4YBZA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
463
structure length
462
Chain Sequence
b'NDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
molecule tags Ligase
source organism Korarchaeum cryptofilum (strain opf8)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
total genus 178
structure length 462
sequence length 463
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4ybzA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4ybzA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ybzA01
2IXBA 1K3TA 4XYEA 4M55A 3BTVA 4MVJM 4WCFA 1LU9A 3OM9A 3LYLA 3DQPA 4PFJA 2VYVA 5C3MA 5TJ9A 1DIHA 1DFIA 1A7AA 3GZNB 5JO9A 1SOWA 5GZ6A 1X15A 4CQMD 3DHEA 3GEDA 3ZW8A 3WJ7A 1R4MA 5KJCA 3BMOA 5KWEA 2Y1DA 5F5LA 1CQIA 4TRJA 2NM0A 3WGZA 4BB5A 7ADHA 2AEFA 3K5PA 1GU7A 3K2EA 5T57A 3OFSA 2CDAA 3AUSA 1ZK0A 4J7UA 3M1LA 3OIGA 1NYTA 3DAPA 4GL4A 3GMSA 1IPEA 2HMWA 3E6AA 1K2WA 3JQBC 4WLNA 3N74A 1ZO8A 1DRWA 1YQDA 3RUDA 4HADA 4BO3A 3ZWXA 2OFPA 3W1VA 4E32A 4ZQEA 3F47A 4IIVA 4XEHA 1PX0A 4QQRA 1QV7A 1XR3A 3D0OA 3JQEA 3H2SA 2NVWA 1PJ3A 3GQVA 1I3LA 4Z9YA 4BO6A 1E77A 3AK4A 3R3JA 2X23A 3FCOA 3AOEC 2QZ9A 4BQRA 2AQ8A 4IS3A 4BS9A 1R37A 1K6IA 5A06A 5L4NA 3I9KA 2WD7A 3WFIA 1M75A 4MKRA 3JV7A 4GVXA 4DPLA 3H9GA 4TRNA 1N9GB 2DFDA 2IRWA 3GRKA 4UUMA 2NVUB 5JAQA 2PA3A 3BMOB 3B20A 4UUNA 4ZHSA 1IUKA 2AMFA 5ADHA 3A28A 1P0CA 1U3TA 2EW8A 3PXXA 2CNBA 1TI7A 2YQ4A 1ARZA 3GDOA 3HN7A 4Y8VA 4BNFA 3JQBA 1SB9A 4XR9A 4IJKA 4WK6A 3MJCA 3PFWO 4IPTA 4IS2A 4TVBA 4ALMA 5FEUA 1HZJA 1P44A 3W4IA 2FSVA 2GCGA 5CDSA 4N54A 1I0ZA 4YJGB 2I9PA 4K28A 2BMAA 3NT4A 4WASA 3WR5A 3DOJA 5H83A 2XXJA 1ZSVA 4DPMA 2P4HX 3G1UA 5EERA 3PPIA 2VWHA 1JKJA 4IGFA 4JX8A 4E2ZA 5BSHA 4J7XA 1JN0A 3DO5A 1LBEA 2G1UA 2PLAA 3W8DA 4J43A 5ICMA 4Z0TA 1B7GO 3K92A 3C8MA 1SOVA 2Q1WA 4XYBA 4RZHA 1YL5A 1OMOA 3B6ZA 3Q0EA 4BO5A 4U0JA 1ZSYA 2GYYA 4LVCA 1X13A 1GAEO 2YW9A 4HY3A 3MOIA 1QP8A 4LISA 4NFHA 4KOAA 1AXEA 4EZBA 4R1UA 1Y5RA 2XXBA 1I30A 1WZEA 3EC7A 3OQBA 4FSHA 3F4LA 2SCUB 4P4GA 1ZIDA 2BELA 2Y66A 5DF1A 4CUJA 3Q11A 3AM5A 4L4RA 1U5CA 1ZJZA 3C3XA 4PVCA 3C85A 4JROA 2DT5A 3HZZA 1V3TA 4OXKA 1UZNA 4Z9XA 1PJSA 3PK0A 3FTPA 3I4CA 4ESOA 4IM7A 3MTGA 2A92A 1H5QA 3VTZA 4KP7A 4KZPA 3P2OA 4LMPA 5LC1A 4A10A 4CUKA 3ANMA 3U3XA 4F6CA 4FFPA 1YH3A 2OBYA 4FJ1A 5BT9A 4DQXA 2P5YA 1MUUA 3RUHA 4HV4A 4RPKA 4I5EA 3I1JA 1E7SA 3O26A 1T25A 3DOCA 2X0RA 1CF2O 1I01A 4PRKA 1NR1A 3E9NA 1B3RA 3KHUA 4A5OA 3CSDA 1I32A 1NHGA 3PHGA 1HE2A 5K6AA 1RM4A 4MO2A 3GVHA 4O59O 3TZHA 1MC5A 2PH3A 4CM4A 1U9JA 2O48X 5JY1A 4CM8A 4AG3A 5JS6A 4GH5A 3L07A 2FP4B 4TZKA 3SJ7A 5K0ZA 4E3ZA 2C7VA 3F3SA 3GZ4A 1Y6JA 3RROA 4FBGA 3X2FA 4E30A 1YRLA 4I5FA 3ZHXA 2PZKA 3BTOA 2RIRA 4QUKA 4R68A 1BG6A 2V7PA 1EUZA 2EJWA 2QYTA 5CAEB 4OSPA 4JIGA 3CZRA 3GEGA 2GRAA 4KTTE 3W4KA 3FWNA 3HDQA 1KS9A 3PYXA 4KDEA 4XIJA 1KC1A 1YDEA 3I9NA 2ZB3A 5HBRA 4J1QA 4B3HA 4EITA 1RPNA 4S1VA 1E3LA 3NKLA 2XPCA 3R3SA 4FFOA 5DCWA 3ST7A 3TZKA 1E3JA 1F06A 2BGLA 3TJRA 4YT8A 5L95A 3MJ4A 1ZK4A 3LT4A 4TKMA 4EJ0A 2R6JA 5COBA 1VC2A 3FSRA 1D8AA 1NFFA 4J16A 3C1TA 4XWYA 4IQ0A 3O03A 1MA0A 5T67A 4IJWA 2V65A 3LVFO 3Q9NA 3INRA 2Q2QA 4D3DA 1B26A 1KEWA 1EVJA 4WNIA 3WIEA 5A9RA 5BNIA 4ALJA 1V9LA 4WECA 2YV2A 1YGYA 1IY8A 2CVZA 1LXCA 4NR0A 3UUWA 4BNGA 1HSOA 4CMCA 3M1AA 4BO4A 4PLTA 2HSDA 2AEMA 3UHAA 3WG9A 1PWZA 4DXHA 4M86A 1HE4A 3FR7A 4WJZA 1ZUD1 1CQJB 5I9MA 2O3JA 2XOXA 1QXSA 1X1TA 5CEJA 2BFAA 3DOOA 4TWRA 3HDJA 3R6DA 3VTFA 1XQ1A 1CYDA 1U8FO 4GLOA 3B1FA 2PWZA 4OXYA 3GC6A 4J0EA 4GGPA 4DL9A 4YRDA 3V1UA 4NFYA 4Q3EA 2NU8A 1YKFA 3S55A 4BHTA 2P2SA 3PZRA 3W8EA 3PHHA 2YV1A 3GR6A 4MKZA 1N1GA 3HQ4O 4AJLA 2X5JO 1T26A 2FZWA 4MP8A 2J8ZA 3OSUA 4U6SA 1QLHA 1XELA 1GZ4A 2LDXA 2D8AA 3OHSX 4NBTA 4L74A 4D45A 3QIVA 2ZKLA 2VHXA 4YT5A 4E5MA 1DRVA 1VKOA 2UUPA 4D43A 1OBFO 4BNTA 1HDYA 2GGSA 2O3TA 1IB6A 2WSBA 3F6YA 3K8ZA 4YJFB 5ICSA 5GZ3A 2B5VA 5TSDA 2EKLA 2C54A 4LCEA 1LLDA 3QV1A 2FP4A 1ADFA 1R66A 1UP6A 1UP4A 3ZV4A 1B2LA 2NSDA 4CM8B 4YAGA 1QR6A 4TSKA 2PFGA 1X14A 1YDWA 3ZU5A 1PS9A 2B4QA 2CDBA 3EK2A 4ALNA 2A4KA 4BO8A 5A1TA 3HN2A 4OXNA 1MFPA 4GGOA 4IDEA 4YAJA 2ILTA 3GNSA 1E1MA 3MJTA 4J3FA 2GD1O 3LF1A 2WE7A 4F45A 5CG1A 1LUAA 4AJ4A 1IOLA 4BNHA 4BKOA 1XU7A 5KIAA 2E4AA 2ZYGA 1ZBQA 2HMSA 5KJEA 2ZATA 3JQAA 1ZK2A 1GR0A 1HZZA 3PWSA 5TS3A 5TLSA 3WOHA 4D44A 3DBHB 5C5IA 3BHMA 5T8KA 3ZWCA 4J7CA 5T64A 2VHYA 4PZCA 3WGTA 4D3SA 1LDNA 3WQSB 3H8VA 2F1KA 1T4DA 3FN4A 5JO0A 3G0OA 2JFHA 3VPSA 4NG5A 3RQSA 1GUFA 1R0LA 1TLTA 2JHFA 3JCZA 5TQVA 2EP5A 3QVSA 1MXFA 5MGBA 1JWBB 3PLRA 3SBOA 1YVEI 5EPOA 3OQ1A 1XU9A 1XIVA 4YJDA 2ZTMA 5C7OO 3BHIA 4RPHA 2SCUA 2VHZA 3DZIA 3B1JA 4BMNA 5MDHA 3RAJA 1M6WA 3BYZA 3O38A 1HE3A 2ZB7A 5A4DA 1JKIA 2JJYA 5G0SA 3U4HA 3ZNPA 4W7IA 1ULSA 2YQ5A 5IAAA 1FDTA 4BMSA 3GG2A 1BDMA 4MPDA 5JW6A 4YBZA 3IOYA 3MEQA 2Z1MA 2Z5LA 1JU9A 4OAQA 3SLGA 3VVBA 2PKQP 1DRUA 1NNUA 4B4VA 4ZJUA 5ENVA 4GX5A 4YRAA 3KVOA 1PJQA 3D3WA 5U9CA 2C7GA 3VPXA 4ONEA 3LZ6A 1H6DA 2Q3EA 5C7LO 1JVSA 3FTNA 4RQUA 3LU1A 4FQ8A 1GZ3A 1PQPA 1VM6A 3RFXA 2PGLA 2CD9A 1LRJA 2VYNA 5TT0A 5EESA 1U5AA 3CEAA 4J4TA 1DC5A 4GX1A 4R3WA 1QMGA 2Y1OA 4RVUA 4IDBA 1DLJA 5AXAA 4DGSA 1ISJA 1LC0A 1GQ2A 3TZQA 3RC9A 3AI1A 4MVJA 1UXIA 1WXDA 4JJIA 1F8GA 2P5UA 1BGVA 4BNLA 4NK4A 3WGYA 2NVUA 2HMUA 4R1TA 4GVLA 4E6PA 2C2XA 4ID9A 4DLBA 4DLLA 3CXRA 5L4SA 1Q7BA 4KMSA 2X7HA 5THQA 2GN4A 4MIEA 1ADGA 4FDAA 3DMTA 1JAYA 3GAZA 4ROSA 3PZBA 3JQAD 4WCDA 2YHUA 5IF3A 3AY7A 3QRWA 3RCBA 2ET6A 3KYDB 3DZJA 4AICA 1E5QA 2POQX 3N58A 4IDGA 3I6IA 4Q9NA 2JCYA 5JE8A 4AJ2A 4U0KA 4JN6B 1PEDA 3F9IA 3KYBA 4CLHA 4W9NC 5FFFA 1UP7A 4WLOA 3WXBA 3ZWOA 4FJ0A 4BKRA 3JD4A 1NXQA 3W8FA 3I9LA 4F6LA 2VZ8A 1N5DA 1FMCA 1C1XB 3H3FA 3NUGA 1EUDB 5IXSA 2QX7A 1G0OA 4BL5A 1P77A 3ZWYA 2HK8A 2HJRA 2VCYA 2X0IA 3WYBA 3DMYA 2YFHA 1E5LA 3V1YA 4K26A 4BMVA 2GZ1A 3H5RA 3JYQA 4IDAA 4GSKA 3P2YA 4L4XA 1E3EA 4UREA 1RM5A 4BNNA 1U3VA 5CDYA 2DVMA 2BGKA 3GN2A 4XJSA 5CPFA 3D5TA 1DXYA 2H6EA 4H15A 2LDBA 2NU6B 2VTEA 4P4LA 5HTOA 1KYQA 2QHXA 4CL8A 4GPD1 2W8ZA 3DAGA 3EY4A 3L4BC 4A0SA 1YJ8A 4D0SA 3NJ4A 2AE1A 1JDJA 2DPHA 1A7KA 2Q2VA 5FYDA 1EUCB 1Z7BA 3GGGA 3QE3A 1RYDA 2P4QA 1H6AA 3L4SO 1PGNA 1H9BA 3KEOA 2QG4A 4TQGA 4J9UE 2GR9A 4WCFB 2IXAA 1KY4A 3WTCA 3K30A 3AU9A 2NU7A 1C1DA 1SZJG 1GPJA 2GLXA 3H9UA 4NJMA 2YUTA 2W2LD 5JYDA 3E5MA 2V6FA 5B12A 3W6UA 1R15A 2Q4BA 4NBWA 2NQ8A 1EDZA 2FN7A 5A9TA 3U0BA 3ASVA 2FZEA 3K6JA 4DBVO 3OEWA 4B3IA 2IZ0A 4IDDA 1E7YA 3TN7A 1PZFA 3KEQA 1B8UA 2EG9A 4DUPA 4C7JA 3RBXA 4KTVE 2CFCA 3I6QA 3NT5A 1HTBA 3GLQA 1DFGA 1ZJYA 1WW8A 1LDBA 4DRYA 4I1IA 2CF5A 4F3YA 1MFZA 1TT5A 3E8XA 5HM8A 1LA2A 1EVYA 1K89A 4R9SA 2I3GA 4E5NA 4ZN6A 3CUKA 4HKTA 4NPCA 3I9MA 3ZI0A 5A5FA 1E7RA 2JCXA 2HCTA 5KVQA 1VPDA 4I5DA 2I99A 1K6XA 1YBMA 9LDBA 1KY5A 4FB5A 1T2FA 1H0KA 2Y0EA 1ENPA 3D3EA 5COQA 1YO6A 2GN6A 4C7KA 3AM4A 5IN5A 5JFOA 3DDNA 4FC7A 1RM0A 2D2IA 5A9SA 2YHIA 1BXKA 1DC4A 2C59A 3K9QO 1C14A 1T2AA 3KV3O 3L9XA 4P8RA 4BQPA 4DLAA 2VQ3A 1NM5A 4M87A 4M54A 2X8LA 4JJFA 3RJ9A 3GK3A 3FR8A 3H5NA 4GX2A 5TC4A 1PZGA 4ZRMA 4YTEA 2HKIA 1H94A 1A5ZA 2EW2A 4GMGA 3RJ5A 4FIZA 3GGPA 3SC4A 4QO7A 4XYGA 3JQGA 5DBIA 3KSDO 1WDMA 1GQQA 1PQWA 1G0NA 1YE3A 3EYWA 4B4UA 1Z74A 4QEDA 2VZ0A 1NAIA 4MVJE 4LVUA 3RKUA 3JQ7A 2C07A 2X86A 5I7VA 1RM3A 3GHYA 3ONFA 1MG0A 1I2BA 2FPGB 4AJPA 3UFXB 1N8KA 2VWGA 4Y6RA 1BW9A 3E5RA 2QZZA 3E1KA 2X1HA 5TNXA 4KUEA 4W99A 4PCVA 4IZHA 4OOEA 2VWPA 1X7HA 4CQMB 3IUSA 4OMUA 4E2YA 3RIHA 2OGUA 3BIOA 1AHIA 3NGLA 3BA1A 4J2HA 1NFQA 3ZU2A 5A5EA 3PRJA 4AJNA 5L51A 1E1NA 2R2GA 3QQPA 4K6CA 1O94A 3EVNA 3NTQA 4L75A 3JQ7B 2Y1GA 4GLLA 1U7HA 2O2YA 2WJPA 4A73A 2EGHA 4D0RA 3PHIA 1EK6A 3DBHA 3JYNA 1E1KA 4LGVA 1C0IA 5KVSA 3FBTA 3WTBA 1ORRA 4PG4A 4B7UA 1ML3A 3DTYA 1SPXA 3WGGA 4XCVA 1NQ5A 2OXIA 4X54A 2AG8A 1E3IA 4MVJI 2B69A 3LQFA 5A3JA 1LSOA 4CODB 1WPQA 1M66A 1ZNQO 2DBZA 4NI5A 1PL7A 5BSFA 1HDCA 3DZHA 2ZB4A 2WM3A 1VJ1A 1NHWA 4ITUA 4KWHA 1HE5A 3R1IA 4MVJG 4RZIA 4O63O 1EE9A 1R16A 3BHJA 2NNLD 1NR7A 2VHWA 2ZQYA 5B4TA 5JXWA 2QIOA 3TZ6A 1LSUA 1MXHA 4BV8A 2VTDA 2G82A 5CFZA 2FPGA 4MVJP 3WLEA 4EUEA 1I24A 1NQOA 3PGJA 1BSVA 3OETA 3U5TA 3HE3A 2E49A 2TMDA 1XWFA 1XYGA 4AJEA 1A9ZA 2ZK7A 1DJQA 3RC1A 5F1KA 3TQHA 3CMMA 4S3MA 1NASA 3L4BA 1YB5A 2PZLA 1A27A 2FRDA 5DZSA 4ZQFA 2D4AA 1KETA 2EKQA 2DLDA 1QYWA 3LT0A 3K2BA 4DA9A 3LLVA 2V6BA 3BAZA 5ITWA 1O6ZA 4EUHA 3PIDA 1I10A 3H9JA 2CY0A 1UDCA 1NPYA 5G0UA 5G4KA 4NJMB 1C1DB 3JQFA 4P4NA 1B8PA 3DBVO 3IP1A 3LC7O 1PGPA 2O7QA 2ZJ1A 2NTNA 1MC4A 2B0JA 1O8CA 4PVDA 1JKFA 2ZCUA 3EAGA 4Z6KA 1Y7TA 1QV6A 1ISMA 2JD2A 3AJRA 1KVTA 4AJHA 4L76A 5KVVA 1SAYA 4B7CA 3VH1A 4MVJF 4DREA 3HFGA 4XZ3A 3OJEA 5KKCA 5DNAA 1EUCA 2BGMA 4UVGA 1J6UA 2D5CA 3MZ0A 1MV8A 4YAEA 3D1LA 3GOHA 4WEQA 4CQLA 3PVZA 4KUGA 2E6UX 3GFBA 2G76A 1LX6A 1FDWA 3Q1LA 2ZYAA 5EMHA 3UAGA 2NU6A 1N9GA 3OIDA 4E2WA 1EZ4A 1U4SA 3INGA 1EQ2A 1Q7CA 3UF0A 4ZGWA 4JQCA 2E82A 3PJEA 1Y8QB 4W6ZA 2O3UA 3ROMA 5DBFA 1OAAA 2HUNA 1E6EA 3GDFA 5KJ1A 3JQ6A 4J6FA 1XCBA 1J49A 4I9UA 1I33A 2PV7A 2FHSA 2D3TA 4Y9DA 3MJVA 4BO9A 2PGJA 4GBJA 3JQFC 4QECA 3HDHA 3RUFA 2H63A 1ISIA 4WNCA 1QLJA 2WD8A 4BNKA 2I76A 3TL2A 5IDYA 4CM1A 5IZCC 1DBVO 3AFMA 5L7TA 2DC1A 3UCFA 4I9NA 3SXPA 4DTIA 3ETDA 3HUDA 2P9CA 1X0XA 4GWKA 4JJGA 1XGKA 2QRLA 4R4JA 4Z0PA 1HDOA 1DHRA 3L6OO 3QVWA 3PDUA 8ADHA 5A03A 1E7QA 4BO0A 4HX5A 4D7AA 3NDIA 1GV0A 4HFRA 2EIHA 2X58A 3QWIA 2WEKA 1SB8A 2J3JA 4Y98A 1PGJA 4YWJA 4EJMA 4PZEA 4BB6A 1PIWA 2EKPA 2Y67A 4JP2A 3F5SA 4ZU3A 3T4XA 1SBYA 3F1KA 4B7XA 3S2GA 5DN9A 3A14A 3GVPA 1P45A 5ILGA 4J0FA 3S2IA 1QORA 2GZ3A 2WWRA 3GZNA 3VKVA 2WE8A 4CM4B 4M8SA 4IMPA 4PGFA 2C2YA 3L6DA 4EBFA 4J90A 5CG2A 2QYSA 1JVBA 3EVTA 1XQ6A 3VZSA 4BGEA 4OKNA 3ONEA 4HBGA 1EUDA 3AM3A 4M89A 5B4VA 3BXXA 4U8GA 1N92A 1NVMB 1HSZA 4WE3A 4OM8A 3ZWPA 4OQYA 4CLRA 4PZDA 1YBVA 3OJLA 1KVUA 5K9ZA 3A1NA 4OJNA 3RU7A 1XHLA 1B3BA 3KYDA 2C5EA 2AQIA 3PTZA 4R54A 2RH8A 4PG6A 1QSGA 2JKVA 4RF3A 3AUUA 1JTVA 3RD5A 1YOVB 5CP8A 4FFMA 3F5QA 3IAHA 4G65A 2HDHA 2AEJA 1DHTA 2BI7A 4LSMA 1ISHA 4BO1A 3VAZA 4JBHA 5H82A 3FNEA 1RYEA 3MJEA 3OMLA 3WMWA 4O5OA 3PYMA 3D4PA 4J1TA 4XRGA 2ZCVA 4RF2A 3GT0A 3VDRA 3WMXA 1TB4A 3QWFA 4JP3A 3TL3A 4HUJA 3PJFA 2VUUA 3RUEA 5HWSA 4IY1A 1B8VA 1O0SA 4J4HA 3ROKA 1MG5A 5BNTA 2FR1A 4E2XA 3BMCA 3OJ0A 3A9WA 3U49A 1W0CA 4LRSB 3BMNA 2I67A 5I7EA 4FS3A 1E3WB 1GCOA 4WOJA 4HNGA 5BSEA 4E31A 4BO2A 2DPGA 1YONA 4PLPA 4XQCA 3RI3A 3ADPA 4TRRA 4EYEA 2CVQA 3O9ZA 2RAFA 3PQDA 1AGNA 2OL4A 3WFJA 5IDWA 3KTDA 4CR6A 4JNKA 1ZMTA 4IDFA 1A71A 9LDTA 1LDYA 3BTUA 4CLRB 4PN3A 1JWAB 1W4ZA 1CIVA 1OC2A 2G17A 1GD1O 3FNFA 4Q3NA 4YDRA 3Q2KA 3OECA 3KUXA 3ZCXA 4BNIA 1GEEA 4CJXA 3WNVA 3UVEA 5IFLA 1TVEA 1HDXA 3GH3A 3RUIA 4J49A 3LC1O 3ZH2A 1NTOA 3D4NA 1LQUA 2P9GA 1R6DA 3C7AA 4AJKA 2ZTUA 2JAPA 2EGGA 2JL1A 5IDQA 1O89A 1P9LA 4IQGA 1IHYA 2WYWA 5A05A 3UFXA 2GN9A 1V0JA 3WS7A 2J5RA 4XYMA 4YJFA 1WAMA 4J1SA 2Q1UA 3OQ6A 1E92A 2D59A 4FFLA 3KETA 3GVXA 5AQ1A 1C0PA 2ZTVA 3H65A 3MTJA 3RBVA 5KTKA 3COSA 4CUZA 3INTA 3JQGB 2X4GA 3UGKA 3UICA 3QVTA 1PS0A 3WQRA 1QYDA 4ZRNA 1K0UA 4XDYA 5AVOA 3IP3A 1I3KA 4NIMA 4O0LA 1QRRA 1O9BA 2VOEA 3HWRA 3IC5A 5AXBA 5KVCA 5IXYA 1V8BA 2YZ7A 4HFNA 5A9SB 5CEEA 1UJMA 4W7HA 1B16A 2O3QA 1HRDA 4BGVA 4FPXA 3QP9A 2VT2A 1VE9A 4WPGA 2QRJA 2BHLA 3AW9A 4R9RA 2XAAA 1G6KA 4XYLA 4ND2A 3ZNNA 4AJJA 4D3FA 3JYPA 3E9MA 4XR4A 1ZW1A 3KBOA 4FGWA 1Z73A 1ZSNA 3NAQA 3NTOA 3AOEA 4Z0HO 1WWKA 1PL8A 4B3JA 3IJRA 1R12A 4RF4A 3JQ9A 4E4YA 2E37A 1CERA 1YS4A 3QJ5A 1CQIB 1TT5B 1F8FA 3F4BA 4I9HA 5F21A 4B4WA 3KYCB 4YVFA 1XKQA 2J6IA 4UVDA 3NT2A 4BUCA 4BV9A 1DIAA 3M2TA 5G2OA 3HSKA 4Q3DA 3ZN2A 1R4MB 4CMIA 1ZVMA 3KO8A 4FW8A 2CMDA 4FFRA 2VZ9A 4FJ2A 3RWBA 2DTDA 2D5AA 1NPDA 1IZ0A 4MIOA 4R1SA 1Z82A 3KSZO 4K9DA 3QWHA 1SC6A 4MOWA 1Y8RA 3UH1A 5ILOA 5JDCA 1B15A 1KVRA 3BMQA 4YQZA 3GA0A 1EEHA 5JCJA 3JD3A 3C7CB 1DC3A 1MP0A 1SCUA 3E82A 4NJOA 3GDGA 1CETA 3VPFA 3RFVA 2V6GA 1Y8RB 3AUAA 3CH6A 4HNHA 2AXQA 4RJTA 5AXDA 4UUPA 3H7AA 2QW8A 2I3AA 4CMEA 4YCAA 1BVUA 3DBRB 3D7LA 2Y93A 1EFLA 4EEXA 5DCYA 1RKXA 4W82A 4CLOA 1ZCJA 1Q0HA 3DFUA 4CMIB 3TFOA 4CMGA 3GVIA 3BZUA 2TMGA 2NLOA 1HWYA 1MGOA 2C29D 3VVCA 1LDEA 3QHAA 4PLZA 1WLYA 3STHA 4BNJA 4BKPA 4DIFA 3ASUA 1KVQA 4Y6SA 3QVOA 5EINA 2E48A 4H3VA 5BSGA 4BNVA 4TKLA 3NX4A 4LSWA 4L9RA 2O23A 2RCYA 2WYVA 3L6EA 4R5MA 5EL0A 5JDCC 3AU8A 4XX0B 2Q1SA 4PG5A 3WLFA 1LQTA 1ZK3A 3BTSA 5I7SA 2C0CA 4K1LA 4PLGA 3TOXA 2EWMA 1C1XA 3RBZA 1PTJA 5JAIA 2RHRA 3NDRA 3VZQA 2PD3A 2DBVO 4JGBA 2GZ2A 2CUKA 1I36A 4Z3DA 4RVHA 5T8KC 2YV3A 4CMEC 1EE2A 3FBGA 2H9IA 1LTHR 1ADBA 1Y9AA 4NFSA 3VHRA 1KBZA 1DC6A 2OORA 3MCVA 1GQYA 1GFSA 2IYOA 1UXGA 2X5OA 1GYRA 1B14A 3PJGA 4IMRA 4NBVA 1ZEJA 3WIDA 1P1RA 3JD1A 1AXGA 2Q50A 4CM9A 4R69A 2VYND 3ZNOA 2GNAA 4JXKA 4BNZA 4CV2A 2B35A 1JQBA 1JLLB 1FDUA 5G4LA 1J0XO 1YB1A 3L0DA 3ZDFA 4MINA 3V1TC 3QWBA 4CLEA 1GDHA 1LNQA 1CEQA 3CPSA 2EJVA 5KCZA 1P1HA 4QX6A 3FD8A 2FWMX 1L7DA 1VI2A 3MWDB 2ZYDA 1LRKA 3E18A 2AHRA 3I4FA 4JBGA 2IEBA 1GYQA 1XG5A 5JCJD 3E48A 1UAGA 2O3SA 3I23A 1EDOA 1ONOA 1LLCA 2EHDA 1H93A 3F46A 2PK3A 1R0SA 4QFDA 3ANLA 1I2ZA 4DC1A 1YJQA 3K31A 4YEDA 1RJWA 4KWIA 4BNXA 1ZMOA 1DSSG 3ANNA 3RFTA 3OF2A 4BVAA 2CDCA 1PZHA 4YJGA 1L1FA 1LDMA 3QA9A 3WQQA 5JNLA 4R1NA 4RLHA 2C82A 1ZZEA 3LSYA 2C20A 3BMCB 4TZTA 3JYOA 3ICPA 2VWQA 2XF8A 2X9VA 2G5CA 4QXMA 4M49A 3VOSA 3IS3A 4XGKA 3H5AA 5TGDA 2QQ5A 1NQAO 2AQHA 4II2A 3SEFA 3V2HA 1DIGA 3PJDA 1LEHA 2DQ4A 1F14A 5EQFA 3DZGA 4OO3A 4KDFA 3WSWA 1U8XX 1C0LA 4ZVVA 2B5WA 4B79A 3DMTC 3SVTA 2FPPB 3MJSA 2WD7B 4CM5A 4E33A 1VL0A 5I9NA 1PJ2A 3GRPA 5AXCA 4D42A 4EDFA 3TF5A 2BKAA 3U09A 2B37A 1UZMA 1JKJB 2PH5A 4CV3A 2FMUA 1NPTO 3TNLA 5IG2A 3D5QA 4PG7A 4RLSA 4R3NA 5DOZA 5ENDA 2JFGA 2VNAA 3RC2A 2HK7A 3Q9UA 1U2GA 2OP1A 4ZQGA 1D3AA 4JLWA 2BI8A 1ID1A 4PLVA 5DP2A 5ES3A 3VPHA 4OOFA 2B4RO 3VH3A 2Y0CA 3U4IA 1EK5A 1QKIA 2NU7B 3PLNA 3PQEA 4WEOA 1W8DA 3GEMA 4YAIA 1X7DA 5L53A 1BVRA 1WMAA 1FXSA 1F12A 1LLQA 2Q2WA 3ENNA 4ND1A 3GY0A 3NTRA 4RPLA 4NDNE 1ISGA 3T4EA 4DMMA 2VNSA 2BD0A 1LI4A 2IYPA 2UYYA 3T7CA 1D1TA 1PR9A 1JA9A 2IE0A 3QY9A 4PG8A 1PQUA 4CV0A 2BF7A 4Q3BA 3TFQA 2Y05A 3Q6IA 3QLJA 3JQ9C 1K6JA 3LDHA 3JQDA 3DAFA 2J5KA 5KJ6A 5TF4A 2IDZA 4IXWA 4U5QA 5DCUA 3GF4A 4CM6A 3O8QB 1WMBA 2WMDA 2P91A 5THKA 3WBBA 1V3VA 3OEYA 4LCJA 3WGOA 2OBNA 3CKYA 1N7GA 4G2NA 3GPIA 3AUTA 5CDUA 1LSSA 2CVOA 1Q0LA 2BFPA 2DM6A 1E3SA 1MB4A 3I9JA 5EIOA 1WP4A 5L7WA 1ENOA 1P1IA 2VRBA 4ND3A 4N5NA 5A04A 4I8XA 3DL2A 4TVOA 1EBUA 4CLXA 1IULA 2NU8B 4XQGA 2YY7A 3VPGA 3ZWAA 4A27A 3MOGA 5H81A 4XD2A 3CE6A 5JLAA 1S7CA 2H5LA 1DLIA 2PNFA 1R0KA 3AY6A 3TDKA 1Y8QA 4WLUA 5C37A 4D46A 4QSMA 3ZWNA 4MVJD 4WKGA 1GUYA 1YQXA 3LK7A 3ZHZA 4A03A 4RGBA 3ABIA 5HA5A 2NQTA 1PJ4A 2BFOA 2OOSA 3NYWA 4LW8A 2HO5A 1KEVA 2HK9A 2Q99A 1KERA 2OP0A 3EW7A 4Y6PA 5G0WA 5C7IO 3DWFA 1TT7A 1D1SA 4D41A 4R51A 3NEPX 1BXGB 1LDGA 2EEZA 3GVCA 4H7PA 1OOEA 4GQAA 4QT0A 4RVGA 2NVBA 4NBUA 1NP3A 1PJLA 3DBLB 1W6UA 1J5PA 4FN4A 3HB4X 4NHEA 3WWZA 3WSVA 4PIVA 1O95A 3JD2A 3WBFA 1EVZA 4RQTA 1CRWG 1H6CA 4TMFA 5G4KB 4CMAA 1DAOA 1BWSA 2PD6A 3C24A 2RBEA 1H6BA 4MVJH 4WUVA 4ZQHA 1QYVA 1M76A 3D4OA 4UAGA 1PU2A 1V3UA 4IGEA 3HADA 4DWVA 4BOYA 1VKNA 1ZEMA 2J3HA 1FDSA 4BKQA 5A02A 1VJ0A 1ADCA 1Q7GA 3HHPA 3JYLA 4NH4A 2W4QA 4Z9FA 3S1LA 1ZFNA 1ISFA 1M2WA 3ZV3A 5HS4A 1VJTA 4GWGA 4IINA 1HEUA 4KQXA 2HLPA 1V6AA 2D0IA 5COAA 3JTMA 4WOKA 3S2FA 1A4IA 1Z6ZA 3LF2A 2O50A 4PLHA 1GEGA 4H16A 4AVYA 5JDIA 5L3ZA 3H9QA 4DBZA 3D64A 2HMTA 3MWDA 1P33A 3VZRA 4YPOA 2Y1FA 3RC7A 5DDIP 1YL7A 2Q46A 1HDRA 3I52A 1QYXA 3E9QA 1UDBA 4B8ZA 3WNQA 1HYGA 4NNJA 1Z45A 3FWZA 3AI3A 3ROPA 4RO0A 3WB9A 2GF2A 3B1KA 3DFZA 1E7WA 2VN8A 1JLLA 4N7RA 3OIFA 5L4LA 1IPFA 2W2LA 4HFMA 2NV6A 3G17A 3PP8A 4FD3A 5CDTA 4IJVA 2FPIA 2ZTLA 4CLDA 1ZKMA 4YAKA 3V2UA 3TOZA 5L9AA 1GUZA 4NMHA 5CEFA 4EUFA 4FFNA 4QO8A 5LCXA 1ENYA 2O4CA 4WLEA 5G0VA 4PLWA 1V35A 3EDMA 3HFSA 4CPDA 1PL6A 5TIIA 2VUTA 2ZJ0A 1XDWA 3TWOA 4CR8A 4L4SA 5DOVA 4R01A 4PLCA 4A7PA 1U4OA 5T6BA 5U4QA 3H3JA 3KZVA 2B36A 4EJ6A 5JDIC 3EHEA 1D4FA 1VSVA 3UKOA 1SO8A 2CF6A 2VUSA 3ZV6A 4D79A 1HL3A 2X0JA 2Q4EA 3U9LA 1BTOA 4XX0A 1DEHA 4LK3A 4ZICA 4CQMA 2C5AA 3EUWA 2HU2A 1DAPA 1QYCA 1LJ8A 2J5QA 2VRCA 3ZZNA 2O7SA 5GZ1A 4NBRA 5FI5A 3SX2A 3CIFA 1Y5MA 5DT9A 4YB8A 1FDVA 1WDLA 3G49A 3Q3CA 3VDQA 4OKIA 4Y67A 1GYPA 4DMLA 4CLOB 2W2KB 4O1MA 3U4DA 4OH1A 4IUYA 1MLDA 1GV1A 3CTMA 4RDHA 1AE1A 4MIYA 2GERA 3U4CA 4AFNA 2W90A 3WJAA 3WX0A 1XEAA 3IL2A 3SLKA 2FY8A 2FSSA 3HDYA 1DFHA 2J3IA 5I8WA 4DQVA 4RORA 1BHSA 4NK5A 2VHVA 8LDHA 1HDGO 1NAHA 2RHCA 3GN1A 3FNHA 4YJHB 4ZD6A 1GL3A 4GSLA 5FWNA 2YDXA 1N7HA 2B83A 1LRLA 2OO5A 4IDCA 4E5YA 2YHIB 4XB2A 3BMQB 3ICCA 1E0DA 1Q2XA 1WZIA 3WGQA 4E0BA 1A72A 3U62A 5BQFA 3K73O 3GUCA 3OICA 2JAHA 4BNMA 3PFFA 3DR3A 2Y1CA 4EW6A 1CQJA 2PKRA 2X5KO 3T7EA 2Q45A 2PGDA 5G0TA 5JAMA 2BFMA 3JQ8B 2PZJA 1KVSA 1NX6A 1UXJA 1NQTA 2HAEA 1EFKA 2Y99A 4XKJA 3ZWVA 3DEYX 4L0QA 1UH5A 3OA0A 1YWGO 3EMKA 4II3A 5JPIA 3IIEA 4GI2A 1XA0A 4XJTA 1M6HA 1DDOA 3ULKA 4FC6A 1R4NA 1PWXA 2VT3A 2X0NA 3S2EA 4ALIA 2DKNA 4RL6A 3WGIA 3LLSA 3WGHA 5BR7A 1A4UA 1KC3A 1P3DA 3GNTA 2EXXA 2HMVA 3LC2O 2HRBA 4N5LA 1E6WA 3CMCO 3KLPX 1CWUA 1IL0A 5CPBA 4BKUA 1WDKA 4Q39A 3LT1A 1KEUA 4LMRA 1HF3A 1IZ9A 1QG6A 4BGIA 3VKUA 2DTXA 3GAFA 2AA3A 3VH4A 1N2SA 4Q3AA 4OL9A 2YDYA 4NQZA 4ND4A 4BGUA 1P1KA 3ZWMA 2VRCD 2IZ1A 2OUIA 5JY6A 1EMDA 3DZFA 4YT2A 3W6ZA 1P1FA 4R16A 3FPCA 1E6UA 3O8QA 4CM7A 3ENKA 2IEDA 4JBIA 3CZMA 3ZU4A 1I3NA 5CAEA 1LLUA 1ONPA 2W2KA 3EZYA 3ZHYA 4OGWA 3DTTA 4FOOA 1C3VA 4XA8A 2V6MA 2HRZA 4RCVA 3G79A 1T2DA 3UCXA 2IODA 3OBBA 1U2DA 3ZNQA 1FK8A 3ZU3A 2NU9A 3IQDB 2DFVA 4DPKA 3DONA 1VL6A 4KQWA 2A94A 2R00C 4OIMA 1FJHA 1MX3A 3QWAA 5F1PA 1HYEA 3GHHA 1BMDA 2PR2A 1HT0A 3P7MA 1UZLA 4Q3CA 3LT2A 4OSOA 1X7GA 1ZK1A 3JSAA 4R5HA 4RV9A 2Z1NA 2X9GA 1WNTA 1VRWA 4IXTA 1HYHA 3NDJA 2DUUA 4B4OA 5JMWA 1VSUA 2Y68A 3DHYA 2P68A 3PHLA 4P38A 2JHGA 4MKXA 1ZH8A 5IZCA 3ETGA 4QFCA 4W4TA 3VZPA 2NWQA 4GAEA 4CMJA 1PJBA 2I6TA 2I5PO 3M6IA 4IIUA 3Q2IA 4PLYA 4BNYA 5TX7A 3PWKA 3VC7A 1BXZA 4GMFA 4RVDA 3G1TA 5I8ZA 1AN9A 4HWKA 4CM3A 4CMKA 2RH4A 3KB6A 3FRJA 3PDJA 4HXYA 1K5HA 3IMFA 1GZ6A 4AJOA 3H2ZA 4PLFA 4CL3A 3BMNB 4XQ9A 4UEKA 3SJUA 2PZMA 3TRIA 4RF5A 3K96A 3PHJA 2ZB8A 2GASA 2EERA 2F00A 3HG7A 1P31A 1U3WA 3AFNA 2D1YA 5LDHA 5KOIA 4FGSA 1YB4A 3KSUA 5TT1A 4BNUA 3I9OA 3V2GA 4TRMA 5BNFA 1F0YA 4GKBA 2H1SA 1WVGA 3WYCA 3KOUA 4J2OA 1EQUA 1U28A 4LRTB 4DC0A 3RSHA 3P5SA 1VL8A 1O5IA 2NACA 4JCOA 3ITDA 1T24A 1NFRA 3V5NA 1GPDG 4G81A 4PRLA 3D3WB 1NVGA 5B4UA 1PGOA 2YYYA 5HS6A 1PZEA 2OZPA 3WWYA 3A06A 3O4RA 3QSGA 1RWBA 3UCEA 1L7EA 4N18A 4O6VA 2A35A 2Z95A 4WLVA 1CJCA 3QVXA 5TJHA 4CR7A 4U7WA 1N1EA 3IDSA 5L7YA 4A26A 3C1AA 1LSJA 4IQ8A 3DBLA 1B0AA 5F3RA 4XDZA 5K6AC 3JQCA 3F1LA 4UEJA 3G3EA 1XLTA 4LN1A 4C4OA 3X2EA 2P9EA 1ONNA 2UVDA 2DBRA 1Z7EA 5JAZA 2NTVA 2NU9B 1OZAA 2X9NA 3UXYA 6ADHA 4IBOA 4N5MA 2B4TO 4P22A 1BRMA 2JD0A 3I3OA 3OP4A 2Q1TA 1UXHA 3OH8A 4IZIA 1EBFA 4E12A 1GTMA 1H9AA 3OJFA 1XSEA 2AG5A 2UAGA 4YQYA 3WDSA 4GKVA 5GY7A 3GFGA 2UV8A 5ER6A 1BDBA 1Z75A 2DAPA 3UOGA 3JQAB 3P19A 1UAYA 1HXHA 2Y1EA 3GPDG 5ITVA 1SEVA 2O3RA 2FR8A 2GPTA 3S8MA 5CHEA 5KJFA 3I83A 1H2BA 4XQEA 1ZXBA 1P0FA 4MJLA 1KOLA 1A9YA 2GSDA 3FPLA 5DULA 1DPGA 5KNLA 4HFJA 4RVFA 5LDGA 3DZKA 4L8VA 3RASA 2AE2A 4RDIA 4CMHA 1DIRA 3W4JA 4JK3A 3RUCA 2EV9A 2PTGA 1R4NB 1UXKA 4URFA 3WICA 5U1PA 3ADOA 4YT4A 1T2CA 3HNPA 3CINA 2EP7A 1SEPA 3B70A 4ND5A 3RKRA 1YXMA 3AI2A 5B37A 2YJZA 1U7TA 4I08A 4RVSA 3RU9A 1E1LA 4HP8A 4DQUA 1Q1NA 2HJSA 4CQLB 4L73A 4MDHA 2WTBA 3H4VA 4XRRA 5F5NA 2YFQA 1ENZA 1S6YA 3TSCA 1SMKA 4G5HA 1YQGA 1TXGA 2DU8A 4E21A 4NU6A 1UR5A 3DB2A 3RUAA 2FOIA 1AHHA 1C0KA 1ULUA 1OFGA 1M67A 3H6KA 1SCUB 2O4UX 3OA2A 3PEFA 4NU5A 1DIBA 3SC6A 4ILKA 4DIOA 1T1SA 2X6TA 1W73A 4WCFC 2JCVA 3FF4A 5CDGA 4UVIA 1IHXA 1IYZA 1Y81A 4UVHA 2NADA 3ZW9A 3AWDA 4YYZA 5IJZA 1GCUA 3NJ8A 2VOJA 4DYDA 1T2EA 5F1OA 1TEHA 3M2PA 4CM9D 1I2CA 1I8TA 5JC1A 5EQDA 5JCXA 5L40A 2FPPA 4FOSA 3ROQA 1KIFA 4YACA 1UDAA 1NBOA 3KYCA 5KKAA 2CSUA 4I5GA 1Q0QA 4J91A 3JQ8A 1PJCA 1P74A 2IZZA 2O2SA 3ZHBA 2DTEA 3GG9A 3HB5X 3PYLA 4OQZA 4YR9A 4EGFA 5AOVA 1H2HA 3C1OA 5L45A 3UN1A 2R00A 4XIYA 4U6QA 2NUAB 1NVTA 3NRCA 5JBIA 1D7OA 5JC8A 4RPGA 5J23A 3E03A 2G0TA 4OHUA 3QW2A 1NWHA 1IE3A 2AQKA 3ZWWA 2GO1A 4YA6A 5FF9A 1Y1PA 1U3UA 1Y9EA 3DC2A 1PSDA 4XGIA 4ZQBA 4YJHA 4AL4A 5B1YA 1PGQA 2JFFA 4ZA2A 3V8BA 4K6FA 3NV9A 1VLLA 3HJAA 4FCCA 3MWEA 1HETA 5TRTA 4DVJA 2FR0A 4J4BA 2W98A 1I5RA 3JD0A 3GGOA 4QTZA 3OJOA 4FR5A 4TROA 4NZ9A 1EVIA 2FPIB 3C7DB 1HLDA 3WYEA 3PGXA 4UUOA 5ER9A 4A2CA 4AJIA 4INAA 5FI3A 1PJTA 4UULA 4IJUA 3KM0A 4MP6A 2WDZA 3I5MA 1LC3A 4KUHA 5EJ2A 2PD4A 3ZGYA 3PI7A 1SNYA 2VYVD 3ONDA 3RVDA 3GUYA 1DOHA 5IZ4A 3DXFA 3ZV5A 5I9LA 4BNWA 1J4AA 1FF9A 1JW9B 1BW9B 1P1JA 4UVEA 4XGNA 5EN4A 5A3VA 2NTJA 5JMPA 5I7FA 4BIIA 3IKTA 1OC4A 3DZBA 4MP3A 1CDOA 1UUFA 2QRKA 3GNQA 3ON5A 4EI2A 1KEPA 2J3KA 1TA4A 4Z3KA 5IDXA 3EZLA 2GUGA 5JYEA 1I3MA 4ALLA 4E5PA 3L9WA 2Y0DA 2AW5A 2DUWA 1HKUA 4BO7A 4E5KA 2ZQZA 4E13A 2DBQA 2HQ1A 3MWEB 4XB1A 3FNGA 1DO8A 3ETEA 4J1NA 5T5QA 3KRTA 7MDHA 1OI7A 5GMOA 1GADO 1GY8A 3IUPA 2BLLA 3FHLA 2WYUA 3IJPA 1F17A 4CMBA 5JSFA 1E3WA 3A4VA 1ZXLA 5AYVA 1T4BA 4F46A 3TPCA 2I66A 4WGGA 2GDZA 2JD1A 3KLMX 3L77A 4M1QA 1G1AA 1X1EA 2UDPA 3FI9A 1YBAA 4CV1A 5IN4A 2PY6A 5HRUA 2I65A 2NUAA 4B8WA 3PWZA 4RPJA 2GN8A 3NGXA 2UUOA 3EGOA 1BXGA 2ZIZA 4DIBA 2Q49A 3AY3A 4UEOA 1X0VA 2A9FA 3TZCA 1U1IA 2OMEA 4J9VA 2PKQO 1YL6A 1HDZA 1AUPA 3PIIA 1PR3A 3PQFA 4DYVA 4YXFA 3ITKA 1NWCA 6LDHA 1HLPA 4AJ1A 4ALKA 3N7UA 3ZWBA 3VH2A 3H9EO 4YRBA 1T1RA 4OYRA 1YOVA 3ORFA 3DBRA 3KXDA 3R0IA 1JAXA 5DBGA 1DJNA 3IKVA 2X22A 1PS8A 3GMDA 4EEZA 4W9NA 5DP1A 3DHNA 2EF1A 1DB3A 2BRUA 4R41A 3UW3A 4GX0A 3AOGA 2CZCA 4WLFA 2BH9A 2OHXA 1E7MA
chains in the Genus database with same CATH superfamily
1E3TA 1WV0A 4HDCA 4IHJA 3VXKA 2QX4A 3QM1A 3CN9A 1JEYB 4RZUA 4L7VA 2FA9A 2PL5A 3L0CA 4N3AA 3NHWA 1KO8A 4RIFA 4WCFA 4EVQA 4ID3A 3B1XA 3DQPA 1R0CA 1S0UA 2OV6A 1OASA 1Z0FA 4PFJA 2E55A 3VNQA 2WQ6A 4OXQA 4JYZA 1XWWA 1H42A 1QZZA 5TJ9A 4GKKB 2QL6A 4HJRA 2LIVA 1S2MA 4LTNA 4MGHA 4CTMA 1KEZA 5GZ6A 1DBSA 3I8XA 4JBNA 5ALNA 4DFDA 4Z51A 2R1VA 2YWJA 1R4MA 1Z5NA 1W0KA 1OFUA 2O05A 2JBWA 2W22A 5JROA 3ZK9A 3VDXA 2HHHB 2ICAA 2F3PA 5DM2A 1CQIA 3QK7A 4C4ZA 3FZGA 3QQ5A 3O31A 3AR3A 3M6UA 3D43A 4P5DA 4H0CA 2GWHA 1T2UA 1OWLA 4M1KA 3UJ8A 1WSAA 2ZXEA 5CGQB 2IP2A 2ZDGA 5A4JA 1JZQA 1QNLA 2NNWB 4HEHA 1N2BA 2AK2A 1OROA 4AU1A 5CIWA 4JC0A 5H70A 1DGQA 1ZK0A 3M1LA 4BVFA 3GW8A 1R6UA 3KB1A 1NYTA 2JA1A 3DAPA 4GL4A 1IPEA 3P9IA 2F3QA 1G8JA 2HMWA 1N33B 1T8SA 3I2JA 3STXA 2IWHA 1OPXA 1ZO8A 3RT9A 2FZGA 3CONA 4BO3A 1XJCA 2I33A 4HADA 5A4MS 1NQWA 1AK9A 1JDUA 1N2EA 4KLCA 4MYRA 3CLRC 1CQPA 4MHSA 4ZPJA 1JH9A 4HNUA 2IHVA 3D7KA 5CYOA 4IIVA 4ZYWA 3U60B 1Y4SA 4P0PB 4C7OA 1CHDA 2BDTA 2FX3A 5ECGC 1XR3A 2WINI 1QPZA 1NBHA 1FYWA 2XECA 3D0OA 2FZCA 2PJZA 3KWFA 2XMCA 4WKNA 3VNSA 5J47A 3R3JA 3CKMA 5IKEA 2WFLA 1P61B 3TINA 4BQRA 2AQ8A 2DKFA 2E5FA 3EDRA 4IS3A 2JANA 2LBPA 2A0WA 1NW6A 3A1EA 5A06A 5EHZA 1JP7A 5L4NA 2HK6A 1M75A 2F90A 3JV7A 4WVFA 5LNK1 4GVXA 3H9GA 2VNKA 1F7UA 3GEBA 2DFDA 4UUMA 1CUGA 3EC2A 2OWEA 1UJBA 3KDPA 4UM7A 2B3TA 3BMOB 2ONZA 1V11B 4YUWA 5JHHB 3ETLA 4R2IA 3EOZA 1U3TA 1II0A 2GFHA 3C8UA 4Q3KA 4YONB 2HB6A 4Y8VA 4BNFA 3OF5A 3JQBA 4R7TA 5J63A 4IUDS 1XD9A 1NIJA 1EB8A 5F4BA 1ISRA 4NX2A 3PF8A 5C1DA 2PMFA 2H2WA 5D5HA 1BCSB 4HDSA 3MJCA 4DRXA 4BP9A 2H3EA 4IPTA 1E96A 1J7KA 2PVSA 4UATA 4NATA 2XKAA 4GMKA 5A1JA 2J3LA 4Y9TA 5CDSA 1N2JA 2C31A 5KI6A 4MUMA 4TUYB 3UENA 3DOJA 2ZSAA 5KZMB 1VMEA 2ES4A 1Y9JA 1J1IA 2RD2A 3AG5A 1Z5WA 4EQ6A 4HF7A 5EERA 3PPIA 2E1PA 5BSHA 2PUJA 2X77A 1JN0A 1LBEA 4CKXA 2QV0A 5DTMA 5ICMA 2OD2A 4QTUB 1KNXA 1B7GO 2Q1WA 4K2AA 4U0JA 3I2KA 3LBIA 1QP7A 3G0DA 1X13A 1GAEO 3WHKA 3IUQA 3IP9A 4DR3B 1NC3A 2WU1A 3AP2A 4BE4A 4FQ5A 4LXQA 4KOAA 1AXEA 1KAMA 1Z4JA 3MNFA 3VUEA 3HDVA 1Y5RA 4UTZA 4B6JA 4B2IA 1MOQA 4M1MA 3OQBA 4AO6A 1KK1A 1ZIDA 1N0HA 3A26A 3D3NA 5DF1A 1YMUA 4P7JA 4CUJA 2VJQA 1WSDA 4ZC8A 2AWOA 1JXAA 1M34E 2A14A 3O9VA 4AUEA 3AM5A 4ZREA 3NHPA 1U5CA 7MHTA 2O5EA 3GO4A 2ZIFA 2O8VA 2EHJA 2F64A 3CUWA 1VLZA 4OXKA 4TTRA 1ZVJA 2W6OA 1QUEA 1Z4NA 2OGWA 1J24A 1LI7A 3PK0A 1G3RA 4R8KA 5CX4A 4IM7A 3WZMA 4IYRA 4XWKA 4D2IA 2PKYX 4DCNA 2H2DA 5DYIA 2XVMA 4KP7A 2MINB 4MWTA 3FYUC 5LC1A 4A10A 4CUKA 3ANMA 4N7MA 3U3XA 5C53B 1K8QA 2FSUA 2XB6A 3PRYA 2OBYA 1G38A 1WUHS 1PV2A 1MJGM 3EVBA 1OWOA 4OBXA 1QZ3A 2VJOA 1MUUA 3GFPA 2XB2A 2BDUA 4U3JA 2P9YA 4YAUA 4LF8B 3D0QA 3ORRA 3T1TA 1SWWA 3W9SA 4F9EA 3O26A 1T25A 2GARA 3DOCA 1ML4A 3IHKA 5AW9A 2X0RA 3D8HA 4NDZA 1CF2O 3W3AH 5JADA 4PRKA 3JQRA 5LP6F 1NR1A 2HADA 2ACKA 2JFZA 2CUTA 4A5OA 1WHSA 1L5WA 2C0PA 3ESZA 4YDSA 4XW2A 1O5TA 3TR5A 5K6AA 3KS9A 4AF6A 4OMCA 1N4DA 4PY2A 4DNXA 1OX4A 4DWWA 4JOSA 4MCHA 1U1CA 1Q1EA 1M6VA 4RM2A 4AG3A 3P9SA 1QAOA 3CSSA 5ENZA 1D9ZA 4JBYA 4HH4A 3SJ7A 4ZI7A 1YS6A 4K1XA 3TQCA 1FP6A 1OT3A 2CK3A 2X15A 3FPBA 4I5FA 3P4YA 1TKRA 1SG6A 2EQ5A 2RIRA 3V33A 3K0EA 3MT0A 1XLUA 4OSPA 4MB0A 3TIIA 2GRAA 1RQXA 2QMUA 5LA6F 3RRYA 1FS5A 2OK8A 3DEZA 3DQZA 3N5KA 3PYXA 1F8XA 1TK2A 4KDEA 2ZYSA 3S68A 3I9NA 4WAUA 1U9IA 2CBZA 3EQZA 5HBRA 1LBIA 2XNDA 3KSMA 4D9EA 4S1VA 3R3SA 5FFMA 2HPZA 4ZOBA 5DYTA 2ZFUA 5L95A 3MJ4A 3IPYA 4LPSA 4F3KA 1XZ8A 3DFMA 1SOAA 4UXHA 5JTUA 1QQ7A 1KDTA 4Q5IA 3OESA 2AR0A 1P5JA 1Z2OX 1QH0A 3A1WA 3QTTA 4WRRA 2DUMA 2HYIC 1Z5ZA 2JHCA 2VDNB 3T5GA 3PDWA 5FBHA 1ZN7A 4J16A 1V6SA 2C5BA 2ZR8A 2Y6UA 4L5AA 1UPXA 4IUCS 3K0AA 2JGDA 5JSZA 1IM8A 2PLNA 4RTOA 3B5EA 5LZ8A 4L0DA 2QD2A 4Q21A 2FGJA 2AV6A 1KKUA 2QQFA 3NIGB 4HLUC 4ZVSA 3ZYCA 1NVXQ 3BJRA 2NPFA 1HR0B 1FTSA 3GRYA 3A4YA 5FCDA 5A9RA 2XYHA 2YWGA 3IX7A 1CC1S 2QT0A 3F3YA 1X39A 3J7TA 5DW3A 1TF7A 2OPHA 1DAMA 4PBRA 1UZAA 4P9NA 2YTZA 4X84A 5BUSA 2HSDA 4BGDA 2AEMA 4RHTA 3FVRA 2NPIA 3ROGA 3UHAA 3WG9A 2WHYA 1GM5A 3OAAD 6PFKA 4M1WA 4HK4A 4KQKA 4M86A 1PLLA 2BMWA 3O94A 4BXOB 4LDZA 1V4BA 1CQJB 1X2BA 4H7KA 1TIPA 3GFTA 1DAEA 3DYIA 3R20A 5KYVA 1YMQA 4NE7A 4Z9AA 5LZ2A 2QT1A 3R6DA 3K0AB 3U16A 3K70D 5JRZA 4GLOA 2Y92A 3OOHA 4PTZA 1YGPA 3GC6A 3LW7A 4C5BA 3ABQB 3KAKA 3TIFA 4ENUA 3HCBA 1Z6XA 3V1UA 2PX2A 4L16A 4LZAA 2HA0A 4XDHA 2NU8A 3S55A 2ZSFA 2ZWAA 1LJUA 1E2MA 1FQJA 4NECA 4KHPB 2QN8A 4MKZA 3MS4A 3HQ4O 2Q5CA 1T26A 4I3GA 3BAFA 4IHJF 4A82A 2P9HA 4U6SA 1V4VA 5FQOA 1XELA 4JDUA 3UMCA 2C3MA 2D8AA 5H02A 3U4QB 3E1SA 1SU8A 3T0GA 1PR0A 2ZAYA 4D45A 2C58A 3G8DA 3LBYA 3QIVA 4UNNA 2D2XA 4O25A 1I13A 1E94E 2C9BA 3T5MA 1FFDA 4EG4A 2R9VA 4E5MA 1JDBB 2ORIA 5AHXA 1DRVA 1AT1A 4A3SA 2UUPA 3HL0A 1GKIA 1VE5A 5KBYA 5JSYA 1D07A 1JEQB 1T9CA 3K8ZA 2RB5A 2A78A 3CLKA 2JIDA 2AFIE 2X3YA 1KJ8A 4YJFB 4V0MA 3SY8A 1IZYA 1R6VA 2B5VA 3LXRA 3OE7A 3VR3D 3M6FA 5FP0A 4IO1A 1LLDA 2HA2A 3V4OA 1ADFA 1JBQA 4UNQA 1R66A 1UP6A 3T7KA 4K9LA 3IVMA 1B2LA 1JR6A 5YASA 1NZJA 2ODEA 4MRVA 5IAGA 3C8ZA 4DM7A 3EXFB 4AUNA 2P6RA 3BIJA 3E3LA 2WJIA 3ZU5A 3BZWA 4DAOA 3MGGA 3WBJA 1PS9A 3PNYA 4RA9A 5FWDA 3PXUA 3WLKX 2DPLA 5CVCA 2UZAA 4IWXA 3CR8A 3EK2A 4ALNA 2A4KA 3TLEA 2OCIA 4OXNA 3U1TA 5FDFA 4REMA 1EP1B 1HM5A 2Q8PA 2ZDHA 5ESXA 3PIRA 1L5KA 3AGPA 3EMDA 3IGFA 3EIUA 4J3FA 1RQLA 4RMNA 3N07A 1BU8A 2H1LA 2WE7A 2Y1XA 4N9QA 1W85A 4PRYA 1V1JA 3W8RA 4L5BA 1R6BX 1TTPB 2KB0A 3ILHA 4G6ZA 4C0LA 2YXPX 1XU7A 3R9XA 4JH0A 1T36A 2GZRA 2HMSA 3IAS6 3KP1A 4PO1A 2O2DA 3DV9A 1N3IA 2CV2A 1LPNA 2EJTA 5FFNA 3U56A 2FH5B 5DCLA 3EIWA 3EE6A 3KR2A 3E0XA 4J7CA 1C9MA 3U7RA 4P3OA 3QBTA 1MABB 4QBKA 1V71A 1LDNA 3IIJA 4PRZA 4L8WB 4V0RA 5H9WA 3QXJA 4IW3B 4JT9A 1NJSA 5JO0A 1OY1A 1E0KA 3G0OA 3ACCA 5HRAA 1ZH0A 3RRBA 2JAWA 1K3UB 2QUIA 2ZSHA 3CUYA 5ADVA 1TLTA 2BR3A 2EP5A 1MXFA 1V8ZA 3LHFA 3GRFA 2BBTA 3AF1A 3M4XA 5ECDA 4XVHA 3CRMA 3RG8A 3G9ZA 3BFXA 4YJDA 1QBGA 2ZTMA 4RPHA 5T7BA 1TQHA 2SCUA 2VHZA 2ZUDA 3RIMA 1QS0B 1MEEA 5AM1A 4FYYA 3BD9A 3DZIA 5HMMA 1RHQA 4HQKA 3RAJA 1M6WA 4N03A 1O57A 5CXUA 2WSMA 4E5UA 3HVRA 1IBKB 1BX3A 4AXXA 1Z3IX 2FRXA 4W7IA 2YQ5A 5EIBD 3LKBA 4ZEVA 4L4YA 1FSGA 2BY4A 3HCWA 4S24A 3ISJA 1UKEA 3K2QA 2NG1A 1T8YA 3IOYA 4K9OA 4MQUA 4Q1VA 4RABA 1DE0A 2Z1MA 4B44A 2MSLA 3S8YA 2Q7OE 1EM6A 4FMDB 3SLGA 1NNUA 5ENVA 3WNCA 1MMFB 5CJ2A 1YF3A 5M3BA 5KCMA 2ZIXB 1VBKA 2EOAA 2GI4A 3TLZA 3TW6A 2ZSJA 5D3QA 2X4IA 3S2SA 3BDVA 4GSYA 1I2MA 2BTOA 3NP9A 2R2AA 3BXOA 1MB2A 5LYJF 1GZ3A 2PQ2A 4N8SA 3VPCA 1Y7IA 4QOJA 1VM6A 5D7BA 2VQFB 2PJRA 4A2QA 2VYNA 2IY7A 1L5HB 1U5AA 4K6HA 4N39A 4RMJA 3BEDA 4J4TA 1DC5A 2XWPA 3L3BA 2BCJQ 1GZDA 5BQXA 4GX1A 5CA0F 4EJFA 1EEXB 3W3AA 4GRAA 4IDBA 3PUYA 5HZKA 1L4MA 4DGSA 3CWCA 4AKTA 1GQ2A 3OJCA 4R83A 1GVHA 4KU4A 4QIHA 3TXYA 1TCVA 5A5VA 4QBFA 3WGUA 5L3SA 1UBFA 3AI1A 1IFXA 1Q12A 4MVJA 5K3OA 2BJHA 1QGED 4BNLA 3OPVA 4BLVA 3U7QB 4J0DA 4JR2A 3PGMA 5EXTA 4KK3A 1CZKA 4DXAA 3PC4A 1SPBS 3RJTA 4E6PA 5BW8A 5AVXA 1PW7A 2JS7A 2QMZA 3HSYA 3IR7A 3CXRA 4ML3A 4YR7A 3N8GA 1JHPA 5NLLA 2QVZX 4KMSA 2X7HA 3D6VA 3FY4A 1ADGA 4L85A 2VL7A 3CVVA 3DMTA 1JAYA 2ODTX 3GAZA 4PC2A 3RVSA 3PZBA 4WCDA 2R6R1 2JAOA 4B87A 4EA7A 2H52A 1IHUA 3AY7A 3QRWA 5HE9A 4UBNA 2FEOA 2VAXA 3DZJA 3RRFA 5FHQA 3V9PA 5BSVA 1VL1A 1E5QA 4IDGA 5JE8A 4PQEA 2QZSA 3I6IA 1WHTB 4U0KA 2YVKA 4QM6A 1IBCA 5AHOA 5AMXA 4W9NC 1YBFA 1J9EA 2FQYA 2H2AA 2H8GA 3R3YA 1X8XA 4G1BA 5FFFA 4BKRA 3ZLJA 3NRJA 4QGGA 1NXQA 4QGAA 3JZFA 2CXXA 1I0LA 3M82A 3LXMA 1N5DA 3N39C 4K3UA 4KO8A 1Z8FA 1NUQA 5DHFA 5BSWA 4ABYA 6Q21A 5K0TA 3TRKA 5K8UA 1P77A 2BGRA 2HJRA 5ALTA 3A7DA 4FILA 1LY1A 1E5LA 1J1ZA 1XAJA 1IATA 2YFHA 3EZGA 3F9RA 3QFHA 4Q4JA 2R6HA 4NMLA 2ZRQA 3MG9A 2GCEA 3OCJA 4KXYA 4XTRA 3I04M 3JYQA 3OX3A 4IDAA 4WOPA 3P2YA 2UYGA 2GVZC 3F7OA 4L4XA 4C78A 1M54A 4BFCA 5TE9A 3UJDA 3L1IA 2EZUA 2B8EA 3QJGA 3HXOA 2C5GA 1U3VA 1QHYA 2B61A 2JGNA 3DOUA 3P0FA 2JVIA 3ZDQA 3KZOA 5CPFA 1IBMB 3R2JA 3HLYA 3L8EA 2CYCA 2LDBA 3TMKA 5IPFA 1SXIA 1KI4A 1DAKA 1M5UA 4P4LA 2WKSA 3DMPA 4KL8S 1U6IA 4BAGA 1T2VA 1ZN8A 1JFLA 3E3MA 2IGTA 1RP7A 3MMZA 3LG2A 2F62A 1YJ8A 3V3KA 4A0SA 1JDJA 3DNPA 4KVZA 4C1BA 1Z16A 1N5LA 1W36B 4OHWA 1RYDA 1BMTA 2B4YA 1KTIA 4FOPA 4TLCA 1RKBA 1AG9A 2F8SA 4BFSA 4J9UE 2IUEA 4IDPA 2GR9A 3ZQ6A 3Q40A 5AKEA 2EF0A 3HHEA 4GI3A 3AU9A 1JEYA 3SCZA 4YDQA 4KFUA 1E5XA 1GPJA 1SZJG 4KW7A 4AX8A 4HMQA 2W2LD 2FEPA 3E5MA 1IK4A 2V6FA 5LUAA 3W6UA 1R15A 2B6HA 2Q3DA 1EDZA 4BNDA 2I7DA 4S1WA 1LWOA 4F5WA 1YAJA 5GM2A 1HDEA 1JQJC 1NBIA 2ADOA 2WHPB 1Y8AA 2YS7A 2J9XB 1FP4A 2YASA 2YY6A 1RAEA 1E7YA 3I4LA 3K1YA 4B3IA 2GNPA 2FMTA 3KG2A 4JI8B 1GU0A 2ZVPX 3RBXA 1PSWA 2CFCA 1XC7A 4MRAA 1Y42X 3BRSA 3I6QA 1HTBA 3I2GA 4MUNA 4OHMA 5H8WA 1DBQA 1RZRD 4EF6A 3CEPB 4X1IA 1KJNA 1S7GA 3GP8A 1L7OA 2GRUA 4I1IA 1QO9A 3S1SA 2DH5A 3Q5DA 4C4AA 3RSFA 1FQKA 2HY7A 2VBFA 3E8XA 1WDTA 4G5RA 3S7ZA 2WF6A 2I3GA 2Q3CA 3D7MA 3D9QX 4E5NA 2VPTA 1GXSB 1Z5VA 3HBMA 4IXMA 3L2OB 4GQIA 5DRYA 2Y1LA 4Z99A 4C76A 5A5FA 4YMTA 1EXMA 2XUGA 5BWMA 2AJTA 4DARA 2QW0X 2P4SA 2R1TA 2I99A 4QLAA 1K6XA 3DQQA 2D5LA 1OGYA 1Y6FA 2AYYA 2QSJA 2OKGA 1ZD8A 3D3EA 2MWMA 1P3Y1 2YVAA 2ZPAA 1Z88A 4RPIA 5IN5A 3DDNA 5J2UB 1RM0A 4PC1A 4QYIB 3FF1A 2YHIA 3K9QO 5GOZA 4DLAA 1C14A 4HLQB 2AWNA 2EFYA 4MW2A 3ZD8A 3QG5A 2VQ3A 4CCSA 4M54A 2X8LA 2WIJA 5LB4A 4CXMA 4FI3F 4K8OA 3B1VA 1YZQA 2A86A 3Q3VA 4YTEA 3STWA 4QOIA 3DKVA 2EW2A 1WY7A 4M8IA 1E98A 2DJ5A 4FIZA 2V7BA 4GR4A 1JYEA 2I2BA 3DWEX 1CF4A 1RZVA 1DWUA 3HB1A 4MPJA 4ZEOA 3SC4A 1J2EA 5A0FA 2ZBQA 1V9CA 5DSXA 2J48A 1PQWA 3EYWA 3LDAA 4B4UA 3PNKA 1ZAKA 3VV3A 5CLFA 1E2UA 2WT8A 4LDPA 1T5BA 3JQ7A 1AKUA 4BCBA 4MQ5A 2AKAB 4KXFB 5HBGA 2C07A 2DR3A 1IN1A 3O8OA 5AI6A 4D9NA 3OZFA 2NZYA 3ETHA 4OHKA 5LSAA 1BX0A 2OSBA 3LP8A 1ST2A 2C3YA 1N8KA 3S44A 1NP6A 2Q9CA 5TNXA 4AWAA 3LUJA 3RTAA 5CNIA 4LNUA 4W99A 3ZE1B 2IYYA 5LZ5A 3ZX5A 3AH8A 1ZGAA 5CNMA 3DMRA 4DLXA 5CXQA 5JALA 1S9DA 3IUSA 5E6SA 2Y9PB 3RIHA 2O8BA 4X95A 1QFYA 5ABPA 1AHIA 2OV1A 3G5TA 3BA1A 4E4RA 4J2HA 3U26A 5ALPA 1NFQA 4X7RA 3WYDA 4O5AA 4D3YA 4QG3A 3ZU2A 3WL8A 3PRJA 5A5EA 5I6DA 2WTUA 1FS4A 3WHLA 1KH1A 1R64A 2IOHA 3JQ7B 4H17A 3SNHA 1U7HA 1RQRA 1L7BA 3QLUA 2WJPA 3AYXB 5FUMA 3F6RA 4FYKA 3H6HA 2J0SA 5G3ZA 3NC0C 1T3SA 2MYNA 1SELA 4H3KB 1XAHA 1EK6A 1IM5A 2ALJA 3DBHA 3JYNA 3A4MA 3NOOA 1XZQA 3GMTA 4K9KA 2YL2A 1C0IA 3IURA 3NQ41 4PZZA 3R7WB 4ZEXA 1M8FA 3WTBA 1ZJ4A 1ORRA 5LD2B 2D7JA 3BD7A 1ONBA 5GMOA 2V96A 3DTYA 2XWJI 3K0BA 4GP7A 5AKGA 1SPXA 3MFYA 1QFZA 1YE8A 1FSSA 1SUPA 4QXPA 3NHKA 1E3IA 2B69A 3NOXA 3N0TA 4AURA 3DE5X 2FR8C 3FHCB 4Q00A 4HNAB 3VNUA 3JZIA 5L6LB 2DBZA 2W0SA 4PYQA 3KAJA 1PL7A 4ZQIA 3W5JA 2UZIR 1TLFA 1J07A 1HDCA 1MAVA 1P7PA 2WM3A 4TLDA 4F7DA 3QU7A 1FYEA 3T7TA 4ITUA 5F2NA 2OMKA 3LX6A 1OJ7A 5AI4A 1HE5A 3R1IA 4MVJG 2UYHA 3O75A 4RZIA 4L51A 5CLLA 3B3GA 1USGA 1WRBA 5B4TA 2O6HA 4H3SA 3EVFA 2QRVB 3L1JA 3WRYA 4F92B 4BV8A 3V7NA 2G82A 5CFZA 3TW8B 5ARCA 4PC7A 3TSAA 2V7TA 5DW0A 5HSGA 7YASA 3F90A 3JALA 1BSVA 3HE3A 2E49A 3TLGA 2IY8A 3GJ0A 3RE1A 2XUDA 1FL9A 3D2LA 1RC0A 1F4LA 2OXRA 2GEVA 1MENA 1NRWA 1YB5A 1QCCA 2FRDA 4AD8A 3QEMA 2I1QA 2QD4A 1DXQA 4Z86A 4YNBA 5DZSA 4ZQFA 2GHTA 4HWPA 2J3DA 1L9KA 1IMJA 2WHPA 1F8YA 1QYWA 4RNCA 2EARA 1U2PA 3D5EA 1SH7A 4YECA 3S2YA 4EUSA 3DMHA 4RIHA 1RFLA 4Q47A 4EUHA 3DNMA 4R1QA 3H9JA 4JA0A 5LP6C 2ZUTA 2CY0A 5AJUA 4JJZA 3LVBA 2EKZA 4Q03A 5G0UA 2GB4A 3JQFA 4P4NA 1PGPA 1CEEA 3GLUA 4NF2A 2IS1A 3R75A 2PX4A 1FS6A 1MC4A 3OC0A 4QGBA 3W5AA 4PVDA 1U0EA 3REOA 4HRAA 4Z6KA 2HRRA 2YR0A 1QV6A 1ISMA 2OXCA 1KVTA 1ORDA 1SWVA 3ZE0B 1KZGB 2Q6TA 4WA8A 1E4YA 1SAYA 3BFPA 3VH1A 3AYZB 1FPQA 4B7CA 1KEEA 4DREA 3UPTA 1SIOA 4JL8A 2F1JA 2RAPA 5C8YA 2INGX 3BH6A 3OJEA 3N6VA 4QQFA 1POXA 4UVGA 3TLAA 1MV8A 5MFZA 3D1LA 3E8MA 1DKLA 3B9RA 4F4DA 2C2KA 3GFBA 2P3LA 2BWJA 4K05A 1P5HA 4Y2GA 3MRTA 3Q1LA 2GHQA 4DEXA 4ENRA 2NU6A 1N9GA 1SQGA 1ZI9A 3H42B 3OIDA 4IIDA 2XAUA 4E2WA 6ABPA 3K9FC 4EENA 4P54A 4OB6A 1CUSA 3BREA 3LV8A 3ZBTA 1G63A 3QXHA 4LI0A 4PF1A 3UF0A 3ZCQA 1T10A 4ZV4A 2Q3LA 1GPH1 4PAGA 2VVTA 4BQEA 3UAZA 1F6WA 4BIMA 5KYUA 2ENWA 3CZ9A 1OA0A 4B3XA 1E6EA 3GGDA 3GDFA 3H1GA 1TFRA 3JQ6A 1FNNA 1Q92A 5KJ1A 3B82A 4J76A 1JMKC 3DPUA 1UMCA 4P33A 1CD5A 2R5FA 2FJ0A 4M4SA 3L0SA 4MUEA 2NZXA 4EO9A 3MJVA 5CCDA 2F8TA 1NKVA 1ZG3A 2BM1A 2XCUA 3MXTA 5TEWA 3T7JA 2BHTA 2FEMA 4G8BA 4ZIRA 3SDZA 3UUFA 1BX1A 1GOTA 4BNKA 3PPWA 2I76A 3G8CA 5ALIA 2HL6A 3THYB 1VXOA 5HG0A 1QH1A 4ER3A 1D0IA 2MT9A 5IZCC 1KYVA 3NH6A 4QBTA 4C0WA 4CIAA 2XDQB 5L7TA 4CEHB 3C3EA 2ORWA 1JPUA 2COUA 2X7XA 3ETDA 4X20A 4DTIA 2P9CA 2PX3A 3KR0A 2CMGA 4N65A 2ZJ6A 3DOFA 3AEKB 2H4ZA 3FUXA 2QRLA 4P4SB 2DLNA 4U2EA 3HJGA 4WZ6A 1VDMA 4F60A 3ZVRA 3U3KA 3HVHA 1E7QA 5IS2A 3VA7A 3V4SA 1ZUNA 4HB0A 2EIHA 4JCCA 4NU0A 2QTWB 4CIBA 1SB8A 1Y5LA 4Y2YA 1NG9A 1XA4A 5E9QA 1QX3A 1XV5A 3T7AA 5KHOC 4MKHA 3BFVA 1QUFA 2QM3A 4ZU3A 4C6RA 3IB3A 4P7FA 3T4XA 3WZ2A 5EPUA 1RADA 5EZ5A 1SBYA 5BQ5A 1FFBA 2IS2A 1X6VA 1UL1X 2QMOA 1JDTA 1P45A 3GVPA 3QHPA 1QORA 4J0FA 1AKVA 3RRJA 421PA 3O8RA 4QVKA 5JNRA 4M8SA 1QVWA 2EX0A 4MJXA 2C2YA 4BMYA 1Z9BA 2ZSUA 5CG2A 1TUBA 1UMBA 2I3ZA 2LGJA 3OM0A 4HNQA 4JC5A 5BN3B 4RV4A 4PINA 4ZAGA 1CRQA 2WOJA 4J3JA 1NP7A 4QYXA 1T9GS 3K9CA 1JU4A 1CVIA 5B4VA 2QU8A 3IIMA 4QYWA 1XEWX 1C8KA 3AF4A 4RD4A 3VC3A 3W2GA 2P6MA 1PK8A 1UBJS 3COVA 5LMCA 3LTNC 3VU8A 1HSZA 4WE3A 4OM8A 1UCFA 1NYLA 2ZIXA 2FLWA 1QQ6A 1FFAA 2BUBA 4KFTA 4DNPA 4PZDA 4CLRA 2VATA 1UM9A 1KAGA 3A1NA 4OJNA 2EL9A 5JYCA 2IZOA 1B3BA 4YRQA 2X0FA 4YX9A 3N5CA 3GLIB 1KMQA 4P92A 4PG6A 1C4WA 4R54A 4AO8A 2ZM6B 4M2LA 2Z6QA 3AUUA 2WI8A 1W4BA 5MFPA 1SKAA 3FZYA 3R0JA 5CP8A 4W6QA 4EHHA 1ZU4A 2BI7A 4HATA 1RTTA 4LSMA 3C7KA 5FRDA 5K0NA 3U40A 3VAZA 4BE7B 5DLEA 5H82A 3OMLA 3MJEA 1H05A 4BC0A 4Q48A 4LOLA 2VC2B 2ZXFA 3FIJA 1GQFA 4XRGA 2GK3A 2ZCVA 2O6LA 4RF2A 4ZVTA 4A0QA 3P2KA 3RF7A 1R9NA 3QBEA 3QWFA 1GPNA 3TL3A 4QKQA 3M49A 5JMOA 2GLUA 3SXUA 4IY1A 5HWSA 3U81A 2FETA 4DV1B 4TKUA 2PE5A 1K68A 4MWOA 4MQEA 5BNTA 3FJ1A 1ZW6A 1DWQA 3OJ0A 1L4BA 1P2UA 1A9QA 1WTAA 3ORSA 5IJ0B 1Z62A 4RVNA 4ZV9A 2I67A 1VXRA 2IDMA 3PL1A 5H0IA 3ELDA 3TMAA 4N0EA 4O2BF 2JJ2A 2OV2A 1NXPA 1KU0A 1FTYA 3K0CA 4WESA 4WOJA 2V58A 5E0OA 4YN3A 4EA9A 4RYDA 4LHYA 4TRRA 4EYEA 5JV5A 1IEWA 2X41A 3PQDA 3LY9A 2A0KA 3WFJA 4BBZA 4BMPB 4A0HA 1R0XA 1YS9A 4KQMA 2JJQA 5ECYA 2X4DA 5BXYA 1IZ7A 1D6NA 4C4YA 2W2OA 1SD2A 1OC2A 2JFBA 1GD1O 4M9ZA 4MVXA 4NXNB 3OY2A 3Q2KA 4DV7B 5IUJC 3FPHA 3KUXA 2X0EA 1Z08A 4EHIA 4CJXA 3UY4A 4W9MC 1RYNA 3F6EX 3VR5H 1OXMA 1C9KA 1FUUA 4EG7A 1RKUA 1WCIA 3RUIA 1CV2A 2OD9A 3L84A 3LC1O 2Z56A 1XE3A 4JY7A 2FWBA 1T5SA 1CF9A 1Q11A 3MRXA 3RS7A 2ZTUA 1XJ5A 4ILEA 2XRFA 4FWIB 5G1NA 2OCAA 4FYVA 1NULA 2JL1A 3EOAI 3RTCA 2WJGA 3PTLA 2OGZA 2YN0A 2BV3A 1W4CA 3AR7A 1E63A 1T4GA 1RXEA 3T1YB 1YI1A 1OJLA 2HWWA 5C8ZA 3E7DA 3HXKA 3T06B 1A5TA 4I1SA 3W0LB 4HQOA 3WS7A 4CHTA 1R8YA 1ULAA 1XTJA 2RHTA 1I14A 4B5LA 1FVFA 3RAFC 4RD6A 3GYBA 2C7PA 4FFLA 2IEYA 4UKDA 3GVXA 5DI9A 3H65A 3RBVA 5G3YA 1N0IA 1Z25A 3HZRA 3JQGB 3UICA 3WQRA 1T9BA 2WJHA 4ZRNA 1GRCA 2MSKA 4C4SA 5EUCA 3L8HA 3EC1A 1I3KA 4NIMA 2P1DA 4O4IB 5A4KA 4NH0A 1QRRA 5AVQA 2HXGA 2YNMC 1T36B 3N53A 1D2CA 3DM5A 3FSJX 3JY6A 4LWZA 2P0YA 3T3PB 1Z6PA 1GPAA 4G25A 1E2FA 3EH2A 3JPYA 1U7WA 3RYCB 5CGZA 4FEEA 4FOLA 1C8BA 2PMEA 4KQ1A 4HZGA 3RYIB 4UTRA 1PNTA 1V8BA 4CN9A 1A8PA 2O0LA 4HFNA 4CDRA 2A1UB 4W7HA 2XCRB 2O3QA 1HRDA 3UHFA 1M8GA 4FPXA 3QP9A 3IPRA 5T41A 5AW7A 2QRJA 3DT8A 3WNZA 1BMFA 4G56A 2B2XA 3L7IA 2XAAA 1G6KA 4HYEA 4ND2A 2II6A 3DH0A 3ZNNA 4A6XA 4AJ9A 3E9MA 3AVUA 4HQRA 4YXWA 5K03A 2NYVA 1ZSNA 2JKYA 3B48A 2X0KA 3FCEA 4CTOA 3NAQA 4WZAA 4BXOA 3NTOA 4GXQA 3ZZ1A 4EUNA 3LX4A 1R9JA 2XI4A 3LW8A 3HJNA 3NTVA 4GO1A 4H08A 4KPUA 4RF4A 2E37A 1MX9A 3G2HA 5DWDA 5F21A 3PNSA 5BSEA 3KSAC 4FNMA 2VH5R 1XKQA 4Q19A 4UVDA 1S2IA 3V8RA 5L8VA 1DIAA 1XP5A 3UJHA 3KO8A 4HQ6A 4WADA 2CMDA 1GQRA 1ICEA 2VZ9A 1FFXB 3OQIB 5REQB 4C1NA 3VKHA 4H6VA 4DMUB 4MIOA 3AVXA 2G6BA 3O7MA 3KSZO 5CH5A 2Y76A 4X8LA 4EATA 3UH0A 1TTTA 4D9JA 1KFCB 1W96A 2CCGA 3DG9A 5FB3A 2NUTB 1OX5A 5IVHA 2IXGA 3VO9A 1DCKA 5JDCA 1XVLA 1AQUA 3PA6A 4U7JA 3SHTA 5IK2D 2DFTA 1Q6YA 2DGDA 2BR5A 3EXHB 4GZ3A 3ROEA 2PL1A 4DCPA 3RHTA 1ODSA 1RZUA 1T0HB 2EP8A 2TECE 4FUQA 5KYWB 1LV7A 2XWQA 4BQIA 2XVXA 2Z09A 4NJOA 1TZJA 1U5BB 2WAXA 5F77A 4PS0A 3ZHSA 3V4PB 3FOFC 1P39A 1UWVA 3IT3A 4O02B 2EX4A 4F1WA 2J4DA 3VI3B 4CMEA 1ZRNA 3FETA 5K8JB 1BVUA 3DBRB 5BYJA 2O06A 4DV4B 4JEIA 3D7LA 4N9WA 3OM1A 5C1IA 2P0AA 4XUDA 3GCGA 4LNHA 2CK3D 2IH2A 4FYWA 4CMGA 1VPTA 3LQKA 2WJJA 4XARA 4CFSA 2NLOA 1XXHA 2RGYA 1K88A 1RMTA 2C29D 3ELYA 4DN6A 1WLYA 2BE7A 2C3PA 3CRZA 4RXTA 2TRSB 4BNJA 4ESEA 3ASUA 4KPUB 4Y6SA 3ES9A 3GEPA 4XCXA 4BVBA 4H3VA 1ZUWA 1ESCA 5BSGA 5EXSA 3H5LA 3L4EA 1DADA 4TKLA 1SVOA 2CKDA 4CDMA 4LSWA 4L9RA 4PYNA 4YMVA 1ATIA 2RCYA 3AESB 4Q1FA 1OXBB 2JLVA 2BTQA 2RKBA 2RAUA 4PQGA 2X2OA 2XGGA 1PZMA 1TEZA 2XNHA 2C0CA 4HZIA 4J94A 3KXKA 4K1LA 3G7NA 3UO8B 4DJFC 5IF9A 2PUEA 2G80A 1JIXA 3DAOA 3FOZA 1C1XA 1MOPA 5B2ZA 3RBZA 5ISMA 3QOWA 5E3IA 1U31A 2PD3A 1HX7A 4LF6B 1DUVG 1I36A 4D4MA 1N8NA 2YZKA 3AJEA 4GR5A 4V24A 4UDYX 4TTIA 5FBQB 4LSZA 3VNAA 5GWXA 1T6BY 3VJKA 2NXNA 1T15A 4FIDA 4QICA 3ORYA 3FBGA 1Q83A 1ADBA 2ARKA 2C4UA 4JASB 1RBQA 1WMFA 3VHRA 1KBZA 1DC6A 2OORA 3OIYA 4H1WA 3VISA 1MCZA 1UXGA 3PJGA 1T1IA 4F8YA 1KAEA 1QZUA 1ZEJA 2H17A 3DEAA 3KTAA 2R7MA 4X3PA 2DHRA 5D8DA 3ZVKA 4GC5A 2XV1A 3ELUA 3FDJA 3MTAA 3SQMA 1P5RA 2WFMA 2YWFA 4PXSA 1GILA 2VJCA 3PICA 3VZBA 1XPOA 4TS3A 2C77A 1WTCA 2CZQA 4OD0A 4YUXA 3IBCA 2G88A 4ZI7B 1UBEA 4MINA 2AOUB 3GEEA 4ZT3A 2NZJA 3F4KA 5ALWA 4CLEA 1CEQA 3DW3X 4OP3A 1P1HA 1A9PA 3D8NA 4QX6A 2VPIA 5KCZA 2FWMX 1B74A 2PRKA 4ZCSA 4NJEB 2ISSD 3OTWA 1HQDA 1QM5A 1VI2A 4LXUA 1PZNA 3H2JA 4B43A 3U7JA 1K7FB 2P9BA 3JVUA 2G70A 4MRRA 4B83A 2I4IA 5IK2A 3IMEA 1LRKA 3WGMA 2AHRA 4F12A 4JUAA 3DLHA 1JZTA 4G0MA 1PWYE 4UBLA 3MAGA 4FLFA 2GMWA 4HNSA 3FMIA 4G0VA 5CW2A 2JAQA 4AMGA 1RRVA 1ZY2A 2HGSA 1T8RA 1TIBA 1LLCA 3DP7A 3ZJYA 5BVGA 5HQ3B 3F46A 2R0QC 1KA9H 1OZFA 1DIOB 1R0SA 2AN4A 3GRZA 4KBFA 4EQ6B 3EXG2 4IX9A 2XY4A 4K03A 3KEGA 3M3PA 4M21A 4CG2A 1G20E 4YEDA 3ZZ0A 2MINA 1EWTA 3KXLA 4LY9A 3RFTA 3ANNA 3OF2A 2OHHA 4EKGA 1G20A 2FW8A 3L6UA 1LNSA 1LDMA 3MWFA 3SOZA 3HUTA 4F06A 1CY0A 1BD4A 3I1YA 4ZGGA 1O6BA 4INOA 4BECA 5MN5A 3E2IA 2JIZA 5CFPA 1Z4IA 1JHXA 3I12A 2ZUBA 2C20A 3LSYA 4TV8B 1MJNA 1NW7A 5GGYA 3P0IA 2IH4A 2B82A 4ESVA 3UJCA 2G5CA 2AC4A 3SOPA 1J8YF 3VOSA 4XGKA 3R3HA 1ES9A 5TGDA 1Q1BA 3VZDA 3OURA 5SZJA 1G8PA 1NN3A 3V2HA 3ORQA 1SU4A 1KJQA 1Y3CE 5AVRA 1JB1A 1LEHA 3W5DA 1U8UA 1V1RB 2I4TA 2VJMB 3UT0A 3VVMA 3HYCA 5EQFA 1ZN9A 3A31A 4I55F 4OO3A 5K7SA 4WCVA 3ZV7A 4BP8A 3K9BA 5JHGB 2B5WA 3DD5A 3SVTA 2FPPB 3BE5A 3IAM6 4D4GA 4ZFNA 3IT2A 3FYUA 4NCXA 1RXVA 2NUBA 2HQOA 3GV0A 4CDNA 4R6XA 2DWQA 3PXCX 4AP9A 4D42A 4EDFA 2BKAA 2IEAA 4YFYA 4IVQA 5AKXA 4QJBA 3TLYA 2G04A 4UTVA 1NPTO 4Y2XA 3L8MA 4AECA 4G41A 3DDCA 4RLSA 3HVJA 4R3NA 1U0GA 3C6ZA 3RC2A 3B1WA 4TGLA 1U2GA 1DT3A 1KQ3A 3GLHB 1Q0ZA 5A0VA 1TEXA 4PV7A 4F7WA 4EECA 1C1HA 1Y3HA 2RHHA 3A1FA 4OOFA 1DBPA 4BCDA 4MWCA 5J4KA 1P7CA 1BE0A 2REBA 3U4IA 1FRQA 4M0MA 3R8CA 4BX8A 3NHAA 3QYFA 2B30A 2I78A 4O33A 3T1NA 4LYAA 4CI9A 1RHJA 3FZQA 3GT3A 4GXNA 3NBMA 4C06A 3U17A 1F12A 1QIJA 1OGIA 1JT2A 2D1SA 4MKGA 4RTLA 1F0PA 2OV8A 4Y1FA 1ISGA 1Q0UA 5J58A 4HUQB