2A58A

Structure of 6,7-dimethyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound riboflavin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
LKGPELRILIVHARYNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSWELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVILGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of charge transfer complex formation by riboflavin bound to 6,7-dimethyl-8-ribityllumazine synthase
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase
total genus 49
structure length 146
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2a58A00
2O6HA 1NQUA 4KQ6A 1NQXA 1NQWA 2C92A 1NQVA 2C9BA 2I0FA 3NQ41 1T13A 1KYVA 1RVV1 1KZ4A 2A57A 1C2YA 2C9DA 2C94A 2JFBA 1ZISA 1KYYA 1XN1A 2B98A 2F59A 1KZ9A 1W29A 2C97A 2A59A 2B99A 4J07A 2OBXA 5IM5A 1KZ1A 1EJBA 2VI5A 5IM4A 1KYXA 2A58A 1C41A 1KZ6A 1HQKA 1W19A 1DI0A 3MK31
chains in the Genus database with same CATH superfamily
5JT1A 5HILA 2ZOSA 1LI7A 3OAAA 3U2QA 1QV6A 2HIHA 2P5UA 2RGUA 1Y1PA 2ZR9A 4EGCB 4L73A 5IH7A 2X19A 1GYPA 2B4KA 2GO1A 4H2DA 3U7EB 3BYZA 3F9CA 2CJPA 5A5DA 5MF6A 2KLHA 4X5OA 3P9XA 3UMFA 5IFKA 3LDGA 2X7JA 1O5IA 2BM8A 3EXFB 3ILSA 1Y3CE 2P4HX 4G5GA 1JHRA 2E21A 4JUIA 1CQZA 2NVBA 2Y68A 4OYRA 3SYLA 4X6UA 4BOYA 1VXOA 3KB1A 3LK7A 2GBLA 1Z5WA 4K03A 2M6LA 1UJBA 2I6SA 1FLNA 4LF5B 1L5OA 1M1YE 2PX3A 5BYAA 9ABPA 5JU6A 3R9XB 4R01A 2WSBA 3H2YA 2PJRA 1T2FA 1RXCA 5DYGA 5DHAA 1CNMA 3SXUA 5KTRA 3QRWA 1BGWA 3LSTA 2WUFA 4QFBA 4LYJA 1PV4A 2CMHA 1OFTA 1VGQA 1NMQA 1VMDA 3B2QA 3SFVA 4R54A 3KEOA 4UW9A 1L5ZA 4F86A 3M4XA 4BZZA 4JC5A 3A6DA 2ZM5A 3TPCA 5K20A 2EQAA 1QOPB 4J3FA 1BXRA 2JIRA 4MTLA 3PJEA 4AULA 2VTDA 5JPDA 4DV0B 2I5PO 4ZMSA 2JIQA 4C6SA 1OZFA 2PKQP 2VDKB 2XNDA 3HNRA 3K9WA 2Q5JA 1Z6ZA 1QPGA 3MZ0A 3K0EA 4TRJA 4E30A 4PN3A 1IK4A 1RKVA 1JB1A 1VDMA 3LG2A 1FRNA 1N0UA 1SGWA 2YH2A 1K8ZB 4I5FA 4A0RA 3IQZA 2JVJA 3D02A 1FSPA 1D6NA 3JQ8A 3Q1KA 4I7EA 4UTOA 4XB6B 3BHJA 1O2DA 4XIYA 5C46F 2HK7A 2J46A 4YRSA 2ZIUB 3B5EA 2VS1A 5CDGA 1V5IA 4NZNA 1IB0A 4ZTBA 1A2OA 5H81A 4OX9B 1E2BA 1JILA 1RWWA 4DR5B 3MXTA 4TTAA 5DIFA 1GRRA 3TSCA 4WBXC 3KL4A 3FRIA 2VP9A 3I1JA 1N4AA 5AW7A 2COEA 5DNUA 2J1LA 4BLWA 1WPQA 4CM8A 1C1XB 1NIPA 2QTVA 3LBAA 5BV8A 2EKDA 5LYYA 4EHJA 1YK1A 4J4HA 5E4TA 4EY6A 2GEKA 4I9HA 1GPLA 2TRSB 3I4FA 2MSKA 2AFIE 3NFYA 1IJEA 1ZCJA 4YI3A 4YWJA 4CETA 1SZPA 1ZK3A 4BJ5A 4YB8A 3C39A 2J3LA 2PGDA 1EUDB 2HLPA 1FUIA 1V0JA 1Z2PX 3ZWCA 5CDFE 1I4LD 4QZVA 5GVSA 2IYYA 2Q8PA 4RJ2A 1Q1GA 4GOND 2ZU6A 3CR3C 1EX9A 2BKUA 4NYIQ 4P2BA 5U1PA 1U8CB 2ZIEA 4QA9A 1NYLA 1SCQA 1W9MA 4MV9A 3IAUA 2PR2A 1Q1NA 4OHWA 3TFOA 3FMFA 1BWPA 5E6UB 4P0QB 1XD2A 2JFUA 2F48A 3AP3A 4UHDA 5C1DA 3VHRA 3UH0A 3TTYA 2VH5R 1RRPA 3V3TA 1Y8RB 1P6UA 3HP7A 4M0UA 1O5OA 2O7VA 3DOEA 1E60A 4MX8A 5FUVA 3HB7A 2YJTD 3V1KA 3UMCA 1J5XA 1FP6A 2GZMA 4MVJH 1A5AB 1WU8A 5FI5A 2F3QA 1T0BA 1YE8A 5KX5B 5H3LA 2FZ5A 1Y6ZA 2XLBA 3F6YA 1XP8A 4AQ7A 4GMXA 4YXWA 5GADl 3R75A 2W90A 2R6ZA 3RSHA 4AJJA 1H2YA 2XB6A 4OUDB 5ECDA 3TE7A 4M98A 3Q3GE 2E1PA 1M2GA 1PGJA 1BEZA 3LWNA 1J56A 3C97A 2O8BB 1QCYA 5CEEA 1IHUA 2A9JA 2I99A 1U9IA 1Z38A 3KDAA 4K6FA 5CNKA 4W9NC 3OHSX 4ZVUA 5IU6A 4KITB 3HO1A 3GEMA 3LXXA 1PHPA 1N0WA 4AIIA 5ENVA 1FEZA 1C1DA 4HDKB 5DTIA 4LFCB 3HXOA 2AR9A 1JE0A 4JB2A 1P4SA 2GJAA 4O4JA 1JU3A 3DW3X 5A7HA 2B92A 4WFQA 5CM8B 3C43A 4C0XA 2XGGA 4LQLA 1X15A 3O9VA 3DHNA 5FEMA 1O95A 2YWCA 3D8UA 5E1OA 5A4IS 2HK6A 1OA0A 3OWXA 4INAA 4F5ZA 1M34E 1TJNA 2IRWA 3R3WA 3U4CA 1PJSA 2VA8A 2WU3A 4A0FA 3N70A 4ASUA 1THGA 4E12A 1WM1A 1Y7IA 1CV2A 1UDAA 3OQJA 5A4MS 3T99A 5L45A 4HX9A 2O2ZA 2RB5A 4D4LA 2NZ2A 3N8GA 2RE8A 3FUCA 4J0HA 4UC0A 3IMFA 1YU6A 4QTYA 3LX5A 1C8BA 1D3AA 2YOGA 2DWPA 5DLPA 4B6SA 3P1JA 4FCCA 5KOJA 4YA6A 4GE0A 4YO8A 5JATA 2JAPA 1GUYA 3LQKA 5JHGB 4FDVA 1TCBA 1SXQA 1YZHA 2G71A 4B31A 1L4YA 4NZZA 2JJMA 4R8KA 1XALA 1RWKA 5JV5A 3HYNA 3ZDZB 4JUFA 4M8KA 4ZAGA 5K3FB 1CY6A 1CQJA 2WIJA 2Q4OA 2P30A 3SQDA 3G82C 2PS0A 2DM6A 2DKOA 3NHZA 1UXKA 1VI2A 2IEAA 3LLCA 4HTFB 1N5RA 4UU8A 4D8XA 4V1CI 3I1YA 1Q57A 3NM4A 1OBFO 1XBTA 1SEPA 2YFYA 5KNCA 2DX7A 1Y7HA 3RCBA 2CDNA 4QT0A 3EEOA 3ESXA 3ICVA 1H8HD 3T38A 4QLBA 3GMDA 1JNYA 4BZWA 2XZTA 1HFEL 3EPRA 3H4VA 1RJ9A 2GA9A 1J0XO 2CFSA 4OQLA 4AO6A 1MKYA 5A6VA 1F7UA 2VJCA 3EH1A 3LUJA 3KZXA 1N2XA 5EMNA 3QE9Y 2LKDA 4ZA2A 4MUKA 2O3UA 1MEOA 1GU7A 2FWBA 2AX4A 5IANA 3I9V1 2IYOA 2VSYA 3ST7A 3WGTA 5EYPB 4M9QA 2VNJA 1QGAA 2JAXA 4E07A 4YQEA 3G2KA 1O03A 4NICA 3V8MA 4HDQB 4H6WA 3BWDD 2HO4A 5JBNA 4Y67A 4L8VA 4F46A 3ONDA 3GJ4A 4CYMA 2ZZNA 1AGPA 4DMKA 1M0EA 1KYIA 2VSOA 4AZ0A 4CMCA 2H16A 2D7DA 3F7TA 3BCRA 4COOA 1KI7A 3MTEA 3K72B 3TDMA 2BAGA 2XMSA 2YDXA 4HNUA 1NC1A 3E48A 1G3MA 2ZYVX 1AB5A 3BHMA 4JBIA 1X8XA 4OREX 5E3JA 4C20A 1N5MA 3DCYA 1NVKA 1KDYA 1G8FA 1BMDA 4PGHA 1BQEA 1POWA 1YFZA 1XKTA 4IMRA 4OHCA 4RAQA 4ZCRA 2D8AA 3K2EA 3OM9A 4AMYA 3OZDA 4UM9D 3HCPA 4EHNA 4MARA 1W46A 3WLAA 3LF1A 5ALEA 1CJBA 1I10A 3NDIA 1SCJA 2PSEA 5FB3A 2OCPA 4KDRA 2Q8QA 1GITA 5FUBA 3U7QB 4CM5A 2I9KA 2Y8EA 4J0EA 3I9V6 4CTNA 1I80A 3H8VA 1KAMA 2HH9A 1LSJA 3PT5A 1CQPA 1I36A 2XWSA 3TCXB 3QVXA 5B7GA 3JYOA 1R9NA 3CXUA 4R40A 3CMMA 2EFEB 1UFQA 2OCKA 3B13B 4L0QA 4W5RA 4AKIA 4BO8A 4ZPJA 2OZVA 2XCOA 5KVVA 1C80A 1E2JA 2DHQA 1VJCA 3UJBA 1CFZA 1J42A 1FP4B 1LCIA 2VHTA 3VR4D 5MN5A 4LMRA 2W48A 1Y7TA 3IUJA 4U0JA 2Z3VA 3U40A 3A9WA 2CVQA 2IIPA 4R2IA 1XVIA 4BMZA 1ID1A 5KTTA 1HNWB 3KXIA 2ZXEA 3O4IA 4ALJA 5E1DA 3DKRA 1A8SA 2D7CA 3HY4A 3OPVA 1M5TA 3PBKA 3ZS8A 3U4MA 3DVAA 4U7WA 4Y2VA 1N6IA 2GMWA 2V7GA 1AV7A 1RCTE 2ZSJA 2QDXA 5JUWA 2IUEA 4YAFA 3ACBA 3EDCA 1J2UA 4QSMA 2GZHA 5L3ZA 2EKLA 1PJRA 2QTLA 3Q0EA 4YJ3F 4KWEA 3H0CA 1QFJA 3DXZA 1O4VA 4DG5A 3V8EA 2CZCA 4OQPA 2VLIA 4F6CA 3OQMA 4EX6A 1E2IA 1OB5A 5HSGA 4KPEC 1TU4A 3QPUA 1JL3A 3VV2A 2PN1A 2HU5A 1NBEA 1TGYA 2H8KA 2XZPA 3FMPB 1AH2A 5FPHA 2G28A 4X6LA 821PA 1HE8B 2FPXA 1WDWB 4LKOA 3PLNA 1F6DA 3LCMA 1JWAB 2X15A 4QVKA 1ZKMA 2HJGA 4ND4A 4RESA 1I6MA 2CLEB 3WLEA 4EECA 4WN3A 4F56A 3T3MB 2XUJA 4EVIA 4OBXA 1SUSA 2JLVA 1AKWA 1H9AA 5EHIA 4RULA 1Z47A 1M1XB 1N8SA 2QX8A 2PKCA 1T6NA 3P5BA 4ZC8A 4ZI7B 1OKKD 5L3SB 2HK8A 3AESB 1YH3A 3HJFA 4BVEA 2A5JA 4Q4DA 5FR1A 2H18A 3IMEA 3GB9A 4R6XA 4DLBA 2OV8A 4FMDF 5LBTA 2QTAA 4HWKA 3WVNA 1DC8A 1J8YF 2HRCA 2ZRKA 3NC4A 1XA0A 3PQ8A 2H4YA 4I8DA 4MV0A 3TD9A 1DELA 4FHDA 4XJVA 2RAFA 4P58A 5CX1B 3UA4A 2I4TA 1JSCA 4M8SA 5LA6F 1SCUA 2OXFA 2X0DA 2O06A 3N2KA 3O8DA 2OAGA 4CTJA 2IQIA 3COPA 3TPZA 1S1MA 2WEKA 3SK0A 5IUNC 4CCYB 3D3QA 3VR6D 2JFHA 4FQ7A 2CN1A 1P2SA 2AJDA 2J09A 3G7NA 2H0RA 4MRMB 4CMHA 1G9XA 5K3SA 1K75A 1CJUC 3P8ZA 1R10A 3NYIA 1K08A 4R84A 4YS6A 5KX5F 1ECGA 3IB6A 3USES 4AMBA 4BNDB 3ISJA 5ALIA 4TS9A 2W4IA 5JDIA 4QQNA 1TK9A 1PZHA 1LNSA 2LTAA 2PCLA 2WIKA 5IN4A 1RSZA 3ITKA 3DBLB 3ZBQA 5FOSA 5BQ3A 4F1JA 5AFSA 3D5QA 1S8FA 1H0RA 3OCCA 2GQ0A 2CD7A 1QNLA 4J0IA 5BMVF 3A6ZA 4IR7A 5HKAA 3EYAA 1HQCA 1CP2A 1AZTA 1C50A 1L9XA 2RHTA 4YDRA 1X7HA 3U7HB 4ZD6A 4GU5A 1Q0PA 4XOIA 1EFVB 3EIWA 5B3JA 1BVHA 3LBFA 1ODFA 4O1MA 4DCMA 1XFAA 4JCOA 1QWOA 4YI5A 1G8JA 2EIXA 4JROA 4ESVA 1ZZGA 2HBQA 2ONJA 3GJ0A 2FPPA 1JMKC 1IPFA 1G20A 4JNCA 3UUWA 3NAQA 1VKNA 1SVOA 2WJ6A 1NTRA 4FFNA 2QVCA 3Q7QA 5IABA 1GM5A 1Z0SA 1Y8ZA 5JMWA 4QG3A 4RGYA 2J0UB 1J0EA 2WJAA 4UAJA 4PLWA 1UMCA 4ZEMA 1VSVA 2NO4A 5CVTA 3U80A 2NG1A 1IEXA 1OQAA 1JU9A 4GPD1 1ORRA 4XPIB 4BVKA 6AT1A 1DU4A 4MZXA 3SE0A 1UKAA 3R44A 3H1EA 2H5LA 3Q9LA 3EFHA 4UFOA 1A9XA 1LWOA 3UT5B 1H0HA 1WB5A 1T6YA 3P2EA 2BPOA 2GZRA 4FZ5A 4K46A 3PUKA 4J6FA 4IVNA 2NUBA 4OMDA 2C2OA 4QSHA 3VR5A 3VOBA 3A1NA 4M8IA 3K30A 5MHTA 1VC2A 1ITZA 4Y2JA 1GTSA 1HC7A 1LJLA 3FPEA 2J3KA 2R7KA 5LP6A 3FD8A 1H9BA 1ZD2P 4OQZA 4J1NA 2G1JA 1QLJA 1SCUB 3KP1A 5ED0A 1G21E 2FWNA 2DWOA 3H8SA 2OXTA 2CGEA 4PTYA 3PX2A 5A0FA 1R0SA 2GVZC 3L1KA 3A25A 4JI6B 3KQNA 2WPDA 1J0CA 1R5NA 3O31A 1U0OC 1SAYA 1LDGA 1VA4A 4J9VA 4E3ZA 2D3WA 2XITA 3S8MA 1TIPA 2DTXA 2Q7XA 1JLLB 2C9MA 3ZC3A 1NUPA 2B36A 3U3RA 1LDNA 2GM5A 3FZGA 3KKEA 3QY9A 2EHJA 1SG0A 3ESCA 2P90A 1B2LA 1M1NB 1T0JB 4LFAB 2W9XA 1ZUD1 1I2DA 4M22A 1DAHA 4IYRA 4C6HA 1MNQA 3BMXA 1HETA 3N7TA 1FNSA 3ABRB 1P19A 3K6JA 2WM8A 4M86A 1D5CA 1G3RA 1VECA 2AWOA 3GRYA 5GZ6A 5IARA 3RG2A 3DAPA 1T43A 4IF6A 4KMSA 3WZMA 1KSJA 1VL5A 1L8XA 1XCGB 3FLEA 3DL2A 4G09A 2PGOA 1UKZA 3HXTA 3C7KA 4JBYA 2QN9A 4G5YA 3ADOA 2YN4A 4KN8A 4Z1MA 4V02A 2P77A 3WLLA 2A30A 4YUYA 5ANRB 1ESNA 1PL6A 3UB4A 1FJXA 4GE3A 3Q40A 4LUCA 2XXBA 4YP5A 3WLQA 1EUZA 1FSZA 1U7XA 5AHKA 1SHLA 5FWYA 1ULAA 4NOLA 3S5JA 2XI4A 4HGZA 1YUNA 3UPUA 2RGCA 4RVUA 3M6XA 2IY9A 1GFWA 2IZ0A 5H4HA 4B6GA 4E2YA 4ARAA 1PGNA 3LQYA 2I3DA 2W7TA 4I1PA 4QDZA 1J2YA 3LUHA 2PS3A 4LW8A 2LGJA 3QVGA 3U3XA 4GBED 2M6RA 3BX1A 5A6SB 1WZEA 2OGTA 1LGYA 2EF1A 4YRRA 3A10A 3OT1B 3QWAA 3IT2A 4NE7A 4OK3A 4V0QA 5REQA 4FDLA 5FKJA 3L1HA 4BWGA 5EHNA 2UVQA 4IO0A 2BEJA 4PQGA 3UT5A 2ENUA 2H1LA 5BYJA 3IAEA 1V4NA 1ISFA 2W4QA 2EP5A 1KR2A 3MEQA 3TVYA 2R2GA 5LU8A 5LVAA 1QQAA 3ZCQA 3FGZA 3X1ZA 3C8MA 4RKEA 2QTCA 1YIAA 3GAZA 4QNRA 3HNPA 3LYHA 4R3UC 5DEIA 3QOXA 2J0UA 4AUNA 1J2EA 3ZVNA 1D6SA 4BY9E 3ISTA 2KI5A 4ZO6A 2GESA 4EGQA 3LVFO 1X7YA 3V9PA 3G0HA 5ER9A 3ZI0A 4XZ3A 4ECAA 4MS4A 4LDNA 4UDXX 3MOIA 4K9MA 3IAAA 4WNAA 4HEA1 1OYYA 4I1RA 5K0TA 2RHWA 2X9NA 4OXKA 2D0PB 4TMTA 2C4NA 5T4HA 2EWWA 2KE5A 2QSJA 3FI9A 4JJZA 3ASUA 4OXRA 1LKZA 4C2AA 5LIRA 3ZHTA 2VHYA 3Q2OA 1K88A 4P4UA 1FYXA 1P6QA 4D3XA 1U9YA 1VE9A 2Y1DA 3TQIA 4UUMA 1K7YA 3LHDA 1E1RD 2OORC 4QYSA 1GYRA 2X5OA 2EKQA 3OIFA 1NN5A 5B7QA 4MW1A 2V3CC 3BMQB 2D2FA 1A5ZA 4KNYA 4AJEA 1UM9B 1S3FA 1CE8B 2ZAOA 4QUEA 1XF1A 1AF7A 3QIVA 3GLTA 1HFKA 4KREA 3LJKA 5WRFA 5CB6A 2O48X 3A9UA 1L7QA 1KYXA 3O2QB 3ROKA 2ID7A 4HQ0A 4CFSA 1DMRA 2BE9A 4NFSA 1M6HA 5DRTA 4EITA 1L6RA 1YZLA 5TPZD 1E3EA 2QV7A 2WNHA 4P4NA 5EI5A 1G63A 1G6OA 4H6VA 1KKUA 3RVPA 3V1NA 4AMGA 2OGSA 1ZOIA 2QZJA 1VKRA 2BVNA 2QTFA 3OTIA 3STYA 4ZZ2A 1G8GA 4WXRA 2XSZA 3ICCA 1L5FA 3GUUA 1Z4OA 3H05A 1G4HA 4PSKA 3EUAA 4U63A 2O0KA 1M6WA 4Z8XA 4JLSA 1CQIA 2RIRA 3AI2A 4KW7A 4XASA 2B6NA 2O52A 3PIIA 3AI1A 2P8JA 1YV9A 2ESRA 5H0IA 1W0JA 3ZNQA 3PLRA 4DA8A 4YDQA 3WDLA 3KYDA 5C8YA 4DDMA 2Y71A 1OOEA 3N2NA 1JAIA 3EXHA 2BGUA 5K0LA 2DQKA 3N0TA 4CU2A 1XR3A 4O4IB 5BWBA 1TC2A 3VVCA 5JS2A 4AYTA 2CF6A 1VM6A 3B3FA 3KEFA 4LC9A 5ALWA 4DQLA 4OKNA 1D2HA 3JQBC 1P1BA 3TPFA 2B82A 1UKBA 2TMDA 2SNIE 1JVBA 4IIXA 1BNCA 5JJCA 1M0TA 5H68A 1EWQA 4EY3A 4Z7NB 2FZVA 4ZVSA 3W1WA 2HADA 4GR4A 4ER5A 3HXPA 1Q7BA 2QNIA 3I30X 1CZOA 5TT1A 1AV6A 1WBDA 4WT7A 2ZYTX 3Q7EA 2PH5A 1X1CA 1XOIA 2EF0A 3BDVA 4IILA 4J75A 2ISSD 1ZIXA 5KJ6A 3QPBA 2DPMA 1AKTA 4FYXA 4EL0A 4O2RA 1YQTA 4F45A 2GYYA 3A6KA 1U0NA 2FWJA 2Y1WA 4N0EA 3BULA 3V4PB 1OLSA 2N47A 3EZFA 3UO8B 2JFFA 3T6KA 3TWOA 2QD2A 4YRCA 3MIZA 4A5OA 3T9CA 4G0NA 2FF5A 2CXQA 4UEJA 5HK8A 4AICA 2GT1A 2J9FA 4BATA 4HI0E 4RHEA 2BDEA 2JGLA 4UXJA 3K1JA 4BFZA 4BRWA 4DUYB 1KOGA 5LZ8A 3Q98A 1KZ9A 4P0TA 1F9AA 3KQMA 2H17A 3AONB 2PSHA 1QC5B 2ZI3A 3V4VB 4C04A 2XCSB 1MX9A 1LK7A 1RAAA 2HWWA 4KK4A 5FQNA 3PCXA 3ZOZA 3H5TA 3ZLUA 4BNGA 3WIDA 3BJZA 2RG7A 3FZNA 1U2ZA 5FPKA 1BG6A 4GXRA 4C7VA 1DS6A 4PTLA 4YFVA 3SJAA 4CPDA 1MRSA 4INZA 3G13A 1A9ZA 1WLSA 2VT2A 3AVWA 2AVNA 2NADA 2RAUA 5EVJA 4KXNA 4UQOA 3ZK7A 5DWQA 4B0PA 1AMUA 4XVQA 1U5AA 5AJYA 1YFJA 3C3JA 3ZZ0A 3ZH2A 2MSWA 4N18A 3TQHA 4IQ4A 4BZPA 1SKQA 4MWTA 2XCRB 3VR5D 3CLTC 1E59A 5I7AA 3TSYA 4LDQA 2OQRA 4QULA 5HUJA 4TSFA 2GBLC 1KSGA 2FE1A 5ESWA 4MHOA 2R6HA 2XQKA 2ZE7A 3IXMA 1H66A 4YP9A 1E1KA 1T25A 5L4LA 4KAFA 1YL5A 3OZCA 2ZITA 1VCNA 1V5GA 2B9VA 4GLLA 4AZWA 3N3BC 2GZSA 1Q0ZA 3ZDRA 4IOJA 3PXBA 4ATNA 1TQDA 2AMLA 2GCEA 3C3AA 3ZX5A 1BS9A 2WD8A 2FSHA 2YZGA 2QMHA 5HRCA 2W83A 5CLJA 1P62B 1TKRA 1VE3A 4DLAA 3M6VA 2HCTA 4UZEA 1HX7A 3GRFA 1GA6A 4F3YA 2HLHA 2J4CA 4MGZR 3REGA 1Z22A 2B7CA 721PA 1OZ0A 1G0NA 3LQ2A 1ECJA 5DCUA 4XEHA 4DRYA 1A8UA 1KMMA 4ECEA 5BRAA 4ND1A 1JHVA 2HT6A 4IHJB 5JFOA 4OIMA 4PNZA 3PCRB 4GVLA 5DBIA 2QDKA 2OXIA 5KJ1A 1HL3A 2Y99A 1UJNA 4YUWA 1PNVA 4ZI3A 1WULS 1MOQA 2WRZA 3U7GA 1JLLA 2IYAA 1QYVA 4ZYZA 1C41A 2QNBA 1IVYA 3H75A 3HSKA 2OFXA 3ZV5A 5FYQA 4EUKA 4N6OA 1TF7A 3ECSA 5T4BA 2IWRA 1VCHA 3V4ZA 3FMVA 4JI2B 1O97D 4CMBA 2FYTA 1OJLA 3CM0A 3IAS6 2AEFA 4A0QA 1I1QB 1XYGA 2Z4TA 3KO8A 2CCKA 1F17A 2G67A 3OUUA 4P35A 4YNBA 4XWKA 7ADHA 1DRUA 1UBNA 1UT8A 1ONOA 3QMWA 1MB3A 2NQTA 2QYHA 1OZAA 1RBMA 2UYOA 3EMDA 4A2WA 3PDCA 1SBQA 1TEVA 2C31A 3BKWA 4RACA 5FTJA 2IGBA 3OOJA 4Z3DA 4B8WA 2PMDA 1PFUA 1QVZA 3IP3A 5H3CA 1GL6A 4LZZA 2F00A 4BMCA 3FIUA 1JR3E 2O59A 4P7KA 1DCMA 3QNWA 4DIOA 4XAQA 1MJHA 1CIJA 3OD5A 5K1ZA 1EVIA 3H0KA 3QF4B 4ZN6A 5BR1A 1SK8A 3LFHA 3QG1A 4N39A 3GLIB 2FSIA 2IZZA 3TL2A 1HG0A 1VJDA 2GX6A 2WK1A 2BGIA 4PNPA 5B58C 2O7NA 3TIFA 3D2CA 2WVJA 2CLIB 4DOMA 3BL6A 1QVVA 3AHDA 1OFVA 4IJMA 5F23A 3V00A 5JFTA 4UCXA 3RYHB 1WUJS 4OTZA 4P5DA 5L3QA 4C08A 1IQRA 1BDHA 1NG1A 2IUTA 2VEDA 3VAZA 4Y1FA 5F9HA 4F0JA 3HACA 4XGKA 3O0DA 3PUHA 4G81A 2IYXA 5A5GA 2C88A 3PK0A 3L82B 1CZNA 4MDFA 1N33B 3IPYA 3WIOA 4ZCQA 2CDAA 4E7PA 3TGLA 2CL0X 2D54A 4XW2A 4DY6A 3PRKE 1V95A 1P2GA 1T9CA 4UM7A 2Q4DA 2ZJBA 3CIOA 3FPKA 4YACA 1JDVA 5TGDA 1NI5A 5MDHA 4MUMA 1F4VA 1V1JA 4BQRA 1KA9H 1MAUA 4D6PA 5BMVA 1KKLA 5C51B 1T10A 2GK4A 1KYVA 3E9YA 4W7SA 2HNAA 3FI0A 3DBVO 2EW8A 1KRXA 3RFXA 3WIBA 4CMIA 2JIBA 4NAUA 3EWAA 5K99A 1Y4DE 3T3GA 1DAKA 3N2GB 4M0PA 5H4GA 2ANBA 5HF9A 1WCV1 4NI5A 3DE3X 5DYWA 4IDBA 5FFFA 2PRSA 1IK6A 3RF6A 5FWAA 3K73O 3NIBA 4YLEA 1U7TA 1NXVA 3TMYA 4GP7A 5A6SA 2G6TA 4OI1A 1GRQA 3QE3A 1P0IA 5GOTA 5JQGB 4MYHA 1FRFS 2HJWA 5FUQA 1XDGA 4KK3A 1U1IA 4WINA 2WFMA 1ABFA 4H4EA 4A8TA 1CEQA 4ND7A 1HTBA 1WXGA 2H2WA 3PNYA 4B9AA 2ZI9A 4PYOA 4YYEA 1JF8A 1H3FA 4DNOA 3OZWA 1TVMA 1RI5A 1T4CA 4HGYA 4O4JF 1MC4A 3FXAA 1JXQA 3AQ4A 3IP8A 3S68A 1UP4A 2HMAA 1KFJB 2CZQA 2X1LA 2XDQB 1GV0A 2QU7A 5K9ZA 4OL9A 4IP0A 3GZ4A 3GRUA 3LIIA 5TF0A 1MAWA 2WUDA 4AJKA 2V6BA 5LLSA 4EENA 1EGAA 2PO5A 4JC4A 4UCWA 3PGLA 1Y4ZA 3E5HA 2ZP1A 1CHDA 1U1EA 1VLQA 3K0CA 3M2TA 3AW8A 3L06A 1EUYA 4RDCA 1WEHA 4ITRC 5AXCA 4EI7A 1YRAA 2WOJA 2O6HA 4N01A 5CBPA 4XQ9A 4CKEB 1QS0A 4K9LA 5JVDA 3QWIA 5FFMA 3TQRA 5ERGB 2ZRPA 1QHEA 3L1UA 4I1IA 4DIFA 1UJ2A 3KJZA 3OETA 2A9VA 4EZBA 4FMCF 4CFYA 2RMKA 2WTUA 4JHLA 3E8SA 3ZJ5A 4EG4A 1WW3A 3U4QA 1MCZA 1QCCA 1HEIA 4BAZA 1SUWA 4FJ1A 4ZVNA 2OZLB 3IQDB 3IP6A 2A4KA 4HATA 4O0MA 5DGHA 3DS8A 3AVTA 1ZA1A 3UT0A 4S04A 2QBYB 4IUDS 2J67A 3C8ZA 3QXHA 3ZDYB 3SFTA 4V1CB 1DBSA 1XEFA 2HAEA 4L4YA 1I2CA 4S35A 1MX5A 2Z5VA 3DHWC 3ELYA 4Z0HO 4BVGA 3AJEA 4QJ4A 2QI9F 4JJIA 2JEOA 1XNJA 1F3LA 2J9GA 2QYOA 4BZQA 4V3CA 3KOYA 3OHPA 3EPHA 3BG5A 1A9XB 1YMVA 4NYJR 2X77A 4C5CA 3DUFB 3PHLA 3CUYA 4MI6A 3VTAA 3E7WA 4UZFA 3VNRA 4J94A 3T7DA 3P94A 1X80B 3R0XA 4RK0A 1TNDA 1EJ6A 3NHPA 1A77A 4RM3A 1M67A 1OMOA 4HBZA 3UNXA 3PNOA 4YRNA 1VTKA 4YC7A 5J5CA 1DNPA 4ML3A 1JYEA 3AFOA 1DRVA 2FG6C 4BNTA 2HFJA 3S2IA 3FOFC 3UBTA 1VCMA 4PFJA 4PX5A 2ZRHA 2BTEA 1WL8A 1F0KA 3WDKA 1DC4A 1P9OA 2NU9A 1AHHA 1EWRA 2IXTA 2FPOA 1HQYE 1E3WB 3DZGA 3E5MA 3I64A 3WNCA 4YMHA 1G9SA 3RVMA 2VAVA 3MCZA 4ZAVA 3GBVA 2BFDB 1FDSA 2P9GA 1AY0A 2V7UA 3B6MA 3L6EA 2Z4SA 3OLXA 3R6LA 4RA6B 4CIDA 4QJ3A 3M3PA 4B80A 2MMCA 4P31A 4EG7A 1W49A 3CCFA 2IH5A 1OE0A 5L9AA 4DV1B 4AKHA 2FDCA 5DM70 4II7A 5BP7A 2GRAA 3RWMB 5TQVA 2JEZA 4C6TB 1K97A 5HOQA 1GPYA 3PC8A 4D3ZA 2WP0A 1IOWA 2FCAA 4EJ6A 1G7SA 4TLLB 4D2IA 2QRMA 1NYRA 2YWXA 3EF0A 4RTSA 1OBOA 3HGTA 5EZ5A 3TG8A 3KJGA 1G3UA 1ZCAA 4GOOD 4P7JA 3Q7SA 3K6SB 4P82A 5G0WA 1GG2A 1FRVA 1F06A 1BAPA 2EQ5A 1F5NA 1LV7A 1XK6A 2RBGA 1VBFA 1JLSA 3MT9A 2H2FA 2PWAA 2Q5HA 4BNMA 1OB2A 4XLZA 1EM8B 5F1PA 4G1FA 1JEEA 4BKPA 2C7BA 4DG8A 1S89A 1XELA 5F3RA 5DX8A 1IBMB 2AKYA 5EKXA 3L4JA 3L79A 1Q84A 1G3IA 1ODSA 1SBTA 2CDBA 2Q5CA 4DJFC 4TM8A 4K8OA 5BSKA 4C2BA 3UY4A 1UINA 4YJGB 1W44A 1NBHA 4XJTA 1RD4A 4EM6A 1FMTA 4UE6A 4X20A 1RRVA 4A73A 3JAWB 3MTQA 4ZK6A 1V25A 1YR6A 3ND9A 4FLEA 3SJUA 4DNXA 4FR2A 4TLCA 2BGMA 4AXXA 1B76A 2I2CA 3QKSB 3OIVA 4OM8A 3VSAA 2AXQA 1RMTA 3I39X 1YL6A 5F2KA 1OXKB 1QIEA 2PMCA 2IPXA 1TYDE 1LQUA 1P5FA 3A27A 3QW4B 2GSDA 3KKKA 1GN9A 4OLJA 2W00A 3RYFA 3S99A 2F3RA 3B9PA 1BTOA 3O4JA 1IONA 2AYZA 2BYTA 1L3CA 4KNVA 2P9EA 4CLHA 1K9SA 4FKMA 3TNJA 2Q9CA 3QTLA 4CV2A 3T0IA 3CZRA 3F3YA 3DOUA 4ZOCA 4RCYA 1JNXX 5DLQC 2BFCB 4E51A 5HTOA 1U8FO 2ASVA 3CF4G 5JVDB 1U9CA 1Q21A 1MQSA 1XZJA 3ZWPA 1CRZA 4KQ9A 2QA5A 4Y2PA 3OFSA 4LSGA 4JB8A 4TTQA 4HNQA 1VP9A 2KSQA 5LCXA 2RGXA 3DF7A 2J45A 3E70C 2EJWA 3JQFA 4XX0A 1KPHA 4KQHA 1H8HA 3DBIA 1HT1E 4MPTA 4QXPA 3KOZA 4WUTA 2DUWA 4YJKA 3RS0A 1O0CA 4BTVA 4LV6A 2VAWA 1Q22A 2IXEA 3CO5A 1FQOA 1PU2A 4KV9A 1V1RB 3L8CA 3KBBA 2F1JA 4NRDA 3EAFA 2ID9A 1U6JA 3KQYA 2J32A 3RB8A 3R6GA 1II8B 4FGKA 2QMZA 3W3AA 2P6PA 3LNCA 5TRTA 1Z8HA 5LA6A 4HV4A 2YIDA 4YIKA 4NFLA 5DOVA 5DSXA 1O5TA 3OJXA 5K8LA 3P9RA 4WLNA 2CV0A 4DN6A 5FAKA 2NXEA 3CX4A 1ZGJA 3E3AA 3PP8A 2P79A 1EINA 3TW4A 3ZWDA 4BCDA 2QAIA 4BFYA 3DOHA 2GNAA 3ZVRA 4NXNB 1L4FA 3ONVA 4QEZA 5CTJA 5KX5A 1EWVA 4L50A 1FDTA 2DEUA 5JD6A 3PQFA 4N12A 4J8PA 3L7KA 4DLYA 1CIPA 4LHWA 1IB6A 3VDXA 3A1VA 1W8DA 2Y6UA 4KQJA 3R40A 1J70A 5BN3A 2UXDB 1T1GA 4RIHA 4DMRA 1THMA 3OLCX 4J16C 3MWEB 3STUA 1XRQA 3CUSA 2BGTA 3DKVA 4DF3A 4EJ2A 1D2RA 3HH8A 4Y2TA 3ESRA 3K5WA 3NWEA 1TAGA 2ZUVA 3EQ7A 4XWGA 1K5PA 4XFDA 5JBIA 4JB3A 2O1XA 2FCRA 3G2PA 1A4RA 2XUDA 3KOOA 4DJAA 4IEEA 4X92A 5BQFA 5JEDA 4XSVA 3TNFA 2XWQA 3FDJA 3CRNA 2Z04A 3DCIA 1WSWA 2R8PA 3ZGXA 4DKJA 1MDFA 4R6WA 2VATA 3D9QX 1I7SB 5ELLA 2ZXUA 4L7VA 3HBJA 4Z49A 1C1XA 1XDDA 3HPRA 3GRCA 1PN3A 4W1SA 4BX3A 4US1R 5CVVA 4Z5XA 1R74A 1ZK4A 3HI6A 3F2VA 4UARA 3UWOA 5K4GA 1NVWQ 1GZDA 3PFNA 1I7QB 4FEAA 5BN3B 3R8XA 1V8FA 1O58A 2OG2A 1TD1A 2ORIA 2UZ4A 2X1HA 4RXMA 1UIRA 5BT8A 2PUAA 1ZD1A 1DC3A 4A1OA 4NV0A 3UYKA 3EWSA 2R4TA 2QWXA 1Z4IA 4O2BF 4RPIA 2QAJA 3EVGA 3JTMA 5C9ZA 2NO6A 1FUYB 5CDUA 4GZ5A 1LPNA 1H2WA 1TDJA 3PJGA 4JFAA 4PYKA 4GOLD 3RTGA 3TJZA 4RPCA 4DNPA 3HS3A 5F5LA 3A58B 1KYYA 3EIQA 4MB6A 3SJBA 1GSOA 4G9EA 4EHLA 1FFSA 4QOGA 2OK7A 1UDBA 3WBFA 1ZGHA 4ZVOA 1A1VA 3UB3A 3SR0A 2B1IA 1FP7A 1ZVJA 2JD0A 4MKFA 4N3BA 3RKUA 3VHXA 2OAQ1 1DV2A 3VSCA 2VDPB 4U7TB 5ITVA 3QEAZ 4CEIB 2X6RA 4RHXA 2PUDA 3GP3A 3F4BA 1U2GA 3JALA 3Q85A 4HB0A 4E5PA 7REQA 4TMXA 4ZT7A 4KVZA 1L5KA 5MN6A 1X38A 4C89A 2ZVJA 4MPRA 3JD3A 4U6NA 4B40A 2DUNA 5KOJB 1R4MB 3KD3A 5ERXA 1NFQA 4ALIA 2GEBA 3SI7A 5HKOA 1RM3A 2HBYA 2Z5FA 3L8YA 5FUXA 4Q34A 3WGLA 4LF8B 4YAKA 1QH8B 3OA2A 1S9HA 3FKJA 2DBZA 4KR0A 2GXUA 1IZ7A 3Q7PA 2B37A 4NONA 3GLGE 4HX5A 1QIKA 4TKLA 2COKA 3DTVD 4F04A 3IKTA 4U6SA 1JR6A 3VPFA 4IHJA 2GXQA 1LPBB 3FLBA 4QXQA 5CUQA 4ZOLB 2ZE5A 1T9GR 1E1RA 3IGFA 3P9CA 3MMPA 1U8YA 1Y1KE 3EZXA 4HGOA 4YAEA 2C4HA 5BVGA 3SBDA 1B4DA 2CJWA 2ZTSA 1K4MA 3PITA 5EVCA 4KR2A 3H04A 3UPDA 3EUFA 2F62A 5D00A 4D45A 1PT9A 3PKIA 1I2AA 4QXAA 1RT9A 1RADA 5LU9A 3OY7A 1T36B 5CM2Z 5KWIA 1FUUA 4E0BA 4H7KA 2EL9A 3DG9A 3IUQA 3H2SA 2PEZA 2RCYA 3NETA 5ALPA 4YVFA 2Y4OA 1SY7A 3TW8A 3DMFA 5JAMA 4QGSA 1VZ3A 1Z6PA 5ECGC 4MS3B 4BBJA 5JQGA 4OQDA 1BFKA 1OLUB 2ZK7A 3H1AA 4J0GA 3JVEA 4OBWA 5K01A 3RADC 3GLIE 5KNBD 2VQSA 5FA8A 3KZ1E 4F2HA 2AH5A 5B53A 4DMMA 2AX3A 3K6RA 1YUMA 2J9YB 2QL9A 5KC9A 3N8NA 3LQQA 2WTNA 4H17A 4F21A 1P7ZA 1NUUA 1TF2A 1WQ4A 4YR7A 5CB4A 2J07A 1IUOA 3EOZA 3IYLW 1T0IA 4HGRA 1B8VA 1CTQA 4MQEB 4UBMA 4D26A 2OQVA 4D8UA 3BS4A 3WRYA 3D4PA 3SF8A 2QOEA 5BNZA 3QE2A 2XZLA 3N2ZB 3GAMA 2OP1A 3ESZA 3O92A 4WIAA 3D3WA 1JU4A 1Y8QA 1L4LA 4ZPXA 2QIOA 3TZHA 4JXKA 2OA0A 4DB2A 1UOEA 2ISQA 4NZPA 4GLFA 1T8SA 1H05A 2G63A 1ND5A 1G2PA 4L22A 2IU3A 1LX6A 2D4HA 3VPXA 1RACA 2N0SA 4N7MA 2XSZD 5DO9A 5H80A 4JXJA 1NLYA 1NLUA 4LZJA 4RJTA 4KXXA 1Q1AA 3JYLA 3OEEA 5FWXA 2ADOA 2PXHA 3H5RA 3LBIA 5JAPA 2AXEA 2VYND 2H1RA 3I9LA 3NWPA 3SQMA 1JDUA 3HU2A 4E5YA 3GYBA 3OO1A 3CZ5A 2B30A 1H1LA 3IP5A 3CPHA 1T3SA 4L9AA 1YJQA 2A1UA 1RLIA 2VNSA 2FP3A 2ZBQA 4QJBA 1RQ2A 1R6VA 1WHSA 3WLIA 4ZHQB 1QWSA 2EJUA 2WKQA 2HOQA 2XWPA 3B85A 3I28A 3IQHX 5LN1A 3T5TA 1WNTA 1P3JA 5CURA 4EO4A 4YP7A 4RMJA 3UB2A 3ZWNA 1EDZA 3BRQA 4AZVA 4MHTA 3EXHB 5DXFA 2YXLA 3JQQA 1JLKA 5KYGA 4N0DA 2I03A 3R77A 1E1NA 2K2WA 3D54D 2IOQA 3CVYA 3DV9A 3BH0A 4HUQB 2JI8A 1ZYUA 3I34X 4URXR 1OV6A 3EXIB 3ER9A 3BJIC 4B9EA 5D51S 4B3IA 4RFVA 3BFKA 1QHNA 2G5GX 1XZ8A 1QGUB 2PZBA 3ENWA 4R2LA 4U9IS 5ALQA 4YT5A 4PN7A 4FGWA 5HKLA 3HRIA 5LWQA 2VI5A 3PFHA 4Q9HA 2RB4A 3KOWA 3FB1A 4ON9A 6YASA 2JJ8A 1AGNA 2BZ1A 2ZQZA 2B61A 1CX9B 3BE8A 4HS4A 3B7PA 3FHCB 3PNMA 4WUVA 2YXPX 2F9LA 4YAIA 1C3JA 1AUOA 2PL5A 3PQCA 1QMPA 4L3OA 4UOEA 1PL8A 1GYQA 3AIMA 1QVRA 1YU9A 2JVKA 4MA4A 3W6ZA 1RWXA 3BWVA 2YL2A 3KUUA 2QQ5A 2YXEA 4M1EA 2Y2VA 3TBKA 4B3BA 2P65A 2QEQA 5CT5A 1RS0A 1CUAA 2ODBA 3MLAA 3WZ2A 2BL4A 1JTVA 3A4TA 4GG1A 3CVUA 2QM7A 3AEKB 2NYUA 4J3JA 4NU5A 2QYTA 4U2CA 5AI4A 1XMOB 3LOPA 3UKJA 4TKUA 4HNHA 3A4YA 1H0KA 1L3IA 1OCEA 2X5JO 3I45A 3PGVA 1I3NA 1QGYA 1AUPA 3LCJA 4B8ZA 2KMLA 3G8CA 2IVFA 1AUXA 5EE0A 5EG5A 1I33A 4LI0A 1MGOA 4I9GA 1HI9A 2BGGA 2D1SA 4U1RA 1WXHA 3AHFA 4MS1A 1XUOA 3A6LA 3GJYA 4O6VA 4QDUA 2ONZA 3CF6R 1CRQA 3CLRC 3MWJA 4KYVA 4M7WA 2QTBA 1KMHB 3WFJA 3K09A 1K5GA 3I1FA 2QM8A 2WJVA 1BXGB 4P7BA 3N8IA 1LW6E 2JFGA 4G8DA 4ALNA 4CW7A 2ZSBA 4B4WA 1BS1A 3D3WB 3TG2A 4BMYA 1RVV1 5BSTA 1GPWB 3PIRA 1N4DA 1PEDA 4XVHA 4B73A 2W6NA 1GG9A 5KYUA 2AQ8A 1ECPA 3L8EA 1Z16A 4M1QA 2HQBA 4C3VA 5AW4A 2QXTA 4Y1RB 1VMIA 2WA1A 3BFPA 2JARA 1XHLA 2Y9PB 1Q74A 4L27A 1OBVA 1L5NA 2C5LA 3EWNA 4J07A 5CVCA 3V2HA 4ZYTA 2J3IA 2QTNA 3CHYA 4LJYA 3SYTA 4YT4A 1DDGA 4R5MA 4PZPA 5G4KB 2B3TA 3JD4A 1PUJA 3B5IA 3P32A 1QE5A 4MR9B 4YRDA 4LXTA 2D5AA 2I4OA 3UC5A 2GPSA 2J48A 3E8XA 3QBJA 1T2NA 4R2WA 2XX3A 3VDNB 1NQAO 3VTZA 2YOHA 5FPYA 4DIBA 3OFVA 3B7GA 4J0JA 4MMXB 4NHEA 4ZOEA 2GR9A 3CNNA 4IX9A 4EUNA 2R1UA 3L0YA 1QIHA 1ZJJA 3PEUA 5GY7A 3VYWA 5GZ3A 3W4IA 4GL2A 4JJGA 1UANA 1E3DA 1VPTA 4IIJB 2Q1UA 4IDPA 3ACDA 5J4LA 4ZRDA 1J9GA 4BNKA 4GX2A 2OHIA 2FQQA 1CVIA 3DO5A 1SXJD 3W4KA 3OEED 5EQDA 2RHLA 2BTQB 1HE2A 3W7VA 2GWHA 1GSAA 2WYHA 3DZFA 3WYFA 1ZH0A 4HNVA 5BWOA 3EPKA 2FF7A 2VQEB 10MHA 1W47A 5KNDA 4TYMA 2VJDA 4OH7A 5ITZA 2XQVA 2FRVA 2A9FA 3STTA 1DC5A 2YIJA 4I4TF 1VPVA 3BJEA 1N3IA 3N9IA 3Q9SA 4EJFA 2ZUBA 5TF4A 1NW9B 1KQNA 3IPXA 1EBBA 2JLRA 1DX9A 1RI4A 1XZHA 1SCNE 1C4KA 1UK8A 1YAJA 3C6QA 5IDYA 2DC1A 2ISCA 3W90A 1UODA 4A8JA 1YJAA 4FYPA 3ZCPA 1DQYA 1UPAA 2D6FA 1LK5A 2DG2A 1PQPA 1VIYA 1P75A 2WOOA 3OQHA 4QO7A 1QTQA 2XMGA 2BFNA 2R44A 2ZBUA 1WP4A 4JP5A 1E7RA 4FBGA 5ITWA 4WKGA 2PRIA 4O4IA 4UU0A 1XAHA 1O77A 2MYTA 2A88A 1JG6A 4HQNA 4N5IX 4CIXA 2ZRDA 6PFKA 1BDIA 1C29B 2NPOA 2O2EA 5KWSA 2OVFA 1XMVA 2R1TA 4G5SA 3IILA 1RJEA 3EBLA 1WVMA 4J0DA 4C22A 2Q0XA 3L01A 2IS6A 1KP3A 3O90A 2C4KA 5HEKA 3RS9A 4FWBA 3AF2A 3NTQA 3Q9NA 4GQBA 3UM9A 4BKOA 1WPRA 2OV2A 3MF4A 4RVCA 3PDIB 3ZZTA 1U63A 3H42B 2DB3A 3UAGA 3EF3A 2GERA 4BMXA 1RC0A 1YASA 2Q1YA 4NMMA 3RW9A 2FFBA 1BE1A 3IUPA 2BHTA 3PHIA 1T9KA 5H59A 3TE6A 3WJ1A 3WP1B 4B83A 1UL1X 2JH3A 1XXHA 1ATZA 3LRXA 4FDUA 2W2VA 3K6SA 3FHTA 4POOA 1TTHA 3X1YA 3ZTWA 3SBEA 5HRUA 2Q5OA 3KJHA 2PGJA 3ZGNA 2R1VB 4AT1A 4F2GA 4X1KA 4ARZA 3JWEA 3X2EA 1R50A 5LYJF 3PXDA 4L08A 3K0CC 3SIXA 3ADDA 2O07A 1C7ZA 5BQXA 2GZAA 4OLFA 1U11A 4RYLA 3WYGA 4C0KA 4LX8A 1UADA 1UPTA 2QV0A 4WH0A 5HUQA 3KOUA 5JNLA 1KO1A 4PQRA 2WF9A 3UHPA 5KINB 2IPLA 4BFWA 5EXDA 3BWEA 3S40A 3QXCA 4R2HA 3UJCA 1HT2E 1PSDA 1ZQ9A 3BK1A 3FWHA 3G02A 3ME5A 4KWHA 3RUCA 3MRXA 4E6PA 5HIAA 2EZ4A 2WF5A 3JAKA 1LU9A 1YBAA 3S5UA 5FH9A 2QG6A 2ZLBA 1A0OA 1T5HX 1P0FA 3EH2A 1ESEA 3HUUA 3OT4A 4ZO4A 2BGJA 5ECWA 5KTNA 1ZITA 3AV3A 2OP0A 3LGXA 5LYJB 1GPMA 2ZKIA 3O9MA 1OBCA 3QPWA 3NOXA 4X6YA 3ABZA 1OXBB 5CW2A 1KDZA 2OCDA 2OK8A 3AVOA 3D6VA 1Y8AA 3FZEA 3OFNA 1ADYA 4JIMA 1NWCA 1HYEA 2F64A 4TYNA 3E3OA 3REOA 1XZPA 4PG8A 2AG5A 3REFA 4J4TA 1WXWA 3T5AA 1LDYA 3G0GA 4YT8A 4GUDA 1E2FA 1LLUA 3MTIA 3WYEA 2XEDA 1XPRA 5LOVB 4TVOA 4G0MA 4QU9A 4MVCA 1C0PA 1UBJS 3C41J 1ORTA 2ZPUA 3RLFA 4IEFB 3LHIA 3BZUA 3K1AB 4HEJA 4Y2SA 5H3HA 4D9HA 3IS3A 5F2NA 3NC1C 1I5OA 1OYWA 4DV4B 4KOEC 4V1CA 4RHCA 5HYVA 3QVMA 4LHYA 1CJCA 1IDOA 7MHTA 2O8CB 5L3VA 3U16A 1Z3CA 2LBPA 3B60A 4QFDA 2VZEA 1YI0A 2LCFA 4Z7QB 2MR6A 4GRIA 3TO5A 1M8PA 2VHUA 2V6MA 4BJ1A 1GOTA 3PL5A 1KBOA 3O8QA 3AXSA 3RS7A 3LH5A 2W58A 1ZVKA 1RQRA 4OQYA 4YREA 1VZ2A 1XRNA 3L7LA 4JBHA 4NE2A 2CHVA 4WCFC 3Q7IA 3HYCA 2AQKA 1SIOA 4AROA 2IPNA 4RDIA 1VP3A 3G0OA 4QQFA 3RSZA 4B43A 3MIIA 2OBNA 1VG1A 3W7BA 1I32A 2IF0A 1UZUA 1J2JA 1W1IA 5E6RB 1E18A 4ZAFA 3CJTA 4R8VA 4CKBB 3RG8A 4ENSA 2G09A 4PCUA 3G2NA 4U8GA 4DWJA 1S1CA 1NATA 4NJMB 1SPXA 3EOAI 3KS9A 4OHUA 1Q92A 2CLMB 1KQGA 2JGAA 4X8OA 1BO6A 2VWHA 3DFMA 1O94C 3H9GA 3ANSA 3G2JA 3JWIA 1IFXA 2FLKA 3TLBA 2NT4A 1XDUA 1AKNA 4CT0A 4PPGA 3CVJA 2PLNA 2YC2C 1CQIB 3IDOA 4QU0A 2FQWA 1E96A 4E4RA 1VHJA 4KIJA 5A1TA 1BRMA 4BPBA 5HIKA 4NQRA 4YX9A 1WV1A 3SD7A 4FNGA 5A5FA 3PHHA 1X70A 3PEVA 4MRSA 2D2XA 2WILA 3IEIA 4UHJA 3QF7A 4AJ4A 1BJRE 4D9BA 3NT5A 1YJBA 2XDAA 4UVDA 5JROA 2ODWA 2ATEA 3R5SA 1AD2A 4BNIA 1EWTA 1JJ7A 4BQSA 3PWZA 4PIVA 1G8PA 2OLEA 3UQZA 4CMIB 5FYDA 3ZCVA 4MQUA 3K70B 5EERA 5BSVA 4R1QA 4IS2A 4UHCA 4BO6A 1Y6QA 2P91A 2SKCA 3N3AC 1EKXA 1UEXC 5TX7A 3NYRA 3RHFA 5TIIA 1Y98A 3KYBA 1SU7A 3AFHA 3HWSA 1JIXA 4II2A 3BA1A 3KQUA 3R5KA 1W5SA 5AHRA 2REXB 3UXHA 4PLPA 2R7MA 2YYAA 2Z5GA 3F4KA 1RLMA 3HUFA 4HMOA 1T13A 2QW0X 1YXMA 3O8OB 1DLIA 2AQHA 4F3TA 1GKKA 2ZI4A 1VRWA 4YMSA 1W4LA 2Q0HA 4BO7A 3VA7A 3GCGA 3CRW1 1YJ8A 2V6FA 3UTDA 4Y2YA 3TR5A 4ZYYA 1QV9A 1UBRS 4HDMA 3OU2A 4MP3A 1FYEA 1ZSNA 5EJ7A 3DFKA 4WACA 1MJGM 2YHIB 3TRKA 1ZIDA 5FWNA 4XJXA 1UC4B 3GH1A 3GPBA 3S7TA 1PFYA 1PWYE 1BVRA 2I3BA 3EFBA 3PC3A 4O3FA 3EG5A 1H4QA 3FYUB 1IM8A 2EKBA 4OPMA 5K2MA 1V5EA 3W9SA 5D85A 3BH7A 1Z36A 3SC2B 3VTFA 1L7DA 2VSFA 1HLDA 5H5JA 2FP4A 5C5EA 4OJMX 5K3EA 4ND8A 4CT5A 4NECA 2A94A 3AI3A 4X41A 5T4FA 4F06A 4H7DA 2WD9A 3GJQA 4QFCA 5KVCA 1U0BB 2ZCUA 3B5JA 4PW0A 4ZEWA 5LDHA 3GP8A 1PZGA 4JLUA 4L5JA 3OKFA 3OT1A 4ETMA 3IT3A 5E7IA 2BP7B 3BFJA 5C5IA 4OU5A 5I01A 4K9KA 1PR5A 1ILEA 1F3OA 3ES9A 5DHFA 5D5HA 2AXPA 1GFZA 3HJRA 1TQ4A 3BD6A 1SQFA 3IOYA 3EQ8A 1KDTA 4NCHA 3UZUA 1MO5A 3TIVA 3X1DA 5T6MA 5JS6A 5CX1A 1WZNA 1ZIYA 3L7AA 1E1QA 3QMPA 1CK4A 1G7RA 1Q50A 2REOA 3FWYA 2XGJA 2I8LA 4M38A 5HKKA 1SQ5A 5CA1A 1XTRA 3FNIA 1MVNA 4F5WA 1ZXXA 1FL9A 5IBQA 4P2GA 2WM2A 4PRYA 1M8JA 1RRFA 2VRBA 3KUXA 3L07A 3EA4A 2XUKA 4U3JA 2HHAA 4O2BB 1U98A 4QU8A 3SM9A 3D1VA 4ZGBA 4W63A 5CAEB 2C5HA 2OSVA 2R8EA 1FFXA 4F4JA 1EVLA 3WYAA 3ZKWB 1Q0SA 3V8VA 5JYCA 4QO8A 1NQOA 5EZ6B 1RWNA 4E7OA 4MPJA 1U2EA 2ET6A 3BMOB 2NW6A 3GN2A 4MYTA 2JI4A 4QTZA 1A5BB 1SFRA 4QD3A 2F3TA 3TLCA 3NBUA 3DL4A 1GCIA 1JFFB 1OI3A 1G17A 2JGEA 1XA4A 5DVZA 1K3TA 4JSYA 1DAGA 1Y7LA 1KY2A 2BMJA 4EJSB 2CLOB 1LSSA 4LZOA 2EWMA 4YV2A 4NU8X 1QG0A 2R2AA 1YA8A 3Q72A 3R7AA 1AK9A 2ZJ7A 3MD0A 1ID8A 2E87A 4FFDA 3RFVA 4D56A 1MOPA 1ST2A 1TKAA 4D44A 1FU8A 4PLFA 4TL9A 3WL4A 3NHBA 2JATA 1P9WA 4MGYR 2Z6QA 2WWFA 5LFAA 2J0SA 2W2LA 2RIPA 1XQ9A 1YS6A 2ZVQX 4PIPA 4E94A 4NYMQ 5I6DA 3ZZMA 2L18A 4WAUA 5ALYA 5K0SA 3TTWA 1ZJ5A 4Q18A 1CKEA 4EJMA 5ALGA 3PC2A 2V9CA 4UE2A 3F6CA 5KOHB 4NYIR 2WYUA 2BONA 4M88A 1RVDA 5T5QA 1JQBA 4G8CA 1JPUA 4NHOA 3BSWA 1XF9A 3M5PA 2OHFA 4TKMA 3D7KA 1VIMA 3L7IA 3HABA 3NC0C 5TC4A 2KM1A 4QPZA 1XRPA 3TJRA 3IV9A 4OOEA 1AT1A 3UVEA 5AUOB 1GRVA 3M5WA 1HLFA 3QU4A 4EP1A 3HDVA 1ENYA 1O6GA 1TMYA 2YZKA 4NS4A 4NU6A 1PHRA 1F0YA 1ZW1A 2CF5A 2ID4A 3IEKA 4ILKA 4II3A 1E2GA 1ADGA 4NDZA 3UYLA 4OLBA 2QGFA 3B52X 1QTNA 4NV3A 3DHYA 1B8OA 1HMYA 1I4DD 1TJ4A 4U5XA 2NSLA 5A0VA 3SSOA 1V9SA 1ZH8A 1W52X 3HZZA 1GCOA 1Y4SA 3MELA 3TYXA 1GCGA 1I6LA 2MT9A 5B1DA 3OP1A 4E13A 3KSRA 1VSQA 3AEXA 4TYQA 3GGGA 3OJCA 5H70A 4PR0A 3OE4A 3HCFA 4H0FA 1J49A 3IP9A 4RXTA 1J2TA 3I37X 3OCJA 4YRLA 4BEJA 4JV5B 4P5EA 2F1KA 3LL4A 1ZWLA 2HYIC 5FFNA 2EEZA 3E2IA 1OC4A 1TK3A 2YY6A 1E6UA 2CUZA 2AFIB 3E9QA 2ZJAA 3IA7A 3F8WA 1SXJE 2CDRA 2PWBA 3EA0A 3BUSA 5TQ2A 1TLFA 4TV8A 2ZRGA 1RC8A 2OCYC 1OXTA 3C15C 1M6EX 1YVEI 2WJ3A 5IJ0B 1NURA 4KIGA 4LRTB 5DTMA 3ROGA 3KXLA 5F1KA 1M5UA 2QF7A 1MO4A 1CSEE 4W5JA 4C0QC 5C1OA 4OLAA 2XVAA 3BAZA 4QHTA 2CJYA 3WAGA 3OEWA 4MAAA 1SCBA 1QR6A 4TWIA 2VJKA 3Q3CA 2W6JD 2OMKA 3QW2A 4GGPA 3FTDA 4BX0A 1Y48E 2C3PA 5KPJA 4BO9A 3HVRA 3VJRA 1A7UA 1SELA 5IPFA 5BR8B 3LBNA 2P3LA 2WP8J 2JLZA 1SD5A 4HO1X 1VPDA 4JENA 4MVJD 1L3BA 3ROZA 3M5CA 4F4DA 3ORRA 4HJRA 3UW1A 3TXXA 1GZHB 1B14A 4EMTA 4EO9A 2PUVA 4L2IA 1U65A 4TPKA 1U94A 1DJMA 2CXRA 2EDCA 1CFJA 1KDRA 4RY0A 2H5IA 3IAM6 1OI4A 1W581 4F72A 3VR5H 2GJ9A 4DSNA 2DVMA 5C1BA 4CLDA 1DG3A 1OFIA 5F5XA 3CBGA 1FW8A 2XDWA 4EW1A 5LQNA 1HFJA 3GPCA 2WICA 3G23A 1Z5OA 3KCNA 2QMOA 1Z25A 3DUWA 3BF8A 3NIDB 3ND8A 3CW8X 4ZU6X 5U4XA 2Z8YA 4HJXA 2JFQA 3G9UA 5J40A 1E5VA 2DQ4A 4DCTA 3QKTA 3TAXA 4G0PA 4OF4A 4AY3A 2Y66A 3QU2A 4C9BA 4EB3A 1MOZA 4N9WA 1P80A 4HZIA 5JDIC 5KAPA 4KKVA 2O3QA 5JTUA 2RKOA 4YJ2B 2OBBA 3ZH9B 5F76A 5GINE 1OFUA 2AI1A 3EULA 2I2XB 4XUGB 3PR2B 2VF4X 3ASZA 1U3FA 1CZHA 3UGTA 2EATA 2YS6A 4MA0A 3GLHE 3WGVA 3F73A 4YJFA 3OPMA 3SYKA 3VZCA 3CW2A 3ZI7A 2Y1GA 1F20A 3LPLA 4Y6SA 5AUPB 4Q05A 2NQ2C 3VNBA 3CN7A 5M34A 3PQ6A 1N2BA 3V6MA 3KUKA 2CLLB 1M2VA 1RWBA 4N5HX 1CF2O 4P4GA 5FAXA 2DWQA 2HA3A 5KUTA 1TB4A 1H8EA 5EMJA 2WZQA 1RPAA 3PPXA 4ZEXA 2DERA 2JHGA 4PG6A 4H3VA 3WY9A 3PHGA 3TLJA 4F5EA 1EGHA 2LIPA 4WK6A 3U7FB 2QL5A 1SQSA 2WUWE 1Z5GA 5EMKA 3TH5A 1A7JA 1QIDA 3MOSA 1SB8A 2RK6A 3SEAA 4G01B 1VLLA 2EFDB 2A1TS 2VOJA 1ZHFA 2NAFA 3PV0A 2G9NA 3M9XA 3LHSA 3AF0A 5CH5A 1XDZA 2NTNA 3DE7X 3MGAA 5DIZA 4B47A 3P19A 5HCUA 3GLUA 1X7WA 5BXQC 1I14A 3ROEA 3TZ6A 2ZUFA 3V4SA 3FDZA 4MWDA 4YR9A 4I55A 1FU4A 3HWWA 3TVTA 1WUHS 3WDMA 1OWLA 3C3YA 1ZOSA 3KFVA 1XCOA 4P08A 4UEKA 2VT3A 4XUDA 1JFTA 1B0AA 3ZV7A 2WAOA 2AN1A 2AOUA 3R20A 5ADUS 3ZNNA 1M75A 3TZBA 2PA0A 2NGRA 6REQA 3CH7A 2VZ8A 5L7YA 3A6EA 2LZ0A 3I2GA 1JKMA 4NMLA 1U0HC 3T4XA 1YJCA 5CXQA 2R8RA 3TLYA 3PUJA 2CJWB 4OSOA 4LBYA 4KE8A 2GFHA 1OFUX 2VRCA 1JT9A 4F8EA 4W9MC 1M6YA 5JDCC 2F2TA 4JJ6A 4LK2A 4TMYA 1ZSYA 3H5NA 4IJ5A 2PVCA 3EGXA 2MHCA 1R0RE 3QVLA 4IXNA 5CJ2A 4LNUB 4RANA 4YBZA 5AK3A 1C9KA 4YPOA 1QXSA 1PJCA 4GKAA 1QUFA 4R98A 3H2BA 2OBXA 1KJQA 1VSTA 2IHJA 7GPBA 3AQIA 3I09A 3ODGA 5B6IA 4QDXA 4REQA 4X0EA 2K7FA 3FLMA 1LSUA 2P1DA 3GJ8A 2IPAB 2YW2A 3D2AA 5ILQA 2NAPA 5I5GA 2SICE 2IVZA 3K96A 3CCBA 4WJKB 3KL2A 4YRAA 5SYMA 4FYKA 2AXNA 1K89A 3RNOA 3NBXX 3VX3A 3R9WA 2DSTA 3P9YA 4MJ3A 4UNPA 5IT4A 1S2NA 1R16A 4FYHA 4OD0A 2NXWA 4G5OA 4YV0A 5I3CA 1FNNA 1MIHA 4YQFA 1SOAA 3ML1A 1QX4A 1VIAA 4RAOA 4B84A 3NDBB 3AWDA 4RPHA 3D2LA 2XY4A 5E9QA 3R7WA 3PENA 5B1HA 1SUPA 1CJTC 2AHOA 2PD6A 3RUHA 3KQKA 2FRXA 3KR0A 3K5HA 3LVBA 5AIBA 5H02A 1PNQA 3B9BA 1ZK0A 2G8NA 3ABOB 1U9IC 3DTYA 1ZRHA 1TM5E 4JUBA 3HY3A 5EFZA 3M1AA 3F3MA 3CCCA 2R4QA 3MJSA 4XXHA 3RVSA 3AEUA 1JFVA 3KM0A 4LOKA 1GTZA 3DR3A 3GP5A 5ALNA 1NYTA 4K9SA 1DJLA 2WJGA 3BH6A 1QANA 4YRIA 2PBLA 5GTDA 5JASA 4L57A 1PJ4A 5J23A 3Q5DA 4IJUA 3WX0A 1VE7A 4QJIA 2WPDD 2O2GA 2G17A 2UVPA 4TLDA 2OFWA 4URFA 4AJPA 2CXSA 3IUYA 4YRZA 5LXTB 4PYRA 5PNTA 5AVJA 5ARBA 3OCWA 2A9PA 4JH0A 4EG5A 1MO2A 1UMDB 2XNKA 3UMMA 1UBEA 2X0KA 1JN0A 1M6NA 3NTXA 4GNRA 1E1QD 2O0LA 3G8YA 2FPMA 4JKOA 2NSDA 2ZAYA 1DP4A 1M8FA 4I36A 5LZ2A 1NVTA 2GEFA 1G3QA 2X2OA 2O3TA 2V6JA 5FPQA 3OECA 3OQVA 2HJRA 2XTJA 1DKLA 3FYTA 4EL5A 4WZAB 4DC0A 1E8DA 1K8XB 3GCWA 3JX9A 2XODA 1PGQA 3S1AB 1N2GA 1MX1A 5INTA 3PF8A 1MEEA 3H99A 2F9FA 3TQSA 3MJHA 4ESOA 3GPIA 4FUTA 4J0KA 1MQ9A 2WMNB 2ZUUA 3NJRA 5AW3A 4HH0A 3Q0IA 5G1NA 3UG6A 2WKRA 1HMPA 3LYUA 3CPSA 5TGZA 3R8CA 3N0WA 4BE9A 4ETWA 3GFOA 3P71T 1G5QA 5SZHB 3UK0A 1BHO1 2YKGA 3GJTA 2XYHA 4AW9A 3NDJA 1YS2X 3R76A 4F3CA 4B09A 5FOVA 2Q3JA 1STOA 1U0GA 2WT8A 2WFZA 3AEQB 4H15A 3R9KA 1V47A 3L8DA 5EUCA 1IMJA 1S8AA 2C3MA 1EG2A 2QPOA 2VP6A 1R3DA 3K0FA 3M6LA 2ZR7A 3BXXA 1YBVA 3Q3JB 4MUHA 4QUKA 3F6EX 1POXA 1V2HE 1YD7A 3O93A 1KSHA 3PNSA 1N7GA 1K4KA 3ENVA 4IV0A 3UBMA 3RSFA 1TI7A 3QYPA 4GUAA 2VJPA 4UMEA 5JTTA 2F3PA 4C5AA 3WB0A 3NJ8A 3B6KA 2REQB 4NBVA 4P84A 4F12A 4EA7A 2Q7DA 3OUTA 1GPNA 1KL7A 4UQPA 3PKJA 1YCFA 4WFJA 1FFGA 4W5TA 1A71A 1FUKA 2J0VA 2ZJFA 3D1JA 4M87A 1SN7A 4O4LF 5HMMA 2BGLA 3ECAA 3TIGA 1QQ5A 1RJDA 3MPOA 1C9NA 1NT2A 3N1UA 2AJBA 4IVQA 4BQOA 4HWTA 5P8WA 2EX0A 1B2RA 3L77A 4JLNA 1I1OA 3LQRA 4DCGA 3L84A 4NG5A 4RHTA 5CA0F 3I8XA 3SZOA 3EDRA 3F1LA 3RFCA 1SUAA 2ZBRA 3L7BA 2OFFA 3JRWA 4PZLA 1NHWA 4UEQA 3H8JA 3ONWA 3QE4A 3EG9B 3UAXA 2O4UX 3NP9A 1UQTA 3AJ9A 3GNLA 1K7FB 1W59A 5JNSA 4MKGA 1X1DA 3QNMA 4O4IF 4Y6RA 4IHAA 4CF4A 4KH0A 1G8MA 2Y3IA 2NUAB 2ZSFA 3QMVA 4TM7A 2H65A 4FYJA 3I62A 5CG1A 3I0ZA 2HRZA 1OIWA 2VYCA 5THXA 3UAWA 1DKUA 3OURA 1D7OA 2VQDA 4KTVE 3OZTA 4KYUA 1OXMA 4CKYA 4NE9A 2C83A 2NT3A 4BTLA 1ETHA 4BP3A 4ZO9A 2WV7A 3EGOA 4D0NA 2WFAA 3DMDA 4YMIA 3CZPA 3FGOA 3COJA 2XQJA 3PWSA 4WV3A 2BEVB 4P3PA 4LYAA 2HZBA 3SKVA 1IG0A 5TR9A 3RC9A 4MCJA 3TD2A 2V7BA 4FW8A 2C00A 1QPBA 4D42A 3CX7A 5BXYA 2DPGA 2XA9A 3VISA 1DFIA 5G4KA 3WZLA 3HXKA 3ZQJA 5JO0A 4ASUD 3P9KA 2A35A 2HLDD 2Q3HA 1O9GA 5DYIA 2H57A 2R3SA 5JLAA 3K8QA 3ELWA 2BFEB 5JZVA 1K0FA 4OQ4A 2G06A 1O1YA 2ZIVB 4DZTA 5L53A 3W6PA 4OMFG 4TVBA 2UUBB 3WHPA 4GH5A 2H11A 2B83A 3C8UA 3N5KA 1QJCA 1Z4KA 3L2OB 1DTSA 5C0OE 5LYJA 3VR6H 2P9JA 1GUZA 1PT5A 2PX8A 4FNOA 4NV1A 1QTRA 2HMTA 4G2NA 1PUXA 1FMJA 4PNHA 3GZNA 4RCZA 4WPGA 4GF5A 4ARBA 1GNRA 3G85A 1SXJB 1UAGA 2C1XA 5JW6A 3H3XA 4Q12A 3FFWA 4JQSA 3ULKA 2ZVDA 4MR7B 1RMYA 1Q95A 4QOIA 4S1NA 1CR2A 4H4CA 3O6VA 4OBBA 1Z12A 5IM5A 3RS2A 1NNEA 4NBWA 5C7LO 1QYRA 3L9XA 1TT7A 2ALJA 4Q47A 4RTPA 4CKWB 4JOQA 4A27A 2IYEA 4X3CA 1LVHA 2Q3MA 1YKFA 1Q5PA 1EFPA 3D1LA 1GLVA 2HMWA 3UWKA 1ODKA 2BW0A 1NR1A 4ZYUA 1VKHA 1U2SA 2VTVA 1RIIA 4PZ0A 2DCUA 1JIJA 3GU3A 3LZ6A 4W4TA 1BEEA 4X00A 5DXAA 1IHDA 2CBXA 3WIUA 1OYOA 4QM7A 2WZDA 1YMUA 2BH9A 3JQFC 4PZUA 1JBQA 3RQIA 4MNTA 4NG4A 3HSSA 4NH4A 4V24A 5K05A 1JG2A 1E1CA 2EFGA 4LJAA 3S2YA 4JI7B 4V39A 3QU5A 4AKEA 2XYGA 3S55A 1AHIA 4BUCA 3D7SA 4G65A 4HAOA 1Y37A 1Z4MA 4FOPA 3ZQUA 3HBLA 3GRVA 1VJRA 2EARA 2GBIA 2JIMA 5F1YA 2Y92A 3IOBA 2G76A 4NENA 3ORFA 2EFJA 3QVTA 4J29A 4RF2A 2A0FA 4QXMA 2NTVA 1R6AA 4MKHA 1YDMA 2CXUA 3KQVA 4LY6A 1PKXA 1DO2A 4GEKA 2YZ2A 3AZQA 3AU8A 4GEGA 2FKNA 4JVLA 3HRHA 4LXYA 1NKSA 1OIVA 3DVRX 5I9SA 3D6JA 3WL6A 4D9NA 5IJZA 1W0CA 3IXQA 3HBAA 1ISPA 3D8NA 3JZFA 4FYYA 4M60A 2N3ZA 1F8UA 1RYZA 4E11A 1BMTA 5FI3A 4NOJA 2I8CA 2XT6A 4BMVA 2AE2A 1WMDA 1XN4A 5EJ5A 1PK9A 1XRJA 4DCOA 2HJHA 1NT4A 2O6LA 4Y9DA 1IVNA 3R9IA 3X2SA 2GS9A 3KKQA 4LJ4A 4EF5A 1EXNA 1JWBB 3I05A 2VPYA 3PKZA 1I6KA 4PTZA 3WFZA 5AVXA 3GJ7A 1NX9A 3IBCA 4LECA 5FEUA 1UPCA 5KB3A 2VK1A 1VYVA 3G8DA 2Y9MB 2FJ0A 1FY2A 2R6CA 3NOQA 1CEEA 4CDRA 3DE1X 2WB2A 2VC2B 1TM7E 3RR2A 1MQAA 2JC3A 1E2EA 3M5DA 3PIDA 2JKYA 3IKJA 3GWZA 4MV1A 2AFRA 4KUHA 2OV3A 1CS4C 1U7PA 3HC7A 3FNHA 4R05A 2NO0A 3C14C 2WWRA 4YALA 2PWPA 5IVDA 1MUUA 5FWXB 4TMKA 4AX4A 4W6ZA 4LOIA 3AVPA 3R7SA 4B4OA 1GLNA 2QTHA 5JXJA 1TO6A 1CB0A 4L5BA 2PY6A 3PYXA 4MCAA 4CIWA 1F6BA 4I1OA 4UU7A 4TUYB 1IOVA 5DX0A 1WZ2A 2XOXA 1EXDA 4KQEA 1RXWA 1WCXA 3AUXA 3NV7A 5CXXA 4IV8A 2RGEA 2C7RA 2KLBA 1Y5NA 1ZH2A 3JVVA 3TTSA 1PQWA 4AS2A 4WJLA 1N7IA 1DAFA 1NW4A 1HYQA 5IAKA 1HBJA 2L82A 3BSSA 1UFKA 2XH8A 1E2DA 2Q27A 2QPTA 3RREA 1TA9A 4GVPA 1JR2A 4MO9A 1RWMA 1GRCA 2OG1A 5TQJA 2CNNA 3R0QA 3MJFA 3OTQA 3R1IA 3RJMA 2QN2A 4JASB 3WJAA 1EIZA 3EC2A 1QHXA 4RMHA 3SR4A 3GRZA 4ZJPA 1TX4B 2XWBF 5A4KA 5FV4A 4IYJA 1U9ZA 1W0JD 3L4EA 5GQSA 5EXEA 4U9UA 3U7QA 5H9VA 2ZUEA 1TE2A 4BKQA 4D0RA 2GM9A 4I50F 5D86A 3OPNA 3RU9A 3CH5A 3QKWA 1JHXA 1EB9A 1C8VB 1NJ2A 2WHYA 4IV5A 2XEXA 2X0FA 2XE8A 3BL5A 4LWPA 4WZBE 1SO8A 1BN7A 3AWIA 1P7PA 2WW8A 3C6BA 4OP1A 4UFPA 3DT9A 4MVJE 5E7QA 2GN0A 2AW3A 1EQ2A 1TM2A 1YRQA 3ILYA 1WU7A 4LBZA 1L4GA 5IEBA 3ZDAA 4LMPA 4MKIA 3TSAA 4WL0A 1YS4A 1E4YA 2I62A 1E7MA 1X1BA 3FMIA 1C3EA 2CLFB 3PQDA 5YASA 1SVMA 3SS8A 4BQQA 4O5AA 4KDEA 3T9FA 5M2QA 3IAFA 1X1AA 1OW3B 3K9LA 4J0QA 1P60A 3GEDA 2QE6A 1J22A 2PL9A 2LDBA 3LZDA 1V8PA 1C2TA 3KUCA 2IU0A 4AWBA 3A2KA 2I3ZA 1XMIA 1N2CA 1OIXA 3EAGA 3U4GA 3ZN2A 3HQ4O 3NJ4A 1R6UA 4WOBA 5EYPA 1PNRA 1HQDA 2X8WA 1YBFA 2ZATA 4XDYA 5A3JA 2ZANA 4D3DA 5IKEA 1HYGA 4AJOA 4EA8A 3A6GA 2ZCVA 2ZI5A 2CY0A 3CRZA 2ZUTA 4YRBA 2H1OA 3R4CA 3QF4A 5AYVA 3IQIX 5KTSA 2W2MA 4I3GA 3AOEA 1N34B 5EHQA 1R4MA 3HMKA 2OCIA 1D9ZA 3HJBA 4EGAA 1KJIA 1RJWA 3WRWA 4G85A 3L49A 3HWX1 1Z07A 1KMCA 2HFKA 2WIFA 3QLVA 1UJ6A 2FXVA 2ZYAA 4RY2A 3NDPA 1H6CA 1E9BA 1GR0A 1E6EA 3QJGA 4WFKA 4X90A 4ZT5A 1FJGB 4QICA 2PTGA 2P6OA 2VR1A 3KPVA 3NOOA 4UPEA 1JDZA 2UYGA 2ZT6A 3D3JA 2YWEA 2WSSA 3AVQA 3GFRA 5TS2A 2IHKA 2QVGA 2YICA 5A9RA 3JSXA 1YVDA 1ZX1A 5KJFA 4M89A 3ZE8A 4DXDA 3CVWA 3LT0A 2PJDA 2VDJA 3CX8A 1UC5B 1LPOA 1Y6JA 2H4JA 1QQBA 1VL8A 1C7QA 4JYZA 3C6YA 2ZAGA 3EGDA 2RSLA 4PS1A 2GPTA 1ECBA 1Z33A 1S02A 3BRWA 3CXRA 3O2JA 4JB0A 5ALFA 5TVGA 3LC2O 1B00A 5HIMA 2C58A 3G8BA 5EE9A 1XWIA 1OT5A 1KEEA 3PWKA 3QLVC 3TS1A 5DWDA 4A5SA 1M5RA 3EXFA 3H1FA 2J9ZB 4M1YA 4MB0A 4DMGA 1EUCB 1T3ZA 1SC3A 3CLHA 3FDXA 3ER8A 3GGJA 3SBOA 1LJUA 1QR2A 3ZDQA 2E49A 1H1LB 3NYQA 4DY4A 1XZIA 3N7AA 1PG0A 4J49A 3ZBPA 3NG1A 3TK1A 2Z2JA 4EKEA 1TUBB 1Y0BA 2BUAA 2K5UA 3N8DA 4D02A 4KHZA 1QQTA 4AMZA 2GN4A 3EDMA 3ZYZA 2VYNA 2P1ZA 4IJ6A 3RNLA 4AJ9A 4L0DA 4CM4B 2PG3A 1WG8A 2CMDA 1KIFA 3MGCA 4K26A 4UD6A 4WZ6A 3L4KA 1EFAA 4MQFA 4REOA 3G8AA 4Y6GB 4OXQA 2IUSA 4UFNA 4V0KA 1Q7TA 4NMXB 5SY6A 3TUJC 1DEKA 5A2GA 1VJ0A 5K51A 2WSLA 2Z08A 3T35A 1Y3AA 1C1DB 2QP9X 4HDKA 2GTHA 2EZ9A 2HB6A 3TJMA 4DLPA 1B74A 1SUEA 4Q3DA 1N36B 3IQEA 5I9IA 3W8EA 1QPZA 3G0IA 4TQ9A 4OHMA 5COQA 1DPFA 3FZQA 1PP4A 4GX1A 5LZ9A 2W71A 1TFRA 1PJTA 3F5MA 1QE0A 2FI1A 3RHZA 1N6KA 5EQTA 1TO2E 4IIUA 1NUQA 3GARA 5JAOA 1SVWA 2I65A 2LXNA 2YC4C 5EIOA 1IBKB 1CNEA 1WBBA 2BI7A 3C4QA 5C1IA 5AIAA 4MUJA 4L15A 1JFLA 3I5UA 3LPNA 1PWXA 1G21B 3RIEA 4I1SA 4MIOA 1P4GA 2Q2OA 3MWGA 4H7IA 3AKZA 1MOSA 5FA6A 5GIOE 3EFEA 5DPMA 4ZVVA 3MTJA 2PE5A 4GPTA 1C7RA 4WADA 4C7OA 3SVZA 1G42A 4ZZIA 4R1TA 3LRTA 1JG3A 3R6DA 2X0EA 1S6YA 1E9RA 1FXWF 4TL8A 1NE7A 1V16B 1WB4A 3MBKA 4LNAA 3RJZA 4C4TA 9MHTA 4GSKA 5I9NA 2E3JA 4CVNA 3AF4A 3MPUA 5EFOA 4YMGA 3MC1A 3CKKA 2F1IA 3V33A 4NBLA 4K0KB 2NACA 1ODIA 1ZD9A 4LE0A 5IJ9B 4C1NA 1XDBA 4GRAA 4ZVRA 3UHAA 2DWCA 4AS3A 5HQTA 3QX7A 4BGIA 1P4HA 3U13A 1EHCA 3DD1A 1NMZA 3S2FA 1RTKA 2O5RA 3IDZA 3AKCA 1Y1TA 3EUWA 1M6VB 1IUNA 4NATA 4QELA 5JCPA 4C30A 1ELOA 4NCNA 1U0RA 4FSDA 1OY1A 2IP2A 4H1UA 2BEWA 2PGIA 2AJLI 4KXFB 3KV3O 3LK6A 3QUSA 1L5VA 3VC3A 5C3MA 4LS3A 4C7MA 3ZE1B 5LKAA 1YE3A 2I7TA 3OMXA 4IHQA 4MUYA 1NULA 4TV8F 3UJDA 1YF3A 2CCJA 1G64A 2QTMA 1P77A 1V43A 4D25A 5EMLA 1PQ4A 4UJ3A 4HYEA 3GT7A 2UUCB 2DPXA 3I04M 1SHZA 2ORYA 2BR5A 2QRUA 3HYLA 3R0IA 3ON5A 5A62A 3TQFA 5K45A 4AN4A 5L6LB 2MINB 4GNKA 1B6SA 4G1BA 4YDSA 5KQLA 3VMFA 5KTKA 3JALB 2GB4A 2XIJA 4F4FA 4AKSA 2J3HA 4MDYA 1PZFA 1NNSA 1YKSA 4TTVA 3ZJVA 2NU6A 2GRJA 4Q3CA 1J8MF 3RVNA 3FBTA 3HMQA 1A9QA 4INPA 3NYWA 2FEKA 2BHSA 1REQB 1CJSA 2L42A 4HPXB 1BJTA 3JAWA 4JEHA 4HZUA 4ED9A 4X20B 3GDWA 4FQ5A 1E64A 1JQAA 3BIJA 4INJA 1IC6A 1KFEB 1FXWA 1Y1QA 2IDMA 3K2BA 3L40A 2AG6A 3MBIA 3O8LA 4EJ0A 4A15A 2ZI7A 1E7SA 3RVQA 3MTAA 2YDYA 4QPCA 3M4YA 4BGUA 1LNZA 2HUPA 4UBIA 5JWRA 5KDDA 2OCBA 5LBUA 1QYIA 2DBYA 1AS3A 3EJWA 1PQUA 1ZPDA 1DXYA 2JFZA 4QPNA 2O1SA 3S7ZA 1XNQB 1DINA 1A4IA 2VJOA 2J6IA 4OQFA 3CNQS 1NJSA 1RI3A 1XFDA 2PL3A 2HJSA 1EBUA 3D0QA 3QFRA 4QUBA 4JQYA 4RADA 1RI1A 1KC3A 4EUFA 2D1RA 2QPLA 1W5TA 2W2QA 1QP7A 1WVGA 5KIAA 4HB4A 1FOEB 2F59A 3IUBA 4FWIB 2ZSHA 4P6VF 1Z6GA 3JPYA 3SN6A 1KMIY 2DF8A 3GX1A 3DZBA 3PFCA 4M8NE 3S28A 4N49A 4ZT6A 3WOHA 1XQ6A 1IH8A 5BR4A 3WO1A 4JWKA 4QEDA 1P5ZB 2Q4BA 1J8VA 2Q6VA 3IQWA 3UTCA 5KHOC 2UUAB 1N1EA 3S1SA 2JK1A 2ZE8A 3EVNA 4GBMA 2VDQB 5AQEA 1VHWA 3P0IA 3PNQA 2CYBA 1J0BA 1U0TA 4BS9A 4HFMA 4YJ3B 1V1MA 5CH8A 1RIFA 3FJOA 1LC0A 1CUYA 4CF3A 2WIGA 3AB7A 1UC9A 4B85A 3AHGA 2JLBA 1D1SA 3ASYA 1OVMA 4MS4B 2G9VA 1YR2A 2CNLA 3AFIA 1E62A 3EZ2A 2P9QA 3EZYA 1DEAA 1HO3A 2PYDA 4GYWA 3C3XA 3FZYA 1R9JA 4JYPA 3OTHA 3P26A 1EFCA 3Q9UA 3BIWA 4HH3C 5D7BA 2NZYA 5T6BA 4ZYVA 1EMDA 5AJUA 1ZUWA 2QAGB 5FL7D 3K15A 5TPWA 3NTOA 1MABB 5BNWA 1PO7A 4HS9A 4JC8A 1NJ5A 1IHXA 3DD5A 3DXFA 2ILVA 2IGTA 1LRLA 3OJOA 5T3UA 1P2VA 2HPAA 3EUEA 4M3NA 3EXG1 3NCHA 1E5XA 3VRHA 4BMPB 4DDWA 2HWKA 1P0CA 1R0KA 2HKIA 1WMBA 3T34A 2OKGA 3EW7A 4RVSA 1Z18A 2MSNA 4OX9Y 2HSEA 2X8BA 4C03A 3WK8A 5K6AA 2JLQA 3NWOA 3OX3A 4I6JA 1N8NA 4PS0A 1HA3A 2YY7A 1WQ1R 2I1LA 5CYFA 3WGOA 1FYFA 1P45A 3WK7A 3HXQA 3QPCA 1N6HA 1COWA 3BFVA 4ABTA 1WS6A 1ACJA 3AO0B 5B64A 3R5TA 1BOFA 2BSQA 3FY4A 1CY4A 1G5HA 2EG5A 3TSWA 3R8FA 5BQ5A 4DC9A 5IC5A 2QUHA 2O3RA 5BN1A 2FN3A 5BURA 5CK5A 1G1AA 4R1NA 4D9GA 4ZCTA 2XNCA 4PQFA 3G0CA 1DI0A 1DARA 4QU5A 5G1PA 3D4IA 1F12A 3SF0A 1VRVA 2ZTHA 2QRLA 3RASA 1P0PA 2FPKA 5GV8A 5JI2E 3SMVA 2AN5A 5FOTA 2C5BA 1PVDA 3AR6A 3KDSE 1T8PA 3DE2X 4RKQA 1GP2A 5LZ5A 3QWBA 521PA 4V0NA 5BVHB 3OM0A 3CG0A 3EIEA 2V4UA 1TA4A 1K7EB 2IPOA 3NEPX 3L0DA 1AGRA 4PGAA 5EIFA 2XPCA 5HW0A 2IYSA 2O8DA 2ZRAA 4BWFB 3ZUPA 1VL1A 3PFGA 5I8PA 1APBA 3T1TA 1L1RA 2C2YA 3LA6A 2YYSA 2A6PA 3HGQA 2V65A 5FBLB 4BO1A 4PV7A 4WZZA 1A2BA 2CFRA 1YZYA 4B6JA 2V7TA 4KNWA 4RHUA 1RXIA 3KJNA 1ZAKA 3PDWA 4NKRA 1Q1ZA 2ON6A 2ARKA 5I7UA 5AWFC 2ZWVA 3UC9A 3DEJA 1E2HA 1J23A 3KVYA 4F9GA 4U3JB 3T52A 3ZCTA 3OQOA 1OZGA 1ZQ1A 2RHHA 4IG4A 2P62A 1CLEA 4M0CA 4M9CA 4YGYA 4AWXA