2ZRQA

Crystal structure of s324a-subtilisin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
QPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Tk-subtilisin folded without propeptide: requirement of propeptide for acceleration of folding
pubmed doi rcsb
source organism Pyrococcus kodakaraensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 114
structure length 318
sequence length 318
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2zrqA00
1EA7A 3PTLA 1OYOA 4KG7A 5CW1A 3T41A 1SUEA 3WHIA 5JMOA 1SIBE 5FFNA 1SBHA 3DE4X 5AVKA 1KDVA 1C9NA 2SNIE 2G4VA 1PEKE 2Z2YA 4CG0A 1S2NA 1MPTA 3F7OA 3DE6X 1Y48E 4AKSA 2XRMA 1NDUA 1CSEE 1PJ8A 2ZWPA 4I0WB 1NDQA 3LXUX 1TM7E 2WV7A 2HD4A 5K7SA 3QMPA 5FBZA 1TMGE 1UBNA 3EDYA 3QFHA 2P4EA 1Y1KE 1HT3A 1YU6A 5JXGA 1YJCA 1ST2A 2W2QA 3D43A 1PFGA 1TM4E 2X8JB 1TO2E 4JP8A 3TECE 4BWGA 1TM3E 3DE5X 3DE1X 2PWBA 3CO0S 4KB5A 4HVLA 1TO1E 1BJRE 2SICE 1OT5A 1JEAA 2WUVA 1SUDA 1PTKA 1GTL1 3LPCA 5B1EA 4J94A 1C3LA 1GTJ1 3I34X 4C3UA 1TM5E 1WSDA 3A3NA 1BE8A 2DQKA 3LPDA 3P5BA 4NE7A 3VV2A 1IC6A 2Z56A 1V6CA 3A3PA 3DW1X 4H6WA 4MZDA 1SCBA 5FAXA 5B1DA 5SICE 4YN3A 3VHQA 4DZTA 3QTLA 3I30X 3SICE 2SECE 1T1IA 1R64A 3TI7A 4HX2A 3VTAA 1AVTA 1AU9A 3D9QX 1GNSA 5ARCA 2PQ2A 1GNVA 1Y33E 3AFGA 1P8JA 2W2PA 4OMDA 3ZXYA 3WQBA 4ZOQI 1YJBA 2ST1A 1V5IA 1DUIA 4ZARA 2E1PA 2XTJA 2B6NA 3GT3A 5AQEA 3GCXA 1SCDA 1SELA 1GA1A 1TM1E 3DW3X 1WMFA 3EIFA 2ZWOA 3Q40A 3BGOS 1VSBA 2PWAA 3BPSA 3DE3X 3OSZA 3DVSX 3A3OA 1SVNA 1BFUA 1GA6A 1SUCA 3I37X 1SBTA 1SPBS 1KE1A 1Y9ZA 3ZXXA 3SQOA 2Z58A 4FONA 5JXIA 1GA4A 1SCNE 1Y4DE 3H42B 3F7MA 1SUBA 3HJRA 5ARDA 1IAVA 4B5LA 1AF4A 4C3VA 3WIVA 3CNQS 5AMXA 2QTWB 2Z30A 4WOCA 3WIUA 4AKTA 1DBIA 1WMEA 1SBIA 3GT4A 2DUJA 4H6XA 3I2YX 4H6VA 4DWWA 1GCIA 1XF1A 2ID8A 4CFZA 4LVOA 1KE2A 2HPZA 1SUPA 3EE6A 3DVQX 4LVNA 1SBNE 1GTG1 1NLUA 4WOBA 3L1KA 1SIUA 1Y3DE 2PRKA 2PMWB 3DDZX 1C9JA 3F49S 4OV6B 3DYBA 1SIOA 2Z2ZA 1LW6E 1T1EA 1Y4AE 3GCWA 2WWTA 2IXTA 1ST3A 2GKOA 4M1ZA 1ZVJA 2X8JA 2Z2XA 2SBTA 1ZVKA 3DE0X 3DE7X 3VYVA 1AQNA 1WMDA 3TI9A 3UNXA 4DJ5X 1P7WA 4Z2AA 2PYZA 3DWEX 5JXJA 1Y3FE 1S02A 1CNMA 1SUAA 3Q5GA 1GT91 1AK9A 1R6VA 2V8BA 2W2MA 1BFKA 3LPAA 4KPGA 1OYVA 3AJ9A 3VV3A 2TECE 1Y3BE 2IY9A 1Y34E 2PKCA 1BE6A 1T1GA 5JXHA 1TECE 4CFYA 5ARBA 1THMA 1Y3CE 1SH7A 1WVMA 3DE2X 4NMXB 1P7VA 1AH2A 1Q5PA 1C9MA 2ID4A 5I9SA 1AV7A 1SCJA 1SN7A 4K8RB 1SBCA 2WUWE 4NE9A 3AJ8A 3VSBA 3BX1A 1YJAA 4GI3A 1SCAA 3DVRX 1TK2A 2Z57A 1KDYA 1R0RE 1S01A 2ZRQA 1A2QA 2DP4E 3PRKE 5AVJA 4RYDA 1BH6A 2W2NA 1EGQA 1MEEA 4OMCA 1KDZA 2W2OA
chains in the Genus database with same CATH superfamily
1KDRA 1TDJA 3IMCA 4U5XA 1JWLA 2J45A 1Q44A 2BTOA 5L6MB 2ODEA 2OFWA 2W90A 1RXSA 3UJDA 2G06A 1ML4A 1V6SA 2HFJA 2XZPA 3GMIA 4EH1A 5ITZB 2ZB4A 2P5YA 3ZIAA 2HT6A 4G84A 3KTAB 2GX6A 1PSZA 1TMYA 2P41A 1G6KA 3QMMA 1D0SA 4MAAA 4O08A 5DHAA 5E0OA 5EJ2A 3GLGE 1MPTA 4I9NA 5DW0A 4UUNA 2GCIA 2I3ZA 3B52X 2C92A 3BGIA 4IDDA 5FO0A 1DWUA 3CT6A 4CG1A 2JAPA 2JFUA 2JGDB 4QDZA 1QH9A 5EWJA 4S1PA 1FA9A 3L9WA 1SVIA 5F9HA 1SC3A 2Y1EA 4BVFA 4ZIRA 4GLLA 1JEJA 3BFVA 1E64A 1VSVA 3VSAA 1R8YA 3O83A 3GEMA 4FT2A 1NY5A 1JKXA 1U0SY 3DE1X 4UQPA 5CAEA 1J7JA 4E4RA 5T7BA 1DOAA 2IRWA 2J3QA 1B0ZA 4UTOA 3ZGVA 4PG6A 2XGOA 1E9FA 1L5KA 2SKDA 4BO6A 1JDTA 2HX1A 1JQDA 2YYSA 4QUHA 1CP2A 3BC1A 5HDQA 3ROMA 3ECSA 3S2YA 3UT0A 5SICE 4BN5A 4B2LA 2R85A 3E9YA 3O6VA 4B4DA 4LF6B 1P2BA 1EYZA 1LLFA 1N5LA 2B78A 2IITA 2CE2X 2OBLA 5HQ3B 1PWHA 1KARA 1A76A 1ZH8A 4D6XA 3WB1A 4U9HS 4QZVA 2DBRA 2Z3VA 2BZ1A 4Z7JA 4E51A 4S0ZA 3U1BA 5HPYB 2EKBA 1QHIA 2Y1WA 1E7RA 1OX5A 3ICEA 5DYWA 2FPKA 3QLVC 2F9LA 4FZRA 3VO1A 2TMGA 2Z5LA 2PYDA 3MF4A 4CCYB 4WZBB 3USZA 1V1RA 4HFNA 4DBLE 3KQKA 2IOQA 5TJHA 3U7RA 2OO7A 3HH8A 1YA4A 2W6CX 1SR8A 2B25A 4NJMB 4KYUA 4HNGA 1PGNA 2C2YA 2H4WA 1DEOA 3P2YA 4G5XA 4JOBA 4P36A 4TXHA 4D1YA 2HR1A 3F7MA 3QEKA 3WGKA 1YRQA 4RVOA 4LZAA 4L08A 5T6MA 4YJ3A 1FP4B 3OQVA 4MP3A 4BCCA 4NESA 2NO5A 4HNUA 5LSAA 2AC4A 3ZWKA 3BTOA 3GGGA 1L7NA 2HSDA 1T2NA 2D13A 4YH1A 1KQFA 4Z4QA 2RAUA 4BC1A 1DAIA 3PSHA 4BE9A 1CUHA 5EUBA 3GPBA 2DVMA 5KCMA 3A11A 4XD2A 1SB8A 2NZVG 3K1AB 4X91A 1IDN1 1E3WB 1G20A 2IZZA 2AI3A 4GI7A 4IO0A 4J8PA 3T5DA 1I0LA 5CDFA 5EEGA 4BL5A 4EMBA 3KB6A 2Q7OE 2NU7A 3OIUA 2O5EA 2ZS7A 4UVEA 2OO5A 3UEOA 2W2MA 2XUQA 4BNKA 4D0RA 4N0MA 5DTJA 4IRUB 2JCXA 4UHBA 3C3XA 4QQKA 2H4XA 1JH9A 4RORA 1JKFA 4CUJA 5CFQA 5A4DA 3BFJA 3PEUA 2OLJA 1YR8A 3R2JA 1BRTA 4L85A 1QB8A 3TPZA 2YWDA 3OCCA 1UKBA 5KJ6A 3PICA 4CEJB 1O97C 2PX5A 1C2YA 4LRWA 4BMSA 2XOKD 4DBLC 5BNTA 4CZ2A 1IOVA 1IZ9A 2XNDA 3HDVA 1ZGHA 1X74A 2WU1A 4PY2A 2EARA 3DVRX 1BE1A 2P8JA 1UJMA 5AT1A 4JI6B 4D9CA 1QV6A 1D03A 1U7TA 1KEVA 2VJMA 3LTEA 2C94A 2MYTA 1FJXA 4W1QA 4GOKA 4RH3A 2PU7A 4WPGA 1IN7A 4S1TA 4C0QC 1XQ1A 5DTQA 1P1BA 3NVMB 1RKVA 2JK0A 1MQAA 3H4VA 5FWDA 3GGOA 1E3EA 3WJ7A 4Y2QA 4C0SA 3W3AH 1QONA 4LK3A 3JQGB 3F71A 2ZYSA 3JRWA 4DR5B 4C2TA 1ISSA 1ZIOA 3HLTA 5CFMA 4QXRA 1EGVB 1Q74A 1Y6JA 3LQYA 3FNEA 4ZAYA 1RAGA 3P0FA 4AK9A 5JSZB 4Y98A 3BWCA 2NXCA 1R4NB 1V11A 3AKEA 3WLSA 2N47A 1XP8A 1UOPA 4Q01A 3G1UA 5HJ2A 1G59A 5DI3B 5ALXA 2JIRA 5LR6A 3HJTA 3R5SA 4OJKA 1Q0UA 2GZ2A 3VU9A 3JTMA 1NBMA 1SHZA 3HU2A 4ARUA 2XCSB 2WNHA 3V33A 3HKBB 3OWHA 4Q3EA 2MSKA 1Q3TA 4QTUB 5IM4A 2M9MA 4G07A 2AD5A 5FEUA 1GRQA 4K28A 4B3XA 2H4YA 4GWLA 1ENYA 4BZWA 5F9MA 4D2IA 1EB8A 2O0JA 4D26A 3T1QA 2DHRA 1EFHA 4MDYA 1AX9A 4KQ9A 3E3LA 4R8RA 2I6UA 1T2AA 4DYVA 5C4IA 3M8KA 2X22A 2E37A 1RCUA 2YV2A 3K2QA 3UXMA 4NFHA 1N2ZA 2ZE7A 4R8MA 4KITB 1AVTA 4K88A 3DL4A 1GXSA 3ZYCA 1QYRA 1L8LA 3TSAA 2Y6UA 1L5HA 3NAGA 4ENUA 4AYWA 3V4OA 1H1LA 1US8B 4GDFA 4B82A 4YV0A 1YUMA 2IH4A 2B4KA 5JDIA 3N7UA 1FTQA 5JRJA 1EH5A 3SHFA 3PVZA 2QYOA 4CI0B 4PIMA 4NBTA 1MORA 3H7AA 3TNJA 4A2WA 1NQOA 1EUDA 1F3LA 4J4TA 3SS7X 5ICCA 5L3QB 3JAKA 4K6OA 1F8GA 2E1RA 2B1QA 1ADCA 1KBZA 3OPNA 1H8EA 1YCHA 1U2SA 3HVKA 3CRZA 4OI1A 2VHEA 4PGHA 3SJUA 4FNGA 4D4KA 4CF7A 3WFIA 4AJOA 1NOKA 3O1JC 3ROTA 1SCQA 4OBEA 2QLBA 4PHTA 3QX3A 1NUQA 3HVIA 2XJ9A 1UMBB 4OK6A 4R6XA 4OREX 2AH5A 3WLTA 4EPRA 6ADHA 5GADl 1XTRA 4YMHA 2QRKA 3IC5A 3BIFA 3PU6A 1K6XA 5CLJA 1HE1C 4D9FA 1Y3AA 1BROA 3VDXA 2PD4A 1I1QB 2IZ5A 3QE0A 2OHVA 4H3VA 1GRCA 1R0ZA 3KJGA 1G20E 4KVZA 4B8ZA 1RAFA 3ZV7A 1XRJA 2W2XA 3E7PA 5GONF 4UQLA 5IKPA 5C9ZA 3AU8A 3EGXB 3TTYA 2UYOA 1FW6A 1KPIA 3V7YA 4FSHA 4DFDA 3QMVA 1QAOA 1KAHA 1OA1A 4MIEA 1Y6GA 2AHOA 3E1SA 1EA5A 5D6NA 3HBJA 1UJ2A 3I4CA 4TTPA 3T9AA 2WWVD 1SUSA 5KCZA 1TW2A 4JUFA 1AZLA 3SHOA 1UJ4A 3I76A 2X9GA 2HHLA 1SKAA 4AS1A 1PTJC 1QTQA 5JSFA 2ZAGA 4TV8B 1IZ7A 3O8RA 2DFVA 4AY2A 1VLQA 4H0NA 2IP2A 4GLOA 4RVUA 4WE3A 1E0KA 5A1TA 3IS3A 4W5WA 3ZGNA 1KRWA 1IBLB 1GWNA 1N5RA 4G1CA 7REQB 1LBHA 3E9QA 3FUVA 5ITZA 2YZ2A 2OSVA 3IMEA 1JDBB 4BNJA 3K9HA 4QL3A 1DKRA 1UQTA 2ZWAA 1GR0A 8GPBA 4HXGA 2O7QA 2IXEA 4N7MA 3RRBA 3SYTA 4YMIA 2ID7A 3GRVA 1VG0B 3H9QA 3V1KA 1M1YA 1LBTA 1R4ZA 2HQBA 4PIPA 5HK9A 4U7WA 3WYAA 1UBNA 3ENWA 1GVHA 1W75A 2FW6A 2FVXA 3EIXA 5HS4A 4TX1A 1HDOA 2X7XA 3HXTA 2XSZA 5BT9A 3SSNA 2JF0A 3TLEA 3WQRA 1FDOA 1ZKDA 3JWIA 4QXQA 1E1RD 3RNLA 1WKCA 4AJ1A 5JWOA 2HMVA 3EGWA 3D6UA 4YUWA 3CG4A 3K6JA 3CH4B 3GRFA 1EIWA 2CLLB 221PA 4XR9A 5AR1A 1NKTA 1Y42X 2HJSA 5K01A 4QUAA 1XDZA 5HGJA 4NCKA 3ONNA 1G5RA 1WZUA 1EMDA 1YZVA 3EXEA 3O8OB 2RB5A 5I47A 5K6AA 3UMFA 3QUAA 4B2PA 1PF7E 4Q05A 4DQUA 4IGFA 1E9DA 3CZ4A 5F5NA 1GTZA 1SZCA 3VR6A 2APJA 3DZFA 4W7SA 1LV8A 1XZFA 5HQ3A 5CCXA 2QRVA 2QL7A 3C48A 3R7WA 2C9ZA 4DNQA 2ST1A 1CK4A 2W0SA 2P90A 4LK2A 2Q50A 2VIIA 3UJBA 1ZGZA 1DBRA 1UPTA 2QRJA 1C3EA 2ZWOA 3GJYA 2YMQA 3SPXA 3OCWA 3Q85A 3GLFA 2I6GA 2YIDA 4J1NA 3RC8A 3ETLA 3OAAD 2IS2A 3LU1A 1WF6A 1VXRA 1YZGA 4INZA 3HZRA 1IAVA 3TM5A 2P4SA 4Q3LA 5BW8A 2JGLA 3GLIA 3L79A 4CQNA 1HSOA 1RCTE 2GRJA 2JBAB 2JCGA 4QBHA 1FPMA 4KRGA 4X62B 3BIOA 4X45A 2ID8A 4XLZA 1KJWA 1N2CE 4IPTA 4RMNA 2Y3IA 1KMIY 2H8GA 1SBQA 5DIZA 4MEJA 3GLVA 4YRRA 4JBGA 2I2WA 2ZTSA 1SIUA 4NQRA 1UXJA 5KC8A 2UUAB 3A14A 3NVDA 5CM8B 4Q00A 3G8AA 2WHPB 4JQZA 5TVGA 5K0BA 4CV1A 2OGZA 5JAIA 3NR2A 2CNDA 1MGOA 2JLRA 4B7AA 1BMFA 1DL5A 4L75A 3WYBA 3AIMA 4BKOA 3IEUA 2YZ7A 3TJMA 2EQ5A 3B7WA 4OP1A 2H0QA 2ZI9A 1ODCA 4X20B 4D3SA 2LTAA 1T8YA 3FYHA 1ABFA 3JR3A 1GV0A 1QRAA 3UYLA 1BA2A 4YCDA 4TT3A 2Z1MA 4C76A 4NNJA 2AKYA 1OXTA 2D06A 1PWXA 4JR0A 2ZAOA 3MGGA 3DCJA 2P9JA 3LBFA 4YAFA 3ZE7A 2ID4A 4BFZA 5ITVA 3ROKA 2JAWA 4NABA 2VTBA 2VP5A 2IF0A 3R7FA 1NXOA 2C4MA 3BM5A 4WKCA 1VJCA 4UXHA 5BSHA 2YJNA 1OH5A 1KOLA 2JJMA 3BYZA 2ZG6A 4N6GA 4U2BA 5BSTA 5TQ0A 2RHGB 2PK3A 3HMQA 1P6XA 1YDFA 5AVWA 3ACBA 3FYCA 2JK1A 4YECA 5E3IA 1RDFA 2JI8A 4KUGA 1DC3A 2DPHA 2RG7A 3DEJA 3PNMA 3EVEA 1OYOA 3GAAA 4FE4A 2CFIA 2Z4TA 4IIVA 2PKQP 3RUFA 5K05A 2QBYB 3DOIA 3GGJA 4ENQA 5C1PA 2W00A 2BE9A 4M76B 4QPPA 3QU2A 2AQIA 2BKVA 3QKRA 4IUYA 4DPMA 2CXPA 5AKIA 1F6WA 2G76A 5FPSA 1SK9A 3UJAA 5E2BA 4B81A 1YBFA 2XODA 5JE8A 4BPRA 4DY6A 2XE7A 3E22B 1KRXA 1N9GB 2FSIA 4WCDA 4IRMA 1KSJA 5IBPA 3ZU3A 4L2IA 3AM5A 2QDXA 4HN2A 1RFLA 1E63A 3K2EA 4HXFB 3STUA 4ZHSA 5HKBA 2A78A 4TVSA 4I55A 4YBZA 5EZ6B 3PLAE 3K5WA 1H1TA 4Q7JB 8LDHA 5DU2A 1E1RA 1KH2A 4DA6A 1QJ4A 3V8VA 2G40A 3K0AA 4ENWA 2PHZA 3IALA 4TPKA 4R81A 2WRZA 1BX1A 1T0JB 1VRVA 1ISJA 1BEZA 2MYUA 2ZSAA 4I1SA 4ITUA 2VDPB 4CTMA 4O63O 4TM8A 1VMIA 3WL8A 5L7TA 1V6CA 3E7DA 3UB3A 3I0NA 3OPYB 1ZOLA 4IOKA 2WTNA 4ZEXA 2QTNA 2VUTA 4K6CA 4C89A 2ZJOA 2C4HA 1YDEA 5FPTA 4MOWA 1J8YF 3EHDA 4ZALA 4CIXA 2FMIA 4JS0A 3IKLA 10MHA 1PJCA 1OGYA 4X94A 4NEQA 1G55A 3OOJA 3ZV4A 4DIBA 1C4WA 4DC0A 4N3BA 2A5DA 4KXQA 2HGSA 2OZLB 3R74A 3RK0A 3HL0A 4LYYA 3F3YA 5LFAA 4HXYA 7YASA 4D0NA 1GA1A 3CEJA 1UOQA 1CPYA 2HA3A 3GJ4A 4OYYA 5FYQA 1KE1A 1Y9ZA 2AOTB 2FEWB 3L8FA 1WSBA 3OZCA 3R23A 5DHUA 3QUTA 1N7IA 4XCQA 2JJ1A 4NENB 4UD2A 3R6DA 1T5HX 1OWLA 1U0RA 1OFUA 2NQ8A 2GXSA 3JVUA 4L8WB 2QM8A 3ESCA 1U1DA 4LXTA 3JAKB 3H2YA 2GJKA 3ZVRA 4C1BA 1JG1A 1PKEA 2FHPA 4BNZA 1JMVA 1T9HA 3ZKAA 1S4QA 2HPZA 3R7LA 2GM4A 3F1KA 3M4NA 1OAOC 4M0FA 5CH3A 1XYVA 3UBMA 3GLIE 1RIFA 2CNNA 2V3VA 3G68A 3NT4A 4D92A 1N33B 2FW7A 5FNVF 1LX6A 3FCCA 4UEQA 2HPAA 1FFHA 3TW8A 4B8YA 3ESRA 1AQNA 1JJBA 5T4BA 4BO3A 4KAXA 4MYDA 3RFFA 4BV9A 2AC7A 3Q88A 2V6IA 1WTCA 1TCUA 4OGKA 1AXGA 4Z8YA 5ED4A 2V6BA 4M7PA 4EQ6A 4FCTA 2EU8A 5LB2A 1JEQA 3BD6A 4Q03A 1ZPDA 5DSTA 5DBGA 3Q9LA 5FL7D 1C9DB 4OHRA 2IE8A 3I0MA 3GBPA 3R3XA 4JLPA 3V1TC 2Z08A 4IZHA 2PJDA 1ZHHA 2FG5A 3JYPA 6PFKA 1VLLA 1LFDB 2FEAA 3OKPA 3FDIA 4FWTA 2C2WA 5B1HA 1YHYA 1KQGA 3JX9A 3I8SA 1RLIA 4YQEA 4BAUA 1PR2A 1T2UA 4ZHQB 4V0MA 1AMNA 3O1IC 4Y2RA 3PC8A 1O3YA 4NCHA 5LA6A 2FSUA 3FWHA 1YR9A 1Y6ZA 1L5FA 3FPJA 1QS0A 5DIFA 2N46A 4H7DA 1Z36A 3KU1A 3EGDA 1N3BA 3CUKA 3D2BA 3V55A 4ZYWA 3HA5A 3LVFO 1YMQA 3NIGB 2HOQA 2VSOA 5J2UB 1UBKS 3SM3A 4MITA 4F4IA 4N5LA 1A7JA 3JAWA 4HNAB 3A4LA 3LDHA 5KOJB 1TMGE 2J9RA 2OXTA 4P1ZA 2JLSA 1O08A 2YHIA 3G2MA 3QPUA 2J3LA 1YFKA 3RTAA 3ZI7A 3D7SA 1C1XA 3S6JA 2ZR8A 1VJTA 3FPAA 3NC1C 4MGKR 3LV8A 4YRBA 2DEUA 1JXQA 3PNLA 3CS3A 4PSUA 1VCOA 1EG7A 2AUNA 5IM4F 3GFRA 3H8SA 4BGEA 4W5TA 1E4EB 1A5TA 1KIFA 2CXNA 1VL8A 3LX4A 5LUAA 4BO1A 3ZNPA 1OA0A 4X3PA 5DTEA 1FU8A 4KODA 1A8PA 2AEMA 2O2SA 2Z2KA 2VOJA 2VAVA 2UAGA 3CVOA 4Z53A 1G291 2DWPA 2WMDA 4BVGA 4RCZA 4D8VA 3ZY3A 5KSOA 4UNSA 3GJQA 5AM2A 3HO1A 2XGJA 5DMHA 4BNDB 2WM8A 3Q40A 2CDBA 3FOCA 4WLUA 2P69A 2QZ9A 2J1LA 3FHJA 5FUXA 1OCEA 1TT5A 2HA2A 4D8TA 4QUIA 4ZMRA 4LYJA 1EESA 3P9YA 5FQNA 4XIIA 4MK4A 2ATCA 4HDMB 5EOVA 3RRXA 3OO0A 2H85A 1GZVA 1SZJG 1SBIA 2GEVA 1QIMA 2KYRA 4N40A 4WZBE 4E6EA 1DT3A 4E32A 5JYDA 3V8NA 3L7YA 1RCFA 1VP9A 4GFDA 5FWXA 5KMGA 2QN8A 4XEHA 1AUPA 2ASVA 4G4SP 2H31A 1U7ZA 4LC0A 3TQIA 3KUCA 1N0HA 4CETA 4G0VA 2X8WA 3I01M 4F91B 1E3DA 1JSCA 1DQYA 2OHFA 1JSXA 3DF7A 2OO3A 1ZCBA 3WB9A 3AZOA 3IR5A 3GRAA 1ISMA 1TA4A 1W85A 2EJCA 1E0AA 4K46A 1LS6A 3MRSA 1VLZA 3NRJA 4C4TA 4CLRB 2FZEA 5DBEX 3D7MA 1NTOA 1X7HA 1LCIA 2C0CA 1RJWA 1J0DA 2JFXA 4N03A 4RA6A 5DBIA 4MEBA 3RHTA 3WB2A 1HFJA 1JDUA 4LJKA 4QT0A 1D5CA 4LZOA 1KI6A 3S2GA 4AO8A 3IIIA 3CKKA 1Q7RA 3F46A 4LJ5A 3B78A 4G4GA 5TMDA 5JS6A 1K7EB 3K8ZA 1KAOA 4IV0A 4K9NA 4URYR 5K3FB 3ADBA 2C03A 3DCIA 1J42A 2HREA 2I03A 2WWIA 1P3JA 5JY1A 3BRWD 4E21A 4XQ9A 1O0SA 4L74A 3EW7A 1YQEA 2H2GA 4BTEA 1SVWA 2IPAB 2JB9A 3KKLA 4LF7B 1EM6A 2W98A 3ELDA 3LUJA 2O48X 4ARZA 2WJAA 4BKRA 2LRHA 2Q1YA 3L6UA 2YXEA 3GLHE 3C97A 3FYTA 2VDWA 2IPMA 3C7KA 2ZYVX 4H7FA 4MV3A 3DSRA 4KPUB 4HQRA 1WHTA 3ZDXB 3F6RA 1EKXA 5T41A 2C7PA 2XLCA 2GEDA 2D54A 2G4VA 2SNIE 3II6X 3ZPXA 4EJ2A 2DQYA 1T9ZA 3CLRC 4I08A 1M6YA 5ALQA 1RPNA 1U7DA 4ZI2A 4YRJA 3G0CA 1RI3A 1XOIA 3M49A 3HSKA 5J59A 1K88A 1X7YA 3AETB 2X76A 3B1FA 5K7SA 4E6PA 1RMTA 4WIAA 5JDIC 3NBUA 3D6AA 1Z12A 1NBIA 2VYCA 2YQ4A 2FK7A 2IEGA 1T0BA 1THTA 4LXXA 4AF8A 2BFEB 1XDDA 1QC5A 4F9FA 4F6RA 1AXRA 1XQ9A 3CXUA 1E6LA 3T9EA 3OD1A 3HYRA 1Y4ZA 2Z5GA 3BULA 4EKYA 2YJ4A 1JBKA 4TWRA 1W36B 2R5FA 3O38A 3BD7A 2OD9A 3KRTA 3SQDA 4DDKA 4X1YB 4MUXA 5DSZA 1TTHA 3K72B 4FYJA 5CBKA 1YU9A 1ZH0A 4IS2A 4OFXA 4L5AA 1VJ5A 2R2GA 4U63A 5LCXA 4ZKEA 4XWWA 1Y1LA 2NM0A 2YZMA 2GVDC 1ODJA 2KBFA 5B57C 5G53C 4X7MA 1F60A 4BJ5A 4F3CA 2GBCA 3PFBA 5EP3A 4F84A 3N2KB 2QL6A 4MWZA 4BFWA 3GCGA 3P20A 3GELA 1KK3A 2H3HA 2X0RA 4IZIA 5FORA 4YUAA 1DMRA 1UAAA 3ADCA 3Q5DA 1ZD2P 3HYNA 2WUDA 1AZTA 2AG6A 2XCUA 4MV6A 1SPBS 1Z08A 3I45A 3R5TA 1Z22A 1Z4KA 4PN7A 1B6GA 4BWYA 1I14A 2UUCB 1UIMA 2M1ZA 1N9ZA 2XUPA 1T3TA 2HMTA 4MVJE 4PTYA 5K3SA 4L95C 3WZ2A 3HCDA 1EE2A 1MAWA 2A33A 5GTDA 5CGQB 4GPTA 4P31A 2CUTA 3I58A 4TUYB 3W8FA 4CHTA 2IXBA 4RESA 3TOSA 1HZZC 4MS4A 4XWGA 4UKDA 3L7BA 2BBSA 1R88A 2QX4A 4EYKA 1EDEA 2BHRA 2IHBA 3OJ0A 5KMGB 3DE7X 1OROA 4JC5A 1WMDA 1FUKA 1RZUA 5TT1A 3TQQA 1OH6A 1TCAA 2CFTA 1I0IA 4OJMX 1QHYA 2K6GA 4TMYA 3WFJA 3HJCA 5D7NA 4FK8A 5EIOA 3STTA 3GLFB 5IVHA 3I23A 2OR3A 4G09A 4ZO4A 1T8SA 3NP9A 1GSAA 1W48A 2W6JA 3EVBA 3P4XA 4FDUA 3UMJA 4RTPA 1HNXB 1H69A 4J0GA 4LPSA 2FE4A 1Q0ZA 1CC1S 2VZ8A 2D5IA 4PLYA 4X85A 1KI7A 4HO1X 4B3BA 1CV2A 4UTXA 2WOOA 1L7XA 4UBJA 1OE0A 3RSQA 1O4WA 3NEYA 1UOOA 3GZNA 2CVPA 1Q50A 3RADC 4IJUA 3RJZA 5CEJA 3K1AA 1QP4A 4UAJA 4E14A 2HIMA 1DLJA 1P1RA 2GJ8A 3F90A 3L1IA 5AESA 4TMTA 2F8LA 2IYQA 2UVPB 3SZLA 5ENZA 2VJOA 1ZI8A 1JSLA 1YOVA 3EMDA 3IEVA 5IKOA 3ENNA 3T41A 5G0VA 1S9HA 2H06A 2JKYA 5B12A 4YJ3F 2FPXA 4RJKA 1KDVA 1E58A 1ENOA 1M5TA 4DIOA 1FP1D 3FZQA 3RYFA 3FW1A 2QMOA 3KQHA 5KTRA 3EPKA 3P0HA 4FMPA 3O7MA 3IDQA 4OKNA 1LA2A 2V6MA 5K3EA 2IYUA 2GBPA 2XWJI 3IILA 2CV2A 1GCGA 1MOZA 4M0DA 4JSRA 3W5CA 3QMPA 1LSJA 3U49A 1Q11A 4OHBA 2Q1SA 1Q17A 1RWQA 2BUBA 4ZZ0A 3A6GA 5B7GA 3HGTA 4KJXA 2ZEJA 1MFZA 4NHOA 1R6BX 1ZXBA 2B61A 4OBWA 4UAGA 1UBMS 4GPIB 5DFAA 3VA7A 4FGUA 2DR2A 3C24A 4FDMA 3G2IA 3A28A 4A8JC 3TMYA 4C01A 1U63A 4JXJA 1B8UA 1RLUA 3A04A 3QJGA 3TEFA 5BR4A 3Q7SA 1RC0A 4KO3S 1N25A 5AHRA 3VNAA 2OT3B 1Q0TA 2FQQA 5HCIA 3MTAA 3CSDA 1UJ5A 3ORFA 2DJIA 1ORHA 2EWVA 5CX4A 1VCMA 3FCSB 4PC3A 3IP5A 5I45A 3S70A 1Y80A 3V8QA 1XPRA 5COBA 3FYUB 3QXJA 2A9VA 1PS0A 3PB3A 4YCCA 4YP5A 3HB4X 4PG7A 1A69A 3H11A 3VSCA 3BIXA 1Z74A 3WAGA 4H59A 3RCBA 3A4VA 1P9OA 3TOZA 1XEAA 5GGXA 1D0IA 1V41E 2LP4Y 3HJRA 1KR5A 2B5VA 1L1FA 3E4DA 5BVGB 1U7HA 4JGGA 1M66A 3ND5A 3Q2KA 4D44A 8ATCA 3IE1A 3OQHA 2Y0EA 3KD2A 4ENPA 1K68A 1EFPB 1U81A 5DKFA 3UWPA 2PS1A 2E7ZA 4N5IX 1UDRA 4ZEMA 2YN2A 5C1IA 2IIBA 3D1VA 4QHYA 1QKKA 4D8YA 1AO0A 4G5GA 3JD4A 4Q21A 2B34A 4V39A 1DJPA 4EOGA 3LQRA 3G0IA 3K53A 3MQ4A 5E2AA 5J5AA 1NHWA 1ZMXA 4LNUB 5AHKA 1JDJA 4KYIB 5AKLA 4D79A 1NVAA 2C3MA 4EI8A 5KPDA 1P44A 3ZLUA 1CUXA 3WWDA 4FSXA 4H7JA 1T0IA 4MHSA 4RH1A 4POOA 1Q22A 5KTMA 4BRUA 2IV7A 3LUCA 3RVPA 1AOXA 2QB5A 3P52A 3UTCA 2F3QA 4YR9A 1F3OA 4OHZA 3M5CA 3GAZA 2DWUA 1Z2OX 3VZSA 1FRZA 2HFKA 3PP8A 4GR9A 4XVQA 2YTZA 1M2VB 3HKCB 3FMGA 1E3LA 2J7KA 3RT1A 2B1IA 4AUMA 2UZ1B 2ZITA 4HB4A 1D4AA 1NVEA 1RZVA 1YR6A 5K6AC 1EQ2A 2JIZD 4WZAE 4FQ7A 1VRWA 3DMTA 1XCBA 2ZP1A 4D80A 1NYRA 1T35A 2G04A 4XA8A 3L1HA 2PH5A 4OP2A 1CDDA 1NMQA 2BGUA 4UNNA 4MZXA 2C83A 3NM4A 1K4KA 5E7MA 4E7OA 2P2GA 3LSYA 1A5AB 4O4LA 1KI9A 3ONEA 2XWBF 1RZRA 4M9UA 4QFCA 1T8WA 3TN7A 3EN0A 2GKGA 2G63A 3PR1A 4HJRA 4J9UE 5EIWA 2XMSA 4OF4A 1ZH6A 2JA1A 1NU6A 1T4DA 3AERA 4W9RA 5FI1B 1IWOA 2P5TB 1I5RA 1CS0A 3GJZA 3AR4A 3E23A 4O2AB 5CTAA 2HKIA 1M33A 3MC1A 3ZCVA 1LLDA 5EXEA 1U2GA 1PAUA 1K8ZB 1OT3A 2O9JA 4JVNA 2C3OA 2QP4A 4W1RA 4QFDA 5T8KA 3F6PA 2ZBGA 2V1XA 1SG6A 4UHFA 3MWJA 1H5QA 3CE9A 1C7FA 4GOJA 3B20A 4AM8A 4NNOA 1EBFA 5KB3A 2ZCJA 5DEIA 1G7SA 5FOTA 4F6RB 4LV6A 4U3JA 1CKEA 1U3WA 2F62A 2I62A 4I3FA 1LNSA 4AB1A 1SA0B 3HA2A 4BFLA 5F7OA 1YRLA 1IY8A 1XTTA 3NJ4A 4MA0A 1D3AA 4YP1A 1I51A 3C41J 4IDHA 1J9EA 3EGDB 2CHEA 3OQBA 1JL3A 2OOKA 4CIYA 2AXPA 4CLDA 2D1FA 3WHKA 4KVGA 1YBHA 2REOA 3AI7A 2IU0A 1F6BA 5EKDA 3TRFA 1P4GA 1TTQB 3DM5A 4L4UA 4O2LA 1DXYA 1C8LA 1MF7A 2O6HA 3JASA 5FA8A 1IBKB 4TMZA 3JAWB 3KKQA 1E3TA 2J87A 2YWHA 4F1WA 3A1TA 3QU5A 2BPOA 2ZZKA 3LHDA 5TY0A 3OOEA 4OXKA 4ZU3A 2H2IA 1ODLA 5CGZA 3HS3A 4P3XA 1K8QA 1E3MA 2FPIA 3MWGA 3W90A 5G41A 4NBWA 1DWOA 1UDAA 2HF2A 1NVVQ 2A88A 3ASYA 5DN6D 1C0PA 3J81A 2H17A 5MFPA 2R87A 3A6KA 5E8RA 1E1NA 4FOOA 2C5BA 2Y9PB 3E2MA 1OKKD 1SCNE 2P7HA 1RM5A 3DEIA 1WP4A 5AOAA 3OZDA 1E5DA 1BXRB 3R6TA 3KQSA 3OFSA 1Q95A 1OW3B 5FR2A 4DWWA 2IQIA 1T2CA 1CUBA 1CRQA 5LDGA 1W0CA 1P2UA 1Y6RA 3QENA 4EYSA 4YUZA 1FXUA 4UOEA 1COZA 2M1XA 4CF6A 4Q15A 2FZ5A 1JPJA 1R00A 1Z0SA 4OQYA 3I6YA 3LBIA 1T1JA 3AJEA 3BK2A 5B30A 1ST3A 2W2LA 4WV3A 1Q83A 3ZI4A 4PIVA 1NRWA 5IULC 3W5AA 4FIDA 4QNMA 5KYGA 3WLEA 2JEZA 3IP6A 3ONFA 2C98A 3JR7A 2WHRA 5CUQA 3L7CA 3Q10A 4L4SA 4A7PA 5BYKA 2F1OA 3GLIB 3PZBA 4HEHA 5IH3A 3IV9A 4BVHA 5I9IA 5HQTA 1VCIA 2ERXA 2Q5HA 3T1VA 4J91A 1KL7A 1N9KA 1KI1A 1I24A 1ZXLA 2V9ZA 2X15A 4IQ8A 1NAIA 4FFBB 4I5DA 3CGWA 4JQOA 5AW7A 3NUZA 4J7AA 4MR9B 4PBTA 2CFCA 4C06A 1ZJWA 1KY3A 3FH0A 1MXHA 3OE7D 5LUBA 1TQDA 3LLVA 3BJRA 3AHEA 4CIDA 3OECA 4KQ2A 2NO7A 2FRDA 4PZ9A 1KOFA 4KXWA 2YY7A 1YZKA 4M1KA 5DULA 1XLTC 3D5QA 4O1MA 1JXOA 2YIMA 4B9AA 1L1EA 3LT4A 3PDWA 1NNI1 1Y7IA 4OMCA 2GXQA 2HU2A 2N75A 4JVSB 4X9XA 4CQLA 2C96A 8ADHA 3AVYA 2ZRFA 3OLZA 4YGXB 2FMTA 2I7XA 1T34A 2RCYA 2QLFA 3SXUA 1U5CA 3BTVA 1GQRA 1GFIA 2JATA 2J31A 1E9VA 4GO1A 4QVIA 5BV8A 4ARIA 1D7AA 1PUIA 4TV9F 4YTEA 2ZOSA 2ZR7A 2XRMA 4RK0A 5DK4A 3T4EA 4UBNA 4NZPA 2Q1TA 4D41A 4E70A 1IJBA 4OLAA 4IRXA 2OO5C 4EY5A 3K1ZA 5EN4A 1EHYA 3RANA 3QV2A 5ER9A 2V03A 1UFKA 2OZKA 4JFRA 1LX7A 4PLGA 4CCWA 1FVHA 4EENA 3CO0S 4WK2B 4JBWA 3GLGA 5GJVC 2CVZA 3EXG2 2IYWA 4A0SA 1X80A 2IDZA 3R9KA 2CXHA 4L8VA 3CLKA 5BOVA 3GEBA 3U3RA 4HI0E 2C5EA 1K0FA 2AI2A 1PDVA 1GGJA 1W46A 2H11A 5EERA 1N2IA 3PUYA 4BHTA 4FCWA 1XZBA 5HIMA 3S5UA 2HO4A 1LD3A 2CLEB 3VKWA 3WBFA 3WMXA 2YH2A 1WXXA 1YQXA 1EK0A 4RQAA 1P72A 2FR0A 3HC7A 3SX4A 1VPTA 3EXFB 2QTCA 3GPCA 2B4YA 2V59A 1LTHR 1MBZA 4PXAA 3WGTA 2WA2A 2XTJA 4Q93A 5HTOA 1RM4A 5CB0A 4EP1A 1L4HA 5L3QA 1YCFA 3T7CA 1KVSA 1MABA 1OIWA 2J9FB 4L5JA 3AFNA 1N6IA 4UNRA 1BFUA 4LMRA 3HY4A 4O4JB 5IMBA 5LB4A 3GJ0A 4CBVA 5BMVA 1N5KA 1RS0A 2ZSIA 4XDZA 2CNWD 4TTSA 4EL0A 3NAMA 2QTGA 2JHAA 4JODA 2JIPA 1RQ7A 2NU8A 5IKEA 2DUMA 2GEFA 3A2NA 3EIQA 2YMMA 4F5ZA 3QVGB 3BKXA 4HGRA 3CEAA 4I1YA 3HBNA 1TD9A 3I9JA 1N92A 4PZPA 9MHTA 1N6OA 3AUUA 1DV1A 3IUQA 5F7JA 3NHZA 2NADA 1UT5A 5A5EA 3DL0A 2NTJA 4X61A 3S99A 3EPJA 1U8UA 3GCDA 2TSYB 3WOVA 2QTBA 1MKYA 2G4CA 1EWYA 2WAYA 4MVCA 1VHDA 1I9CA 3PQ2A 2GBLA 4LJAA 3CIOA 1SD5A 4HLUA 2R1UA 4CRWB 5M2QA 2Y4OA 3H5TA 3AVQA 1ARZA 2XMGA 3NTQA 2PL9A 1YS7A 3A6DA 4NYJQ 3OJLA 4KH0A 5EIFA 2JFNA 5A7FA 1QHHB 2IYSA 3HP1A 1VI6A 2FG7C 2PKCA 1PWYE 2F4NA 4KIUA 4DUZB 1TZJA 4M1WA 1V47A 2Q4DA 5BWMA 2IA5A 2QOEA 3GDFA 2P1ZA 2RMKA 1U3TA 3B12A 3JSXA 5EE0A 5FFFA 1FSZA 1TKCA 2GSWA 4FHFA 3P9SA 4EB6B 4Z54A 4HNVA 2VK4A 1RRCA 3MGBA 4M7RA 1ESMA 4G8CA 4OFWA 5D00A 4A0QA 4EJ6A 2PX6A 1PQ4A 5TVKA 5JYCA 1U8ZA 1XMPA 2QX8A 3DD5A 5ADVA 2VBCA 2CLOB 1VBMA 1YB1A 4YRLA 1ID1A 4DG9A 5JJBA 5KTTA 3DLPX 1UBRS 1USWA 2QUIA 4S0XA 3UJ9A 5BV7A 1OPRA 4G8BA 4N18A 1XD2B 1IM8A 2IEYA 2X2OA 2HGZA 4GVLA 3B5JA 4MUNA 4L28A 4AWBA 4BQFA 4IQFA 5FBVB 5E6SB 2I6QA 3KJFA 2CLCX 1PV1A 4ZT4A 3G85A 4H08A 1GFZA 4S1VA 4Z9AA 3AGQA 3HM9A 4DM7A 2EG9A 1LBSA 2IYFA 1TQ4A 3IP7A 2FF5A 4KFSA 2I29A 2YINC 3PFFA 4JB3A 4QXMA 3IKJA 5FNVA 5JOQA 3OCYA 1IBSA 1V48A 5TC4A 2WE8A 3MWDA 4DVJA 5HKKD 2YR0A 5BOSB 3BFXA 3AXTA 1J2JA 3PGXA 1B8OA 1GYRA 1QK3A 4PE5B 1SOAA 2W6QA 2OAP1 1J0EA 1B8VA 3A3KA 3FSGD 4YRIA 2B92A 3OEHD 1U0NA 3BF7A 5G0WA 4TZ0A 5DRTA 1XWFA 1GYQA 3D81A 1RKXA 3NZEA 1DIHA 1FW8A 3DZIA 1SKBA 3FUXA 4J94A 3QJ5A 4C5AA 1MUUA 3HFGA 4UFPA 2O1SA 4FPXA 1N2GA 4Q9KA 3RB8A 3ZS8A 1HLFA 3N39C 4KXXA 4XARA 3IT1A 1VI5A 3ML1A 4FX5A 3WWEA 3GRZA 4QNRA 1IY2A 1HSZA 5CXSA 4D9GA 2QD2A 4RELA 1WB5A 4WBSA 3RF6A 5ILQA 3RRMA 4S04A 4KJZA 3AU9A 1AQ6A 1H85A 2E6UX 4KGXA 5DNEA 1X7GA 3JS5A 2AJTA 1AHIA 3GG9A 4RPGA 2XQGA 1NBWB 1XDWA 5FT9A 1YQGA 1KVUA 2A4MA 2AG1A 3RVJA 1AHHA 1C1XB 3R0JA 3D6HA 3KBOA 1X7ZA 4P0TA 1DRVA 3IP1A 2COKA 5CFLA 2IZ6A 1G6HA 3THXA 3MAAC 4L22A 4ICIA 5K8TA 1FX0A 3TIXB 5IJXA 3NHWA 2P2SA 5BR7A 3VHLB 1MB9A 2NSJA 4DDVA 5LXTB 4C6TA 1UWVA 3DMRA 2Y1CA 1OC2A 4DLYA 3WKDA 1QXSA 3QH4A 2GETA 2OC9A 2WJZB 1IB0A 4YT2A 1XCGB 2FKAA 4XLTA 4JOQA 1Y63A 3E82A 2H08A 5EXPA 5ECDA 2WU3A 1DEHA 4HDSB 4MSUA 3AF6A 1J0AA 2MU1A 3ORSA 2RHBA 4TYMA 4Z86A 1E1CB 1MQSA 4PNPA 2EFYA 2XCLA 4TSFD 4U7PB 3E7FA 1ZUNB 4TKLA 1YAHA 5CBPA 1YDWA 3BMCA 1UXOA 1JLKA 2B4AA 2RBGA 2VS1A 3ASZA 3PA8A 3LNCA 3ZTTA 4DLRA 3Q5GA 3EA4A 2D6FA 1G5IA 3E5NA 4C43A 3N76A 4W5HA 3O47A 4DV0B 3G79A 1F9AA 3T3DA 3E3OA 1U2QA 2O8DA 4K6GA 2LIPA 3IT0A 4X6YA 4MKXA 3JYQA 4FNAA 4MWBA 2QN2A 4IIDA 1HF3A 4MVJM 4XUGB 4I50A 1P7VA 1Z83A 3BWBA 3OZBA 4PGGA 2GKSA 3L04A 3GZNB 3UCFA 4ALLA 1FBNA 1N0IA 2IVFA 5LNK1 2TS1A 4QECA 2XYQA 4UZEA 3WJ2A 3D31A 3QFFA 5C8DA 4EMSA 3OZSA 3SQWA 3JQBC 4I5FA 1L7DA 4XIYA 2LZ0A 1GRRA 3DLIA 4YCJA 2OFFA 4GKKB 3GLSA 1Y1TA 4B4WA 2HHAA 2P9HA 1V4NA 4BDTA 1II9A 3CSSA 5I7EA 1GPKA 1YV9A 4HS4A 2QYHA 5HGXA 1Q7GA 3WY9A 4WNAB 2FN9A 4UEOA 1DKQA 4DVGA 4F9EA 1KI6B 3FBTA 2JFOA 4NTZA 3IAS6 2Q62A 1XHEA 3HVHA 1OOEA 1PKXA 3ACCA 3MT7A 4AZVA 5A62A 4W6ZA 2P4QA 3C74A 1WCWA 3PXEA 3ZZ0A 1Z0UA 2FYTA 4UJ5A 3DOFA 1S7CA 3O8CA 5E0KB 4YPOA 3OTOB 3W5HA 5EZYA 3U17A 5K3AA 3UMSA 3QFHA 4Y6GB 4S05A 3KOXA 3R7BA 2FXIA 4TRNA 1ZGJA 3D43A 4JI4B 2EBUA 1JFFB 1HA3A 1DQSA 2P79A 1P0CA 2OM2A 2WKPA 3TWOA 3UV3A 2WMNB 7MHTA 1BN6A 3QITA 2GM9A 3RBAA 4MVJP 3ROEA 4G37A 4LMAA 4QDKA 3N8IA 2XXAB 3BORA 4MQEA 4XVUA 5KAPA 3OUZA 1TEXA 4LCBA 4I4LA 5PGMA 1AGXA 4Z1OA 4FYXA 4PSDA 1HURA 1Z7YA 1PO7A 1II8B 2JNWA 2OWDA 3ANNA 3LPLA 4JLSA 3R4VA 2CVQA 2ZFUA 4KIFA 4URHA 3WWPA 3ZBPA 5KJ1A 3RAEC 2QLLA 3P96A 1VE3A 1JQAA 3DMTC 1NT2A 1O94C 2R47A 1M0SA 2OFXA 1OTHA 4KKXB 2XB8A 1JPUA 1CRWG 2QJRA 3OWOA 4RE5A 2AL7A 2OK8A 3KEMA 3UMRA 4IYRA 1E2DA 1JLSA 2VDRB 4NIMA 2QTRA 3EVNA 5IXSA 3EA0A 1E2EA 3AUAA 1D5WA 3CMCO 5EWLA 3SYLA 3KETA 2NAFA 3ROZA 4Q4HA 3HR4A 2IFTA 3IURA 4O4JA 3BDVA 5KYWB 3IGFA 3LKZA 1OGIA 3U60B 2UYCA 4MQ6A 4ZO6A 1KZHA 4KE6A 4MV8A 4LX0A 2HCJB 3O8QA 1COWA 1XDBA 2OZVA 5CLIA 4FBLA 1E2HA 3T7DA 3Q2IA 2WPDA 3BZBA 2EP7A 1PHPA 1P9RA 3JV7A 3KB8A 4U5QA 5CNMA 1DIBA 3KPVA 1HEYA 4RM3A 2XTZA 4G9GA 3RDPA 5JS7A 1H9CA 2WYOA 2NYUA 4M1QA 1KO4A 3WNZA 1Y3DE 1M34A 2XYVA 5DNWA 1ZIXA 2GN4A 3AKDA 4B3HA 2D7CA 2EV9A 2VEOA 3C4QA 2C4NA 4PSAA 5JD3A 3UB4A 1BU5A 1W93A 2QX9A 4MX8A 2C07A 2G28A 4MUGA 3VVBA 4BIIA 4D4JA 2IS6A 5DGXA 2ARKA 4F93B 3L8MA 2OY0A 1XRQA 3KAKA 2C5HA 2OV6A 1EAMA 1HLPA 5KS2A 4DTIA 3KR2A 2VAPA 3N0RA 4JA0A 4QBGB 4QFMA 1CD5A 1Y3BE 2IY9A 1FVXA 4HQOA 2AWNA 2OPBA 4LQCA 4GF5A 5FNZA 4AS2A 2ZUUA 3TD6A 4M46A 4A6EA 4Z4GA 1THMA 2GYVA 3R75A 1CTQA 2X19A 5FTMA 2PDAA 4N5MA 3HWSA 2FFAA 1MX3A 1M6NA 2YRXA 2OCXA 5TEVA 2NUBA 2Q6VA 3K0FB 4H1UA 4MWSA 1E98A 3VPDA 2IIVA 3ZV5A 2JAUA 1WWKA 3PDHA 3LH5A 2YZNA 4LCEA 3O0DA 1VPDA 4P9NA 2FX5A 1SZPA 2RSLA 4MCIA 3LY7A 4REQA 5CB6A 4NH4A 3P9RA 2FZVA 5H5JA 5TARA 3T7JA 4WXRA 2GO1A 5CITA 2G25A 4OJYA 5GMOA 4W7HA 4PV7A 3AW8A 1P4HA 1W9MA 2XUKA 3Q15C 4WK4B 5I51A 3QEAZ 1D2EA 1GQOA 2RK4A 2AX4A 3AUYA 3UMCA 3BXOA 2FWNA 2HL6A 2XKBA 1P4JA 3SDZA 1SNYA 3PVCA 1DKNA 3GVHA 1UBSB 1K08A 4M1TA 3THRA 2XQFA 3RU3A 4QDUA 4A4DA 1M1UA 3K71B 4P81A 3PF9A 2RAFA 4B84A 4LBYA 3RH0A 4WDRA 2ZETA 3ZJVA 3FGOA 3MPOA 1YZNA 3D8NA 2ZUBA 4KXFB 5C52B 3KSDO 3LF1A 1U6JA 3W2IA 3D3QA 3QKTA 3D1LA 4KCGA 3NNSA 3MMZA 2IV2X 5FI3A 3FHTA 1WM1A 3KUUA 4IDQA 2X77A 4U3JB 4DEYA 1Z63A 3OQJA 1BHQ1 1KFEB 1HYQA 1GGVA 3M6XA 3Q1LA 4IDNA 4UVHA 4Z9FA 2C00A 3TTWA 4E1AA 4CG3A 1KO1A 3WGNA 1TUGA 3O03A 1JKIA 4FFVA 1TJ4A 2IEZA 4ZXPA 4Y1EA 4JMPA 3UFXB 4CL2A 1U9YA 3KO8A 2PR2A 1OAAA 2JANA 1RRFA 4CFSA 1VPLA 3UKDA 2G9UA 4MUAA 2BZGA 1DS6A 1XEWY 2XF8A 1GR1A 1NN3A 3O4FA 1D2CA 1UZAA 2HCRA 5LZ7A 1FB5A 4DOMA 1EUZA 3CLVA 4ACBA 2WFZA 3S1SA 3F98A 3U1VA 1AQUA 3VJRA 1G5HA 3EARA 4CODB 1ZM7A 1BVYF 4J0FA 5IT0A 3TG2A 1KP3A 1GPUA 5SV2A 3AMVA 4PONA 5ULLA 1U1FA 1OAOA 2Q3CA 3AP2A 3GZJA 3JQFA 4ZGBA 5BMOA 2RG1A 4M1MA 3PPWA 4ZDKA 4GD3Q 4ZOAA 4WESB 1XC7A 2FETA 4RZ2A 1S2LA 3BB3A 5CFRA 5KOYA 2FUEA 2QQ0A 1I1OA 1WCIB 3EZXA 3W5JA 1HG1A 4HSGA 4D6YA 3TIFA 1CIJA 3M33A 4IKEA 4ZEOA 2VYQA 3UIEA 3WDKA 3L49A 1CYDA 1NF3A 3DB2A 2TYSB 4KRYA 2FUKA 3ROGA 4AQYB 4KE7A 3U31A 1WZNA 2WDPA 4N6OA 4P7JA 1PL8A 1FFWA 1ORTA 3IKVA 4D5GA 5JFOA 2Q3JA 1DKUA 1XTIA 5LPNA 3TMKA 4Q3KA 4X24A 3VKHA 4AYTA 1HGXA 1NFFA 1ZVJA 2X8JA 2ZJ0A 1ZVKA 3E84A 3M6AA 3HYSA 3TR6A 3WLLA 3ER8A 5K20A 5JVDA 1S8AA 3B1YA 1PL6A 3DNPA 3H6KA 4TXLA 3ZZTA 1YZ3A 1JDNA 3D54D 2AG0A 1F2UB 3LPAA 1IL0A 1Z18A 4OHMA 1L6RA 1QQ5A 4RIIA 1U3CA 1LF0A 1MG0A 4L6CA 2WABA 1KYWA 3VOTA 5GVSA 1SUFA 1P77A 4BB5A 2R5NA 1BH2A 5JS8A 3T3OA 4G56A 2XTMA 3G0GA 3UG6A 4C6RA 3K3PA 1RPAA 3CINA 3IERA 3D1JA 4UUQA 3INRA 1NG9A 5TPZD 1Y5LA 4Z5XA 4PAGA 4XSVA 2JLUA 1CUJA 1QRRA 2GWHA 3E5MA 4YJFA 1QORA 3G9TA 2O5RA 1WZEA 4CWAA 4K9LA 1X8KA 4XWAA 1T4BA 2ZJFA 3C8MA 4E12A 1NKSA 3W3ZB 5ILGA 4E7PA 3CUVA 2MOKA 5ALEA 3B38A 1IZ0A 1FEZA 4HLNA 4N5DA 3IVMA 1BMDA 2Q4RA 1XJ0A 1KKMA 1QLWA 3HP7A 1XZLA 1KJYA 3UPTA 1TYEB 1NP3A 1HFEL 3HYCA 4QSHA 4PHHA 3THOA 1E5VA 4YT5A 5SZHB 4EAQA 1JFSA 4V0ME 2X1LA 3V4LA 1HQDA 1OX4B 3E2PA 2V3WA 2WWGA 4X3CA 1R9NA 4YJDA 1NWHA 4B4UA 4IUDS 3ZVMA 3PGKA 1Y1KE 3EEYA 3IUYA 4PXSA 2GEBA 3EIUA 1V3UA 2Q4BA 2GA8A 3QKIA 4DXDA 4O0LA 4P4NA 4JLVA 1MVLA 1L4NA 1QGED 2FG6C 2QSYA 1PTKA 2EFCB 3LQKA 4AICA 3FDJA 4WD3A 2B35A 1TA0A 2C42A 4MA5A 4EGQA 2XRZA 4G9BA 2JLWA 2UXCB 2EZUA 2ZPTX 2O7RA 3SHQA 1KFJB 3A3PA 1PP4A 1RHMA 2Y2VA 3IAUA 3GLQA 3JW8A 3LXRA 4P2GA 4RDHA 3R1IA 2CXUA 1VDZA 3EDMA 4NX2A 4PLZA 2XUZA 4L16A 4MCAA 2I80A 3W4JA 4O02B 1KSHA 1Q12A 3D0QA 3H4TA 3LQ1A 2C29D 3KEGA 3PHGA 2F8MA 3OQIA 1X7WA 3AM3A 1C7QA 5EA2A 4EA7A 1BO6A 3H9GA 1SXJB 4UMDA 3FVVA 4E5PA 2O19A 1DKLA 5EE3A 3GQBA 3L18A 3KZNA 1OBCA 2DBQA 3WO1A 3IVRA 3COJA 2IEIA 2OENG 2X41A 4U0JA 1G9TA 2J3MA 5EJFA 1I3CA 2C5SA 2X2PA 3DJYA 2KB0A 4I1OA 3OCUA 4Z7NB 1WIWA 2NTYC 2CYBA 3P0IA 2RGNC 4QQ8A 1JEYA 5BRAA 2NU8B 2OHJA 2NVWA 1WOMA 4S12A 1CR1A 4BN0A 2A5GA 1QFZA 4WH0A 1EHIA 3IDOA 3EH1A 4Q6WA 1XXHA 4I7EA 3KM0A 3P2JA 4O6VA 5LC1A 3KQNA 1EDBA 1E59A 4NYMR 2QXTA 2R7LA 4NJEB 2R1VA 4PZDA 3LVRE 3HJFA 4TQAA 2OMEA 3BIWA 4D97A 4IVPA 4IWXA 2JGMA 1U8XX 2BISA 3L8YA 1NURA 4OA5A 4IJKA 5A3JA 1T2EA 1XNGA 3BSFA 1N3YA 5C35A 4KFCA 3KJEA 4RLSA 5HNKA 5LD2C 1F48A 1IY1A 1SQGA 1AK9A 2JFYA 3L0BA 2COEA 3FF4A 1PZFA 1VZ3A 4CV0A 2GLUA 1GEGA 2VDVE 1FX0B 4YDRA 4I50F 4OQZA 1KYIA 2VYVA 3H1AA 1VB5A 3MJ4A 4KBFA 3TYXA 3MJCA 5E6RB 1KVTA 4D4GA 1D8TA 1FX1A 2AOVA 3DS8A 3KWMA 2IIPA 4IIBA 3VYUB 1OFUX 2OHXA 4X7PA 3U7QB 1Z39A 1KYVA 3I53A 4M9XA 1H3EA 2IS4A 1T10A 3UWDA 4RW0A 2VHVA 1FFAA 1L7AA 3ESDA 2M32A 2PGLA 3QYAA 2QMHA 5LZ9A 3FSEA 5K0FA 5ADWA 5JNRA 2F8SA 2ZZMA 1J90A 4OQEA 5JG7A 3IQZA 2J33A 3BJIC 1ZO8A 1QIGA 1RJ9B 3H2KA 4U2EA 5JSKA 1T3LA 5CW1A 3ZHUA 3ECAA 1JDZA 2VJDA 5C4MA 3GBVA 4G01B 5ALLA 2GHRA 3NIDB 4LYFA 3A6LA 1ULBA 4ISCA 1G5QA 5EYPB 2O8DB 1CFJA 3OQNA 4LRSB 4WFQA 2H7CA 2ZVDA 1POXA 3G13A 4XQCA 3UOGA 1ZL0A 4DA7A 1ONSA 2R97A 3IH5A 2QAIA 4DJJA 4TLEA 5HCNA 3S2UA 3E15A 4BP9A 9GPBA 1T5SA 1YUNA 2OORC 2RHJA 3GA5A 2G9NA 5KDDA 1WD7A 2I7TA 3X1XA 1Q0SA 2GYWA 4HLUC 4Z4EA 2KLBA 4LJ6A 4WFKA 3N58A 4F60A 4JJAA 2A0KA 4ZYUA 1ZK4A 1WCV1 2FF7A 3EPLA 4BBAA 4UE2A 3V3TA 2ADMA 2YOHA 1DI0A 4MRMA 2CHGA 1QSGA 1L6IA 3A3NA 1ZDMA 4LNAA 4YA6A 4Z9XA 1EWKA 4DUPA 1ZRMA 2XHZA 6CHYA 3N0TA 5I7SA 4CEHB 1LTKA 1QOZA 4C2UA 3L0SA 3OFKA 4CLOB 2FPWA 1TRKA 1PFWA 3FAKA 3K9LA 1UJ6A 5EMKA 4AW9A 4CUKA 1SD1A 3ER6A 5D7BA 3WFZA 5JCPA 4DV2B 3LA6A 1UANA 1X0VA 4LAFA 3ESYA 4BMYA 4YQFA 2VDUE 4Q34A 1NLZA 3FPSA 4OI4A 3BFPA 2BI7A 2HT1A 1XZKA 3GNQA 3DZCA 4GE0A 4MQLA 1NXWA 2ACWA 1HPLA 1REQA 3DCYA 3GJ3A 4IDPA 4O4JF 2PIAA 2VDNB 3LZCA 4ZAZA 5JDCA 2O59A 1R0KA 2FNAA 1P61B 5FF9A 2PKXA 2VHQA 5BN5A 1RQXA 4DILA 1S6YA 3G2LA 1Z5ZA 3DV0A 4FBGA 4WESA 4R9SA 3FDZB 2QD5A 1DHRA 3GY0A 2RJ3A 3O8OA 1P2DA 3R5JA 2A7QA 4IGEA 1E1YA 3G89A 1CFZA 1JPNA 1YQDA 2GNAA 4N01A 5B37A 5C8YF 3TPFA 1DCFA 2CVHA 3EFOA 2IPOA 3QVOA 4Q9HA 3I8XA 5EWMB 4EG6A 4PM4A 1CCWA 1CR0A 2Z0MA 1A72A 3ONVA 2ZCVA 1PZXA 1ACLA 2D5AA 2ZRCA 4Q3CA 3TAUA 2C7RA 4R4JA 5LQDA 1U6KA 1N3LA 1S8OA 5FPPA 5C4GB 5D2CA 2IZ1A 3I05A 3REQB 4EB3A 2NU6A 1YHZA 3AI3A 3L8CA 2PAAA 3HB9A 1N2SA 2BEWA 4WLNA 4NCJA 4TTIA 4KV9A 3U1TA 2DWQA 2WPDD 4DLNA 1ZRNA 3D3JA 3GVIA 3RTDA 4AMYA 4BB0A 4CDGA 1QQ6A 4CF5A 1V3VA 3BTUA 3V4PB 4G5OA 4DSAA 1NOJA 2P9BA 2JIDA 4JJIA 1RXVA 2GBGA 3ESBA 3ED5A 1FUEA 3QVGA 3B1JA 4MVJD 1TVKB 2ZVPX 1OXBB 1ODKA 3KQTA 3FIJA 1OTYA 4EEXA 4LDRA 2V7UA 4IJMA 1R0LA 4R8LA 3F73A 3Q7EA 1FXSA 3I5MA 4Q7QA 5T4EA 1KAGA 4HQKA 5CEFA 1T36A 2C2MA 3Q8KA 5CYPA 4MVWA 1E6WA 1J2UA 4Q24A 4QEZA 5KNDA 3A37A 3TR0A 2D8AA 5AW6A 3B60A 4MCHA 1CEEA 2ZI6A 1QHSA 3VZCA 1TUBA 2IP1A 4WUVA 5CURA 1KP2A 3JWEA 3VC1A 2WWWA 2HA5A 1A9ZA 3U5TA 3B70A 4KACA 1I7LA 2O0KA 2QU8A 4Z0PA 3SX2A 1UH5A 3HUTA 4D9HA 1P73A 2MR5A 4E33A 1CEYA 3L7AA 1QOPB 2K5UA 1THGA 4BFUA 3P5SA 4XFJA 1L1QA 4Z4CA 1FDSA 3A6EA 4CYMA 1DPFA 1E0DA 3NHLA 3ZZNA 5EXTA 1A98A 1Y7HA 2B83A 3AG6A 4PC1A 3UFBA 3KX2A 3IVXA 3W2GA 3T3NA 4W82A 4B3IA 1GL7A 1UMBA 3OE1A 2QTLA 5EVCA 4KE9A 1Z28A 1T6ZA 4F5DA 1QE3A 2F67A 2GUWA 1PN3A 3WK7A 2NU7B 4ZPXA 3LI2A 1WB4A 2REQB 1XD2A 2DRIA 1F2VA 2P2NA 3CO5A 4NOLA 1EIZA 2VDWB 4JJKA 1XVTA 3ZY2A 1H1DA 4AL4A 4DTCA 3H5RA 3TSWA 1AV6A 2WJ3A 2ZT8A 1L5WA 2ZIWB 2F43A 5DXFA 3BE4A 4UBLA 4LJLA 1SM4A 4R68A 2Y93A 3DUFA 3VKGA 3T3PB 4LY9A 1CZNA 3UQZA 3VJKA 4PS1A 4F4HA 3D3EA 5L4LA 2WW8A 2QAGC 4N4AA 2Z1NA 3F6EX 4O4HF 5EJEA 1ZU5A 3STWA 3AIKA 3U7FB 3PHCA 4CMEC 3D0KA 1F5SA 5F78A 5G1NA 4FFOA 1RJFA 2BGIA 3U56A 2WF6A 4TV8A 3WTCA 1RYFA 1Q16A 2M6RA 5JC8A 3V80A 5JAMA 2PT6A 3M83A 4UBKA 4XUDA 5G40A 3TLXA 1MRSA 5DI9A 3H05A 1DDIA 3DB1A 2Z58A 1S89A 3FWPA 1PK9A 3GJ8A 3DBVO 1BS1A 1KI8A 1VMEA 2P2DA 4C08A 3IUPA 4WGFA 3GRKA 1Y9AA 1DBSA 3DDCA 5EJ4A 4W8HA 4R5HA 5K51A 1DX6A 3FJYA 3WIBA 1PVVA 1DTSA 2CMGA 3CQ9A 3KYDB 4MKZA 3L4JA 1D7OA 1O6CA 2ZYGA 4EKGA 1JTEA 2VPYA 3DPSA 3K4HA 1KSGA 2ONJA 2P6RA 3SI7A 2R84A 1DJNA 4OTZA 5JSZA 1DELA 3BH0A 5K9ZA 1IPEA 2GCOB 1AKYA 3B3QA 4RMJA 1JTVA 3OZWA 5JVDF 1ZHOA 3PNKA 4GMDA 2QORA 4ZFNA 2QG4A 2IUFA 2P2YA 2I0FA 2RE8A 1GPH1 4I4TF 2AOTA 3VU9B 4J76A 1N0VC 5JCOC 3T5BA 4IIEA 1B6TA 1JHXA 4NCBA 1DZIA 2NUAB 4EVSA 4RS4A 1DAMA 3P9ZA 4GC9A 4P5DA 4PZZA 4NSNA 5AI6A 4V0KA 1XSEA 2FU5C 1ZIPA 2OFPA 3TVDA 3EIEA 3MJTA 2IHNA 521PA 2A92A 2WJWA 3TCKA 5EIBD 1LZLA 4G1EB 5IVIA 4N7BA 3LS2A 4M8NE 5JR3A 4ERXA 1VLHA 1PNVA 4FR0A 3ZU2A 5DNCA 5FOSA 3M5DA 3D4BA 3I9OA 3KT6A 4TTTS 4Y6QA 3AOGA 4ENSA 5LU8A 1U9IC 1HQYE 1WPGA 4I4NA 1YFJA 5IWCA 1RBMA 5AVJA 2JVKA 3FOAA 3NVKI 5A2QA 4MJ7A 2QJFA 1U8CB 3OU7A 3DT9A 5IC6A 5JZVA 3IEMA 4OLFA 1MPXA 4G0OA 2FVYA 1F12A 3JQPA 1IONA 4BLTA 5T8KC 3KPYA 2R9VA 2B0CA 3O26A 3W8DA 4H0CA 4ZMBA 3PYXA 4EY6A 2JD2A 2JFWA 5EYPA 3GFSA 1V37A 5LMCA 1E2KA 3RC1A 2XITA 2WSBA 4KQWA 2CD9A 2SHKA 4HQLA 3SS9X 1O9HA 4UDOA 5EZSA 3AGPA 3LXUX 5CYFA 4QLBA 2FDXA 1ABBA 5AJWA 3EVZA 4Z8XA 1QZTA 4J0IA 5FIUA 4GVXA 4QYMA 2JZCA 3QWIA 3RUIA 4P33A 4JLBA 3FLEA 3SN6A 3WDSA 1VKJA 2D59A 2ZPUA 5JY6A 3DMFA 5FV4A 5KINB 1XN1A 4ENVA 1ESDA 2C2BA 2M6LA 3T7IA 2LCQA 2EIXA 5DYIA 1B14A 4E0BA 4L73A 1DAHA 3W9YA 4CHGA 1ZNYA 3KJNA 1SHKA 3NIBA 5FV7A 3RV4A 3TF5A 2H92A 4ZRDA 1VP3A 3EVCA 1RACA 4V0RA 5ALHA 1FRVA 2AN9A 1FMCA 2AYZA 3S27A 4F56A 1GDTA 3B1VA 4QPCA 2RDMA 5K0LA 2HB6A 1Z34A 1CNFA 3WSTA 3ANXA 2XOXA 1YS4A 1Z7BA 2YBDA 3TIIA 3RD5A 4B79A 3K1JA 5E4YA 1PT5A 4A3SA 3UGTA 4KR2A 5IUNC 2QTVA 2VJBA 4O5AA 1CQWA 2QQ5A 3Q11A 4X6LA 3TVTA 1OFHA 2IYRA 4JITA 1WW2A 1P1HA 3D02A 2BDUA 4ZZ2A 2PWAA 3DLTA 2VBIA 3I6MA 4BOYA 2VUHB 4Q9LA 3D7LA 3OLXA 4ZKDA 3ZDZB 1MTOA 4EFKA 4CW7A 3NH9A 1U2TA 2WVJA 3M5WA 4FD3A 2G8LA 4B85A 3PGJA 3NTLA 5EJIA 1KY2A 1Z5VA 2XDQA 2YWBA 2VZ9A 4E5UA 1XZ8A 3LBHA 3I2YX 2HF8A 1SQ0A 4ZAWA 3C3MA 4RD4A 4P0PB 1NVWQ 3W06A 4IQ4A 1GTRA 3LHFA 1GUAA 3NXSA 3SFZA 3LOQA 2C0QA 3MERA 4QGHA 5FP0A 5TQ2A 3PHIA 4IMJB 4JN6B 3JAMA 4BXOA 3CH7A 2Z2ZA 1AB6A 2PUFA 1YGPA 3ITNA 2BMWA 1VKHA 1RWVA 1V4VA 2EEZA 3P26A 4JIGA 2Q46A 1A8QA 5B1YA 3PNPA 3H97A 3HBFA 1JQJC 4PAOA 3GO4A 2HRDA 4RVHA 1VL1A 1KVQA 2Q6TA 1ZH4A 1NI3A 2I99A 4GI2A 1L2TA 1RC1A 5HBGA 1L0BA 1B00A 4WKPA 4FINA 2VH5R 2V5UA 1CR4A 1GFSA 3G49A 3DHEA 3GG2A 5IAKA 2VHZA 2IBTA 4EPTA 4B83A 2N3ZA 1UWLA 1PHRA 2QR3A 3ETDA 1MVOA 3C8ZA 3HCCA 3WGIA 4N3GA 2PLRA 5FBLB 4GYWA 2R1VB 1RYYA 2JASA 1MA3A 3ZNNA 3S4YA 1JZQA 4DWVA 2O8FB 3KB1A 3K0EA 1PX0A 1ZJZA 1C9YA 2DT5A 4BVKA 4IQ0A 2FV8A 4N3AA 3LDGA 3WBJA 2XUOA 3S8YA 5JASA 4NK4A 4OSOA 4EHJA 2XDAA 2CDRA 2GAFA 2VT6A 2XB9A 5C3MA 1JQ5A 5LKAA 4LFCB 2PT5A 3D7NA 3I2GA 1I4EB 3CRQA 2D0PB 3OURA 1LK5A 2YZKA 5JALA 4IIJA 4L0CA 4BUCA 3U4QA 1G8YA 1I8TA 2V4UA 1W1WA 4LYHA 1Z3IX 1XU9A 4DCTA 3CVJA 5DHSA 2V0NA 3C7AA 1XROA 3N8DA 4M9QA 4EHDA 2QVCA 3IBCA 4RFVA 1CSEE 4W5QA 3DOJA 3MMSA 4TKUA 1M2VA 4M37A 3KQOA 3CF4G 4GYJA 4OFZA 4OL9A 3ZK7A 2NPIA 5F7XA 5KPJA 1J07A 4WKOA 1YT5A 4OBBA 1D6NA 1JAZA 2LE0A 3HZZA 4MEAA 2E48A 3CW8X 3AM1A 3CZAA 5ICSA 1OI4A 3F78A 2BMEA 3T0IA 3NDBB 1TTTA 5DLQC 1X38A 1NMSA 3IB3A 3PJEA 4RPKA 4BBJA 4CVNA 4MCJA 4X1KB 5JJCA 3MIIA 3W9UA 2ZPAA 1G8JA 1AGYA 1IXSB 4AU1A 4B2IA 1L3CA 1NTRA 3AF0A 3VR1A 2ZE5A 3O2QB 3SIWA 1PJRA 4ZV7A 3D64A 1DXQA 1JALA 3K20A 1CS0B 4NZ9A 5DLEA 4ZV9A 3QVTA 5KSWB 5H80A 1YACA 1D6JA 1ZW1A 2ZT6A 4RQBA 3U3KA 2PA0A 3VO8A 5EE9A 4ZCLA 1JKJA 4H3KB 4X64B 4TL7A 4EYOA 4LDZA 3WL5A 3PFKA 4DT1B 2XIJA 3BPSA 2C7BA 4ZYXA 1KC3A 3KBBA 1U9JA 2PBFA 2Z98A 2FFQA 4XVRA 1X77A 5FDFA 1C0KA 3CLRD 3Q72A 3PYMA 2YFYA 5B3LA 3G5UA 4OHUA 2BFFB 2GGSA 3FF1A 4R2IA 4Y2YA 5KJCA 2COUA 4TMKA 4E2FA 1FQKA 1Y5NA 2AEJA 2Q3LA 5DM0A 1M2EA 4HQ6A 7AT1A 3OUTA 3QLVA 3IPAA 1T8TA 1B23P 2R1TA 4IFTA 4L3WA 4WBNF 1Z45A 4LVNA 1AN0A 4GLJA 4BQSA 3T7EA 5BNZA 2O57A 3E18A 5KOJA 2Q0SA 4RHTA 5T57A 3VPGA 1K7XB 1GL6A 2PFGA 3GCWA 4AMVA 2YWGA 4P4SB 2YHIB 2BEUA 2Z2XA 3OPYI 4P35A 1OLUB 4TKVB 4IHJA 3ZWOA 1YO6A 1K4YA 3C8HA 3PRYA 2C1ZA 1VHTA 2QVXX 4W5OA 1FU4A 3AESA 1AS3A 4MR8A 1GSIA 1BJKA 4JYZA 1ZD9A 3M3PA 1ZMBA 2YJ5A 3H1FA 3C43A 3I2KA 4YWHA 5DHTA 3MQFA 2EL9A 1PZHA 1JHRA 1U1GA 3UJHA 4GECA 2D2VA 1Q92A 3IP9A 1UPUA 1O77A 2NXNA 1ADYA 1JQBA 1RBQA 1KO7A 5BUSA 2HA6A 3HBMA 3RIXA 4LF9B 4JP2A 4ND8B 4N12A 3UUFA 3RYHB 1PR6A 3GIDA 3K1YA 1AZSC 4H18A 4I9FA 3U0BA 5I7HA 5DHRA 4R0MA 3JALA 1IM5A 1WUKS 2RI6A 2ZE6A 2OCKA 1QIJA 2VSNA 3QQPA 5JMTA 1I4LD 1K3TA 2BGTA 1XT6A 4J6FA 3IR6A 2FZKA 2XR1A 3PFGA 2HXYA 4HVTA 3TLZA 3QBJA 3WHIA 5AJTA 3HB7A 4F71A 4LJ9A 5FFNA 1GCOA 3CU5A 4G1UC 4RC9A 4AN4A 4OLHA 4L7QA 4ZYTA 5JS1A 3DP7A 5A4JA 1ZK2A 3B6JA 2O2ZA 2YJ3A 1CQJB 1AKQA 2CFOA 2IU4A 5AUNB 1OU4A 4UMEA 1FSPA 3V2HA 1MJGM 5DW3A 4O2RA 1YL6A 2ET6A 2PUHA 2NG1A 1UPBA 3H0KA 1ISRA 1MW9X 2RGDA 3GFOA 2AJCA 2X5NA 4INPA 1ZJ4A 2PJZA 3G8YA 4MR9A 4Q4JA 2OPHA 3EXHC 4D6PA 4FYVA 2BEJA 1KQNA 5H02A 3NDJA 1DNPA 3P9IA 1F0NA 4B40A 3RC3A 3OKFA 3TUJC 2Z9BA 4K3UA 1S4MA 2W43A 4FHDA 1TUBB 3M9WA 3ZQ6A 1KEKA 1Z33A 2CUZA 2DY0A 2IHTA 1AK1A 3A25A 4IP0A 4Q1CA 4UUAA 5DV9A 3TSYA 4CM4A 2J6CA 2HK9A 1DQRA 3KWFA 5CD1A 1IM2A 5SY4A 1DLIA 1H6DA 1GZSA 2QRPA 3OTIA 4TL8A 1MC4A 1CY4A 2XQJA 4Q3OA 1PYOA 1FLVA 4TLCA 4TL6A 4FX2A 3RROA 1YZYA 1Z4LA 4RL6A 4UQOA 1A4XA 1ZRSA 3BG5A 5ARCA 5J58A 2AOUA 3ESZA 4F45A 1SULA 1BJTA 3ZZ1A 1QDLB 1UKYA 5EC8A 3K0SA 1ZNXA 2E1PA 3IOMA 5GGYA 4WCVA 3UWKA 4NJOA 3HVRA 4GGOA 2FFJA 2BONA 3NHPA 1IHXA 1UINA 3DDNA 3DKPA 3QYJA 2PX2A 4LHVA 5JNWA 3GLGB 3WJ1A 4Q47A 2XBMA 1CZRA 2IUUA 1IU9A 1TLFA 1ZINA 2AN1A 1RM0A 1WE2A 2QRMA 3DOEA 1DO0A 3FLMA 3NC4A 3Q7IA 3NRCA 2HIHA 4FYWA 4JH0A 1OLXB 4QPJC 5JPDA 4UULA 1O0CA 4L72A 1H42A 3WYNA 5AIAA 1ZC3A 2F43B 3FZNA 2H1CA 2E4ZA 1XF1A 3GDHA 4NR0A 5C46F 1S1MA 1QBKC 2B1JA 1L3BA 5GZ3A 1NNLA 4AZ0B 3PDIA 1X8XA 3PWSA 4PO1A 5CIWA 3UT5B 2PRKA 3GQBB 1BWPA 1C9JA 4GUDA 5CK5A 4L27A 3UAZA 2ISQA 1KI2A 5DLDA 2GZDA 1YE8A 1NUTA 4MP8A 3T54A 1YB6A 1XL1A 3GA0A 2ZT7A 5GM1A 3TLKA 4YMGA 1CYEA 1NATA 5AWFC 4LTNA 1YE3A 3FJ1A 4LF8B 4PFQA 4BVLA 1U2EA 4YLEA 2JRLA 1SWVA 2JD0A 3HCFA 2OXEA 4EVRA 4OM8A 5AVZA 1VC2A 1PUXA 3A05A 3R41A 4LDJA 1ONNA 4RVFA 3VI3B 3R3VA 1TLTA 1EFPA 2PL3A 2Q9CA 2Z5FA 2GM3A 4OEHA 4IHKA 1G38A 3C3WA 3ZDAA 2C59A 3LD9A 1AV7A 1E1DA 3V8EA 4XX0B 1NQAO 2ISSD 5FB3A 2OZEA 4YP9A 4NULA 1SCAA 3EZFA 4X7BA 4XFDA 4Y2VA 5JDCC 2B7BA 3LNTA 1I5OA 2I4OA 2J41A 1DADA 2Z09A 3OLVA 2VVTA 2EP8A 5HEKA 3RUPA 1H0RA 3E8MA 1L4GA 4G3XA 2WAAA 4HAOA 4LC9A 4AMBA 5FQOA 3JRXA 1UZUA 2B82A 4RS3A 5EMMA 4ENTA 5ICFA 4PC7A 4UTPA 2I33A 4Y2JA 1WVGA 3RC7A 1A9XA 2P3SA 3GUZA 3HADA 1VE7A 1G2PA 2V74B 4JYAB 1TPZA 2O1WA 2O4CA 2G4LA 4HRXA 5I01A 2FZ4A 4ALNA 1UBLS 3A0UA 3QKWA 4JJFA 1ETHA 3U81A 1JP7A 1J5EB 1ITZA 4P6VF 4UREA 2V5AA 3A7EA 1AK2A 2DFTA 3ILSA 4TKUB 5T4HA 1K8RA 4JQSA 4CN8A 4HUQB 4EFNA 1HX7A 4M8IA 1TF5A 4QODA 3A1VA 3Q8XB 1Y98A 2JRCA 2RONA 3WNCA 5GOTA 1G8MA 2VTKA 5KNCH 4KGVA 2YWJA 3S29A 2YASA 4Y3UA 3FUUA 4QUKA 3L8HA 1Z0KA 3VJLA 4OPMA 1DJQA 1VL5A 3WMRA 4COKA 1PBTA 2H2DA 1NJ1A 2WV9A 4FFPA 3ZU6A 1XMIA 4J1QA 1FDVA 1L8AA 4YUYA 4JLWA 2AGVA 3V9AA 4C21A 1PIWA 5K0SA 3NH6A 2KHZA 1G16A 5E6SA 4JJ8A 3ILVA 4PPGA 1M8GA 3KXDA 1U9CA 2OFOA 3L6RA 2D0DA 3P45A 3QEMA 5IFKA 2OV2A 5E1BA 3WSVA 4PPYA 3QHPA 5ESXA 4LW8A 1ZGBA 4RGQA 4DDTA 1YKSA 1ZN2A 4LTMA 5D85A 1VIAA 1ZIYA 4MKRA 5AHXA 4ZARA 1UXKA 5BOSA 4XUEA 1GPJA 3Q0TA 5MN5A 4EARA 1L7RA 4COOA 5F35A 3DNFA 4MRNA 4PX3A 1BDBA 3MXTA 5NLLA 3BK7A 1K1EA 1EQUA 4GKAA 1XFAA 1AKVA 1P0PA 3A9WA 4FKZA 2EFDB 4F7DA 1Z07A 1SHLA 1AO3A 3ANSA 4HDKA 3RFCA 3UWMA 2PBLA 1N5IA 3JQ6A 4QU9A 3VYWA 3QY0A 2QTWB 2HLHA 4PYIA 5DYGA 1MT3A 3EQ7A 5LWHA 4QSMA 2AW5A 2G9RA 1SIWA 2X42A 6LDHA 1E9AA 2C1EA 4FU0A 4TZTA 3CRVA 1AB5A 4WJZA 2A6PA 2IVZA 3ZK8A 1DOHA 5AVYA 1ZMTA 2IDJA 2R6DA 3QWFA 3L7IA 1FQWA 2H1SA 1EJ0A 2NXJA 1BOFA 1PQWA 1JFRA 4XSHA 4AUNA 2CLFB 4OXXA 1QP7A 4MV4A 4CGYA 3PFHA 1OLSA 5F1YA 4DJ5X 5KYUA 1PWEA 2W4MA 3OLYA 2CDNA 4AJEA 1X94A 3CX7A 3G8DA 3WJAA 1P80A 1YNSA 2P4HX 3S7TA 3AV3A 4WXMA 2A58A 4QLOA 3S2SA 1WMBA 1Z7EA 3N2LA 1BXRA 1RSZA 1SY7A 1VPVA 4WCFA 1ZH2A 2FP3A 3HDGA 4IILA 5EUQB 4BUJA 3L01A 3EG5A 2I7DA 1QU3A 4XI9A 4HGNA 1UBFA 4LGVA 2VWPA 5BSFA 5I48A 2XGSA 1JB9A 2VAXA 2YOGA 1I01A 4HWRA 4CMGA 4MLCA 4R16A 3RUAA 2GOYA 3A10A 1RRPA 2VKTA 4BJHB 2Y6VA 3WMEA 5FL3A 3RVQA 3GXOA 1MEEA 1QAMA 1WNFA 2NSLA 3C5CA 4QDXA 3OOYA 4A8HA 5JROA 3LZDA 2GQ0A 3HCWA 4LRUA 4LYEA 4GNRA 3KL2A 4G63A 1GDHA 4Z0NA 3WLMA 5GJBA 1M8JA 1QGAA 4G85A 1XVAA 3WQSB 1EJ2A 1ZD4A 3EA5A 4C04A 2AYYA 4HG2A 3ZWYA 5KVSA 4CG0A 4H4EA 4CKYA 4CTKA 4OMUA 4ZZ1A 1XI2A 4X1IB 3ASVA 5FD8A 3PRJA 4IDAA 3GC6A 2ZK7A 1LI5A 3C3KA 4YQYA 2V7WA 4DAEA 5EVJA 2X2EA 3R40A 4IF4A 1GUDA 4XPIB 1D6MA 1X15A 3VOAA 5FPQA 1EUCB 4LRTB 4FI3F 1O57A 2C9CA 2PGDA 4O2BB 3WKAA 3DLHA 3N7TA 4ZAXA 3BTSA 5ALTA 1IN1A 2HJ9A 2I6TA 4DV4B 2E18A 2I1LA 1BHO1 3NI2A 2UXDB 3KLOA 1KFBB 3TQRA 5BO5A 1XD8A 5B1DA 3S2IA 3RYTC 1KVRA 3ORQA 5KQRA 2XT0A 3L0IB 2X5OA 3I72A 1THZA 2LUOA 1ZWKA 5BW6B 1ZOSA 2QN9A 3BK1A 3NB0A 1CEXA 1JHOA 5ALVA 3CNOA 3EVGA 1EP9A 3WMFA 4KPEC 3ZYZA 3O4GA 3QPCA 5TXGA 2NT3A 4P4GA 2AFIA 3TGPA 4IUBS 4KR0A 3T5GA 4BKQA 4LDQA 3R9XB 3PGA1 3WRYC 5DXAA 2J5QA 2XNDD 3F67A 5HM8A 3TUZC 2XOEA 3AVOA 3ID6C 4R2HA 2R66A 3K9NA 3KUKA 1NIJA 1PJSA 1ZUD1 2GJSA 3MINA 1ZD8A 2YXPX 4KMSA 2QPOA 3UMBA 5ALIA 2GPTA 2I2BA 2RHLA 3MZ0A 2H7XA 4M53A 4RQUA 3HI6A 3HXPA 2J7PD 3K30A 4G2TA 4G25A 4TGLA 2R8EA 4MQUA 1SZDA 5SYNA 4WVLA 1NN0A 4WBNA 2XEDA 1FLAA 4G0QA 5C8ZA 4D3YA 2YHAA 3MBIA 2FZWA 1ZEJA 3IDZA 3GLHB 3R6GA 4YJHA 4D4LA 5B7QA 5GONB 5JLAA 2P1RA 4NU0A 3T1OA 5EJ6A 2PU5A 3DL7A 4F8EA 3ZLVA 1V45E 1PDOA 1R4NA 1V11B 1WABA 2CBGA 4FS3A 4Y1GA 4F85A 5F3WB 1OMOA 4PS0A 4A6XA 4OXIA 2XA9A 3I28A 3RG8A 5AK0A 3O8NA 4Z9BA 3RE1A 1L7EA 1MXFA 1NQXA 2IYXA 1DDOA 3K0CC 1M7BA 3VGJA 2Q1UA 1DC6A 4BLPA 1BQ3A 1JIVA 3UHAA 4Z2AA 3KOUA 3E05A 2BDEA 5BURA 2H4FA 1B41A 2PZMA 4A0HA 5BMVB 1FJ2A 3X1DA 2C97A 1UKAA 4NK5A 3SDSA 1I4DD 3GPDG 1UP6A 2C2GA 1SO8A 2MWMA 4HNQA 3WGMA 4F2WA 2JFBA 3ELBA 5TSDA 4R1LA 8MHTA 1NX9A 2YX1A 2H1IA 3KDSE 5AUQA 2CXQA 2PA3A 1Z26A 3KYDA 1MQ9A 2QV0A 1NKVA 3DOUA 4QOGA 3BAFA 2JJ2A 2R25B 5AM0A 3OKCA 1XMQB 3PKZA 4KO4S 1FMLA 4ZT2A 1YONA 2R44A 4L0MA 1XQYA 4QEKA 4PFJA 3IX7A 4D9IA 1QG0A 2CK3D 4GMXA 1CWUA 4UEKA 5B4VA 2W2NA 1F4LA 4E2ZA 4E3ZA 4FFRA 1Z5UA 4XYLA