2A58A

Structure of 6,7-dimethyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound riboflavin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
LKGPELRILIVHARYNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSWELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVILGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase
publication title Structural basis of charge transfer complex formation by riboflavin bound to 6,7-dimethyl-8-ribityllumazine synthase
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 49
structure length 146
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2a58A00
1C2YA 1C41A 2A59A 4KQ6A 2VI5A 1XN1A 1KYXA 1W19A 2A58A 2C97A 1KZ9A 1KYYA 1KYVA 1KZ4A 1NQVA 2C9BA 5IM5A 1HQKA 2B98A 1W29A 1NQUA 1NQXA 2I0FA 2C94A 1T13A 3NQ41 2O6HA 2C9DA 2JFBA 1KZ6A 1EJBA 5IM4A 3MK31 1DI0A 4J07A 1RVV1 2OBXA 2B99A 2C92A 1KZ1A 2F59A 2A57A 1NQWA 1ZISA
chains in the Genus database with same CATH superfamily
2R1ZA 2ZJ4A 1FSSA 1T9AA 1W48A 2O1WA 3P0RA 1Y8RB 4UCFA 1Q5PA 4L9RA 4X61A 4MPDA 1J49A 1G60A 4LDJA 3VNQA 3QVVA 2ZRQA 1VYTA 3F97A 3PQ6A 1J5XA 4XIFA 5CFPA 5IX8A 2FW8A 3T99A 3R7SA 1KAOA 2GCOA 2JGMA 4DZZA 5IF9A 4IVQA 2H1SA 3ST7A 1GQSA 1LC0A 1RXIA 1TT7A 3MOSA 3WL8A 5FUQA 5JMTA 2E4VA 5DGTA 3I2FA 3TM4A 2C9OA 3CYFA 2VXOA 4LRWA 5IW8A 3DEYX 3H4IA 3TLBA 3QU7A 5G0TA 4Q15A 3OOWA 4G0UA 4HAVA 2O3QA 2SECE 3VR2D 5BR8B 4L4RA 1I6KA 4RVSA 3GH1A 1U2PA 2XF8A 3QVLA 3VPDA 3WLMA 1IBKB 4M46A 3VPXA 2IX9A 3BMQA 3M7IA 2COUA 4L57A 4O4LF 1J56A 4X85A 1ZM4A 1XXHB 2D3WA 2ZI9A 3MNFA 3TD9A 5B30A 5CCXA 1CQWA 1UANA 1DBQA 1M0SA 3KVVA 4M54A 3REFA 4DR2B 3WI7A 5EXTA 3QPVA 1YQQA 1KZYC 4IINA 4OMDA 3PRKE 4GNKA 1O94A 5A62A 1DTSA 4UBNA 3W90A 3ICCA 3G2IA 3DMRA 2YJ5A 4IWYA 1KJIA 5AD1A 3ZTYA 1XQXA 5BSMA 5EHXA 1U7UA 5AUPB 2MINB 1MB9A 2XUKA 1KO8A 3A0RB 4XQ9A 2PZFA 3BFPA 3QZUA 5D5PA 4BUJA 2FWPA 3Q15C 1QZTA 3AI2A 4WERA 3I53A 3NAMA 3MRTA 3WIDA 1BDMA 2PXCA 3RRBA 3IV7A 3P9YA 1JHDA 1QANA 3H8SA 1VFPA 1JNXX 2GNOA 2HIAA 4MV0A 4IUBS 5TVKA 4E4YA 1PV4A 4LQLA 5A3VA 2B8EA 4H4EA 3CR8A 4AW9A 2PSJA 2FCRA 1NPYA 1PVDA 2R2AA 1CV2A 1OLUA 2X8AA 4HRXA 4L78A 2JIZD 3MG9A 2OHVA 2IDMA 5LOVB 2XWPA 4JK3A 4U7PB 2OK7A 2ZPTX 2RFLA 1E0DA 2W83A 3H1BA 4AX4A 1T13A 1CUGA 1MVOA 3NM6B 1AT1A 3TMKA 4LOKA 5A6VA 1AIPA 1XEAA 3LSYA 4PYOA 3GAMA 4DCUA 1GRQA 4RIHA 1MG5A 2NAPA 1KNXA 5K8UA 4ZPXA 1M1XB 1R3UA 3EIHA 1X1CA 1Z12A 1UDBA 1Z8NA 2HXGA 4BFCA 2ERCA 3DF7A 3KOMA 4YT4A 4D8TA 4ZGGA 3G17A 4JODA 3GLHA 1R8SA 2H5IA 3ZK8A 4CW7A 3LLUA 1XCMA 3PPXA 3WLEA 4AD8A 4HH1A 3BMNA 4H7IA 4MYCA 4O4HF 5CRIA 1OFGA 3N8DA 3D4LA 5J4VA 1XTJA 4OREX 4AKSA 3I2GA 2ZANA 3TZCA 3IP5A 5CHEA 5LZ9A 1ZG3A 1XCOA 1RRPA 3GLRA 4QELA 4IJ5A 1Q91A 3KO8A 4DY4A 1GIAA 5KQGA 3N3AC 4PYKA 1ELOA 3ANNA 1YZQA 4I66A 1YZVA 2JZCA 4O8ZA 3HO8A 3RDPA 4TZ0A 1F2UA 1SHZA 4AIRA 3HKEA 3MQFA 4B0PA 1NFRA 1ZR2A 1GD1O 2NGRA 2PZEA 2TYSB 2NO1A 4F2DA 4TQUS 1P2FA 5J2TB 1MC8A 3WE7A 4EYGA 4LRUA 4JJFA 3VUFA 2X0JA 1Q84A 3GLGE 4AJNA 1MAHA 1Z2OX 1ZCAA 1OB5A 4KXUA 1A69A 1GTG1 4H7KA 5C31A 1GGEA 4MWCA 4BV8A 2HJVA 1MXFA 4CCSA 4L50A 1EX9A 1SVSA 3PC7A 3A1FA 1JN0A 4LBWA 3H5LA 1X7XB 2QPOA 4MJLA 1IOVA 6ADHA 5EE3A 3PFIA 4JOQA 5AW7A 3MJEA 3OIDA 4NENA 3LGXA 2W71A 3NPMA 2NV6A 5F76A 1QPZA 3ISJA 4I4LA 4Y6OA 1GG2A 1Y1KE 2P9JA 3JQ6A 3T15A 1D2CA 1YBFA 4LGYA 1II0A 4Q4DA 4HDSB 5A4MS 4N49A 1TC2A 4NOKA 3DWIA 1E59A 1Y8CA 1TKRA 1YQWA 1AUXA 2D00A 4RZXA 5TMBA 4D4KA 5I8PA 2AXEA 1C81A 5CFZA 5A7GA 2CSXA 1T9DA 2IVZA 2VRWA 3OZCA 1XMJA 2C7VA 3UXYA 2BSQA 5ESXA 3W8DA 1EXNA 3K1ZA 2OCPA 2QLBA 3F7NA 3QITA 3WSTA 4CMHA 2CUZA 3MTBA 3F5MA 1ZJJA 2VP6A 1EE9A 2B20A 3OIYA 4HNAA 4A8JC 4EG0A 4EI2A 4NKRA 4EYQA 5AOBA 1CK4A 2I6QA 1KMQA 1T29A 1UC4B 1ATIA 1MTZA 3E05A 2QYSA 2QPTA 4GPD1 2MYPA 3VKFA 4LY3A 4W8OA 5C4IA 5C81A 4D9EA 3MWFA 1CVIA 2RB4A 9MHTA 3IXQA 4XR9A 5BURA 1KDZA 3EG9B 1YVEI 5JRJA 2KI5A 4ZVUA 4X7BA 4HJRA 4DKJA 1WQ1R 3QOXA 1NN3A 4E4RA 3O8QB 1QFMA 1TLLA 2JJYA 3GRPA 4IGFA 3W3AA 3FNHA 5IAJA 3ER9A 4H1WA 4LMAA 3H3XA 4R9NA 4KXMA 3BDAA 3NHLA 1ZBQA 4LZOA 2N9UA 3AUKA 1E1QA 1Z8HA 4LS3A 3VR4D 4RHUA 2PMFA 5NULA 3CT4A 5JV5A 2G7ZA 3BX1A 1WSDA 3T61A 4JBLA 5L4NA 3D7SA 4QXQA 4ARSA 4DMFA 3TRFA 3GPLA 1I7LA 2H11A 3IP1A 1T3SA 5KSWB 2ZAMA 1ZU4A 1AU9A 1COWA 1G20B 1OX4A 1UC9A 1VKOA 2DQ4A 3GC6A 5TQ0A 2ZRLA 2VNSA 3UMGA 1OY1A 2CVFA 3IQFA 3T7SA 4QDXA 3STTA 3P5BA 3V6LA 2PGOA 4LDRA 3DQZA 3PXDA 5HW0A 2YIJA 2JLRA 3V4VB 4DDUA 1QM5A 2YVQA 2QRMA 2ZJAA 5BRJA 4PAMA 1OILA 4FT4A 5FI0B 4GDMA 3TD6A 1DZ3A 5ENZA 4HWGA 4RKQA 1Z4IA 3HY4A 3I8XA 3WTBA 2GM3A 5LD2C 2QQ5A 2AI2A 4OJYA 2JCGA 2O2DA 1FTNA 3NC1C 4DR5B 1OPRA 5ALXA 4JUAA 2HUNA 2VJAA 1ZC4A 4UHBA 3WL4A 3NCTA 4H6WA 1NMYA 3A28A 2O4CA 3MJCA 2ZSDA 3T06B 4B48A 2BEUB 3LCJA 4NMMA 3LO5A 1GFIA 2ZYSA 4Q0MA 1FA9A 1BXKA 3LYAA 1RLIA 4K8RB 5FTJA 4LXGA 5EY5B 5CA0F 2OXTA 4Z4CA 5C5IA 3HE3A 4X41A 3GL9A 1IMOA 3I0MA 1QGUA 2WJGA 1X2EA 3OO0A 2FR1A 3G8AA 1XBTA 1L5GB 2FZVA 4IQ4A 1JFSA 1LBEA 2GBPA 2NO9A 1QG2A 2GOYA 3GBVA 3QMVA 5CX1A 2GZHA 1JS1X 3MLBA 1HFWA 3ZX4A 5A1JA 1NVGA 2GPSA 1U81A 4QGFA 3KKPA 1XL0A 4M88A 1MRZA 5LP6C 3RVOA 2VT6A 1O95A 2VYQA 2VYCA 3MUOA 1SMKA 4MDFA 1N8KA 5ETJA 3V2GA 2CLSA 4GW3A 2WJWA 2DPXA 3TN7A 1X15A 1W30A 2A9QA 1ISMA 2XOEA 2B5WA 1UJBA 2DKNA 2D4HA 3DB1A 1G5FA 1TVEA 5KOYA 5H8WA 3AVXA 1KPIA 1W6UA 4M37A 4YV7A 3SBEA 4MUGA 1M6HA 1Y37A 2IHNA 1B0PA 4NTZA 4XFJA 1ZA2A 4PHHA 2K2WA 7MDHA 3CKKA 2XTMA 1IQ0A 3CB2A 1PT7A 2R7AA 2VAWA 3MYYA 2CY0A 3Q0TA 4UM9D 4WEOA 5AJWA 5F35A 4D4MA 1P29A 4XE5A 2H6EA 2O7QA 4N3GA 1ABBA 4XWAA 1V5EA 2RG7A 4YJHA 2EGHA 1YGPA 4H1VA 3HKBA 2AJDA 2BTEA 3RS3A 1E9SA 2IZOA 4YJDA 3SSMA 2J45A 2ONYA 2J41A 3MERA 3U31A 3ZQUA 4U00A 1Q0UA 3A6KA 3TQRA 5K0BA 1LI7A 3PJDA 3SXJA 4YRZA 1EVIA 1HDYA 3C6QA 1H5UA 1H1LA 1WXQA 4GYWA 5ALWA 3AEKB 5B3JA 2WJVA 1N0UA 2Z6QA 2NNWB 4QYWA 5GV7A 1CY4A 4IGAA 5L7YA 1PRYA 1SCJA 1TQDA 1JKXA 2RH5A 2WJIA 4PHTA 5H16A 2GBFA 1MH9A 1SA0A 2VK2A 3YASA 1CQJB 2VDPB 4BO3A 5GINE 1T9HA 3O9MA 3JSXA 1V8ZA 2NPOA 4GRIA 4LUCA 1E63A 1KBZA 2ON6A 2BEVB 3L0PA 1SD5A 3TXXA 3NEAA 1EVLA 5IK2D 5AVQA 2KHZA 2VSQA 2AOUA 1Y82A 1DRUA 2IEGA 3GBPA 5BP7A 1JG4A 2Y66A 3N86A 1OHHD 4YBRA 5E2BA 3WR5A 1OLXA 2LKCA 2VYND 4RF5A 3IQZA 1YU9A 4ZI7F 4CKEB 2DR0A 1KSJA 3OJEA 1GSOA 3DAPA 1WMFA 2L69A 4A3SA 1MOPA 5BSUA 4EKEA 1GGMA 2OLJA 1LI4A 5F3DA 4KIUA 3ADPA 1IN7A 3EA5A 3N0TA 4DJAA 1SC6A 5CU7A 5GVRA 3OIGA 2QN6A 1GSHA 1LFAA 3RWMB 2VTKA 4RENA 3OQVA 1XCLA 3D4NA 4ZQBA 1A76A 2H4FA 3OFSA 4AKHA 1RI5A 1L5QA 4GWKA 1K4YA 2VVTA 4M7RA 5NLLA 1NATA 1RM3A 1RKXA 2XUDA 4IZIA 2XQJA 2GPTA 3WGVA 1IOZA 4JBIA 4P93A 4WK6A 5EXXA 1T8WA 2YWFA 1YHZA 1NBMA 5FPKA 3GRKA 1Z63A 4RK6A 4DWWA 2XUQA 1IY0A 2PSSA 3WAKA 4GPZA 5F52A 3WYEA 1OC2A 3BKXA 3MBOA 3TNJA 5IKMA 4RD2A 3ABZA 2OCAA 5ABPA 2L2QA 3DYBA 1VPDA 1X74A 1ZOOA 4H1TA 4EH1A 4Z6KA 2D5LA 2WB2A 2YXPX 4E14A 3ECAA 4QSMA 5A06A 5CDSA 5A9RA 1Y9AA 4KO8A 3LYHA 4BC1A 1L5KA 1UPXA 1JIXA 3E03A 3G2HA 4EYKA 1E4EB 3BBLA 4QE3A 4W6ZA 3MGCA 1ZUNA 5F7OA 4YRJA 3SFVA 2PGJA 2IZZA 3B20A 3A36A 3CRW1 3DBLA 4PC6A 4Q1FA 4R1PA 5AW0A 3VAYA 5BVGA 2P91A 3WLOA 3EUFA 2JAPA 2KX7A 1RADA 2V1XA 3L8YA 1WNTA 4PYNA 2WQ6A 1AY0A 2JAUA 2DBYA 3S8MA 2QMZA 5I7VA 5JCPA 3L02A 1Y9ZA 1Z4MA 2I2CA 3DFMA 4LYAA 5HS4A 1KJ9A 2PSHA 3GRVA 8LDHA 3DHWC 1FU4A 4W9NA 3PEFA 3Q88A 4FDMA 2VDWA 4B5LA 3PCXA 3R9XB 3LQRA 4WBNA 1FP4B 1Q7RA 4OTZA 1X6VA 1UPTA 2ZSUA 1Z37A 2QTMA 3W6NA 3O82A 3WMGA 3GDOA 1K2WA 2BKEA 5DK6A 1OE0A 3VGPA 1A2BA 5A9SB 1H65A 1H66A 1EDOA 2FMHA 3CN7A 4G5GA 4J3JA 5EHNA 1ZQ1A 2JVIA 2FZGA 2J5RA 3GUYA 4X24A 1IG3A 3PHGA 4RF4A 5EE9A 5ADWA 4FWTA 1QG6A 4E46A 4EELA 4YGYA 3S4YA 3OLXA 1YR8A 2DUNA 1T1EA 4B4DA 3LPAA 1WX1A 3AHEA 3MLAA 2DWUA 2C2KA 1C7RA 4HOYA 2WZQA 1SZDA 1WP4A 1R4ZA 4MQMA 5CTJA 3VVBA 2WHEA 2YINC 3JQCA 2I2XB 1A3CA 2VDVE 1X7WB 3DO6A 2VJBA 3I1FA 4IOMA 4WQMA 4AUMA 4JJ7A 3BXOA 3FVVA 4FWIB 4NULA 3VOTA 1GZ7A 1U3TA 2NO6A 3DTVA 1Z3IX 2Q7XA 5CB8A 1PL6A 2C88A 2BFEB 4QM6A 3K1JA 1FFXB 1K89A 3AY0A 1QS0B 2WWVD 2XXBA 3RVKA 1WVGA 4EHAA 1U2EA 1SBNE 4P3KA 1KYIA 1P7YA 2OV1A 2VHYA 4RJLA 1XPOA 4GDFA 3BSYA 4UULA 2Y9MB 4HFJA 5K8IA 4U7DA 1NW3A 5DULA 3UTDA 2E49A 1N8NA 1LBQA 1M5RA 3I04A 3WGHA 5DXJA 1SU6A 1XA4A 2NM0A 3L4BC 1WBBA 3A4LA 4ID9A 1T1SA 4OFBA 3NBFA 4U3JA 2AI1A 5SYAA 1QMGA 2AV6A 2Q8QA 3Q6NA 3QTBA 1M75A 1UKZA 1VOTA 2QUZA 3DDZX 4GOMD 4IWXA 1Z29A 4D82A 1CUCA 1I2MA 1C41A 3C7TA 1DKNA 1FDVA 2ERXA 3EVTA 3NONA 5D3MA 2Q7OE 4BFXA 3AEQB 1C1DB 1VBNA 2CDNA 1YBVA 1AE1A 1B6TA 1Z68A 2QWXA 3FCOA 3GFSA 4BCDA 3GW8A 4KTTE 3I8OA 4ZOLB 3EUAA 5JS7A 5CNMA 4DIEA 3PUHA 4URFA 2DRIA 3D4PA 2FRDA 2EHDA 4RGBA 3JS5A 3MUFA 5MN5A 3O3MB 1LQTA 3D7MA 1GHTA 4TM8A 4EKYA 4F72A 2ZSIA 3GVIA 1X1SA 4I7EA 4IKOA 1V6AA 3THOA 3JV7A 3E9CA 1CT9A 3JQBA 1A0OA 4ICIA 2DSTA 4D99A 4WJZA 3UAZA 2JW5A 2J3MA 1SVIA 1XKQA 5DNWA 1E3QA 4M49A 1ZGGA 5CHYA 3Q7PA 3S1AA 1KDVA 4YRPA 4ALNA 5AVUA 5JC8A 3ISVA 3M6LA 4WY5A 1FSGA 4EA9A 1YFZA 5CFLA 1P39A 1NPTO 2QW0X 3H2YA 3AF0A 4ZICA 4I50A 2EW1A 1JQLB 4PX3A 3ABIA 3EF1A 2NO7A 3OWHA 2VDRB 4TTSA 3N2NA 4HATA 4UCXA 5AOVA 2OFFA 3DFKA 1NN5A 4DB2A 2JK0A 3GJSA 4LZWA 5C4MA 2FF5A 1T1RA 3TE7A 2C2WA 4PQRA 4QNMA 2WINI 5B6PA 2GAIA 3PD1A 3FI9A 3SR4A 3GJ3A 4CHTA 1VMAA 3RSOA 3R3ZA 1A8HA 2WJHA 1AHPA 2R6JA 2GM5A 3DEJA 1W4CA 2JFBA 1P17A 4RVFA 3PF8A 5DBEX 4EJ0A 4GLOA 1A1SA 5KVCA 3M9WA 3BUSA 3ESXA 1Z38A 3CUSA 1YJAA 3UCFA 1W49A 5IVDA 2ANCA 5AIAA 2VUUA 4TL8A 4RW0A 1KVRA 1GGNA 4ZDKA 3UYKA 4AZ3A 1EFVA 4RSGA 1AVTA 3CEAA 4I1RA 2J0SA 3PE4A 3Q9UA 4G25A 4C04A 4D43A 3FIJA 3Q3HA 4U5QA 2RARA 2QAJA 3QFTA 2OHFA 1WXEA 2Q6LA 3UJ6A 3ZWQA 1H22A 4YWHA 5CBPB 4DV1B 5MGNA 2I8CA 2WYHA 2Y0CA 2NSLA 4KNWA 4RD4A 2BELA 3B2NA 4W9RA 3WWOA 3DBHB 4CLDA 3LL4A 3DE6X 1TUIA 2CL5A 2F3PA 2NZJA 4OA8A 2CNOA 4PU0A 4DCTA 3UPDA 4JJEA 1WB4A 4LDQA 3W5HA 1A4IA 2OUIA 3IUQA 3PC3A 3R5HA 5HKAA 3KEGA 5BN1A 1RR6A 1TJYA 5FADA 3NDRA 4U0JA 3CRNA 5AK0A 4ZV9A 5IABA 2DP4E 1Z34A 4PSUA 3D7LA 4EO4A 4PSKA 4QHSA 3JAMA 4YCJA 3C5EA 4IIGA 1X70A 4EFNA 3BFKA 1XL1A 4Q1AA 1NJ6A 1HSOA 3LHFA 3IR5A 4PZDA 3D3WA 5GMOA 1MRSA 1CDDA 4OHFA 5JAHA 1WMDA 2KB0A 5AW6A 1S2GA 1NPDA 2C03A 4RK1A 4PZ0A 4C0BA 5K0EA 4KRFA 1DAFA 2E4XA 3OM8A 4KQJA 4XGIA 1USVA 2PT7A 1JTFA 4RPGA 1UMCB 4GHWA 1HNZB 1KC3A 3WADA 5HIIA 1S9DA 2C61A 2CE2X 2EF0A 4MKIA 1ISHA 4RMHA 1BW9B 1MO3A 1BE6A 2QP4A 1NM5C 4LYJA 4YJGA 3A3OA 3UWPA 3J81A 3ETCA 4U1RA 2CF6A 2RC6A 1H4VB 2ZQZA 2I4TA 3RTCA 5GZ3A 1OH6A 5DN6D 2B6NA 3ZNNA 2H63A 3CTMA 1UXJA 2QRZA 3IAFA 3QXJA 4N40A 3RFUA 1ZLXA 4J1NA 2NAFA 4N0PA 1MQ9A 2B4KA 4RSMA 5IH3A 3U9TA 4DCMA 3EW7A 4PAWA 2QV7A 4O4IA 4ADSG 3T5PA 1R18A 2WMNB 4FMDF 3DBVO 4QC2A 1MFPA 4G4JA 4XOUA 1CJBA 1KVTA 2PUEA 3PIIA 3RC3A 1RBYA 3KQQA 3V1MA 1OA0A 1HUQA 1TCVA 3R8XA 4RY0A 1HEIA 4YRTA 3ZDDA 4RVGA 4PCUA 4KQ9A 4XWYA 2VP3A 2P8SA 1GYPA 2ST1A 4ND6A 4X7MA 2B82A 1V3QE 2W11A 4PYJA 1HQCA 2K6GA 4I46A 3FSGA 4R4JA 4DDHA 3PWZA 1ESMA 3AIIA 3TBKA 3ZU3A 4ZAGA 2WMYA 4IZOA 1RPTA 2DQSA 1GUDA 2QJTA 2GM4A 5DCWA 3SVTA 2ARKA 5EZYB 1KTIA 3H2BA 4HBGA 1N5RA 3SQWA 1HE5A 2B37A 2NACA 4LQDA 2HQRA 5TGDA 4ITRC 2XGJA 4A27A 4P5PA 3IPLA 3R3VA 1SU4A 4KV9A 4PSVA 2ZBRA 3K9QO 5GWXA 3VYVA 1EFRA 1SHTX 4ACAA 3U56A 1W5SA 4JA0A 1TPZA 3K92A 5LZ2A 2R7MA 3LLCA 4LQ4A 1JLHA 1D2RA 5HFJA 5KB3A 2C99A 4CKBB 4TROA 1U8AA 4IIYA 1SBIA 3JWEA 4OQYA 2C7QA 3MMXA 1LJLA 3SS9X 1E1YA 2IHVA 4DSOA 1QFXA 2PFKA 4Q3LA 1G6OA 3BRCA 5I7OA 3ZWDA 4IF6A 1G9TA 1WEKA 1XU4A 2DKFA 4I6EA 4A0FA 5A4JA 2QL5A 4J03A 4RH0A 3QU9A 3O8RA 2YTZA 3EARA 4XJSA 5EKUA 3RS0A 3RRJA 1RYBA 3IUYA 2YWEA 2CZQA 1TT5B 3ZLJA 3FRJA 4HAUA 4ILKA 4WZBB 1G6HA 3GD5A 2VRCD 1W0KA 2Y92A 4GGPA 4OKIA 3SEAA 5BRAA 1ZI6A 1QP4A 2X5NA 3LCUA 5BW4A 4JGGA 1IXZA 4F6RA 4YO8A 3QBTA 5B5SA 3HLYA 3NWOA 1CNFA 1YE5A 4QLOA 1YDGA 3AKEA 3T7JA 5KVSA 2XVMA 2VZEA 1O1YA 2J3HA 4EMTA 5AM4A 1TTHA 1BEEA 4BTEA 3JASA 1Z4QA 1RC8A 1TQ8A 2EFJA 2B4QA 3AF4A 3DMHA 2TSYB 5IDQA 2WA1A 1D4AA 3MCTA 3TVTA 1GITA 4COOA 2WJJA 4C01A 3WJAA 3KDAA 2WVGA 3EUWA 4QYIB 3WO0A 4JJAA 1SVUA 2FXVA 2H2GA 3GLIB 4UPVA 3CSDA 5T41A 2H07A 3ONEA 4J43A 1YRYE 3HMKA 1B93A 3R7AA 2XSZA 3CISA 3HR8A 1NI5A 3QPCA 3LP6A 3T94A 2VHCA 1C8VB 1P77A 2ZJ7A 2D13A 3K9NA 3WLHA 4DTCA 3WY9A 3FNIA 1XXLA 1UT5A 3STXA 3U09A 2R7NA 1IEVA 1V47A 1BOFA 2VJMA 5KIAA 3EXHB 4I55B 4DUPA 3G2PA 3DO5A 1E32A 1PFVA 2ZWIA 2ZRHA 1SQ0A 4QYXA 2GJAA 3T4XA 4XFKA 2GZMA 1GNRA 2JVJA 2NXNA 4IM7A 1E3LA 1P7PA 3C16C 1NV8A 3GIDA 3KLNA 4M21A 2GMWA 4BZWA 3ROZA 4MUXA 5FEUA 3TEFA 2JGJA 4OUKX 2AK3A 3ANLA 3IC5A 1YIOA 3P8ZA 1NVTA 2ZWPA 1M2NA 5LQSA 4DLNA 3TX2A 1YC5A 2ZQ5A 1CFZA 3FPFA 3G49A 2R6FA 4MCIA 2AXNA 1TM1E 5DBFA 4X65B 1MJFA 2JA1A 3OD1A 5DMXA 3EJ6A 2Z8XA 1BJRE 3CC8A 5C34B 3ERCA 2FN3A 3ZGZA 1HEUA 3M6FA 1K2VN 2R1TB 3II6X 1T6XA 5JH7F 4L2IA 5EI5A 1M74A 3SYTA 4P7GA 2AI3A 3GYBA 2EQ5A 2IE0A 1FMCA 1WXFA 1Y5IA 3AT1A 1EWKA 1TO1E 3QEOA 3QX7A 2AJ8A 3NBYC 4KEAA 1HZZC 4LHEA 1V8PA 2XDQA 3CE6A 5CAEA 2P6NA 2CXSA 3HSYA 1FUEA 4MICA 3DLHA 4U39A 5CVJA 2V7WA 3BFJA 4HLQB 3SF8A 3RUEA 1IZ9A 5JJKA 4KODA 4A26A 3SS8A 1AKUA 4DDKA 5DM2A 1U0EA 1ILEA 3VTZA 4PANA 4FHEA 5H3HA 3C6ZA 3UJ7A 5C1PA 5JCOC 4MJXA 2HR1A 3KUXA 4MHOA 2WM9B 3FHLA 4N9QA 3IQGX 1YR6A 3ZHOA 2B78A 3GLUA 5EMNA 5IT5A 3TGWA 5DLEA 5A0FA 5D3QA 5K0NA 1JE0A 2B4AA 3WMFA 1QQTA 2D6FA 2HLHA 2C8VA 2Y4NA 1LH0A 3DFZA 2G82A 3FOBA 3O38A 3AVVA 3HYTA 4GYJA 1B76A 4RD3A 1BG6A 1UKAA 2Y9PB 3C8MA 1DLIA 2NZUG 2PEYA 4PSCA 1M6WA 3OTWA 1KSHA 5HQJA 1KJJA 4LOIA 5JT1A 1IHPA 3E70C 3U1TA 4XAQA 2QL9A 2ERYA 3E9MA 4R51A 3HJGA 1LUAA 3KPWA 3MTJA 4KO2S 4PGHA 5KI6A 2YBEA 3G2NA 2HA0A 1XA0A 4HTFB 4B3FX 2VQFB 4G01B 1VPTA 3EGOA 3UAWA 1YVUA 1CETA 3KALA 1QIJA 1X9HA 2IQIA 1QTQA 4V0MA 1BC5A 1A9QA 1SB8A 3QPAA 4G4IA 3OX1A 3VXKA 4P36A 4P4SB 3TSYA 4D46A 2D7CA 2QBYA 2RBEA 1G0NA 1K98A 5CFOA 1D2EA 1N1GA 1USKA 2XE8A 4TWBA 1BDHA 4B9AA 4BX0A 1QR2A 2A9FA 2Q1TA 2Q28A 1EYZA 3BMCA 5FWAA 5JAZA 2B4YA 3LPDA 2DFNA 4IIUA 1NFFA 4LNUB 3THWA 5AIBA 3W5BA 2ZM6B 3GWGA 4OLJA 1RJ9B 2P9FA 1QG4A 3VTKA 2X8WA 3O1HB 4B8YA 5EZSA 3KFLA 3CEPB 3UJBA 5HQTA 3VU9B 2JBHA 5CVCA 1PKXA 2G5TA 4XDGA 4L02A 2PKXA 3ZKAA 2Z30A 3L18A 5FAKA 4WXEA 3CF0A 2PUGA 4XIIA 2R4UA 3QVTA 2FE4A 4IDEA 3AVTA 3O3CA 2VP0A 3I58A 3LCVB 4PC3A 1HDEA 3R0VA 3GBSA 4MJ3A 1M2FA 4P4LA 3G7UA 1U2TA 3S70A 1VLZA 1JQEA 3V42A 3F4BA 4XQGA 3RT1A 2VNAA 4DCNA 2YMLA 3E48A 1DV1A 1KI6A 3S2EA 1A7KA 1JR3E 1UJNA 3KT0A 4D6XA 2OBNA 3RHZA 3PJEA 2VEDA 1S96A 5DT9A 3JATA 2KYRA 3G68A 3GFPA 1LK7A 5ARCA 3NOOA 4EX6A 2ZCVA 3V3KA 3WGQA 3BDIA 2XUFA 1DB3A 1BN7A 1NQUA 3FYTA 2RSLA 3OIVA 3L79A 4MLDA 1T0JB 4H27A 4KUEA 4RZHA 2O5RA 1RHQA 5DCYA 4GZ6A 5FPTA 4KACA 1TVKB 3TSOA 3KSZO 1ULSA 4O2AF 1IY8A 4BFTA 2EJVA 2X3FA 4LV5B 1IPFA 4N5DA 3TTVA 4IF4A 3LWZA 2OHIA 2OMEA 3DONA 4UM5A 4TV8A 1JPNA 2ETXA 3BWMA 3QLUA 2R5NA 3ZJYA 5IWAB 1JR6A 4CEHA 3RUAA 1DJNA 2JJ1D 1PX2A 5AUOB 5LP1A 2OHXA 1VLVA 1YRWA 3HBMA 1DQRA 1EHIA 1XK6A 4HH0A 5EZYF 1US8A 1CLUA 1WHTA 4FFSA 4C4ZA 5IU6A 3I5UA 5TJHA 3BXXA 1ADJA 3OCCA 1GXSB 3NBZC 5GJVC 1V5IA 4J1TA 3WNBA 1SK8A 1U8YA 2BY4A 3N5KA 1EJ0A 2IWHA 1EXVA 1P0QA 1RCTE 3JAKB 4L27A 3ZLBA 1ORTA 1PJAA 3I0NA 4MUMA 1GYRA 1TM7E 2QD1A 3I42A 3VOBA 2WKPA 1R0LA 1ZEJA 4RV5A 1XLTC 2C2MA 1MW9X 1CS0B 4WCDA 1TTTA 4AYTA 2LVBA 1DIHA 3R4VA 3GN1A 1U0FA 2C9MA 4A15A 3UBTA 3PSAA 1LPMA 4JNCA 2IIQA 4B84A 3LQ4A 3EDYA 4HS9A 3GMTA 2RHMA 1BXRB 4ML3A 4R69A 3WWYA 4OH7A 4HXGA 5BOSB 2HK6A 1B14A 2PV0A 1BVUA 2H92A 5LCXA 5IJ0A 2L18A 1W36B 1XK7A 2LUOA 1DAMA 1EGMB 2FXIA 1EUYA 4JJKA 1SPXA 3KJNA 1C1HA 1PFWA 3IDZA 3K9GA 4UUNA 2ZRNA 3EGDA 3CF4G 2VBIA 4YLEA 4JDUA 2OYSA 1Q15A 5ALQA 3U7QA 2I6FA 5JNSA 1MU0A 1MX5A 4DLPA 1TOAA 2REQA 5ES4B 3WB0A 4GBGA 4QKQA 3WLNA 3MD0A 3ZY6A 5LDGA 3O92A 3PT5A 4Z5XA 1E98A 3H4TA 5AMXA 1P31A 4KU4A 1E94E 5CGQB 3KOYA 1HBJA 1DX6A 1SKAA 4KXLA 1NG1A 2DHDA 4J0KA 4BOYA 1P80A 4TZ6A 2R8RA 1EZZA 1SN7A 4R01A 1I3KA 1XJ5A 2D0OB 3G1WA 5CA1B 1Y3HA 1BVYF 1CC1S 4QHYA 3DWGA 4MMXB 3SSNA 3T1OA 3LT1A 3ETEA 1HKUA 3D64A 4HP8A 2QRJA 4LGMA 4F4CA 1GGKA 4XB1A 2V8OA 5JS2A 2WD7B 4IVNA 4LPKA 1S2LA 3GFRA 3INYA 4UVDA 2HJ9A 2GCIA 2IHYA 3KU1A 6ABPA 3S8EA 2EBWA 4AP9A 5HZHA 3GPCA 4O5OA 3RG2A 2GH1A 4LECA 4CG3A 4NX2A 4MYSA 5FX2A 3GELA 2K4MA 2ES4A 1CYDA 4DMMA 2QD5A 2ABWA 4XJVA 1ACJA 3PD7A 1Z56C 3K1AA 3Q7IA 4PVCA 3WWDA 4OXRA 2QS9A 4HUQA 4S1PA 2ATXA 2MINA 6YASA 1H4TA 3MF4A 2NTNA 3S2YA 2R0QC 3P26A 4LXHA 4UE6A 4DBLE 2QM3A 3N5CA 1VDZA 3E27A 4XRRA 2V7PA 3TOCA 3D6JA 3T3GA 1QKIA 2J33A 1JYEA 2Q9AA 3FHTA 3HJNA 4YXFA 1CUZA 2GYWA 4QPPA 5ALOA 3J7AC 4A8JB 2AF3C 2G4LA 2XA9A 2ZZNA 3GUZA 3M6AA 1XTIA 1U94A 2GGSA 2Q3HA 3ZCUA 1L4UA 2VDUE 4LBZA 4QFMA 4Z0TA 2IZ0A 2DBZA 4FW9A 3KZ1E 4H2DA 1X1QA 5ITSA 1I51A 2FUNB 5HNKA 2XUGA 2YWDA 3EC7A 3NBAA 1ZIYA 5AJXA 2UZ3A 3UPTA 2XUAA 3HDJA 1OXMA 2DY0A 2PMEA 2IV7A 2BP7B 2A88A 2WHQA 1X42A 3KELA 5KKNB 2RHLA 1DIBA 3ZWNA 1HZJA 4CIBA 1IY2A 5KVVA 1TB4A 3RHFA 1Q6YA 4N12A 4TXJA 3CVVA 1AKNA 1UF9A 1J5EB 4Z4QA 1EHYA 1DMSA 5J9FA 1MUUA 2WVAA 3HB4X 2C54A 4YDHB 2E55A 4JR0A 5A3JA 2BEWB 4ALIA 5BQXA 4HLUC 3OMWA 1B7GO 2OHJA 2JLXA 5DF1A 5FBVB 4Z2AA 1Q2XA 1BAPA 1E9VA 4ZN6A 4XTCS 4IV5A 1R16A 1BEZA 3LFHA 4YT2A 4GWLA 3GI1A 4RAQA 1W5TA 3G9XA 4R1MA 4U5XA 3UC5A 5JC1A 4XCXA 3VZDA 1L7RA 2BFDB 3OLZA 4BMDA 4PQYA 4W5OA 1GQOA 1R8QA 3WLKX 3F3MA 2D1SA 3L7NA 4BGEA 2YYZA 3ZZUA 1UWVA 2BC9A 2H1LA 1JJFA 1F60A 3TTUA 1GU0A 3TO5A 3TGLA 1F2DA 1JHRA 1WQ3A 5AW1A 4DS3A 2OO7A 2PJDA 3LNTA 1K7FB 5JY6A 2AE2A 2QT0A 3ZGNA 5JQWA 4BKMA 1SUEA 2YCBA 4I1UA 1QH8B 1UAYA 1Q83A 1F8XA 1P2DA 4H0NA 1AQIA 4DL9A 4LF7B 1O2DA 1VL6A 2Y1EA 3CG0A 1Z2PX 4P4UA 2JI6A 3U7FB 5DX1A 3KFVA 2C4TA 3K0CC 3QVJA 1PX0A 4HEA6 3MS7A 4L0CA 5KTTA 3CBQA 3I62A 4X20A 3CW8X 1WEHA 3AF5A 2OBMA 2LNDA 4QNNA 1JHZA 1IWBB 4U6QA 4HPXB 4P7BA 5BXQC 4N76A 3S2ZA 3GEEA 3MIZA 3ORRA 2Y6UA 3PUWA 5TF0A 4XZ3A 3S7ZA 3VHXB 4E5UA 4ENSA 4TKVA 5L3QB 1C8KA 1NXXA 3E61A 3DLBA 1SQFA 1AO0A 2BKVA 2ZDQA 4KOEC 1IIRA 1H9AA 2R8ZA 2H65A 4FD3A 4GBJA 3EDCA 4QTUB 3VR1A 5KSYA 1Y5LA 4QYMA 3DL2A 4NOJA 1Y8ZA 1UJ2A 1CNEA 2ZIGA 2H1FA 5G3ZA 5HUHA 2PYIA 1ZFNA 3U6KA 5F4ZA 2Q6IA 2XUPA 4C6RA 2SBTA 1J8MF 3F9RA 3G9ZA 1OVGA 1AG9A 1EVQA 2FZLA 2O2SA 4CR6A 4GD3Q 4KHZA 1C3OB 2J3DA 3KOXA 4JDPA 1ZIDA 1ZOSA 1BX3A 2JARA 1HYGA 4B3RB 3T0IA 4A73A 3TFWA 1AKMA 2V6JA 1QF9A 2JH3A 2UZAA 4J0HA 1MV8A 3G2JA 1XQYA 2A9KA 2GSDA 3RFXA 3DSRA 4FPXA 2J09A 3KVRA 2WF8A 3F71A 3RS2A 4ZALA 1TJ3A 3O8QA 3PRYA 2W2LD 3QVXA 3UH0A 2HM7A 1Q14A 3FZYA 3PUKA 4BNVA 2EARA 2I8LA 2I67A 4IOJA 2H1HA 4R9UC 1OGYA 1E7WA 1PWXA 1ZOLA 2EXXA 3OIFA 1ZJWA 3BWCA 2CLDX 4B3HA 2ICAA 2C96A 2OMKA 2QZPA 4TS9A 3PTLA 4HAZA 2V59A 4X71A 3ZWBA 8MHTA 2MR5A 5SICE 4UXJA 4BVLA 2OQ2A 3ELYA 3TBHA 1K08A 2W2TA 1NXTA 1HQKA 2ZYTX 4RIIA 2GKSA 3RYFA 1SOAA 5CDFA 2PE5A 1YIDA 1RAHA 3NHAA 3R40A 2WDPA 2O8FB 1K63A 3GHHA 3PUVA 4MQBA 2IH5A 6LDHA 5EVCA 1P5RA 4FK8A 4BNXA 4L0QA 1AO3A 4M53A 1Y8AA 3E81A 2WNHA 3PDIA 4Y3UA 4Y6PA 3GOQA 2Q5LA 4AG6A 2X0NA 2IU4A 5IVKA 1E69A 4NNPA 1Y98A 2C5EA 3IVCA 3TQIA 5FBQB 4DUGA 4JC5A 3DZCA 1FLAA 3QI2A 2CV0A 2BI8A 3WGJA 3C6BA 3CZ9A 1EK5A 4GL4A 5LYJB 2PZMA 5I7AA 3NATA 4AXXA 4JBXA 2CNWA 4WNYA 2BEUA 2X2FA 1XG5A 1M2VA 3CX4A 2A4KA 1ZM7A 2P2DA 1KZ6A 1VP9A 4UVGA 1DOAA 1NURA 2C58A 1QNLA 4PF1A 2NZVG 5BV2P 4NY1A 5EP3A 4EB8A 3TOVA 1ESDA 4B73A 3D6HA 5TY0A 2ZSEA 4KW7A 2PEZA 2CV1A 2QD4A 3L0OA 4AJ4A 2FEXA 5FUVA 4CG2A 5GAJA 1CUYA 4H1UA 4R40A 4BVBA 1QVAA 4REQA 3ZWXA 3EBLA 5JDIC 5JSZB 4LE0A 3O1JC 3S0JA 1TCUA 2HF7A 4ZC8A 2YYAA 5T64A 3AVPA 2AX4A 4GE3A 2NU7B 1G4UR 4MTLA 3RASA 2I1QA 1XAIA 4L8VA 1IXYA 1H0RA 1S3IA 2A9VA 4KXNA 1N6PA 4Q93A 5HJEA 5CLQA 3NTOA 4O2BB 2FSPA 1YA6A 3S2GA 3CQ9A 1ENZA 1AKYA 3I73A 4MKHA 4C07A 4ZCSA 3TR6A 5A02A 1OJ7A 1U3GA 3OU6A 1IQPA 5MN4A 1E6MA 4H4CA 5DTMA 2ZXEA 1DCTA 1EJBA 1ZL2A 2G9UA 3GLGB 1IEWA 3TNLA 3AZPA 1AV6A 1FBTA 1KS2A 1E7YA 1UEXC 2AJCA 1IN6A 3B3GA 1T2DA 2HO5A 3E7XA 4MVCA 4R0NA 3M9LA 4YACA 3AWDA 3HPQA 3K6SA 2V9PA 3C6MA 1PJ3A 1Z0UA 2X6RA 1I14A 1ZK2A 1O6GA 4H18A 4JZKA 5JAPA 3M5DA 3HM2A 4QSHA 4C06A 4EENA 3N53A 1WOMA 2C3PA 1JBKA 3JXEA 1W6RA 4UEQA 1T9BA 1Y7IA 2W8BB 3ND5A 1I7DA 3M1YA 4TT3D 5LFAA 3GVPA 5C52B 1WBDA 5KNCD 4LXXA 1BE1A 3C5WP 1EVEA 1TLFA 3B38A 3DJFA 3DOUA 3UTCA 1CVRA 3I6IA 2QLLA 2FV8A 1A98A 4R84A 1KYZA 1TNDA 1UXIA 1MDBA 1WE2A 3P4XA 4HQLA 1X19A 3OPVA 2G6TA 2OK8A 1TEXA 3QXGA 4X8OA 4D8WA 2ZU6A 3EPRA 4PG5A 6PFKA 3B53X 3LK7A 4ZARA 3BN3A 1JT2A 2H8KA 1JA9A 3DAGA 4WNIA 3TLGB 5TQ2A 2G0TA 5JEEA 4MGEA 1GG5A 4Q6WA 3QKSA 3K32A 4J2TA 1UXHA 1PR2A 3TLEA 4DADA 3THXB 2ZBQA 1J7JA 2GJSA 3CH5A 3FPJA 1HLPA 4IDOA 4MUYA 4RZUA 3U5ZB 5HVNA 2FMXA 3JVVA 2GZDA 3ETJA 4QDOA 3PFBA 4OYYA 3Q2KA 4Z9YA 4C6TA 2BGJA 2OZVA 4XR4A 4CPDA 1T2EA 2BCGY 5B2FA 1XRNA 2UUAB 1JMKC 2YL2A 3EH2A 4LQCA 2FJPA 4DXAA 5LKAA 2FZCA 4ARZB 4CM7A 3CKLA 1SU8A 2I78A 3ODGA 1JMYA 1PFYA 4PGAA 4W63A 1U0OC 2C92A 4F4UA 1GJRA 1KK1A 1M6VB 1T6BY 1YQXA 4FGWA 4WADA 2AJBA 1UK7A 3WYGA 2AR7A 1EM6A 4JX8A 4H7EA 5FWYB 4Y1GA 5IS2A 3KBBA 1KQNA 3EQ9A 4FKBA 5EJFA 1JFFB 5KKAA 4AN4A 3EFOB 2KJQA 2VKQA 4AKGA 1TAGA 2XE7A 4UAVA 2O20A 3LHDA 4YBZA 4B75A 1GAXA 4BX8A 1PQYA 3LDFA 1E2UA 1ZGZA 2VJCA 3KKZA 2AX3A 2VDQB 5JVDA 2A9JA 5D00A 2CUNA 3I9V1 4LZLA 5AVWA 1XSEA 5EKXA 1IB0A 1PW5A 4INAA 1EDBA 2BGGA 13PKA 1AS0A 1Z18A 1BMFD 1NF2A 2Y3IA 2V3CC 1XJCA 2TS1A 2R8EA 1PUXA 2P3OA 3NZEA 2DH5A 4EPYA 1CUSA 4MHTA 4X7PA 1CJKC 2IV2X 2EZ8A 4FFPA 4NJMB 5EHZA 1YDEA 1B2RA 4AKIA 4WECA 2ZYRA 3GPBA 1XZJA 3EEFA 3SR3A 4HB2A 1GPMA 3L7DA 4GSLA 4M9RA 2AEFA 5CB4A 2ILVA 3AM5A 1VKZA 2I3DA 1R5JA 4GO1A 3VV2A 3N2KB 2DWPA 2E4WA 2EEPA 4INZA 4AN0A 1Z47A 2H4JA 3C7CB 1IHOA 1VLMA 4FYWA 4TMVA 4ZQHA 3GIWA 4EEZA 5ILOA 1L4KA 3PGA1 3V00A 2EBFX 3OM0A 2HRBA 1U8FO 2JJMA 3U7JA 1E20A 1Q21A 2RKBA 1G64A 3BT7A 2G25A 1CNMA 1GNSA 2BGTA 2XTJA 2Z5VA 3AM3A 1BIFA 3HEMA 2AN3A 3NRJA 4N39A 5CT6A 3PC6A 3WWCA 1C80A 3A9RA 4IDPA 1AA6A 4YUZA 4I4IA 2OB2A 4QPZA 3TYXA 3GJ6A 3ZWAA 3SK0A 3DOIA 4GC5A 1OAOC 5FDFA 2WP8J 4UHFA 4BS9A 3A1SA 2X77A 2O5EA 2ADOA 1QFZA 1UC5B 2QRVB 3MZ0A 4BNMA 5BXYA 4ROTA 3CFYA 4Q47A 1A7AA 3JVDA 3T9DA 1Z2EA 3AESB 3RTBA 3SZGA 5HFAA 1IOWA 3CLKA 4YFYA 1ECCA 4MOWA 3GP5A 1RACA 2VPZA 3C45A 3HO1A 2ZDHA 2GILA 2H4WA 1X7WA 3C24A 4I2NA 4F8YA 1O8CA 4B47A 7ABPA 5HYVA 5HKKA 1GEEA 1LWOA 4KLZA 1WD5A 2ZUFA 3NORA 1NLMA 2HJWA 4LYDA 1GSIA 4QQFA 4KXFB 1RKVA 1GNLA 2I4NA 3ZXSA 5BVHB 4RBNA 4PC2A 4NFHA 1Z0ZA 3RC9A 5E3HA 5ALLA 1ODJA 4BLPA 5FTLA 2CCJA 3UK7A 1BS9A 2YC4C 2RGEA 5K51A 2R6DA 4BNJA 1M1YE 4DCVA 2BMFA 3A6EA 3V2HA 3D81A 2YHIB 2HMVA 4CTMA 3V2IA 2AGVA 4AJLA 3C1OA 3DVSX 2O6HA 5LQUA 4FE7A 2ZJOA 1Z6XA 2DWQA 3FGOA 2X4IA 5FNVA 1Z22A 3Q9LA 4AECA 1A9OA 4ZVRA 3EWSA 3G59A 4GXQA 4CF3A 1Z26A 1AZLA 3RFCA 5C5CA 1NMSA 3F8TA 1TADA 4RMIA 4TXMA 3PXEA 2BJWA 2PX2A 2ZR9A 4JP1A 4NNJA 1ISPA 2OHGA 2X5JO 3DMGA 4FFLA 3E9ZA 1IDOA 3FYCA 3OHMA 5EKTA 1E18A 2R8XA 3NRBA 3OCXA 5DTJA 1YL5A 4KXVA 4CT5A 2WU4A 5AVRA 3E7PA 4PNEA 4JJGA 4PWYA 1QH1A 3QU2A 5DTRA 1QWSA 4E7PA 4QD3A 1NZDA 4EYSA 3AY3A 2P0AA 2D5BA 2OSBA 5LQKA 2O7NA 4OHVA 1CDEA 2HIGA 3GLHE 4RTLA 1A2QA 1FL9A 1FFDA 3BXGA 4TQ9A 4JXKA 5DBIA 5EAIA 4Q16A 4KE6A 5JALA 2D2VA 5GY7A 4XX0B 4Q00A 1KO5A 3MWJA 3AV3A 3HZOA 4D45A 1YRLA 4DIUA 5JO9A 1ZOIA 2EWMA 5C46F 3SJAA 1IHYA 3RE1A 1NUAA 4I14A 3IE1A 1R0YA 1NE2A 1QBKC 1XAJA 4ZAVA 3DKIA 3H99A 4I1OA 2XCRB 5DM0A 1G8AA 2J85A 1TX4B 2YDXA 5DWQA 1NRXA 4NYMR 1QBGA 3CSSA 1S2DA 4IIDA 4WWHA 2QW8A 1GPKA 1M2OB 4QVGA 3VR6D 5AW3A 1L7EA 1W88B 4Q9HA 1UUFA 2BDTA 3C7KA 1HDXA 4A0QA 3ZD8A 4D3YA 1HDZA 4N8DA 3PEVA 3GEMA 4MPJA 2B1QA 2ZRKA 1LTHR 1WB5A 1IMJA 3DVAB 4K6OA 4M1WA 2WDZA 2XCTB 4LC9A 1XCJA 1MB3A 1KRHA 4LPSA 2YHSA 3T5DA 1FYXA 3QJ5A 3GLFA 3ABOB 2YV5A 2A57A 1DLJA 4GX1A 3RC7A 1NR5A 2BGLA 4KFUA 2HZ7A 1E8DA 4BMNA 1T8PA 1QRUA 4I1SA 2DQZA 5ALDA 4DQVA 1JZQA 1W4AA 4IMJB 3R3XA 4OF4A 5E6RB 3X0DA 4ZYUA 2J9RA 4QRHA 5DASA 1J2TA 4YR9A 4C2TA 2OHHA 2GN2A 2VA8A 1UOPA 5FWNA 3IQIX 4O4JB 3U7GA 1W5EA 4M1EA 2NVUB 3BILA 3VC1A 2FSIA 4COKA 4E15A 1R0ZA 4CMAA 5BMVA 1JJVA 4EK9A 2AZMA 4WZ6A 2QUJA 2RAPA 3Q2OA 2FX3A 2N1BA 3JQFA 5B3KA 3IEUA 3L1HA 2H5LA 1QQAA 4HZIA 3B3FA 2HMAA 3DWEX 1LNSA 1AZSC 3FZQA 3K7EA 4QAQA 4O8CA 4N01A 3LUAA 4MZDA 2RI1A 4D79A 3KWLA 4JBYA 5CT5A 3NUGA 5KNLA 4Y6QA 3Q5DA 3IT1A 3R20A 4KSYA 3VZSA 3FAZA 4CL3A 1H1DA 1XZ8A 3HBFA 3GV0A 1O5TA 4EHKA 1Z9BA 5ALVA 2VBGA 3KL4A 1ZDMA 4Z99A 3FTPA 5FYQA 5JMPA 3WZLA 4I9FA 3H1AA 2VWQA 1DBVO 3RUPA 3R6DA 1CUBA 3VSCA 1Q12A 1ONPA 2YX1A 1DKOA 1G17A 2FN7A 2D0PB 4DIMA 4IILA 4BQFA 1DWUA 2JLWA 1N5OX 5DSTA 1K68A 1RLUA 2FJ0A 3EZYA 4I0WB 4DNOA 5LU9A 1SO8A 4ZYLA 2WMOB 3WMRA 1Y6GA 1Q0TA 1HE8B 4MEAA 3TKAA 4CLOA 5C7YA 1JVSA 2QPLA 3PQ2A 2Y0DA 3GRRA 5IBPA 1JYFA 2PJRA 3FPSA 2JL1A 4DRXB 2FOIA 3QF7A 2HV9A 1OXXK 4LXQA 3A25A 3ZE8A 4AAYA 1PV2A 3WBJA 3ABRB 2ZSKA 3PI6A 2PM8A 1KHTA 4M7OA 4UMVA 1TECE 3D1JA 3HXPA 3A26A 2C9BA 4MYUA 4RNCA 3ZVLA 4MZXA 2JLZA 2D2FA 1NW7A 2B92A 4G5HA 1YRHA 2QZ9A 4PONA 5EIOA 1SXIA 3KD3A 5T4BA 1PJ4A 3VM6A 2FX5A 4F9TA 1YCGA 1YQDA 3OPYA 4EA8A 1NT4A 1AB6A 4ETMA 2ZJ5A 2B4TO 5E95A 1GZ6A 2YV1A 4DB4A 1KFCB 1QRDA 4B7ZA 2NUTA 2WLSA 2YC2C 3ZHCA 1O0BA 5IKXA 1JSXA 1R0BA 2EYQA 1ZRHA 3FDZA 1CUEA 1R0KA 7ADHA 2WU3A 5FEMA 4FZRA 1KP9A 3CONA 1QGED 3OQMA 5ALFA 2YMPA 3HRIA 3LHKA 3L05A 3IV6A 4IWNA 1OMOA 1ZWLA 2ZB4A 4K6MA 4E07A 4TTJA 4BC0A 3UW1A 3LX8A 5H81A 3H5TA 1OIVA 3OZAA 4QBFA 5KYYB 3JRWA 1OB2A 1D4FA 3U3MA 4YUXA 2R6GA 4QU0A 4P53A 1AK1A 1JKIA 5TJ9A 2B9VA 3G5AA 1PVOA 4XGRA 2JD2A 2ZRAA 4A6XA 1P0IA 1KBOA 2XCUA 2B25A 2JCSA 1QOPB 4QRDA 4Y8VA 3TQTA 5BPFA 3FFWA 3HJHA 3IIKA 3RROA 5G41A 1HX7A 5CIYA 3WYFA 1D3AA 2GKOA 5AM3A 1DU4A 4AQDA 1Y7LA 5DHAA 4G5RA 1KR2A 3IAM1 3FMVA 1KWGA 3H1PA 4EKGA 4OAPA 3ESBA 1SCAA 1V43A 1NI4A 1VLLA 3OQHA 5KTKA 5DYTA 3JALA 1T3LA 4GNRA 3L8GA 5AHKA 3E9YA 4AJOA 3AVUA 2FPPB 2BGWA 3A7EA 4MQLA 3S2UA 1NKSA 1SUSA 3CUKA 3IMKA 5HM8A 1EEHA 1J22A 3FNQA 2QXUA 1NSYA 3W34A 4AUKA 3MS2A 3N7UA 3FF4A 3OBIA 3I6ZA 4AZWA 2CUTA 3T7EA 1MPTA 4DQDA 3WGLA 5U4QA 4EP1A 4MKRA 4PW0A 3UXMA 1ISGA 1J33A 4PCLA 1HNNA 2NTYC 3B85A 3KB6A 4BKPA 1RZRD 4OXNA 5KPJA 3W5AA 4A8HA 2ZJFA 3K6KA 3SSAA 2JLAA 1RJEA 1SQ6A 4ZO7A 3ZGXA 2CXRA 1P2SA 4GLFA 5CFNA 4E2YA 3PZBA 3SCZA 3EIQA 4Q3DA 5KQSA 3AUFA 5E0OA 1XVUA 4YAWA 3U4MA 3W1EA 3NGXA 4DJFC 1QYDA 4TTTS 3CCBA 4WPGA 2D5AA 5EP2A 5H0IA 3SZLA 1ADCA 1D04A 4HFNA 3VU1A 4ZGWA 2RGGA 3JYNA 3LNCA 1PBNA 2A1TS 1RMTA 2Y93A 3CRZA 3NXSA 4YRQA 3B89A 1L1EA 4N4AA 3WDKA 1OWOA 1R6AA 1V4BA 4AL4A 4C05A 2O57A 3WHKA 3DUFA 1UDXA 3K2BA 3AR8A 1U9YA 4YK7A 3CR7A 4FHFA 3TUZC 1GPYA 1G9XA 1BWPA 1IXRC 1EX7A 1ZCBA 2H85A 2WICA 2R1TA 2PJZA 4XVCA 1M66A 3H87A 4D4IA 4QT0A 4A36A 2P90A 1Y3BE 2L19A 3AM1A 1AC5A 1X77A 4GF5A 3EGXB 4F86A 2XH8A 3WV5A 5JNRA 4KH0A 1I30A 3C3KA 4V0KA 2I4MA 4YJFB 3W0LB 2AFHB 4IV0A 4YQEA 2IXFA 4EB6A 2IS4A 1QRAA 3A2KA 5IDWA 1BGWA 4O29A 4YRDA 1YCHA 5AXCA 3U81A 1FK8A 1W1UA 2A0WA 3SDZA 2ID4A 2JZOA 3RVPA 2D0DA 3O9ZA 2Q6VA 5HX7A 4UATA 2OFWA 2M9MA 4MJ7A 4TS3A 1SQGA 1JTEA 1QO0A 1FVHA 4I4TB 2FPMA 1JG7A 4U0KA 4O0LA 3NIBA 1TCBA 2XUOA 3ZDYB 1NBME 5HGXA 5G4KA 1Z0KA 1IXKA 2AMVA 1JAYA 1L7XA 3PHBE 2VQEB 2IQ5A 1LLUA 4Y0VA 1P5JA 1GLGA 3QIVA 1LNZA 1C9MA 3L1IA 3LUFA 3SZMA 2QTRA 2GDZA 3NANA 4UDXX 5F7ZA 1U11A 1XMXA 4FJ2A 5FOTA 4F5ZA 5T4FA 3BRSA 3OCYA 3OY7A 4AIIA 1J06A 2FW0A 3A6JA 5ALRA 1E1DA 1T5LA 2FEWB 4PGFA 5K2OA 5JLAA 2BZ1A 5C0OE 3I3SR 4FNMA 3U0VA 4C87A 3VPAA 2GTPA 1XDBA 1R74A 3HKCB 4JL6A 4BDSA 1D4OA 4OD0A 1JQJC 4Y6GB 3ZCTA 4DV7B 2XEXA 3R7LA 3NNNA 3GJTA 3MA0A 3FDFA 1JKFA 1K1EA 1P1RA 4IKPA 1QAMA 1UMBA 3BVPA 4MITA 1E2KA 4MV5A 4NP6A 1HSZA 4BV3A 5CB0A 1KZ9A 1WLSA 3WK7A 4ZMSA 1O0CA 2Z3WA 2J6IA 2D5IA 3ISTA 1IUKA 3OIUA 4PRLA 4LG1A 1W36D 1GZUA 4DSZA 1JX6A 1JDSA 3EFEA 4UTRA 1KGSA 3GQVA 4K6CA 2W7TA 3LT2A 2C4KA 1OROA 3N2LA 2ODTX 4MEJA 4WDQA 3OOYA 2PUCA 5BUZA 4K9LA 3EGEA 4D9KA 1UINA 1LA2A 2QVLA 3MGBA 4A7PA 4EITA 1FSZA 2PAFA 1DGQA 2I9KA 1P60A 1JWAB 4Q48A 3T4UA 4IFBA 2GI4A 4BZXA 3L41A 3KSMA 4CUJA 4AK9A 3IJPA 4ZXFA 2CJWA 4HAWA 4H77A 3PQDA 1T4GA 5CNKA 2OQRA 4BLQA 4K9PA 2ZULA 2VJOA 1AS2A 5FHRA 4N47A 3H2KA 4NC9A 1JPUA 3LGSA 4WFJA 4YJ3B 5JQGF 3MOGA 1AM4D 3W5UA 5REQA 3USES 1CTQA 2P9CA 3Q11A 3T41A 5A3RA 2GZRA 4D5EA 2VNJA 3U19A 5AHOA 4HNGA 2NMVA 4YP7A 2CJXA 4MYHA 4JFAA 1E58A 2EIXA 2W0SA 3DE2X 3OHPA 4RH1A 1NVBA 1QNFA 1QTIA 5IK2A 2X41A 3M6WA 1FW6A 3W3ZB 1Y89A 2IZ6A 2IZ7A 2M6RA 1T5IA 1OZHA 2I3ZA 2PZJA 3BD6A 4XB6B 1OHHA 2VSOA 3FAKA 4YRCA 1OAAA 4CG0A 4MLZA 1VC2A 1RXEA 4MRMA 2VYNA 5AXBA 1R27A 1KI1A 1AB5A 2GXQA 5B57C 2VQDA 3PWSA 2OC9A 4MVJI 5LA6B 1PJCA 1IZZA 1R4MB 2G72A 3EBOA 4ATNA 4E30A 4N03A 1T34A 4ZTBA 1YJXA 4CIXA 1JVBA 3SP1A 3D54D 3GARA 1Z0IA 2J46A 3JSAA 3I3OA 1B1AA 2ZB8A 3DEKA 2G5PA 3CUWA 1J8DA 2A14A 3VR4H 3KB2A 2CVQA 1YE8A 2VHJA 4RS3A 4RVNA 4Y2XA 1J2YA 1ADYA 5IXYA 1V96A 1DIGA 1JU3A 1V26A 3EQ8A 5I6DA 1F8FA 1QPBA 1T1IA 1RQGA 4M0DA 4CIWA 5HKBA 3BD7A 1G6KA 3HZHA 1B6GA 3KB1A 5EZ6B 5KTOA 3D0KA 1F7VA 5CVDA 1OFIA 4FQ7A 2QR2A 2WF5A 5BN5A 2XZOA 3HNOA 5KDOA 3PGKA 1QV6A 4JJ8A 4ZU3A 1J6UA 2ZCJA 3ZDRA 3EZNA 4IQGA 5KTPA 3FPBA 2PL5A 3T4PA 1A5SB 4X3OA 3UMVA 4U8HA 5FUBA 1O6ZA 3UANA 4HDMB 3T5GA 1XYGA 3D5EA 5TPZD 4WKGA 5IMBA 1XKXA 2RI6A 4MAFA 1LTQA 4FGSA 2C83A 4TKLA 2ZT7A 1REQB 5DHUA 2UZ1B 4BRZA 1KAQA 4YAKA 1SIBE 4UBOA 1PL7A 1Z39A 4C1NA 3M1AA 1LU9A 3NTUA 2PKWA 4WFQA 1ISSA 3F2VA 1R4NB 2Z43A 5CT9A 1DJLA 2EC5A 3MXTA 1V7PC 1V45E 1W59A 4K5QA 4XW2A 3P0FA 5EJIA 1HMYA 1QTNA 3ZWKA 1MNAA 2HCTA 2Y1CA 4EY8A 4ZTZB 1R2QA 3NDIA 1TMGE 4QASA 5TRTA 3DD1A 3AR6A 5FBZA 5AUNB 3NTLA 3R7DA 2XUIA 1N5IA 1FSPA 3IV9A 1O95C 2ILTA 1DTEA 1BXRA 2OXRA 4X45A 1Z5NA 1RP7A 2F3QA 2I99A 2OZEA 4MQEB 3PJGA 1AKVA 1H2HA 1E6WA 4IJQA 3LCMA 5T67A 2FFAA 4D41A 1QCCA 2BM9A 2GEDA 3HADA 1QO9A 1NF8A 1UBKS 3D4BA 4TV9F 3K8OE 4HUTA 4ZQIA 4RM2A 5JSUA 2CNNA 1RYYA 2JDIA 1GNVA 3D3EA 5K3FB 3IURA 4B40A 3IIJA 3HL0A 3V4LA 2QZ4A 3EXIA 3QVOA 5J5VA 1Q2UA 1UBMS 1X87A 1QZXA 2MHCA 2ZUUA 3G9UA 4U6NA 1E1CB 4TLEA 3U4DA 1AF4A 3NTRA 4LSMA 1RHUA 1HT3A 2IEBA 3KOWA 4IDBA 3A4MA 1DJQA 4D2IA 2W2KA 3E8XA 4MUKA 2HKIA 4BGUA 1CR4A 3S27A 4UKDA 4HNSA 1AURA 1KH1A 2XRYA 4ND8A 2C82A 1C3JA 2Z57A 3SX0A 3W05A 3WK8A 1Y3FE 4CI9A 4UNIA 3FUXA 2AG1A 2QY9A 1FLDA 3P97A 5DM70 3VC2A 4CM9A 1CE8A 3UN1A 1NVUQ 4DWJA 3VJRA 3H8WA 4QOHA 3FKJA 2BMDA 3UXEA 2EDAA 1QRRA 2P79A 3C5HA 3IEPA 2VH5R 5HCIA 1EM8A 3GCXA 1RWOA 5B3JC 1E9AA 3AH8A 4GPEA 4B3MB 2UV8A 2C4NA 4YJ2A 1AGNA 5TMDA 1I7QB 3SQDA 4DPKA 3HU3A 1E2GA 3BB3A 3CJQA 4JUCA 2W6ZA 4L22A 1NIJA 2TMDA 4W1RA 2Z9BA 4AMZA 4X62B 4GICA 2NUPA 5CIQA 2AMFA 4KQ2A 5C7IO 3AIKA 5E2IA 4Q7MB 2HK9A 1GUFA 4XXHA 2WHPA 4LBVA 1YA8A 2QTZA 2O06A 4G3XA 4BO7A 3HNPA 3QOYA 4CKXA 3KUDA 4PLVA 3NXKA 5GGYA 1YR1A 2SCUB 1XP5A 1KJYA 2OGTA 3INRA 4FEYA 5DNAA 1YFJA 1BFUA 3EZ9A 5BWNA 2XQVA 2HK8A 2A35A 2R68A 3F5FA 4HLDA 5LMZA 3TTXA 2BM1A 2QG6A 1KR5A 4A8JA 2IH4A 4IH9A 3IP6A 3STYA 2RBKA 4Q7KA 4LWZA 3EZ6A 3JQAD 1PWHA 1LXCA 2XUZA 3KQWA 4U7JA 4O3MA 1BCSA 1TKBA 5D5QA 1XZMA 2CDRA 1P9WA 2ZYHA 2VDMB 5HFNA 4AMBA 3WBBA 4FCTA 4RMNA 1XAHA 1HGXA 1OVMA 1VG1A 1F8GA 1ZVKA 3P9ZA 4FE4A 1LPBB 2DAPA 3E2MA 3OWOA 4OQEA 5AK4A 5SYNA 5FUWA 5CXSA 1QV9A 2P2LA 3V8QA 1L4YA 4M36A 1XNRB 4YYZA 4MS4A 1M2KA 2IF2A 1DTWB 2G09A 3PNQA 5TF4A 4Q39A 2GR9A 3ZGOA 3MAJA 1ZD1A 5ITZB 2QLJA 4FFBA 3DGFC 3QWIA 1U5BA 4BMSA 3F7MA 4JWTA 5MF6A 2PGAA 3JYHA 2WU0A 1XTBA 2ZUSA 5LIRA 3ONFA 3V7YA 1DXOA 1TW3A 3AUUA 3LY5A 3N2IA 5CVUA 4ZCPA 4DJJA 3SX4A 1K5HA 1WP9A 2AMYA 3QWHA 1P6UA 4JH0A 1EGVB 2JGEA 3SJZA 4EJ2A 1CIPA 2P2GA 3D7NA 4IDHA 3WIOA 1E5VA 5AVZA 4H7PA 2AR9A 3OEED 4FHDA 2G9RA 1Z07A 3K15A 3DMTA 1VBMA 5E6UB 2BMWA 3IKJA 5ADHA 4N7JA 1XZQA 4RIFA 3BGIA 5KOJB 3ESCA 4GYYA 2O2GA 2CDCA 1P19A 4IX9A 4ZRMA 3OY2A 1G1AA 3MD9A 4Z8YA 4OP1A 4BASA 4W9NC 3B9QA 4G97A 5JJ5A 2WJPA 4F4FA 1Y42X 4DSAA 2F8SA 4G1EB 4N1AA 2YJTD 4MARA 4M83A 3RIEA 1K06A 3QFHA 4MNTA 1XPJA 4MRNA 3HGTA 1UPBA 4OQ4A 4RSHA 2HA3A 4CMIA 1G8SA 3PXUA 1OBVA 1WZUA 2XW6A 3QA9A 4BRUA 4AS1A 1B00A 6CHYA 2FUCA 3O9VA 1SGWA 2FHSA 2Q6KA 3FB4A 5CT4A 4O4LA 4TLAA 5IM5A 3A6ZA 1P61B 1QYIA 1UZLA 2P7HA 4J8PA 4WMLA 1UP4A 2ZIVB 2NU8A 4A03A 2ZP1A 3PEWA 4KN9S 4FB4A 2C9DA 2VSFA 4X94A 1T36B 1SURA 2ZUWA 1SG9A 1BN6A 1HTBA 1QQ7A 1TMYA 5CJ2A 5LP6A 1X80A 1XNJA 3T5CA 1VFNA 3BH7A 5DN6A 1JLMA 4CLEA 1GCUA 4CLRB 2BMAA 4OHOA 3NAQA 5I51A 4NZMA 3P9SA 3M4YA 4C4SA 3WNCA 4ZZ0A 2YZNA 3LH5A 2OE2A 1R10A 4NDZA 2QSJA 3RKSA 3PX2A 5BY2A 2P5YA 1OV6A 1NUHA 4YRRA 3RBXA 2VDOB 3OMXA 4J0CA 5T3UA 1P74A 1YR9A 4L51A 5FBLB 4AG3A 3HUEA 3E15A 5BT9A 5JS8A 2PSFA 3JQ7A 3R76A 1AMOA 4QPNA 4BQOA 1UDRA 3UCEA 3ZH9B 5KYNA 1QE3A 2GYUA 3DAOA 3JARB 3L8FA 2HGSA 4YROA 4ZOCA 1CJSA 1DRKA 4UUQA 1R1DA 1VDMA 2X4LA 3H9JA 5YASA 1RDFA 7AT1A 1KVSA 4LNHA 4W5TA 5TE9A 4N0EA 1L1QA 2IU6A 4LRYA 3ZCRA 3M89A 3Q7TA 1CQIB 5B37A 5GP1A 4ERNA 4DAOA 4DW8A 2JPDA 5LMNB 3IAS6 2GAFA 4GRAA 1IPEA 2OO3A 3AG5A 2J0EA 1OKKA 1Q17A 2PNJA 2UUPA 3LECA 2BBTA 1PGQA 3E1GA 2G9NA 1Q3KA 2VHTA 4HZUA 1CIVA 1R00A 4IGIA 4WESA 2GSWA 2X1VA 3A1CA 5BOSA 2OOKA 1KZHA 3U5TA 3E9DA 3JQBC 1SPBS 2H0QA 1SC3A 3ZZMA 4BVGA 1JIUA 2FWBA 4F45A 4TLCA 3OE5A 4O4HA 4M8SA 3DE7X 2XZTA 2C9YA 4K3VA 4U63A 3X44A 2CHEA 2R62A 3P2IA 5TLSA 2CJFA 3L3BA 4PIMA 3RYCA 2GCEA 4ZOAA 5JPDA 4RC9A 1JBQA 4F85A 4PYRA 5HF9A 4OYHA 3MBKA 3OI7A 1CUHA 5AOAA 2YWGA 3H7AA 1ZUHA 3I1YA 5GGXA 2JGAA 5LXTB 5FBKA 1OCEA 3N05A 4QUGA 1F48A 1N7GA 1D5WA 2OORC 3UB3A 4MUHA 2XPCA 4HCJA 4QDJA 1WPGA 3N75A 4DPLA 1Z33A 2R7LA 2X9QA 4Y2PA 3T0GA 2QL6A 1U9ZA 3AFGA 2AHOA 4PINA 2WV7A 2QLNA 1G8MA 3LS2A 3B5JA 3MLEA 1E2IA 1GZHB 2VRCA 4GZ3A 4Y67A 5ENDA 3O0DA 5DSXA 2JI4A 4I3HA 2CXPA 5AESA 3WKDA 4OB7A 1JI3A 1WDWB 3LYUA 1CF9A 4RK4A 4C2AA 3MFQA 4LYFA 3WGOA 4GQBA 1PHPA 2XGGA 2Q3JA 2X5KO 2ZJ1A 3EZXA 4LSZA 3TR0A 3VHQA 5HSGA 3D5QA 3DA8A 5FAXA 1U2ZA 1ZH4A 3RPEA 4UDOA 1N2XA 5B58C 4V0ME 2JH9A 4XA8A 3RW9A 5K2MA 5KJCA 4ZAFA 1A7JA 1KPGA 4KK4A 4EMUA 2ZIUB 4FLMA 5LDHA 3D8NA 3R9KA 2QEQA 5L3VA 3HCNA 2JAHA 1LPNA 1NY6A 1ZOPA 2GBGA 4G4SP 5HR5A 5KU7A 2H1OA 2PSDA 1KWKA 4JEHA 4YQYA 4PYMA 3BCHA 5DLPA 3N58A 4Z7OB 2QM0A 3K9CA 3M6MD 4L07A 3UUWA 1XIVA 4WLVA 3H05A 2QLFA 4CIVA 1BJTA 2ISQA 2CMKA 3VZRA 4DCPA 5JU6A 2VDNB 2JEYA 4FHCA 4AUEA 3K0SA 5CEEA 3QW4B 2GO1A 2ZDGA 3WYBA 3QUCA 2HTFA 1C4XA 4IJVA 3SZOA 5K0ZA 1UZNA 1UXKA 1YR3A 5DNVA 1RM0A 7REQA 2W8BA 3NUZA 2PFGA 2JLUA 1GWNA 1L5WA 3KL2A 4KYVA 5A6SA 1DHTA 1IPHA 1OFUA 2Q3LA 4P7KA 2WKWA 4KSCA 3ZD9A 2NXEA 3QEAZ 2NV2B 1PNOA 2CGEA 3A1VA 3NHYA 3OF3A 4KYTA 2ZZKA 3RS8A 1QHIA 1UQUA 3VO9A 3BFVA 1Q7EA 5EVJA 5JRDS 2QZZA 3KYDA 3CLVA 1D6SA 3I72A 4PLGA 4YCDA 1QJ4A 1U0HC 5ELLA 4R1QA 3ADBA 2R6HA 5DKFA 2CVOA 3QPUA 4JYMA 4R5MA 2IJGX 3AEYA 2YCLA 2CF5A 1U9IC 1VL1A 3RUHA 4DIFA 2OYCA 2YJ4A 4ZCTA 3COJA 1LK0A 2B2CA 1II8A 5DHFA 1NVVR 3D2CA 4U2KA 1QWOA 2UVPA 3EDRA 4Y6LA 1EBFA 2WU1A 5TARA 1XRPA 2IOQA 1J07A 3QG5A 4KBFA 4BFYA 3DFIA 4MR8B 1DC4A 2F43A 2NXWA 3G2KA 3DBRA 2W6JA 4OI0A 2B69A 1KJZA 2ZI4A 4QHTA 1K8QA 1S2MA 4R31A 3SE7A 4C0LA 2Q62A 4FONA 4G0XA 1YOVB 1SXHA 3I5YA 3T54A 4TYWA 2OUKA 4KR6A 1IE3A 2OZLA 3EK2A 5T6BA 4ZHQF 2IBSA 3MMZA 1WHSA 1BQ3A 4OGFA 4Q7EA 2XMZA 1AGRA 4ZOEA 2M1XA 1NXSA 4I6JA 4NV0A 3TI9A 1NZJA 1YL7A 4WY8A 4ZZ2A 1QAOA 2O3JA 4G86A 1RLOA 4A2WA 2G9QA 4KG7A 4TKZA 3IUJA 4B87A 1DI0A 1INLA 2HJSA 3F7TA 4DYHA 4ENUA 4S24A 1QCDA 4TXLA 4JENA 3U4QB 2HOQA 5E7QA 4L6AA 3BK1A 4FYXA 2ZVJA 1R0SA 3LMKA 3NWEA 1E4OA 4RAOA 3RIMA 3JQ9A 5L53A 3A3KA 2OV3A 2WIDA 1VIVA 1KH2A 1UT8A 2LPMA 1JHPA 4DANA 8GPBA 1RXYA 4NCIA 5AI4A 4QM7A 1TA4A 3DXYA 3GGDA 1MQ8B 2P8JA 3FA2A 3HYLA 1A5TA 4IMPA 3U2QA 3AJAA 4I9GA 4RE6A 2A2ZA 1T2VA 1Z4PX 3FTQA 4UEKA 4BEJA 4JIMA 4X90A 5AO9A 1I6LA 2WFLB 2OILA 4CV3A 2FLWA 3MAAC 4FYVA 3ENNA 2E87A 4GI1A 1QIMA 4AZ0B 3P9RA 2IYNA 4BJHB 3IEVA 2ZXFA 1GPNA 2B94A 3F3YA 1SKYE 2W42A 4C5AA 3RI3A 3H18A 1MOQA 1IBCA 3EPKA 3MQ4A 1NJ8A 3H6GA 5BQPA 2AE1A 3LTNC 4CQMD 1ZNYA 1OJLA 1XRLA 2QJRA 4XRGA 3EVCA 4F6CA 3GJ5A 1FQJA 5HG0A 4CDRA 2JGIA 1PFQA 3CR3C 1W19A 3KEMA 4YIHA 2YVUA 3N74A 1JHMA 1H6AA 3QEKA 3USZA 4XCQA 4E5PA 1STOA 2B1IA 5JBIA 3G9TA 4TTPA 4OI4A 2P9HA 2HU8A 3G5MA 2QGZA 4OL0A 1ILWA 5IN5A 4C88A 1ZJ4A 1QGOA 4KQ1A 4EFMA 3DB2A 1BXZA 3UFBA 1H2BA 5H5JA 1WW8A 4ZD6A 2PO7A 1UR5A 3RS7A 5AVTA 1A77A 2ECOA 2GFIA 1JZTA 1PQPA 1Q0HA 3FIUA 3MJTA 2EG9A 3GU3A 4IRUB 2LXNA 1DXHA 4L8WB 1YB5A 4C78A 5GV8A 3REQA 2OSVA 1B41A 3L6CA 2FSVC 3HKDA 4QTXA 5DZSA 4RIGA 1GKIA 4QPJC 1ZMOA 3BAZA 3FXAA 3H42B 5DOZA 1XRJA 5JFGA 2Q5QA 3KZNA 3KR2A 2Y0BA 4ZQGA 1XXHE 4K05A 4RETA 4CMKA 1U65A 3NHPA 4DLBA 1DXQA 2IU3A 3A9SA 2H1WA 1U3FA 2UXDB 3CZ5A 1Q11A 3FSEA 3ZV6A 1ULBA 2JI7A 1GL3A 4KUHA 4PS1A 4RFSA 3DBIA 4ARAA 2J3KA 4N18A 4C7KA 3BZWA 1TTPB 1M6NA 5CNIA 1ZRSA 1VYUA 2QX4A 4YDRA 3GAAA 1I7SB 4CYMA 1RYEA 2WYOA 4CE6A 4B3BA 2N0SA 2OCGA 3BMOB 1KDOA 1D0IA 3WB9A 3B9BA 3ES9A 1PS8A 3K6RA 4DF3A 4ZIRB 5KREA 3MTDA 4EY4A 1R0RE 5JR3A 4EUEA 2AFIA 2R3SA 4KMRA 1V35A 1K3TA 2FPOA 2QZSA 1B6SA 1PWEA 2HJHA 3RRNA 4IIJB 2HPZA 4ZI7A 2DB3A 2JJ1A 3KYIB 4K9DA 3KVYA 4JUIA 1XZPA 5DPMA 4HDRA 5I4KA 3LX4A 1HF3A 2F48A 4FN5A 3THYA 4PZPA 2XVYA 1JXMA 1M1NA 3E22B 1WTAA 4LYHA 1G42A 3E7DA 3FCYA 1JG1A 3OZIA 3BJRA 2CD9A 2A5JA 2EX1A 2ZBUA 4QQKA 4D9GA 1NM5A 1VPWA 1IB6A 1P18A 3K0FA 1EINA 1KXJA 2V7UA 3DLCA 4D5GA 3R5KA 1QUEA 3LXUX 1CKEA 3I39X 3QNMA 4D0LB 5KOHA 1UEIA 5ERXA 1KE1A 1IM8A 4PQEA 4Q4HA 1NUSA 3DT8A 2QN1A 3HDQA 2WSSD 2HB6A 5K0CA 1FDTA 1L1RA 2QD3A 3WQSB 3S2FA 1D9ZA 1BROA 1COZA 1T3HA 2ZRMA 5HBRA 4X97A 4AULA 2ZE7A 1QF6A 4CKCB 3VNBA 5HA5A 2ECFA 5D3ZA 1Q0ZA 1R88A 3UGJA 1QYRA 1MO6A 3U62A 2IHJA 2WWWA 3KFXA 3AERB 4HV4A 4KXXA 2PSEA 2R1UA 1EFPB 3ED1A 4GYKA 3U7RA 3ZE1B 4PLZA 2Y4OA 1D6NA 2VHXA 4RADA 2HWWA 3HUFA 2X0KA 3PHJA 3FPKA 4E94A 4NMXB 2YNMD 3W6UA 3ZVRA 3R44A 3RJ9A 3SGLA 3UMJA 2BFCB 1XHLA 2BR5A 2RHTA 3I9FA 3OFNA 4PO8A 3L5KA 1UKBA 3SJ7A 1P1BA 3T7RA 1VZ3A 1ZUWA 2JFQA 4TXHA 5E9WA 3GA5A 2QI9F 4TS4A 4QQRA 1IM2A 4MP6A 4TL6A 4UUOA 1C0PA 3D7KA 1QHYA 1XHEA 3HFJA 3HR4A 4R83A 2F90A 1XQ6A 3ZHUA 4EO7A 5HKOA 5AOCA 4AFNA 1I2ZA 3M2TA 3GB9A 2HAEA 3DTTA 4IEIA 4QL3A 2HGZA 4WGGA 1RAFA 3ZXXA 3A6DA 3KYJB 1WCWA 3IMEA 2OFXA 1F2TA 1SBTA 3C8ZA 1CY1A 3CS3A 4KXYA 1EFLA 1HL7A 1JDZA 2V8BA 3HZRA 3R6WA 4HXYA 4KMSA 1ML3A 2WWIA 3UJ9A 1ESZA 1XNGA 1LBSA 2H7VA 3PNVA 5K01A 2BE9A 1KVUA 4UPDA 3CLHA 2I76A 4BVHA 1UFVA 3WB1A 1WY7A 3VH4A 1ZK3A 1L5LA 3MT9A 4DZTA 3X3HA 2GCOB 1XALA 3ZJTA 1P2UA 2HF8A 3PP8A 2FMFA 3TIXB 2GBLC 1N77A 5IJZA 1U28A 2P41A 3ILXA 1GCIA 4HDKA 4IVPA 3KPVA 4X6LA 1NX6A 3DTNA 5ALKA 1QLWA 2OV2A 3R0IA 3HVIA 1WZCA 5TEWA 2D54A 3WNDA 2E5WA 2WFZA 4UAJA 1R0CA 3SEFA 2GNPA 4D3XA 5EWMB 2WUWE 2P9GA 1YZ3A 1Z5WA 2RKWA 1KP2A 3BMQB 3GFOA 3BSSA 2QG4A 3KAJA 4CL2A 1IG0A 2NWQA 3DDOA 4N5NA 4CTNA 4ZT4A 2GRUA 1VIAA 3CM0A 3EDMA 3L82B 1FNBA 6GPBA 1U0JA 3KQOA 1QQ6A 2BFFA 2PHZA 2BBWA 4RPJA 1NLUA 3D1VA 1P3JA 5DNEA 3KX2A 4F3TA 3H4MA 3F4KA 3DV0A 2VCEA 4R2IA 2QMHA 3NAGA 3SPXA 5CH3A 4CODB 3GAZA 1SOWA 2C5LA 2BCJQ 4DCCA 4F9EA 2IEAA 5IM4A 4UD6A 4DJEC 1BVRA 3UVEA 2FN8A 4R9SA 3OJ0A 4YP0A 1JA0A 2AG0A 2HCRA 5F9HA 3QLUC 5CYOA 3CNHA 2IS1A 2IYWA 5DYGA 1Z6PA 2WZCA 5DK4A 1G20E 2YMMA 5CDFE 1M5TA 5DBHX 2CXXA 3JU3A 2B0JA 4ZAZA 2LCQA 2GUWA 3IDFA 5JASA 2AVNA 1FP1D 4AY6A 1JHQA 2IOFA 3N8IA 4UFNA 5IJXA 4UQOA 1TYDE 2JEOA 2PWBA 2PK3A 3EHEA 3D8HA 3CNLA 2Y71A 5FPSA 4C0AC 4LAFA 4OBEA 1OLUB 3E1KA 4FC6A 1TQ6A 3H9EO 2VCYA 1J2UA 1MGPA 3TCKA 4ZJYA 1X1RA 3QA3E 4K81B 1FJGB 2VDJA 3NVAA 4V0LA 1CUIA 2QM8A 1U0GA 1I0IA 1Q57A 4UASA 1DSSG 1B43A 3L4SO 1N2JA 1Q1AA 3FCCA 4O02B 4UE3S 3B1WA 4MO9A 2PS1A 2E89A 4FR5A 4YC7A 4F4HA 3KZVA 3VYTB 2FG7C 1HZZA 1NNI1 1ZM3A 2JGLA 3O84A 5DN9A 4IFEA 3GLHB 1FXWF 1LY1A 3AF3A 3ECCA 4G4GA 3O8OA 5DU2A 1KF0A 4NYIR 2DJIA 5K6TA 3ZXUB 3OJWA 3BMNB 4XCVA 4CKWA 2BZSA 2XXAA 5A4DA 4RIEA 2DECA 1NWHA 4TTQA 4BAZA 1W85B 3CTPA 1RTKA 1B0AA 1UDCA 2IYPA 1P3Y1 3BCUA 1ADGA 5JCOA 1P8JA 1ODFA 5KTSA 4P0TA 1P44A 3AHJA 1WXHA 3LBAA 2AD5A 5H82A 2BJHA 4DR1B 2Y1FA 1K86A 1F4PA 1VMIA 4JLNA 4B4WA 2BM0A 1H2AS 9GPBA 3AR2A 1QYCA 2F3TA 2BV3A 5C80A 2UZ0A 1IVSA 1DUSA 3KZMA 3CY6A 3ZDBA 1KO1A 3HKEB 5IYZA 1IL0A 4HNHA 4CN9A 3D59A 1QFJA 2HXYA 3CZAA 1VCNA 4HXFB 3TGPA 4G0WA 4AC9A 4QULA 4FM9A 3K8ZA 2AVDA 4KMMA 4KPGA 1CP2A 3IEKA 1N2BA 3RIYA 3TOZA 2J6BA 3B60A 5E7IA 1YUMA 3RTEA 5H83A 1IBRA 4G5XA 5FA8A 2PGNA 5BYBA 1G3MA 2IIVA 4IHKA 1ZN7A 5G53C 5HF8A 5I3ZA 5JS6A 1KU6A 1YB2A 3P96A 4GECA 4JYBA 4NYJR 1F0PA 4RESA 4Y7CA 1JNYA 2P2YA 2WAAA 8ABPA 3NDBB 2AC2A 4LWOA 5FBHA 2FTKE 4NENB 5A04A 3H3JA 5TS3A 1ETUA 4YXWD 1TUGA 1PUJA 5E8JA 2O8VA 4QZVA 2FA9A 2FP3A 2FRVA 3PFGA 3KJIA 3CLTC 3CKMA 2QW1A 1MFZA 2C3UA 3IUPA 1TZJA 4URXR 2A67A 4UBKA 3UY4A 3O03A 2I4RA 3MTEA 4LHYA 5I7FA 5BQOA 3I12A 5EHGA 3DAYA 1UAAA 3X1DA 3FZGA 1NXWA 3GDFA 3G5UA 3P45A 1U1CA 3FNEA 3FPEA 4KPFC 4OQLA 3ZHSA 1E79D 1RAGA 4TYMA 1V25A 4LY9A 1FUKA 1GN9A 1I4LD 1VJTA 1SK9A 2IXDA 2HHHB 4HNAB 4BAUA 1KY4A 3FTCA 1YFKA 1DX4A 3QM1A 4FGUA 3TJRA 3HEBA 4OXQA 3PNMA 4P83A 1S1MA 2BHNA 3KC2A 3ZV5A 2NSJA 2XNKA 3PLRA 1J8YF 2MR6A 2OAP1 4HQ0A 4BQQA 2IV3A 4G1FA 1C7ZA 4M0PA 4C3VA 1NE7A 4CQLB 3KHTA 1A9XA 3VPBA 4OLBA 1WRBA 4TKUA 4NPAA 2Q50A 4U6SA 1FDOA 3LQFA 1O58A 1T5TA 3DR5A 1DO2A 4DA9A 4FB5A 2JIBA 1WA5A 2VNHA 3JD3A 4Y2QA 5B4VA 1UPAA 2BUCA 3BRQA 5CG2A 3CB4A 3GLSA 3TR5A 5AKXA 2AFHA 3TL3A 1T0UA 1Q16A 3ILSA 1VHQA 3QEJA 4RVHA 3RQIA 4E03A 4BYGA 2ADMA 1EP2B 2AH5A 2CHUA 1QTRA 2FG6C 4WD3A 1U1GA 4GUDA 4PWZA 1CRWG 2YUTA 4EI9A 1SXQA 4V0OA 1I9CA 1T15A 5BSWA 4RA9A 1ZHOA 4P08A 4GBED 4KDCA 1DAEA 1PWZA 1OX4B 1P1IA 1TEVA 2IHZA<