4YBZA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
463
structure length
462
Chain Sequence
NDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
total genus 178
structure length 462
sequence length 463
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4ybzA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4ybzA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ybzA01
2E6UX 2O2SA 3GOHA 1IPEA 2VCYA 4DVJA 1WAMA 3AM4A 1DRWA 4ND2A 4WEQA 5K6AA 4R51A 4I08A 3L0DA 3I9JA 4RF5A 5JCXA 3BTOA 2E49A 1BHSA 3QWAA 5L9AA 1IHXA 3FNHA 4PG7A 1HXHA 5IXYA 4YJFB 5I9LA 3E5MA 3WGHA 1LJ8A 4HP8A 3RASA 2B5VA 4XB2A 1FMCA 2VWQA 5EN4A 2V65A 3PXXA 1PQWA 1UAGA 3PJFA 1RKXA 3WNQA 3GK3A 3ROQA 5I7FA 2O23A 4WLFA 1DAOA 1PGJA 4A7PA 5H81A 1DIHA 4BO9A 5DP1A 5I7SA 3WMWA 4FQ8A 1S7CA 1GR0A 5KIAA 4YJHA 2RBEA 2P2SA 1AUPA 2OBNA 4O1MA 2B83A 3GLQA 4K6FA 2NU9B 1GU7A 4J7UA 1MA0A 4YJGB 3OQBA 3TOZA 4MPDA 4BHTA 1GUZA 2CNBA 2Y1OA 5DP2A 1NXQA 3TL2A 2HDHA 5C5IA 3WWYA 3DHNA 2G17A 3HB5X 5FWNA 1R0KA 3B1JA 3GGGA 2EW8A 4ZD6A 4BQRA 4ALJA 1P3DA 3JQ8A 8ADHA 5JYEA 5IN5A 3VHRA 5G0WA 1HDOA 2O3UA 2PD6A 4J4BA 1PJ2A 1D3AA 2IZ1A 4YT8A 5ES3A 1MC4A 2VN8A 3PTZA 4OXKA 3PQDA 1YH3A 5TSDA 1C0PA 2PD4A 1UR5A 4UEKA 3GN1A 4JBGA 4EUHA 3ASUA 4IIVA 2ZCUA 5IFLA 2ZKLA 1VPDA 1UXJA 2GERA 1LSJA 1V9LA 4PLTA 4S3MA 4B7CA 3E9MA 5EINA 1I5RA 1Y5RA 3PRJA 3H9EO 3QSGA 1PJBA 4IS2A 1EFLA 4CMIA 3VTFA 3SLKA 1ADGA 3AM5A 4IGFA 1U3WA 3ENNA 4CQMD 1XKQA 1FF9A 1WP4A 2GZ2A 2XF8A 4CLDA 4LRTB 1IE3A 2CUKA 2YJZA 4DYDA 4RPHA 2FPIA 2HAEA 4PVCA 4TWRA 3VPSA 3TRIA 3FCOA 4CLXA 3BIOA 4FJ0A 1E7WA 1GDHA 1X7GA 2I3GA 3D4OA 5ADHA 3MCVA 2PZKA 1T4DA 3SC6A 5ENDA 3MEQA 3ZWMA 3ST7A 3NT5A 3TN7A 3IUSA 3O8QA 1ARZA 1EVJA 3HDYA 1O94A 1HE5A 3O26A 2YW9A 3PDUA 5B1YA 4Y67A 4D3FA 3ADOA 3OQ1A 4ND5A 1LU9A 4ZICA 1ZO8A 3G1UA 3H9GA 4NBRA 3JD0A 4KDEA 3UUWA 3ZWXA 1DRVA 3M1AA 4U0KA 2R00A 4IXWA 3U4HA 2PFGA 1TT7A 4DQXA 3L07A 5JAIA 4E6PA 3V1UA 1WDLA 4IXTA 3KLMX 2W4QA 4IDEA 2HJRA 3GY0A 3M2TA 4XQEA 1UXIA 1E3EA 1YRLA 1NHWA 5EQDA 3BHJA 5TF4A 1NVMB 2Q1SA 1W4ZA 1JKIA 4WOKA 4RVUA 3HNPA 1Z82A 3DBHA 4EZBA 3JD2A 4JNKA 4CM7A 1ZK4A 1BVRA 5L4NA 4IDAA 3VPGA 2J3IA 3HZZA 1M75A 1ZXBA 3GMSA 5AOVA 3WGGA 5B4UA 1KEPA 3GZ4A 1ZK2A 3CXRA 4L4SA 3RUIA 2ET6A 2XPCA 1MUUA 3KVOA 3R6DA 1VE9A 1GYRA 4UVDA 4RCVA 3GNQA 5LDHA 2TMGA 3GZNA 2HMVA 5JFOA 3EMKA 1PS9A 5CEEA 3AJRA 3CMCO 1C1XA 2Z1MA 4IS3A 4MVJE 1DIGA 4RZIA 1P31A 3JYQA 2VRBA 2LDBA 4YQZA 4BV9A 3I6QA 4RV9A 5F5NA 3O9ZA 4JQCA 2AE1A 2FSVA 3A06A 1GUYA 4Q39A 3EVTA 4NJMA 4UREA 3WYCA 4DLAA 1NNUA 1G6KA 3ANLA 1T1RA 3C8MA 3D0OA 4RO0A 4CM5A 1DSSG 4I8XA 4DC0A 3U49A 4EW6A 5I7VA 5JYDA 1U8FO 4YB8A 3DBLA 1GCUA 1E3IA 1K6XA 4MP6A 3DOJA 1QR6A 4PLWA 1E6EA 4K9DA 4NHEA 1IOLA 1RM5A 1JAXA 3KBOA 3JSAA 2EKLA 1LLCA 1YBVA 1Z7BA 1E3LA 1BSVA 2GNAA 3OA0A 4LN1A 4GWGA 2HMWA 4YT4A 1NFFA 2DBZA 1AHIA 1VRWA 3DAFA 1EVZA 2YQ5A 2PZLA 3AUAA 5DN9A 3S1LA 5IN4A 1XLTA 5KNLA 3A28A 2OP0A 1FDVA 4OO3A 2WD7B 1BW9A 4J49A 3K92A 1TT5A 5FI3A 4XQCA 4CQMB 3GFGA 4E32A 1QSGA 1PWZA 3CTMA 4M89A 3KSZO 1A7AA 4OH1A 1ISHA 5G0TA 3ZWYA 1EUZA 1CIVA 2EV9A 3MWEA 5DULA 3JYPA 1PL8A 2Q46A 1A7KA 4JJIA 1ADBA 3Q1LA 1UDBA 3TFOA 2HJSA 1JDJA 3VKVA 3JQBC 3BMQB 1AHHA 3JQAA 4B3JA 3PJDA 3N74A 1Q0LA 1S6YA 5HWSA 1EDOA 3PK0A 4ZJUA 3I23A 2I65A 4JP3A 4J3FA 4P4NA 4RLHA 4Z9XA 4FOOA 1B2LA 1BRMA 4PIVA 1XGKA 3NV9A 3WLEA 3GDFA 2YV3A 2BKAA 3RD5A 4N54A 3DMYA 3FSRA 3QVTA 4E12A 1V3UA 5IG2A 5L7WA 1SO8A 2Q50A 4UVIA 5IJZA 3ZU2A 5EQFA 5L40A 4BGUA 2O3TA 1HZJA 3JQ9C 3PYMA 1I01A 2VUTA 4A73A 2IXAA 5T67A 1C1DA 1CERA 3JQ9A 1EVYA 1QP8A 2JD0A 5ICSA 4L73A 4WKGA 5BSGA 3O03A 1IY8A 1I33A 1M66A 5JCJD 5KJ1A 3LF1A 1DEHA 3GMDA 1Q0HA 1DO8A 4BNLA 4DPLA 3CUKA 3HDQA 1PZFA 3UHAA 5CAEB 4XYLA 2W2LD 3F3SA 4FS3A 5JPIA 2BF7A 4PLGA 2EW2A 1X1TA 4CMCA 2D2IA 4OJNA 4KMSA 3LYLA 3I4CA 3ETGA 1E0DA 5G0UA 5COAA 4TROA 1XR3A 3QVSA 4OXYA 4CM3A 5A9RA 4XYEA 3GVIA 4YAJA 2X5OA 2B5WA 4NDNE 3K2BA 3GG2A 5IAAA 4DXHA 1VSUA 3MOIA 1U7TA 3HQ4O 2X8LA 2DTDA 2B4RO 1PZGA 3HSKA 3I9OA 4ZGWA 2J8ZA 3AI3A 1QXSA 4CMGA 4E5NA 2RHRA 2CDCA 2NADA 2QRLA 3DZKA 2V6MA 3AUUA 5TLSA 2I66A 3EVNA 3JD1A 4G65A 3BMNA 4D7AA 1IZ9A 3QHAA 4CV0A 3CEAA 1Y8QB 4PZCA 4LW8A 1XEAA 5A4DA 2YYYA 1I2ZA 1R15A 2VZ0A 4K1LA 1YOVB 2CVZA 3ZW9A 4QTZA 1C0KA 2YHIA 1JAYA 3SEFA 2C2XA 1BTOA 1KVTA 3SLGA 1E7YA 2GDZA 4WLUA 1N9GB 4PZDA 4PLVA 4B8ZA 2ZB4A 1EUDA 4B7UA 5I9MA 3AI2A 1YB5A 3KLPX 1LRJA 1KERA 3I1JA 3VH4A 1VL8A 1C0LA 1E6WA 1YJQA 2XAAA 3GEDA 3C1TA 4IIUA 1E1LA 3PP8A 5KVSA 3BMCA 4O0LA 1GZ3A 2Y0DA 3BYZA 4J0FA 2AQHA 2NWQA 1LC0A 3PIIA 3WICA 1XG5A 3EYWA 5AVOA 2HK8A 2X9GA 4PN3A 4JBIA 2DPGA 4E31A 5THQA 1Z73A 1E7SA 4UVGA 3I4FA 3WGZA 4XEHA 3C1AA 5CP8A 4EJ6A 4P4LA 1GQQA 2Q4EA 3OFSA 4WK6A 3EDMA 3HB4X 2QIOA 2FP4A 1Q2XA 3PHGA 3Q2KA 4OOEA 3WJAA 4UAGA 4CV3A 1QORA 1NWHA 4YVFA 3K9QO 4BNJA 3STHA 2BFAA 3ZHYA 4XYMA 2DTXA 4GQAA 4Q3BA 3ETDA 4E5MA 2BGKA 5A3VA 4AJKA 4BB6A 2FPGB 3QVWA 2NVBA 3WTBA 1EZ4A 6LDHA 4M87A 2HCTA 1I32A 3RAJA 1KVRA 4NK5A 2WJPA 1UDAA 3V2HA 1DIBA 3RQSA 4TVBA 1NPTO 2DFDA 6ADHA 3HFGA 1JVBA 4R5HA 3U0BA 3F6YA 4XCVA 3BTSA 2A9FA 2HK7A 4L0QA 3ZV5A 3H3FA 1HE2A 2I5PO 4ALIA 1SOVA 3C3XA 3AWDA 4PLCA 3RVDA 4N5LA 1YL5A 2C2YA 5I8ZA 3NTQA 2P4HX 2NUAA 1HDCA 4Z9FA 2AQKA 4MKRA 2P9CA 3WXBA 3UXYA 1A4UA 3IAHA 2PR2A 3UGKA 3LK7A 3DTTA 3KSUA 4J9VA 3ZU4A 4LGVA 4Y8VA 2PGLA 3V2UA 1PGOA 4ZU3A 5JLAA 3WQRA 4OQZA 3INGA 1E1NA 4GLLA 1B8PA 2CF6A 4F3YA 2A92A 3KYDB 1U3UA 2UV8A 4II2A 3AM3A 1EK5A 2C82A 3WNVA 3U62A 5U1PA 1PWXA 1PJCA 1ZEJA 2OBYA 4BNKA 4E0BA 4ONEA 4J1TA 4B4UA 3NAQA 1IZ0A 2J3KA 2D1YA 1P0CA 2G0TA 3PLRA 2BLLA 2VHWA 2WE7A 4IUYA 2B36A 1Y9AA 3HFSA 1DPGA 1SB9A 3GHYA 3MTGA 3ZV4A 4CLEA 4ALNA 2ZB3A 2O3JA 3INRA 4YJDA 4A26A 1YQDA 1ENPA 3NDRA 3GT0A 1IYZA 3L4BC 4B8WA 2ZB8A 3ONFA 4NBWA 1AN9A 1HF3A 3NT2A 3S2FA 3D64A 1F8GA 2AW5A 1H9BA 2O3QA 1YQXA 3FF4A 4XIJA 3WIDA 4EJ0A 1C3VA 1K6JA 3KUXA 3NGXA 3VH1A 4YAGA 4BO2A 1E6UA 4XDZA 4BUCA 4BNIA 5H83A 2QRKA 4LVUA 3WG9A 5BT9A 4ZRMA 5DBIA 4RQUA 3T4XA 5DNAA 2GASA 1TI7A 3RC7A 2Q2WA 3DZBA 3EW7A 1NR1A 5A03A 1JLLB 1PL6A 2H1SA 3TZHA 3PDJA 3AUSA 4OKIA 4RVGA 3PVZA 3PQEA 1W6UA 2X0NA 4NQZA 4J91A 4G2NA 1U4SA 3WDSA 4BMNA 4D42A 1CRWG 3KEQA 4R3NA 1MB4A 3PZRA 2VHXA 4QQRA 3SXPA 3ITKA 1BXGB 3X2FA 3MOGA 4B4WA 4KUHA 1VI2A 1WZIA 3DR3A 2Y68A 5JS6A 1MXFA 3T4EA 1K3TA 4IY1A 2C54A 3U09A 1Q7GA 1A27A 1HL3A 1XELA 1IHYA 3IDSA 2OHXA 3GN2A 1GEEA 5JDIA 5KJ6A 3TNLA 1HDXA 2P5YA 1P74A 5C7OO 1NVGA 2DVMA 4RVHA 4AJLA 1LX6A 4ZQEA 1LLQA 4GGPA 5HM8A 3DFZA 3DC2A 3VAZA 4HFNA 3MJCA 4CMJA 1R6DA 4CL3A 2NTVA 4AJEA 3MWDA 1HRDA 4GH5A 2FR0A 2VTDA 4CL8A 5JAMA 4CMKA 1O5IA 2H6EA 4FGSA 4DWVA 2ZIZA 1LC3A 3I3OA 1SC6A 1T24A 2DKNA 1NQOA 3U3XA 1RM4A 2FSSA 1X7HA 4A2CA 1R4MB 1HLPA 3BMOB 3DBRA 4AJHA 3CSDA 1AXEA 2JAPA 3JQ7A 1OC2A 3COSA 4J4TA 4J2OA 1UZMA 3D7LA 5DDIP 5MGBA 4OGWA 4MP8A 5T8KA 3PQFA 1N7GA 1ZKMA 5L4SA 3JQGA 1FJHA 1KEWA 2OXIA 8LDHA 4IJKA 1NAIA 4KDFA 3C1OA 1LDMA 4OKNA 3ZHZA 3L77A 4OSPA 2CY0A 4E2WA 4CLRA 2JL1A 3RFVA 2I67A 5BQFA 4BNVA 4QFCA 3AOEC 4MKZA 2GRAA 4XGIA 1K6IA 3I9KA 1HSOA 5HBRA 1RPNA 2X86A 4BNGA 1ADCA 1X14A 3HADA 3PPIA 2WYWA 4CMBA 4IINA 2JD2A 1W73A 3DZHA 3I9LA 4OOFA 5JDCC 4NZ9A 3U4CA 1ISIA 3B1KA 3HUDA 4HXYA 1OC4A 1XHLA 3G49A 1ZXLA 4AJ2A 1XQ1A 1SBYA 3I9MA 3GVPA 4XRRA 3W8DA 2CD9A 3TZQA 1GV1A 2ZJ0A 3H4VA 4ZHSA 4FBGA 2D3TA 3EAGA 3GA0A 1NQ5A 4KUGA 5JDCA 4CR7A 3D4NA 5F1OA 1E7QA 5AXAA 4UUOA 4FIZA 4W7HA 4WPGA 1FDWA 4RGBA 3AY6A 1R12A 4Q3EA 1EE2A 5G4KA 5JAQA 4CLOA 2UDPA 4II3A 3WIEA 1N5DA 3IIEA 3GF4A 4DRYA 1FDTA 1KVQA 2NU7B 1JW9B 3FBTA 4Y9DA 3W6ZA 5A06A 1WW8A 2CVOA 1CEQA 4JJFA 4PVDA 2WDZA 3L6DA 4E4YA 1DIRA 4Q3CA 1Q1NA 1P1KA 1PZEA 2JCYA 4GVLA 1U9JA 1KC1A 2PKQO 1YL7A 4CM8B 2VQ3A 4Z6KA 5A5EA 2EGGA 1EVIA 2A4KA 3T7EA 1DC5A 1P1IA 5BNFA 1HYGA 4CM9D 4F6LA 3GPIA 3H8VA 4NR0A 5DOZA 2JHGA 4FW8A 1JQBA 2RIRA 1OZAA 1OAAA 4RL6A 1EBUA 4FFOA 3W1VA 4K28A 3ZWNA 5L4LA 4HBGA 1WVGA 4CQLA 1E7MA 3DZIA 3E48A 3RI3A 3F4BA 3IP3A 1N1GA 2YV2A 4EGFA 3KRTA 3OJLA 4TVOA 1IULA 1ZFNA 4QO7A 3W4IA 4IZIA 4TRMA 2FMUA 4D0SA 4J7XA 4J1QA 5B37A 5G4LA 1H2BA 2FPIB 4GMGA 4R9SA 4I9UA 4JK3A 5JSFA 4I9HA 1PJTA 4J43A 4RVSA 4BMVA 1YQGA 3A1NA 4N5MA 4Q3NA 1UP7A 5F5LA 1RYDA 1QLHA 4LMRA 4IDDA 3IOYA 1XCBA 4DBZA 5JC8A 4EJMA 5KTKA 3O8QB 3CKYA 5HS4A 4D3DA 2Q1WA 4JCOA 3UW3A 1YGYA 3QV1A 1LQTA 2AG8A 5TQVA 4A27A 3QWFA 4S1VA 3DWFA 1F12A 3D1LA 1ENOA 3Q2IA 1I2CA 3UCEA 3EC7A 1QRRA 2OFPA 4RZHA 3F46A 1WDKA 1CF2O 5TIIA 3DZJA 5JAZA 3H2SA 1CDOA 2ZATA 3JD4A 4BKRA 3IP1A 5IDXA 3O38A 3C7CB 4G5HA 2SCUA 1DHTA 1YO6A 4BKPA 4YJFA 4GWKA 2GYYA 3FNGA 4TRJA 1DFHA 4BNTA 1KC3A 4DL9A 4EEXA 1NFRA 1SOWA 1LI4A 3IC5A 4IPTA 4DBVO 7ADHA 2IZZA 1QV7A 2NU6B 3K30A 5TS3A 3K73O 3ICPA 5CPFA 5CG1A 4FN4A 1PEDA 2NQTA 2BI8A 4GVXA 1R4NB 3TF5A 3DDNA 2C29D 1H6AA 4YJGA 2NU9A 1LBEA 2HO5A 3GVXA 2X1HA 4DYVA 2Y67A 4NMHA 3SX2A 1RYEA 4MVJF 4ID9A 1RM0A 4PLYA 2HRZA 1P1RA 3RBZA 4RF2A 2O48X 3PHJA 4AJPA 4E5PA 5A9SA 3GZNB 3LT1A 2UUOA 1KY5A 2WYVA 3DAGA 2VZ9A 4XIYA 1X13A 5GMOA 4XGKA 2J3HA 3DHEA 2IE0A 5LDGA 2JFHA 1DBVO 4MVJH 1BDMA 5CDGA 5ICMA 3M6IA 2CDAA 4MVJP 3QIVA 3KXDA 2Y1FA 2NSDA 4J6FA 3WQSB 4KQXA 2EKQA 1NBOA 4WLNA 1M6HA 1T1SA 2AE2A 4IBOA 4IDGA 1M67A 1WWKA 4WJZA 1BWSA 2ZYDA 1D7OA 3G3EA 5DCYA 4YBZA 4EDFA 4E2YA 3IQDB 3PWKA 1E3WA 1GAEO 3BTUA 3FI9A 1D1TA 2O2YA 4JP2A 3HDHA 1JVSA 1ZK3A 4NBVA 4UUPA 1QYDA 2FOIA 4Y6PA 4NBTA 3KYBA 4FOSA 1GL3A 4WLEA 4O63O 4PG8A 1P0FA 5A04A 3JYOA 3P7MA 4GX5A 2WE8A 3Q6IA 4D41A 3VDRA 4MOWA 3QP9A 3RBVA 3DB2A 3E18A 2GD1O 2AA3A 2D8AA 3WSWA 3SC4A 2YZ7A 1ZK1A 2BMAA 1SCUA 3PGJA 4W82A 3SJUA 1Z74A 3ZWPA 4ZVVA 4IZHA 1GFSA 2DUUA 1WZEA 2QYTA 4U8GA 3HJAA 1YXMA 3N7UA 4U0JA 3RUDA 4N5NA 3S8MA 2GPTA 4FDAA 3GVHA 1YDEA 4IQ8A 4CPDA 5JBIA 1RWBA 1BXKA 1P1HA 1XSEA 1ONPA 4DC1A 2YQ4A 1OFGA 4NU5A 1CWUA 2P9EA 4FSHA 1EQ2A 1KVUA 4BO7A 3TQHA 5A05A 5CDUA 2H5LA 3ZWWA 3WBBA 1BG6A 3V2GA 2W98A 2JAHA 1WMBA 4E3ZA 1MXHA 2P91A 3BZUA 3OJ0A 4ND4A 4Z0TA 2BFOA 3EY4A 3KHUA 1GPDG 2DLDA 2ZTVA 3OIDA 1LDEA 3OMLA 4IJWA 1P1FA 1YBMA 2H63A 2QX7A 3FHLA 3PGXA 1PSDA 5DCWA 3ZNQA 1F14A 2J5KA 3RU9A 4M1QA 5JE8A 3W8FA 2W2KA 4Z9YA 3NGLA 1X1EA 4B4OA 1GPJA 4J2HA 3UFXB 1E7RA 1OBFO 2Y0CA 3O4RA 2VTEA 4MVJD 1B3BA 2FN7A 1OI7A 2FR8A 3BHIA 4Q3AA 1IUKA 3JQDA 1B8VA 4C7JA 5KOIA 2X9NA 2V6FA 3LZ6A 4GAEA 4HUJA 5FI5A 1JWBB 1ISMA 1KOLA 3C7DB 3LC7O 3S2IA 4Z3DA 3UICA 4DLLA 4I5EA 2I99A 1CETA 1HYEA 1LDGA 2X6TA 3F1LA 4PLZA 1BGVA 1PJLA 2VYND 2ZB7A 1F06A 4W99A 4FFRA 3OM9A 2C59A 4H7PA 3VZPA 1HDZA 1VL0A 3JQBA 3QWBA 2Q99A 2PZMA 4HKTA 2HLPA 5ITWA 1I36A 2Q49A 4NFYA 4YAIA 3ZWCA 4AJ1A 2HRBA 1J5PA 1ULUA 4F45A 1ONNA 4ALLA 3GPDG 3KSDO 2AXQA 2FPPB 4LSWA 4J1SA 5TNXA 4WCFB 2RCYA 3PJGA 1E1MA 1HETA 3D3EA 2WM3A 2PH3A 2EKPA 2ZQYA 4XKJA 1P45A 3KZVA 1A71A 1EQUA 1MV8A 4UVEA 3AUTA 3AU9A 1B7GO 1SZJG 3RFTA 3NDJA 3QY9A 5TGDA 4R16A 5C37A 2O4CA 3WFJA 4OM8A 5L7TA 3WQQA 3BMNB 2DT5A 3FRJA 1EK6A 2WD7A 4YRDA 4WOJA 3CZRA 3AY3A 3S2EA 5A02A 4NBUA 3PHIA 1E3SA 1CQJA 1O0SA 5JO9A 4CQMA 4D44A 1FK8A 5L53A 4K26A 2FR1A 3GG9A 3B6ZA 1QLJA 1UH5A 1H94A 3ZWBA 2WD8A 1LDNA 4O59O 3SJ7A 1DRUA 1R0LA 1B14A 1T25A 4MKXA 4MO2A 1VJTA 1I3MA 1BMDA 3LC2O 1HKUA 3AFNA 3AFMA 4UUMA 1AE1A 1X0XA 1PGQA 3HE3A 5DBFA 2EIHA 1U5CA 1A72A 3H6KA 1YONA 3H2ZA 4MVJI 5ER6A 4YRBA 3BMCB 5IDQA 4DPKA 3LSYA 3E9QA 3LF2A 3ZWAA 4A5OA 2VYVD 2IDZA 4L76A 1GY8A 4WE3A 5EESA 1NVTA 3F5QA 4BNMA 2YY7A 1M2WA 1DIAA 2TMDA 4H16A 3VPFA 1EBFA 1YE3A 1LLUA 3RUEA 2PKRA 4CV1A 2Y1DA 2PLAA 1DJQA 5GZ1A 4MJLA 2IXBA 3LVFO 4QEDA 4BO3A 1ZVMA 1PL7A 4E5YA 3H5NA 4JN6B 2X9VA 2A94A 4PCVA 4CUJA 4WGGA 3EK2A 4CR8A 3JCZA 1MG0A 1SNYA 2YFHA 1T2EA 4LCEA 4HNGA 4RLSA 3G1TA 4R69A 3GC6A 4TRNA 1KEUA 1CYDA 3VPHA 3PEFA 4J90A 4U6SA 2VNSA 4IDCA 2ZTMA 1VLLA 4WCDA 4RJTA 4CM4B 2DBQA 4BO4A 2HK9A 2HQ1A 4BNNA 1P9LA 1LA2A 5CAEA 2PKQP 3MJVA 3NUGA 1LQUA 4WNCA 4M54A 4BO5A 2Q2VA 1H5QA 4OXNA 3K2EA 1VKOA 3D3WB 4TZKA 2I9PA 1HDRA 3OSUA 3DXFA 2QQ5A 4AICA 3FBGA 2B69A 2VRCD 5C7IO 3GEMA 3GRKA 3LT2A 5GZ3A 5EPOA 2FZWA 4LMPA 3SVTA 1YL6A 3LT0A 2NUAB 3ROPA 5I7EA 3HN2A 2Q45A 2B37A 1SPXA 1PQUA 1VC2A 3R1IA 3KTDA 3OP4A 4IM7A 1GQYA 1PS8A 5K0ZA 3GEGA 2FY8A 2VWGA 5B12A 1SAYA 5EJ2A 3RUFA 5L51A 2Z5LA 4IDFA 4XYGA 1ULSA 1Y8QA 4HNHA 1E5LA 1O89A 1BDBA 1V35A 4J4HA 5DCUA 2OL4A 1Y8RA 2OGUA 3ZW8A 1YOVA 2JHFA 2PK3A 3TPCA 4B79A 5HA5A 3FNEA 3TFQA 3BHMA 3CMMA 5L95A 1ZSNA 5TJ9A 2NU8A 1N9GA 2NTJA 3NTRA 3EZYA 1DLJA 2QHXA 1U7HA 3IMFA 4B3HA 2Q1TA 1V3TA 1ZCJA 4GKBA 4EBFA 3C85A 4YCAA 1NTOA 3Q0EA 4LRSB 1ENYA 1J4AA 4Z0HO 1UP4A 5CFZA 3RJ9A 3TOXA 3H3JA 4JGBA 3U9LA 1UXHA 2GSDA 3D5TA 5G2OA 2X7HA 4KTTE 3GR6A 3JQEA 2H9IA 2E48A 2HMSA 1GQ2A 2C0CA 3CH6A 3LLSA 4CM6A 2G82A 2B35A 2WSBA 3I83A 4TQGA 4U5QA 2ZCVA 4FD3A 3HN7A 3R3SA 1PJSA 2PD3A 3JQFC 4E2XA 4ILKA 3L6OO 1HWYA 2AQ8A 4R1TA 1I10A 2NVWA 4CMHA 2HU2A 1NPYA 2VT3A 1F17A 4JXKA 2D5AA 3JQ6A 1JKJB 3TL3A 4E21A 1JTVA 4UEJA 3QVXA 5COBA 2F1KA 1MLDA 2FPGA 2EP5A 3V1TC 3OEYA 2O4UX 1ZMOA 2EJWA 2DM6A 3I9NA 4YXFA 2B0JA 2AMFA 3RKUA 3MJTA 2G1UA 3KV3O 3V5NA 2CFCA 4HV4A 5A3JA 1LEHA 1AGNA 3FR8A 4JX8A 4PLPA 3H7AA 3NYWA 3WX0A 4GSLA 1U2DA 1PQPA 3BXXA 2PZJA 1GZ4A 2OP1A 2DQ4A 3L4BA 3GFBA 4XQ9A 1Q7CA 5U9CA 1B8UA 2POQX 1FDSA 3B70A 1DFGA 3W4JA 4IMPA 1KBZA 4CV2A 5EERA 3WGTA 2PWZA 4AJ4A 2D4AA 3AU8A 3VZSA 4NFSA 2X58A 1ZJZA 2RHCA 4L75A 3MWDB 1PGNA 1I24A 4R5MA 5JCJA 5KVQA 2VZ8A 3VC7A 1UUFA 4HX5A 2DFVA 2BI7A 5LCXA 3AK4A 3KYCB 3TDKA 2W2LA 5IDWA 1WPQA 1PJQA 1EUCB 1E1KA 3IL2A 5IZ4A 3JV7A 3PFFA 1G0OA 3DBVO 3C24A 3KYDA 4Q9NA 5F21A 4QSMA 3QRWA 1YJ8A 1BXZA 1N7HA 5B4TA 3RC9A 5K9ZA 3PFWO 4YA6A 5JY1A 5KJEA 2DPHA 3FR7A 3WS7A 4XX0B 1EE9A 1DHRA 3ZNPA 4FB5A 4BGEA 5KVVA 1DB3A 4R4JA 5AYVA 3EGOA 3P2YA 4ZN6A 3MJSA 4BS9A 1Z75A 3FTPA 4CM1A 4I5DA 3DOOA 5FFFA 3DHYA 2DBRA 4M49A 3TWOA 1KETA 2UVDA 2G76A 3CPSA 1D1SA 1ONOA 4BNZA 1B0AA 3HDJA 5TC4A 4D46A 1PJ3A 5TJHA 1B3RA 3C7AA 4CMEC 2CDBA 3E8XA 4GSKA 1BVUA 1ZW1A 1I30A 2XOXA 4CLHA 1ZIDA 2DC1A 3K8ZA 4WEOA 4ALMA 3FWZA 3ZZNA 4BO6A 3EHEA 3RIHA 4CMEA 2O3SA 4BGIA 3WGIA 2Y99A 1EEHA 3K31A 1GYQA 4HFJA 3ZDFA 3ZHBA 4PG6A 1DFIA 3PJEA 1I3KA 1N2SA 3ANMA 4X54A 2NM0A 1ZSVA 3ON5A 3PI7A 4BNWA 4BGVA 4R01A 2G5CA 4IMRA 1VM6A 4C4OA 3DL2A 3W4KA 1ID1A 2ZTLA 4BKQA 1NYTA 2VT2A 3QLJA 4XJTA 1A5ZA 5BSEA 4HFMA 3GQVA 3LC1O 3IUPA 1I8TA 2LDXA 4B3IA 2CSUA 1EFKA 3L6EA 3T7CA 1YDWA 3UH1A 2AQIA 2Q4BA 3MZ0A 2P9GA 4TSKA 3Q3CA 4RORA 5KWEA 1TVEA 3WMXA 2V7PA 3AOGA 1QG6A 3DAPA 3P19A 3KM0A 1KYQA 3AOEA 2GCGA 4DMLA 1WMAA 3UN1A 1ADFA 3Q9UA 3OICA 5KKCA 3KB6A 3IKVA 3U5TA 1O9BA 4ND1A 2I3AA 4DLBA 1W8DA 1T2CA 4OMUA 4M55A 3VVCA 3GGOA 4GX1A 3WLFA 3H65A 1SEVA 1W0CA 3OF2A 4N18A 4KQWA 3TZCA 1ZNQO 3NEPX 1TEHA 1CQIA 3GUCA 1L1FA 4CQLB 1H6BA 1QYXA 3ZGYA 4YEDA 4YJHB 3GRPA 1CJCA 4B7XA 3TZ6A 4J9UE 3A14A 2BFPA 3OJOA 1U28A 4DIBA 4BNFA 3W6UA 1RJWA 1LLDA 2C5AA 3GAZA 3UVEA 2NVUA 3KOUA 1PX0A 1I0ZA 3E82A 4Y98A 4U7WA 4CUKA 3QW2A 5AQ1A 3JQ8B 4DPMA 3BTVA 4ND3A 2QZZA 3V1YA 3UCFA 2C5EA 1HYHA 2PNFA 4D43A 3FD8A 4FCCA 3H9JA 3WTCA 2PTGA 2V6BA 2OUIA 4PG5A 5K6AC 5HRUA 2P4QA 4MIYA 1V0JA 1AXGA 2Y05A 1D4FA 4R68A 2D5CA 3I5MA 2VNAA 1LUAA 2QYSA 4QT0A 4R1SA 5CHEA 4L4XA 1HE4A 2IEBA 1GTMA 3OH8A 4CJXA 4KZPA 3AI1A 4CMIB 4DUPA 4PFJA 5CDTA 2Z1NA 2O3RA 4YACA 3FN4A 2SCUB 1V6AA 2OORA 2NTNA 4XA8A 2IYPA 2NV6A 3OBBA 5COQA 5A1TA 5I8WA 1K89A 4MDHA 1HT0A 2E82A 4R41A 3JD3A 5EMHA 1E77A 3HG7A 3WR5A 3JQAD 2W8ZA 3G17A 5ENVA 5T6BA 5IF3A 1RM3A 3K6JA 1T26A 4NJOA 3ABIA 4ZQFA 3E03A 2O7SA 3OQ6A 4NU6A 4OYRA 3ROKA 4E13A 2NU7A 2BH9A 4Z0PA 1J0XO 3ZV6A 5HTOA 2DBVO 2E37A 2EERA 4HFRA 5HS6A 4CMAA 1NWCA 5A9SB 5CPBA 4CM8A 3ZNNA 1E3JA 3NJ4A 3NRCA 4XDYA 2AEFA 4PGFA 3KEOA 3ZNOA 4FPXA 4XYBA 3NX4A 2ILTA 1K5HA 2NNLD 4MP3A 5B4VA 3DOCA 3FNFA 2EG9A 2IRWA 2WYUA 4TRRA 1NPDA 1P44A 1NQTA 1YWGO 2VOEA 3CZMA 3DBHB 3GDOA 3ZH2A 1LNQA 3TZKA 4A03A 3WSVA 4PZEA 4CUZA 1E3WB 2EP7A 2ZJ1A 3WJ7A 2JFFA 2ZK7A 2UUPA 3OETA 2OO5A 4J7CA 2BELA 3X2EA 2Q2QA 1L7EA 5T5QA 4IJVA 5C7LO 1YS4A 2VOJA 3UCXA 1H6DA 4QFDA 2PA3A 1ZEMA 2EJVA 3DTYA 2VHVA 4BNUA 4PRKA 1EMDA 3FPLA 3WBFA 1K0UA 4J0EA 2YHUA 4UULA 3RUCA 1SCUB 1C1XB 4D45A 1IL0A 4QXMA 1YBAA 4KUEA 4GI2A 1XDWA 4I5GA 2BRUA 4FR5A 3VDQA 5GZ6A 2R00C 4TKLA 1SB8A 2P68A 1ZJYA 2EGHA 2X0IA 5JMPA 3IS3A 4I5FA 4I9NA 2RAFA 4NJMB 1F0YA 4UVHA 2X0RA 3RC2A 1NHGA 1PZHA 4GLOA 4JBHA 1F8FA 2HMUA 1NQAO 2EWMA 3JTMA 3MJEA 1JN0A 3DBLB 4ZA2A 2JJYA 5BSHA 4LK3A 1Z6ZA 4JJGA 2QG4A 3F47A 1JWAB 5JNLA 4GX2A 1H6CA 3JYLA 3E9NA 4QO8A 5ITVA 1C14A 2X4GA 3RBXA 2R2GA 3OECA 3DQPA 1R37A 1GUFA 1PGPA 1R66A 3INTA 2NU6A 3G79A 4DTIA 2AHRA 2WTBA 1DAPA 2JCXA 5A5FA 4RQTA 3ENKA 1T2DA 3WGOA 4BB5A 4E5KA 1NFQA 4URFA 1U1IA 1DC6A 1D8AA 2W2KB 4LISA 1B16A 1R4NA 3R0IA 1BW9B 3LQFA 4BVAA 1TT5B 2GZ1A 2CF5A 4P38A 3QVOA 4P8RA 4FC6A 2B4QA 5DOVA 3VZRA 2GN8A 3PZBA 4YDRA 4I1IA 2JCVA 4WECA 4KP7A 5ILOA 1Y9EA 1TLTA 3MWEB 3OHSX 1LSSA 4PLFA 3UAGA 3D5QA 3RJ5A 3ZU5A 5BNTA 3JQAB 5DT9A 3ULKA 2YDYA 3D4PA 4KWHA 4PRLA 4BNXA 1I3NA 2UAGA 3WOHA 1QYWA 2PY6A 1N8KA 2Y1CA 3F5SA 4RF3A 4FJ2A 2ZTUA 3DMTC 3PYXA 2GR9A 2PV7A 2BD0A 2EEZA 4ROSA 4INAA 5TRTA 1XU7A 5DZSA 5TT0A 1O6ZA 5A9TA 5KJCA 1DC3A 4YAKA 3F1KA 3DMTA 1IB6A 5ER9A 4E30A 3A4VA 5EL0A 1U3VA 2BFMA 3ASVA 4U6QA 4YRAA 4CM9A 5BR7A 4PG4A 5CDSA 4PLHA 1MX3A 4WLOA 2XXJA 3ICCA 1C1DB 2F00A 3ETEA 4Y6RA 1Z7EA 4W4TA 2X0JA 4GX0A 5JY6A 1I2BA 4DGSA 2ZQZA 4YQYA 1CQJB 2Q1UA 4AJNA 1X15A 3AY7A 1UXKA 3GAFA 1U5AA 1H2HA 1Q0QA 1QKIA 3M2PA 4HADA 2C7GA 4EUEA 2Y0EA 4BO1A 5GY7A 1K2WA 4XQGA 2O7QA 3RUAA 5ILGA 3NTOA 1A9YA 5F3RA 3OIFA 1L7DA 3ZWOA 4UUNA 2D0IA 1NP3A 4IDBA 4J16A 2IZ0A 4BKUA 1QV6A 1N92A 4G81A 1KVSA 1VKNA 3UOGA 1TXGA 3VVBA 4EITA 2DU8A 3DONA 3GHHA 5G0SA 3F4LA 1KY4A 3B1FA 5BSFA 4HY3A 2JKVA 1GCOA 3UFXA 2UYYA 4KOAA 3ROMA 3VPXA 4AVYA 2GN4A 4AJJA 1H0KA 2X5JO 1R0SA 2YHIB 1MFPA 2BGMA 4FGWA 1J49A 1PTJA 2DTEA 1DLIA 1ZK0A 3QWIA 2B4TO 3TJRA 3DFUA 1XWFA 3ITDA 2O50A 1EUDB 2P5UA 4ITUA 4R9RA 4XGNA 3WYEA 1T2FA 3BMQA 4A0SA 4DIOA 1P77A 4Y6SA 4BO8A 3ADPA 3RWBA 4XZ3A 4F46A 4O6VA 5MDHA 4FC7A 5EIOA 1XA0A 3P2OA 4ALKA 3IJPA 2WWRA 4EEZA 1UP6A 2WEKA 1WXDA 3ONEA 3Q11A 3NT4A 1NASA 7MDHA 4L74A 3G0OA 5CDYA 1DDOA 1O95A 1HZZA 4WCFC 2NACA 2ZYAA 4RF4A 3ZV3A 1LXCA 1UZNA 1ZMTA 4P22A 4DREA 1TB4A 1J6UA 4NFHA 2FP4B 3V8BA 2PGDA 2VUSA 2FPPA 4OAQA 3ORFA 1G1AA 1GADO 2QW8A 4CODB 5KCZA 1Q7BA 4EI2A 4WCFA 2Y93A 4BKOA 3DZGA 1LDBA 4XR4A 1UDCA 3FTNA 2AG5A 1A9ZA 4R54A 2VHYA 1GEGA 4NIMA 5L7YA 1NR7A 3F9IA 3PHHA 4D3SA 5DBGA 4YPOA 2HMTA 4RVFA 3PWSA 4MVJG 1HEUA 2DAPA 1WDMA 1NM5A 4W6ZA 3E5RA 4M8SA 3DEYX 3NKLA 2XXBA 4Q3DA 1V3VA 1Y8RB 3U4DA 4AG3A 1GD1O 1QYVA 5T64A 4GMFA 4LCJA 1WLYA 2VUUA 5AXBA 1N1EA 4WASA 1ENZA 4FFNA 2J5QA 4WUVA 4BV8A 5G0VA 4YT5A 2Z95A 4JROA 2NU8B 4ZQBA 4BL5A 1SMKA 2GN9A 2X22A 1DC4A 1B15A 3GH3A 1KEVA 1PR9A 5F1KA 3ZN2A 3TSCA 2Y66A 3WB9A 4KWIA 4RDHA 1T2AA 4BNYA 1MP0A 3LLVA 4MIOA 4A10A 2Y1GA 1MG5A 2YV1A 5T57A 3RUHA 3ZCXA 4AL4A 4GGOA 4FJ1A 1LRKA 3NDIA 3HHPA 4DQVA 5L45A 2GGSA 4IQGA 3H9QA 2IODA 5FEUA 3QA9A 3PLNA 3U4IA 2IEDA 3JQCA 4FFPA 1Y5MA 2BGLA 4J1NA 3RU7A 1Y6JA 1VL6A 1P1JA 1MC5A 1ML3A 3NJ8A 1UZLA 1TA4A 4NPCA 3I52A 1NX6A 3H5AA 4KTVE 1O8CA 2CZCA 3ZWVA 4LSMA 1V8BA 2QRJA 2VHZA 1Y1PA 2PGJA 4RPJA 4NNJA 5TX7A 1XQ6A 4CM4A 1KS9A 2FHSA 3ZU3A 1FDUA 1Y81A 1LRLA 2Q3EA 3RROA 4BMSA 5JW6A 9LDBA 3JYNA 1YB4A 1VSVA 3D3WA 3QQPA 4MVJA 1IPFA 5TT1A 2NLOA 3KETA 2D59A 5J23A 5KJFA 4R1NA 4MIEA 2J6IA 4FFMA 3PYLA 4DMMA 1GV0A 5BNIA 3A9WA 4DIFA 3E6AA 4W7IA 1GZ6A 4IGEA 4L9RA 1I3LA 3H9UA 3ZI0A 2FZEA 2VYNA 4NI5A 3OJEA 4OIMA 1HTBA 1JU9A 3ANNA 3JQFA 5IZCC 3IJRA 2Y1EA 2ZYGA 4D79A 2RH4A 3SBOA 1HDYA 1YVEI 2HKIA 3DO5A 4YT2A 3HWRA 2GZ3A 3RCBA 4ZRNA 3ZHXA 1XYGA 5IZCA 3K5PA 3R3JA 1PJ4A 4BIIA 9LDTA 3AW9A 3L4SO 2R6JA 3RSHA 1M76A 4NG5A 2CVQA 3E1KA 4EYEA 1ZBQA 2WMDA 4Z3KA 2IYOA 3OEWA 1ISGA 1LTHR 4R1UA 1E5QA 1E92A 4LVCA 4OHUA 2BHLA 1M6WA 2OOSA 3Q9NA 4O5OA 1G0NA 2AEJA 4QUKA 4AJOA 3VH2A 3GUYA 4RPGA 1VJ0A 3PHLA 1R16A 1X7DA 3GNSA 3IKTA 1T4BA 3FWNA 1ISFA 3OJFA 3CIFA 1ORRA 4IQ0A 4ZQGA 3W8EA 3H5RA 3RKRA 3LU1A 1H93A 3B20A 3N58A 2FRDA 3DBRB 5JO0A 3QWHA 3JQ7B 4RPKA 5AXDA 1HSZA 4JLWA 4AJIA 1KIFA 1VJ1A 2JD1A 4YTEA 1ZH8A 4EUFA 5H82A 1Z45A 1ISJA 2VWHA 4OSOA 1UAYA 4ESOA 1JKJA 4OL9A 1U8XX 3JQGB 1GYPA 2VYVA 4JIGA 4NK4A 2EXXA 1FXSA 4RVDA 3VTZA 3GNTA 1MGOA 1C0IA 4MINA 4BNHA 2OZPA 1OMOA 4H15A 4D0RA 4CLRB 2A35A 5JMWA 4GKVA 1U3TA 3WWZA 4TKMA 1XU9A 4RDIA 4OQYA 3OIGA 4TZTA 5JDIC 5JXWA 3ONDA 1HE3A 1X0VA 4QECA 4YWJA 5IXSA 4DQUA 1MFZA 4GBJA 4GPD1 2GF2A 4HWKA 2I6TA 4XR9A 4FFLA 5I9NA 3VOSA 2I76A 4B4VA 5KKAA 1SEPA 2VWPA 4YAEA 1PIWA 4GL4A 1U2GA 2AEMA 3BA1A 5U4QA 4E33A 1Y7TA 2GUGA 3M1LA 3GVCA 3RFXA 2X5KO 2RH8A 1U4OA 4H3VA 5C3MA 1PU2A 3FPCA 1PR3A 5LC1A 1JLLA 4TMFA 1CQIB 4XWYA 4ZQHA 3VKUA 2EF1A 1WNTA 3KO8A 4W9NC 1ZSYA 2DUWA 3UF0A 5G4KB 4AFNA 3KYCA 4IJUA 5F1PA 4CLOB 2J5RA 2C07A 1LSOA 1LDYA 5DF1A 1ZZEA 1EUCA 2GN6A 3OA2A 5JC1A 3MTJA 4W9NA 5CEJA 2NVUB 5T8KC 1BXGA 1JKFA 2VRCA 4L8VA 2V6GA 4N7RA 2CMDA 3RC1A 4QX6A 1A4IA 1DXYA 2HUNA 1EDZA 2X23A 3CINA 3WGYA 5L3ZA 5CEFA 5KVCA 2HSDA 1OOEA 2E4AA 4XRGA 4XX0A 2GO1A 4BQPA 3PWZA 1DJNA 2J3JA 5FYDA 1QMGA 3EZLA 1UJMA 2YUTA 2W90A 1PS0A 3L9XA 4M86A 4RPLA 5THKA 3UKOA 2GLXA 4K6CA 4L4RA 3VH3A 3S55A 4C7KA 3WFIA 3I6IA 4XB1A 1XIVA 2OMEA 1YKFA 3BAZA 1HDGO 2EHDA 3L9WA 3PIDA 4CR6A 4XD2A 4WNIA 5CG2A 1LSUA 1DOHA 1NAHA 2FWMX 3LDHA 1UXGA 3S2GA 3WGQA 4R3WA 3QJ5A 1R4MA 3BMOA 3EUWA 1HLDA 2C20A 3K96A 3GGPA 5AXCA 4E2ZA 4YYZA 4WLVA 4UEOA 5FF9A 4DA9A 2JFGA 1YB1A 2QZ9A 3MJ4A 3WYBA 1H9AA 4BOYA 3VZQA 4F6CA 3QE3A 2YFQA 2YDXA 2PH5A 5IDYA 2C7VA 4XJSA 3P5SA 1QYCA 1B26A 4P4GA 4BO0A 3LT4A 4NH4A 2NQ8A 3CE6A 4MVJM 4YR9A 1P33A 1ZUD1 3GDGA 1JA9A 3DZFA
chains in the Genus database with same CATH superfamily
2A1TR 2H4HA 3ABRB 4X1YB 1IPEA 4TQ9A 1DRWA 2GN1A 3AKCA 1GM5A 2CJWB 3PXAA 5JCXA 4RF5A 3BTOA 4R2MA 4QATA 5L9AA 3P9KA 4YONB 2PQ0A 3LHDA 1IHXA 4Z7NB 1ODFA 3IAM6 4PG7A 1SCBA 3ZS8A 1VHLA 1FS4A 4C08A 2C58A 3QKTA 2QK4A 3FRIA 3EHDA 4OD0A 3WLLA 3U7RA 3RASA 2GEKA 4XB2A 4EO7A 4F85A 1FMCA 5D87A 5CBKA 4X60A 2H17A 2Q4OA 2VWQA 4WKBA 3WMEA 2DFKB 3ZWYA 1US8B 2FDRA 3RS5A 3ROQA 3KQYA 5I7FA 3R3ZA 2YWEA 2VF8A 2OGWA 4ESHA 1UOQA 1DIHA 4KSYA 5DP1A 3SHWA 3VV2A 4X1KA 2H4FA 1S7CA 4MLPA 4NBNA 4B8YA 4ZIRB 2HCRA 3O82A 2RBEA 4GP7A 5FA8A 5CYGA 2ZE5A 2OBNA 4Q1BA 5K5EA 1YFLA 3B2QA 2B83A 3GLQA 1E2NA 5CRIA 4J7UA 2PYIA 1JLMA 3DUFA 5AWFC 1THTA 3FGZA 3I53A 3TOZA 3E70C 3OT4A 2R48A 4BVGA 4PYJA 1GUZA 1NRJB 3GZTB 4I5IA 1NXQA 3CY6A 3QU7A 4YCDA 1QAMA 3DHNA 2YIJA 2EFDB 5DX1A 2JFWA 2A7XA 4AY3A 3UMSA 4LHVA 3V7UA 1YD7A 4ABTA 4A6XA 1L1QA 2EEPA 3TTVA 3U7EB 5KPJA 4PTYA 3SU8A 4QJIA 1CR6A 5EXSA 5GWXA 2O3UA 2Y0BA 5JJBA 1Y1RA 4HCJA 1NURA 4X94A 3KJHA 1V4NA 3M4JA 4I4TF 1C0PA 3S2UA 1UR5A 1AUXA 1AQYA 2PU7A 3ASUA 2W6IA 3BFKA 1A9PA 5IFLA 2O8CA 4I1YA 4R9NA 1UXJA 2GERA 2QRPA 3CRVA 5BQ5A 3ZE8A 2GZSA 4B7CA 4Q00A 1Y5RA 3QSGA 3H9EO 1PJBA 4JZKA 2RB4A 3SLKA 1JUDA 1UF9A 3C3MA 3D02A 1A5SB 2C92A 1NBAA 2JI4A 2OXRA 2P90A 3B3GA 5E1BA 3CH7A 4OA8A 3DT9A 3OD1A 3AHCA 1XKQA 4WNAA 3BUSA 3GUVA 4CKWA 2UYHA 4JVOA 2B1JA 2FMIA 4MUBA 4CLDA 1VIAA 3CO5A 1J9EA 3PJRA 4GE0A 4LXIA 4TWRA 2WUGA 1JILA 1F48A 1XLWA 4D4HA 1L7AA 3GP5A 4FJ0A 4ICIA 3S7TA 1E7WA 5JVDF 4OU5A 5AHKA 2G9RA 4OBWA 1L7PA 1X7GA 2J0UA 2NUBA 2BBOA 3OOSA 4QRIA 1JT9A 1T4DA 5JBNA 2FQYA 3ST7A 3R7AA 4WZBE 1G66A 1S1CA 3DTVB 3TN7A 3IUSA 7REQA 4LJSA 4NATA 2B2XA 2N3ZA 1C3JA 1S8OA 2ID9A 2YW9A 3C5VA 1Q21A 2AZMA 4DLRA 5BVGA 3OQ1A 3L6CA 4XH9B 4BAZA 4Q9KA 3UJ9A 1ZO8A 2R8RA 4NBRA 2HNBA 1ONBA 1XLUA 3A3NA 4N4AA 1VI5A 4URWR 1W44A 1TKCA 4IEFB 5KVAA 4WY2A 2VSXA 4U0KA 5H5JA 4FXPA 4IWYA 1TT7A 2YZKA 1NLUA 1FNBA 1Y8CA 1WL8A 4Y1RA 2F62A 5B1DA 5JJ5A 3V1UA 3LXXA 1WDLA 2F48A 5JJCA 1CBUA 2W4QA 2AZ4A 5CW2A 1KYIA 5DW3A 2HSWA 2ZI7A 1YRLA 1E3EA 3HRHA 3SKXA 5EQDA 2CB0A 4UHEA 4G5OA 2HL6A 1AK1A 5CYFA 5TF4A 3CG4A 3T3MB 2REQB 4YJ3F 2XIJA 4EW1A 4RVUA 2GX6A 4WK0B 3HKEA 3O9VA 2W4MA 3FDJA 1Z0DA 3FH0A 1QOPB 4YRPA 4AZSA 4EZBA 3TJMA 3VHXB 1KFKB 2RGNC 3GELA 3OVMA 1DGQA 3R3WA 5E7QA 2GEJA 2GBFA 3B1XA 3N0WA 2EDCA 1CZKA 4LF5B 1C7IA 1XTPA 4ZOEA 1F6WA 1QTNA 4MV1A 5ELMA 4U7DA 3VPGA 4RD2A 3V4FA 1M75A 1YCFA 5B4UA 2Z9DA 1KEPA 4KEAA 2WMYA 1QM5A 2Y27A 2ZPTX 1RLUA 3AVOA 2EFHB 2XPCA 3KVOA 3C3DA 3C8ZA 3TQTA 3KCQA 1VE9A 2QI9C 3O4FA 4UVDA 4KXMA 4RCVA 1NI5A 3MWGA 2HMVA 1K86A 3M89A 4MUFA 3P8ZA 4PF1A 3W7BA 2O0HA 3EGWA 3PC6A 5CEEA 2I8CA 3G2JA 3QXJA 1C1XA 4LA4A 3V8RA 2Z1MA 3CLRC 2YYZA 1IZYA 4HOYA 1RIFA 3S5JA 1URPA 4EVQA 4G0ZA 4XW2A 4LF9B 1AJEA 1UJBA 1PJAA 3CLUD 2C8LA 1D03A 4RV9A 5A6SB 2H7YA 5JD5A 4JQCA 2NSYA 1IBLB 1XO1A 1N2CA 3WK7A 4PR0A 2ZAOA 5J2UB 2QX9A 4ENRA 2D13A 4DLAA 3NBAA 4QVKA 3ANLA 3D0OA 5SZIA 2RI6A 2EBFX 2WV7A 3U49A 2W6NA 3D6TB 4YB8A 3QSYA 1B0UA 2AJTA 3I9FA 1GCUA 4WT7A 1XP8A 5IYZF 2AI1A 1K8YB 1QR6A 2HJVA 4JOQA 1EZ1A 4BV2A 4YCBA 5BR1A 5PGMA 2C99A 3C3EA 4MWBA 3V8MA 3DWIA 3JSAA 1XLTC 2W93A 2EFGA 3CUVA 4BFTA 3HK2A 1YBVA 5LD2B 2M6LA 1R8JA 1U0BB 2P2NA 2WAOA 3ZDAA 4GWGA 4YT4A 2QQGA 5BQ3A 3MPOA 4MWOA 2DBZA 1AHIA 3DAFA 1A96A 3KFXA 1XE3A 3UXMA 3AUAA 4LHZA 2GCNA 2ZJ4A 1E79D 2FZ5A 3RUHA 3ZLTA 2WD7B 4J49A 3A6KA 2QDXA 3KB8A 4NE7A 2QENA 4KNYA 2Q3JA 1FIUA 1DC7A 1JEQA 1NMZA 1X1CA 4XQCA 5IH7A 4AY4A 4RENA 4FCVA 5CK4A 3FIUA 5C9ZA 3CTMA 8OHMA 3WFZA 2GZHA 3PNPA 1A7AA 4OH1A 4PR3A 1CIVA 2OHFA 3PCRB 4IJ5A 2M6KA 4DZRA 4Q4HB 3OTWA 2GD0A 3JYPA 5CVCA 3HN6A 1GFWA 1ADBA 2QUZA 3Q1LA 2C5FA 3TFOA 2HJSA 2LNDA 3KPUA 4E09A 3JQBC 3ESZA 1AHHA 2WHPA 3JQAA 1F9AA 2A59A 3FYUB 4KO1S 5FIUA 3UK0A 4BNTA 4K6OA 3ZZTA 1PZNA 3PC8A 4KV7A 4ZMRA 4HQOA 5AW0A 4WXEA 4WJKB 4ZCRA 2MMCA 5HWSA 5EXEA 1X77A 1YCHA 3PK0A 4ZJUA 3O8DA 2QN9A 5HCNA 5ADWA 1FYEA 4P86A 3QKRA 4BASA 2YBDA 1MC1A 2MSEB 3HCPA 1KQ3A 4Z1MA 5B55A 1XALA 4PIVA 2BI4A 5EWMB 2YWCA 4HWRA 2BFFB 1HC7A 2X6QA 2ZRIA 3EQZA 3OZBA 5IG2A 3H1FA 3U39A 1U80A 2Q50A 2DWUA 5HGJA 1ZH4A 1P2GA 3G2KA 1JECA 2O3TA 4EFMA 1I2DA 2V4ZA 1U8CB 1I01A 4FSDA 3TM5A 3SMVA 4AURA 3IPCA 4A73A 3FNQA 3TLGA 2OM2A 2H51A 4DANA 3COJA 3BEDA 2PX3A 1H1TA 5JROA 3FKJA 3FMOB 3FPBA 1KO4A 2HYDA 2V9PA 3G6WA 3JQ9A 1GGVA 2JD0A 6Q21A 3JWPA 3A1FA 1C29B 2IBTA 1PLKA 1MB2A 3EDCA 3QU2A 4LJ9A 1I33A 4M0DA 5JCJD 1NYQA 2CCGA 4ATNA 4C0QC 3F74A 1C7EA 4F8EA 1Q0HA 5EPUA 1DO8A 1M7BA 2H00A 1ZYUA 4R98A 3SXJA 5LQMA 1NUUA 3JZDA 1OLUB 4L5IA 3CLSD 1CFZA 4XIIA 3FOWA 1Z4JA 1GCIA 2MJLA 4HDNA 3KOXA 1L5YA 4KMSA 4OJNA 3MTIA 4QUDA 3NO4A 3UHFA 4KO4S 3I4CA 1NXVA 1XTIA 3LV8A 4KDRA 5HK8A 121PA 1V5EA 5COAA 5C8YB 3U5ZB 2MHCA 3KKZA 3VKHA 3QMPA 1Z6YA 3A9SA 2PBRA 4GO1A 3A4IA 1R6AA 1FNCA 3LUAA 2AW3A 2VTVA 4Q7MB 1FJXA 3DD1A 4TZ6A 2QMYA 1RJ9A 3EARA 3RG8A 4DXHA 3EDRA 4C3OB 3MOIA 1XMOB 4BRSA 4IJMA 2EQAA 2DTDA 1SUPA 4U1RA 3HSKA 4ZGWA 2P4SA 3AI3A 1QXSA 4GXQA 3G9QA 4QAJA 1OGIA 1RCUA 2FJ0A 2QRLA 4CMGA 3C3BA 2G04A 4ZWNA 5LYJA 1XWWA 2I66A 3B1WA 3EVNA 4UHHA 3TINA 4Z5XA 1QIGA 1N6OA 2PEYA 3BMNA 3KZKA 4LX8A 1JFLA 4UOEA 4KN6A 4WRRA 1NMEA 2PUJA 4WY8A 4RULA 4CKZA 1ECJA 5DMXA 2CVZA 3SIXA 1C0KA 2YHIA 3DBOB 3SEFA 2C2XA 3JZMA 3Q41A 5JYCA 1IWPB 2HC9A 1BTOA 4R8LA 2XQFA 3E0QA 1V9CA 2HSZA 3IR6A 3L82B 3SLGA 2NW6A 5LYYA 1N9GB 2FB9A 4PZDA 5FBWB 1GPH1 4G5SA 1FVFA 3AI2A 5LZ5A 4FYHA 3VH4A 2MT9A 6ABPA 3ERCA 5DB4A 1M5TA 2H2GA 1YJQA 2WF8A 5E9QA 4EQ6B 3EIOA 4YK7A 1E1LA 1T3SA 1X94A 1M2KA 1AD2A 1F8XA 1Y3CE 3V00A 1UODA 1OLOA 1XG5A 1ZONA 2P75A 2VR1A 4MAAA 3WICA 1GT91 3VM6A 4PTLA 3NHJA 5K45A 2DPGA 2I4RA 1U0LA 1C2TA 3K70C 2VDKB 1OAOC 2XX3A 2YHAA 3K0KA 3AVWA 5EVJA 1PSWA 4EJ6A 3EOZA 5A4KA 3A6JA 4DLYA 1I4EB 4QT4A 5EE1A 4URXR 1UK9A 1JHXA 2FP4A 2AFHE 4OOEA 3HU1A 3LDUA 3OZCA 1X38A 3V6LA 2MR6A 1II9A 3R3VA 3W2IA 2WQZA 3WJAA 2ZWOA 3FCSB 3RBAA 1QORA 1NWHA 4P82A 1CULC 3OZSA 4BNJA 3STHA 4RJJA 3RAPR 3ZGXA 4AY2A 4ZFNA 1XJWA 3OZDA 1GUAA 4YAOA 2BFAA 5HIMA 1JFSA 2EX0A 4Q3BA 3IT1A 1Q1GA 5ALSA 3CVOA 2FSFA 2I2AA 4X65B 4KPYA 2JS7A 2V6JA 2PGIA 5HZGA 4MV9A 5AK5A 2NVBA 4FK8A 3TR0A 5EZYA 5DI9A 5TQJA 1RXVA 2MU1A 3C8HA 4X00A 4IR7A 3TLMA 5DWQA 4NK5A 1EXDA 3W5DA 2B61A 3BILA 3V2HA 2AD5A 1UEJA 3RQSA 4C78A 4TVBA 4DM7A 1V2HE 3M6XA 1VJGA 3FLAA 3HFGA 4Y2GA 5B1IA 6ADHA 2XUGA 4GXTA 3T1TA 1BZYA 1J90A 1NUPA 1W49A 3FUWA 4OQLA 1XQWA 2JLXA 1IK6A 1IN5A 1H8HD 4REQB 4MRVA 3ZKWA 3JRWA 1RBYA 3C3XA 4PLCA 3FWPA 2C7QA 4BYGA 4N5LA 3STVA 2ZIVB 4GKKB 5I8ZA 4B31A 3LW7A 2NUAA 4Z9FA 3QBDA 1ZDMA 4BFXA 4MKRA 2CYAA 4N49A 2ZRLA 5FL7A 3WXBA 1ISRA 3FZGA 1IZ8A 5KMGB 4YUXA 1FFAA 1A4UA 1Y3AA 2PR2A 2PRZA 3RC8A 3QFHA 4ECEA 5JH7B 3IIMA 4QNMA 1KEKA 3PC3A 4B6GA 3M3PA 5DHFA 4LGVA 1H2WA 2VKQA 1WV0A 5ALHA 5JLAA 2XY4A 2ODNA 3KWJA 3NHPA 3FXAA 1ZS9A 2PMKA 5A0FA 1HFKA 5BUZA 1U1EA 2YJ6A 3K8YA 3RS0A 3OZGA 1N57A 4F3YA 1ZHHA 4PAQA 4II2A 4LWPA 2QV0A 1IQRA 1V6CA 3CNHA 5U1PA 4BNKA 1OGYA 4JYZA 1Q0RA 4EMUA 5H02A 4EG3A 2H5EA 1F2TB 1G3MA 5AVXA 2G0TA 3CRZA 3N70A 1KH3A 1LS6A 1W5EA 1H69A 3MTQA 6AT1A 2VHWA 2WE7A 5AIBA 2ZIEA 1JA1A 3QKSA 3ZV4A 1HM5A 4K1XA 3DMGA 3H0CA 2ZB3A 2O3JA 1U2DC 4YJDA 5HQ3B 5ICGA 2NP7A 3QUSA 1ENPA 3BXZA 3OCCA 3R6GA 4V2UA 2X4DA 3GT0A 3WWOA 1DU4A 3FUCA 3JZIA 4R7ZA 3B12A 4NBWA 3S7ZA 5TMEA 3DLBA 1PFWA 3HJRA 3NT2A 1XT6A 3C7TA 4ZC8A 1N6LA 4KVFA 1VE6A 4LHWA 5DRTA 2ZYWX 3FF4A 3W9BA 1K6JA 4YAGA 2PIDA 4PSAA 5A4AA 3PS9A 2HW8A 5BVHB 1GCGA 1Y8AA 3GH1A 1ANKA 4D9EA 4S0ZA 4DUGA 2PU5A 1CJMA 3T4XA 1AQUA 5DNAA 2GO7A 1TMGE 1IN7A 1TI7A 4OHUA 2P11A 1UM8A 2VHTA 5M04A 1P0IA 4RTNA 3ESXA 1ZD5A 3H1GA 1W6UA 5K0EA 1VGRA 3DJFA 4KR7A 2X8AA 3BICA 3IBFA 2HPVA 4J91A 4G2NA 3THSA 4DJFC 5EMNA 2I33A 4OQXA 3V4SA 4KR3A 4C2UA 5GP1A 1MB4A 4Z8XA 2VHXA 1EM6A 1PFVA 3X2FA 1D2EA 4ZCMA 4KUHA 2ID8A 2Y68A 4MK4A 3CR8A 3T4EA 3TBFA 2C54A 2PTHA 4FYMA 1EG7A 1HGXA 1YZNA 1Q7GA 4QLBA 1A27A 1HL3A 3AUFA 2QNBA 5FUVA 4LDZA 1QX4A 3ZD6A 9ATCA 1Q7TA 3GN2A 5KJ6A 1HDXA 3L02A 1P74A 1SHZA 4LEIA 5E4TA 5AUNB 4ARZA 1ZRNA 2DVMA 3CWCA 3CLTD 3TIIA 4EGSA 5HM8A 3DFZA 3M8KA 2VAWA 1J22A 4KXYA 2WFZA 4RKFA 3ONVA 4WA7A 3TXYA 2GF0A 3MJCA 1I4LD 4HDMB 3THWB 1XEFA 5D3KA 4M3NA 4GOLD 2BVNA 1QPBA 3WL4A 2J7PD 2VTDA 1KZHA 2J3MA 4PYKA 4QXPA 5LUAA 1OT3A 1W4AA 4CMKA 2C3PA 1O5IA 5K3AA 5KCMA 1CY7A 2H6EA 3LC0A 4FGSA 3DOFA 4Q4AB 3WLSA 4DWVA 5LQKA 2EZ9A 1OKKD 4N82A 1P7WA 3QXSA 3VA7A 1X7HA 1TD1A 4HNRA 3NHWA 1ZC4A 2WRZA 2UYOA 3CSDA 1YI1A 4OXRA 4TYMA 5AT1A 3UB2A 4AJHA 3JQ7A 4ZVSA 1G59A 1KAMA 3NXSA 1IEWA 1OC2A 3V4RA 2V0GA 4TTTS 1QR2A 5GPBA 4QA9A 2Q3MA 1O1YA 4IEIA 4QPJC 4YDQA 2I55A 1UZMA 2IXTA 4B6RA 3GFPA 2N1BA 5IU6A 4KRYA 4OGWA 3D2BA 3PQFA 5IUJC 3IEMA 1ZNWA 3EC2A 3NETA 1N5IA 1GGFA 3CR7A 5L4SA 2YL2A 4P3OA 1IY9A 2OXIA 5DHUA 3K6KA 3M5PA 4KDFA 2ZIAA 2XYVA 2MR5A 3F7NA 3LYAA 2QWXA 3L1JA 4AULA 4EPXA 1J1UA 5BV2P 3L77A 1UQUA 2CY0A 3EW9A 4E2WA 2JL1A 3RFVA 4CLRA 1HO3A 1N2ZA 1ZN2A 3LO5A 4TLCA 5FHRA 3WKCA 2EGUA 2Y2VA 4ZI2A 3QHPA 1Y3IA 2HRCA 4MKZA 4RS3A 3KAKA 5KYYA 3H13A 1K6IA 4IL5A 4XGIA 3KKPA 2XUHA 5A3SA 2JGNA 2X86A 4DG5A 1E3TA 1EFPB 2WYWA 4UZEA 3ZOKA 3MUFA 4QOHA 1W88B 4BWFB 3I9LA 1W73A 3AFHA 4M8LA 1IY0A 4B2PA 2Y1WA 3HUDA 1RS0A 2PX0A 1E59A 1EAMA 2AMYA 2O14A 3O8LA 4W9RA 5AM0A 4MW4A 1VA5A 4M6WB 4EG6A 1C30B 1XVLA 2JZNA 1KAGA 2PGOA 4Y0AA 2CD9A 5EXTA 3D4LA 3UMCA 3ESBA 4HSGA 1TQ6A 3TG2A 1GV1A 1GLNA 2QVZX 3KZMA 1U28C 2XDAA 4CR7A 1L3IA 1J2UA 2BBSA 3LLUA 3G7NA 4HZGA 5AXAA 5HCIA 4FIZA 4MA5A 2F1JA 1G8FA 1R12A 4Q3EA 4NZYA 4EWLA 4FZVA 1TO2E 3NVAA 5D8DA 4JUIA 4X24A 1EVKA 3HZOA 5KC8A 4RSGA 1EFTA 3UEOA 2F90A 2H07A 4DRYA 1II8B 1XQXA 4EKDA 4V39A 4CCYB 2I2WA 5IS2A 1VLZA 4HDRA 4ARCA 4Y9DA 3DV0B 3L04A 4GOJA 1CEQA 5LIPA 2OD9A 2QUKA 4YASA 4JI7B 3WNBA 3PVCA 3L6DA 4KBGA 1ATZA 1KIMA 2ZU6A 2GILA 3L6BA 4YJ2A 5BN3B 3CF2A 1ZITA 1VJDA 1OXUA 1Y6ZA 2VQ3A 3K0FB 5CFMA 1MAWA 3B6MA 3ZEIA 1EVIA 2WAXA 2P3QA 4BU0A 5CXUA 2ZS7A 3KV1A 4GPTA 2JZOA 4PO9A 3ZVRA 4BCDA 5EAIA 2A84A 1Q1ZA 1JH8A 1OBVA 1P1IA 3PUHA 2H2WA 2ALJA 5FV4A 4CM9D 2QJTA 4ZYVA 1RZUA 3D8BA 3WIVA 3WYGA 4QOJA 2ZITA 2LKCA 4ZHQB 5LQCA 3RS8A 2P77A 3S5UA 2CXOA 3X0DA 5KYXA 1QTIA 3NW9A 1V7ZA 1DKLA 2VI5A 2O8FB 4K8OA 3JARA 3A7EA 3TEMA 5KX5F 4YC7A 2VEDA 3NHMA 4HBGA 1E61A 4D25A 5D6OA 2YCLA 4TZ0A 3E48A 2SHKA 4II7A 3HHEA 2WHRA 3IDZA 2IEYA 3LYUA 3RF6A 3VRHA 4QO7A 1U6JA 2WMNB 5AUOB 3I1IA 2J9ZB 2GBLC 4TRMA 4D0SA 4J7XA 5G4LA 2A1TS 5LP6A 3BH0A 1GRCA 3DLTA 3OE7D 2O2XA 2PUHA 4GMGA 4UUAA 2LE0A 1M8GA 4KVZA 4R9SA 4RXMA 2ZUVA 4DN6A 5JSFA 2KBFA 4TMYA 4I9HA 1D4OA 2ZXEA 3P9NA 2QEQA 4MUIA 4BMVA 3GMIA 4FWIB 4Q3NA 4R2HA 9MHTA 4C0AC 1IBMB 1MU0A 1RYDA 4LJ8A 4JUFA 1XCBA 4FOLA 4Y6LA 2FEMA 5JC8A 3ZEAA 4EJMA 5EKUA 3O8QB 1JIXA 1XTKA 3Q85A 3L8YA 4EKEA 3BCHA 2AJ8A 5BSUA 2FPUA 1YGYA 3CBGA 1J1IA 1PR1A 2AG8A 2LIVA 4RVOA 3WHPA 2HIHA 4FD2A 4JJ7A 3QWFA 4S1VA 2JLZA 2V03A 1MVNA 3DWFA 5CFRA 1ENOA 3GGSA 5CJJA 5FFNA 1ULTA 5JFGA 4C30A 1OJLA 5BRAA 3F46A 1IQPA 2R44A 1T8SA 1GPUA 3DZJA 2I4IA 1U94A 1LY1A 4D6PA 1CDOA 1VHTA 5JAZA 2ZI9A 1YZYA 4GG1A 2XWSA 3C7CB 4P32A 1ISPA 4ZPXA 4B7ZA 1M1UA 1DHTA 4GWLA 2GYYA 1WKVA 2QW1A 2VH5R 2YW2A 1KC3A 1CU1A 4KE9A 4TX1A 4YRLA 1J8FA 4DL9A 3L2OB 1QQAA 3BOSA 3SXUB 4LBYA 2OO5C 2ZBGA 1RJDA 5JJIA 4WAUA 1UWLA 4DBVO 4ZV9A 1N5KA 7ADHA 4OXIA 1B4DA 2YWGA 4KXQA 2QMQA 2W6QA 1BU8A 1A1SA 3DMNA 3GP3A 3ZDRA 2NQTA 3TF5A 4NE9A 5BRNA 3OD5A 3R5HA 4P7GA 5JSHA 4YJGA 2IS4A 3SSAA 2ONZA 5F51A 2Q2OA 3GVXA 4LAFA 2X1HA 4UOQA 1M0EA 3T5TA 1EH5A 2WWIA 2ONCA 3QJYA 3GYBA 1RYEA 3UGQA 3S8EA 1O95D 1ZM3A 4MVJF 4O25A 4ID9A 4PLYA 3JZFA 4RF2A 3MCAA 2C03A 3BWEA 1QIMA 1DELA 4AJPA 4P5PA 2L18A 5PNTA 1KY5A 1ZQ9A 2WYVA 4RDCA 2Y4NA 3BB1A 1J8YF 3ESAA 2JFHA 3PUYA 5EJ7A 5AVVA 1SKYE 1OH6A 1BDMA 5CDGA 1QBKC 3KG2A 2CDAA 4HG2A 4OJYA 1DJPA 3HACA 2PJDA 2Z09A 3KXDA 3TNJA 2Y1FA 1EGHA 1UWKA 4J6FA 2IWHA 3S81A 1E6LA 1NBOA 2RHBA 1M6HA 1XZJA 2AE2A 3ET4A 3F3KA 1WWKA 3OO0A 4WJZA 3LWNA 4JI1B 1D7OA 3I72A 4I55F 3DZ8A 4YBZA 1WB9A 4HR7A 4E2YA 1KY3A 4X3PA 4AKHA 4HDSA 3I04M 4B40A 5HFJA 5GQSA 4MUMA 3AUYA 1D4AA 5E6RB 2OXFA 2RC5A 3UC9A 3PDIA 4NBVA 1KFJB 4N8SA 2IS6A 3NHAA 3Q6NA 4FNOA 5LBUA 5KYUB 5CVEA 5LKRA 3NNNA 1VIYA 4PG8A 1P0FA 1Q12A 5LA6A 2VF5X 5F35A 1Z37A 3MNFA 2WE8A 2HXSA 3Q6IA 4N03A 1TW2A 1QO0D 3QP9A 4MOWA 3C16C 5MN6A 3DB2A 4EKGA 3KR1A 3LPLA 2B3DA 2O0JA 2OC9A 2BEJA 3KPJA 4TV8B 5IKOA 2Q0HA 1S8NA 3EIEA 1ZK1A 4DCJA 5CB8A 2B20A 2HQBA 1YOBA 3D6FA 4W82A 3ZGZA 3RYFA 2PKWA 1MPXA 2CL0X 5K51A 1CZRA 4ZVVA 2BJVA 3H2HA 2JHCA 1GFSA 2DUUA 2QA5A 4Q9IA 2I03A 3HJAA 3W04A 3N7UA 4U0JA 3RUDA 1XDGA 2DHEA 3BD6A 2HMYB 3NWBA 4QDOA 2R85A 1FJ2A 4OP1A 4IF4A 2PWAA 5JBIA 1CUCA 5MN4A 1P1HA 3GEIA 1R64A 3VSEA 4LYFA 2FNAA 3N3AC 4BQQA 3UGJA 3EQ8A 4G01B 3OLVA 2F1RA 2QRQA 1YRAA 3P9YA 3CVXA 2IHYA 5TEWA 1TA9A 4BMXA 1W87A 4CEJA 1Q0ZA 4FSHA 2QTLA 4WK2B 4D8VA 1GITA 5NLLA 4DMCA 3QXHA 3ZZUA 3II6X 4QOIA 3LPNA 2QPLA 3NHUA 1HE8B 3I2HA 4B1FA 2I6QA 3GRYA 3V2GA 2W98A 4RS4A 2JAHA 1WMBA 3DKIA 2BFOA 4UPVA 1WMSA 1GPDG 2DLDA 2ZTVA 4BLVA 5B6JA 1GAXA 3I6MA 3OZUA 1P5HA 3G9ZA 5AVYA 1L1RA 2A9OA 2PMWB 3AX6A 1P1FA 3RK4A 3UG7A 2QX7A 3FHLA 3ISVA 2IZ5A 2J48A 4G0YA 1E94E 3ZK8A 2J5KA 3ZNQA 4G4IA 4MLCA 2G0NA 3K5IA 3NS7A 4D9JA 1N77A 2G4CA 3OG9A 1PK8A 1X1EA 3J81k 2BMWA 3B1ZA 2OV2A 1GPJA 2CV2A 4AMGA 2J4DA 1QX3A 5HE8A 3TLXA 1QDUA 3VJLA 3UFXB 1OBFO 4DHWA 1BN6A 1RYMA 3WGVA 4ND8B 1IAVA 3I39X 2VTEA 1B3BA 2P69A 3EZ2A 4Q3AA 3E0XA 1X1DA 3NV7A 3PKIA 1P81A 2C5BA 4L1KA 4C7JA 1XKTA 5B58T 3F0TA 1ECBA 4P98A 5KOIA 2WYOA 5HILA 4ZYUA 2CXUA 2HEGA 4HUJA 3BRCA 3G8DA 1Z9BA 1XTBA 4ARVA 4F60A 1PWYE 2FFBA 4PN7A 2HU7A 3CUEF 1ZVQA 5JASA 3UMMA 5IVDA 1AKYA 3H1BA 4NQRA 4PQGA 5UKDA 4ZO6A 2KE5A 2I99A 4PAOA 4NF2A 1P3JA 2X6TA 1WE2A 4PLZA 3F1LA 4LRQA 2AHOA 4B46A 3CVUA 2D2VA 2VYND 1M1NA 1F8YA 1JR3D 4FYVA 2IL1A 3AFOA 3OM9A 5GOZA 4BNDA 4RKQA 1L5QA 3NVDA 2PT9A 5IVPA 1VRVA 1KQOA 2VPPA 3V33A 2M1XA 2QAJA 5K0NA 5LP1A 2PPVA 3HCNA 4B9AA 1TCCA 3G8CA 1U8ZA 3IT3A 3LDAA 2Q49A 4W5NA 2EKBA 4YAIA 4H7EA 3P4UA 3EG9B 1ULUA 3CT6A 1KMHA 4F45A 1GTZA 2FN9A 4MCJA 2B8EA 3FZYA 1O6FA 3ZVKA 1GG9A 4AT1A 3QPWA 4Q21A 4NAVA 5EIHA 4OX9B 1HETA 5SICE 1H65A 1UJCA 3OOYA 3PQ5A 3SMQA 3EVFA 3TL6A 1MV8A 3MAJA 2ZYRA 4UVEA 4RYDA 1KPHA 1TQ2A 1PD0A 1C7JA 5TGDA 4R16A 4KRGA 3H42B 1GDTA 1H1DA 5L7TA 4JXXA 1FSZA 4ED9A 2EFEB 4Q7LA 1L7OA 3HUUA 3AEKA 3WQQA 5K01A 2W00A 1PTJC 3WYFA 4UKDA 1OTHA 2YWXA 1IB0A 3CZRA 3CZPA 4WOJA 4EDHA 1AQNA 1DAEA 2GPNA 3PHIA 4LZAA 1BX0A 4NBUA 4D44A 2WP0A 3MMXA 4K26A 1QPGA 4YCJA 1SXIA 1UH5A 2P30A 1QC5B 1TM3E 1WEHA 2K2QB 2VKTA 1LDNA 4TSRA 2JAQA 2OLEA 1R0LA 4IVRA 1B14A 3L41A 4MKXA 4MO2A 1ECCA 4B4KA 3UV3A 5I7OA 4PXYA 2UZAA 2H4YA 1DBQA 1N2HA 1SCIA 1M1YB 2BFDB 2ZUWA 1XNJA 4O2BF 5B57C 1L5LA 3GPBA 1XD2A 2G67A 4GQIA 4M4SA 4O4IF 2XBUA 3TRDA 5EFOA 3WLNA 3VNVA 1IVYA 1U31A 2EIHA 1FL9A 1USVA 1X80A 1XXHE 2FMKA 2W22A 3H6KA 3HU5A 4PHGA 4TLEA 5DMHA 5DRYA 1VGQA 4M46A 4C6HA 1T9HA 3L7MA 3LSYA 4ERXA 1KRXA 3TAUA 4EHBA 3N87A 1GY8A 3BCUA 2PKCA 1UPXA 3G0BA 2H1WA 3B3JA 4YLEA 1Z4OA 3ILYA 1ZNZA 3VPFA 1XJQA 1RMYA 4AX8A 4B82A 4JU8A 3OF3A 2A5GA 2DG2A 2Y1DA 2YIDA 4HNAB 2CNOA 2CFTA 4QHYA 4JT4A 3GRFA 2A5LA 2X2PA 4EVRA 1T3TA 2IXBA 1IK4A 4I6EA 5GZ1A 1ZVMA 4E5YA 2E1PA 2Z57A 1DKMA 1SM4A 2X9VA 2A94A 2ZIXB 5F12A 4CUJA 1DAKA 2O8EB 4FZ3A 3AHHA 3F8TA 3GWZA 4WKPA 3SX4A 2GCOB 1JHUA 2HIGA 4XAQA 3PXDA 2XNHA 1T2EA 4LCEA 2Q7XA 4HNGA 5G0TA 3DDOA 2ZRAA 3U3RA 2JA1A 4NOLA 2FWNA 2OPBA 3ETJA 1T43A 2ODQA 4PC7A 4C4RA 4CFSA 3BMXA 4U6SA 2Z30A 3MQ2A 1RWQA 2V8BA 3TECE 2Y1KA 2PYZA 1VLLA 3D3KA 2HDOA 3R7WA 3TGWA 2XGJA 2FPSA 2GVZC 3GJ0A 4UM9B 1MHPA 1P5RA 3F5MA 4BO4A 2HK9A 4XM2A 1P9LA 1NW9B 3HR8A 4MDYA 2ZYVX 4TS1A 3NUGA 3VR4D 3ABOB 5HRCA 4WNCA 3GI1A 3OPMA 2Q2VA 4M54A 1FNDA 3A36A 4P4SB 3W9SA 4OXNA 3K2EA 2ZCJA 1L8OA 1MJGM 3GL9A 3HP4A 5JFTA 2JI6A 3OSUA 4QU9A 5CVJA 1DT5A 2F2TA 3ZI7A 2VRCD 3ZTWA 3P71T 3GRKA 4MQLA 3IJEB 3LT2A 4DLTA 5K0JA 4XI9A 1V39A 1XV5A 2F3TA 2I87A 3UMBA 3ROPA 3PLAE 3ER6A 3DTNA 4RZSA 2B37A 2O07A 2ZVPX 2YMLA 3BORA 4WA8A 4I4TA 5DXJA 1A98A 2B94A 1V5WA 4IM7A 2FQ1A 1GQYA 4RMHA 5K0ZA 3KJIA 4EA8A 4X6XA 5EJ2A 2P9FA 2G36A 2I22A 3N9IA 1OXKB 4NOMA 2PZGA 2Q3FA 5D1NA 1DQNA 3H05A 2Z5LA 4QDUA 2WAMA 2X6RA 1G9TA 1ZXXA 1T3GA 3F67A 3O31A 4XYGA 1ULSA 2YNMA 3KUKA 3DNPA 1MENA 1X6VA 1QB7A 3EMDA 1E5LA 4J4HA 4CEHA 1SXJC 2OL4A 4OYYA 5FPYA 5IRCD 1H4TA 1M3SA 5CMLA 3ZW8A 3WISA 4YRMA 4RBNA 1AV6A 2OY0A 4QYIA 5HA5A 3UHJA 4G25A 1WKCA 4INJA 3T7JA 3CSSA 1GA6A 3T3EA 5L95A 5A0VA 4M99A 4QYSA 1Q3TA 2EBHX 2NTJA 3NTRA 4LVOA 3SSNA 4L0DA 5CYPA 1JP7A 2LR0A 5DLPA 3N6XA 4B3HA 1VPTA 2JIPA 2WNHA 3B78A 5ALNA 3DQZA 3PT9A 4NZNA 2WG2A 3WXMA 1WUYA 2OXEA 2B7CA 2XA9A 2A30A 4WINA 2ZR0A 4BVLA 1ABEA 1K75A 2FPKA 4LRSB 4K9MA 4CKCB 5JR3A 1ENYA 4O33A 5E8JA 5CFZA 3GBVA 1ZOIA 3H3JA 3U9LA 2ERYA 4KLZA 2CEKA 1XTTA 2J3LA 2IYWA 4WH0A 1U7UA 1GPAA 1WQ1R 2X7HA 5K8LA 4KTTE 5CCXA 5JVDA 1SA0A 3RJMA 1LI7A 3NHZA 3CV3A 5EVCA 1DKOA 3TQSA 4C22A 1ND6A 3GR6A 1TTHA 2BCGY 1DUIA 2E48A 3GJRA 3LBFA 4XX1A 5EHGA 4A0FA 4NPAA 4CEIB 1TX4B 3CH6A 3ELWA 4CGZA 4MUYA 3PNYA 1X8LA 2G82A 3OESA 2PWPA 3I83A 2J41A 2QRHA 2XE6A 3SKYA 3HJGA 4R2JA 2PD3A 4PTZA 1D0VA 4RESA 2ZR9A 4ILKA 3L6OO 4WERA 4D4MA 1HWYA 4I8IA 3GCGA 2NVWA 4CMHA 5EA2A 1F17A 3X2SA 4IIYA 3Q8XB 1KBQA 1J39A 1L5HB 1KI3A 1WF6A 2IIBA 3QVXA 3TB4A 2FHPA 1L7NA 3A6EA 3OT1B 1ZESA 5CW1A 2QBYA 3V1TC 1GG5A 5HRAA 2EL7A 2O4UX 1NY5A 1EB9A 2DWQA 2CLFB 2DM6A 3I0ZA 1NLZA 1F4VA 5GONA 4D6YA 1ZIXA 1RR6A 4HQ6A 4IHJB 2W42A 4HZUA 2OVBA 2XE8A 4OY3A 1RNLA 3FR8A 4HV4A 2OE2A 4A0RA 4JX8A 3H7AA 3EMBA 1NVEA 2VDVE 4BJ1A 1Q95A 1QGUB 2ZPUA 2HSGA 3BXXA 3KVRA 4CTNA 2I71A 2JBAB 3AHIA 1Z15A 4HXEB 4EI9A 1CQWA 4D96A 2P5TB 5EI5A 1L5RA 2CWDA 4WXHA 5I8PA 1B8UA 4S05A 4GKJB 1EBBA 3B70A 1DFGA 4W1SA 5F4ZA 2F7SA 2P9TA 3PFGA 3FJYA 3W4JA 4IYRA 4KIGA 5GV7A 4OI0A 1LCIA 1NTRA 1MABB 4LJ7A 3WGTA 1F0NA 1BOFA 2Q6IA 1WUHS 2XMBA 1WPGA 4XSHA 1IVNA 3PPVA 2QTBA 4G85A 5DSTA 2HN9A 1L4BA 2QI9F 3ZX4A 4LYYA 1A9SA 7ABPA 5LZ4A 3UOWA 4AWXA 1KJ8A 2H7XA 2C78A 3M6MD 4HX5A 3ZK7A 2BI7A 2DP4E 3TDKA 5AO9A 1NZDA 1EA5A 5IDWA 4KREA 2HBQA 1WPQA 1D2CA 3QXXA 3K0CC 1EUCB 1WR8A 2OCGA 3OOJA 4G23A 3LUHA 4JLPA 1XRQA 3C4JA 3PFFA 4AX4A 3HKCB 2HA3A 2ATXA 4K6MA 5GGXA 1M72A 1PR5A 1VKZA 1J20A 2P8SA 3KYDA 5IYZA 2YC4C 3AHDA 2HEIA 1AQJA 2A5FA 1EHCA 1YJ8A 3IPRA 4CF7A 3RC9A 6REQB 1NBMD 4LF7B 2IPNA 4KR0A 1WQ4A 2M9MA 1TTTA 3WIBA 2ZTSA 5THXA 1M83A 2R84A 3FR7A 5IJXA 4XX0B 1EE9A 4QBFA 5E2BA 4HEA6 3RYHA 4DG9A 6PFKA 4FB5A 3HVRA 3GLIE 3WSTA 2QZJA 2D5IA 2B4YA 5KVVA 1A2BA 3AGPA 3VTKA 2P27A 3J7TA 4ZN6A 3MJSA 4S35A 4WADA 1D1QA 4N76A 4NP6A 1MQSA 3ZBQA 3DOOA 1EHIA 1C9DB 3EAFA 1HEYA 3DHYA 4NESA 1CCWA 1JJAA 1PE0A 3LQYA 3TWOA 4DKXA 2WMOB 3JRNA 2CLKB 1ONOA 1B0AA 4EGAA 5TC4A 5ALVA 3VUFA 2RGUA 4ZI7B 1U2GC 3C7AA 3CW2A 1FQOA 3E8XA 1UDXA 5CA0B 2UZ4A 1RSZA 3T5MA 3QX3A 2ZAMA 1XEXA 4EY6A 1KRWA 1ZIDA 3SJAA 1IATA 3B1YA 2H3EA 3NM4A 4GS5A 4WEOA 4X5OA 4ALMA 3K0HA 5J47A 1B0PA 3FWZA 5KNCA 4RTPA 4PFKA 5ALUA 3PNMA 1M2HA 1W75A 3I04A 1FP6A 2L42A 2O3SA 3HGTA 5EJ8A 3WGIA 1X8JA 1AY0A 2HM7A 1HH4A 5CNIA 4MVWA 3K31A 3ND5A 3GEHA 5IUKC 3K15A 3S99A 3TLCA 4LZJA 4PG6A 4ZKEA 1KSJA 3ZHBA 4E94A 2CJXA 1N2SA 1RHKA 3WAKA 1PCXA 3TLEA 1DX9A 1O08A 3VR3A 5C32A 4C4OA 5JEDA 1TMYA 1ID1A 5IPFA 4RJKA 5DIZA 4C7BA 3RRMA 5CCEA 4AN0A 4XJTA 1A5ZA