ML3A 4W6ZA 4GLLA 5DBGA 3U3XA 1E92A 2DBQA 2VYVD 1FDSA 1I3NA 1K3TA 4OL9A 4XB1A 4K26A 1MG5A 1PJLA 3NX4A 4G5HA 3NYWA 4AJPA 2EGHA 4I5FA 4WEOA 1ADBA 1NYTA 4CLEA 3WJAA 4PVCA 1Y5RA 4MP8A 4B79A 1CIVA 4NFHA 4YCAA 3ZWOA 2FHSA 4D7AA 9LDBA 1OI7A 1GYRA 1BXKA 4Q3EA 1EQ2A 5JE8A 2B4TO 4ZQBA 3UVEA 1Y81A 4BNLA 4RQTA 1JA9A 4HX5A 3DQPA 5G4LA 1NNUA 3R0IA 4BKRA 2H1SA 5COBA 4OXNA 1W73A 4BNNA 1C0PA 2IZ1A 4Q3NA 3JCZA 4II2A 4OM8A 3BTUA 1X1TA 2C29D 4IPTA 3PI7A 5DCWA 1KEPA 2YZ7A 4CMCA 2WWRA 1CDOA 4RDIA 3DBHB 2P4QA 4NU6A 4NBUA 5CHEA 1IB6A 3PFFA 2BKAA 1LTHR 1LXCA 2VZ9A 3CEAA 3ZNOA 3H65A 3H7AA 3VPXA 2TMDA 3CINA 3L6EA 1Q0LA 4ALNA 2EHDA 3GY0A 1Q1NA 2JCVA 4R54A 1LDBA 1KIFA 1NPTO 2F00A 2Q1WA 1PWZA 1DC5A 4YAGA 1B3RA 3OQ1A 3DZIA 3I9MA 5CPFA 3G79A 1G6KA 3LC1O 4AJ1A 2POQX 5F1PA 2GZ2A 4BNGA 2LDXA 3GGGA 4GMFA 2X9VA 4YYZA 3JQAA 5KWEA 1EMDA 2NQTA 3BMNB 2BF7A 2Y1CA 3C7DB 4EDFA 3E82A 4EW6A 3D3EA 3QRWA 3TL2A 2YUTA 3HQ4O 4OJNA 2DC1A 4CPDA 4NG5A 4E0BA 4UULA 7ADHA 1ZIDA 3QVSA 4EJ0A 4X54A 1H6BA 4I9NA 1NWHA 3D1LA 1KVUA 5BSFA 1MGOA 1EFKA 3WQRA 2J5KA 4LVCA 4R01A 1PJTA 1GV1A 1LBEA 1YXMA 2WE7A 4ZHSA 3PJDA 2VTDA 2GLXA 3COSA 1Q7CA 4ROSA 5CG1A 4FBGA 4DPMA 3JQBA 3FTNA 3RI3A 1PJBA 2CFCA 3K92A 4MVJH 5DBFA 4CUKA 3L0DA 1JKIA 1EE9A 1YB5A 3L9XA 4UUNA 2AQIA 3F4LA 4MIOA 5IF3A 3WGTA 1AE1A 3DOOA 4J2HA 3H3JA 4GMGA 4OSPA 4JIGA 4XR9A 1RM0A 3RIHA 1GV0A 1NXQA 4FJ0A 2DFDA 4HKTA 1GZ3A 1ZMTA 4WECA 4BNKA 3AY3A 4WLOA 3R1IA 4GX0A 3S2GA 3ZDFA 1OFGA 4E33A 4N5LA 5A02A 3KOUA 2AEFA 4WLUA 1D4FA 5JY1A 1YL7A 4PLYA 1PU2A 3P5SA 1ZK3A 3BTOA 2YV3A 4YRDA 1OMOA 3NTQA 1JTVA 2QQ5A 2PH5A 1OOEA 2JCYA 4UUOA 2EW8A 4ZRNA 3KM0A 4YWJA 1PQPA 4E5MA 5IDQA 5ES3A 1IUKA 4M8SA 2Y1DA 4OGWA 4PG4A 5JO0A 1XIVA 4BO1A 5T8KC 2P9CA 1MC5A 4CR6A 3GZNB 3QQPA 1U5AA 2DUUA 4EEZA 4E5PA 3IUSA 4HV4A 3H5RA 5LDHA 1DSSG 2VNSA 1B8UA 1V9LA 4J7UA 3U62A 4ONEA 2O2SA 1V3TA 3FPCA 5THQA 3I1JA 1WZEA 4U6SA 4FOSA 5I8WA 3K5PA 4CMJA 4LISA 3ICPA 4EGFA 4RORA 3AY7A 4OH1A 1Q0QA 5HA5A 2UAGA 4IDBA 3KEQA 4BO8A 5AQ1A 2Q50A 1UDBA 4PG7A 3D5TA 4YT5A 4L4SA 4D3DA 4A5OA 1DC6A 4BO7A 2O7QA 1PR9A 3PQEA 3WICA 2C20A 4CM5A 1O95A 5COAA 3ITKA 3KVOA 4PLFA 2HAEA 3V2UA 2NVUA 1YWGO 2X5KO 4MVJI 1SCUA 1Z73A 3BMQA 4PVDA 1DEHA 5C7OO 1GEEA 2AQKA 1DHRA 1DBVO 1M6HA 4MO2A 3PYMA 2PWZA 3DMTC 5L51A 1ZMOA 5HBRA 2I5PO 4J0FA 1KEUA 4H7PA 1C0IA 2LDBA 4R5HA 3FNEA 4M55A 2AEJA 3MTJA 3E48A 4ID9A 1F06A 4I1IA 5FI5A 4BMNA 1GZ6A 1N7GA 3QWBA 5IXYA 1YE3A 2X0RA 1ISJA 1NBOA 3MEQA 4AJNA 1EFLA 3WNQA 5L40A 4Q39A 2ZTMA 1HDCA 1DIHA 1VKNA 3JD3A 4G65A 1HKUA 4GX5A 3JQEA 1F17A 3V1TC 1DAOA 2QRKA 3RROA 3TRIA 2C5EA 3BMCB 3ZWMA 2VQ3A 3N7UA 1A9YA 2X58A 4KWHA 1DJQA 1X7GA 4OQZA 5TGDA 5JDCC 1WDKA 4ZJUA 1X7DA 4DVJA 4BNJA 1Y1PA 2P5YA 3BIOA 4YJHB 2C7GA 3IS3A 4TZTA 4OAQA 5EMHA 3AM5A 4RVSA 3BAZA 4HXYA 1J49A 1UZNA 3B20A 3ZH2A 4G2NA 1QR6A 2OXIA 2V7PA 1P33A 4EJMA 1EUCB 4N54A 3OETA 4RZIA 2QYTA 4PRLA 3T4XA 4FDAA 3VTZA 1NFQA 2I6TA 3HN7A 4MVJA 3JQCA 4YTEA 5KIAA 2BFOA 4RJTA 1JQBA 4IIVA 3KSZO 3UOGA 2DT5A 3LK7A 1GQQA 1GCOA 1M75A 3FRJA 3VKUA 4AJHA 2O3TA 3QW2A 2HU2A 2VWQA 4XWYA 3UXYA 4NR0A 5HRUA 1YOVA 5U1PA 1YB1A 5AXAA 1P1JA 1I3MA 3NT2A 4FIZA 3JQDA 3O4RA 1A5ZA 2BI8A 1XELA 1I2ZA 3AOEC 3KSUA 1QYXA 1XU9A 1C1DA 3IQDB 5F21A 2FPIA 1T2CA 2QHXA 3WDSA 3ETGA 1EUZA 1VPDA 2Y1FA 4JX8A 2VHYA 4D43A 3G49A 5AXCA 1P9LA 4WLNA 3ICCA 4J16A 2P5UA 4QT0A 3DMYA 3MWDB 1RYDA 5I7EA 3ZHXA 4Y6RA 2UDPA 3H2ZA 1WLYA 4XQCA 4IGFA 4A03A 4B7UA 3RASA 2NU6A 1C0LA 4CL3A 1LLUA 3ZWXA 4CM4B 3OH8A 2HUNA 2WE8A 3FNFA 4BMVA 2GN6A 1BXGB 4FFOA 4E31A 4RZHA 2B0JA 4XR4A 3LQFA 1T2FA 5A05A 4AFNA 1ZBQA 4IMRA 1LLDA 4UEJA 4DYVA 4FFMA 1MG0A 3AK4A 3K2BA 3ZU3A 1HDGO 5HM8A 4CUZA 3P7MA 5A9RA 3NT5A 3GFBA 3GRKA 3OQBA 4K6FA 4CV3A 3AUUA 5BNTA 1F0YA 4NBVA 3TZKA 3W4KA 3WGHA 1LC0A 1ARZA 4JP2A 4CQMB 1Q7GA 1HZJA 4CR8A 2GPTA 3OF2A 4TKMA 2H5LA 2G0TA 3ZWNA 1NHWA 4CR7A 3CUKA 3ZCXA 4UUPA 1YGYA 3MOGA 1HE5A 2JFGA 1UP7A 5ENDA 3RU9A 4WEQA 1LRLA 2Y0CA 5TSDA 3I23A 2AHRA 4YAJA 2BI7A 1DC4A 2OBYA 4BB5A 5A03A 1Z75A 2DBZA 3AFNA 1JWBB 3UH1A 1U4OA 3UN1A 1ZEJA 3UGKA 9LDTA 4HUJA 4MINA 3RSHA 3UF0A 3VAZA 1KYQA 4Y67A 3DWFA 3PJGA 1E77A 1KETA 4IIUA 5FYDA 1CERA 4DTIA 4XX0B 3FR7A 3LC2O 3IKVA 3RVDA 5JSFA 4PLZA 2YQ5A 3W4JA 4KUGA 4WGGA 4CJXA 3TWOA 2Z1MA 1H6CA 5BNFA 3WGGA 1RPNA 1R4MA 4FC6A 4I5EA 3ASUA 3KYCB 1N2SA 4CV2A 3UHAA 3U09A 4G81A 1U1IA 3W4IA 4CLOA 4HADA 5JYDA 1AXEA 4A0SA 4ILKA 4OMUA 5B12A 2HJSA 2FR1A 1YL5A 1I2CA 1PGOA 1SAYA 2HRBA 3JQGA 5TJ9A 1LUAA 4UVDA 1OBFO 2X86A 1A9ZA 3WGYA 1FXSA 4BNWA 4CODB 4CM9A 4F46A 4OKNA 1DC3A 4NHEA 1MXFA 3WGIA 2YQ4A 1CWUA 4W9NA 1G0OA 4RV9A 3HDYA 1E6EA 1ZH8A 3EC7A 5CEFA 3HHPA 2Y66A 2Y1GA 4TSKA 1QV6A 2D2IA 2A94A 2A92A 2RCYA 1K6XA 4K9DA 2NUAB 1YQDA 5L7WA 3JYPA 2DKNA 2OHXA 3ROKA 3C1AA 3QVWA 1VJ0A 1V0JA 1JAYA 5IDWA 2ILTA 4Z3DA 1H94A 2Q3EA 3CTMA 2V6FA 1HETA 3JQFA 4TWRA 1E3WB 1TT7A 4ZQFA 1N8KA 3NGXA 1LSUA 4XD2A 5CAEA 2UYYA 3GA0A 1P3DA 1YDEA 4O6VA 4YEDA 2C54A 3OEWA 2VWGA 1DLJA 1UXHA 3ZU2A 3K9QO 5FWNA 1I3KA 5JYEA 3EZYA 1DIBA 3OA0A 4XYMA 1T24A 2VWPA 1AUPA 3PXXA 4MIEA 1HL3A 2EKPA 3SXPA 1E7SA 3NRCA 4NBTA 1LSOA 4JBGA 2IYPA 4UVEA 4R1SA 3HFGA 3WBFA 3NTRA 4XGKA 2VYNA 1TT5B 3QWIA 5KKAA 4DPLA 4NU5A 1LJ8A 4YJDA 5JAMA 3GZ4A 1K6IA 3KO8A 2DBRA 3Q0EA 4NH4A 4DQUA 1O94A 1A71A 1OAAA 4LRSB 5TS3A 1SNYA 3GEMA 3Q2KA 3VZQA 4AJJA 1N1GA 2X9NA 4MOWA 1HXHA 3JQBC 5TX7A 5C5IA 4HY3A 3JYQA 4QECA 1E5LA 3ZW8A 4PG8A 4M54A 4ALIA 4BIIA 2FN7A 4ALLA 2OUIA 4Q3DA 5I7VA 3TZ6A 1SOWA 2E6UX 3ZHYA 1QV7A 4GPD1 4NZ9A 1Y7TA 3LT4A 1UXIA 3H8VA 4KDEA 1YL6A 5A9SA 2JD1A 2VNAA 1V3UA 2CF5A 1OC2A 4Z3KA 5FEUA 3EUWA 2BH9A 1ENYA 1E3JA 1T2DA 2X23A 4WASA 4BO6A 3UCEA 4BGVA 3VHRA 4IS2A 3TFQA 2EERA 5AYVA 4EUEA 1JW9B 2DQ4A 5ILGA 2JFFA 4AJIA 3GEDA 3NKLA 4GWGA 1HF3A 1UR5A 2W98A 3E9MA 3P2OA 1V8BA 1RJWA 2NU7B 5THKA 4JK3A 3RJ9A 2BD0A 4FJ2A 1YBAA 2NVBA 4MKZA 3L9WA 1CQIA 2P68A 4XQEA 4CMBA 4BQRA 3WS7A 2EW2A 3HNPA 4UEKA 4GSLA 4S1VA 3OJEA 5T6BA 1PGQA 2PZJA 4J9UE 3KYDA 1I36A 5TC4A 4ITUA 1PL8A 2HQ1A 5GZ3A 1ZZEA 1H9BA 4JCOA 2O3JA 1N9GB 4ZQGA 3ZGYA 4CM7A 3NDIA 1P77A 2NQ8A 5BNIA 2AW5A 4J1NA 4HFJA 1X15A 5GZ6A 3UFXA 3JD1A 4KTTE 3A9WA 3OEYA 4J1SA 3RBXA 4PLGA 2YV2A 3M1LA 3NGLA 1HDOA 3WLFA 3ADOA 5GZ1A 3FSRA 2Q1UA 4DQVA 3ZHZA 4D45A 3OSUA 3N58A 4GVLA 4L8VA 4NMHA 3INTA 3TQHA 3GMSA 4OQYA 3X2FA 1T4BA 1B26A 1NAHA 2QG4A 3ZWWA 4XZ3A 5G0SA 1Z7BA 1LI4A 1RWBA 1X0VA 2C07A 3PZBA 3VDRA 2NSDA 2ZYDA 1DPGA 4YXFA 2QRJA 1M67A 4RF4A 3K30A 5CDGA 3PTZA 5I9MA 4LMPA 5KJCA 3JQ9A 5DULA 1QYWA 3RCBA 5A3JA 4N18A 3DBRA 3GDFA 1IY8A 3WSVA 4RF2A 3ZZNA 1CYDA 1ZK2A 4YBZA 5LCXA 4UAGA 3F47A 1ADGA 3RFXA 1NQAO 3HDQA 2WD8A 1IL0A 5A3VA 1HDXA 1WNTA 1EDOA 2X0JA 3DONA 3PWKA 4JNKA 4F6CA 3DBLB 4XQ9A 3GH3A 4Z9XA 3D4PA 1Q2XA 3SJUA 3HZZA 3VZSA 1E3EA 2X4GA 1SB9A 2A4KA 4WJZA 4K28A 4Z9YA 3KV3O 3JQ8A 4DPKA 1V6AA 1TB4A 3D4OA 2DM6A 1ISIA 1UP4A 2NTJA 1BDBA 1PZEA 4JQCA 3WBBA 2ZB8A 4PRKA 4BVAA 1C1XA 1WAMA 3QE3A 3CPSA 1DIAA 7MDHA 1GUFA 1I33A 3CKYA 1WMAA 1OC4A 2NTNA 3PZRA 1UDAA 3RUCA 3F6YA 2O50A 3ONFA 1A7AA 1I0ZA 3PHHA 3TOZA 2NACA 4EYEA 4E5YA 4IGEA 4P4GA 4QO7A 4YA6A 2NWQA 1EDZA 2NNLD 2Q49A 2B4RO 1N7HA 2JD0A 4DIOA 1F8GA 2I99A 3FNGA 5KCZA 4F3YA 3Q1LA 3HJAA 3JQAD 1NQ5A
chains in the Genus database with same CATH superfamily
3HLYA 5K8JB 1ENPA 2CMDA 1Y4SA 3SLKA 1JQJC 1U7HA 1XMPA 2COKA 3IMFA 3K6JA 1H2EA 2ZOSA 1BCSA 3PDWA 5FTNA 3RM3A 3QKSB 4IDQA 5BYBA 2JK0A 3RFUA 4D2IA 4KIUA 3ZDDA 2I6SA 2W93A 1XDWA 1XPUA 2C1XA 3O8LA 1NNSA 1KIAA 3GPIA 3CCFA 4LHYA 1KC1A 1NVVR 4F9FA 1HPLA 4UDYX 2HPHA 3JWGA 1F2DA 4W1PA 4XGNA 2F1KA 2H2DA 3ANLA 4YECA 5LDGA 3LOPA 3FLBA 5CITA 1DO0A 1J2RA 1TIBA 4NFLA 4NARA 2QOEA 2M6KA 4J16C 1RABA 1UT8A 1KVRA 3H4TA 5E6UB 3SFTA 4RHUA 1EK5A 3UXMA 4C7JA 4D9CA 1LF0A 1M2EA 1Z62A 5EJGA 2ZUSA 3KAQA 4J1TA 4TS3A 2J9FB 3SZLA 1M1ZA 1NURA 1TMGE 5D3MB 3F4BA 2QTCA 1QO7A 3K9BA 3O6VA 1BA3A 1YCFA 5CT9A 2DQKA 1LLQA 2W6JA 3GK3A 4J2OA 2HDWA 2PYDA 3ODPA 4QRIA 5CLLA 3LS2A 2AW3A 4L15A 1P7PA 1OA1A 3ROGA 1T25A 3RSFA 3GYBA 3D2LA 3W05A 1GTG1 3TNJA 4BOYA 3TN7A 4GR4A 1D1SA 2Q5OA 2AOWA 1KY5A 4OB6A 4UM7A 2OT3B 5HEKA 5K0SA 1WUYA 2XTZA 3D3WB 5EIXA 3K09C 4WZBA 1N25A 2V6BA 1ZCZA 2GZ3A 1GHTA 1NG9A 1AV7A 3MXTA 3U56A 3USZA 3IOCA 2GUGA 1XMIA 1GJRA 2PRIA 3ICWA 5FOVA 1XVTA 1HQCA 3HFJA 5AIBA 1JYFA 2J3KA 3AERA 4LE1A 3H99A 4F84A 5JAUA 2IE0A 1TC2A 1XLUA 3QOWA 1SZDA 2WA1A 4RLSA 3UCXA 3OU7A 3K2IA 1KU6A 2BISA 1KAMA 2X1VA 3CIFA 2C61A 3M81A 1WVGA 3U4DA 3TZEA 2Z4TA 3NUQA 3IIKA 3T41A 4TV8F 3KKNA 4HDCA 2BGUA 4QFMA 4LNUA 1M66A 4LCBA 5AKXA 4FX2A 3ZY4A 3UENA 1PV2A 2G07A 4ZYLA 1I0LA 5E0KB 3KLMX 1EVLA 3LZ6A 3ICVA 5I7RA 1MFPA 3JD2A 5E2IA 1CJUC 4US2R 2HA5A 1MJGM 3MMNA 5HXAA 4Q4HB 1B15A 1YRAA 1G20B 2CW5A 1Y5IA 4B31A 3OD1A 4DBLE 4FMDB 4TT3D 5NULA 3LDGA 1AZSC 3QFTA 2Q46A 1XRQA 3Q9SA 4G5GA 2EBUA 5C34B 2PY6A 3KE8A 3OY2A 5EXTA 3OBBA 2GCNA 2NU8B 3HI4A 4FHEA 2OOSA 3MCAA 1Y5NA 1WU8A 4B2PA 3FSJX 3IP8A 2A0WA 1XCJA 4Z1MD 1WQ4A 5A04A 2PNFA 3A1CA 1DFHA 4L07A 4B3RB 1U0HC 2I3ZA 4GUAA 3IRVA 1J39A 3VSCA 4D42A 1NRXA 2DLDA 5BVHB 1T1IA 5JZVA 1KO8A 3DCYA 3K94A 3DL0A 5DN9A 3LHSA 2HHAA 4MCHA 4YJGB 4EKGA 1LQUA 1QG2A 4PG5A 1VMKA 1U2ZA 4L0MA 4UDOA 1XI2A 1KJWA 4UW9A 4IX9A 2ZKIA 2P4SA 2RH5A 3VAAA 4QQRA 1I3LA 1LDGA 5JO9A 2CXTA 1SOMA 5L45A 2CSXA 5IT5A 1GNLA 3SMVA 1HNZB 1JT2A 4QTYA 2EKLA 5K1ZA 3F90A 4OQMA 5D87A 1XTVA 1M6NA 1NA5A 1VYUA 3AH8A 3LWBA 4G1FA 2OMKA 3WB9A 4RPGA 1ZKDA 3R2JA 1KL7A 2I4RA 2O6HA 2UVPA 4WZZA 1IC6A 4D9FA 1BC5A 1B0PA 1YR9A 2PRJA 3D2AA 1R4AA 2HD4A 3NAMA 3GJRA 4FTWA 2ZUBA 3COYA 3KKPA 1FDVA 3M9WA 4X6XA 9GPBA 3CZMA 1JDPA 4PC6A 1PNOA 5CGQB 3W8RA 4G9GA 1VPEA 1XTBA 3I2GA 3G5UA 3OURA 5A2GA 2PVCA 1AHIA 1VPVA 3UGTA 1SPBS 4LCEA 1IIBA 4FYJA 5IJ9B 3IOMA 3LUPA 1F51E 2BMAA 3KB2A 1R88A 4JIMA 4Y1RB 3V7WA 4CCWA 1ZNYA 1LH0A 1REQB 2P8SA 3U60B 3FNHA 2C0CA 4I99A 4X6YA 3W2GA 4CMIB 3U3MA 1H1LB 3Q5EA 2C8LA 1ZVVA 3EZGA 5CTAA 2FUKA 3TLBA 4YPFA 1LF5A 2L69A 3GJ0A 4YMVA 1GAQA 1LNZA 1CRWG 2PMEA 2GS9A 4P82A 2C94A 2K7FA 2E4WA 4YUWA 3E6AA 3LPDA 4JI4B 3OCZA 1R5BA 4GDFA 3WLHA 1JMYA 4E7PA 4W9RA 3Q10A 2JD2A 3PKJA 3WV5A 3H2BA 2OCGA 3QE4A 2EGGA 1YQUA 2ZUVA 3NEAA 5DHUA 1L8XA 3ZIAA 4IO1A 5JVDB 2BBSA 2IDZA 3E3NA 1CJVC 1JKXA 1X80A 3KTAB 3DE4X 1NUTA 1ORIA 1OXSC 3LX6A 3SFZA 3E70C 1W36C 3NW9A 1F6WA 1MX9A 5E6SB 4XEHA 5FNVB 2H5IA 3A70A 1YR8A 5DU2A 4IDFA 2DU8A 3M7IA 4U3JA 1QUEA 2GESA 5HG0A 3ND5A 3WNCA 3LI2A 3MWLA 4KO2S 5B7QA 1YZLA 4CM8A 5ITVA 3G0OA 3TRFA 3ZJUA 2XT6A 1GDDA 3FI9A 1TO6A 5IABA 4C7MA 1U3UA 1F6DA 1SRRA 3TTWA 4FCWA 3V6LA 4G5YA 5B7PA 1AXRA 3KZXA 4KWCA 4XPIA 4NZMA 1GCAA 4RE5A 2DERA 1C8BA 3N70A 4PFKA 1G5RA 1I2BA 5JNLA 3V3KA 2DAPA 3EGOA 4R5MA 5JR3A 5B53A 1P80A 3WAJA 4HWKA 5K0NA 2QRLA 1PQ4A 3KPWA 3PIDA 4M98A 4CRWB 5K8CA 4X00A 4EZIA 3I1FA 2EFHB 3K1YA 1JSZA 4ZAFA 5KO2A 3KAPA 1GGEA 3L8GA 1AKTA 2EG5A 3Q6NA 3RNLA 4FLMA 3KWMA 4ZHQF 3DAFA 1VE1A 1E7WA 4QGGA 3GDWA 3QWAA 3HG7A 4I3GA 4UTPA 5JBNA 1A8QA 13PKA 1CULC 2J9YB 4Y2RA 5T4EA 3YASA 4A8JC 4XIYA 4MDHA 2XZPA 3H5AA 3BWMA 4FHCA 4H9GA 2HDHA 4E51A 3UPTA 4TYPA 3H11B 4M9RA 3L7DA 3LY7A 2IYTA 2GEVA 5BSKA 3A1UA 3KLPX 3A1VA 3HADA 4GOOD 4URYR 5J2TB 3U2QA 4H08A 3F7OA 4GOMD 4KO4S 2C4WA 4U2EA 5G40A 5BO5A 1V1MA 3VR0A 3QOYA 4MQMA 4C76A 5I51A 3ESQA 2CMGA 1DAMA 3QMWA 1FYEA 1D8TA 1GQ2A 1W0CA 2LUOA 3BJEA 1NBHA 1NVVQ 4BO0A 4KLAA 2ILVA 2Q5EA 4RV4A 3SEAA 1GTL1 2VUSA 4MV3A 3GJ3A 1YZTA 3U4HA 4UUAA 3FZGA 1J42A 2CNDA 3U5TA 4QXAA 1D6NA 1T2EA 3WE7A 4XFKA 2Y9PB 2OENG 2OGZA 2HBYA 5E7JA 1CSEE 5J4KA 3WVNA 5BW6B 3VQTA 2FZLA 1P17A 2O8DA 5C2JB 4C0WA 2WUDA 3F6EX 5I4IA 4DV4B 4LHVA 1N34B 4O4IB 1H6AA 1YJ8A 2SHKA 3CMMA 1GN8A 1TGVA 1RXSA 1BQ4A 3DE0X 4LRTB 1K6JA 2Z08A 1T36B 3A58B 4ZO4A 5BOVA 2WHXA 1VPWA 4P5PA 1MZVA 4RTNA 1CVIA 1VQ1A 1VG9B 4KP7A 4R2KA 5KTPA 1YQTA 4IIFA 2WFAA 4P38A 1FNNA 1MU0A 1QLWA 1TM2A 2HSZA 3N2GA 3T5MA 2CYAA 3M70A 5MFZA 2CUKA 4F4IA 1X42A 5A5FA 1YB4A 3RAPR 2NP7A 3PVCA 2D74A 3GAAA 4PCVA 3WGUA 4DMCA 1E7RA 2W0MA 3Q3IA 1U2GA 1M5RA 3ZW7A 4PLVA 1W2GA 2PJDA 4PO9A 2XA9A 2YXDA 1YZHA 2XX3A 3DYBA 4RE6A 4B81A 4W8HA 3WFIA 1AM4D 1NASA 4EY3A 3ZD6A 1PUIA 5E7MA 3GT4A 2JAOA 4LHWA 2GWHA 3G9UA 2J0UA 1CETA 3NKFA 3JALB 3ILVA 1QS0A 1U7OA 3ZXXA 1HYBA 2QSZA 3JQ9C 4IJQA 4U7WA 4IRUB 4WKNA 1PWXA 4DNFA 2VDPB 2ZQ5A 4LHZA 4PN3A 5CB6A 4UU0A 2BC9A 4MJXA 3WJ2A 6Q21A 1XLTA 2Y1KA 1HE4A 3IT1A 1QRAA 1IULA 4R84A 2XKKA 2O54A 1EUYA 2FI1A 3K4HA 3WK5A 1T6XA 4AP5A 5E4YA 4D57A 1CUWA 1G1AA 1BRMA 4HMOA 5C52B 3AW9A 4M76B 3JYOA 2ZGVA 4I4TA 2EXXA 3C3BA 5DNVA 4KPFC 3RSSA 3PLRA 4B0PA 5ITZA 1WB9A 2G88A 2WIBA 1DG9A 5JXIA 2B4YA 1PFKA 3IDZA 1AHHA 4DLTA 1ZDMA 3E9YA 1QK3A 1VBFA 5K3CA 1IUNA 4DMHA 1A50B 3ME5A 4WBXC 1A4XA 1JHXA 2XYVA 3I09A 4PC1A 1EXDA 2FPSA 2CL6X 1LI7A 1E7MA 1YZVA 4FW8A 2RB4A 4UE2A 3N5CA 3Q11A 4IQ8A 5CEEA 1NONA 1G1MA 3VNBA 1EJBA 2CKDA 3IBSA 4LRWA 4C7BA 5GIPE 5ALHA 5C46F 1OXUA 2VHWA 5D6NA 3PL5A 3V2HA 4WKCA 2OHHA 3BWXA 2O07A 4U02A 4CTOA 3T5BA 5CCEA 1CV2A 5BUQA 1JA0A 1GQYA 1VI6A 5LD2C 3IR5A 4LXQA 3NNDA 1PV4A 1HZZA 2WIAA 4IZ6A 2EJVA 3CPEA 5DWQA 1HYHA 3H8SA 4PTLA 2V6IA 5TQJA 1H0KA 4R6WA 5LJIA 2CHGA 5M04A 3E4CA 5BT9A 3C0KA 4NYJR 2W90A 2DH5A 3A8TA 2J48A 3PHLA 1E59A 1NATA 2NYVA 4L9RA 2VDNB 3TI7A 3UW1A 4AD8A 4F3NA 1GSHA 1USIA 1N1EA 4WNIA 5KNCA 4UZSA 4URVR 2GYYA 3I73A 3ZWKA 3G2NA 3TIFA 4DSZA 4EITA 1T6ZA 4F04A 4QPJC 3B3FA 3KPYA 1ZZGA 2PZLA 3BRWA 2J5RA 2VYND 5EHNA 2ZXEA 4WADA 1DOAA 1U28C 1UWKA 4NNPA 4Q4JA 4RK4A 1NR7A 3UFBA 5K4GA 2VCYA 2PKRA 1Z2AA 2O2YA 3C3CA 3PXBA 1RZ3A 4J43A 2JARA 3NC4A 1IXYA 3RRMA 4AM8A 1JJAA 3E0QA 4EB6A 2INGX 1HFEL 3SR0A 1U5BB 4I19A 3KLOA 1L5SA 4MV8A 3SICE 2P79A 2R79A 2AG8A 2NVUB 1D1QA 2P3LA 3UWPA 1H2RS 2IUEA 2KBEA 2BCJQ 4CVNA 5CB4F 4AN4A 2YYSA 3OTWA 1T4CB 1K9SA 4J6FA 3TR6A 1SMKA 1Q16A 2GRAA 2IOFK 2XQVA 1MPXA 5AUNB 4JP8A 3KBOA 1Z7YA 1I6WA 2OV3A 2ZYUX 1W35A 4BYGA 4X7RA 1R50A 3SX2A 4C5CA 5B30A 2VT3A 4GBJA 2X19A 2B94A 3R6TA 4GWLA 4YGXB 3HJFA 3AO0B 1LPBB 2HSDA 4N6OA 2ORED 2CLSA 1DJLA 3VKWA 1MOSA 4OEHA 3I0ZA 4LSWA 4JI2B 1O9GA 2OCDA 4M4SA 4IINA 4IWYA 4FINA 4GAEA 1GGHA 4OAPA 1FNCA 1IB0A 1NBMA 2IOFA 4NCKA 1WZ2A 3ELDA 4J03A 3Q6IA 4F4DA 5HKOA 5ELXA 4KPYA 1N4DA 1V11A 1UQTA 1K7XB 2AZTA 3P8ZA 3TD2A 4JLKA 4M0FA 3RT1A 4B3DA 3CRQA 3FTDA 3ILSA 2FMKA 1KI8A 5FOTA 2I4OA 2V7QA 4UCXA 3I72A 1T9ZA 4HLUC 1RMYA 1RYNA 2WHRA 3QVGA 1QYVA 4DYDA 4I1VA 4RM3A 3GUZA 2OBLA 3ROFA 1JU9A 4J0IA 4NBWA 4XTRA 4KLRA 3OA2A 4HK4A 4YIKA 2DR3A 4PGFA 4IXWA 2BFAA 3EJWA 1R00A 5G02A 1MX5A 3KU1A 4PE5B 1BDMA 1R66A 4PQFA 3RAGA 2NU9B 4CLRA 1Y9JA 3UMBA 3BWYA 1JJVA 4XYLA 2K7ZA 4NVRA 4HVCA 4G0UA 2CN1A 2O20A 2VVTA 4Q4AA 5U4XA 3TLEA 4TVKA 3FOBA 1CUXA 3HCCA 4JZYA 3W8DA 2YJ5A 1VB5A 2RGDA 3P2JA 3TLYA 2JI9A 4P8RA 5JS7A 3PD1A 5CX1B 2Q6LA 5BXYA 1WXFA 5CURA 3R4CA 4C0XA 2IHJA 2B8EA 3QF4A 1E9VA 4QAJA 4R6XA 2UXDB 4FCTA 5C8DA 3Q1KA 2OBMA 1J5PA 1WUIS 1BOFA 1JR2A 1ZGHA 4NIMA 2CDCA 3WQSB 5A6SA 5AD1A 4X5OA 2Y27A 4ZVNA 2AOTA 4ZWNA 3THYA 4DR1B 1LLCA 4HDAA 2EC5A 1ZMRA 2P6MA 2G28A 1JSLA 4GSYA 5K09A 1QIHA 2RJ3A 4EWLA 1UJ4A 1YJ5A 2Z4RA 4YRGA 2FY8A 2IEBA 1NRWA 2J09A 3MD9A 4FGWA 3TAHA 3BWCA 3V9PA 1F0NA 4EHKA 3FUVA 2NUPA 2QTWB 1FQKA 1D1PA 2R7NA 3C39A 3BJZA 2W6PA 2CVZA 2PUJA 3FMIA 4PPFA 1FRFS 3QU9A 4E11A 3WNVA 5JI2E 3IVGA 4NLLA 4RA6A 3KAJA 4HF7A 3EX7C 5IZ4A 3KKOA 2HLHA 4LQDA 2UVQA 2FX5A 1Z4QA 4EX7A 1GGMA 3TECE 3MMZA 2C2YA 3PC8C 5CYPA 2E7ZA 3L4BA 5T57A 2F62A 1YVDA 1LEHA 1W5BA 5AJYA 1OHHD 3L0BA 2G1AA 1L7QA 1Z74A 1YR2A 2EOAA 3W8FA 4PWZA 5I7UA 3K15A 4MVCA 3IV9A 3HJNA 4NK5A 3SI7A 4TYQA 1VIVA 2IGTA 3KEOA 4O63O 1U9JA 2MSCB 3OZ7A 4N1AA 3WLEA 4GLJA 1P5FA 5M34A 3AUFA 4TZKA 4AZ3B 3H42B 4MR9B 1W1WA 1Y1QA 3URKA 4W6QA 3DVLA 3U7QB 1R4NA 2AYYA 3RHZA 7MHTA 3FVRA 2O1XA 2BGTA 3T3IA 1Q0TA 5JAHA 3QVTA 3GVPA 2GD0A 3EZXA 3MINA 1TA0A 4H7IA 1QQTA 4J7AA 2C5BA 2ZAOA 3FCSB 5TMEA 4NV1A 4OGKA 2BMDA 1VJGA 1JDBC 1QCYA 2BZ0A 1NLYA 2NZYA 4RGQA 3B9RA 3VYTB 4HRVA 2WHYA 1FFSA 4YXWD 4CI9A 4DKJA 1JFFB 3RS5A 1Y63A 3IR6A 4TSFD 1TKRA 5AHRA 4LOLA 4LN1A 4MW1A 3ZDRA 5J23A 1ORRA 2XNDD 1Z07A 4M7OA 1VL1A 4TV8A 1V43A 3MD0A 5DXJA 3STWA 3VUFA 1U7ZA 3T7TA 3ADPA 3EMKA 2VH1A 2P1ZA 2FUG1 3I83A 2VDLB 2P78A 3LL7A 3OPQA 4OHRA 3SXUB 2RKOA 3I6YA 5CNMA 3O9VA 3SYLA 1QQBA 3AZPA 3R4VA 2JH9A 3CX6A 3DLPX 4B47A 1TZMA 2JATA 4XCXA 4C89A 4LOIA 2E5FA 4URUR 2PKQO 1OI3A 1PGPA 1VMEA 4EO7A 3M6LA 5C81A 5I9IA 2FZWA 2OILA 5BW5A 1D5CA 5JW6A 2PAFA 3PE3A 1FJHA 5E4JA 5DYNA 1VI2A 3ZVLA 3C3KA 1MLDA 5DK6A 4ITRC 3TVYA 2YZMA 3PJEA 4DLPA 3FYDA 2C99A 1QH8B 4RXTA 2VPWA 3DCNA 5DYYA 4QFCA 3QPCA 3DT8A 4E08A 1AMNA 3K9HA 4I3HA 5A71A 3S8MA 3U4AA 5TNXA 1TTTA 1RBMA 1UJCA 2JFNA 2JHPA 2W8BB 3OF3A 4FFRA 5GM2A 3BCHA 4UVIA 1ZH2A 4GPTA 3DTVA 2A9FA 3AJDA 3QE9Y 3DO6A 3MGCA 4LX0A 3BX1A 5CCBA 3HA7A 2CXXA 5FAKA 1NRJB 6ADHA 2XB2A 3H5VA 5LP6C 3ZDXB 1DKNA 1SOUA 4UZFA 1J06A 2CL7X 2ZBUA 4EL5A 1OFHA 2X76A 1C8KA 4GKBA 1EK1A 4LRQA 5EP3A 1ONOA 4EZBA 5IVHA 1KHTA 3Q3CA 4NONA 5DTIA 4M36A 1JR3E 2W6JD 4KLNA 1ABBA 4YO7A 2AH5A 1R4MB 5F9MA 1EWRA 5TGZA 2DZDA 1X7YB 3SZ3A 4MKRA 4RVCA 5EQDA 1RWOA 4NZZA 5FQOA 3K0CA 1V5GA 2R5NA 4RX1A 4DDTA 1DQZA 1D5WA 4PFQA 2YFHA 4PHTA 4O4LF 2GN0A 3B6JA 1E6KA 2VYFA 3INGA 3UKOA 4Y8VA 1S01A 1JB1A 3HY4A 4MS3A 4WY5A 5JPIA 1Y1LA 4K0RA 1A5AB 1C1HA 1W1IA 1OWNA 2W4IA 3QELB 3I39X 3REQB 1IOVA 3CF2A 5IH3A 3C1OA 3N2IA 3FPEA 4M9XA 1ADFA 2PQ2A 4LTNA 3CGGA 1ECFA 4MP3A 4O8CA 1FW6A 1O58A 3JAWA 2ACKA 3A9RA 2XJ4A 3LQ4A 2B37A 1BKDR 1OXMA 1KZ9A 1DL5A 1QHNA 2D54A 2P62A 3AF1A 4M1WA 4WY8A 5EGNA 5EQTA 2QYSA 4KHPB 1FDWA 3GEGA 4DGQA 2PK3A 5ALEA 3ROMA 2WJ3A 4EFLA 4F7WA 2EBFX 3A4MA 3I28A 2AR9A 3OTHA 2AN4A 5AK3A 5HIAA 2DTEA 4P4NA 4R83A 4TXJA 1HRDA 3ZCTA 2ZBDA 3DC2A 3CN7A 3UPUA 4O4JB 4RTLA 5T7BA 4BO3A 5HK9A 1RW4A 2LGJA 3RYFB 1GUYA 1YH3A 3CU5A 3G2QA 3EPLA 1XKQA 3B6MA 1I0IA 4Q9NA 3IDSA 1FPMA 5LZ2A 2VHXA 2QX7A 4Z4HA 5ETJA 4J6EA 3HDJA 4MQFA 4B6FA 4AY2A 1EUCA 4BKQA 2ZYAA 1VL0A 4Y1GA 3E9EA 1WHSB 4JJFA 5DOZA 1NTRA 1Y3CE 4RHTA 4MDYA 1CY1A 4BP3A 5IN4A 1D2HA 4OXKA 4RMJA 2QN9A 3WGOA 4ZXFA 3OQMA 1H6DA 1U8EA 3CLHA 4S3MA 1L4UA 4R0MA 3R5TA 4RENA 1KZGB 1W36B 1SUSA 1X2EA 1C3OB 1E6UA 1JQDA 1U7UA 3HXTA 3UW3A 3RRXA 4C7XA 4UVGA 3WNZA 2GAIA 5J2UB 2IYEA 1C4OA 1JE0A 1VSUA 4HWPA 1QP4A 4YRAA 4HDNB 2IU0A 4YMGA 5AFSA 1U2DA 2IE8A 3W8NA 1AZTA 1JQ5A 1YRBA 2WFLA 2QMHA 4E15A 4E4TA 4KTVE 4D56A 3U4QA 4KI7A 4NENA 1OD6A 2P9TA 2VDKB 4KO3S 5NLLA 3T5AA 2G8NA 3U4CA 3WRYA 5AVYA 5E95A 2GO7A 3GXBA 2PWPA 2PD4A 3D1JA 4BFYA 4Z2AA 3DLBA 1O9BA 1OREA 2RGNC 2NXCA 2VUUA 4H3VA 4ZAYA 4YYEA 4W7IA 1EQAA 3PVZA 2ZM5A 2HMTA 2PJZA 3UWKA 3USCS 1QYCA 1GP2A 1TTPB 3DWGA 2DECA 4Q0MA 1ESNA 3WX0A 3A6KA 3G2HA 4K3VA 4MLDA 2FOIA 3FBGA 1N57A 2ZI9A 1NC3A 5CBKA 3FDFA 3GLFA 3N0TA 1Z5NA 1FVXA 2H7VA 4B6EA 4C6TA 1NG1A 2IV3A 1OILA 2EKBA 4DV6B 1KFEB 4WBNF 4YRRA 5CM8B 4NBKA 2IPMA 4A8JB 4D5GA 3Q85A 4LGVA 5LBIA 3MQ4A 2PPLA 4L95C 4HP8A 3I2IA 3EDQA 3KJEA 1EFVB 1XJ5A 4ND2A 4LSZA 4TXLA 3VKFA 5BV2P 1YONA 1B0AA 2AJCA 1U11A 3ORFA 4KQFA 1EVIA 2F64A 2HCFA 5CJJA 3C3DA 3NZEA 4EHDA 4HQRA 4BNDB 1JPNA 5FPPA 2NP6A 1IH8A 2WM9B 1NM5A 4KUEA 3AHJA 4RFSB 4PGAA 5K5EA 3LM8A 2H1CA 2CLHB 4GXRA 4L8YA 3Q7EA 4Q3BA 3S6JA 1YJAA 5FWYA 1CRPA 5C3MA 3TB6A 4O0MA 3PGKA 1T9CA 2G9VA 3OICA 3PNBA 4X7PA 3UJ8A 3U9TA 4LXTA 4CMEC 2E5LB 4BRZA 3KETA 1DOZA 1WU7A 3N2EA 4I4IA 3ZIAD 5JZSA 1S8FA 1OFTA 1ZOPA 5BN4B 1OSNA 4IIEA 1PJCA 3KQYA 4Y30A 2DFTA 3ACCA 3KYDB 4RZQA 4GEKA 4TTIA 1KAGA 1M33A 5CM9C 4DQDA 1YF3A 3WNBA 1GWNA 4N5MA 4YRTA 1NF3A 2V6GA 2GN4A 2NTVA 1W5EA 3HJGA 4OBEA 3TEJA 5KU7A 2PRZA 3RVNA 4MW7A 1YD7A 4OHVA 5F51A 3WQHA 4FGSA 1S8AA 2FN3A 1A5TA 5F2KA 1DIRA 4YQYA 2Y6UA 3BD6A 4CKYA 1YQEA 2GO1A 3SAJA 2H1IA 2ARKA 2HU5A 2WQZA 4FFBB 4WPGA 1VOTA 1GNRA 3T95A 4BV8A 1KH2A 2IV2X 4DIMA 3G9ZA 2CY0A 2Y1LA 4GPBA 3I5XA 1QG0A 3NHRA 4BP8A 4ZTZB 2YIVX 4YGYA 2H4JA 3PLNA 2P8JA 5JCOC 5JMWA 4B73A 1CJSA 4IUYA 4KWTA 4OD0A 1KMHA 5ELMA 1E1KA 3D8BA 1CU1A 3NV7A 2C97A 2Z2IA 2AMVA 1KVSA 4Y9UA 3QLVA 1KTIA 1ZSVA 2C5GA 1SHLA 4ZO8A 2O4CA 1S02A 4EG7A 1KR5A 3WWDA 4HH3C 2BGJA 2D5CA 4MS1A 5BR1A 4XX0A 1L9XA 3AIMA 3NNNA 5DE3A 1JHPA 4IXNA 3OQVA 5IC5A 4AMBA 1XRJA 4ISBA 3EIXA 2V6MA 4AQYB 1PL7A 1XPOA 3NNSA 3IQEA 3EASA 3OM9A 5CLJA 4OYLA 1HT2E 4DBLC 1Q83A 3W6UA 1LD3A 1E60A 2YWRA 3W79A 4GMHA 1SIBE 3WWEA 4QBHA 1JV2B 1UK6A 2VAMA 1GSOA 1HI9A 2RGWA 3I8XA 4MRVA 2YW2A 3QG1A 5AJVB 5JHGB 1GD1O 2CXOA 1K2WA 1T26A 3DOCA 3NJ4A 1AIPA 5E3IA 2IY9A 4DIKA 1XTQA 4AWAA 1KY4A 2YHIB 3ND6A 5L6MB 1WS6A 2BFFB 4NC9A 5EPEA 1GZ4A 3KEMA 5K51A 2C2BA 4ENPA 1EX1A 2DHEA 5LZ7A 3X1DA 4NKRA 5CLQA 4CMKA 2OGWA 3EWNA 4CM3A 3WYDA 2OY0A 3LT0A 4KXFB 5FWAA 3VMFA 4ZI7B 4FKBA 1Y9DA 3HGQA 2HMSA 1NIPA 3PEEA 1YZYA 3K0BA 3BXGA 1T1RA 1LRKA 1QKIA 3DV2A 1HK7A 1RZUA 3S2IA 3U16A 2ZW9A 2ZYWX 3D8UA 2R6HA 4CUJA 3DULA 4DMKA 3D7KA 1YIOA 4ER6A 4HZUA 4YV1A 2CUNA 2CVFA 1US8A 1R6AA 3SR3A 2CT8A 2H59A 2QL6A 5JJBA 1UMDB 3UAZA 5K03A 1Z25A 2GAFA 3AVXA 1BKSB 5IJ0A 3VISA 2ZVDA 3A3YA 4OREX 5LD2B 1FU8A 3HPRA 4MRPA 2YIJA 1IFXA 1O1YA 2ZWIA 4A6XA 3JVIA 1QP8A 4QVGA 3QEKA 3QXGA 4XH9B 1FYVA 3NATA 4NOKA 2Y67A 1MX1A 3LT5A 3W5VA 2D1YA 3WLMA 1G8KA 4B4KA 4GXTA 1SOVA 1KTVA 1N6OA 2P7HA 4GQAA 1GNTA 2CMKA 3MRVA 3OT1A 4JXKA 3DFMA 4P93A 2I3DA 5LU8A 1ZHOA 2CXRA 5A5DA 3MTGA 5KVCA 2IEIA 1AQNA 4IDCA 3MLAA 4F6RA 4K2HA 3P97A 2X1LA 4Z8XA 5BNZA 3W8EA 4MJ7A 4HLDA 2NIPA 3IIEA 4B0OA 4GKKB 2D4AA 5C3UA 3ZE7A 2WB4A 1IJFA 4XUCA 4QBGB 1JR3D 1XD9A 1ZXBA 4BKUA 3VGPA 4R1UA 3FMVA 2OAP1 4Q93A 5IARA 2WHEA 5CB4A 2X5JO 2QBYB 4CG1A 3WLSA 5IJZA 4FGUA 5M29A 3ILHA 3UAOA 3O8QB 2C92A 2N1BA 3RTCA 1DADA 4DNOA 2JIPA 2FSUA 1KWGA 1TK3A 2QR2A 5T4FA 1R16A 1J4AA 1Y82A 1V4VA 4HQ6A 4I8XA 2XE6A 2XIJA 4BZZA 5AW6A 5TEWA 3MWEB 2FZGA 1ADCA 1P7YA 3DVQX 4RH0A 3NUZA 5CDYA 2O6LA 3PNLA 1LWOA 2XUKA 2ZIVB 2PXCA 2Y0BA 1ODIA 5EIFA 5G4KA 1HQKA 1ZN7A 1ENZA 1ULBA 2PBFA 3KB6A 3MGGA 4L0QA 3V8VA 3ZJVA 2AUTA 2AB0A 1CR4A 2GBGA 2ZSDA 1JXMA 2JGMA 4HFMA 3KTDA 5HBGA 5B37A 2ZIXB 1AKEA 2FWBA 4A3SA 1G9XA 2D1FA 1T0UA 2F43A 2C1EA 3W1EA 1CS4C 3B70A 5EC8A 4MTLA 5LLSA 3OU6A 3P9YA 3FKJA 3RUEA 2D2FA 2IYNA 4G36A 4QJBA 4QBTA 3UAVA 3UKDA 3F46A 1M6YA 1KAHA 4IJWA 3NGMA 1W4RA 1YFLA 2QL5A 3P9PA 3D64A 4BGUA 4R1TA 3IUNA 1S2GA 3L04A 1HV8A 4OHFA 2V7UA 1JDSA 2IK8A 3KOMA 4LV5B 5FRDA 1XWIA 3T7JA 4M6WA 3WKAA 2WILA 1AKVA 1ZSNA 1TX4B 3CE6A 3GCZA 3QU2A 3B1KA 2HRRA 1LS1A 2VHTA 2ZU6A 5AJTA 1YUBA 1IEQA 1TF2A 2C4KA 4JLSA 4B2LA 3MTDA 3B5JA 4D4JA 2B5OA 3T5TA 1POWA 1GGJA 4QC2A 3SZRA 2H5JA 1OLXB 2ROQA 2ATCA 3CEPB 1RI3A 1HE3A 3DLTA 4IGKA 3CEHA 1DBWA 4ZTUB 3SKYA 2BM1A 2RHHA 4XM2A 2EIXA 1E5XA 2VJBA 1Z0SA 2R1TA 5L95A 5TB5A 5KNCD 3C4JA 3QVOA 2Z8YM 3RK1A 3G89A 4AO6A 4DT1B 1UOEA 3H6HA 4PC3A 1GZDA 4U1RA 3UJ9A 4C3ZA 4BNHA 4DOMA 1BHO1 1I9CA 2WFMA 3BRWD 1SQ5A 1EB9A 1G64A 2J3EA 2CYBA 3B6EA 1O77A 2QGNA 3CUSA 1I32A 3FHCB 2VJKA 3N75A 4RCZA 2MT9A 4UMDA 4NAVA 1U0TA 5EFOA 1FVFA 3C15C 1Y8RB 3T1NA 1P7ZA 4RTRA 5T3UA 1W34A 1DWOA 4M1KA 1M1YA 2P0YA 4GEGA 3BIFA 4LYDA 4V0ME 2R6AA 3EXHC 3M1AA 4IHJB 1YK0A 3ROPA 1IAVA 2ZBRA 2PR2A 2XA1A 2UV8A 3QMPA 3AEYA 4H3KB 1U8FO 5HHTA 1SZJG 4Y6GB 3X2EA 3CH6A 2B2NA 5ELLA 1M7HA 1UK9A 2Y77A 3DPUA 4FEEA 4M9CA 3BEDA 2F3SA 4ZD6A 2FKAA 3EAGA 4NPHA 4EF4A 4D4HA 3ZYZA 2ODPA 4QPPA 3RODA 2VZ0A 4QPDA 4LXYA 2DVMA 2JCBA 3MJTA 3BHJA 2UVDA 4MHOA 4YCBA 1IMOA 2A5YB 3IQXA 3DB2A 1P4HA 4AY3A 4URWR 3W0LB 4F86A 3DD5A 2LCFA 4HO1X 1JF8A 3GPLA 3SC4A 2BFMA 4K9MA 3NBYC 2ZTUA 2VRBA 1TE2A 2UUOA 4G41A 1AUQA 2ZRAA 1GUZA 1L4LA 1WHTB 4HT3B 1NBMD 2YXEA 5JD3A 1DRUA 1OVMA 4QVIA 2YWJA 4JR2A 4LYYA 1DWUA 3RIGA 4TLMB 4QQKA 4AURA 3HUTA 4IJMA 4FYKA 1UEXC 1YSCA 2J3HA 4RLHA 2A5LA 4GQBA 2HDNB 3T0IA 3A1DA 3O73A 3V1YA 4ZCRA 3UBMA 4Q24A 4D9NA 2BP7A 3LP6A 2OORA 1I6KA 5B58T 4XJTA 4WLEA 3ZLUA 4GR9A 2PT5A 4YS6A 3URMA 2AFHE 3VVMA 1USWA 4U6QA 5ARBA 4DFDA 1JDBB 2PRKA 2RAPA 1L4EA 3IQFA 3PQ4A 1JYSA 1PJ4A 2O2XA 5IVIA 4OFBA 4ZAGA 4LSGA 3NBMA 1I94B 1Z0ZA 3JD4A 1K2VN 4IH9A 1SQ6A 1X8LA 4EG1A 4BV9A 3BDAA 4OHUA 4D26A 1GZVA 3T3EA 1QYIA 1H66A 3FWKA 2ZB2A 3HM2A 1D6JA 5DCUA 3WG9A 2IZ7A 4YP0A 1BCRB 1BH6A 3AI3A 3EH1A 3T12A 2W4QA 3TKYA 2PJUA 5LIPA 2WI8A 2RHOA 3F6PA 3OJOA 3H3FA 3QXJA 4B75A 3ET4A 2AK2A 1VJCA 4KQ2A 3RFTA 3H6KA 1CQJA 1JB9A 1II8A 3A06A 3JAKA 3KWLA 2PZBA 4ML3A 1V1RB 5HQTA 5K3EA 3TG2A 5IJ0B 1T9GS 1TGYA 4MVJF 5CFPA 1RM3A 4AG3A 1N36B 3PHCA 4E6EA 5I8ZA 1QYDA 1UXOA 5AHWA 4Z0NA 4ARVA 4KX3A 2XITA 1QDUA 4OHPA 2ZRCA 3QF7A 2VDMB 1JFLA 1OT3A 2GYWA 4L8WB 3SM9A 4DJ5X 5EPUA 5I8PA 3EF1A 1AHNA 2VH5R 5AKHA 3D7LA 1BO6A 2A9KA 3AHGA 4XAQA 4IBOA 1WD7A 5AVQA 2BEUB 3SMQA 3TIGA 4YUZA 4HL6A 2F3UA 5AKYA 3WLJA 2RGYA 3T1VA 3MJSA 3D8SA 4B3SB 3U39A 2YWBA 4P83A 1O0SA 4KSBA 4DJAA 4B3XA 1HFKA 5LP6B 4G4SO 4W5WA 2Y9MB 2B92A 5DX1A 3NTOA 1K98A 1UEIA 3DMFA 4DZZA 3ZGOA 4UQOA 1SRQA 2VO1A 4ZARA 2C2XA 4PYLA 5EIEA 3DL4A 4J91A 4O4LA 4D0RA 2YDXA 1NTOA 1RVV1 2G71A 3R6WA 4MVJP 4P34A 5BRJA 3SWWA 5BSVA 2B8TA 2GN1A 2WD7A 3L0CA 3D3QA 3UUFA 2CYCA 3JQ7A 4B2IA 4EELA 1PS0A 2B1RA 9ATCA 1AO0A 2XXAA 2K87A 5HZGA 3FNRA 1YACA 1Y3AA 1FXUA 1K75A 3F1LA 4C43A 2QA5A 1PJRA 1SIOA 3L7BA 4MCIA 3D2BA 4QG3A 1RLTA 2D5IA 3AJAA 3TKLA 2DT8A 2IOHA 4PZDA 4I55B 4BGEA 5B4VA 5KTOA 5CB8A 4OA8A 4J2TA 1QKJA 2EF0A 2XNSA 1NXOA 2EFJA 2PT7A 3FSEA 3ITEA 4LYEA 1MCZA 1T0JB 4U7HA 4DR3B 1QRRA 1N6LA 3NPMA 3FVVA 4K1LA 3QKTA 1XTKA 1HKHA 1VJDA 1EP3B 1SUBA 3EVEA 2FOLA 2IBMA 1JLMA 2JI6A 4RPLA 1C4KA 1NI4A 4Q37A 1KS2A 3PEFA 5HVNA 1PZFA 3WLRA 4GT1A 3CUVA 4BNXA 4P53A 5JDCA 1S7GA 2NMVA 2G8LA 5JNUA 4F8EA 4TWIA 1EWVA 5AI5A 4B6JA 4YMUA 3LF1A 2O0MA 4G9BA 4YQZA 5C37A 5TQ2A 4KXXA 1P45A 2O23A 2XXBA 1I2MA 2Q4BA 4IYJA 4UVHA 4H2DA 1FP6A 4LI0A 2PLAA 2VSNA 3DJFA 3MELA 4POAA 1AB5A 3V8PA 3ZWBA 1IPEA 4CKCB 2PMCA 5EYPA 1QHFA 2ERCA 3NH6A 4BX0A 2V1UA 1J0XO 2PEZA 1K8YB 2CXNA 3TCNA 4M1TA 2F6RA 4Q21A 4EI8A 1WY7A 4L9AA 5C1BA 1NQXA 3H0CA 1NVDA 3DTVD 2I65A 3TX2A 1XEFA 1U2QA 2GERA 4FSHA 3U17A 5L3VA 2ZRFA 3IIIA 4HVLA 3DHVA 3DM5A 5JV5A 4C4ZA 4D97A 1O97D 1R8YA 3L8EA 3ZHCA 4RJJA 2NO6A 4FM9A 1M5UA 2A57A 2DMRA 4F96A 1J7JA 5BMVA 4MQ5A 221PA 3SJCA 2QRVB 2YZ2A 4TMFA 5HQ3A 5KKNB 3K8QA 1C7ZA 4NJEB 3ZWCA 4CF4A 1EHCA 3C3XA 1W48A 3FD8A 1T5HX 3WOHA 5IZCC 3FGOA 3I64A 5T3YA 3NJ8A 1WE2A 4ND8A 2JKYA 3PDUA 1EBUA 2B6HA 4UCFA 4D8YA 4CTKA 2R00C 3WWZA 3QJGA 2ZT8A 3AI1A 1CR2A 4LDQA 4BNFA 4G89A 4AZTA 5PNTA 3BT7A 2J5XA 5JXGA 1PG5A 1HNNA 4KQWA 1EWYA 3V4VB 2TMGA 4NE2A 1P1HA 1SCIA 2B1GA 3FCXA 3KL4A 2O3UA 4RO0A 3L0PA 4H7KA 1UJ2A 1U3WA 1XGKA 2A86A 2FETA 1KK0A 1ZVJA 3UV7A 5D5PA 3I3SR 1C3JA 2O8CA 1U04A 4WTOA 1SKAA 4TM8A 4H7JA 4DXDA 4X66B 4I08A 1VRWA 3IE0A 1KQOA 1QTRA 2BR3A 4PICA 3O1IC 4U63A 5JAIA 2ZBPA 3IQZA 4C4YA 1V5WA