4YBZA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
463
structure length
462
Chain Sequence
b'NDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 178
structure length 462
sequence length 463
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4ybzA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4ybzA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ybzA01
1Z75A 3BZUA 2EF1A 1NTOA 2P9CA 4XDZA 4OQZA 1BG6A 2VT2A 3C7DB 2WD7A 3EUWA 4CM9D 3GUCA 4Z3DA 1AHHA 2JJYA 4BNMA 4NDNE 1MLDA 3S8MA 1VLLA 2O3UA 1KEWA 3HQ4O 3WGQA 1KEUA 2CD9A 1LJ8A 1W4ZA 3IDSA 1BXZA 1U9JA 1TT5B 2VOEA 3H3FA 3OQBA 4J49A 4L9RA 4WEQA 5FFFA 5B1YA 4YCAA 3DBRA 4XIJA 4HADA 2HRBA 2HLPA 2WE8A 2I6TA 1C0LA 4LN1A 5T64A 4CM4B 5FF9A 3GNQA 4E33A 3DHNA 3K92A 1EBUA 5IDYA 2WWRA 3JD0A 1BW9A 1GD1O 1GEEA 1YQGA 4KWHA 1FDUA 4IY1A 4Q3BA 1GZ3A 2OORA 1O9BA 3A1NA 5KWEA 2D8AA 5LDGA 3WJ7A 3ZW9A 4OOEA 4JBHA 4Z0TA 2NUAA 1NPTO 3OH8A 3GN2A 4MVJH 4QXMA 1ZJYA 4CLOB 2PD4A 4ROSA 1LQTA 1WP4A 2GN9A 3KXDA 4GI2A 2UAGA 2GRAA 4O59O 3AOEA 1XA0A 2OP1A 1ML3A 1PZFA 5FEUA 5BQFA 2CDCA 3O38A 3RU7A 1ADBA 4L76A 3GDOA 3GZNA 3OQ1A 2G0TA 2VYVA 4OYRA 1H6CA 2P5UA 2CVOA 3CXRA 3OICA 3DXFA 3BTUA 4JQCA 1I3LA 3GPDG 4MOWA 2VWGA 2OFPA 5G4KA 3GMDA 3JV7A 4NJMA 1MFPA 4YRBA 3QRWA 1N1GA 2GZ3A 3GGGA 2HQ1A 1NYTA 3NT2A 4KP7A 3V2UA 4Y8VA 1IPFA 3D5TA 4I5DA 3ZWVA 3U0BA 2Q2QA 3IAHA 4OHUA 3WGGA 1Y81A 1YL7A 4YPOA 3W4KA 3QWHA 2CZCA 2C07A 4N7RA 4IM7A 1MX3A 4BOYA 2X5JO 1PR3A 4BIIA 3C1OA 1Z45A 3GEMA 4E32A 1LDNA 3NT4A 1Y5MA 3GDFA 3ENKA 1R4MA 3IUSA 3PHLA 4NBTA 1PTJA 1NXQA 2ZTVA 1LQUA 3ZHYA 3MTGA 3WQSB 3TF5A 3L4BC 1ZMTA 2C20A 2Q1WA 4LW8A 3PTZA 4PLHA 4CMEA 3WTBA 4J16A 4MJLA 5DCWA 5FI5A 2O7SA 4W9NC 1A4UA 1GTMA 3HDJA 2FZEA 4QO7A 1Z7EA 2FPGA 1IOLA 2BFMA 1HSOA 5A1TA 1ISFA 1PJCA 2P4HX 4B4VA 1VL8A 3PJDA 1XCBA 4DQVA 4CM1A 2WD8A 1CETA 3UICA 2VTDA 3RU9A 4AJEA 1ZJZA 4WCFC 2FPPB 1DC6A 3KBOA 3QVWA 3C3XA 5BNTA 3RFTA 5AXBA 1K0UA 4LISA 3JQ7A 2Y1EA 4GX0A 3DMTC 3GAZA 4L4SA 4XJTA 5AVOA 3DAPA 4MVJG 3NYWA 3U5TA 4EITA 4GGPA 2X58A 4CV2A 4NBVA 1H5QA 2FWMX 1YH3A 1IL0A 2D2IA 3PIDA 4CMGA 2AEFA 5JDCA 2X8LA 4LMPA 1E7SA 1GUZA 2VRCA 2DTDA 4OSPA 2Z95A 1E7RA 2VTEA 4G2NA 2Q1UA 4RF2A 3KO8A 3KEQA 1BXGA 3MTJA 2D5CA 1NP3A 4Y6PA 4FFPA 4ZGWA 2X1HA 3F1KA 3M2TA 4S3MA 2WD7B 3DZIA 2Q2WA 2GCGA 4R5HA 4E4YA 1SPXA 1XG5A 1DO8A 4BO0A 1ZSNA 2BLLA 4BO8A 4D45A 3TWOA 1DXYA 3M2PA 2VUTA 1E3JA 3TZ6A 2BRUA 5ILOA 3DBRB 1EVZA 4CMIA 1RM0A 4DRYA 4YB8A 1RJWA 3GVHA 1RM5A 4OIMA 2GNAA 4OO3A 5KIAA 5EERA 3RUEA 3H3JA 4PG7A 3GDGA 3GA0A 1U4OA 5THQA 1BW9B 1HDYA 2WM3A 3BAZA 2CF5A 3DZKA 4XCVA 1N7HA 3DONA 5GZ6A 3DFZA 3C7AA 1EUCA 4J1QA 5BR7A 2NUAB 1VJ0A 1FDVA 4Y6RA 1WVGA 1LDBA 3RKRA 3PQDA 3RUHA 1NPYA 4AJJA 3NKLA 1YDWA 1HLPA 4WLFA 3U09A 1MXHA 3A06A 1MG0A 3H6KA 1Q7GA 3V1TC 2HMUA 2CDBA 5HS6A 3BMCA 3ICPA 4C7JA 4LSMA 1T2FA 3S2IA 4O0LA 1NX6A 1KBZA 4EYEA 2GN6A 3KUXA 1DHTA 2H6EA 4N5MA 4UREA 2OO5A 3R3SA 4XQCA 3P5SA 3RUAA 5HRUA 3JTMA 2WYUA 2W2KB 1YBMA 1BMDA 1Q2XA 3GZNB 4AFNA 3IOYA 2J5RA 2Y93A 1LEHA 1PEDA 2Y0DA 2BH9A 1OI7A 1U5AA 1SCUA 3GY0A 1R6DA 1ENYA 3TJRA 4BO7A 2DFDA 3TFOA 4ZRMA 5ITVA 1VKOA 3AWDA 3GZ4A 2AMFA 1JAXA 4EUFA 3MCVA 5G4KB 1ADFA 4NJMB 4ND4A 5C7LO 4EI2A 1B3RA 2P2SA 3WYCA 1WW8A 1IULA 5T57A 1B8PA 1MA0A 4XWYA 3H2SA 4UVIA 2X5OA 1V3UA 4XR4A 1DFHA 2H9IA 3FTNA 3GUYA 3HN7A 4B8WA 3K5PA 1I5RA 3DO5A 4Z9YA 4YQYA 3PJEA 1A9ZA 3C24A 4CJXA 3CIFA 1I30A 3QVOA 1DHRA 5TJ9A 2I3AA 1DIAA 4HX5A 1NFFA 1NHGA 2VWQA 1TI7A 1R4MB 2GLXA 2PGLA 5U9CA 3OETA 1NAIA 5IZCC 3FCOA 4FCCA 3SC6A 2VNAA 4IBOA 2NSDA 2X9VA 3IS3A 3ZWPA 2PK3A 4EGFA 4K6CA 2ZYDA 3PZRA 3TZQA 1AHIA 4KTTE 4A7PA 5KJ1A 2B4TO 3COSA 4DIOA 3ZU3A 2FPGB 2V6FA 2AE2A 1XQ1A 4KQXA 1HE3A 1ONNA 2X22A 2XOXA 5JXWA 2AEMA 4YEDA 4AG3A 2EKLA 2OBNA 3JQ8A 2NTVA 4B7CA 3PHHA 5CDTA 3UCXA 4ZQGA 2PY6A 1PZGA 1SBYA 4AICA 4NH4A 3WFIA 4GKVA 4PLPA 2X86A 1YS4A 3JQ7B 3ASVA 2LDBA 1HE2A 3U49A 3VTFA 4FFLA 4WGGA 4IUYA 4I1IA 5G2OA 3DQPA 4NNJA 1BVUA 1MC5A 2PH3A 1JQBA 4WLVA 3KM0A 3KSUA 1IZ9A 3L6DA 4YYZA 3T4XA 4EUEA 3W8EA 2E4AA 1MGOA 2ZQYA 2BMAA 4ZQEA 4DLLA 4B4WA 1M76A 3D1LA 4TRMA 3SC4A 3DDNA 4J0EA 1F17A 1Z7BA 2FRDA 3DTTA 2UDPA 4U6SA 3RASA 1JWAB 5JLAA 1VE9A 1ZMOA 3JD4A 1BXGB 2AG8A 2CY0A 2BI8A 1DFIA 3JYQA 2YY7A 4R41A 3ANMA 3ITDA 3K73O 3I9NA 3RUDA 1MP0A 4CMHA 1TA4A 2FHSA 2X0JA 2JAHA 2HMSA 3CSDA 5JBIA 4G65A 3DZBA 1A27A 5L51A 3BIOA 4RLHA 1CDOA 2V7PA 3DBHA 2JL1A 5TX7A 1YJ8A 2O4CA 3E9QA 4CMIB 1I2ZA 1PJ4A 2BD0A 2ZB8A 5A04A 1PJ2A 4IPTA 4CLHA 8LDHA 2OP0A 1M6WA 3L9XA 4R68A 5DOZA 4W7IA 4IS2A 4UUNA 2FP4A 3K30A 3KSZO 4R1TA 4ZU3A 3QVSA 3RC2A 1HSZA 1EUCB 1QV6A 2JFHA 4YQZA 1VJTA 3PQFA 5K6AC 3ITKA 3AY7A 3PYMA 2CMDA 4PG4A 1J0XO 5EESA 1LTHR 3FNFA 3JQGA 1FDSA 3PRJA 1MV8A 4W82A 5GY7A 5A9SA 4NU5A 3BMCB 3BMOA 5EJ2A 3VOSA 4UVEA 4DA9A 4WASA 2EERA 4P4GA 3GPIA 3IUPA 1X14A 5C7IO 3MWDA 3NGLA 4MIEA 1GR0A 1DDOA 3BHMA 1T1RA 5DP1A 4L74A 1UXHA 2PLAA 3PFFA 1SCUB 4ND1A 4QSMA 2OHXA 3NV9A 2PR2A 1PGPA 2VNSA 2DPHA 5IFLA 2O4UX 5KKAA 4AJPA 4OMUA 4E5MA 2SCUA 3WIDA 3GAFA 1RYEA 3FNHA 4FFRA 3PDUA 5COQA 2QRKA 3BMNA 5JCJA 3HHPA 3LVFO 3KYCA 2Q49A 1E1MA 2RH8A 2VZ9A 4IDAA 4CMCA 1GEGA 2NTJA 3OBBA 3DAFA 3UCEA 4RF3A 3HDHA 2DT5A 2RAFA 3L6OO 4RPHA 1X7DA 4PIVA 5DNAA 3ULKA 1LDEA 2VHVA 4DPKA 1WNTA 4BMVA 1IB6A 1X7HA 1WDMA 5JAMA 3PWKA 2AQIA 5B12A 2FMUA 2EWMA 3OJ0A 1SEVA 4MKRA 1E3LA 3ZWBA 4D42A 2TMDA 5B4VA 3JQ9C 1R4NA 4HKTA 2JCVA 2Y1DA 3E6AA 1HRDA 5IDWA 1R15A 4BO2A 4JP2A 4I5EA 4WLEA 1O8CA 4OM8A 4WEOA 3UCFA 1PJBA 4EW6A 1B26A 3B6ZA 4MINA 1EBFA 1OAAA 1UR5A 4YA6A 1QP8A 2VRCD 4L73A 1ZEJA 5I8ZA 4BKQA 3E48A 1T2EA 3LF1A 4Z0HO 5IF3A 1U4SA 2I99A 1BSVA 3HFSA 2CVQA 3U9LA 4AJ1A 4Z6KA 3JQ8B 5C7OO 2BKAA 3RC7A 4BNYA 2VOJA 2WMDA 3K96A 3KYDA 4DQUA 5JE8A 3UOGA 4F6CA 4KTVE 4BGVA 1UP7A 1YXMA 5AQ1A 3E9NA 4DTIA 1SAYA 1GCOA 4HNGA 2EKPA 3RC1A 1UZLA 4JIGA 1P33A 5DBGA 1LSJA 4Q3DA 3JQBC 4BKPA 4E5PA 4D0RA 5AXAA 1D1TA 2XF8A 1J49A 4XYBA 3QSGA 2DAPA 1CIVA 3VKUA 4NFSA 5U4QA 3D4PA 4DLAA 1NFQA 4R1SA 3OA2A 1E92A 4ZQHA 4A03A 4GMGA 4JJGA 2HMWA 2Y1GA 3LK7A 1G0NA 4ND2A 1O95A 1X1TA 1UDBA 2XXJA 4TKMA 4CMKA 1BDBA 1LLUA 4CLRA 2EXXA 2YZ7A 1PR9A 3GNTA 4DPMA 5F5LA 5JAZA 4HUJA 4BKUA 3BTOA 4GVXA 3TDKA 2IXBA 3CMMA 1KVTA 2PGDA 3RJ5A 2OOSA 1DLJA 4BNZA 3LC1O 1T2AA 4M54A 4RF4A 1VKNA 1PGOA 3GHYA 3H7AA 4H7PA 1M75A 3S55A 3BTVA 3DBHB 4BNWA 4BGIA 2ZB4A 1O0SA 2YV3A 2R00C 3U4IA 1U3VA 3MJTA 5JW6A 4NK5A 4R69A 1ZIDA 1XQ6A 2P9EA 4D41A 1F14A 3JQFA 4MKXA 4IZIA 4JJFA 3WOHA 2EJVA 2EP5A 1LRJA 1MUUA 4J2OA 3IP3A 3NTOA 3E8XA 3S2EA 2GGSA 4WUVA 1UJMA 1L7EA 1ZEMA 4R01A 2D4AA 3DBLA 2BHLA 4F46A 1YVEI 1OFGA 4J7CA 1DIBA 3QWFA 5COAA 5JO0A 4QFDA 1W8DA 2PZJA 3KLPX 3OF2A 3Q9UA 4CLDA 5ENDA 3JQGB 3UGKA 1JU9A 4PLVA 3F6YA 2G5CA 1PGNA 3Q3CA 5A9SB 1Q0LA 2C59A 3BMOB 4H15A 4TQGA 1ENZA 1I2CA 3MZ0A 4JGBA 1Q1NA 4GL4A 3ZWMA 1IUKA 1HDOA 2FPIA 4ZQBA 3PJFA 4XIYA 3VH3A 5TNXA 3MWDB 2YYYA 3BMQA 4XEHA 5L7TA 1QMGA 4YAIA 1ONOA 2B0JA 2JCXA 1JAYA 3WGHA 3HDQA 2C5AA 2WYVA 4BO5A 1NFRA 3IMFA 3GVCA 4IDDA 4WE3A 1QR6A 1YBAA 3HWRA 1F12A 3E03A 4XZ3A 5GMOA 1K6IA 3GFGA 4CM8A 2SCUB 4P8RA 3WBBA 3IC5A 3ZCXA 2J8ZA 4J1SA 1YE3A 2W90A 2VQ3A 4M49A 1D3AA 3BMNB 1Y7TA 1FF9A 5L45A 5JMPA 3KYCB 1YGYA 4IQ0A 1NAHA 4NBWA 5CDSA 1B16A 1UXKA 4XR9A 1EEHA 1AN9A 1WPQA 4TROA 5CDYA 4K6FA 2BGKA 1EQ2A 4M1QA 1ZSYA 4YAJA 4MVJI 3WTCA 1IE3A 4ND3A 3WYEA 5KVVA 5IDQA 3JYNA 2AQHA 1DJNA 1O6ZA 3EC7A 3UF0A 4DBVO 1YOVB 5IXSA 1B7GO 3SLKA 4K9DA 2X0RA 1UXJA 1RM3A 3WNQA 3LDHA 1R4NB 4FDAA 1FMCA 4FFMA 3VTZA 4HWKA 3CZMA 1MFZA 3LZ6A 4TMFA 1GYQA 4IZHA 3RQSA 3WS7A 1NQOA 4ONEA 3E1KA 1A5ZA 4D3FA 4YJFA 1P9LA 4EZBA 2X4GA 4JX8A 2YW9A 2PA3A 2C54A 2NLOA 3NT5A 5JDIC 1T2DA 1G0OA 1VJ1A 3I23A 4IINA 4OH1A 2C5EA 1KY4A 1K6JA 3CEAA 1G6KA 3OQ6A 4AJNA 4IMPA 1R16A 3V5NA 3KYDB 1NBOA 4DMMA 1ORRA 2IYOA 4IIVA 4HNHA 5H82A 3F5QA 4D44A 2I67A 4WPGA 5U1PA 1EK5A 3RWBA 3UVEA 3CKYA 1U8XX 2G17A 4B3JA 1HE4A 5L7YA 4E2ZA 1C0IA 4IJKA 3PK0A 3BHIA 5IN4A 1Y6JA 1YB4A 5L4LA 1T26A 5AXCA 3DZGA 3I3OA 3OJEA 3V1YA 2X9GA 3ORFA 5JY1A 3D0OA 2H63A 4PCVA 3RBVA 4BNTA 2FOIA 1Q0HA 1XGKA 4JNKA 3N58A 4MP6A 1UZMA 1BXKA 3K2EA 4KDEA 3JYPA 3O4RA 3ZHZA 4CLRB 4M87A 1NQTA 1MB4A 2DM6A 1I3KA 1T4DA 4W4TA 4YJDA 1VI2A 3OMLA 3FSRA 3H5NA 2HDHA 3AUSA 3INTA 3I1JA 4QT0A 2W2KA 4F45A 1JWBB 4ZA2A 2CUKA 7MDHA 1TEHA 1YL5A 4NPCA 3PYXA 3WXBA 3G49A 4IJUA 3WIEA 1TXGA 1U3TA 2DU8A 2FSVA 1E3IA 4N5NA 4Q39A 2OXIA 1J5PA 4K26A 4ALMA 3ZU5A 2J3IA 2AG5A 2FN7A 4AJOA 4B4OA 5A06A 1X0XA 3ONEA 3WB9A 3EHEA 4OOFA 1EDOA 5JNLA 1A71A 1EVJA 1CYDA 4DPLA 1NVTA 3WYBA 5CDUA 3MJEA 1UDAA 2HRZA 2NNLD 4UVHA 3GGOA 1DIGA 2EKQA 3O8QA 3SJ7A 2JAPA 4BMNA 4NR0A 2ZATA 3HDYA 1XIVA 1QYXA 3H8VA 4LCJA 3DBLB 4BS9A 2J3HA 5IZ4A 1N8KA 1K6XA 3SLGA 1TLTA 2P68A 1ZH8A 4YBZA 1YJQA 2V6BA 3U4CA 4DWVA 1SOVA 4NU6A 3OA0A 4GGOA 1KS9A 1HYHA 3FNGA 3OIGA 1I36A 3BTSA 3DOCA 5JCJD 2GD1O 4DLBA 5TLSA 4PVCA 5L4NA 1DC4A 9LDBA 2FPIB 3VH4A 5L3ZA 4Z3KA 3ZGYA 3CPSA 3BMQB 4IQGA 4CV1A 5TIIA 2NM0A 4BO6A 3G1UA 2YQ4A 3LYLA 2FR0A 3INGA 1PWZA 5A05A 1I33A 2QX7A 3B70A 3EGOA 1BDMA 3PXXA 4UUMA 5G0TA 5CHEA 4P4LA 4UVDA 5ICMA 1GDHA 4NFHA 1JKJA 3H4VA 3UH1A 4CM8B 1QSGA 1PZHA 4CLXA 2EW2A 3V8BA 1O5IA 1B8VA 3VZPA 3MWEA 2X7HA 3LQFA 1BTOA 3QWIA 5G0VA 5TT1A 4PLYA 1N5DA 4UUOA 4JBGA 1HEUA 1QLJA 3FBTA 2IYPA 3JSAA 4BB6A 3ETDA 4OGWA 1XU7A 4TRJA 2A94A 1OZAA 3LU1A 1QV7A 4H16A 4WNIA 1GYPA 4NBRA 3ZWYA 2EIHA 3VPGA 4WECA 4A5OA 5COBA 5CDGA 1Y8QA 4XRRA 1GU7A 4GLOA 4BNUA 4DBZA 5JC1A 1WDLA 1ID1A 4QUKA 4QX6A 3TN7A 5THKA 4IMRA 3NDJA 2VRBA 2HAEA 4L4RA 1YB1A 4ALKA 1PWXA 4MPDA 2JD2A 3FR7A 1OOEA 4EUHA 4II2A 1VL0A 4PZCA 2Q50A 3K6JA 3TZCA 3ON5A 2IRWA 2NADA 2DUWA 4YJFB 1HF3A 1XDWA 3P19A 3U4DA 3Q1LA 2X5KO 4OQYA 5FWNA 1JA9A 3GG9A 2IZ0A 5EPOA 5AYVA 3W6UA 5TF4A 4CQLA 5T67A 4NI5A 4TWRA 3A28A 3EZYA 2PD3A 2QYTA 2AQKA 5AXDA 4P4NA 3ANLA 1Z74A 3LT2A 1DAPA 4OSOA 2V65A 4D79A 3D7LA 4BMSA 1PQPA 2RBEA 4Q3AA 5H81A 3GR6A 2Q1TA 1L1FA 1B0AA 4RVHA 5CEJA 1ZXBA 1E6EA 1EFLA 1PJLA 4X54A 1ULUA 1U7HA 5JS6A 3RD5A 5JO9A 4BGEA 4YT8A 5KJ6A 3GFBA 4Y98A 1RM4A 3I9MA 4F3YA 3HJAA 2YHIA 4CL8A 5A5EA 3ZDFA 5EQDA 1JTVA 2DBQA 1W73A 1CQJA 3P7MA 1KC1A 5KCZA 1JLLA 3NGXA 3PGJA 1H6BA 3RUFA 4MIOA 1EUDA 1LC0A 5L4SA 3BA1A 2A4KA 1DLIA 4ALJA 3MJVA 2HMTA 3PZBA 4IJWA 1H2BA 3QP9A 1Z73A 3FF4A 4KZPA 5MGBA 2Y05A 2VZ8A 3M1LA 3NTQA 3D5QA 3WBFA 1NHWA 2I3GA 2DTEA 3WFJA 5F1OA 4D43A 4BNHA 3OHSX 3AOEC 4HBGA 4I5FA 4MIYA 2QHXA 4BNIA 2J6IA 1WMAA 4GWKA 4J2HA 1RKXA 2H5LA 9LDTA 1DEHA 3H5RA 3NAQA 4YR9A 3O8QB 4ZICA 1ZK0A 1Z6ZA 2J3JA 4QFCA 3ADOA 3GC6A 3Q2KA 1P1JA 4PLWA 4QECA 2OMEA 1CJCA 3ICCA 1PL7A 1B2LA 4J9VA 1MC4A 1WZIA 3UXYA 5CAEA 3GLQA 2B37A 2BGLA 3AFNA 3GVXA 3UN1A 3FN4A 4RPLA 1B14A 4ALNA 1OBFO 2IZ1A 2P91A 3DOOA 3IKVA 3ZN2A 1SOWA 5KJFA 4RPJA 1R12A 3DZJA 3TOZA 4FOSA 3PYLA 5I9LA 1MG5A 1BVRA 1VPDA 3K8ZA 4RDHA 4WOKA 1ISIA 1EVIA 1HDCA 1KERA 3AU8A 1LXCA 4LSWA 4PVDA 3GHHA 5J23A 3KRTA 1JKJB 3HADA 2JKVA 4CV0A 4J7UA 4CMEC 4RJTA 4MO2A 5A5FA 3QV1A 4IGFA 5ILGA 4M55A 4YT2A 3GMSA 2OGUA 2Q4BA 2YV2A 3MWEB 1UP4A 1ZKMA 4GSLA 3SEFA 3T7CA 4DQXA 4HY3A 3WX0A 5IG2A 4O63O 4WNCA 3HUDA 4R9RA 2NU7A 1FDWA 4YAGA 5JSFA 3C1TA 2X9NA 3JCZA 4M8SA 1ONPA 1XKQA 5T8KA 1X15A 4R3WA 4UULA 1EMDA 2HKIA 3DZHA 1Y8QB 1R37A 2FR8A 1VC2A 3PHIA 4I9HA 3OFSA 4OAQA 1GZ4A 1JVBA 5B4TA 2PFGA 4CR8A 4MVJF 3CZRA 1DB3A 3S2FA 4DIBA 1LSOA 1PZEA 2DTXA 3IQDB 4NBUA 1CRWG 1LA2A 4YVFA 1B8UA 4E0BA 1I10A 5A02A 3QY9A 1SO8A 3JQCA 1DC3A 4GAEA 2HUNA 4CQMA 1J6UA 4J43A 4OXKA 3PP8A 5ADHA 1E77A 1LSSA 1ZK2A 4MVJE 3GRPA 1NR1A 4GX5A 4J1NA 4XGIA 5JDCC 2X6TA 4WLUA 4EJMA 3W4JA 1YQDA 2HJSA 3E5MA 2VUSA 4CQLB 1Q7CA 4J0FA 1DJQA 1Z82A 1ZW1A 4R3NA 3QVTA 3ZH2A 4L8VA 3VDQA 2JHFA 1WAMA 1ZCJA 2NQ8A 2ZTMA 4I08A 4ZJUA 2O3TA 1I2BA 1TT7A 3ZNPA 1TB4A 2QZ9A 1B15A 3JQ6A 2A35A 3E5RA 4ZVVA 5G4LA 3WQQA 2NU6A 2ZJ0A 1O89A 2E48A 2VYVD 3SBOA 1OMOA 4EJ6A 2ZCVA 1ZK4A 4QQRA 4D3DA 3AI1A 3V2GA 3ZV6A 3AI3A 2YHIB 2CFCA 7ADHA 5BSFA 1VM6A 2FY8A 4XB1A 2VYNA 4JP3A 4BO3A 1V3VA 2NU8B 1I01A 1CQJB 4CUKA 4CV3A 5I7FA 1P3DA 3ZHBA 4BGUA 1JLLB 1GADO 3AK4A 4PLCA 3UKOA 1EUDB 4IS3A 1HDRA 1P45A 2HU2A 3I9LA 3VPSA 2YJZA 5C3MA 3D3WA 4ZD6A 1Q0QA 5BSEA 2ILTA 3TSCA 4C7KA 5CPBA 4BNKA 4YACA 2Q3EA 5DT9A 1GQ2A 1P1IA 2PZMA 3UHAA 1GAEO 4NMHA 4YT4A 2VHZA 1LX6A 1GQQA 1A7AA 1HZJA 3F4BA 3VH2A 3ZU2A 4FOOA 1I24A 1LDGA 3AM3A 2BFOA 2NWQA 4BKRA 4E2XA 4GVLA 3G1TA 3EW7A 1SB8A 1YONA 1ZFNA 2D1YA 3WNVA 5ER9A 4LCEA 4LRSB 1QLHA 4XD2A 4GPD1 1HETA 2NVWA 2ZB3A 5F21A 2IODA 3ADPA 1WMBA 4E13A 4O6VA 5L40A 3PJGA 4A2CA 3C85A 1CF2O 4I9UA 5KTKA 3OEYA 3ZNOA 3JD3A 2EHDA 4BQPA 3VVBA 1BGVA 1C14A 1IYZA 3RCBA 3SX2A 2PKQO 5G0UA 2Y0EA 1P0CA 5CAEB 3OJFA 3LF2A 5FYDA 2UVDA 1AE1A 1DC5A 1LRLA 2TMGA 4CMBA 3B1FA 3I4FA 1YOVA 2QQ5A 3KYBA 3AUTA 4HFRA 3RBXA 2YHUA 4J90A 2W2LA 1JW9B 3F5SA 4EDFA 4R1UA 2NV6A 2R6JA 1E7QA 2R2GA 4J3FA 4FGSA 3W8DA 5C5IA 1PL6A 1YQXA 1LLQA 3KLMX 5F1PA 4PN3A 1SNYA 1P0FA 4GMFA 1T2CA 1M66A 4ID9A 1PS0A 4WLOA 1H0KA 1VSVA 4ZHSA 1E6WA 5HBRA 1PJ3A 1ZK3A 2A92A 1H6AA 3WG9A 2RH4A 4YWJA 4D7AA 4ALLA 1KVSA 5KVSA 4FGWA 3A14A 1A7KA 4RQTA 5LCXA 1E6UA 4Q3EA 3VC7A 1EQUA 2NU7B 3AJRA 1Y9AA 4RCVA 4YTEA 2Z1MA 4D3SA 4IDEA 5GZ1A 1QYWA 3L4SO 2JD1A 3QVXA 5A9TA 2O7QA 1ZBQA 2GN4A 3OJLA 4RQUA 5T6BA 3ONDA 2RCYA 3D64A 3ROQA 1GPJA 4AL4A 2JFFA 5CEEA 3OP4A 4UEJA 3VKVA 2GR9A 4DIFA 3S2GA 2D5AA 3G0OA 3RFXA 1ZO8A 1W6UA 1A4IA 3A9WA 4OXNA 4CQMB 2W8ZA 4Q3CA 5A9RA 5LC1A 1PGJA 4R9SA 3X2FA 3ZV4A 4IDBA 2O23A 3F9IA 2D0IA 4G81A 5I7EA 4K1LA 2DVMA 3RKUA 3ZV5A 2G82A 1LSUA 2JFGA 1DRUA 1UAYA 3L77A 1E1KA 3ENNA 4MKZA 3HNPA 4NIMA 4RV9A 5TQVA 4DVJA 3DOJA 3PI7A 4EJ0A 1P1RA 1HDGO 4YJHA 2DFVA 3GRKA 3E9MA 4JJIA 2BFPA 2HK8A 4RDIA 3S1LA 3I9JA 1F8GA 3V2HA 5JYEA 3NX4A 3NJ4A 2Q2VA 1IHXA 4IQ8A 1V6AA 3PQEA 2BGMA 3PHGA 4S1VA 2NU6B 4AVYA 1OC4A 4UVGA 2WDZA 4YRDA 2EG9A 3DMYA 2O48X 2Y66A 5JC8A 3WICA 2VZ0A 2RIRA 4A27A 1U7TA 2Y1FA 1D8AA 4D46A 2D3TA 1YBVA 2Y0CA 3ZWWA 4PG6A 4U6QA 1NWCA 2AQ8A 4RORA 1PS9A 1LBEA 1WWKA 1MXFA 2DPGA 3GG2A 3ZV3A 1E7MA 3AI2A 3DFUA 3TPCA 2UYYA 3JQAA 5BNFA 3GNSA 4DC0A 3D3WB 4TRNA 1S6YA 3LC2O 4RVFA 3VPXA 1YRLA 4J9UE 4PRLA 1DIRA 5L53A 4GQAA 3L4BA 1YL6A 2VCYA 4XJSA 5EN4A 1U3UA 4OKIA 2Y1OA 4Z9FA 2ZCUA 4I8XA 4W9NA 1HE5A 1D7OA 1P44A 2EP7A 4ILKA 3B20A 3EDMA 3PLNA 4N5LA 4AJLA 1U2GA 4Y9DA 1AUPA 4PRKA 1JKFA 4YDRA 3F46A 4OKNA 3EAGA 3I4CA 1U1IA 4XQEA 3W4IA 5IDXA 1SMKA 3NDIA 2GN8A 4GX1A 4GWGA 1GV0A 2C2YA 2W4QA 1JKIA 1FK8A 2AA3A 3CE6A 3EVNA 4FFOA 5CG1A 2IEBA 1H9BA 1EUZA 1HT0A 4WCFA 1GY8A 4PFJA 5DOVA 4PGFA 1QORA 3DMTA 1DSSG 2ZKLA 2Y68A 5CP8A 4RGBA 3N7UA 1OC2A 3T4EA 1PU2A 5IJZA 3F1LA 1HZZA 4KQWA 3F4LA 4AJHA 4U0JA 4YXFA 3X2EA 2OL4A 1QRRA 4BO1A 2DKNA 2I76A 5DULA 3TOXA 4R51A 3M1AA 4U7WA 2VHXA 2EEZA 3KTDA 3I6QA 1R0SA 1QKIA 4RF5A 4I9NA 3LT0A 4PLZA 3GVPA 3ONFA 1E1LA 4RL6A 4HP8A 4W7HA 1K2WA 2CDAA 3OECA 1AGNA 4CL3A 5HA5A 2C0CA 2QIOA 1QYDA 3JYOA 3WQRA 5C37A 4P38A 2HO5A 1UAGA 4JROA 2IZZA 1V35A 2DQ4A 3Q11A 5L9AA 4URFA 1R0LA 2WJPA 3KVOA 4U0KA 4E5NA 1HYEA 3PIIA 1EVYA 3QW2A 1LDMA 4Q9NA 4ND5A 4BNLA 1K89A 1RPNA 4DXHA 3ETGA 3K31A 1R0KA 1DBVO 1D4FA 2F00A 2HSDA 5EINA 1XSEA 5L95A 1E7YA 2F1KA 2BFAA 4Y6SA 1NVMB 3GH3A 4IDCA 4Y67A 2BELA 3UW3A 1ARZA 3AU9A 1EE9A 1I3NA 1XR3A 5JY6A 3QQPA 1FDTA 4FN4A 3JQDA 1PL8A 3RUIA 2P9GA 4DGSA 2ZTUA 4WKGA 3VDRA 3HZZA 2HJRA 4BNVA 1GQYA 4NHEA 3E18A 2DUUA 2PD6A 1XELA 5TC4A 2VYND 3F3SA 3PFWO 1AXEA 2Z1NA 4XGNA 2C82A 4BNNA 4YJHB 4Q3NA 5CEFA 2ZB7A 4CUJA 3FWZA 4CM7A 1F8FA 3EZLA 5GZ3A 2PKRA 5KOIA 3H2ZA 3HE3A 3GEGA 3DWFA 4IXTA 1T4BA 1ULSA 1DRWA 1QG6A 3I5MA 4MVJA 5BT9A 2ZIZA 1LLCA 2I66A 1KYQA 1C0KA 3JQFC 2Q1SA 4OL9A 4GSKA 3FI9A 2UUPA 2NU9A 4TKLA 4DC1A 4BV8A 4O5OA 5KVCA 3U3XA 3INRA 3JYLA 3JQAB 3CINA 1N7GA 2ZK7A 2YFHA 3R0IA 1Y1PA 3A4VA 1SEPA 3PWSA 1N1EA 5IZCA 1WLYA 1EE2A 3DAGA 3RI3A 4J91A 4JN6B 3C8MA 3OIDA 1VL6A 3I9OA 3Q9NA 4C4OA 4O1MA 1O94A 1EDZA 1N9GA 3I6IA 3SXPA 3L0DA 1LUAA 1JDJA 1P1HA 4DL9A 2VT3A 2W2LD 2J5KA 2YQ5A 5I8WA 4D0SA 1C1XA 1LI4A 1G1AA 2O3JA 4RLSA 1SC6A 3VH1A 3AFMA 5EL0A 2FSSA 3ZWXA 5A4DA 3Q2IA 3WMWA 2I9PA 2QG4A 3GT0A 1P1FA 4DYDA 1GV1A 4KMSA 4PLFA 1V8BA 3KZVA 2VUUA 4WCFB 3RSHA 3ETEA 1K5HA 1X1EA 3NEPX 4EEZA 1C1DA 3LLSA 5I7VA 4BNJA 3ANNA 2VWHA 3H9EO 3OIFA 4WCDA 2OUIA 5KJEA 1EZ4A 1Y8RB 3VPHA 2C7VA 4KUHA 2I5PO 3DC2A 2UUOA 4OJNA 5T5QA 3GVIA 4IJVA 2CSUA 2O3RA 5TRTA 3TFQA 2GYYA 2DBRA 1D1SA 4B7XA 3PDJA 4MDHA 4BO9A 1E3EA 2EJWA 1HYGA 4UEOA 1DFGA 4RZHA 4WOJA 1GZ6A 2BI7A 4HV4A 4KUEA 1SB9A 5EMHA 2XAAA 3KOUA 3UFXA 2QZZA 1HLDA 2GSDA 4W6ZA 5I7SA 2YDXA 4BO4A 4FIZA 2GUGA 1Q7BA 4LVCA 3HB4X 1ZSVA 1XWFA 4TVBA 1TVEA 4A26A 3ASUA 3B1JA 3D3EA 3TRIA 3L6EA 4E21A 2P4QA 2EGGA 2POQX 4RVDA 1IPEA 5ICSA 2CVZA 4R5MA 2NACA 4B3HA 2B69A 1RYDA 3G79A 5KJCA 1CQIA 5JPIA 6LDHA 1FJHA 1YDEA 4INAA 2QW8A 4FJ1A 2HCTA 4JXKA 3DBVO 4J4BA 2ET6A 4BB5A 5K6AA 2NU8A 4FJ0A 4RPKA 1PQWA 4UUPA 4FB5A 2B5WA 2EW8A 4RZIA 4XB2A 2VN8A 4ITUA 3TZHA 1DAOA 3O03A 3AW9A 3BXXA 1XLTA 3RBZA 1UDCA 1ENPA 2EV9A 2Y67A 4CUZA 1KEVA 4BNFA 3NUGA 3ZWAA 2DBZA 4BV9A 1DRVA 5EIOA 4IDFA 2GERA 1UP6A 5K9ZA 3R3JA 4NQZA 2E6UX 4H3VA 4K28A 3ZNQA 4PG5A 1U3WA 1A9YA 3TL3A 3VHRA 3EK2A 2NTNA 3JQAD 4BQRA 4TZKA 2QRJA 4KOAA 3AOGA 3WLEA 4CM6A 2Q45A 3OJOA 1I0ZA 2DC1A 2B83A 3AUAA 2P5YA 3GF4A 2GDZA 4J1TA 1P1KA 3QJ5A 2J3KA 3IJPA 4CM5A 5JFOA 4HFMA 1H2HA 4BL5A 5DCUA 1EK6A 4M86A 5TJHA 5I9MA 3QLJA 1F06A 3LSYA 4B4UA 4CM3A 3G17A 3VZSA 3HN2A 1XEAA 4FC6A 4GX2A 4AJIA 2JHGA 4IDGA 1X13A 3P2YA 1PSDA 3FTPA 3RFVA 2NU9B 3GN1A 3WSWA 1ISHA 3ZWCA 3AM4A 1CWUA 4XQ9A 2PZLA 3NJ8A 1CERA 4FW8A 3VVCA 2HMVA 3G3EA 2B5VA 1QYVA 2EGHA 4ZQFA 1Y9EA 2ZYGA 1NQAO 4R54A 3HB5X 1U5CA 1XHLA 1J4AA 2X23A 4YT5A 4CODB 3H9JA 3WJAA 2QRLA 3JQ9A 5FI3A 3WWYA 2C7GA 3DHEA 5A3VA 2PGJA 3MJ4A 2O3QA 3PPIA 1N9GB 2GASA 4E2YA 3GQVA 1E3WA 2IDZA 5ITWA 4BHTA 4BKOA 1C1XB 5DBIA 5KVQA 4E12A 2B36A 3VZRA 2VHWA 2YUTA 3H5AA 4DYVA 4LGVA 3MOGA 3TZKA 2VWPA 1LNQA 3LLVA 4U5QA 5ENVA 1T25A 1KEPA 1ZZEA 4E6PA 3AY3A 1H6DA 1NNUA 3K9QO 3D4NA 3ZNNA 1N92A 1CEQA 2CF6A 3WGZA 4BUCA 5ES3A 1P77A 3V1UA 2BF7A 3ROPA 1LC3A 2Q4EA 3FBGA 4J4TA 1PQUA 2JCYA 1ZNQO 1C1DB 1R66A 4PZDA 3MJSA 3WSVA 3JQBA 1GFSA 4NFYA 2YFQA 3QA9A 5JAQA 3SVTA 2V6MA 1KY5A 4OXYA 4EBFA 3CH6A 4CMAA 1F0YA 4NK4A 1A72A 2IEDA 3H9GA 5BSGA 4YJGA 2VHYA 3ST7A 3W6ZA 4YRAA 2GF2A 4L4XA 1ADGA 4E31A 1ISGA 4FS3A 3FHLA 3RC9A 4XX0A 1V0JA 1XYGA 2WYWA 3EVTA 5EQFA 4CM9A 1YB5A 3QIVA 1LLDA 1V9LA 4IIUA 3WGYA 2YV1A 3IP1A 5LDHA 2G76A 2ZTLA 5TS3A 3MEQA 3U4HA 4RO0A 1ZXLA 4JK3A 3UFXB 5K0ZA 2O2SA 1QYCA 3FRJA 1IHYA 3DB2A 4KUGA 4TVOA 2R00A 5HTOA 3SJUA 1NWHA 2O2YA 1B3BA 2WTBA 1KVRA 3KV3O 5A03A 3HG7A 1I8TA 1NQ5A 3ABIA 3ZU4A 5DZSA 1JN0A 1Y5RA 1WXDA 1CQIB 2ZYAA 2PTGA 1KVUA 4QO8A 6ADHA 3D4OA 3JQEA 3OEWA 5AOVA 1VSUA 3NDRA 1HWYA 2DBVO 4JLWA 3HSKA 2IE0A 2AE1A 4RVSA 4M89A 5TGDA 4E5YA 5L7WA 1PGQA 5G0WA 2Q46A 1M2WA 5H83A 3KEOA 4PG8A 3WDSA 3BHJA 3TQHA 1BRMA 4MVJD 2B4QA 4XKJA 4XA8A 3PEFA 3B1KA 2PH5A 3LT4A 3PLRA 3Q6IA 1HDZA 2I65A 1BWSA 3NRCA 2XXBA 3WGOA 1KIFA 4Z9XA 2PWZA 1YKFA 3DHYA 2PKQP 3L9WA 4MVJP 2GZ1A 1ISMA 5CPFA 4YAEA 4J4HA 4E2WA 5IAAA 3FNEA 4MP8A 5HS4A 1U28A 4FBGA 2W98A 5TSDA 4B79A 4HXYA 2ZQZA 1L7DA 1WZEA 3P2OA 3W8FA 3WLFA 3H9QA 3DEYX 1S7CA 1UZNA 4CLEA 2E82A 4HFNA 4ESOA 1JVSA 2ZJ1A 4L75A 4J6FA 4ZRNA 3GGPA 4XYGA 1GUYA 3TL2A 2AEJA 2C2XA 4WK6A 1K3TA 4BNXA 1H93A 1T24A 1YO6A 2UV8A 1E5LA 3IIEA 2AXQA 5JMWA 4QTZA 1NPDA 2Z5LA 4DREA 3AM5A 5DN9A 1UUFA 4Z0PA 3MOIA 4EEXA 5CFZA 2XPCA 1GYRA 4AJKA 2H1SA 3KHUA 3IJRA 1GUFA 1UXIA 3PWZA 1HXHA 3N74A 1M6HA 2X0IA 5G0SA 1E3WB 4PZEA 3EMKA 2NVUA 3IL2A 3Q0EA 3I9KA 1SZJG 3QE3A 1I3MA 3GOHA 3GK3A 2YDYA 2D59A 5MDHA 4JBIA 1LU9A 5JDIA 3ZZNA 5BSHA 2JD0A 3QWAA 1DOHA 3TNLA 4F6LA 3E82A 1VRWA 1FXSA 3OSUA 3WMXA 1P74A 3K2BA 4NJOA 5DCYA 1PX0A 3WGTA 4XDYA 4LVUA 1KC3A 1E5QA 5KKCA 4R16A 3NTRA 4GLLA 1HKUA 1U8FO 2RHRA 1HTBA 2G1UA 4UEKA 2E49A 1ENOA 3IKTA 2Y1CA 4E5KA 2NVBA 1EFKA 1PJSA 5TT0A 1E3SA 3U62A 1TT5A 3KSDO 3PHJA 1E0DA 3F47A 4NZ9A 3M6IA 4R4JA 4E30A 3VPFA 4LK3A 1PJTA 1P31A 2RHCA 1C0PA 4FQ8A 2WE7A 5T8KC 4GH5A 3AY6A 4QEDA 4ALIA 4B3IA 3CUKA 4B7UA 1GPDG 4L0QA 4CM4A 4YJGB 3RJ9A 3UUWA 2PNFA 1NVGA 2C29D 4JCOA 3WGIA 2AW5A 3T7EA 3L07A 4PLGA 2FR1A 3FPCA 3FR8A 4HFJA 4XRGA 5DBFA 2O50A 3H65A 1PS8A 2Q99A 1HDXA 1PJQA 4TSKA 1ISJA 5DP2A 3WWZA 1NR7A 2LDXA 8ADHA 4MVJM 4W99A 4FC7A 1M67A 4LRTB 4XX0B 5KNLA 3EYWA 5CG2A 4BVAA 2Y99A 1NM5A 4UAGA 4KWIA 2FZWA 4CLOA 4N18A 2E37A 2PZKA 4I5GA 3OM9A 4GBJA 3FPLA 4BNGA 1LDYA 3RIHA 3FD8A 4WLNA 1ZK1A 4CMJA 3O26A 5I9NA 3VZQA 2B35A 3DZFA 3MJCA 4RVUA 3WR5A 1KVQA 1X7GA 3C1AA 2HK9A 2X0NA 2NQTA 1IZ0A 3I83A 3CTMA 3EY4A 2GO1A 4E3ZA 2DLDA 1BHSA 4AJ4A 2OBYA 1ZUD1 4FJ2A 5F1KA 3RVDA 5B4UA 1DPGA 2O3SA 2IXAA 3R6DA 3LC7O 1T1SA 2CNBA 2QYSA 4NG5A 3ZWOA 1U2DA 5JAIA 1X0VA 3GEDA 3ZHXA 1C3VA 1W0CA 2J5QA 3BYZA 5F3RA 2PV7A 3PVZA 4II3A 4B8ZA 1E7WA 4P22A 5JYDA 2FP4B 2GPTA 3JD2A 2AHRA 4ZN6A 4FSHA 4CR6A 4J7XA 5JCXA 1LRKA 1WDKA 3LT1A 3ZI0A 1QXSA 4AJ2A 1PIWA 3DR3A 1NASA 5B37A 2B4RO 3ZWNA 4RPGA 1AXGA 1GL3A 1DIHA 3JD1A 2GZ2A 4N54A 3QWBA 3C7CB 4MP3A 1XU9A 3RROA 4G5HA 2HK7A 3FWNA 3ROKA 4R1NA 4XYEA 3KB6A 3RAJA 4XYLA 4TRRA 5DF1A 3ROMA 5DDIP 3CMCO 4TZTA 3STHA 4FFNA 3ZW8A 1HL3A 1ADCA 2WEKA 5BNIA 5A3JA 2WSBA 5ER6A 3UAGA 4A10A 1YWGO 3R1IA 4PLTA 1ZVMA 2A9FA 4A0SA 4DUPA 4XYMA 1IY8A 4LMRA 4KDFA 4XGKA 4DMLA 3PGXA 4RVGA 4FD3A 5IN5A 5F5NA 4FPXA 5HM8A 3KETA 4A73A 3HFGA 2FPPA 2OZPA 3RUCA 4U8GA 1Y8RA 4CPDA 1N2SA 1UH5A 4XQGA 1KOLA 3W1VA 1KETA 3H9UA 2V6GA 4FR5A 3DL2A 2NVUB 3O9ZA 1H94A 5IXYA 4IGEA 1H9AA 4IXWA 1UXGA 3AUUA 3QHAA 5HWSA 4CQMD 1I32A 4GKBA 4YAKA 1E1NA 3DTYA 3I52A 1GCUA 1V3TA 4WJZA 3VAZA 1RWBA 4CR7A
chains in the Genus database with same CATH superfamily
2FHPA 3BZUA 1N7IA 4YV1A 3ZX4A 1NTOA 3H1AA 1M6YA 4KN9S 3ZD7A 2HWYA 4F2PA 1ZGHA 1CE8A 4HEHA 2J87A 4KWTA 4UDOA 5EE5B 3V80A 4BMDA 1G3IA 4CM9D 2M6KA 4FYWA 1GGNA 2IFTA 3BERA 4NDNE 1VLLA 3WGQA 1KEWA 3HQ4O 2REOA 3CGGA 2OGTA 4M99A 1B00A 5BN4A 1WCIB 1C4WA 3L3BA 2YTZA 4L9RA 1W85A 1TT5B 4WEQA 2IYTA 5D86A 3T54A 1ZG3A 2XH8A 4YCAA 1UIRA 3D8SA 1W94A 3B13B 1Y3HA 3GRFA 5D3ZA 4V0QA 2WE8A 4LN1A 1C0LA 1S1MA 4CM4B 1N6NA 3DHNA 3ISVA 3ICOA 3K92A 2HXGA 2ZUDA 4YK7A 1N5OX 3A6LA 1JZQA 3JD0A 2AOUA 1GEEA 3FGOA 3QEOA 1K5DA 4LBZA 2OORA 8ATCA 3VKFA 4EI9A 2ECOA 1TK9A 5DNYB 5I6DA 1IBLB 2IGTA 3HXQA 4I1VA 4JBHA 1ZLXA 2NUAA 2YINC 5J58A 3NRBA 4IIGA 2V9PA 2GRJA 4MMYB 3D7KA 4BMOB 1XZQA 4FOLA 3H11B 5TPZD 1S5PA 1IXYA 1BD4A 2H4FA 3GA5A 2WWTA 1OTXA 3LTEA 4MVJH 2B2XA 4O4JF 1ZJYA 2I4MA 2MYTA 4LXQA 4MYCA 5BQ5A 1LQTA 3CISA 4GI2A 3JWJA 1D1QA 2BGNA 3URMA 4BBJA 5K8TA 1BVYF 1XZCA 1ML3A 1PZFA 2X1VA 1JQJC 4HEA6 4L0DA 2HCRA 2VNIA 3RSOA 3IP6A 2Q7XA 1RQ7A 3IQEA 5FT9A 1AX9A 2VPWA 3O2JA 4QGHA 3TPFA 3GZNA 1RBQA 3OQ1A 3ZCUA 1H65A 4UUQA 2VYVA 3OESA 4KFRA 2P5UA 2IYUA 2CVOA 3DV9A 2X0FA 4C2BA 1IVSA 1RFLA 4WA8A 2ON6A 1DZ3A 1IK4A 4R2MA 3KVRA 2A67A 2PAAA 3INNA 1EG2A 3BTUA 4DB2A 4E22A 3GPDG 2VWGA 2OFPA 3GPBA 3GMDA 4GNKA 3FSJX 4LQCA 4FDUA 5AI6A 1MFPA 4YRBA 5IVPA 2ZYRA 2HGZA 1N1GA 1X39A 2DUNA 3KJXA 1Y8ZA 3ELUA 1KAMA 2GZ3A 4B83A 1UPUA 3MJHA 3HPQA 4KP7A 1TTTA 1MC8A 3PNOA 2J09A 1IPFA 2D2FA 1GLGA 4RZ2A 3U0BA 4AQ7A 1GA4A 1J2EA 1HL7A 3ODGA 2ZB2A 1Y81A 4J94A 4HDKA 3AX6A 2AYYA 1IWBB 2C8KA 1QZUA 2GPYA 4JKIA 4KVZA 1BWPA 2C07A 3CVJA 3EZGA 2OILA 4K05A 4NX2A 4X9XA 3FKQA 1KNXA 1L7OA 2GYVA 4R7TA 4BIIA 3GEMA 3I0MA 3MT7A 5JEDA 1L5FA 3EA0A 3NT4A 1PSZA 1Y5MA 2DT8A 3PC7A 5IH7A 3GDFA 3ENKA 4JP8A 1R4MA 3IUSA 3SIRA 3LI2A 4X66B 3DYIA 4AF6A 1M5TA 4CTKA 2FWIA 5D1NA 1N2BA 3WQSB 1JFRA 4Q9HA 2C20A 2OD9A 3E8SA 3TZEA 5HRAA 2AG6A 5FI5A 4BQIA 4F97A 2I78A 1Z33A 2O7SA 5F51A 1QDEA 3UK2A 1YDGA 2Q6OA 5KU1A 4RHCA 1Y5IA 4D57A 2ZDQA 1Y8CA 4NWIA 4UNSA 1W59A 1Y1QA 3AQ4A 4JLJA 2YMPA 4UEWA 5AI5A 4G97A 3IV9A 4HX2A 2NZJA 2J3QA 4MR7A 2QWXA 4BPRA 2P4HX 2FPKA 2QL6A 2H57A 3HLTA 5K4AA 2F48A 6Q21A 4NICA 2QN7A 3I8SA 3VNAA 1Z5GA 4EG4A 1BQEA 2FSFA 5DM1A 1Q20A 2GPWA 3P8ZA 1CETA 3UICA 4DE5A 1JMKC 3PKJA 1SUEA 3TRFA 2FPPB 3KBOA 5AXBA 1KBOA 4QYXA 3CVVA 1SRQA 2LCFA 1GKYA 5E6UB 5AVOA 3T5DA 4F3KA 2G7MC 3IHKA 2OHHA 1LZLA 4MVJG 2IPNA 1XOIA 4HYEA 5AHWA 1S4MA 3GLTA 4NBVA 2FWMX 2PUBA 1KMIY 3V48A 3F8WA 4OQQA 3ORYA 1RZRA 2AEFA 4DSAA 2XMPA 3ZJ4A 2X8LA 4WN3A 4EPYA 2B8NA 4JODA 5I5GA 1YU6A 1Z88A 1ZVJA 1DELA 1BCRA 1BROA 2HEGA 3NQ41 3P0RA 4R84A 4XD7D 3TD6A 3WNZA 2RH5A 1OFUA 4B74A 2H2WA 2O0MA 5LIRA 3EG9B 4G2NA 2KBFA 2EQBA 1BXGA 3IV7A 1L1RA 1STOA 1RWMA 1BX0A 1W5AA 2C2HA 2X1HA 2N3ZA 3SBDA 3PFCA 5ALGA 1W36D 5K0JA 1CE8B 1K88A 4MWZA 4UARA 2GCGA 4R5HA 1ORTA 5KCMA 4TVSA 5K05A 1DO8A 4EO7A 2I2XB 2CMHA 4LC9A 4WADA 1AUQA 5BN4B 3TWOA 4D45A 3ZUPA 4U2EA 1BGWA 3M2PA 1W85B 3VPAA 3M6FA 1N1MA 2C4MA 2XYGA 4OQEA 1OH5A 3S6JA 5EIBD 2Y8EA 4EKIA 1EWRA 3KKOA 3GVHA 1XAIA 2OO7A 3H3JA 1K5PA 3GDGA 1NMSA 1U4OA 3CRRA 3PD7A 4YAWA 1BYIA 2AOUB 5LVAA 2ZSEA 5THQA 1CCWA 3BAZA 3N6XA 4GOOD 5KQRA 1LKZA 1VIVA 3DZKA 4XCVA 1M7BA 1DTWA 2FFHA 5GZ6A 5IJXA 3C7AA 4WSOA 4IJMA 5D3MA 2V45A 1KAQA 1VJ0A 1V7ZA 2H18A 3GNLA 1FDVA 2NUAB 4B3XA 2WAXA 1WVGA 5EMKA 3LTNC 3VO2A 1HORA 4RNCA 1BKDR 2QVBA 1ZNYA 3EZ6A 3IDOA 1AB5A 2HA5A 3NKLA 1ZWKA 1VJGA 3CPEA 3H84A 4Q1AA 1P2GA 3HJHA 2OSVA 2PQ6A 4G0YA 1MG0A 3M6LA 1MIOA 1EK1A 1EFDN 3EA5A 2B3TA 3ECSA 1W0JA 1T8TA 3HU5A 3WRVA 5JATA 3L1VA 4FSDA 5J3JA 1O3YA 3EMBA 1GFZA 1SN7A 1ZI6A 2GN6A 4N5MA 4AG5A 1BDJA 1XXHA 3R3SA 4XQCA 4DMUB 1I7NA 1JI0A 1U1GA 2ECKA 1UC8A 3P5SA 4J76A 2IY8A 2W2KB 1YBMA 1GU0A 3GZNB 2XRZA 2ZRDA 4FHCA 2J5RA 3X2SA 4AKEA 2Y0DA 2C92A 1OI7A 1SCUA 4LMBA 1XI2A 2J9XB 1R6DA 3TFOA 4ZRMA 4ZVQA 3LW8A 3QPWA 4YRJA 2LCQA 4XGRA 1C3EA 3GZ4A 5B3KA 4W5HA 5KS2A 2PFKA 4RTPA 4LXIA 5BW6B 1Z16A 3WYCA 2P2SA 3RVPA 1IULA 3DCJA 3ENQA 2GCPA 4HGZA 5T57A 3ICWA 1V3QE 1V3UA 1SQ0A 1VSTA 2FZCA 2H9IA 3FTNA 1A9QA 3QLUA 3V33A 1Y34E 1O97D 4MGZR 3VPDA 4B8WA 2XSZD 4Z9YA 2BYTA 1R9NA 2HPAA 4GE0A 4A8TA 1E96A 3G0GA 4HDKB 4ZOLA 3LL4A 4FEAA 1KZ4A 3SJAA 3WAGA 3EGWA 1DHRA 2PMDA 3NHBA 2B20A 5PGMA 4HX5A 1FU4A 2VWQA 2OQVA 1R4MB 3I39X 3PNVA 4K3VA 4A92A 3VNQA 2WMNB 4Q18A 1XK7A 3ISTA 5E7IA 5DXAA 4HATA 2ATXA 3R0QA 1CKEA 4G0MA 4IBOA 1KPGA 3EC2A 4KQHA 1CZKA 1CZOA 4K6MA 5CYOA 1U2TA 3KZNA 4A16A 5K6RA 2AMLA 2JH8A 3ZWPA 2I8LA 3PZRA 3CT4A 1A5AB 1JLHA 1WKBA 4JLDA 1KZGB 2KHZA 4NYIR 3JZAA 4DIOA 3C8DA 4CFSA 4G56A 1EAYA 4D9GA 5BUQA 1SR8A 3DOHA 4MYUA 1NXVA 4YALA 4IIJF 1XQ1A 5H1YA 4CFZA 4B3RB 4MR7B 1J22A 2H3EA 5JXWA 4YEDA 2O1SA 5BP7A 2JI4A 2OBNA 1QG4A 1TLLA 2QS9A 1WB4A 4MQMA 3VYWA 2NTVA 2QN8A 3PHHA 4B7CA 2QF7A 1I9CA 3CVOA 1KK1A 2CNWD 4YMLA 5I4IA 4FBLA 4IIEA 3ZE8A 1T9HA 4RTOA 1PVDA 1UBCA 1RLIA 4CDNA 1UIMA 1PAUA 2SNIE 4NYMR 3ASVA 1ORHA 4LJAA 4IUYA 2BL4A 2HHLA 4DA4A 4NNJA 1DBSA 2QE7A 2VF8A 3L7BA 4IV5A 5CIWA 5BRNA 1F1JA 5I7AA 4LNHA 3LKZA 4FGUA 5IM4F 2ZIWB 1RQLA 2CNNA 1E89A 2IPAB 3K6SB 4N47A 1JBQA 4URYR 1BCRB 4AMYA 1TUBB 1M76A 3BQNB 4QRIA 1B2RA 4J0EA 4UBKA 1YZKA 1Z7BA 2YJNA 1Q3HA 3HWX1 3MTAA 3RASA 1JWAB 1RAHA 1RAEA 1VE9A 4Q9DA 4KI7A 2GBCA 2I7CA 3P1JA 3RGWS 1BXGB 3X1YA 2CY0A 4F3CA 1DFIA 4ENRA 4X20A 2YY7A 3F5DA 1AM4D 1Q2UA 2D1QA 3BWYA 4H6XA 2HHJA 2FHSA 3AUKA 1YR1A 1XPUA 2ZZNA 2A2ZA 3IVGA 4JOCA 4LX0A 4QUIA 2C2GA 1CJMA 1Q1BA 2FWNA 3NEYA 2BC9A 4BFUA 3L93A 4PFQA 2QIPA 3BIOA 4PYMA 1IM8A 3WJ2A 3WQBA 3S8EA 5FBVB 4BLQA 1CDOA 5CIQA 5ICGA 2YZNA 5ISMA 3E9CA 1PJZA 2P7IA 1NQXA 1VLZA 3RAFC 4N48A 3UG6A 3FYDA 1XCLA 1A97A 1FSFA 4MW4A 5AVUA 2GYUA 1NP6A 3OMWA 5A04A 3K70B 2AZDA 2OP0A 3EOZA 3SKYA 2VL7A 3K1YA 3X3HA 4E5UA 4PGAA 4M0FA 1NJSA 4Y2TA 5IWAB 1L5QA 1KDOA 2AZMA 4W7IA 4UUNA 2VAVA 5TGZA 3F98A 3RIGA 1XPJA 1WF3A 3FYUA 2WDPA 1H3NA 4ZU3A 1DTWB 2WTXA 5D3MB 2B1QA 1P3Y1 4YQZA 5I9SA 4I1RA 3AESA 3ROFA 3ITKA 4TZ0A 3LQ2A 1L3IA 2XUPA 2QAGC 3FWHA 4PG4A 1WY5A 5DU2A 5BYJA 4PY2A 1DT3A 3RSZA 4ITRC 4B2LA 2WWXA 4HGQA 1FDSA 5LXTF 4MEBA 5GY7A 1MIOB 1CW2B 4AMGA 2FEPA 3MS7A 4NU5A 5A9SA 3D7MA 5ALJA 3UWPA 3ID6C 5EJ2A 2EJCA 3M6UA 4UVEA 2P6UA 1C9JA 1D09A 4LZPA 4CCWA 3VNRA 1XXHB 3H86A 3HR7A 3MWDA 3M9LA 3C3JA 1SRRA 1QIGA 1SXJD 5CUQA 1ICEA 1VE3A 2V1XA 2NX2A 5J4KA 1YNSA 1QVAA 2EAUA 5AM4A 2PLAA 1SCUB 3KQVA 4TLAA 1ESMA 5DASA 3AUJB 3CJQA 4I99A 4XARA 2KPOA 4Z2YA 1FFEA 2OXEA 3I32A 3R44A 1QTIA 2BFDA 4YUYA 3UENA 4Z51A 5JASA 3R76A 4JYZA 3QY0A 4TTJA 4JJ6A 5B55A 5C1OA 3AT1A 2PWPA 3DEKA 3QG5A 1E0SA 1TU0A 2CKMA 5KKAA 4OQDA 5E9JA 2ZS8A 3GLIE 2V98A 3TEFA 4JU9A 2BGIA 4JT9A 3PKZA 2XODA 4ZEXA 2QRKA 5B57C 3ECAA 5JCJA 3X0DA 2QTMA 1W76A 1PUIA 3FOEC 4ZCTA 4MJ7A 3PCXA 2I6GA 3K35A 2XMCA 2NTJA 4B8YA 1XRPA 4UPEA 1EK0A 4X3PA 4XTCS 4ZOLB 3HDHA 2DT5A 3WKDA 3QOFA 4BX3A 4ZHQA 3IPCA 2VHVA 1EP9A 3TL6A 4G1EB 2A1TS 4ZMBA 1X7HA 2QGNA 3HY3A 4WFQA 4OXIA 4YRLA 3BSWA 3ESAA 4KODA 5AVQA 4XEUA 1Y7HA 4RM3A 3VR3D 2X0DA 2RGGA 5JSYA 3GJ0A 5SY4A 1ECBA 2OE2A 4HKTA 2JCVA 3E6AA 4FZVA 3TAXA 1HRDA 3FYCA 1PUJA 1C9DB 3DQZA 4JP2A 5BRJA 4I5EA 4OM8A 2AMJA 3UCFA 1LJLA 5KX5F 3B6ZA 1J0BA 5F23A 1JHAA 1RVV1 4H59A 2R5WA 4F5DA 4YMUA 1QP8A 2VRCD 4L73A 3WL5A 1ZEJA 2X2OA 3FZGA 3IYLW 1DAKA 1TZKA 4U39A 3ILSA 4ISBA 4TTVA 1KWKA 4IHQA 2GEFA 3KWFA 3D8UA 3U9LA 4Z6KA 5BYAA 3KZOA 2O59A 5CGZA 3CZ5A 2QROA 4QU9A 2P1RA 5DLEA 1M5UA 1G7RA 3Q6NA 3MN1A 5C8YA 4DQUA 1TCCA 3TMAA 4ZAYA 5CJJA 4DLXA 3SM9A 5E3IA 3CBGA 2CLHB 4MXDA 5HIMA 1NC1A 2YC2C 1GG5A 3QUQA 2EKPA 4HNGA 4RLFA 3E53A 3RFFA 4EAQA 2R7LA 3B3AA 3KHSA 3OD1A 1P33A 4BKPA 4ME6A 1H42A 5AXAA 1D1TA 4PYOA 5CFNA 3IILA 2W83A 2G1JA 5ANRB 3VKUA 2VDWB 3D4PA 3LECA 4FDVA 1ZMBA 1S8AA 2B4YA 1R9MA 4HJRA 4PX2A 2ECFA 5B30A 3TW4A 3LDUA 2QVYX 4GMGA 2HMWA 1LPAB 1U9YA 1O95A 4TKMA 1TD1A 1I4OA 1VBMA 3SI7A 1L4MA 2H0QA 1QBKC 2PRIA 3H9BA 3M5CA 4FP9A 4OATA 2XUIA 2I87A 3HEAA 1EI9A 1NL3A 2V5AA 2WNSA 2QK4A 3BE5A 4X20B 3KR9A 1X77A 4GVXA 1L5HA 3TDKA 3DPSA 3KE8A 4JC0A 4MV3A 3WLJA 3CMMA 4KQCA 1ZIPA 3K5IA 2PM8A 2VK1A 4NPHA 3FSEA 4BNZA 4V2UA 3T9DA 1L7AA 2A0WA 1Q0PA 1VKNA 4LI0A 2CMFA 3IAAA 4LFBB 4YFVA 5C4MA 1G8FA 2C57A 1GG9A 2JI6A 2OBBA 1QR2A 3E9ZA 3LHFA 3OX4A 4ZALA 2CVPA 1HM5A 4YRCA 1P2FA 1T9ZA 4EHLA 5KMGA 4MWSA 4M1EA 3CNNA 3VNVA 1UPAA 4TKZA 4DA8A 3CPJB 4NK5A 3QZUA 4ZV4A 1ZIDA 1XQ6A 2NTEA 3AR7A 1CUYA 3QLTA 5JHHB 1F14A 3L0IB 2DZDA 2OB1A 4FXOA 3IBSA 4F2HA 1Q44A 1QF7A 1T43A 1OTYA 3VSAA 2JFPA 2EP5A 1LRJA 3GLKA 3IP3A 5F2OA 3TVYA 1FYEA 3FYUB 3S2EA 3M6AA 2HD4A 1PWHA 3LXRA 4P08A 3HXKA 1L7EA 3JPWA 4R01A 1OWMA 4JNCA 2D4AA 3DBLA 2JGFA 4E7OA 4F46A 3ZWQA 2YJTD 3AESB 1OFGA 2A6PA 4GLBA 5EZ5A 3QWFA 3KOWA 3BJIC 4RACA 1W8DA 2PZJA 3Q9UA 2YN2A 4BEWA 2I2CA 2H8GA 2HA4A 3Q3CA 4QQFA 3D0QA 5A9SB 2J33A 3DMFA 3B3JA 2YWFA 1ENZA 1KE1A 3QMMA 5CNKA 1CUVA 4MCHA 3W5SA 4DZZA 4V0SA 2BGGA 2ZGVA 2ZUEA 5I51A 4ZQBA 3ADDA 5AH0A 3A9SA 3DE0X 4TWAA 1XD9A 3MWDB 2PSJA 2P8JA 3DFKA 1JLRA 4X61A 3IIJA 4XEHA 4RX1A 4P7GA 5H0IA 1FXUA 2V5VA 4AG6A 4YAIA 4KK4A 3BFJA 1NUQA 4BO5A 1B93A 1KR2A 1P8JA 3ICQB 5A4AA 2ETVA 4U00A 2DQKA 1N4DA 4OBBA 1TVCA 1QR6A 3H0CA 4D92A 4XDHA 1F12A 2BCGY 3OPYI 4GRAA 3JR7A 3RS8A 3KJIA 4GI7A 2RC5A 4RK5A 3ZX5A 4CM8A 4BVFA 2O2EA 4D98A 1KSJA 2BR5A 3ITEA 4KWEA 3TUIC 1YE3A 2QSJA 3WZLA 2LXNA 1AS3A 1J9ZA 2F8MA 1RMYA 1UBLS 3MGGA 4PAQA 4PPYA 3ONWA 3VR5D 1FF9A 1N77A 2FETA 4F9FA 1J8DA 5JMPA 5DNCA 1CRZA 2P41A 2GEUA 1C50A 4RKRA 4XR9A 2HX1A 2PFSA 3IR6A 4G4JA 5C2JB 1O9GA 2Q6TA 4EI8A 2HI0A 1EQ2A 1E2PA 1R2QA 1N2CA 4BGDA 3UTDA 1NQUA 2BFBA 3EC7A 4FHZA 1A04A 4YFYA 4DDVA 2ZFUA 3J7AC 2BR4A 3NCTA 4F5ZA 5B7NA 1NY6A 4EMTA 1M9NA 2LD4A 5P21A 2P2NA 2WUGA 2QNBA 3AKZA 1C4XA 3RF6A 1SD1A 3LBFA 4TT8A 3KPYA 1MFZA 4TMFA 5C0OE 1TRKA 4KR0A 3AVYA 5F1YA 5F3WB 3E1KA 5HJ7A 1X74A 4YJFA 1Z0ZA 2QLLA 1ZLYA 1JDNA 3F2VA 4B6SA 4EZBA 4JX8A 3UJ3X 2HH9A 2PA3A 1SOUA 2NLOA 2XGSA 5FD8A 1FP6A 5CFLA 1XQWA 4FZRA 3QVUA 3IO3A 4Z4CA 3UMRA 2J59A 2PRZA 1VJ1A 3QU4A 1KY4A 4AECA 3ZGOA 3H5WA 1ACLA 3PEUA 2IYAA 1CB7A 3TLMA 5KSOA 5C8YB 5HF6A 1KDVA 2IYOA 3F5QA 5LKRA 3TGWA 5JALA 1I1NA 5T4EA 2H1RA 5KNDD 4CF4A 4BE9A 1U0NA 1GNPA 2OBFA 2V7QA 1XZIA 1NI3A 3ENWA 4Q4LA 2FTKE 1F2TA 1NNI1 4DIBA 4ZC8A 3T34A 2ZRGA 2JB9A 5IN4A 1YB4A 1VI6A 5L4LA 1G6HA 1RLOA 1I0IA 2EL7A 1MF7A 3I3OA 3LE8A 1QFJA 4CUJA 1P6UA 3ANYB 3D0OA 2EP8A 4LZAA 3ZHVA 5HUHA 5I4CA 5JD5A 3GLHE 4B2IA 1R5BA 2ODWA 1VB3A 1U90A 4U1RA 3TOVA 3N58A 2Q28A 1BXKA 3ORQA 2OZEA 3K2EA 2DJIA 1XD2A 4KDEA 4MWTA 4UFOA 3O4RA 4DM3A 4EATA 3GLGE 3PGMA 3ZTWA 4TUYF 1SOAA 3KKKA 4RU1A 3ZHZA 3C0KA 4M1WA 1NSFA 1WSAA 3QPCA 1L5HB 1NQTA 2ZAMA 3ZCTA 3U6KA 2DM6A 3G9ZA 3HCNA 4QPZA 3L8EA 4W4TA 3D6FA 1W36C 3LS2A 2F59A 2HIHA 2YNMA 4P5EA 3BL8A 4JITA 5ARDA 3RFUA 2WG1A 1JL3A 1Q50A 1HTWA 4QT0A 4F45A 1NM5C 3SU8A 4YRMA 5L6MB 1YL5A 5HQTA 2QI9F 4R1QA 3T3EA 1EXMA 4IJUA 3OOWA 1NYRA 3DVLA 1XX6A 1U3TA 2DU8A 3WIUA 2PSHA 3Q9LA 3CLHA 1J5PA 2CK3D 3WL3A 3ZZMA 3IDZA 2AG5A 4B4OA 4DRXA 5EIBC 5KMGB 1JIQA 1XT6A 4C4PA 2TYSB 2GM3A 3CNOA 1CYDA 5TDHA 1NVTA 3WYBA 3KVNA 3RVQA 1II8A 1V16B 3MJEA 3OAAA 4D02A 2HRZA 3HFRA 4JL6A 1K98A 2ZSBA 3EXEA 3ABZA 1FC0A 2RBKA 2WT8A 2Q4RA 3KFXA 4M9QA 1MBZA 5AJXA 3VOBA 5C7YA 1Q6ZA 4GT1A 1FNNA 2WUDA 2ZSHA 2QRZA 4Z54A 4ETNA 1QYXA 4CDMA 3C45A 3DBLB 1GGMA 4HH3C 2R3SA 2ACKA 4MLZA 4QDUA 1TLTA 3VSEA 5BUZA 1ZH8A 1ZOPA 4ADSG 3GELA 2IXFA 1TC1A 2KBEA 4DWVA 4CKYA 4P58A 5LNK1 1DE0A 2I22A 1HYHA 3OIGA 1I36A 3BTSA 3BXFA 1G3MA 3SYLA 3DOCA 1T4MA 1XL0A 3AR5A 4PVCA 3HNRA 5L4NA 4WV3A 5DRTA 4OGFA 1Z8DA 1WUTA 5EPEA 1XTQA 3VH4A 3D7RA 3HA2A 3TGPA 4JXXA 1QO0D 3SIWA 1OE0A 4IQGA 1Q91A 1KE2A 1XZFA 4DSZA 3A0UA 3KU1A 1H5NA 1TO6A 4AY2A 2GAOA 5ALQA 2VP3A 2YQ4A 4YRGA 1YHYA 3TSAA 3EUAA 3INGA 3D02A 3NIGB 1F0PA 5G0TA 4DXDA 5CVVA 4DCGA 3ADBA 3QK7A 5CHEA 1W5EA 4PZAA 1YRYE 2IDMA 4UVDA 5G41A 1NC3A 5JJLA 4H7HA 4A6DA 1JKJA 1Z06A 3H4VA 1UZUA 4CM8B 3GBVA 4N6NA 2FOXA 1RPJA 4L72A 2OBLA 1XU4A 2XEDA 4QODA 2GN1A 4DCSA 3VZPA 3MWEA 3SFVA 1BTOA 2GUWA 4FZ5A 4N9QA 4KH1A 1NATA 2C97A 1C81A 2UUAB 1WU7A 1ZY2A 3HHEA 1HEUA 2R6AA 3FBTA 2MSNA 3FRIA 4FT4A 5FLXA 1YQTA 4A2PA 1JR3D 3GJ4A 5IT0A 4TRJA 4IKEA 3ZY5A 1QV7A 5FOVA 3N6RA 1TCAA 5FQNA 3FOZA 4PSVA 1FX1A 3ZWYA 4DR3B 4WECA 4A5OA 5COBA 5CDGA 1Y8QA 4JBXA 5IUJC 1G8HA 2O2DA 3MWKA 1CDDA 2B6NA 2BFBB 1L2TA 4QUKA 3U9TA 2IX9A 1QKJA 3DDHA 4REOA 3GUVA 2J6HA 8AT1A 4UXHA 5J1TB 3L0BA 4INJA 3LY7A 5LQRA 5IJAA 1C4KA 2W2VA 3HXTA 4ALKA 1VXRA 1LBTA 1Y0BA 3BWXA 3PIRA 2FJPA 3N2YA 4II2A 4PZCA 2Q50A 4UHDA 1XCGB 4PE5B 3HA3A 3K6JA 3QLVC 3GIDA 1N4AA 3TZCA 5JEEA 1ZHOA 3DDUA 4WZBA 2NADA 4QIHA 4YJFB 1XDWA 2HF2A 2PCJA 3P19A 5DGIA 2SBTA 3Q1LA 1A9OA 5F4ZA 3U4DA 4AK9A 3GG9A 2WWYA 2QPAA 3S3TA 4MVXA 4EZEA 4CQLA 5J2TA 4LJRA 1J56A 2XAUA 3OEHA 4NI5A 1ZR2A 4OYLA 3TCNA 4NCIA 4FI3F 3CRNA 3EZYA 3LCCA 3DW3X 2HA7A 4MUMA 1NVAA 1TU4A 1T9GR 2BY4A 1MDBA 4XVQA 4D79A 3KT0A 4XLZA 1G8PA 4P3KA 1G291 3CKKA 3PRKE 3R2JA 2PRSA 1F2TB 4KV9A 2NO9A 4WY2A 1JR2A 5E1DA 5A3RA 4RH1A 4DV0B 5GJWC 3PC8C 2INGX 4YRPA 1ZXBA 1UBTS 3OC0A 2FPMA 4JVNA 5AI9A 3CUEF 4XFDA 2AYXA 3RT7A 2H1CA 2VZEA 3LBIA 5JS6A 1ND6A 4BGEA 3MT0A 5LQDA 1Z2EA 4IDNA 4YT8A 2I2FA 2Z2XA 3GFBA 1VZ3A 2WT4A 1IWPB 4OHCA 4Y98A 5DMHA 1SG6A 3I9MA 3T3DA 1RPZA 1XD2B 2YHIA 2ST1A 2HXSA 2JJ2D 3V1NA 4CL8A 5A5EA 5K4HA 5KNCD 1Q0RA 4EFMA 3H1TA 4C2TA 1U8ZA 1CQJA 3C98A 3WISA 3BILA 1AMOA 3T7TA 3DP7A 1Y4SA 4Y2YA 3W78A 1QTRA 3BRQA 4TKVA 2ZTHA 1ZZGA 3ET4A 1K4MA 4EY4A 2XUHA 4OK6A 2PWBA 1LNZA 1DLIA 4ALJA 2CKDA 3EVGA 1LVHA 2MSLA 3EVCA 4AC9A 4BUJA 2XA9A 4YY3B 3DPUA 4INOA 5HCNA 2BCJQ 3C3DA 2Y05A 1OH8A 1NG9A 2GXUA 3JQRA 4U7PB 1NHWA 3OPVA 2B4KA 2R79A 4G5QA 4ND7A 4HRAA 5FTWA 3KKLA 1MENA 1M10A 3WFJA 1GITA 4BNHA 2F2TA 1CQWA 4PYNA 4QRDA 1KYWA 4M83A 3UHOA 4I5FA 3VOTA 3N28A 4DRXB 3BGOS 1CNFA 2HJHA 3LUJA 1M72A 1TM5E 1X1QA 3O4JA 4KE8A 3MLEA 1TK2A 3G88A 2YBEA 2YWEA 1RKXA 2J6CA 4HJXA 1II8B 4I2NA 2WOOA 1NBMD 2XBUA 3Q3JB 4DCCA 3EXEB 3H5RA 1I7SB 3CZ9A 5SZIA 4LHZA 1ZK0A 4ZICA 2IH5A 2ZSAA 3RRYA 2JVIA 3U7IA 5HJEA 2J3JA 1V41E 5I7UA 4Q00A 3OI7A 4QECA 2CUZA 2Z8ZA 2OMEA 1DIOB 4I1SA 1UANA 3PGLA 1M6NA 1U81A 1MC4A 2KYRA 1T2VA 5HZKA 5I5EA 2R48A 3UXYA 5BVGB 4FLMA 1SU4A 2IKSA 5CAEA 1FLVA 4RVOA 4G4IA 1FU8A 3EPLA 1NF3A 1B14A 4ALNA 1KYTA 1V1JA 5KNDH 3QFRA 1Q57A 2UYCA 1UMCA 4V1CA 4PO8A 3LVBA 5LNK6 2HSZA 2JAWA 1R12A 2WPDD 4OH7A 4RPJA 4DDUA 3PTAA 3PEWA 2PGNA 3TOZA 2II6A 3R3YA 4FOSA 4Y1FA 3PGA1 1MG5A 2I3DA 3RG8A 2D06A 1SXJC 1NN3A 1YBHA 1RNLA 2XQJA 1OFTA 4D6XA 3IMGA 2AOTA 1GVHA 2PZEA 3L79A 1XMSA 1L8LA 3QMWA 3QI7A 4MUEA 5B1SA 1HDCA 3Q12A 1EVKA 2I1QA 1GGFA 1LXCA 3CZCA 4LSWA 3MTEA 3DW1X 4WX2B 5EHQA 3AVTA 4AX8A 2HJGA 5J23A 4C9BA 2EBHX 3KRTA 1JKJB 3J80A 1D2NA 2JKVA 4P7JA 4CV0A 2WMYA 1VA5A 5A5FA 1W5FA 2H0AA 1JPNA 5ILGA 4Y2RA 3T06B 1L8QA 2M6SA 2OGUA 3GMSA 4YT2A 4N9WA 3CVUA 3MWEB 4GSLA 4DQXA 3LCUA 5FCDA 5K8CA 1GUBA 2HWXA 4FX2A 1AHNA 4E09A 1KJ9A 1SKYE 1WXXA 2YZKA 4WNCA 4MX8A 3HUDA 4N8SA 4R9RA 5JSFA 4D9JA 4YAGA 2NZYA 1SXHA 2C61A 3CC8A 3JCZA 4BB9A 1E59A 2XOEA 1NXSA 4H1UA 4I6GA 1QIIA 1YIOA 3WLMA 1EAMA 4V0ME 3MCTA 5CLLA 1KI1A 3DZHA 1Y8QB 4JBWA 2FR8A 2CFTA 5HMMA 2JZNA 4I9HA 3OFSA 3HJBA 3VV3A 5CR9A 1GZ4A 4TLEA 2BGTA 3FDXA 5CFPA 2PFGA 2QZSA 1YS6A 4TMVA 1NVFA 3DV2A 5EXSA 1PZEA 3VDNB 4WW0A 1CRWG 1QH8A 3Q0IA 1K8ZB 1LCIA 1DQRA 3JQCA 4RHTA 3GD5A 3H5IA 1KXJA 4OXKA 4V2IA 2CJPA 1C30A 3BXPA 1YV9A 1NR5A 2PH7A 1E77A 1LSSA 4PNPA 3SZGA 3TCXB 4WZBB 1N5KA 4FYIA 5BSTA 1TGVA 1UADA 3LFTA 5DTQA 5HEKA 4GX5A 5CW1A 3Q1KA 1JAZA 4Q9AA 4WLUA 1XFAA 4Q1DA 1S2DA 3E5MA 3O75A 1X8KA 4Y2SA 4ZVRA 3I12A 3SVZA 1Q7CA 4M1ZA 4R3UC 4CQLB 5J2TB 2YRFA 1A1SA 4MW6A 4MRRA 4QULA 4YS6A 5F2KA 1XHFA 4C29A 3ZH2A 3G2QA 4RPCA 5FUBA 3VDQA 1KR5A 2JHFA 2QRHA 1HT1E 1ZCJA 2NQ8A 1QPGA 4QYTA 4RXMA 3LBYA 5SZJA 3ZE1B 2J0EA 4WZAE 1YD7A 4BDTA 1I2BA 3BA6A 4PYRA 2ZRKA 3M6VA 5AW1A 4JELA 3N2NA 1JQEA 4Q9IA 2DHDA 2ZU0C 4GGMX 1IVYA 4ZCMA 2A35A 3ZJVA 1ESDA 5G4LA 3L92A 2NAPA 1CJSA 3BXGA 3GFSA 2FW7A 3T7IA 1D2HA 2E48A 2VYVD 3I2KA 2W6OA 1MOPA 4M4SA 4WFKA 5GINE 5HF8A 3DEZA 4DAOA 2DYKA 2I55A 2FN8A 1BO6A 1J9GA 2CC2A 4G0OA 3DLHA 1IMOA 4D3DA 3WGJA 1HOTA 2WA1A 3HABA 2C83A 3AI1A 3LY5A 1L4KA 5LKAA 4BLOA 5E1BA 4ETIA 3V4SA 5DYIA 3AI3A 5DLPA 3N8IA 1AOXA 4X6YA 2YHIB 2CFCA 3ZV6A 4GHWA 3VYVA 2DY0A 3PNLA 3BFVA 1JG4A 4X0EA 4Z7QB 3RM3A 1CQJB 4XI9A 2IF0A 3TPZA 3AK4A 2NP6A 1FS6A 1VDZA 3NFRA 3ZCVA 1XTRA 2G72A 4FFDA 4KGXA 4TKVB 3UKOA 1SKMA 3GEPA 3U26A 4QD3A 4ZEOA 2IWRA 2YJZA 1TLFA 3V1MA 3VPSA 5BSEA 2JIDA 2X7XA 1L4FA 4FEEA 2RGXA 3CF4A 4RMIA 2F9MA 4HQ6A 2OV6A 3FNRA 4OIFA 4YACA 4BEBA 1E94E 3S28A 3DMHA 2W2QA 2QJTA 3DHWC 1P1IA 4I1PA 4P93A 3PXDA 5HG0A 3H42B 1XZPA 3ZGLA 2XE6A 3Q87B 4JENA 2FRXA 5A5VA 1HZJA 3NOOA 1T1GA 3VH2A 5AUQA 4JDPA 4KXUA 5SY6A 5CFQA 3E9DA 1E1YA 2W11A 3H9CA 5ECYA 4O3MA 1TK3A 2BFOA 2BKLA 1I7PA 2FPLA 3U3OA 4UJ3A 2XDYA 3I09A 3EBOA 4GVLA 3ND6A 1YVUA 2DQYA 4BKRA 3DVAA 4ZAGA 1ZFNA 2VF4X 4NKRA 3WNVA 1YQQA 5T4BA 1HNWB 1UKYA 2G1KA 3NETA 4UNQA 2WOJA 3ZS8A 5JNRA 3E9YA 2ZB3A 3I9V1 1H0SA 1T5LA 5DHAA 4U2GA 1A4XA 1PEYA 2WP0A 3N53A 3ZE6A 4OI0A 4FR0A 1QFSA 1YTLA 3TLKA 2O6HA 5C81A 2HRCA 3VVBA 1IYZA 3EIWA 4HPWA 3RCBA 3TD9A 4ZZ3A 1U80A 1U1FA 3OJFA 3QFCA 1GDDA 3DNPA 5CAEB 2EFCB 3VVMA 4BRZA 3ZYZA 5JANA 1M8PA 2AUMA 3ZIDA 2WIAA 3IIIA 2W6PA 3CUVA 2GA9A 2E3JA 1EWKA 1UMCB 3AUTA 1T1EA 3PS9A 4RYLA 3RBXA 4V1CB 1L8XA 4QOFA 1JW9B 1AUXA 3OZ7A 1E7QA 3HRHA 2R2GA 4MVCA 2JDIA 3NG1A 1DAMA 1Z3IX 2C99A 1RJEA 1OFUX 2AOTB 2B3DA 2C2MA 3C3KA 1L7MA 2M32A 4RVNA 4XH9B 4HB0A 4DWWA 3M4JA 4WFJA 4PN3A 3RODA 2YXPX 4ZHSA 1KKMA 1U0FA 4DKXA 1OXUA 4W1SA 2RH4A 5ALIA 1DCFA 3DQQA 3QTTA 1G8GA 3KQMA 1UBHS 2PX5A 1AVTA 1A9RA 4MGKR 1KSFX 4N7JA 1WHTA 1X8JA 3MUEA 2R62A 4R81A 3LOQA 4IXMA 4ZT4A 5JJ5A 2G3YA 3LX5A 4U5XA 3TGLA 4NCAA 5LCXA 1E6UA 3DP9A 1T8UA 3AJRA 4HQRA 4RCVA 4CEIA 2Z1MA 3IUYA 5DWQA 2P27A 1NN5A 2J5XA 4KO4S 4Q3LA 3WLRA 5GZ1A 4UASA 2JD1A 1P5RA 4ARZA 3GFRA 4KNYA 1M33A 2FQ1A 5A9TA 3K8QA 2Q7OE 1K63A 5KC9A 2ASEA 4QASA 4KI0A 4HS4A 5KOHA 1QG0A 1ODCA 3ROQA 4HBZA 2J48A 2GJSA 4AL4A 5CD1A 1VG1A 1IK6A 5IHPA 4KFSA 3RVOA 2Q5QA 4PS1A 3Q5EA 3OOJA 2OC9A 4W9RA 1CY6A 1QFYA 4YRRA 3K70D 3U56A 4ZCLA 3F6CA 1GQOA 3R77A 4QDXA 5A4JA 4JVLA 1QH8B 3IOCA 3NBXX 1BE8A 4O3FA 3HH8A 2D5AA 1ZO8A 3F6SA 3KOZA 4HLQB 2V55B 4F96A 4NBLA 1IN4A 1GPWB 1C30B 5D5PA 1G63A 3ZV4A 2ZUCA 3HFJA 4BN0A 2MR5A 1SCDA 2P6RA 4BE7B 1D6NA 4G81A 4QTUB 1IPHA 1FPMA 3OZAA 5I7EA 4C7VA 4CF5A 3ZV5A 2RI6A 1EHIA 1IHOA 1SUPA 4EYGA 2UZ4A 3ESQA 2VTBA 1YGPA 1J8YF 3L77A 3B5IA 3ENNA 1FY2A 3HNPA 4LA4A 4OMDA 4TL8A 2FRDC 5TQVA 4DVJA 3V55A 4FOPA 1L5VA 5H5JA 2OCIA 3SZ3A 3EZ2A 1DDIA 1X9HA 2XIQA 3EVEA 5BVHA 5FHRA 1HDGO 4QAJA 1W5BA 4YJHA 5KSZA 2EX0A 2HK8A 3I9JA 4GPIB 3NX4A 4EYQA 3GJ3A 3R3XA 4IQ8A 3LXXA 1IM5A 3PQEA 4RHUA 1J9EA 4S1VA 4KR6A 1T6YA 4KXFB 2C3MA 3GRUA 8ABPA 2YYAA 3KOYA 3BWDD 2IS4A 2WDZA 2IYXA 2OD7A 4A0FA 1B76A 5E95A 3W8NA 2O48X 1A8IA 5JC8A 3OM8A 4UM7A 5A7GA 4A27A 1U7TA 5EMMA 3M5WA 4BECA 1U5BA 5J43A 3PPXA 3FHTA 3ETLA 1GPUA 1UBKS 2D3TA 4F12A 1YBVA 3G8DA 4LXXA 4U7DA 3QE9Y 1SVWA 3J81k 4RORA 1PS9A 3GG2A 4S05A 1E7MA 4XIGS 1F4LA 2JGIA 1IHPA 3JQAA 3SJCA 2JGJA 2ZI5A 2JFNA 1CG6A 2G25A 4DC0A 3H18A 2QMEA 4JKYA 5LLSA 4F7WA 2D1RA 3N39C 3D6JA 1YRLA 2JAUA 3UPUA 2WKPA 1NJ2A 1JUDA 3CGWA 2HR1A 5J1SB 1QGZA 4GQAA 3UTCA 4OKIA 2DBYA 5KBYA 1LNSA