2A58A

Structure of 6,7-dimethyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound riboflavin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
LKGPELRILIVHARYNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSWELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVILGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase
publication title Structural basis of charge transfer complex formation by riboflavin bound to 6,7-dimethyl-8-ribityllumazine synthase
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 49
structure length 146
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2a58A00
1KYXA 1C41A 5IM4A 1W19A 1ZISA 1KYYA 1EJBA 1NQWA 2A59A 1KZ4A 1XN1A 1HQKA 1W29A 1KYVA 2C92A 3MK31 1T13A 2A58A 2C9DA 1RVV1 2JFBA 1NQUA 2C9BA 2O6HA 2VI5A 1KZ9A 2F59A 5IM5A 2C94A 1NQVA 1C2YA 2OBXA 4KQ6A 1KZ1A 1DI0A 1NQXA 3NQ41 2B99A 2I0FA 2A57A 4J07A 2B98A 2C97A 1KZ6A
chains in the Genus database with same CATH superfamily
3AO0B 3LDFA 3WYCA 3SX4A 1MB4A 4Z86A 3IQDB 3ZDYB 1SCNE 2PQ0A 4EMSA 1EJ2A 1V26A 2EHDA 4YT8A 4KO8A 5H02A 5FOVA 4YCCA 3ON5A 4LF8B 4DSZA 4IAOA 4CL0A 4I55A 2NO5A 2QQ5A 1L1QA 1GNPA 1U80A 3BWVA 5J43A 2PV0A 3TGLA 3PF8A 3PNMA 1JT9A 3OCZA 1N6OA 5H80A 4X90A 2FF7A 3WJ2A 4MVJF 5LMZA 3T7SA 4U7DA 4AK9A 1IC6A 3JVIA 1VKJA 4IFTA 2RCNA 5KINB 1VSTA 1E2EA 1JE1A 3EUEA 1X0XA 2GK6A 5BR8B 3GW8A 2VPPA 1S8NA 4MRNA 1V41E 4U9IS 3K3PA 3IA7A 1ZIXA 2IXDA 1DVRA 3ESAA 4U2EA 3HYNA 1J42A 1PJSA 4ECEA 5C37A 4OJYA 4M0CA 5L7TA 1Q22A 1VL5A 2AOUA 3CJQA 1D3AA 1OZFA 1GGNA 1Y1QA 1I4WA 1VMDA 5CX1B 5DHSA 5GINE 3I76A 4FKMA 3LE8A 5EYPB 5A3SA 2OYRA 3PFBA 1RCUA 1PTJA 5FA5A 2E55A 1E8MA 2I3DA 1PTJC 1I6MA 5IJ9B 1C0EA 3SSOA 1VDMA 5AM4A 2CSXA 4ZTBA 2IYNA 3UUFA 4LJAA 3QI2A 2WBLC 3RQIA 3ZCQA 3D6MA 1FIUA 2VAVA 5IM5A 1YQDA 1KDTA 1A4IA 5KNLA 5JYEA 2NPOA 3BUSA 4HL6A 4RL6A 2FPPA 1YQTA 4NBRA 1RXSA 3Q9LA 4Q15A 4QXMA 1Y3IA 1M34E 3GJYA 5CT8A 1JV2B 4C21A 1EIZA 1RTKA 1QNFA 2H0QA 3E4DA 2XQKA 3IQWA 3K96A 4UFNA 2ZI6A 3QEOA 1PR1A 4BN5A 1D2GA 3KRTA 1FS4A 1AGYA 4OXYA 3WDLA 4DG5A 3VNQA 1E6WA 3R9XA 2JVIA 4RDXA 1AY0A 3WLIA 2Q4RA 2YVQA 1AZSC 3H0CA 2JIMA 1WW3A 3N7UA 4EJFA 1F17A 4WDRA 1WB5A 1XCOA 1HNWB 1SQ0A 4C89A 4EWLA 1J99A 2TSYB 4ZXPA 2X4DA 3I5XA 2NTJA 4YBRA 5CLLA 1M34B 2Q4EA 3LPAA 2A7QA 4GZ3A 1CU1A 4ZOQI 1G8MA 1L7NA 1DJLA 3N7AA 3W9UA 3WDKA 4DMMA 1OASA 3LA6A 3ZJYA 3E9DA 2WJJA 2WLSA 2QTLA 3AR3A 1I3MA 4ZQEA 4V0QA 1IQ0A 4KLZA 4RH3A 4EAAA 5H7XA 1BDBA 1XEXB 3ZXUB 1E1YA 2IUSA 3GCXA 3QLVA 4ESHA 6NULA 2COUA 3K6JA 3BJIC 2JI7A 1P0PA 3QLVC 2VDJA 2XF2A 3EXAA 3OJWA 1IULA 3ISJA 3GMSA 3LBHA 1EGQA 2QUJA 3R3YA 2X0FA 3FI0A 4R41A 4BO2A 3D8NA 1Y1PA 4PHCA 3E8XA 1DADA 4Y2HA 5C35A 4GYYA 3NHUA 4KE8A 1MH1A 2FETA 1U7WA 5IUJC 1CUJA 4WLUA 1WZIA 1RWWA 4MVJG 5IDYA 2CMFA 1E92A 1YH3A 2IIPA 4K3UA 1HYQA 3QV1A 3CNNA 1YQWA 4D8XA 3KCNA 4C0AC 2R2AA 5BT8A 3B6JA 4L5BA 2G04A 3EOBI 2JCBA 4GPIB 2IA5A 2NN3C 2Q2OA 2WVHA 3GJXC 3EW7A 3MUEA 3T3NA 2I4OA 1XMJA 5BR7A 3UH0A 2PJZA 1UMBB 4NNOA 2QXUA 2I3ZA 2PGXA 4DPLA 1R0WA 3T7KA 4ESEA 4MHOA 1O54A 1I36A 4MUKA 3TVYA 3M5PA 2XOEA 1RQGA 1K8YB 2QRPA 3ND8A 4ZCTA 1XBTA 1TT7A 2X5OA 2M32A 5DNWA 4DV7B 1QHHA 4MITA 4PPQA 4RD0A 3RSZA 3OECA 1NJSA 5AVQA 4JY7A 5MHTA 1ISRA 3VAYA 2CXQA 1AA9A 1U8TA 1IN6A 1KAGA 2FFJA 1JDJA 2JI8A 3EFBA 3VHRA 1YS7A 2V7QA 1ABEA 3KX2A 4ZCSA 5JS7A 2PZLA 3SYRA 2GYWA 2Q6KA 2NV0A 4LIPD 1OX5A 3TIIA 3HN6A 2YZGA 2WYWA 2X86A 1E3QA 4DA6A 5JALA 3RFCA 1XHFA 1XJ0A 1RLJA 1TA0A 1VCIA 1XTSA 4NZPA 3RSQA 4QUIA 4NCAA 2YV5A 4JU9A 2VRWA 4KXVA 1DCFA 1SXHA 2GUWA 2FJPA 3OMLA 3N8IA 4MMXB 3A2MA 2JCYA 4ETMA 4IINA 2DLNA 4YT4A 4HWKA 1RS0A 2F3RA 4NEGA 4ZDKA 2AFHB 3AVOA 1YI1A 3OZRA 4KVAA 5AI0A 5JMPA 1MEEA 4Z49A 1VJ0A 2OV2A 2RGGA 3ORSA 4ZVTA 1FUEA 1PR0A 2VF5X 3SYNA 3FHTA 2J9FB 4BCCA 3I53A 2VN8A 4ZU1X 5IZCA 4E08A 4WOPA 3ACCA 3TM5A 2X8AA 3MWLA 5HKKD 5IZCC 3DWIA 4EMBA 2HIMA 2IH5A 1E58A 1W76A 2GBCA 3HJCA 2GJ9A 2PBRA 3OZDA 1U63A 3DONA 4U2CA 2EYUA 5K0ZA 3EDYA 1K6JA 1JTVA 1MA0A 4AURA 4LVOA 1VRCA 3L5OA 3SQNA 1IAQA 1LKZA 1M2EA 3GWZA 4E22A 8AT1A 1Z68A 2ZT8A 2HQRA 3QU7A 4O2LA 4DNXA 4ZP1A 5CLJA 1RAFA 3CNLA 3THWA 5KNCD 5CPBA 2CEKA 2WD9A 2HHAA 2ZIAA 5E1DA 5JUWA 1PK8A 1FB5A 4NU5A 4WLOA 2PUCA 1IHPA 1BTOA 3LYAA 3NBFA 1IAVA 4K46A 3JYNA 5C8DA 1E2PA 3B1XA 4OHRA 3H2IA 1GZ3A 1QCDA 2E48A 3NEYA 4BP3A 3HB9A 1JHRA 4MCIA 4ZO9A 5HDQA 1EM8A 3CLKA 3OJEA 5B4TA 3U1VA 2V5VA 5AUQA 4U2GA 3ZCPA 1VIYA 4Z1MD 2H8KA 4PU0A 5HBGA 1ZOIA 2VR1A 4IG9A 2JHFA 4I4NA 4C5AA 3RRMA 4QKQA 4YJFA 3UYKA 1Y1TA 2BDTA 3R7BA 5BOSA 2NVUA 1CS0A 5TC4A 1J9GA 1XMQB 3ETJA 1N9GA 1YA8A 4QVGA 1BGXT 3OZWA 1WB4A 1R5BA 1CE8A 3H4VA 2IELA 2Q9BA 3ETDA 1TTPB 4HNAA 4R5MA 3ZZ1A 2G0AA 4L22A 2R6R1 4KFRA 5JXWA 4U63A 2WC1A 4NJMA 1X7YA 3FVQA 3O8CA 4DUZB 1AC5A 3TEFA 4R4JA 2YH2A 1PVOA 1X7WA 3AT1A 3PKJA 4DFDA 2XECA 4OKIA 3FWYA 1G5TA 5K6TA 1AHIA 3RYIA 1E2UA 5KI6A 2DSNA 4PLWA 4LG1A 2IS2A 2IXAA 1EXNA 2ZETA 3T52A 2LWIA 2QRVB 2IIQA 1J49A 4BC1A 3FHOA 3RC9A 3W9SA 3LUPA 2PLWA 4FMCB 1UP4A 3ROKA 2OORA 3C8DA 2G09A 3SQLA 2ZPAA 4A03A 4C4AA 4ZI7F 4LCEA 3F5QA 2OORC 1ZVVA 2AZ4A 4WNIA 3M3PA 3HL4A 1QO7A 2VUHB 3B8EA 1RXWA 4RTKA 3N59A 1ZUNA 3M4ZA 4PLVA 2PMEA 3A9CA 2WYHA 4R7TA 3BMNA 4DV2B 3GLKA 1EVQA 3TLYA 3QITA 1VQ1A 3TW4A 5EE9A 1FTWA 3F4KA 2ZSDA 2C9MA 4IXWA 1BEZA 6PFKA 1HYGA 3ZHXA 2FEOA 4ARSA 2DULA 3AQ4A 3N0VA 1MP0A 1OAOA 1UBSB 1T9CA 3L07A 1VXOA 3EHDA 3NONA 5GZ6A 4P36A 1OAOC 4IS3A 2ATXA 3NDJA 3ORFA 2NSDA 1XDDA 4J1QA 4OJQA 4Q4AA 4WLVA 4CCAA 5KNBD 3GEIA 3CW9A 1MO3A 2GASA 2Z4TA 3WYEA 4TTAA 4WZZA 3ZDZB 2B7BA 4XW2A 2B8EA 4KNWA 3BRSA 3UMCA 2C9CA 1YBVA 1PZEA 4JODA 3RJ5A 5IXSA 1FNCA 1JA0A 1YQXA 1UZNA 1LK5A 3W5UA 1A7UA 1IXZA 2WFMA 3W7VA 4DNQA 5TVKA 1KNQA 1Y1LA 1I9GA 2PKYX 2W2QA 2GEDA 1SKYB 4I6JA 5FOQA 1TI7A 1OIVA 1YVEI 1ZIOA 3D3EA 3DBLA 4AFNA 2H9YA 3N0TA 1NI4B 2J0UB 3HACA 1EHYA 1IE3A 3JARA 4JLBA 2LDBA 4W6ZA 1FQJA 4GZMA 4WKNA 2BSQA 3TE7A 5SYAA 3L7IA 1Z4OA 2QTZA 1U8UA 3Q7IA 4H1TA 3QA9A 1F4LA 3VR5H 2Z6UA 3H2JA 3O4FA 3C6KA 1HFJA 3RK0A 4RUKA 5IAEA 3ESCA 4JLOA 1ZUIA 4K5QA 4OH1A 4RABA 4MCHA 3ZGNA 4EHJA 5ADWA 1JSZA 1JXMA 3D6TB 3OM0A 1ZSVA 5DASA 5BUCA 3CV3A 3PU6A 3LT4A 1FXSA 3ZV5A 3B3QA 3N8NA 4K9RA 3RVKA 1D04A 3G88A 4S1PA 3R9IA 5GVSA 1CY2A 4CMHA 1STOA 4OHXA 1JAXA 3L7CA 2CE2X 3MWDA 3QKUA 1J06A 3E3NA 3DLIA 4MI9A 1WF3A 4JJZA 3A4MA 2ZIWB 4A2CA 2Q0QA 1P2DA 4IH1A 1HT3A 1GARA 2AUNA 3ZY2A 1YJBA 1BEUB 1E0KA 3TOVA 1I6LA 3SHTA 4B83A 3T5PA 3PEFA 4YCNA 1WOMA 4KN8A 4EJSB 2QZSA 1REQB 2HA6A 1CUWA 1EB8A 3Q2KA 4ZI2A 1WLSA 4D0RA 5CDFE 3VJKA 3PHBE 2VZLA 4KQGA 3ENQA 2P2LA 3JQ7B 1E4EB 4BOYA 4I1PA 2WWFA 1VHLA 4UBMA 1XMVA 4AJJA 2O5VA 3E3OA 4Q05A 4S1TA 5TEWA 2ADFA 4GWLA 4RIGA 3EPRA 1ZINA 1R0LA 3FSEA 3L7BA 1E9SA 2PS9A 1POXA 3LU1A 2QMYA 4JB0A 3BMQA 3C8MA 2W37A 1VCMA 1RM5A 4PWYA 2VLBA 2WMOB 3R41A 4R69A 3W5CA 3FPBA 1AO0A 1Z5PA 1WNTA 3C1TA 3ACDA 5EZ5A 4Y2QA 4MICA 4E12A 1WR8A 1B2RA 4LE1A 1QHFA 3RUAA 2GNAA 4L75A 1T0HB 3T5MA 4EKDA 1EBBA 1PFQA 1BX3A 1JEYA 5DF1A 2WQ6A 4NJEB 5DHAA 3J81A 1KOGA 1ISHA 1X80A 1Z3IX 2VNAA 4LHZA 3L6RA 4HMOA 3GUHA 5JXJA 3U80A 4BE4A 4D9EA 2B69A 2WHPA 1WCV1 2VXBA 3MWGA 2Z83A 2AC4A 3VTFA 1VMEA 3PG5A 3DVQX 421PA 8LDHA 2G8NA 1QZTA 3T0IA 1HEUA 4G0PA 4LK3A 3ZE6A 1KAHA 2GAOA 3WTCA 1BOOA 2CMDA 2OEPA 3JZAA 4Y2VA 4Y6LA 4B33A 3BHIA 3EGCA 1XHEA 2IYEA 9MHTA 3AK4A 5AK3A 3RJMA 1VA5A 1WXFA 2VHQA 3BXPA 3A8TA 2XTMA 3DMHA 3IEKA 1JB1A 3IILA 3EQ6A 4DLAA 5JV5A 2QLFA 1C0LA 3KOYA 3IAS1 2PD6A 2I7XA 2ID4A 4HY3A 5DOZA 4IW3B 4AG5A 3QE9Y 1D2HA 5BQXA 1I5EA 4JUFA 5EJEA 5J63A 1PW5A 3KDPA 2ZUTA 3ELWA 1SHKA 1F5NA 1E89A 1X2BA 1ORHA 1NBHA 3L8EA 3ISTA 3OJLA 3KTAB 5JASA 1PGQA 4YRNA 1H05A 3E61A 4ND8A 1Z6GA 1NBAA 2HSZA 4HKTA 3DR3A 4PQGA 4P08A 4X1IB 3WNBA 3GEGA 3ZCXA 3ZXIA 1OT3A 4BWFB 4YJ3A 5L3QA 1X8XA 1WO8A 5HFNA 1F6BA 2ANCA 4B7AA 3GQBB 2YV3A 2GNOA 3LXXA 1PL0A 3MAGA 3ROQA 4XWTA 1D6NA 1HR0B 1N1GA 1W46A 5B7GA 3HKDB 1BQ3A 4EHNA 1N8TA 4MQFA 4NCHA 3EEYA 1ENPA 1XD8A 3PNBA 3BGOS 4XPZA 1ZHOA 1IDN1 2EG9A 3GA0A 5FF9A 3RUCA 1TYDE 3MTDA 3C3DA 3PUHA 5D51S 1Z62A 3PTZA 3PVCA 4GSKA 4E6PA 3TBFA 2VQ6A 5B6JA 5CGZA 4WI1A 4KGDA 4ZU3A 3RODA 2F9LA 4X9XA 1PDWA 3HABA 4CV0A 1A9OA 1LD3A 1B8VA 3QVSA 1M2VA 2ZVDA 1VP3A 5K09A 4HNUA 4HV4A 3MW8A 3WGVA 3RSGA 2WU8A 1TAUA 1Q77A 2EBFX 4MCJA 2BWJA 3IEUA 5DIFA 3VU3A 2P69A 3PRKE 3FRJA 4PAGA 1DC6A 1GSIA 4TV9B 1AGNA 2DGDA 5LQSA 1XZMA 4XM1A 4OLBA 3U0VA 4BVJA 1FEZA 3FETA 3UWDA 1C8BA 1XIVA 2VRBA 1N2OA 4GZ5A 3RTEA 1VPTA 5FTMA 4B0OA 1XC7A 2ZTSA 3BWEA 1K89A 1SWVA 2ZW9A 3DMYA 3FCSB 3MD0A 3QP9A 4FPXA 4YASA 5AIBA 4OKNA 3T3IA 2H2GA 4BZXA 5KX5B 2ZPTX 5JJKA 2ZZNA 2QLTA 3TQOA 4CUZA 1Q2UA 2HFJA 4XVQA 1MNAA 3D4PA 2ZE7A 3CUTA 4JBIA 1FTNA 4AO8A 1G64A 3DLPX 3P9IA 4NONA 4RD1A 2CK3A 4ENRA 1ODCA 1EFHA 1T6YA 2VJCA 3AR8A 3EZ9A 4UZFA 1DBRA 2R8PA 4CMEA 2UU9B 1Q7GA 4IVPA 1BVRA 2VHWA 2QTTA 4MJXA 1QG2A 2A9RA 3IBGA 2W6NA 4PYLA 3A1UA 4TMWA 2NYUA 2BCEA 4ZCPA 2C7VA 3LWNA 3CKMA 4G0MA 4FFMA 3PQEA 1BHSA 4D96A 4EYGA 2XMPA 1KZ1A 3CHYA 4EUHA 4QJ3A 3NYRA 1N6IA 4I2VA 4L8GA 2NAPA 3AY7A 3K70C 5EOVA 3IEXA 1XMSA 2DCMA 1FFHA 2JJ8A 1EJ0A 1I8TA 2X9QA 4MSUA 2ZUUA 5MGNA 3VI4B 2ZQZA 2PKWA 4IJMA 4MMYB 4L28A 2GNPA 3S8YA 3QH4A 2V8OA 3PWKA 1GQSA 1WETA 2NWQA 5BRNA 1I0ZA 4LY6A 3CCBA 3H5RA 2DFDA 2WJZB 2Z5VA 4H7KA 2MTBA 3LQKA 1T2VA 5DTEA 4BX9A 5ISMA 2IEIA 4AI6A 5LWQA 1ZVMA 2K6GA 2AW3A 4UBOA 2OC9A 2GCGA 3RNOA 4BPRA 1XZHA 1ADBA 1NF8A 3KDAA 4J0DA 4PYIA 4KN6A 4TWAA 2ODNA 3T54A 3QBEA 3UPTA 1ZIPA 5FHQA 4Z7OB 1P61B 1JHUA 2PSDA 3F78A 2J8ZA 3IB6A 3AP3A 1ZN2A 4G9EA 4QG7A 1G66A 2GVZC 3C24A 5AJXA 1SRRA 2CB0A 3FBWA 4M9XA 4AZSA 4MWDA 3UAWA 5HGXA 3DFFA 5B1IA 1LBTA 4YXFA 2AYYA 1Q0UA 5FR2A 4ARUA 2VTBA 3ND6A 1M2JA 5I9BA 3F5MA 4XGKA 4KMMA 1NI3A 1GAEO 3QFFA 5KREA 2QN7A 1GGFA 1S01A 2ZWIA 3D6HA 2PJRA 2ZT7A 4TQUS 5B1YA 4RJ2A 2AQ8A 1DINA 2X15A 3FKSD 3FFXA 3JU3A 3K2IA 3PQCA 4DADA 2ISCA 2QVZX 3G5MA 1AN0A 2AI2A 3TX6A 4F93B 5GJBA 4LXYA 3BCHA 3B1ZA 2CUZA 2PRZA 3JYOA 4BEWA 4WERA 4Y2SA 5EPEA 2VOEA 4FYXA 2ZR9A 1HRKA 2CLFB 3QVLA 1TVKB 2C0PA 1T0UA 5GM2A 4YIHA 5B1SA 1RHUA 4O4IB 2I55A 4EGAA 3GFFA 3OAAD 5IT9A 4I4IA 5J2UB 4B7UA 4LZJA 4U6NA 3ZIAD 4FC6A 1J0DA 5EKDA 1JZTA 1ADFA 4GI3A 1XQXA 2XX3A 3O1LA 3VR2D 5KOJA 2IBMA 3LSTA 1RBMA 5CXQA 2I6UA 1TRHA 1KZ7B 1N7IA 1NJFA 4YRRA 1KAMA 2XNJA 1RI5A 1W75A 1NW8A 5H8WA 4EPYA 2HM7A 4I3HA 4I50F 4AP5A 3ADPA 4UHEA 4DR3B 2LKCA 1VSVA 3H4MA 2E4AA 2FG7C 3PGA1 5G3YA 4EVRA 1U0SY 2BEWB 5JDCA 5KDOA 2IPNA 4YUWA 2IE8A 3LRPA 5JDCC 1JYSA 3PFGA 2OO3A 4HGZA 3AJ9A 5JXIA 4AKHA 3LIPA 3E7PA 3N2LA 2X76A 1W96A 2HQSA 5ELLA 4NE2A 1RU3A 5EZYB 4F2WA 1WRBA 3NZEA 4JB8A 5CVTA 2HY7A 2Q5CA 3A27A 2B0CA 3DAYA 1T5IA 2DLDA 3KLOA 4UEKA 5BSUA 3ZH2A 4AO7A 1KA9H 2HQBA 2NU8B 3MWEB 3ZHSA 1P17A 4RO0A 4OLAA 1EDBA 2R4UA 2SHKA 3BWCA 3QFSA 3S5JA 1L4NA 1N5MA 3TDNA 5AVZA 2WU1A 3I6IA 4XFDA 4EPRA 3R44A 1M73E 3HJFA 1U3TA 5IBQA 1X1BA 2AMYA 3KHSA 4QT0A 1CWUA 1DUSA 1OF1A 1EGAA 2A0UA 1DS6A 1V11A 2AVNA 4K1LA 1Z2EA 1J8MF 1WBDA 1HEYA 1JT2A 1DGQA 2VHUA 3JSXA 1XTPA 2UYYA 3GK3A 3I9MA 1MC4A 3LK7A 1JECA 1PNTA 3W7AA 1LNSA 3ZLUA 3H9BA 2H06A 4GI7A 3K5HA 1NGSA 4IG4A 1LVUA 3TR0A 4E15A 1OGYA 4LYFA 2R44A 3VDXA 3TGWA 1HDYA 4CI9A 4YP9A 3OZUA 5BYAA 2D54A 1P77A 1K7FB 5K0CA 4Q1AA 3G0CA 2PMWB 2H2HA 2WE8A 3OJ0A 1FF9A 2FI1A 5DT2A 2NO6A 4ZT7A 4PC7A 5T4HA 2QA5A 2ZWOA 2QP3A 2HA3A 2XNHA 3AC0A 3D2AA 4MUXA 3L4JA 2IYFA 2ADOA 3DMPA 4DLBA 1CR4A 1TCAA 3B89A 2FFBA 4HNQA 4MOWA 4NEHB 3SG0A 4BQSA 4MYCA 1UAYA 2JAOA 3F6SA 3VSAA 2IEYA 4XWGA 2HF8A 3LRXA 3OO0A 1QLHA 3UJPA 1GQRA 3L18A 3U7RA 1NM5A 2BM0A 3NAQA 4JD5A 4FLFA 1NM5C 4N39A 1DDGA 3GT7A 1TD1A 1FU4A 3DE2X 3AIKA 3KTOA 5F64A 1I13A 3RWMB 4B74A 4D9HA 2ATVA 1PCXA 5DT9A 2FSIA 1JH9A 4M22A 3P20A 2G5CA 1YCHA 4KXUA 4TLAA 3KJFA 2HWWA 3HYRA 4MR8A 4ALJA 4PIVA 4DCUA 2Q5FA 1J2TA 3A3OA 5JD6A 4EHLA 1SUFA 3BRCA 4MR9B 1PZNA 4YDSA 4WNCA 1YBAA 2Q5LA 3TQIA 2X8LA 1OXXK 1ZJ6A 2CDCA 2VJNA 1KVSA 5AJWA 3W1WA 2B1RA 3A6EA 3L7KA 4RZHA 1CLEA 5ALJA 1M6HA 1NR1A 4DIDA 2OESA 2YHSA 4FM9A 2EFJA 3AGPA 3OHSX 4R6WA 3ED5A 3S28A 4C76A 4NL4H 4QBFA 3DDZX 1SIOA 3UJ6A 5AM0A 4M1KA 4EA6A 3IDZA 3A26A 4B9EA 4R1SA 1S1MA 2MSWA 1SQ5A 1EP9A 4G9GA 5EIOA 3EC7A 2FQWA 4RK1A 4ND5A 3DP9A 2BM8A 3KUXA 3F9CA 3ULKA 3W8EA 4ZYXA 2W6QA 3E8SA 1M2OB 1ZITA 1BRTA 2TMYA 1GVHA 5BSWA 2VDOB 3H5WA 1H4QA 1JG1A 1K8ZB 4BZPA 1G3IA 4F6CA 2YZNA 5JXGA 1V8ZA 3EASA 3MTJA 4M46A 5FTNA 3KLNA 3VPHA 3C2QA 5BN4A 2RGBA 4XX1A 1XFDA 3AB7A 5ALPA 3IDFA 3N8DA 4HDQB 1OI3A 4RTMA 2VP9A 2Z8XA 2F1RA 4HWSA 4TROA 1ZUD1 4TMXA 3AG5A 3ZNQA 4AVYA 1K7EB 4EB3A 3AW8A 4FVTA 4QHTA 2JGDB 5AOCA 1NLZA 2RE8A 1BDIA 5K8UA 5IDWA 3NWOA 1RJDA 4XQ9A 1YQ9A 1BIFA 1X39A 2YBDA 3QUAA 4W99A 5JADA 1NMYA 3YASA 5BY2A 4Q3LA 2BFPA 4WXMA 1TK9A 3D4BA 3IVAA 1FNBA 3HU5A 4G5GA 4PEVA 3COYA 4E2ZA 2X8JB 5GIOE 1HTBA 1HL7A 4DR7B 2B30A 3DL4A 4HQ0A 2VYFA 2WWYA 3KXIA 2FGJA 1L3BA 2QTVA 3DXFA 5CEEA 2C9YA 2O50A 3A7DA 4W8OA 2H54A 5FQNA 3SIWA 4RVHA 4B6EA 2VFAA 2IXBA 2XXJA 3IMCA 3PHLA 4NSNA 5K4GA 3OM8A 4PPFA 2NUAB 4CQNA 2JI9A 1L5RA 1N5LA 3MVEA 5IEBA 1OBCA 2AEFA 5JAQA 1U3UA 2FZEA 4GX1A 1S2NA 4DTIA 2ZSHA 2A0FA 5CVJA 2CNNA 1SVOA 1Z16A 4DEXA 2MYTA 3O3OB 4X8HA 5H1YA 1BW9B 1R0RE 2B83A 2V9ZA 4YFVA 4IZOA 3UMFA 2RBGA 5ALRA 4WPGA 3VM6A 4G0UA 3S2YA 4DMRA 1DX6A 4EKGA 3OHMA 2AKYA 3DE1X 4QPDA 3VYUB 4CEJB 3OICA 3CF4G 4I46A 2EU8A 2GOYA 4G01B 4HLQB 4L0MA 2IZZA 1ZH2A 3OPQA 1WBJB 3IV6A 2ZB3A 4CLEA 1WE2A 2IEDA 1G6Q1 2GAAA 3CY6A 3D6AA 3QLUA 4GBGA 2BSXA 5FOSA 4AUEA 2A3RA 2CHQA 4JHXA 2PNFA 3NGXA 4NENB 1H69A 4JC8A 4RKFA 2ERCA 1DELA 3TLMA 2AB0A 2YVKA 1KE1A 4C6TB 4OV6B 3C1UA 4C6TA 1WU7A 1JWBB 1IMJA 1XWIA 1NVXQ 2RKOA 3FLEA 3GBPA 4LCJA 4YWHA 2AC2A 5I7VA 3S99A 3VV3A 1U0JA 1A7KA 2DT8A 4UM7A 2KMLA 4LRWA 2BPOA 5FI0B 5EQFA 1ZZEA 2PTGA 3NALA 4Z54A 2VJLA 1XJCA 3B5EA 4P83A 5FLKA 1PJBA 2QENA 4EHIA 3HB4X 1YFLA 4ERXA 5AK6A 2R6DA 4YREA 3Q4GA 1MXHA 3E22A 1QYXA 3HDHA 1A1SA 4FGLA 3QXXA 4I36A 4IHJF 2I99A 4RY0A 4WJZA 5DMXA 5ECDA 5AR1A 5JCJD 5LOVB 3V46A 5AMXA 4EX7A 3HXMA 2Q3FA 3OE7A 3GVIA 3DAOA 4UUNA 5ALQA 1TLFA 3QMVA 4LVNA 4AMYA 3G2PA 3TBKA 3TNDA 5B58C 5BUZA 4R5HA 5AW3A 5MFZA 3RSLA 4MVJA 4RE5A 3P19A 3PX7A 3HCEA 3ASVA 4B87A 3K9GA 3ONWA 5G0SA 4I1YA 5LBIA 3IO5A 5TV2A 4CT5A 1F2UB 1CD5A 2AEMA 1UKAA 3VGJA 4OHBA 2WF9A 3D2LA 4WCFB 3I42A 4HFMA 4Y2RA 3TD9A 1YD7A 4GOJA 4NABA 2H48A 5G0VA 1XD2A 2JIDA 3A6ZA 3A6FA 3RABA 2XDAA 3O6VA 1T29A 2V6BA 3DOHA 4DCPA 5A2GA 1UBTS 3R3JA 3ZS9A 3LZDA 3N2KA 1GNSA 4MW5A 3DF7A 4QT4A 3PXUA 5CMLA 2RDMA 2OFFA 2DHCA 3C8HA 4RLSA 3D9QX 1H4SA 3S2EA 1I1HA 2H7XA 4B7XA 1QQAA 2R1VB 4CI0B 3CLVA 4CKWA 4XYMA 1EFVB 3PDIA 2PS1A 1SELA 5NULA 5JYBA 2IH4A 1QR2A 1H2XA 5FUWA 1GR1A 5BR4A 1BS9A 2NM0A 2ORWA 1T8YA 3PZBA 1PLKA 4ZT2A 1QYRA 1NMXA 4W8HA 1H8HD 4EGCB 3JR7A 4YJKA 4JEIA 1C3OB 4EJMA 5AKJA 1ZR2A 1XDBA 4FFPA 2IOQA 2EZ9A 3JTEA 3GN1A 3MIIA 1LI4A 2NU7A 4EELA 1ATZA 1AQUA 1NQTA 5J9FA 3ND7A 2QE6A 2VQ3A 2Y99A 2Z43A 2P1ZA 2B1JA 5ESWA 5B64A 1QUEA 1O03A 3N75A 4F45A 4F86A 3UCEA 1E1DA 1UEJA 1K4KA 1N5IA 2NADA 1WCYA 2V5AA 3GHYA 1NXPA 3EFOB 3U3ZA 3TG8A 5GONF 3WWZA 1WG8A 2IBSA 4DMFA 4GNKA 5H3LA 2BEVA 4LTDA 1MAUA 2I8LA 2PZEA 5JATA 1YR7A 2VCEA 2GTIA 4KMOA 1P19A 1YU6A 3HM9A 4QL3A 3T1NA 1E4VA 1SUIA 4Y1RA 3MAAC 4HH3C 4N5LA 5FJIA 1TZBA 1G291 5JPDA 4E5UA 4G36A 1Z39A 3KR1A 1O4VA 2YYZA 3FYCA 2B1QA 4HWGA 4B35A 3N05A 1SH7A 2HSWA 1R6BX 5C3UA 1HX7A 2EGHA 8GPBA 4NZMA 3PDWA 2VEDA 2O5CA 1G7CA 3BH7A 2HO4A 1X87A 5T4EA 4A8JB 4D7AA 2AHRA 1IZ8A 5ALLA 1GL3A 4U2DA 1PS0A 4V38A 3OQIA 2BFBB 3I6BA 3T9BA 1QVZA 3TLKA 3T5AA 5IXJA 4M8SA 1C8LA 2Q3JA 3O8LA 2I0FA 2YL2A 1L4KA 2EOAA 1L5MA 4ZT6A 3ZCUA 2RIPA 1LF0A 4BZQA 3STVA 1QQ5A 2BEJA 4KLCA 1BO6A 5EHGA 5L51A 1KZHA 4BVHA 3FOCA 1D4OA 3FVTA 3K15A 2GM9A 1Q50A 2I71A 5CVCA 3TH5A 1K97A 3TIFA 3S44A 3IDOA 3VR4H 3RO7A 3UUGA 3P9SA 3F6BX 1C9NA 2YRFA 1SC9A 1UBOS 2DUNA 3AU8A 3AU9A 3AHJA 4MDYA 3Q8MA 2ODTX 4JUDX 2OHVA 3P7MA 3RRBA 3RFTA 3R2JA 2HJRA 3VHXB 1ORVA 4KQ6A 3EODA 5F2OA 4HUQB 4JLJA 2FQQA 2QX9A 1MOSA 2FCAA 2QZ9A 2BFAA 4Q37A 1QC5B 4IWYA 5FTJA 1AF4A 2JAHA 2C03A 2FMFA 5JCXA 1I7SB 3SZUA 4IRUB 1RDFA 5GADl 3WK7A 3ZWNA 5EUBA 4LZLA 5BW6B 3GVCA 3NPMA 4D2IA 4V39A 2NZUG 1LQTA 2EP5A 2GEBA 2IOYA 3KEQA 4ZHSA 1M0TA 3JD2A 3GYBA 3IAXA 4UAGA 3KKNA 2BN4A 2W43A 2CUKA 1FRZA 3JV7A 3MWFA 3DPIA 3S40A 4N0PA 5BP7A 1NNEA 2QTAA 5G4LA 4C4YA 1CQIB 2OHHA 5MN6A 3LCCA 4OQZA 2O2GA 4ZZ1A 1KI8A 3ANXA 2GCPA 3FVRA 1AS2A 4E33A 4CR7A 3U7FB 1NF3A 1NOIA 2DT5A 3ZBTA 3HEAA 2AJLI 2O6LA 1AKNA 1QS0B 4ZFNA 1WB6A 1M67A 1RQPA 2OZVA 2WHYA 3VR4D 1LSJA 2QN1A 3QRWA 4FFBB 3AESA 1H85A 1I6KA 3KIPA 3ES9A 1JYEA 5JNWA 5DXJA 5CFNA 2AL7A 1JR3E 2DHEA 3BTOA 1SEPA 2YHIA 4OOEA 4YCBA 2OHOA 4KQFA 4UZSA 4AJKA 4LWPA 1YB6A 3D5EA 3K4PA 1I4EB 5TJHA 4WKGA 1R8SA 5AJTA 1FRNA 1FJHA 5LMUB 3WWEA 3VPFA 3V32A 2EDCA 2WV7A 1R5OA 3NFRA 2ZB2A 3OE4A 4P38A 2BEUB 2QUAA 2AEJA 1QGUB 3JQ9A 2NZ2A 4QZVA 3JQEA 3V2IA 2CLEB 1EJBA 1BMTA 2JFXA 4UFPA 1T36B 2HLHA 3CRRA 4KXLA 2Y4OA 2OSBA 2C92A 2A9PA 3G8BA 4XH9B 4HWPA 2WKRA 3M9WA 1QDEA 4V0ME 4YLGA 1O96B 3D3QA 2HA4A 2ZIGA 3A6DA 4K3VA 2LW7A 3DB2A 1JKIA 1LJUA 3ML1A 2HEGA 1E7QA 3BXEA 2I6SA 1B73A 3OTWA 4J2TA 1Q92A 1JXQA 4ZOCA 4UOZA 4DRXA 3CVUA 1XMIA 4GKAA 4Y0AA 1Y80A 1DFHA 4FJ0A 4ZOLF 5L3RA 1QOQB 2D0PB 2GM3A 2CNKA 2V5UA 3DZCA 4IILA 4QBKA 4ZI7A 1NMEA 5JSQA 2WTEA 3EAQA 4GXNA 2IYAA 4JA0A 3HBAA 3PSAA 4BLQA 4EECA 8ATCA 1EJ6A 1V0JA 3DZIA 4G85A 1XR3A 1FVXA 2FN7A 4EQZA 2XAAA 1XYVA 5IX8A 1VFNA 3MA0A 4MMZB 2N75A 4YV1A 1GQ2A 4EYQA 4BMXA 1TE2A 4MWCA 4MI3A 4EIWA 4G63A 1AHNA 3W2HA 1FMJA 2VBIA 3C8ZA 3K8ZA 3BE5A 2Q6VA 3JQAB 4TVBA 4PONA 4DBZA 1MO4A 2XYRA 4DF3A 3LPNA 1YRYE 5CU7A 5MF6A 2B9VA 2DOKA 3EG5A 4QUKA 1W36B 5CCEA 2PMDA 1J70A 1L4EA 2J4CA 2W71A 4ML3A 3DT6A 3QXSA 4LXTA 4C4XA 3S81A 1EDOA 1ZGBA 1KU0A 1OXVA 3DW1X 1U7ZA 1CR2A 5BVHA 5AI9A 3UGKA 2EKBA 3Q3HA 4LOJA 1QYWA 5F5XA 1UJCA 5FBVB 4YMIA 3DBHB 5AKIA 3L7YA 3P5BA 3UICA 1NRWA 3V55A 3A2KA 5HIJA 5KOHA 2RGYA 3DCJA 1U7PA 2P2SA 4HC4A 2YWXA 4Q7KA 3RARA 3ZZTA 2B0JA 4UU8A 1G18A 1PT6A 2E4VA 2UUOA 5KDDA 4BP1A 4DJTA 1T13A 2NXEA 3MMSA 3LS2A 4KNVA 4L4UA 2IP2A 4D1YA 2WU4A 4OQQA 1B1CA 2C95A 1ANKA 1E6CA 2Q6TA 5AJYA 4AZ3B 1NOKA 4IGKA 3T1VA 2LD4A 4ZZ2A 1HWYA 3L1HA 3MJSA 5JW6A 1Q14A 2E6KA 1GDDA 4MH0R 2CXOA 1AKYA 1MX1A 2OR3A 2V3WA 5CT5A 1UFOA 3A31A 3HB1A 4P2BA 4CG1A 3KQNA 1P62B 3ER8A 4WK4B 5HSGA 2AXQA 2WSIA 4O1MA 4URUR 2ZUDA 2AD1A 2PY6A 3CUWA 1FOEB 3G49A 4W1PA 1W52X 3G5TA 1LF5A 1MABB 5DHUA 2XSZD 3IKLA 2YQZA 1OXUA 2PN1A 3K73O 4JB3A 4L4SA 4LXUA 4P34A 4QUEA 5K2OA 3TRKA 1E9DA 5CXSA 1YE3A 1DAGA 5L3ZA 2FUNB 4XTCS 3H13A 3PDCA 4J0JA 1KRHA 3RTGA 2Q3BA 3I8OA 3AXTA 3U4DA 2WINI 5ILQA 2ZIVB 1P4RA 3SNHA 3LYLA 4U7TB 4PGAA 3MCAA 3LCRA 4KTTE 3C5HA 3HBLA 4LYGA 5CNKA 5CVVA 3OJFA 1U9JA 1R8QA 5A3VA 3R7WA 4BJ6A 3FOEC 1A5SB 4PCVA 1BS2A 1GCIA 3T3MB 3NPAA 1GHTA 2QJRA 4V3BA 1FYFA 1ISMA 2VSFA 4DJJA 2O2CA 5EMMA 3OZXA 2AIRA 1NTRA 4S35A 1HNXB 4RNDB 3WLEA 4C07A 2POCA 1NQWA 3TCXB 1ODJA 1ZXXA 3T7CA 1BSVA 3FG9A 1C29B 3PF9A 3ICCA 3LTNC 2B9EA 1ZEJA 3WJ1A 3IAEA 3KKZA 4QAQA 5BN3B 1IBKB 1X7DA 4LHVA 4O1HA 3SYKA 1N1EA 3EZYA 1YJQA 4Z2YA 1SUCA 4TL8A 4UXJA 4UNIA 3COZA 3WSTA 1MXFA 4J0CA 4QYSA 2H2WA 3N70A 1N6HA 4P22A 2G1JA 3ZBPA 1D2CA 1WPRA 3JAWB 3PQ2A 3GO4A 5FL7D 1HC7A 1HPLA 2WD7B 1DIGA 2FLVA 4OJNA 4AX4A 4RMJA 5ITSA 3P9RA 2SKDA 1XTZA 4TMZA 5J1TB 3WIEA 4LGYA 3CSUA 3UK1A 2B8JA 1R9NA 3NBXX 5FORA 1NOJA 3K9BA 4HAZA 4B3CA 1OLUB 3HHEA 4MVJI 1GCAA 2I2CA 2XE4A 5AJVB 3SXUB 4Q3DA 2QM8A 4MUIA 4KKXB 1V3VA 3IQHX 4AY4A 2GARA 4P7KA 3VH3A 3IXQA 5LSAA 3JATA 3F7NA 1HT1E 4KN5A 1XYGA 1LJLA 3G2NA 1IN7A 1UBMS 3R6TA 4NR0A 5C18A 4V1CI 3G8AA 2HWKA 3K9LA 2NZWA 3NTQA 1ZONA 2XWJI 5ECWA 2V7TA 4YRIA 1KPGA 2Q3LA 4NOJA 5IJWA 2ETVA 4DS3A 2AQIA 2GKGA 2UAGA 4MUFA 4OXKA 5ICCA 1RWVA 4CLXA 5EJFA 2VTKA 5EGSA 3AL0C 4AZ0B 1Q0RA 3D0KA 3KUCA 2YYYA 2ZE8A 3H05A 3Q15C 2ZTMA 2GD2A 2O06A 1JDNA 4G1BA 3VPAA 4C4OA 3SVTA 4OSOA 2W8BB 1L8AA 3KP1A 3LAWA 3ABRB 4CKBA 2BM9A 2VPQA 1TECE 4YXWD 1G21B 1XXHE 4GE3A 2Z2XA 1PR2A 1E7WA 1XZCA 1YT5A 2DWPA 2OY0A 2IW3A 1VYVA 2V3VA 4ZEXA 3QENA 1L5KA 2GILA 3ZDEA 3WK5A 4UULA 2LP4Y 4QDKA 3ZYZA 4GHWA 4D3ZA 1SXJA 2K87A 2JJ2D 4CDMA 5ALSA 1JFLA 1SXJC 3KOMA 5PGMA 4WY5A 2FX3A 1TJ5A 5TNXA 1CCWA 5EJ6A 1H9CA 2C4HA 1RRPA 4G0OA 4KLRA 3K6RA 3T06B 1A77A 4FJ1A 4LV5B 4EKYA 2GVDC 5KQGA 1JP7A 1EK2A 1LLCA 1CY4A 2OD2A 2YZMA 4HDSA 4HTFA 4DBVO 3SXJA 2ZJBA 5EMHA 2V3CC 2BZSA 1PJ2A 3Q11A 5KTRA 1IY1A 1Y9AA 3FMGA 3PJEA 2B1IA 2DVMA 2ZKLA 1DO8A 4GBMA 2C59A 1UAAA 1D8TA 3KS9A 2GZ2A 3P8ZA 4ISCA 1FU8A 4QELA 3NVAA 3LP5A 1AT1A 1JHXA 3DCYA 4F3YA 3M9LA 4OGWA 4BYGA 4G4JA 3OX4A 2XEXA 4KV7A 4XQEA 4ZT4A 1KH3A 3UWOA 5G1PA 2QUZA 2HLPA 3PXAA 2Q9UA 2VXYA 4RVCA 4YJHA 1Y3HA 2C9ZA 4CNBA 3V1KA 4OHFA 1MLDA 1PS9A 2WWGA 3BXFA 4JQYA 5CA1F 1G6OA 1J5PA 2E6UX 1T43A 2H1HA 2O8VA 2HCJB 4H4CA 3PXGA 1F0PA 4E7PA 3DCIA 2VPYA 1LTQA 3NRBA 3HKBA 4DV1B 1ZN7A 4UNNA 1HK7A 2AZMA 4Q9LA 3T7AA 3KKEA 3V8RA 2G9RA 4Y6PA 3FTDA 4XD7A 3AVVA 4GRAA 4BFZA 1T2CA 4Q3CA 3W78A 1YC2A 1VA4A 2A58A 3GWGA 4FSHA 3QMPA 4HBGA 2WB4A 1Q1QA 2FSHA 3FNQA 4F5WA 4FE7A 2L17A 1P7VA 4BVFA 1TEZA 3FJ1A 4NPAA 1X42A 1SUAA 4H7DA 1EG7A 2D2IA 2AOXA 4OHKA 5B1DA 4H27A 1J2UA 4BAZA 1UM9B 1SZJG 4XJTA 4L2IA 3X1XA 2FXIA 3GAAA 3A4NA 4B4WA 2X13A 1XNQB 1Q0QA 1RACA 4XYBA 5C7LO 1PX0A 3H5TA 6CHYA 3CX7A 3QA3E 3DULA 2I6XA 2Y4NA 4K6KA 2JH3A 4W8GA 5KB3A 2QX4A 4MV1A 2ZI3A 5H5JA 2ZG6A 3OVMA 4QBHA 4AU1A 3VR5A 2RK3A 5G1OA 5BYJA 3VHQA 2C8JA 1QE0A 1Q12A 1IVYA 1P9LA 2BGMA 3HCAA 5FBQB 1Z22A 2QMUA 4KMSA 5IC5A 5KVAA 2JLZA 2VPIA 1PHPA 4QTXA 4OAQA 3VOSA 1RT9A 3WX0A 2DQYA 1J6UA 1MC1A 3NHWA 4W5RA 3OKCA 1AKWA 1YFKA 1Q7CA 5CH5A 4DWOA 2ICAA 5D3MB 5FUYA 3SAJA 4FK8A 2C98A 4JJ8A 1OYOA 4LHYA 1RAAA 4XSGA 5CXXA 1LU9A 1XX6A 2DX7A 3BTSA 3F9RA 3NKVA 1K5DA 3PEWA 4UU1A 5C7OO 5TQ2B 1RKBA 1S96A 1G8GA 1O2DA 4UJ5A 1BA2A 4R2JA 2XKJE 3CZ5A 1L5YA 1C2TA 1KFCB 1XVUA 1BMFD 2ZFUA 1V47A 4JFRA 5T57A 3VC2A 2L2QA 4WN9A 4IMRA 5SYNA 1V9SA 2QHXA 3U3RA 5H16A 3T3PB 1VGRA 4LBWA 3N2EA 2G28A 1OAKA 3KZCA 1ACLA 2LBPA 3P2YA 4ARVA 4MW9A 1MO5A 5K9ZA 3AUXA 1E6LA 1L7AA 3NG1A 4UEWA 4WESB 5TF4A 1C30A 2CNWD 2D8AA 3A28A 3HSYA 2OXTA 2X2PA 1JEQA 1RKUA 2Q8PA 2W2KA 2WF5A 3OPYI 3FF4A 3WGKA 2QP4A 1Y8AA 3EZNA 4YV2A 5K8TA 4PINA 1VP9A 3VDNB 4L74A 1GN8A 3ZD6A 2WFLB 2R60A 4IFEA 3R7AA 3GT3A 2P9CA 2KSQA 3SQXA 2F1HA 1N33B 2WUDA 3QXGA 4ARIA 1Y3BE 2ODBA 2W2LD 2C4MA 1SMKA 4E2WA 1IL0A 3WRYA 5JCZA 4F5DA 1G2IA 1ONOA 1TIPA 3WRYC 4CHTA 4I50A 4TQ9A 3EAFA 4IHAA 2UUCB 2F4NA 2C8LA 3M82A 3S27A 3WIBA 1YUBA 3M33A 4AIIA 2JHGA 4NE9A 3QOFA 1R64A 1E4OA 2GERA 1VSBA 1X1DA 3WI7A 3G3EA 3E0QA 3FGOA 3LBNA 3AKDA 3MOGA 3N2GA 1PJQA 2IEGA 3L8FA 4Q1FA 1JKFA 1VE9A 2YYSA 1JFFB 1QFJA 4I8DA 4YC7A 5JECA 1F7UA 1J39A 4KQEA 3HV2A 3F7OA 1D0IA 3BRWA 2OCAA 4OB6A 5ESRA 2A59A 2WMDA 4LGCA 2C3OA 3BJMA 3JX9A 1P1KA 5AHWA 2PA0A 4L0CA 1KYWA 2Q1WA 4E1VA 2EERA 2K4MA 4LZZA 3ICEA 5ALWA 3NJ4A 2GN0A 4JLWA 2F3TA 3O8NA 3OCUA 2GWHA 3T7EA 4B6GA 4YGYA 4BX3A 5K8CA 1LA2A 1ZD3A 3OETA 4RK5A 3OQMA 3FD8A 1H42A 5B3KA 2P9HA 2W2NA 3ICPA 4JLSA 4FB4A 4F4CA 5KPDA 4CMCA 2AFIB 1O3YA 1UJNA 3TGPA 1U3VA 4MVJM 1JSXA 3CO0S 1R4MB 3BF7A 3ET5A 1NSYA 1S8OA 2ZRIA 4G8BA 4M1SA 2A7XA 2H1FA 4AJ2A 2XYGA 3GLIA 1CR6A 2RHDA 1NNSA 5I4IA 2OT3B 4GXQA 4H3KB 3EW9A 4HEJA 1KI6B 5L7YA 1JMKC 1C4WA 2JKVA 3OBBA 4TKMA 1GQYA 1UL1X 1Y81A 3LDHA 2IZ6A 2OVFA 3ODGA 4JQOA 1XRRA 3FTQA 5IABA 4GKKB 3UJ7A 2JJMA 3DOEA 3HM2A 4D99A 1V2GA 3IXMA 1C0KA 2I2DA 4IQFA 5DFAA 4C0SA 3AJDA 2FEAA 1X0VA 3OZVA 3WV4A 4J0HA 1FSZA 3NNDA 1ONNA 2O8FB 1UDAA 3BTVA 1YNSA 4FFWA 3TFOA 2XKAA 1J0XO 1GV1A 1KJZA 2QAJA 4A0FA 5ICSA 3BFXA 1TYBE 2W7TA 1W5EA 1NKVA 3LUHA 4CMIA 1YZFA 1MMFB 4FEYA 4RA9A 3QELA 5TMBA 4B4DA 1RXVA 4MWEA 1XNRB 1CIJA 3U7QB 3KM0A 5KTMA 3FPAA 1UJ4A 3THSA 3W6ZA 4K6HA 4J1SA 2IU4A 4IXNA 4D5GA 1PV1A 1RWMA 1QH9A 3H16A 2VF4X 2PXHA 3L0OA 3QXCA 1UKEA 4M4SA 2ZJ4A 1ACMA 1D8AA 1U1IA 1N0WA 1D6JA 2B82A 4UMVA 2V65A 3M5CA 4X66B 3IPXA 4OA8A 1M1YA 4G0WA 4MGIR 2VXCA 3TZLA 2D7JA 3OTQA 1I4OA 4DDKA 4NOLA 2NXJA 3CF4A 2B4QA 5HW0A 1ZKDA 1T6BY 3GCZA 1DCMA 3MPOA 1TEVA 4AAYA 3UCFA 1CULC 5D3QA 1G5QA 3ASZA 2EJBA 3STYA 3EXEB 1PSDA 1B23P 4I99A 3M5DA 1MJGA 1P9OA 1XVVA 2D3WA 5HF6A 3B3JA 1Z82A 3A6HA 4E0BA 5IULC 4QDOA 3S70A 3G2KA 1QPBA 6ABPA 4EUNA 5I4KA 3QPBA 1RKVA 4XR4A 3N2IA 4FDMA 2DKNA 4ENVA 3ZJ5A 4B3SB 3GH1A 3ZEAA 3SMVA 3IXLA 1WZ2A 2YWCA 1VKZA 4EG3A 5TQVA 3A36A 2KLHA 1QPZA 2VWPA 1I2MA 1Z63A 3IUEA 5EMLA 1M2GA 3KYDA 4C01A 3G0HA 1TJPB 1USKA 3PQ4A 4L73A 3VISA 2YFYA 4R01A 3AWDA 3TLGB 2Z6AA 1R0CA 2P41A 3EH1A 4FINA 4C7OA 5AOAA 2LCIA 2WVJA 3AF5A 3G0IA 3H75A 4FHZA 1Z26A 4ZAGA 4GR5A 3S1AA 2C7QA 3L8GA 3ZQ4A 3OQPA 2ONYA 3CEMA 4YJ2F 3FUVA 1U2RA 4Y2JA 5AM2A 2CKDA 4YN3A 5EHZA 1BU5A 3LBIA 3PGMA 1P4AA 4CCSA 3T7TA 3LL4A 1DARA 3PRHA 3TCKA 5DM70 1S8FA 3ABZA 1QGDA 4LRUA 3ZNPA 2PLFA 4EM6A 1NMZA 1QX3A 3UPDA 1ISSA 1KVUA 3OD1A 1E1CA 4L16A 5DIZA 3PQDA 3PA6A 1EESA 1MX3A 5L95A 5BYBA 1FSSA 2GF9A 3OLVA 4EX6A 2DQ4A 3ZWBA 1E1RD 3TRJA 2IF0A 2X5JO 3HCOA 1KZGB 5FWXB 4RA6B 1D2RA 3MZ0A 3R5HA 4GEGA 3EXFB 2A8YA 3MCTA 3OTOB 5LU8A 2RI1A 4QSMA 2WILA 1E7RA 1M6WA 1HH4A 1EUCB 4CKCA 4IJVA 4HNVA 3DS8A 3BCUA 4JVLA 3I64A 2D62A 3CSDA 3QVXA 4Y3UA 5FWYA 4TKVA 3A3KA 5BV0A 4IJKA 5C7YA 2CKMA 1PBNA 4XM0A 5LZ2A 2IQ5A 3X1ZA 3CVJA 1NW4A 2X9GA 4KR9A 3AI2A 3C7DB 3G89A 4O4HF 1K6IA 3K8OE 1CEQA 1OPXA 4PR3A 2P5UA 2D1YA 3DO5A 2FW1A 5TQJA 1L5GB 4OHMA 9LDBA 2C5SA 4E03A 2D5BA 1AZWA 4BKOA 2DMRA 2OLEA 4CM6A 4JV5B 3INNA 2HFKA 4CYMA 1N8NA 4ZVOA 1DWQA 2AQHA 4Y6OA 2WMYA 1Z2OX 1TOAA 4HQNA 3DA8A 1H3EA 2HMYB 3I2JA 3KB2A 3RE1A 3FNFA 3RUEA 1AKQA 5LDHA 6ADHA 4HNTA 1LEHA 3M6UA 3PD1A 4PR0A 5KBYA 1N2XA 1KNXA 1O6ZA 1UBGA 1UXGA 3TN7A 2Z8YA 3ZZNA 2Z3WA 1E3JA 2ERYA 2NU6B 4OM8A 4RGQA 4IHJA 1RD4A 2XGMA 4JBGA 1AJEA 3MB5A 2JGJA 3L05A 4GQBA 4I9HA 4CTNA 1F9EA 1ZS9A 4JI6B 3K0AA 1A9QA 4R2XA 1V4BA 2FMUA 3TRIA 4X20B 4CDGA 4KBGA 4EG4A 2MT9A 4CDRA 1CQXA 4WKOA 5D7BA 1NPYA 3MPUA 4DQLA 2ZM5A 3FFAA 3EUFA 4K9DA 1Y8QA 3I39X 4OP2A 2OQVA 4DANA 5C51B 4QNNA 1FDVA 4G4GA 2W5UA 1JIVA 5DBEX 3HY6A 1AGPA 2X23A 4WUTA 1N2JA 2CJFA 1YF3A 3RT7A 1EFDN 3BK1A 4L72A 5ALFA 2YJGA 3ZHUA 3HBNA 4HNSA 2UUAB 3IKMB 3LW7A 3TJMA 4ND4A 1RYNA 3VU1A 1F12A 2V6MA 1WQ1R 3JXEA 3V33A 4AT1A 3AIIA 2FG5A 3A4TA 2CVOA 4HX9A 4I4TF 3IV7A 1ULSA 4ER7A 5A7FA 2PX4A 3FOWA 3OFSA 1MV8A 1Y98A 1ZJ4A 3DTVD 4UM8B 3NCHA 4NAHA 3T1OA 4PFQA 2V0GA 5BSRA 2IWRA 4HYYA 5KNDH 2BDEA 4PZLA 1F0NA 2HU2A 1BHO1 3BD7A 4DR1B 3LUCA 2VIIA 4DREA 1JILA 3QW2A 4YECA 3TXAA 1BZYA 1Q7TA 3TNFA 5LB2A 4BRWA 4C6HA 4KQHA 6REQA 2BGNA 2YV4A 2H16A 1WQ3A 3C3PA 2BBOA 4Z9FA 3RQSA 4ZMSA 4Z9XA 4CKYA 2VJMA 5JNVA 2FVYA 1EZ1A 2BTOA 4L5CA 5G0UA 4H7FA 1SVNA 4O2AB 1UBUS 4AQDA 3OEED 3RYCA 1PGJA 2WABA 5DX8A 5C4GB 5CXUA 1TJ3A 2BONA 2VQSA 2XOXA 1PDOA 4FLEA 4KWTA 4X41A 3VX4A 3FVWA 4KK4A 4YI3A 521PA 3G85A 3TAUA 5J23A 1NJ6A 1F3LA 4Z51A 5GONA 2Z98A 3OT1A 5CFLA 1TZCA 5C4IA 3U0BA 4AJEA 2PPLA 1Z6YA 3MBOA 6AT1A 3RFFA 3BSFA 4CL3A 3AIMA 3WGGA 3IODA 2B5WA 3V5NA 1T5TA 4Q5IA 3DV2A 4RFSB 1X9GA 4QHYA 3GLGA 2OE2A 2ATIA 2R2GA 1KMNA 1ND5A 4L3OA 4TWRA 4F11A 3H1TA 4BWVA 1NE2A 2A5FA 3SC4A 1XI2A 1YOVB 2ZRMA 3IESA 5ALIA 1YL7A 2ILVA 4Y7CA 4R51A 3K0EA 1KI3A 5KOYA 1US8B 2PWZA 4MPDA 4BZWA 4M1QA 2XHEA 1P33A 2EIHA 4TSFD 2BFOA 3BG5A 3HPQA 1MIOA 5EKSA 2AMLA 4E09A 5EJ9A 3EDMA 5JI3E 3DDUA 1K75A 1A9XA 2AOTB 3NANA 3IEMA 3LK6A 1ULAA 3RI3A 3SJZA 5AVWA 1Y42X 1JU3A 4D6YA 3S2SA 1SU4A 2NT4A 1OBHA 2QN3A 3FPCA 4PN7A 4HADA 4LPKA 3A6JA 2BUAA 1QDUA 4NBUA 4WZ6A 3ZZ0A 4AWXA 3ND9A 1FVOA 4GT1A 1CQZA 1LLQA 4P7GA 3GU3A 2VYND 3ZHQA 3EGDB 1FLVA 2GAJA 1XG5A 2ZAYA 4WHMA 1DOZA 1WZNA 4F97A 1K27A 3HYTA 3PNVA 4YUAA 4LYEA 1NN3A 1EA5A 1RWPA 2VDWA 3IEIA 3Q7EA 5LYJF 2XW6A 5DTJA 3T5TA 3ELBA 3CPJB 4I5IA 2EW2A 5MN5A 5K3DA 2F3UA 5AKEA 1JQLB 3BWMA 1W88B 3V4FA 2CLOB 3SEZA 2XUGA 2B8NA 4NFSA 3TOCA 5K3SA 5KYYB 2VDRB 3SY8A 3UC9A 4AYWA 1XCLA 1DEAA 2UVPA 4HDAA 4MQBA 3VTKA 4WN3A 3AR2A 4ZWNA 4HX2A 1POWA 2B36A 3HYCA 2E4ZA 4BDTA 2LZ0A 1UADA 3IP3A 1QVWA 2XVAA 3BKXA 4HBZA 4H7IA 3ZH9B 2BGIA 4OGFA 1U28A 1JDBC 3R5TA 4BNMA 2XUOA 1U28C 3LPDA 4N7MA 4G5QA 5FNVF 5K0SA 4M9SA 4MPPA 4BV8A 5K51A 3O92A 4K1XA 3GDFA 3FBGA 3G02A 3LYUA 4K40A 4R1LA 5CDUA 4MJ7A 2OM6A 1Z07A 4YRKA 4D4HA 4WZAA 5IM4F 1JRLA 4BWGA 3WLKX 3N1UA 3OLCX 1DSSG 2F43B 2K7ZA 4Y9RA 5ITWA 4TTQA 1EHCA 4AJPA 1VCNA 1DP4A 3I4LA 4K6MA 2GM4A 4CMGA 4P0QB 2XUIA 1ADGA 4OBEA 2CN1A 1KEEA 1IWOA 1KPHA 3OE5A 4DJEC 1P81A 2FMKA 2FPLA 4TVOA 3BE8A 1ECFA 3EH2A 4CG3A 2VDMB 1T9GR 2CMGA 3PC7A 4JELA 3PWSA 1F8YA 2V7WA 4MVXA 4BEBA 4J90A 4EB8A 4Y2TA 1EE9A 3P5SA 4N5HX 2P9FA 2VSOA 1VMKA 4CG2A 3HEMA 4S2UA 4RENA 4I5EA 1IXKA 1E5DA 2NZVG 1F2VA 3RS9A 2QJFA 1A5BB 2FOXA 4E2FA 4IWXA 3BSYA 2X4GA 4QREA 4Q4DA 3BMCB 4YALA 4Q3AA 2DXIA 4RKEA 2PWPA 4I3FA 4BXOB 1YCFA 3QSGA 1FMTA 3WTBA 1JR6A 1T2FA 1HDIA 3GCGA 1YXMA 2Q8NA 4PYNA 3AI1A 3DXYA 1WUHS 2G71A 4HWRA 3LCJA 3F8SA 3G8YA 3VKUA 1UWCA 2G0TA 1UJ5A 2WHXA 4OGKA 3QNMA 4OXRA 3ZW9A 4ER5A 4POOA 5GZ3A 1QP4A 1GGEA 4X1KB 1NNI1 1UWKA 1I5OA 2OXCA 2PIAA 2V4MA 1RQ7A 1YB7A 2I03A 3RB8A 3QE4A 4F4FA 3ECSA 1NY6A 2I62A 1H8ED 3LTEA 2DF8A 1WHSA 1TK2A 3LSYA 1XGKA 1GRNA 2XY4A 3MRSA 4ZOLA 2BMJA 3R8CA 4XWWA 1RHMA 1UPXA 4JT8A 3TQFA 1IWBB 2V8BA 3D6VA 2DWQA 3UXMA 3LQ2A 1V5EA 4GDMA 2AE2A 4XEHA 5C9ZA 2L19A 5F33A 3DDCA 3L93A 4ND7A 3T1TA 4DV0B 5ADUS 3H9CA 5JNLA 1A7AA 3D7NA 4LQDA 3AVYA 2QSJA 1VJRA 1J90A 3D2BA 2ODQA 1QBKC 3KPYA 3PPIA 1VJTA 4UUPA 2G9NA 3SKYA 2H59A 3C3JA 4KPGA 2FTKE 5JO0A 1TCBA 5I7HA 1ESDA 1OC4A 2RH5A 4R0MA 3U09A 2VQFB 1YUMA 1VPLA 3IPYA 1EDEA 3KAJA 4X20A 1H0RA 3DZGA 5AW1A 3KVVA 3EDQA 2O8CA 5JAPA 3E2PA 3NHAA 5B55A 1ZK4A 2EATA 3AV0B 2XCOA 2GFIA 4RMGA 4MV8A 2QORA 4OQFA 5ARBA 3NAMA 1W6UA 1PZHA 2I3AA 4OMUA 3ZU2A 4A2PA 4DRYA 5B3LA 2HCRA 2AOUB 5C31A 3C6XA 4PYQA 4F4IA 1COWA 4LX0A 4QE3A 5F3DA 4YRBA 1R6XA 3IRVA 1N4DA 4D6XA 3L46A 1LVHA 5HIKA 1EDDA 1NVVR 5IH3A 1JBKA 2JPDA 3O1IC 4QLAA 2JANA 5IAGA 1KQ3A 1WV1A 3A05A 3VNAA 3FKQA 2HUNA 2BI7A 2BI8A 1YC5A 1XTRA 1TTHA 4WCVA 2BV3A 5KVQA 1KBOA 1BFUA 3WLLA 3DKRA 4OYHA 3KTFA 4FWIB 2IJGX 2MMCA 3Q41A 4RQUA 4UU0A 4W5JA 4DY4A 1A4UA 3HSKA 3MJEA 5IN5A 1QYDA 4TXHA 4BIMA 4G6ZA 1DG1G 1TO2E 4LHEA 5LBUA 5CEFA 2J6CA 2QGZA 3CPEA 4W6QA 5IH7A 4H1WA 4B6JA 5KSZA 1C0IA 4MLPA 1JAHA 2PFGA 4QLOA 1KMHB 2J46A 1U0LA 3JYHA 5FDFA 1FJGB 2VT3A 4EEKA 2REQA 2YINC 3L43A 2C77A 4DA9A 5A3JA 2A35A 1ZNYA 4MO2A 4RFVA 3GZ4A 1BVYF 4MW1A 2OZPA 1GILA 4R3UC 2P4QA 5C8YA 4JI4B 3OA2A 3MTAA 2G80A 5T6BA 1W34A 2ZYUX 4NBVA 1T0PA 2C1EA 3N7TA 4PICA 4HYQA 1UCFA 3SQMA 5ALTA 2QAIA 4U5XA 3TLCA 2QRZA 2XUAA 1JNYA 5LMCA 2HRZA 3TBHA 1AHHA 3TS1A 1K8RA 5FLXA 1TUEA 2X0EA 1JUDA 1RSZA 1NDHA 1PJRA 4M7OA 1XZBA 3H5VA 3MJDA 4RIEA 4RYLA 3RFVA 3EXIA 4BLRA 4DB2A 4LYDA 4H3HB 4N47A 2BHSA 5BT9A 4N9QA 1VG1A 4XSVA 3SHQA 2JD2A 1LZKA 4HZGA 3ANSA 2GK4A 2X5NA 4IYRA 1ZUHA 1LPPA 3UXYA 2QN9A 5K3FB 2ZYHA 2FEKA 4ZODA 2RGNA 3D02A 1KK1A 1RXYA 1XAHA 3EFEA 2RGNC 1ZK2A 4BFWA 4Q93A 1S7GA 4R2MA 4O0MA 1NN0A 1UFRA 5DGIA 2Q21A 4RTRA 4TLEA 4IQ0A 3QVVA 2O7VA 4I1SA 2BEKA 3J81k 3H97A 3DE0X 2PYDA 4XCVA 1K7YA 2ZEJA 2Z5FA 2RHLA 5CPFA 1DBWA 4WA8A 2UVQA 5ETJA 4MUJA 5F2NA 5L8VA 2XODA 2V1XA 1SNYA 3TMYA 5BSEA 5L6MB 1R37A 4KJZA 1XTKA 5ITZA 1TYAE 1BWPA 3OKPA 4LF5B 1WDMA 2JFNA 3I6QA 1MH9A 1YS4A 3PXCX 3LA8A 1Y9ZA 3I01A 5DTQA 1DHRA 4XDHA 5DYWA 1JR2A 2VI5A 4FE4A 1NAIA 3DBOB 2FRVA 5ENVA 1Q3KA 1Z6QA 1YA4A 4DMGA 1H0KA 1U3FA 2XMQA 1R3UA 3MQ2A 4NFYA 4A6XA 5EXEA 4L7QA 3EX7C 4RVOA 1X8KA 2FMIA 3AHCA 4BECA 1P7YA 1U90A 4QDJA 3R7FA 4YAUA 1C1DA 2P6PA 1AK1A 2PBFA 2CBZA 3OZEA 4IDOA 3SS8A 4KYTA 4AM8A 4JIMA 4EJ0A 1FW6A 3WHIA 4QA9A 2G72A 4ZVKA 1CB0A 3DKKA 5FPYA 5EJIA 4BFYA 2HQOA 3G2MA 1AUVA 4RFLA 2DQSA 1X2EA 4NYJR 3MLEA 3X2EA 1CZKA 3LC7O 2LXNA 3W3AD 2BF7A 5CDSA 3TINA 1CPYA 3GX1A 2D1QA 2Q2WA 3A1DA 2NUPB 3IVGA 3NTVA 2AT1A 3AONB 4UTVA 3UJBA 4OYLA 1N5KA 1PF7E 1JSRA 2VSQA 3PLNA 3UK2A 1RW4A 1WP4A 1Z74A 2A5LA 2F6RA 3JQRA 4YRTA 5CA0A 2VNIA 5IPFA 3DGEC 1Z15A 2OBMA 1DUIA 3HFRA 3NHLA 1LPSA 1L7RA 2VYQA 2WU0A 3AH8A 4G8CA 3A6KA 1VL1A 4IS2A 1SHUX 1FDIA 2Y0PA 5SV2A 1Z2NX 2WAYA 3RUPA 3TM4A 4B8WA 5BMVB 3FTFA 4PC2A 3NBQA 4O4LF 2VS1A 2XGOA 2PEYA 3G1WA 3WA6A 2QT0A 3H84A 4MR7B 4UPVA 5JAMA 2QW0X 4GLBA 2XA2A 4LCBA 3ZVNA 5JS2A 4L5AA 5BSFA 1EM8B 4UBNA 2RK4A 4P3PA 3H99A 2Y05A 4OAPA 1BGWA 3LOPA 1VZ2A 4RQTA 3F74A 2G40A 3ONEA 1P2UA 4AXBA 5KYWB 3CR3C 3IP6A 3F5FA 4XYGA 3DEKA 1QF9A 1Y8RA 3GUCA 3ZX5A 1JE0A 1XD9A 3ITKA 2GJ4A 4FHCA 4OQMA 4CWAA 2PXAA 5DJ5A 3BMOB 4YACA 4LJSA 1VG0B 3RBAA 2A9VA 4QUHA 3CX6A 3S4YA 2B4KA 2ZCJA 1ZLYA 4JEHA 2QD2A 3DBIA 4NZZA 4U4AA 3CPHA 3DLTA 1CE8B 3RYFA 2L18A 4JJFA 1Z4PX 3DFMA 2PXCA 3PXEA 5E7MA 1L7BA 2V74B 1TCUA 2V6FA 2W9XA 5DX1A 5CA1A 5IZ4A 4QQNA 3WAJA 1E0JA 1YCGA 2DHQA 2G9UA 3ERCA 3RF7A 1XQYA 1EI9A 4FYIA 1Z83A 2H07A 3AEQA 3OURA 3V7UA 1I9CA 2DC1A 1NULA 1YACA 3P9KA 3QLJA 4YYZA 3PD0A 4MROA 2AD5A 3HU1A 3CVWA 5EWLB 5ALYA 3FPKA 2JJ1A 2ZB8A 1XDUA 4F06A 5E2IA 1C7JA 2WZQA 3DTYA 1DJQA 1Q0SA 3FW1A 2EZ4A 3I32A 4POAA 1BE1A 1E1QA 4WEOA 2GLXA 3BVPA 3AEXA 2P90A 3H18A 4GGMX 4KXMA 3T95A 4D3XA 2P9EA 4EY8A 1EVIA 3D8TA 4C5CA 2P2ZA 3LKBA 4Z4QA 4YMLA 2C5GA 4P3YA 4EGJA 2OKGA 4V0SA 2ZK7A 3R40A 2HMWA 3B1YA 3JASA 4BC0A 2FDXA 3OH8A 3NH6A 1X7HA 2GXQA 5AJUA 1MJGM 3ZWQA 4ZYTA 1QK5A 1WHTB 4OJKA 1H1LA 3N2YA 1IBLB 2OILA 2XYVA 3QKIA 5EJ8A 5FAKA 4RF4A 3R3HA 3ZWAA 4B2PA 5HZHA 1NLUA 4C1NA 1PYOA 3L0CA 1WMAA 1EQAA 3H8WA 4E5DA 4RBNA 3WLHA 4AMGA 2FE4A 2ZTLA 1FFBA 3WOHA 3FWPA 4HLDA 1L5LA 4BO4A 3ESXA 2FMHA 4Q4AB 3PDUA 3FLBA 3DT9A 1KYTA 1D07A 3ZE1B 5I9NA 2ZRBA 2BL4A 1ZAYA 4LXIA 3BIFA 4OQDA 2EW1A 4QECA 2Q8QA 3HI4A 5A4MS 4JGIA 1KQNA 3KJEA 4FOOA 4N9WA 5HJ2A 5T3UA 3H11A 1NNUA 3IVMA 3W3ZB 3A1CA 3OTIA 4E1BA 3U4AA 2Z56A 2XB8A 2RHCA 2Z9CA 3EOZA 3LLCA 3PT9A 4M8NE 4NPHA 5M29A 2AZDA 3OFJA 2E7ZA 1FW8A 1V16A 3SI7A 1PKXA 3JARB 1LTHR 2HB6A 2VUUA 1VL2A 5IKEA 2O20A 3WBJA 5K03A 1S2DA 1YKGA 2OVBA 1JHPA 2I1LA 5DI3B 4GLOA 3AR6A 1PNOA 3AF0A 2QYTA 2GN9A 3EMBA 3T0GA 5I3ZA 1EGVB 4N8DA 4ZQGA 3SE7A 1O94D 1GG9A 5GY7A 4E07A 1DKUA 4KAAA 2QRHA 1NYLA 5TY0A 1Q16A 3OPXA 4KE9A 3AY0A 1M54A 2GPAA 4UHFA 1PQWA 3EG9A 4V03A 3ANLA 4N40A 1DKNA 3TFQA 3H6KA 5IBRA 1PQYA 2D7CA 3RS7A 5B5SA 5IJZA 2BMDA 3EXG1 2NUTB 3RKSA 2ZWVA 4F56A 4CZ2A 5JXHA 1UAGA 1QRRA 4A4DA 4DDTA 3C3AA 1QKIA 4M1MA 1H6BA 3LCUA 4EY5A 2KHZA 5HJ5A 3LWDA 4AMUA 1AVTA 1QXSA 1U04A 4E70A 1KJ9A 2OKCA 1T3ZA 4QNRA 4L6CA 4UXHA 4KKVA 1EAYA 3LPMA 3RTAA 3OQNA 3RVLA 1E6EA 5JSZA 4Q9NA 3RLIA 2EWWA 3S5UA 2ORYA 3TWOA 3VVLA 4HT3B 2RKBA 4O6VA 2RONA 5KWIA 3SYLA 1JI3A 1KFEB 4MVWA 3K9CA 1S9DA 4GRDA 2HU8A 2XTJA 3Q3CA 4EFKA 1NFQA 3ZBUA 1M8GA 4D74A 1GGJA 1HE1C 2M1XA 2ZRGA 3I58A 5BNWA 4Q6WA 2FEWB 1EE2A 1RPTA 1CEEA 1T3GA 4RH1A 3OZSA 3O0DA 2VQDA 5DULA 1HF3A 3WE7A 3QPDA 1TVMA 3CGWA 4B6RA 3BMQB 2NVBA 3E7FA 3BA6A 1HTWA 4H1UA 2XQIA 4RHFA 4K03A 4WXEA 4EL0A 1A2KC 5FJJA 2HOQA 1QH8A 2Z8YM 1JFSA 1N36B 2YRWA 2UYHA 3W9BA 1R6DA 3EJ6A 5LB4A 1LPMA 4JLAA 3B8HA 2A92A 1NUQA 2BKVA 2NO7A 4E5YA 1JEYB 1PQUA 4UQPA 1AB6A 3JD4A 3V3KA 3W79A 3E18A 2BFEA 4W5TA 2JGEA 2FDRA 3A0RB 1XHLA 1P72A 3FMIA 3L0YA 5HQ3A 4ZCQA 1JAIA 1QO9A 1T26A 4NMWA 3RUHA 1G8AA 1Z5OA 1ZK0A 4OJMX 3V9AA 1P9RA 2RG7A 2P7IA 2WSYB 4NWIA 1MEOA 4G26A 4DV5B 2YV1A 1PRYA 1H22A 1SOWA 2R8EA 4EEZA 3I3OA 1S02A 2M6RA 4OFBA 3TR6A 5HMLA 3KXPA 4Y9SA 4BO6A 1G5RA 2JVKA 2DRIA 4RZXA 1NFRA 4WA7A 4CMJA 5ICMA 3GCDA 4YP0A 1YR9A 3M1LA 5DW0A 3ZLBA 3X1WA 3TZKA 4UCXA 1G41A 4X8LA 1A8HA 2AOWA 2GHQA 1P60A 4X7PA 4HR7A 1VLLA 3ETLA 4X6UA 2EARA 4P4SB 5BSMA 3KQUA 1PR5A 2KWIA 5FHRA 1VKRA 2G06A 2XBUA 2A0KA 2FNAA 3D6UA 4ND8B 2ISSD 4RACA 3QF4B 1CUHA 1B42A 1SKAA 2QJWA 4YJ3B 5L3QB 1P6QA 1QLJA 1TM5E 2AN3A 2G5TA 2RHMA 3PNSA 3ZI4A 2V03A 3UJ9A 4ZICA 5L45A 2XUHA 4Z4GA 1WSDA 2IYQA 3P27A 3AKEA 4FFNA 1P6XA 2JATA 3QOYA 1KFBB 4NYIQ 1OH5A 3WIOA 2JH9A 3E82A 1ISFA 3GA5A 1U0FA 4DIFA 5BV7A 2Z9DA 1AMNA 4DWWA 1K06A 4WZBA 5EC8A 2O0JA 3TECE 2PUVA 2OAGA 1U1DA 2LVBA 3V7YA 2XMRA 2W6PA 4B0PA 3G2IA 2GK7A 1QHXA 1YAHA 3I2IA 4MQFB 4C03A 3PHJA 2GFQA 5JYCA 1ISIA 3MMZA 3UUEA 2WHEA 2P6NA 2JLSA 1U5CA 2HMVA 3AJAA 2Y1FA 2FW7A 1ORRA 3MSCA 1D4AA 4WNAA 2EJWA 5FBZA 3EVBA 3N2NA 4IZ6A 3HVUA 1L5VA 4J16A 1WXEA 4MEJA 4IDNA 3ENKA 1OA0A 4J16C 4AJIA 4UOEA 3ZWWA 4Q16A 4HATA 2W2MA 3OPNA 3IJ5A 2YY5A 2QQEA 4HXGA 5AHOA 3FYHA 1XTUA 1T5HX 3F98A 2FP4A 2X7JA 4CTMA 5DGXA 4XX0B 5B4VA 5DVZA 1EK6A 1DHTA 1TF7A 2HCTA 3CNEA 2X3YA 1WTAA 1RIFA 2YJ3A 4PLYA 4OXXA 1Y5NA 1Z5GA 1A76A 4BB0A 1DT3A 3G1TA 2O14A 3AEUB 4EFNA 1E9RA 3O7WA 4MQ5A 4DN6A 4NHOA 3GOQA 2QLNA 3LX6A 4MKRA 1MA3A 1PR4A 2M1ZA 2RKWA 5LLTA 3V4LA 4IM7A 3CGGA 1XWWA 4Q1EA 3FIJA 1W4ZA 2ZXEA 4H3VA 3PNYA 1I3KA 1SG6A 1Z73A 2ZYVX 2ZIZA 2J9ZB 3ZVRA 2D00A 2ZRLA 4CCYB 4C4TA 3HUUA 1IJEA 3PC2A 2JKYA 1E2DA 3HP4A 4TYQA 3WKCA 1N92A 2OQRA 4LZAA 2JKZA 5CW1A 5K3OA 5BO5A 3TFWA 4YJ2A 1L7QA 5EWMA 1ESCA 2GAFA 2IUYA 2P11A 1HA3A 3GGPA 4OHYA 4E1AA 5IHXA 5IKMA 1KZYC 1AQNA 4TVKA 1X19A 5KHAA 4RZQA 1RLOA 3RV4A 3V8NA 4PYMA 4UKDA 2INGX 2VHJA 3OFNA 3RVMA 1VGQA 2WTMA 3HU2A 1WMEA 5C1PA 2YIMA 3NHFA 5DLYA 2I7TA 2PSJA 3K70B 2HA7A 1ENOA 2PQMA 3JQQA 4FMCF 5L9AA 2UUPA 4Q7MB 3OIVA 2PV7A 4ETIA 1D4ZA 1YUNA 1HQCA 2QOEA 3UCXA 3IOCA 4URYR 2WR8A 4CF5A 4JXKA 4OTZA 3AI7A 4ZKEA 1CUXA 2L82A 1Z2PX 1NIPA 4MV0A 2JG3A 2AG5A 2AX4A 4L1KA 1N6NA 3IS3A 3H17A 1XALA 3H8VA 5F2EA 1Z4LA 4DA4A 2AZTA 3A1SA 4FI3F 1WPXA 1NVWQ 3C3KA 4UD6A 5K3AA 1OH6A 4UEOA 5BSVA 2WF7A 2C9DA 1MX9A 4OYYA 4PWZA 3B2EA 2W4MA 1JMYA 2GYVA 2PT6A 4GYKA 4H7HA 5G4KA 4ZQCB 2HC9A 1G59A 4QBIA 1RPNA 3AF3A 3K2BA 3MHPA 5EE5B 4D45A 5DE3A 4O4HA 5KWEA 4KYUA 1DU4A 2CCKA 2PGIA 1HDOA 3LIIA 1E2QA 3PUVA 4CUJA 5ES4B 3U4QA 2ZTHA 1UMKA 4JLKA 1J7JA 2JGMA 2WNHA 1CRWG 3N3BC 3V4PB 1R27A 2O3JA 3GFRA 3FOFC 2H5IA 4MTCA 2TMKA 1COZA 1CYEA 5A6SB 2Q6IA 4C05A 2C4VA 3C4JA 3WK6A 5HKBA 1LLDA 4OQ4A 3FPSA 5E7QA 3TPCA 1RLUA 3A4YA 3CINA 3I0NA 1G7RA 3IAM6 1KE2A 1SKQA 3L41A 4JWTA 4Z7NB 1YGPA 3LM8A 1TQHA 3SJCA 4ZJUA 2SICE 1R16A 1F60A 1XJ5A 5DRTA 3HN2A 2ABWA 5KVVA 1EBFA 2CCJA 1JIQA 5TPZD 3SEAA 3GNQA 3QYPA 5DXFA 3E1KA 3HGQA 4RHEA 2SNIE 2VPTA 3TB6A 5LQNA 4HSGA 4Q9AA 1Z6TA 1XDZA 1KYYA 4KQXA 1RI1A 3SDSA 2CXTA 3C5CA 4Z6KA 1YE5A 1M6VA 1DTEA 4RLQA 1NPDA 2LGJA 2X0IA 2MINB 4JGBA 1Z0DA 4MS4A 3WLTA 1CVLA 3ZXYA 1SGWA 4ZTUB 1GU1A 1MDBA 2HDOA 1YIDA 4WLNA 5EIWA 4K9QA 2IHBA 3OT5A 4FGSA 3AP2A 3VPCA 4EUEA 3QY0A 2CY0A 3WK8A 4Y6QA 1PI3A 2A3NA 4HAOA 4OREX 1CUYA 4RVUA 5F1OA 1EUDA 3K9WA 2AR0A 1VECA 3NBKA 1N9KA 1S2LA 4IP0A 4PZUA 2R97A 2XT0A 3DQQA 4PIPA 3UT5A 1YJ5A 4ABTA 1E3MA 2OBBA 4PNHA 2RJNA 4E51A 4I4TA 4KQ1A 1H94A 3VVMA 4X92A 3UXHA 5LD2C 1L6RA 4DKJA 3AFOA 3ENWA 1EUQA 4IJWA 2ZM6B 1JWLA 4C43A 3EVCA 2OOKA 1CUBA 2IPLA 1VI2A 3GJ3A 5I9LA 3OU7A 2HPZA 2IV3A 1I3OA 4QWWA 3DDOA 3MINA 3UG7A 2PGJA 5JU6A 1FRQA 5JVDB 2ARKA 4Y30A 3TW8B 2CWDA 2XMGA 2B8WA 2JK0A 2WWXA 1QIDA 3HA5A 1ULHA 4WASA 4GGPA 5ITVA 4N7RA 1JDUA 1Z4JA 4B2LA 2BELA 1T1GA 1GUAA 2DY0A 2WG2A 2O2XA 3SR3A 5E0KB 2GVNA 4QEDA 5CM2Z 2A94A 3TPFA 1EXVA 5AOBA 5K0LA 3BORA 3QWHA 3HSSA 2CWWA 2ZZKA 4KXYA 4NVRA 3HQ4O 3U3JA 1QIHA 1PBTA 1V43A 2FPIA 2PL3A 2GLTA 3TOZA 3WLPA 1Z8DA 3GFOA 4ZJPA 4HH0A 1JJFA 4HPJB 4JDPA 3T1HB 3AVWA 3U3DA 1GTJ1 2GYYA 4MQEB 3FOBA 4M98A 4Q03A 3EHEA 4LMBA 4X93A 5HCNA 1ZOLA 1O8CA 3BTUA 5F51A 3SSMA 4YCAA 1XT6A 5JSKA 5BSHA 4JYMA 1TM4E 1HMPA 3UT6A 2V6GA 5BOVA 5FTWA 3F4BA 1G5IA 5G1NA 4Z4HA 3SXPA 1XTTA 3U7GA 3NGLA 2P65A 3UK6A 4K9OA 3ZOZA 4ZYVA 1JXOA 3EXHB 1VHTA 1DXOA 5BW5A 4BAUA 1XKQA 1UUFA 1VG8A 4MRMA 3F6EX 4JBHA 3C8UA 5AKKA 2HK6A 1LK0A 5G3ZA 4AJOA 5A2QA 5JJ5A 4XUDA 5KVCA 4UE2A 4QOGA 3L1IA 1W1IA 4ASUD 4ZO4A 2WUEA 1Z12A 8ABPA 1UEIA 1QE5A 3PQFA 5DLDA 1QWSA 3D3WB 4DJFC 3SC2A 2BFFA 3FBTA 3DLBA 3ZHTA 4IVRA 2WFZA 3IUQA 3OMXA 1U1GA 1YDFA 5KYUA 4ATNA 1U8XX 1Z29A 2PT5A 4CCWA 1C7RA 2GSDA 4WECA 3DQPA 4KPEC 1HE2A 1ZM7A 2Q3DA 2WHQA 4MWZA 1LW7A 5DH9A 1NVGA 1GUFA 3WQSB 3B36A 1OFUX 5EEGA 2H4ZA 5LYJA 5JZ9A 5JAHA 4MNTA 2B1GA 4QDUA 3ZJTA 2HRCA 1YSCA 5KHOC 3HY4A 1RRGA 3OA0A 4ZCLA 2TYSB 1SZCA 2DJIA 2X9NA 1T2UA 3AB8A 1K0UA 3HMKA 3HCBA 1GKLA 2HBQA 3RRNA 3L79A 3LFTA 4RTQA 5EKTA 4O2BA 2XOKD 3G0GA 2PR2A 4FFLA 3BT7A 5ESXA 4IXTA 1UC9A 3IUYA 1SHJA 1UK8A 2CVFA 4OY3A 1OUMA 3H1GA 1PYGA 3EZ7A 2H4XA 2QMEA 3JS5A 3N2ZB 4WX2B 3U16A 4QEZA 4U7GA 4MA4A 3IOMA 1EG2A 1OILA 1HE4A 5FNVA 2QMZA 2XWSA 3G8CA 3FZYA 4KP7A 4MUGA 1UJMA 3D0QA 3QKRA 3LWBA 4O5AA 5TMEA 3WGTA 1DCTA 2ZJ7A 4I14A 2GETA 1CEYA 4K2HA 5KX5F 3UKOA 2O2ZA 4A0SA 1NWCA 4ZVRA 4NU8X 1CJVC 1Y1RA 2OQIA 1THMA 5IAKA 5IM4A 3IJRA 4HN9A 1JVNA 1U5BB 4RPKA 5D5HA 3R6LA 1KO7A 2WSSA 4FGZA 2QTVB 4JYBA 5IRCD 2P9ZA 1ZGCA 3CTMA 3C5WP 3PNLA 5REQB 1W0KD 3U3KA 3L6DA 4ENQA 1PVVA 5DYNA 1IY0A 4MIOA 1XZDA 3I01M 4G0YA 5I8ZA 2WLTA 1Y1SA 3R7DA 2O1EA 1T8SA 2P9BA 2UZ1A 3VGPA 4E5MA 3C3MA 4L0DA 3EIUA 2VHYA 2WYOA 4FU0A 5I48A 1GKKA 2O0KA 3MG9A 4L6IA 3LL7A 2OGUA 4B48A 2OBFA 1QGYA 5CB4B 5AI8A 5EHXA 3MWYW 2E85A 2GZRA 5BQFA 1M8KA 2ZQYA 2ZUBA 4B3BA 2W4IA 4RXTA 3BDVA 1O97D 1OFGA 5D84A 4TL6A 3GG9A 1N5DA 4QEKA 1UIMA 3EJWA 2QVCA 1IPFA 2ERXA 2Y1CA 3K0HA 2VG8A 4B71A 2V59A 7YASA 1KEZA 3C97A 1NBWB 2B61A 2WPDD 3NXKA 4CM8A 1XLUA 2VHXA 1N78A 5LPNA 5KVSA 2OCYC 3RC7A 1D5CA 1X77A 2IYVA 3V8BA 1P3JA 4IIXA 3HUEA 1MHTA 5CTJA 4GM1A 4X3PA 1QANA 3QU9A 1KWKA 3A9VA 4LGVA 4B2YA 1TKCA 2ZSUA 1NVAA 1Z38A 1Q0ZA 1QTIA 1H23A 3NO4A 4MVJE 1L9XA 3VSCA <