2ZRQA

Crystal structure of s324a-subtilisin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
QPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Crystal structure of Tk-subtilisin folded without propeptide: requirement of propeptide for acceleration of folding
pubmed doi rcsb
source organism Pyrococcus kodakaraensis
molecule tags Hydrolase
total genus 114
structure length 318
sequence length 318
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2zrqA00
1AU9A 2WV7A 1OYVA 2DP4E 5CW1A 3EIFA 1AF4A 3GCWA 3DDZX 2ID4A 4WOBA 1SBNE 1SBTA 1TK2A 1SUEA 1EA7A 3DE4X 3D43A 1WMFA 1NDQA 3PTLA 1R0RE 1SBIA 1BJRE 1TM4E 2DQKA 3DYBA 3WIVA 3GT4A 2SNIE 1Y3FE 3D9QX 3SICE 2WWTA 4ZARA 2ZWOA 4C3UA 1T1IA 3QMPA 3F7MA 2P4EA 1V6CA 4LVNA 3Q5GA 1GTJ1 3EE6A 3WQBA 2SECE 4H6WA 3DWEX 1XF1A 2DUJA 1PTKA 1TECE 1AQNA 1SN7A 4AKSA 3Q40A 1GT91 1YJAA 1GA6A 2TECE 3LXUX 4I0WB 3VSBA 1NDUA 2WUWE 1S02A 1C9NA 1SBCA 2W2NA 3L1KA 1GA1A 1SCNE 4GI3A 1WMDA 1Y48E 4B5LA 3DW3X 1KDYA 1GNSA 1ZVKA 3VTAA 3CO0S 1HT3A 3H42B 2ZRQA 1WMEA 2PMWB 2ST1A 1SIBE 2IY9A 3AJ8A 1R64A 3I2YX 1JEAA 1C9MA 3DE7X 1PEKE 1VSBA 1BE6A 4NMXB 1SCAA 3BX1A 1PJ8A 1V5IA 2XTJA 3VV3A 3CNQS 1C3LA 1TMGE 2X8JB 3GCXA 1THMA 5JXIA 3TI9A 1GTL1 3I34X 1SUCA 5K7SA 2PRKA 2PKCA 4OMDA 3DE1X 1SIUA 1Y4AE 1BFKA 1SPBS 3HJRA 3DE6X 1P7VA 1TM5E 3A3NA 1MEEA 1DBIA 4M1ZA 3WHIA 1IAVA 2WUVA 3UNXA 2V8BA 1OYOA 3GT3A 1Y34E 2W2PA 2ZWPA 1SBHA 3I37X 2W2OA 1Y4DE 3DE0X 4WOCA 2PWAA 4HVLA 3LPCA 4OMCA 3ZXXA 5B1EA 1BH6A 1SCDA 2PWBA 3VV2A 4H6VA 2HD4A 3WIUA 1GNVA 4J94A 1SUAA 5JXHA 1YU6A 5JXJA 2Z56A 1SVNA 3DE3X 1P7WA 1KE2A 1ST2A 2Z57A 2Z2ZA 1Y33E 1UBNA 5ARBA 3T41A 3VYVA 1Y9ZA 4KG7A 2W2MA 1Y3DE 2GKOA 2Z2YA 1WVMA 1Y1KE 4ZOQI 3BGOS 5AMXA 1AH2A 4KPGA 1Y3BE 1R6VA 1IC6A 1S01A 1GA4A 3DW1X 4DWWA 5FAXA 3EDYA 1ST3A 3QTLA 3DE5X 1TO1E 3DVRX 2HPZA 4AKTA 1BFUA 4H6XA 1GTG1 2QTWB 2XRMA 1C9JA 1MPTA 3F49S 1SCJA 1SUBA 1SUDA 1P8JA 2Z2XA 5FFNA 2X8JA 4MZDA 3SQOA 4RYDA 1KDVA 3PRKE 3OSZA 4CG0A 1OT5A 2B6NA 1GCIA 3LPAA 1CNMA 1AK9A 1Y3CE 3F7OA 1T1GA 2ID8A 4NE9A 5ARCA 5I9SA 5SICE 1BE8A 1SELA 4DJ5X 1KE1A 3DVQX 1YJCA 1AV7A 1AVTA 4YN3A 3DE2X 1T1EA 3QFHA 4CFZA 3TECE 1TM1E 3VHQA 1SUPA 1TM3E 3A3PA 1PFGA 2PYZA 1YJBA 4Z2AA 4C3VA 5B1DA 4KB5A 4BWGA 1TM7E 1ZVJA 5AVKA 2IXTA 1KDZA 1S2NA 3BPSA 1SCBA 2Z58A 1A2QA 1TO2E 4HX2A 1DUIA 2W2QA 3LPDA 5AVJA 1SIOA 4K8RB 3ZXYA 2Z30A 1EGQA 1NLUA 3P5BA 2E1PA 3A3OA 4DZTA 5JXGA 4LVOA 2SBTA 3TI7A 1Q5PA 2SICE 3AFGA 4FONA 3DVSX 1LW6E 1CSEE 4OV6B 2PQ2A 1SH7A 4CFYA 4NE7A 1WSDA 5FBZA 3AJ9A 5ARDA 5AQEA 3I30X 4JP8A 5JMOA 2G4VA
chains in the Genus database with same CATH superfamily
2HBQA 2W4MA 4R3NA 2AI3A 5AW1A 4GR9A 3E70C 1PGQA 1YBFA 4XFJA 2MHCA 1O8CA 3IMFA 4MCHA 4DV5B 1R6XA 5DP2A 4YMIA 4G1VA 3UEOA 2QD3A 4UFPA 2KMLA 4B4VA 1L7PA 4I55F 1WETA 1NRJB 5D3MA 3HSKA 1NMQA 2WIKA 1J1IA 1DKLA 2RKBA 1Z2DA 3CZAA 4I4TA 1J42A 1WO8A 1BHJA 1TUIA 1Z17A 2HEIA 4CYMA 3PHBE 3QWBA 2IDZA 4FX5A 1GNTA 4KVFA 3T7RA 4GL2A 1MVNA 3AYXB 4Q3DA 1E2DA 4ARZB 3CV3A 4D3SA 4DLZA 3KXPA 2IOYA 1M1YA 5B6JA 4Z0TA 4YUZA 5BSKA 1AUQA 4WJZA 3GLFB 1N6RA 3D43A 3EH1A 4PGFA 5DPMA 4P3KA 1WEKA 1S3GA 5L9AA 3NMUF 3EARA 5JVDF 3ELDA 4X1KB 5HTKA 2FPGB 1V95A 2J08A 3IQEA 4JJFA 5JW6A 2DTDA 3AVYA 2ENUA 3E3NA 4X6UA 3SOPA 3U4QA 4BP3A 2A5FA 3MWFA 2HU8A 3C5WP 2QRMA 3E4DA 3H9CA 2RGAA 2X14A 1QRDA 4L8FA 4P7KA 3RVOA 1PTJA 3J81A 5DXJA 4B3TB 2WM2A 3NV9A 4HMPA 3GT4A 4I9FA 5FOTA 2OC9A 1YGPA 4IMRA 4LFCB 3OURA 4DKJA 3FSGA 2OG1A 4G0YA 4NHEA 3SY8A 3WZLA 1U04A 3DHYA 3S2YA 2D2XA 3A6EA 2VLBA 4ID3A 3PEYA 5J58A 3EVAA 2JHGA 4DNFA 5J2UF 1AKRA 1LU9A 2HMTA 3VC2A 1T1IA 2Q7XA 4EHLA 3D8UA 2DULA 1C3EA 3IO5A 1CRLA 1Z7WA 4LX8A 2WIGA 3CTMA 2G4LA 4WECA 2AW5A 2NPOA 5BRNA 1P2FA 1IY2A 5FUMA 2BFNA 1AC5A 1II8A 1R10A 1PT6A 2PG3A 3MTBA 3D4IA 4QYTA 1Y80A 2AK2A 3FUUA 3Q0TA 5NLLA 1A1SA 3ZK9A 3U19A 5JTTA 2I1QA 1SR8A 1UODA 1VYVA 2DUJA 3E5MA 3CVJA 1ISPA 1R6BX 4FQ7A 4YGXB 2YHAA 2PS9A 5D6OA 3TOSA 3UVEA 3X1DA 5KTOA 5HCNA 4Z4EA 2JGLA 3TPZA 5JNVA 1R4ZA 4EB8A 1U6JA 3FIUA 4LC0A 4RVDA 3N2GA 4Y67A 1SCIA 1A4IA 4EZIA 1UP7A 4FSHA 1G2IA 1G8SA 1I36A 2Q2NA 4G5GA 4FMDF 3AONB 4ZO4A 4FDMA 1ORIA 4HJXA 1NJSA 1H1LB 1YJAA 1YAHA 5BT9A 5JJLA 3W1EA 4DR5B 4ETWA 4KI0A 5CJJA 3M1AA 1EUCB 4CM9D 3LXUX 4AROA 2X0NA 2XOXA 3QFCA 3GVHA 1M6WA 4MRSA 1V8FA 3M6XA 1IRIA 2Q7OE 1DG3A 4YDRA 3UXMA 4PZLA 5HX7A 1FMTA 3U39A 1PQYA 1SU6A 1U5AA 4O4LB 3RWOA 3ZGNA 4OHRA 1TYBE 2PXXA 4TXHA 1G7TA 3E7PA 3S99A 5K4HA 4Z4GA 5IFKA 3MCZA 1P0PA 3IIEA 1LD3A 1XBTA 3X1KA 2R7KA 3ZIAD 1NATA 4BWFB 1QBGA 1TU4A 3CZ5A 4F6RA 1ZM4A 3RYIB 2WZQA 2QE7A 3ES9A 1QCYA 4J0KA 5FNVA 5LYJA 3TG2A 3ZGLA 1MENA 4G5QA 2P9QA 4U7DA 1AV6A 4N6NA 3TIFA 5KPDA 2PUFA 2X1MA 4P4UA 1JR3A 4QAJA 2EARA 1YRLA 5J63A 4OD0A 4JUAA 1ZMBA 4MQEA 4HDAA 3L0ZA 7GPBA 4B3IA 1QQTA 3LX5A 3B9QA 2BFEA 4ARVA 1K0FA 1RC1A 4ROTA 3VJLA 2PRYA 2ZE8A 4J3NA 1OBFO 3DNPA 4JOBA 1E9BA 4GZ3A 4LOIA 2CLFB 4PO9A 2CLKB 5TF0A 3RC3A 5CDUA 3K6KA 2D7CA 3CPJB 1PQPA 3D4OA 3L7KA 1IUPA 1VMAA 4PO1A 4RVHA 1PKXA 1OW3B 3RSQA 2X7HA 2AOTB 1NVAA 1ES9A 2VDKB 1UIMA 5AI5A 5LP6C 4L95C 4M21A 4EG4A 4MDYA 2UZ1B 4YCCA 1VJ0A 2AD5A 4NMXB 4YLGA 2O57A 3LBAA 1KPGA 4S0ZA 3U1VA 3PEFA 2HJ9A 1W85B 3WKEA 1O5OA 1O0SA 1U3GA 3IMGA 4LBYA 4ALIA 2GF9A 4GT1A 3HZRA 2J48A 2ZIAA 1J2TA 1T2EA 2FSFA 4ZXFA 4QDZA 1J90A 1Z4KA 5L53A 4KR2A 4JT8A 1PUIA 4GIBA 3QVJA 3MHPA 4GI7A 1R4NB 2OSBA 5CXUA 4LN1A 1TMGE 1GUYA 1R6TA 5K8CA 2QUIA 1TKBA 1Z47A 2M6SA 2PLFA 2UAGA 2W6JD 1KH3A 2BFDA 3GUUA 5AKXA 3MUOA 4ZKDA 4CETA 1GO2A 1JWLA 2VYQA 3L2OB 1HYGA 2R8XA 1XL1A 4Y30A 5AW4A 4O25A 4DB4A 2AMYA 2VHCA 1QRUA 2BSAA 4KWEA 1KPHA 3GYGA 1CUXA 1TCUA 1XMOB 1BN6A 4FE7A 4DC9A 5HKOA 1LTKA 1ZEMA 4RDXA 3GEIA 2BI8A 2VLIA 2BH9A 5F4BA 1IN5A 2YICA 4YDHB 1A69A 1SK8A 2D2EA 3C6ZA 3O8OB 3MTQA 3PDHA 1F3LA 1TMKA 2EZ8A 3OC0A 2GO7A 4PYRA 5CCXA 1O8BA 1A97A 4DARA 1PG2A 4CLOA 2QRVA 3VAYA 2FDXA 2IXFA 2GPYA 1BX0A 3WGVA 2D0OB 3HMQA 1A0OA 1O94C 2G09A 3OZXA 4H6PA 3V6MA 2NO0A 3U3KA 1G2PA 1J09A 2HRZA 2ZUWA 3D59A 4D5GA 4K2AA 1Y37A 3K30A 3PQCA 2AN4A 3ZZUA 4JBHA 1DXHA 4GOND 2RH4A 5BWMA 5H68A 3TX2A 2V0GA 2ZB2A 1NF3A 1Y4DE 2OM2A 2RHRA 4C30A 3EPHA 3MA0A 2P5SA 4CRWB 4CQMA 3AF3A 1LS6A 1VGQA 3OKAA 1PQUA 2IV7A 5J4HA 1AA6A 4UEWA 3B48A 2HJHA 3QBTA 4LF8B 2VRNA 2QP9X 2JL1A 2CDNA 3TQQA 3BT7A 4KLZA 5EUMA 1TO6A 4RD2A 2ZBUA 1MX5A 5KOHA 1HYEA 4Y9RA 1J1UA 4EVQA 4OQNA 3CX4A 3E9EA 3WDSA 1D6NA 2HCRA 4G4SO 5CPFA 4MINA 5FUYA 3WHLA 1BCSB 2UYQA 5L8VA 3BB3A 4D2IA 2PQMA 2R86A 4WLOA 2QPLA 4U2FA 4GBMA 5DTEA 3TKYA 4QU9A 4DT1A 4DZZA 5JNSA 3ICCA 4E5YA 2JLRA 1RIFA 1YU6A 5JXJA 3CE9A 1ZCFA 2FPUA 2O1EA 1MABA 2C8KA 1Y63A 4HB2A 2G9QA 5LZ8A 1W47A 4A0FA 1UPXA 3JWEA 1VRCA 1OFTA 1P1CA 5AKEA 3WYAA 4BMNA 1WXXA 2YYYA 3EASA 5EJ7A 2BH2A 1SUIA 2JGAA 3M4YA 1VZ3A 1R0YA 2H29A 3D3JA 3K8QA 2Z2ZA 5EWJA 5EJ5A 2Y66A 5AKYA 2XZTA 2X0KA 3NBZC 1D1TA 2Q5LA 1BGVA 1R0KA 2VEOA 4LJAA 1I7PA 1MUUA 4V0KA 3U61B 1H1TA 1YS4A 4WK0B 3PI7A 3GRKA 3VYVA 3C3WA 4NEHB 2PMEA 4Z0PA 2XNSA 4N5LA 4IMJB 1M9NA 1KJQA 3G2NA 4RKEA 3VH4A 4EYEA 3VBCA 4BNNA 2HT1A 1WY5A 3EGVA 4GOXA 1LH0A 1OXUA 2Q1YA 2CNDA 4XIJA 4ASUD 5CB8A 1DPGA 1YQXA 4V39A 4BKQA 4YRPA 2ZBPA 1W52X 2OKGA 4YFVA 2H85A 3ZE6A 1CZOA 4C6RA 4RWEA 1A9RA 3AFHA 1JZQA 1QQ6A 3RAGA 3CRQA 4D02A 3X1YA 2WUFA 5KQRA 2V3CC 1VPTA 1Z2OX 2VJLA 2FK8A 2QI9C 4W5HA 4CKXA 2XV1A 3I5MA 4EJMA 3V1TC 4Q3AA 2ZRHA 3U7EB 1Y8RA 3E9RA 5JUWA 1DRJA 4R1SA 2ZANA 4ZQEA 3SEZA 3ZNPA 2WAOA 2G71A 4H1HA 4IV0A 4HWPA 2P75A 1WTCA 2PFGA 1JHDA 4G8CA 5DRYA 2UU9B 4URZR 2O8FA 3N07A 1PFVA 4AJKA 2GKSA 3Q0IA 4JJGA 1UZNA 2ZDGA 3BE8A 3GJXC 3ZZTA 4EG3A 2D4HA 3K53A 16PKA 2DSTA 3R3WA 4OH1A 4OQFA 5DNEA 3TLMA 1YQWA 3DBOB 1DDOA 5I9BA 3FMIA 4Y9DA 4ENVA 2W2KA 3PUVA 5IHXA 3ZLJA 5CYPA 1FRFS 2H31A 4TL7A 3RR2A 1X1CA 3A11A 4IJUA 1YNSA 1TIPA 4I4NA 3D3KA 5FJIA 4RMHA 1JLRA 3VNAA 1QV7A 3EVGA 3K5HA 1YCDA 3DM9B 4JITA 5HF6A 5JROA 1DCFA 1IU9A 2H1SA 1NNI1 1TT5A 2VWPA 3N8DA 1M1UA 1ORWA 2GF0A 3W5VA 1K5PA 1MA3A 1DIAA 2ES4A 4HD8A 3DEAA 4LJSA 4F38A 2ZYGA 2CMGA 4PSAA 4RV4A 1YZKA 3RH0A 3BDAA 1RLOA 3LYAA 4F4CA 1JHYA 1XVLA 2EGHA 5TQVA 2SHKA 3GMSA 3CRW1 1GL9B 3LWBA 4V02A 1TZMA 3JRNA 1AQJA 4QUHA 7ABPA 3NHPA 2Z4TA 3ZWOA 5D5HA 4YC7A 1KTIA 2A5LA 2EDCA 3C4QA 4MWDA 3HBMA 1SQ0A 4ENRA 1E6CA 4CG0A 1D1SA 2VL7A 2EGUA 3PFNA 2IP4A 2IYPA 4OHOA 1MRZA 1KO8A 4CODB 2I6UA 2XQIA 3HU2A 3I9JA 4LJLA 1PWHA 1RP7A 1RYHA 3H84A 4Q7JB 5A03A 1VLMA 5B57C 3VTFA 2FQ1A 1CQJB 4W8GA 5ALRA 4D25A 4OFXA 1QF9A 5I5EA 5FB3A 2FG5A 1ZUNB 2SKCA 4C14A 2VXOA 1FVFA 1DCKA 4GRDA 2R6DA 3UMYA 2J4FA 1TZBA 2WDPA 1MT3A 1YACA 1OLUA 2J0VA 3O47A 1CJCA 4M9CA 4TWIA 1KI2A 1RZUA 4PZAA 2YCBA 5LP6A 3GCDA 2OBNA 2AUTA 4OA5A 3P0JA 5BN3A 4MRNA 2ODPA 3I5UA 3KE9A 1QWOA 1MJGM 4RD6A 4GSLA 1HL3A 4NVRA 3ETEA 1W75A 4WNAB 2G08A 3QFHA 4ZYZA 2C29D 3K70C 1H6DA 3KFLA 3ZTWA 4C08A 5LQAA 2ZUVA 4FGZA 5EVJA 1Y6GA 2Y1FA 3DF9A 3WGLA 5JAZA 4ITVA 5DWVA 3STXA 1F2DA 2D5CA 3SEFA 1FTWA 3KZVA 4MW7A 3V2HA 5AM5A 1D7AA 4DTIA 1QRRA 3EH2A 3R9XB 5BURA 5EEHA 3ASZA 4H08A 3SHFA 2FV8A 3DG9A 5JSUA 3RYCA 3A1NA 3AVXA 5ICCA 4BFYA 2M2IA 2VHYA 2ZYIA 2ZYSA 4PWZA 3OTIA 1H22A 4M6WB 5THKA 3QKUA 1TUEA 1DIHA 3L8ZA 3HU5A 4NJMB 1MOZA 3ED5A 3AM5A 5IN4A 1E6LA 3OZFA 4R2XA 5E9AA 3H6KA 2Q5FA 4I2NA 2LWIA 3JAWA 4V3CA 2OQRA 2P3QA 1Z5WA 4ONEA 3IQXA 4K03A 4M2LA 1UKEA 1HV8A 1IHDA 1NZDA 1KERA 4JOQA 3LLUA 1TXGA 4EVIA 1DUIA 2GPBA 2OV3A 3W90A 3QEMB 3LQKA 1P62B 5LFAA 1QHFA 3URKA 2AS0A 4RZHA 5JFOA 3G9ZA 1NQVA 3NASA 4LRYA 1XYYA 1T36B 2B8WA 1YFJA 6NULA 2HDWA 1EGQA 3VPXA 2FDRA 3QX3A 1TIKA 1GJRA 2DFPA 1XTQA 3T06B 1ZUWA 4TTQA 5HG0A 3N2YA 3TDMA 3V55A 2PH3A 1Q21A 1LVUA 2QN2A 3JVEA 3DNMA 1WOYA 4NRDA 4RYLA 1YKSA 2PU5A 1KP3A 2EKDA 2YYZA 3HB4X 1JYFA 2V58A 4TMWA 3STHA 3KOZA 3QVLA 4WKGA 3DMPA 2Q9UA 1UMDB 2PTHA 3CF0A 1YZFA 4IEFB 4WCFA 1BROA 3C14C 2FQQA 4FYJA 4JP3A 3C74A 4EGAA 4Q19A 3TKAA 5IVIA 3OQJA 1OHHA 1PGNA 1D6SA 4XUEA 2OXFA 4TYNA 4X6XA 1C9EA 2Q3JA 3A28A 2IIBA 3PI6A 1P3DA 1N6IA 3VBEA 4AL4A 1N25A 4LF7B 3D8RA 1T5OA 4YAKA 1D0SA 1RE1A 3H5VA 5C8XA 3K2BA 4QGFA 1N8KA 5CM8B 3F3YA 4XGNA 1OH5A 1SGWA 3ESRA 3QI7A 2BDTA 5JQWA 3B36A 3HXKA 3LDUA 4WUVA 4BZPA 3G5UA 3SZOA 1JEOA 3I30X 4U5XA 4B7XA 2QPTA 1QE3A 1YDHA 4IUYA 4JP8A 2UZ3A 3IP8A 5EZYF 5A3SA 5K0GA 3OOYA 5CCDA 3DEKA 4U63A 1ISSA 2ZB8A 1VFPA 3LGXA 4PZUA 2J67A 4V38A 2QVCA 2YRWA 5DSZA 1P77A 2HQ1A 4RVFA 1AKVA 2JBAA 1DIOB 1T9AA 4LYYA 2HTEA 2GEUA 4MA4A 3JQ7A 2RBEA 3SK0A 4Z3OA 3EWSA 4IWNA 1XV5A 3ZCUA 2VDOB 3F67A 3MJRA 3CEHA 4Z4HA 4IXNA 4MS3A 1FLVA 5BRJA 2YHIB 5BV8A 3HCFA 2WQ6A 1H5NA 2X1VA 2CXHA 1TZ2A 4FHEA 3GCWA 4F3CA 2V4MA 5JDIA 1R2QA 3IULA 3W2EA 5JISA 3LUGA 3BZUA 2X3FA 3VFDA 2QRPA 4GVPA 4FYPA 2Q5JA 4HUQB 1WHSB 3TUIC 1GM5A 1LCIA 1RTTA 1WDMA 2LNDA 2YUIA 3ABOB 4II7A 4CT5A 2GILA 1FJ2A 5F33A 2QZ4A 2P9YA 3WR5A 3DHNA 1SUEA 5IJWA 1JILA 1NBEA 1RLTA 1ZIYA 4DC0A 1YIAA 4W9RA 3OM1A 2ZVQX 4EW2A 1A8PA 3DE4X 2FWMX 1E2PA 5FYQA 2NUTB 1YD7A 3REOA 1G55A 1Z63A 3V6LA 2NZ8A 3C8DA 1AY0A 2IYTA 3PD7A 3PKIA 4HYYA 1BJRE 1FDSA 3RRBA 2B1QA 2XKAA 3OZTA 4ZPXA 3ZH2A 3AI3A 4DM3A 2ZRMA 4ARZA 1W93A 1DIBA 1THZA 2WWXA 3LUCA 1Z6PA 5A5FA 3JQBC 2YW2A 4YVFA 2DR2A 3WLJA 3BJIC 3D4BA 2VG8A 2RBKA 1UC5B 3DAOA 3MT8A 3PR1A 3FOZA 1KWGA 4X1KA 2B30A 2FPGA 3QX9A 2WJIA 4JLJA 3GR6A 4C21A 4ZYYA 2CNOA 3OOJA 3HM9A 4PLVA 2OHHA 4RIFA 1JQJC 3SR4A 3SS8A 1G291 3GP3A 3OE1A 4RKQA 2OC4A 3PWSA 4EJSB 4BO5A 3OQOA 2EZ9A 4UULA 2QUHA 2X0RA 3AERB 3HR7A 1ZXLA 1P72A 1E4VA 1KZ7B 3C8UA 4DABA 1N1DA 2QLBA 3IAFA 2GK3A 2F4NA 4PG5A 1ZH4A 1BMFA 2NPIA 3R24A 3ZU5A 3PJRA 3QYJA 4BU1A 4HAYA 3CLUC 1BMQA 1XAGA 2HDOA 2P4EA 4LZZA 4RGQA 5C8YB 1XB2A 3R6DA 5FOVA 1QAQA 4X7MA 2QRQA 1FEZA 2FP3A 3LZDA 3R2JA 4OHXA 4XGQA 2XLCA 3TPCA 4FHZA 2FUEA 2SECE 2Q4OA 3OT1B 1ORHA 4KO8A 3SF0A 10MHA 3NOOA 3H8SA 1XF1A 3BHMA 1WRBA 4Q1BA 1F12A 4HGNA 4HNGA 1KWKA 4IUDS 4Y2GA 3IKMB 2HADA 3GJ0A 4MLCA 3FDXA 3CUTA 2C2ZA 1QZUA 3VPDA 4P84A 1JEEA 1H0SA 1SNYA 2UVPB 5HP4A 1PL6A 2P0AA 5E6SB 4DKXA 2B92A 1NXSA 1MAHA 4AP5A 3OO0A 4ISCA 4JI8B 5KCZA 1P9NA 1M75A 3B1FA 3KR9A 3BULA 3OETA 3OBIA 2J87A 3Q2KA 4UUOA 2XMCA 2H4YA 4KYVA 3WKDA 1C7JA 1KS9A 3CNLA 1JJFA 3IPXA 4TLLB 5CU7A 1URPA 2PA3A 2OK8A 2PT6A 1N6PA 5KVAA 2CVHA 3LFUA 3BTUA 3VPBA 3K8ZA 1L4FA 2VCYA 1X9IA 2DBRA 4FKBA 1H1LA 2Q1UA 2OXCA 3E8SA 5EEGA 1GA1A 3M4ZA 4J6EA 1EUCA 2A1IA 4OM8A 3T7AA 5JZOA 5LMZA 2AX3A 2EW2A 2YASA 3WYCA 3MT0A 1NR5A 3L8MA 4KXQA 2JFXA 4MCAA 3ELYA 4ALLA 1F9AA 3NWPA 5B5SA 4TS1A 2O8EB 5K03A 3O8RA 4PW0A 3S44A 4UW9A 4DV7B 4Y2JA 2ETXA 3FRIA 2XXBA 5KAPA 2TSYB 4JEHA 5I9MA 4K9QA 2D74A 1JKJB 4Z2YA 4AZWA 2FG6C 2Q41A 3CEMA 4MS4B 4C0HA 4QUKA 3TG8A 1NWCA 1TUGA 4YP7A 3K6RA 5GZ1A 5BWOA 1L1EA 1J25A 3OD5A 5CDFE 3R0XA 4DJAA 4PNEA 4JL6A 4K88A 2PMWB 1E1CB 2GK4A 5G1PA 2ZTMA 3WJ1A 1UANA 4EW6A 4OBWA 3ZWVA 3PL1A 1PVDA 1P7ZA 3MGGA 2XQKA 2JB9A 3ME5A 1E9FA 5ALUA 4BEBA 4EYSA 3O4IA 5KNCD 4P0PB 2DR3A 1E79A 3DMFA 4N48A 2VPQA 1ZX1A 3IDZA 3IQDB 3OQBA 1IK6A 3USCS 3ZXSA 3DVAB 4PHFA 3SZMA 1L4GA 2A1TR 1MQAA 5TARA 2B83A 1SHZA 2XYRA 4X7RA 3ZQJA 3QPDA 4AJ2A 4EMSA 5C81A 4QUIA 1HZJA 3NOQA 4L3VA 1EVLA 1GTRA 4O63O 1RZRA 4J4TA 3PRHA 5LJIA 1U0FA 4GP9A 2RKWA 4P80A 1FJGB 3HY4A 4R05A 4P4GA 3PGMA 3NIBA 3HQ4O 3CNQS 3RG2A 3GL9A 3KB8A 1GZDA 1MAVA 2ZJ8A 1JAZA 1T8RA 2UZ1A 4FKMA 4GBED 3MWDA 3QBJA 3GRCA 4MQBA 2Z83A 2HMAA 3CGGA 2WUGA 1TGVA 1DPFA 1DKUA 1I0LA 1DT5A 3L0OA 4ZOEA 2CFCA 3CEJA 4FMCF 1G64A 2IPMA 1B74A 2HSGA 3GRUA 4PPGA 4ED9A 2IX3A 5TB5A 5BVHA 4LGVA 2R6R1 1QBKC 2PVSA 5BMVB 4F97A 4A16A 1JXAA 5K7SA 3B1KA 2QQFA 3MFQA 3QV1A 1R4NA 1EDZA 1F1BA 4FDUA 4KAJA 4BGUA 5KMGB 3W5BA 3ROKA 5DI3B 1IM2A 3HTXA 1PK7A 3CT6A 1XWFA 3KOOA 3CSDA 4HAZA 4HUJA 3JW8A 3BEOA 3LQRA 3NHFA 3KCQA 5CNJA 1I32A 4FEEA 3AGPA 3TJRA 3TFQA 1NI5A 1AB6A 5JPIA 2L0XA 4FHFA 3BD8A 4KAXA 3GV0A 2QTVB 5L4SA 1UPTA 4CL3A 1FYDA 2WPDD 4M1ZA 1GAXA 3PGLA 2J32A 3K05A 1VOTA 4GDMA 4W5QA 4BLOA 1TF2A 2C2GA 1UAAA 4K9SA 4AWXA 2A92A 2QSYA 4E2XA 4QVGA 3EF3A 4IOLA 2JFFA 3H9QA 4HQRA 5J59A 4C0JA 1O9BA 2NMVA 4N0EA 2EW1A 2BHLA 5EA2A 1UK9A 3IQGX 1E4OA 1DJMA 2WJ6A 5E6RB 3AO0B 5E3JA 3S40A 1NASA 4FHGA 2WB2A 5ALWA 3ZEAA 1V4NA 3PV0A 3NX4A 4GI5A 4N8EA 3X1XA 5GONF 1KMHA 2MYTA 1U8TA 2ZJOA 3GBSA 1MXHA 4R2IA 3HDTA 2ZXUA 4FUQA 5L4NA 1GAWA 1HM5A 2D5BA 3ZDYB 1XAHA 4AECA 3I6MA 3DFMA 2BVNA 2RAVA 3HCOA 1KRHA 2BD0A 3LPCA 2JVIA 2AZXA 2AJTA 4FFOA 4JMPA 2V7EA 2ZIGA 3G1WA 3NEPX 3O3NB 4O1IA 2QL7A 4OMCA 1LI4A 5JDCC 4EGJA 1Q91A 3M6AA 1VCMA 2IBSA 3UMVA 3BILA 1T0UA 3PNSA 4N54A 2VJMA 3KM0A 3L49A 3IOCA 1TJNA 3QPUA 3NHAA 3B1YA 4Y2UA 2BI4A 1OIXA 1QGDA 3PE3A 4HFJA 4XX0B 1DAFA 1JS1X 1CDZA 5IBQA 5CA1F 4ARCA 5TS2A 4RSGA 4CDGA 2Q5IA 3AW9A 1QOPB 2YUTA 1C7IA 2CSUA 1NHWA 3C70A 3PFWO 4IWYA 4PSCA 3T9AA 1T2FA 4XIGS 1KU6A 4IG9A 4TMXA 5DYTA 2ZATA 4PV7A 3ZKWB 5CBPA 1AS3A 2AOVA 2C9OA 1UJ4A 1XROA 4L5AA 5FWAA 4L5YA 4QYWA 4CF6A 5K0JA 2XRFA 1UWKA 3JQBA 3KC2A 2O3SA 5E6UB 1I2MA 4QEZA 3SEAA 3ZVLA 2Y99A 4ETIA 3LIPA 3ZHOA 5E4FA 1OU4A 1GDTA 4ZTZB 2RGDA 3REFA 3E9CA 2WU4A 5TS3A 2H5EA 4G1FA 4KGVA 4X5OA 2YJ3A 2RFLA 1OZHA 2GKGA 1PQWA 1FSSA 3W1WA 1JQ5A 2FLWA 3N5KA 1NNLA 4CT0A 1ZA1A 3TOVA 2KW5A 4M9ZA 4BMCA 3IAEA 3EFOB 3TNJA 1ZBQA 4FZ5A 3I72A 1INLA 5AW2A 3DKPA 4HJRA 4DYHA 5EINA 5ALOA 3KBOA 2F00A 2BC9A 5M5BA 2UXCB 3RS0A 3CRMA 2H63A 1ZWKA 1MJFA 4JB2A 5LA6F 1M72A 1JECA 1QQ7A 2OTCA 3AR3A 4DWWA 4U7JA 2NLOA 4Z7OB 5J4VA 2R4TA 3KAKA 2JD1A 4XAQA 3UK2A 1PZGA 3MYYA 4OA8A 1Q7CA 1YULA 1XCBA 4GZ5A 3VNVA 3RHZA 4RTKA 3EQ6A 1VE6A 4ZZ2A 4YRMA 3AF4A 5CDSA 2Q1SA 1DQSA 2HCBA 3LPNA 2DFTA 3SBXA 2WJVA 4R8SA 1XZEA 1K8QA 1ZOSA 3GZNA 3LBYA 2AJ8A 4JWKA 1G60A 1K66A 3K0AB 4MJ3A 3R3ZA 3MHTA 2C9CA 4L16A 4QE3A 5KDOA 3EZ6A 4B6FA 3TB6A 3P0FA 2CDCA 4N3AA 5I9TA 5BVGB 1TPYA 3KHTA 5IJXA 5MDHA 3ZV4A 1FFCA 2YH2A 1Y1SA 3C2QA 1IBRA 3I6BA 2IYWA 4LJYA 1QH9A 3HS3A 5HVNA 3QVMA 1PJ4A 1TLFA 3RSSA 2HZ7A 4F6CA 2V7BA 2VATA 3VRHA 3O9MA 5JNUA 1VSUA 2Q2WA 3A9RA 5FWYB 5T5QA 4BLTA 1X2BA 1EWYA 1M7GA 1YDGA 2YJ4A 3EEQA 3GFSA 3HCDA 4K9MA 3AI2A 4LYEA 4RVOA 3IAM6 2FSHA 3EX7C 1T6BY 3DZBA 3PC8C 3PTZA 3T0GA 2R2AA 3A4TA 1HT0A 3B52X 1O6GA 3L0YA 4PONA 5FFNA 1R0SA 2BEKA 1XVAA 3ILXA 2ZJAA 3QRWA 4HFRA 4MZDA 4R31A 4S1VA 1XTZA 3SQOA 1LZLA 1WNFA 2OQVA 2I3BA 5BPHA 3WMRA 2CB9A 3GEGA 4YI3A 3LE8A 1GLGA 3N58A 2QK4A 3MCVA 2C2XA 3RYFA 1L4NA 2FFHA 1ZN8A 3HL0A 3UK0A 1S6YA 4D8WA 3U9TA 1YONA 2IHTA 3RC7A 4NPCA 3DEFA 4EAQA 3NDJA 2PJRA 3PHHA 1Y1RA 2GPAA 1JN0A 4PR3A 3WX0A 1BNCA 2BM1A 2VK2A 2BWJA 3HYLA 4UTPA 3F2IA 1QJCA 5ALKA 1XMSA 2YKGA 4UTOA 1Q17A 5FI0B 4M0CA 4DIEA 4UHHA 3W9UA 5BQFA 2VP4A 1ZJ5A 3G02A 1TQ4A 3TQOA 1C0KA 2JH3A 2Y76A 1D09A 1EIZA 1T8SA 2GJ9A 3CWQA 3G2MA 3EXHC 4FBMA 2R8RA 3BJZA 5L3RA 3TKLA 2I91A 1GGEA 5C3UA 1N5LA 2BGJA 4LAFA 2ILVA 3TZ6A 1XQVA 4N5DA 1DC6A 1AOXA 3VR1A 3M1LA 2N47A 4JC8A 1MNQA 2I67A 2ZPTX 4ZK6A 1ZUNA 3VVMA 1JVNA 2OFFA 2REOA 4ZI2A 4O2RA 2FEAA 3L8GA 3PDWA 4JP5A 3R7LA 1KZ9A 1AK1A 4RDIA 2VJCA 2CXUA 4K9RA 1YFZA 2XJ9A 1J8VA 3SN6A 4CQNA 3ILYA 4MDHA 2FWJA 2OV6A 3GZJA 2Q1TA 2KWIA 1I4EB 1YS9A 2DGDA 1P91A 5FL7D 4NZPA 1UXJA 5TJ9A 3TYXA 2VHZA 4BLRA 1Z8NA 3HY3A 4JP2A 4Q4AA 2C2OA 2P0YA 4G5XA 2CB0A 4WOJA 4WNAA 3RIYA 4M49A 2DFNA 4OEHA 3QVUA 4LECA 2XJ4A 3FNEA 3FPHA 3HM2A 4YV0A 2HPHA 5KYNA 2A9PA 2J9FB 3F5DA 1WZEA 1QLHA 2Q9AA 4MVJH 4U7FA 5G4LA 4P0TA 1QX4A 4V0OA 1XTBA 3D0RA 4KIWA 4CBVA 3SSOA 1KNQA 1X7XA 4YCJA 5B30A 1MA0A 4G0WA 5EHXA 4LHSA 2IHYA 2AFHB 2PFSA 3U4AA 2QMOA 7YASA 4Z3DA 3CX3A 2O5EA 3WLLA 2VXCA 3OOWA 1SHTX 1SC3A 3AXSA 2EHDA 3ROGA 4LDAA 8LDHA 2CN1A 1UEXC 2FG7C 1QS0A 3AR6A 3COWA 4KE8A 5E7QA 1GUBA 1QKJA 4OGWA 4FGWA 2NTVA 3W7BA 1D0VA 4WBXC 3KB6A 3HPQA 3KJQA 2FE1A 5CCEA 4C5BA 3SPXA 4W6ZA 1ZHHA 2JLAA 3E1SA 2VUSA 3NBXX 3R44A 4GGOA 1L5LA 2E1PA 1VI6A 5D1HA 3QUSA 4BBPA 2I76A 3LX6A 2YXEA 3ABSB 3QEMA 5ILQA 5TGTA 4DZTA 3KG2A 4RTJA 1OVGA 1WQ4A 2ZJYA 2C5EA 4L4ZA 2E4ZA 5EJ9A 5HKKD 3GGSA 1QR2A 2JCYA 1T36A 5ETJA 1JFVA 2DWUA 4IUBS 1A50B 4QEKA 4BU0A 3LT0A 1Y3IA 2R44A 1RI1A 3OIDA 5CJ2A 1FYVA 5K2MA 2VZ8A 2K4MA 4BLUA 1RCUA 1M34E 1I01A 1C3XA 2R4UA 3CYFA 4BFXA 3DZHA 4CM5A 4UM9B 4WWHA 4IIHA 3RHTA 2GK6A 3SZGA 1PEDA 1SCUB 1O96B 1CR2A 2JHFA 1XQ1A 2YN4A 1UMDA 3CUKA 1TTPB 2VHEA 2QTMA 4FZJA 3FLMA 3UYLA 5J1TB 2H2GA 3ZWCA 3WOVA 1I3NA 1XMVA 2HWWA 4IGKA 4PIMA 5T41A 1OLSB 1VLQA 4NYIR 4RAOA 3H1FA 4UNPA 3OM9A 2JAXA 3AF5A 3TZQA 2O1SA 3L82B 1J0EA 1TJ3A 3RFFA 2PM8A 5C7LO 4U1RA 2GZDA 4GI1A 2XE7A 3KQNA 4ENQA 4RKRA 4A6PA 3WLSA 1BWRA 2CD7A 2A0XA 2O9JA 2OHIA 1LW7A 3UC9A 4ENSA 3AKYA 2HF7A 3Q7IA 2J9XB 4IF4A 1OAAA 3WJAA 1UBSB 2Q2QA 2WF7A 5KTKA 2BYTA 4Z1OA 1KXJA 1QHHA 3IT1A 5F21A 5AESA 3EXFB 1ODSA 5DWQA 4YTEA 3L8YA 3IFSA 3D1JA 5ENVA 4JI5B 1JV2B 1PD0A 2OHXA 2FN3A 3DFZA 4C4PA 1NW9B 1EDOA 1SVWA 1K6MA 2B2CA 2HN9A 2NQTA 3C8MA 4R8VA 4W8HA 3VSEA 3WV4A 1BJKA 2YHIA 3O8DA 4WOKA 4Y1GA 4ZOAA 5CA0A 2W6MA 3NVAA 1YSCA 1I14A 3BQMB 1Q2UA 4PX2A 2OUIA 2VZLA 3KD2A 3LSTA 3A1FA 3CNHA 4AKEA 4MGIR 2NUAB 2BGUA 5AXDA 3GP8A 3WGKA 4ZVVA 2WF6A 3WZ2A 4LXTA 4HUQA 2VYVA 1WHSA 2A30A 4MWZA 4MQMA 3HXMA 4UCQA 1QZTA 3CRRA 1IWPB 1S7GA 2FEXA 3GY0A 4TQUS 2V3VA 1EWKA 5LB2A 1G6HA 2FY8A 1NUQA 3AKEA 4KQGA 4MW9A 4YAWA 4TV8F 3OHMA 4DA8A 2NUTA 1XLVA 1W30A 4B71A 2E4UA 5LZ9A 3OIYA 4LHEA 1HEUA 2EQ5A 4CG2A 1OVMA 1AIPA 2HIMA 1JIXA 1HDXA 4CL2A 1UT5A 5F2NA 2IP1A 1YDMA 4UBLA 4A9AA 1Z07A 1EA5A 1PX0A 1Q1QA 4KBGA 1F3OA 3FM9A 4V0MA 1J4AA 3MN1A 2PNJA 4HNRA 1R0WA 1E7SA 1PI3A 1VE1A 3V4OA 2CCGA 1OWNA 3QMPA 2W58A 3A1CA 5JNRA 3FOWA 1RLIA 3CZQA 2WZCA 3UQZA 4L4YA 4R2WA 5KQPA 1V6CA 1OXKB 4HZGA 3S0JA 1USUA 4Z4CA 1P2DA 2GTPA 3THXB 3MS4A 1SJ9A 3AERA 4RY2A 2VTEA 3RG8A 1DEXA 4MMXB 5IULC 3PC8A 3ZW7A 4ZAWA 2SCUB 1E2IA 4LNHA 3K92A 3D0KA 3AVWA 3E8MA 3Q72A 4LWPA 2HSZA 1E2FA 1SN7A 3I2IA 2ORIA 1NXQA 3IPAA 5C8YA 3RJMA 5IAGA 5T6MA 4KQWA 3EC2A 4EITA 4ZGBA 4DR6B 4UMFA 1PBNA 5EPOA 2BGGA 2WR8A 1CV2A 2BM0A 5AHWA 2ZTHA 4PQFA 3HYTA 3OLCX 3SS9X 1EGMB 2DR0A 3F6RA 4GMXA 4NQRA 4PCAA 1WB5A 2FE4A 1ONNA 3ECAA 2O3UA 3FBGA 1OBHA 2JJMA 1BXKA 2NVBA 1F2TA 5EWMB 3SD7A 1G4HA 2CVOA 2RHGB 2ROQA 4HYQA 5LZ7A 3F9CA 5HIKA 4P86A 1P44A 1HO3A 5SV2A 1XSEA 3K8YA 5EZQA 1A82A 1E60A 3ELBA 1LJUA 3UKDA 5E6SA 3WLOA 3WGGA 3LUJA 3EULA 3EAGA 1ZCAA 4RD3A 3CF4A 1LNQA 2A94A 3WDKA 1AKTA 4CPDA 5A9TA 1CRWG 1Z0FA 5CYFA 4WESB 1II0A 1P4AA 3UUFA 4CR7A 1CUHA 4AXBA 4B73A 1LX6A 4YAEA 4NBUA 1E1RA 5H5JA 1K5GA 3P97A 1IG3A 3WNDA 4LQCA 1RI5A 4BCBA 1W46A 1N6KA 2CDBA 1MX1A 5DW3A 4CMAA 5HPYB 2HYDA 1AD2A 4FGLA 2QY6A 1YR9A 2QE7D 2Q4DA 1DRUA 1ZJYA 3HRKA 3LUFA 4FB4A 3KQUA 2HF9A 3M6MD 5ELXA 1XU7A 3DHVA 4D4KA 5EPUA 1TD1A 4E32A 4L5JA 4YCMA 1K27A 4HR7A 3TTXA 3AJ8A 1L4LA 1JKJA 3GK3A 2HXYA 2IGTA 4K6HA 1ZO8A 4M1YA 3DSRA 5ECYA 2OBYA 3CONA 3IBSA 5EI5A 1XN4A 3EMDA 5F2OA 1E1CA 1HBJA 4PAOA 4EY4A 2HQSA 2OCXA 2OO5C 3T7TA 2VT6A 1RBZA 2P6UA 4N5MA 4FFBB 1RRFA 2Q3LA 4CLXA 3V2IA 4IVNA 4G9BA 4GECA 1A8SA 5H3LA 4Y9SA 5ANRB 3OF5A 2BFMA 3ICQB 3DFKA 1JDZA 4QHTA 2HBYA 4GI2A 4MVJP 4CMHA 1JH9A 3GVPA 4HLDA 5BUZA 5BOVA 2VN8A 2XSZA 3B70A 5KZMB 3NQ41 1DTWB 2QE6A 4URVR 1BKDR 3FCSB 5DIFA 4BQEA 4K0RA 5KNBA 1NPDA 1EB9A 4M1WA 2B2NA 4HC4A 3SBOA 3VC3A 4C0BA 3KYCB 2X13A 3C97A 1MIOA 3GRVA 3UHPA 1DQNA 1V4VA 4R2LA 1J24A 5CVDA 3QE9Y 5J23A 1QYIA 2WAAA 1ZIDA 2VTBA 4B0PA 2QA5A 4EKNB 1LK5A 2ZYHA 3S28A 2J41A 2V54A 2QRNA 1US8B 3BEDA 4E7OA 1P1BA 3VSDA 3HJRA 2A0KA 4JU8A 1UH5A 3UJBA 3FKQA 5BMVA 1IY9A 5I8WA 1SU4A 4Z9BA 3KPWA 5JECA 1G9SA 1MEEA 2R47A 3TAHA 5KMGA 2DBQA 2X77A 4FJ2A 1YVPA 1GTSA 4MRVA 1KJ9A 5DI3A 4D4JA 5H8WA 1JJIA 4JVNA 1I10A 2ZB4A 3IOEA 3SXPA 4P4LA 1M6VB 1N5IA 3VMMA 3ZVNA 2W9XA 3FTPA 5FPHA 4AQ7A 1WLYA 1P33A 1FLAA 2BKLA 4UTXA 3V7YA 1OI4A 3ONDA 2VDWB 2QTVA 2AN1A 2B4YA 2JJ1A 3LY8A 3NBUA 2I55A 3LBIA 3RJ9A 2P9EA 4BRZA 4EJ0A 2Z04A 4XTRA 2M98A 1SUWA 1AS2A 5HCIA 1UMCA 1NBME 3VZPA 4DBLC 1JG7A 1YQEA 4JMLA 1I6WA 3AF0A 1Z83A 2FQXA 2G7ZA 4H9GA 2VRWA 1KXZA 1ODTC 1GPLA 2VAXA 4D79A 2PWAA 5BW6B 4CQMD 2I6XA 1QPZA 2FF5A 2UKDA 2J0UA 1MO3A 4LBZA 4A8HA 1ZIPA 1C8VB 3CH5A 1IATA 1VKNA 1RRKA 2FUCA 2Y4NA 3OZDA 3QELB 3L93A 1KARA 3B5IA 3SQDA 4TLDA 2NO4A 3COSA 3HLYA 4J2OA 5HTOA 2FW9A 5IEJA 1Z9BA 4LYHA 4A4DA 2CEAA 3PC6A 3WHKA 2X42A 2YXDA 5IK2A 2ZZNA 2KYRA 2H48A 2P90A 2HRCA 4I55B 2RCYA 1XA3A 1HOTA 3CUEF 1SVUA 3OQVA 4EDFA 5IJAA 3LJKA 5CB0A 4A92A 2N9UA 1Q22A 1NQUA 2XAAA 3C3JA 3G8CA 1W0KD 1RPJA 5JYDA 3KSAC 4XR9A 2CYCA 2C20A 1X94A 5JASA 5AP9A 4DWVA 3TRDA 3TO5A 4CF5A 4L4XA 4ZO7A 4D4MA 3PLNA 3TZKA 3FPCA 2R7MA 1CJMA 2CDAA 1T8UA 1S4QA 3AHIA 4G1EB 2O52A 5JS7A 4HMOA 1Y3DE 1D2EA 1FX0A 3K7EA 4MWTA 1CNEA 4KJZA 5JVDB 4C7KA 1ZM3A 2WUDA 2RD2A 3AESB 4PFKA 4HX5A 5K3SA 1J9GA 3ZKWA 5FA8A 2OAQ1 1KF0A 4PWYA 5DK6A 1Z88A 3DMTC 2H7YA 3N7UA 2X5KO 4GKAA 5E6UA 2V1UA 3JWJA 1TE2A 1FXUA 1WXWA 2VXYA 1PR5A 1KSFX 2FPMA 4HF7A 1P0CA 3SF8B 1QQAA 4TVOA 3QPAA 5GOZA 1N2CB 3BRSA 3NRBA 1MFPA 3VJKA 3DDHA 4X7PA 1CZHA 3FCOA 1VPWA 1VXOA 1EFRA 1P5JA 4CMEC 4D1YA 1EXWA 1QH0A 4S2EA 5HQ3B 5ALEA 3DOHA 3JQGB 5I7HA 2X1HA 3G49A 1E3TA 3AHGA 4P3OA 1DFGA 2RARA 1WABA 2WFAA 3I05A 4UQPA 1SXJE 5J2UB 3LDGA 3H2SA 4MW5A 4WZAB 5CK5A 3LOQA 3U3XA 2W6QA 2UVQA 3CB2A 3HG7A 2ZS9A 3RTEA 2GSDA 3PK0A 4UOEA 3PIRA 1CLUA 5J1SB 4OQPA 3BQNB 3IUJA 1HTBA 5K3AA 1ZMOA 4CLHA 1EINA 4YV1A 5EP3A 1T5IA 3G5LA 3H2HA 4TLBA 3WK4A 4BJHB 1KYQA 1L7XA 4LX0A 3GGJA 3I0MA 3KTDA 4OBEA 1ENZA 3DTYA 1KFBB 4XWGA 3ZCVA 3SHWA 2QD1A 3K0AA 3HO1A 5EE1A 3RKUA 1OX5A 3CGWA 2VWHA 3LCUA 2CLCX 4OJNA 5LDGA 4MVJE 5BVGA 1D03A 2C0CA 2Q28A 5DHFA 4FMDB 1EG2A 1CBUA 1LPBB 2AN5A 3A05A 3BCSA 5LQKA 3S3TA 1HC7A 3U2QA 3DMNA 4PXYA 1Z0DA 5AI6A 2GLXA 3A2KA 1BVYF 1XDZA 2R84A 2RK4A 1HTWA 2WA1A 2IHNA 2GZRA 4C1BA 3G9QA 5FWYA 1IY1A 1ZHFA 1CVLA 1USGA 4A6DA 2I34A 4BGIA 4CN9A 3AVQA 4CI0B 4W7HA 4YONB 5K8LA 3KKKA 1OXTA 1AK9A 2A9JA 1I24A 2OMEA 5DM70 4WCVA 2NM0A 5B1IA 2EATA 3BSFA 1Z73A 3E82A 1Q6YA 2NNLD 3A6JA 1TEHA 3DOIA 2JAPA 1BO6A 3I9KA 3STUA 1EXNA 1Z28A 3DQZA 4HDMB 4E08A 2ODAA 3F4LA 4PLGA 1Y5LA 4JT9A 4KUHA 3LC2O 1E8DA 2MSWA 4LY0A 4ZT4A 3SSAA 2I2AA 5BNZA 4CLDA 4FWTA 2ZR8A 1OLXB 3RHFA 3EGEA 4WFKA 3DVQX 2RGCA 4NAUA 3EWIA 3F73A 1R3DA 1VE9A 2D8AA 5CVUA 3ZCSA 2GN4A 1GNPA 1N5OX 4O8ZA 1S2GA 3T3GA 4F2DA 3TUZC 3IUYA 2Q5QA 1AVTA 2NZJA 4WDRA 5CT9A 2KQUA 4RZQA 1EEHA 1T1EA 3BXEA 3KJZA 4PPQA 1HURA 2EJVA 2ZKIA 5AH0A 4C2AA 5EXPA 1KI6B 1A5SB 1LWOA 1ZD3A 2DZDA 3CLSC 1GFZA 5MFPA 4LYDA 3TFOA 1IQPA 3UJ9A 3WRWA 4L72A 5K20A 1HQKA 3L8CA 2Z95A 4GMGA 4QXRA 1B76A 1LK0A 2GT1A 4QSHA 2EZTA 4B3DA 1K3FA 3VU9B 4BVJA 5CB4F 1VCNA 3QVWA 2HLPA 3FYTA 4BWGA 5JO0A 3SCZA 2Y1GA 3AM1A 2ZWVA 1GRVA 4O2BF 4DLLA 4PZZA 1GTZA 4BE7B 5DW0A 1FFSA 2JIRA 3E3OA 2G82A 3OEWA 2CKDA 5IAKA 3UGQA 5IEBA 4RZIA 5CFPA 4LHZA 4YWJA 3PX2A 2MCFA 3ZY5A 4X41A 4FK8A 4C7JA 4YASA 4X8OA 1QNFA 3I9OA 4QL3A 5G40A 2IYQA 4MPTA 4XEUA 1W87A 2Z5GA 1DLJA 1E89A 3EVEA 1RHMA 3MC1A 4H0CA 4BQFA 4G0VA 1JJ7A 2W83A 3OJ0A 1TO2E 1EWRA 3OZEA 4S1WA 3T9DA 4ALMA 2F48A 5DHUA 4ZI7A 4OSEA 2NUPB 2YVQA 3P2OA 4RX1A 4TRJA 4UZSA 1SU8A 4EY3A 2I7DA 3OUUA 3QXHA 4TSFA 5LXTA 1U0EA 1X1EA 2Z5VA 1KVUA 3R5JA 5C7YA 4XTCS 3L8HA 1KJWA 1I7LA 3U17A 3WBFA 2VTDA 1MRNA 2OD9A 1A4XA 3C3EA 1NIJA 2PAAA 2IPAB 2B9VA 4OXNA 2VA8A 3ASUA 4OLHA 3UJ8A 1FFBA 3FVVA 3T7SA 4GU5A 4PINA 2WLSA 3A1WA 3JATB 2PY6A 3INTA 3NIGB 4RMIA 3T0FA 4D6XA 4Y98A 2CNBA 3DLAA 4FW9A 1NDHA 4RM3A 4EUKA 4NY1A 5CDGA 2R751 4PLYA 1D5CA 2PYDA 1JSCA 3MD0A 4NTZA 4PU0A 4UTNA 2OZLB 1U99A 4IGFA 4XJXA 4Y3UA 4FD2A 2HA0A 2JGNA 4DANA 5FNZA 4KVGA 5CNKA 1XDGA 3GMTA 1UF9A 4YHHB 4DJJA 3KQTA 1CERA 3MYRA 1ZSNA 3L92A 3OX2A 5TT0A 3UK1A 3PJEA 1NP6A 1UP4A 3DCYA 1K8YB 4FE4A 1YZLA 3MJFA 1CZUA 3PA6A 1GGVA 3LYUA 1ZD2P 2Z9DA 2NXWA 4FW8A 2LW7A 4L51A 2G4VA 5BR4A 4RQAA 3E9NA 1PN3A 1SCUA 2ZBDA 2FWAA 1WXGA 1PS0A 1Q0QA 2F3RA 1Y42X 3M3HA 4RACA 3AKDA 5JQGF 1JHQA 4H7JA 5JD4A 4LW8A 1NVKA 2VSNA 2XEDA 2YIMA 1OLSA 3QOWA 3VZSA 4BRSA 5KKNB 4ZCIA 3OOHA 3HDJA 3SJUA 2N42A 2P68A 3OIVA 1H8ED 2QS9A 4RPKA 1IHPA 4OQDA 5MN4A 2F8SA 2P9FA 2BE9A 4KIUA 3A2NA 1VFNA 1TQHA 3QSGA 2IHBA 4DREA 4KE6A 2OV1A 4Y0AA 2WYUA 4DMKA 2GJKA 4BKUA 2OENG 2QDKA 2WHRA 3FXAA 4IVPA 4FJ1A 4C88A 3AR2A 3IKVA 2A5GA 1VYHA 3KUDA 1ZM2A 5AJYA 2WDZA 1S8AA 1QIFA 3EXFA 4Z0NA 1KDOA 3RTCA 1KI8A 1A2BA 3NR2A 3ZWQA 1MU0A 3VHXB 4F3TA 1NDQA 3KHSA 5BWBA 1U7HA 2CMHA 4QHYA 4OGGA 1L5GB 4UVGA 1T3TA 1NVBA 4UJ3A 4MI6A 4D45A 4RL4A 2X6QA 3FNGA 1Q0HA 4CMEA 4EHDA 2K2WA 5CVEA 4ISBA 2Z08A 4WGGA 2NUAA 2XVXA 2YX1A 4X45A 1QF6A 3ETDA 4YUAA 3HWWA 1CYEA 1GCAA 1ZKDA 1SBYA 4XCVA 3D8TA 3PXUA 1Z0KA 4QNNA 3UENA 1NULA 4S2UA 4F60A 5KREA 2Y6VA 3KEMA 1WB9A 1AMUA 4PAMA 1B1AA 1TC2A 3K8OE 1B93A 3PS9A 4Q16A 2BSXA 4NV3A 5A04A 2XVMA 2VR1A 5I4KA 1I2ZA 3ZEIA 2PLNA 3NM6B 3H1BA 4GPEA 2HV9A 4BB5A 3H3FA 2D1YA 1AUXA 1BMFD 1UQRA 2BOVA 1HTTA 2B0JA 5TVGA 4OHYA 3WB0A 3CCBA 4JSTA 3MEQA 3D4NA 3KSDO 1SOUA 1KR2A 3MJSA 4IMPA 1M6EX 2GWHA 2Z09A 1Z36A 5A1JA 1E2HA 1YHYA 4B74A 3THXA 4AKSA 3AFNA 3OJLA 1K9VF 3K31A 3IHTA 5CTJA 3MRXA 2BR4A 1N1EA 3BWBA 5GJWC 2Q3HA 2WPNA 3RFTA 2SCUA 3L4JA 4LZAA 3KWJA 1NBWB 2E89A 4JLWA 3DTVB 3GPCA 3X2FA 3B12A 4LQLA 3HNPA 4N5IX 5FULA 2R5NA 3OZVA 5JMTA 3B51X 3NTRA 4MUJA 1U0HC 3ZVMA 2ZIXB 4F0JA 1SBCA 1XT6A 1CU1A 3M9WA 4REOA 4CUKA 3IHWA 3ICWA 4WZZA 1NSYA 3GJQA 1P1JA 3FUVA 2J59A 4IDNA 2DHEA 2II6A 5KIAA 3RIGA 2ZLBA 1X92A 1L1FA 4BO6A 1QCZA 1RYYA 1N7HA 1OFUA 1Y48E 5EWMA 3AUFA 1ZCZA 3WQRA 3TLXA 4XVUA 2BMJA 4P98A 4DIBA 3ULKA 2H4FA 2IYFA 1GNSA 1GUZA 2FNAA 2MSKA 1V7PC 2D2VA 4MKGA 5HMLA 5M29A 5IVKA 2O8BB 3G5AA 4CQJA 1IJEA 3O95A 1PJ2A 3H42B 3W6UA 1I3LA 2H9YA 4I81A 3IELA 4JYBA 4OJKA 4R9SA 2AMVA 5G1NA 1IY8A 3QWFA 2GD1O 5AVUA 2XOKA 3PC3A 4FPXA 4QO7A 4B32A 2GYYA 2QJWA 5KYUB 3QU4A 1JFFB 3F6EX 3T5MA 4UU0A 3ZG6A 2ZSEA 1SXQA 3PHJA 1Q7RA 1VYTA 4MVJM 1WA5A 3B1WA 4KUGA 5B1HA 3K70D 4FXPA 1JFTA 4MQUA 5AD1A 3L4EA 4MLPA 4UBMA 4WNIA 1WBJB 2KLBA 4A7PA 1L7BA 4MWSA 5ESDA 1WZUA 3VUEA 4QRDA 3DO5A 1RC8A 2RHLA 1B14A 3F0TA 3QVXA 5KPJA 1YTLA 3CB4A 4TLCA 3OZRA 3P1JA 4NPAA 2IOFA 2O8CA 3E3LA 1RIIA 2H51A 2YL2A 3IR5A 4MUXA 5EIBC 2E5WA 4DQ0A 5J4KA 1AKWA 2FETA 1E79D 1SCAA 2OGWA 1E5LA 5IM5A 5CVJA 3W8NA 1M67A 3KNZA 2VFAA 1E9DA 1P9RA 2D62A 2AKYA 3GJRA 3FF1A 5DNWA 5FF9A 4TZ0A 2ZREA 5AVZA 3QSYA 4HQLA 3UWKA 1EAYA 1KIAA 5EN4A 2V0NA 3UTDA 2HH9A 1KYYA 2V0CA 1DHTA 3T3HA 1UJ2A 1AGXA 4PYLA 1RZRD 4Z4FA 1ECLA 3CC8A 5K3FA 5F1YA 4KP7A 5JXIA 2W2VA 2Q4BA 3AHFA 3R5KA 2FZ5A 4FFBA 3ROMA 3WBBA 4NOKA 2BHTA 5EJIA 1MZVA 4CI9A 2Y1XA 4YAJA 5AK0A 1QC5B 3FGZA 5JCOA 2O3RA 3QVTA 3NEAA 1WMBA 2FJ0A 2O7SA 3GEPA 3O8QB 2QN7A 3E1KA 2E21A 3U4GA 3BAZA 2KM1A 3KB1A 4ZC1A 2NXCA 5F2EA 1EJ6A 2PGJA 4NOMA 5EIXA 4GL4A 3SLKA 1CT9A 3KEOA 1R1DA 3FSRA 3KYCA 3QI2A 4J43A 3ELUA 3PNVA 1EJ2A 1NUHA 3PNMA 4IDHA 5AOBA 3PHGA 3TW0A 1OA0A 4UAGA 4C4XA 1FDIA 2GN9A 3BIFA 1BOOA 1E1KA 3U09A 2NU9B 1A3CA 2PL1A 1AXGA 2FPSA 1A7KA 1GNLA 1US8A 3KB2A 3W79A 5HS4A 5KYWB 2C9BA 1ZH2A 2IXDA 2QV0A 1Y34E 2ZIUB 3FG9A 5DO9A 5B37A 3KR1A 1YDEA 3KJIA 4OQXA 5DN9A 2CUZA 2SKEA 3ZHXA 1N3LA 5HR5A 1RLUA 3HFRA 4K7JA 1GZVA 1W0JA 2J3KA 3ACDA 4LJ8A 2BPOA 4AUEA 2AL7A 4DWJA 2DT8A 4BO3A 1YZQA 3IUBA 3QOYA 1EBUA 1M6VA 1M5RA 3NNNA 2DUUA 4RIGA 2O5CA 3VTZA 3U16A 2IH2A 4A0GA 1S2LA 3MINB 4L4UA 1IOWA 1UBCA 4HQ6A 4WFJA 4DSAA 3MSCA 1IN8A 2VDWA 4R5MA 3QH4A 3D0QA 4MEBA 4RZ3A 4BIMA 4C4ZA 5BRAA 4KSBA 3USZA 4U2GA 5AVXA 2P1RA 5EZYB 5KSZA 2V74B 3HY6A 3OPXA 4YJ2F 3A3KA 1DV2A 2E5LB 1QCDA 2FPIA 3EIQA 3EG9B 4YMLA 4YCNA 3NP9A 1ZXBA 3A6GA 1GR1A 2O7NA 1NMXA 3ZDEA 1PGOA 4QD3A 3ZXUB 2D59A 3FZNA 5CK4A 3VYTB 3GEMA 1PJCA 1XTUA 3GQBB 4RWZA 2XGJA 3EBOA 3MF4A 4P7BA 3LP5A 1TF7A 4QG3A 1NFQA 4L0MA 3KWLA 4BXOB 4LXUA 1EK5A 1OAOC 1JHOA 1ZI8A 3QELA 3L7DA 1G3UA 2QAJA 2A6PA 4WLUA 1XJ5A 5INTA 4G25A 3P0RA 2QLLA 2VWQA 4H4DA 3MZ0A 1VPDA 1YMUA 1EFLA 4OOFA 5LNK1 1PFKA 3R5FA 3KT6A 4UCXA 1EUQA 1XGKA 2Y4OA 1NOJA 2B25A 2R87A 3PUYA 2PUBA 4I55A 4RY0A 3RI3A 2ZVDA 2ZUEA 4FIZA 4K05A 1Y9ZA 2WJGA 2HNBA 3B78A 3JZMA 4ILEA 2W2MA 1VJDA 4Y9UA 5JI2E 3QHQA 1SC9A 4J0QA 3LT4A 3JQFC 5DE3A 3O1IC 2IY8A 2YBEA 4L9RA 4MJXA 2Z2YA 2H3HA 4BVEA 1X77A 2NTNA 3DNFA 4BO0A 4ZVMA 3ZJVA 1O6BA 4WZ6A 3HKDA 9MHTA 5JD5A 3CG4A 3BSYA 3BGOS 2GUGA 3M89A 1VTKA 2C98A 2IZ7A 2ZYAA 4QUAA 3CX7A 3ILVA 5F73A 4X66B 4CMIB 2ONJA 3THYA 2W70A 1Z75A 3VZRA 1M2FA 4H7FA 1E2GA 4NU8X 4Y6SA 1GV0A 4IBOA 1WMAA 1FDUA 2RIPA 1EZZA 2C61A 2WIAA 3K72B 3TNFA 1EFPB 4R8LA 1ZL2A 4W7IA 5F3DA 1VP3A 2FJUA 2FRXA 2PRIA 3KP1A 3SOZA 2BM8A 3ZD9A 4BNIA 4F5DA 3WGQA 2LXNA 2YXNA 3RUCA 2VAWA 4ZFNA 2HU5A 3VKWA 3CLUD 5KO2A 4J9VA 3L7IA 4BWYA 3SF8A 4P4SA 2J0QA 4N0PA 3WGHA 2GB4A 3F1LA 1N2CA 3DKIA 5FOUA 2TMGA 3K16A 4G8DA 2P6PA 3EWAA 2QLMA 4E5NA 2IYXA 3FMFA 3ZBTA 2FF7A 5AVTA 5KOJA 2G77B 1YL5A 1H2YA 4L8GA 4A0HA 4E0BA 2R68A 5HQ3A 3HWSA 3JQGA 1T5TA 1RAHA 2WICA 4FCTA 1XTKA 4M7OA 1ZOOA 4BO4A 2VWGA 1IHXA 2GM3A 1A7JA 1TCAA 5J2UA 4WZAA 1E7MA 2H7CA 4NV0A 4DRYA 3VO1A 1CQIB 3W5UA 2VA9A 1YBMA 4JLBA 3VZDA 1MBZA 2GGSA 2G8NA 3FNQA 2WVJA 4TGLA 3KQKA 1OB2A 3R7FA 3VTKA 1E2KA 3KEQA 2W6IA 2YVLA 3OFNA 4DIMA 5CLFA 4YJ3A 1MFZA 3HXOA 3NBFA 3RT7A 1YJ5A 3WI7A 4YMHA 4BECA 3DBHA 3H9EO 4ZCPA 1K2WA 1E2LA 2AZ4A 4G4SP 3W05A 4ETNA 5BOSB 4O3MA 1GQSA 4XZ3A 2BEUB 3TTYA 2CVFA 3ECCA 1SHKA 2VDVE 3H1PA 1QP4A 3R8CA 3E0QA 3C7TA 4BJ6A 4J0IA 2CEKA 1JP7A 4FUTA 1ZGAA 3M6FA 1KDVA 3PRKE 4HCJA 2F3TA 2PX8A 4QT0A 3ZWDA 1ZC4A 3MBIA 2ZRPA 3S7ZA 2VDQB 5JARA 2XHZA 5U4XA 1NLZA 2FUKA 4ZCTA 2P6OA 2C54A 4PPNA 1SOVA 4Q7KA 3NO4A 4MNTA 5AM2A 2GPTA 1RQNA 1ZITA 4FFPA 1T15A 2D54A 2OD7A 3WLIA 1ULAA 4PYIA 4E6PA 4Q3CA 4UEQA 3K2QA 3MUEA 5JZMA 4EPRA 1NX9A 1LGYA 2YHUA 3LX4A 4JUFA 4HXFB 1JXOA 3FSEA 1BE8A 2GN0A 2LDBA 2ZG6A 4INAA 4QYSA 3S8YA 4OLAA 2FMUA 2JANA 3HI4A 2JHAA 1POXA 3JWHA 3OE7A 1IWBB 1G7RA 4G0XA 3X1MA 5FV7A 3IE0A 4ABYA 2C4HA 4A2WA 3NH6A 3QXJA 1U8EA 4DR4B 3OM8A 2X2OA 4NU0A 1XA0A 3UKJA 4B48A 4B3RB 3IVXA 5TGDA 3Q8KA 2Q9CA 4HDMA 4QTUB 1S0UA 3PGXA 4N7RA 4OJMX 2V9ZA 1YJ8A 2LVBA 4ZRMA 5JAUA 4KEAA 1OLXA 1TM1E 2K7ZA 4G09A 4URWR 3OT4A 2A14A 4NFSA 3TM5A 2GVNA 1DXOA 1XVVA 2CYAA 1K1EA 2AXQA 4FYXA 4PCLA 5DULA 1ISGA 2JFZA 3O8NA 4JQSA 1E2EA 1QP0A 1RZVA 2EKBA 3GLHB 4ZEXA 3PL5A 4I8IA 1GGJA 5LBUA 4ZVOA 1JJBA 1E9CA 1ZVJA 3GELA 4DIUA 2GERA 2QR2A 4FXOA 4LRQA 4EFMA 2BI7A 1KI6A 1K97A 1AXEA 3HU1A 3I53A 3M9LA 3O3CA 3IS3A 4WE3A 3ZXIA 1FBNA 2VQ6A 1QTQA 1BHO1 2HK8A 1L7MA 4MPPA 4L7QA 1E0JA 5KQSA 2BAGA 1JYSA 4LK3A 3IGFA 4QDOA 2PVPA 3P4XA 3CSSA 3NJ4A 1FK8A 3NXSA 4C0XA 4LSZA 4F4FA 2OOKA 2PFKA 2F3QA 4FMCB 1JDJA 4GXTA 2NU8B 4KX5A 2XB4A 3LPDA 2VP6A 1B6TA 3A9WA 1ORTA 3R7DA 5JXWA 2WD9A 1ZH6A 1QDLB 1VL0A 1YE5A 1TGYA 2XOEA 3CSUA 3LT2A 2FHSA 1RACA 2GZSA 4FIDA 4IJ6A 4KW7A 4FCVA 4QDUA 4RFSB 3VR4A 4NZZA 4BQSA 1IMJA 5JCJA 4C9BA 2FPKA 4Q3OA 1BS1A 1JIKA 1TA0A 2WE8A 3NYIA 3QNWA 4IQ8A 5F5LA 3ZKAA 5AVWA 1N7IA 3A6KA 2WHYA 2QLFA 1RXWA 1ENOA 3O4HA 1K7SN 2TS1A 2MSCB 2PJZA 3LHFA 1E62A 3PQEA 4HSGA 4IINA 4KQEA 2WWFA 1DRWA 3L07A 3SBDA 5ITSA 4CV2A 3TI7A 2ZSAA 5AXAA 1PT9A 1T29A 5FA5A 4IDQA 1Q6ZA 4DRXB 4DLVA 3D6JA 5C32A 4X94A 4TOIA 1TMYA 3CMCO 3LKBA 3DAGA 2Q50A 1AE1A 1JEDA 4U5QA 3LRXA 5IJ9B 1U2RA 2DUMA 1B8OA 2P4SA 1QMGA 2BGTA 2I87A 2I71A 3JATA 4H1VA 1TI7A 4NABA 1XUOA 4RA6A 4BN5A 4NXMB 2C4VA 4TXJA 3N2LA 3R7SA 4TROA 2FRVA 2VSXA 3CO5A 3BSSA 2Z2KA 4QTTB 4UC0A 4CF7A 3HVUA 2ZCJA 4J0HA 1I3MA 3SR0A 5JMOA 2NZUG 3B6ZA 5GONB 1HYBA 2LV8A 4WKPA 3F9IA 2JLWA 1OWPA 2P5YA 4FN4A 2EJBA 2FRDC 1G8PA 2R1UA 3S4YA 1YBAA 3UXEA 1S8OA 3K20A 1OAOA 4R81A 1QSGA 4H16A 4K6FA 1B3RA 5AVSA 1XZAA 4JBXA 3W2FA 5J3JA 2H1IA 3A6FA 4BBZA 2IXAA 4N41A 1Y7HA 3G89A 3HCAA 1SRQA 1ZOLA 1MJHA 1RAEA 1SD2A 1RWBA 1WXEA 2CXQA 1NVGA 3NDRA 4I08A 4OHBA 1E1NA 2I2DA 3RSLA 2PPLA 1E3JA 2UUOA 2WJAA 1L4MA 1DEKA 1CY1A 4JCOA 4RFVA 4RJLA 4XSGA 4ZOBA 3RVPA 5F7XA 2X3UA 1HDEA 1FTNA 2REQA 4RABA 3AF6A 3JQFA 2AZTA 2WW8A 4NDAA 5CA1B 2MYPA 3B9PA 4IFEA 1IOZA 2CD9A 3R09A 4CE6A 5B3LA 4JC5A 2WYHA 2PZLA 4B3SB 1COWA 4PG7A 4C6TB 2LPMA 3PYLA 4LXHA 3CZPA 4L1KA 4Q4LA 3W6PA 4G0UA 4BNXA 3D6UA 4UVDA 3PTLA 1N4AA 4BX3A 1M1ZA 2JBHA 3WSWA 3FPAA 1LBTA 2I7CA 1Z2NX 3JVIA 2O7QA 3UOWA 3A36A 2YYAA 4UNSA 1OT3A 3TDKA 2CT8A 2Y6UA 4IHKA 4RADA 2C5HA 3RU2A 3SC6A 4F93B 2C7VA 2V6JA 3DEIA 1MTOA 3UJPA 4XDYA 1YJQA 5TPZA 1UBOS 2VYVD 5AJZA 3GAZA 5C9ZA 3T54A 1QDEA 3E7DA 2CHUA 2I1WA 4AFNA 3RYHB 1MC4A 3GZTB 4YALA 4EGFA 2BFWA 2FMIA 4HFNA 1HRDA 3TQFA 5HJ7A 1HG0A 1IUOA 3P26A 2J3JA 3L1UA 3X1ZA 3IEXA 1JSXA 3JCZA 1WL8A 1W35A 1CUZA 3NONA 3USES 2RHJA 4OY3A 3WLQA 4AS1A 2JLYA 3FDZB 3FHCB 4ZAVA 5LA6B 3ZU2A 1NKTA 4ES6A 3CISA 3OD1A 2PGDA 1GDDA 4CIDA 4ESVA 4TT3A 3G82C 1GHTA 1N3YA 1U9YA 2WA2A 4GKVA 4DMMA 2RI1A 1ACLA 2VT7A 5KYXA 3IURA 3LHDA 3AZQA 3M3PA 3Q5GA 2GBIA 3QTBA 3V9AA 4B6EA 5BQ3A 4LRTB 1FFGA 3QXCA 2J3QA 1PNQA 1Z8HA 1KETA 1U8YA 3HN7A 4RHCA 3WGNA 4IHJF 3ZWMA 3GARA 2PGNA 1N36B 2FOLA 1YRYE 4OMUA 3IHKA 4PEVA 1MOQA 3ACCA 1JHRA 1EH5A 4TTJA 2CV0A 4LJ7A 3D6MA 4J4BA 3OKFA 4AIIA 5ALJA 1HRKA 3BXPA 4JC0A 2O8DA 3M1IA 2BHRA 3Q40A 3R6WA 3EVNA 2I2BA 2I0FA 2C82A 2I33A 2OLKA 4M53A 3L43A 4RANA 1EUYA 1YO6A 3BF8A 1RYFA 2CXNA 2TECE 2QI9F 4DAEA 3P32A 5A4JA 2B9EA 2C4UA 1AMNA 3ZLVA 4LXIA 1DS6A 4BFLA 3GG9A 4QDKA 3MMSA 5DP1A 1ZZEA 2IS2A 3MK31 3VSAA 3ANTA 3RREA 2NGRA 4ND1A 5E2IA 4Y2QA 1W6UA 2WMDA 2HRDA 3L1KA 1ADGA 1A2OA 1TPZA 1Q3KA 1SCNE 3P4YA 4ZK2A 5MGNA 1SK9A 4UHDA 3H2GA 4RK7A 3UJAA 1W4BA 2B78A 4ZAZA 4HH3C 1AUOA 2X4IA 3GGCA 3K6JA 4KH0A 3Q98A 4XRGA 4NK5A 3TLEA 5TY0A 3KVNA 2ZIXA 4E46A 4B6SA 4LGYA 3Q85A 2G06A 3ZHBA 2EZ4A 2BMFA 5ALMA 3TEMA 3W7VA 4F85A 4XIIA 3NAZA 2XT0A 2NNWB 2VJYA 4P1ZA 5GGXA 5IDVA 3V4LA 5HSGA 5C52B 1QU2A 4DDTA 1E1RD 2Y0DA 3T5BA 3LWZA 1IVSA 4ZRDA 4H17A 5E95A 1GPNA 1T3GA 3AY0A 3DJFA 5EHIA 2W7TA 1G0NA 5ALPA 2ZDHA 3DMDA 3GRAA 4LI3X 3FNRA 1G5HA 1QG0A 3SQNA 5HQTA 3QP9A 4G85A 1QGOA 2P9TA 4I36A 2X0EA 1T1JA 4JJ6A 2OP0A 5C0OE 4QZVA 3UB2A 5KYUA 3EA0A 3RSFA 4E7PA 1R9GA 1JFFA 3LA8A 2R1TB 1F6DA 4CTNA 4YRJA 1ZKMA 2CBXA 1RKQA 3O3OB 1VRWA 2KJQA 4B4WA 3OQ6A 2FLVA 1I9GA 4B45A 3A8TA 2PL5A 2F8LA 4WH0A 4FCCA 4XUGB 5FBQB 2BMAA 3C6BA 3EGCA 1MAWA 1V5IA 1MH1A 3N76A 3I6ZA 4JODA 3VDXA 2D6FA 3OPVA 1QTNA 2AMJA 2QBYB 1J07A 1RSZA 3GGPA 5EQJB 1O9GA 1QU3A 1DXYA 2MSEB 1J9ZA 1K86A 2HRBA 2HMVA 5DZSA 4F2WA 1Y9EA 1G20B 4X65B 1RWMA 3DC2A 5HIJA 1KQFA 4Q82A 4RMNA 1U3DA 4RHUA 1AK2A 4PGAA 5K5EA 3TFWA 1W4CA 4KXYA 1MMFB 3D02A 1BVUA 4R71A 4HN4B 5IH7A 3GFQA 4QYIB 5KNBD 1EGHA 3ESDA 3JQDA 3PEEA 5CLLA 5A3QA 1F4LA 2I66A 4AY2A 1BMTA 3MJHA 4B81A 4DY6A 3MB8A 1ZBDA 2NV6A 4A82A 5HUHA 2Y77A 1EHYA 1GZSA 2XUHA 1XZIA 1N2IA 3TAXA 3QF4B 1QYCA 1Q0RA 4KWTA 3TQRA 1ZCBA 1C1XB 1G19A 3O8QA 1AKYA 1MTZA 5IHPA 2P4QA 2WUVA 2EWWA 3AJRA 3L8DA 3T1HB 4AF8A 1UOOA 1LB1B 4LHVA 3RDPA 3TIIA 4UD6A 3B6MA 1IB6A 1N2EA 1MJGA 2WM3A 3B9BA 4JYPA 2FU5C 1NQOA 2W2PA 1BEUB 3NAGA 1V71A 5IT4A 5IC4A 5LQDA 1G8FA 4MHTA 3X1WA 3PVSA 1DLIA 4Y6GB 1VHDA 3P19A 3ZLUA 1OGIA 1P19A 5B6PA 2QVGA 3A06A 1E1LA 2FRDA 2NU9A 3VO8A 3KAJA 2GS9A 5HFAA 2QDXA 3MTJA 1SC1A 3IUEA 5KYWA 2J3HA 1YU9A 2X9VA 1UDCA 1UXOA 1RM5A 2B1GA 3O2NA 3QA3E 4FFLA 5K3DA 3TTTA 2JJ1D 4TKUA 3S81A 2PQ0A 2IEYA 3WWDA 4QVIA 3T6KA 1RCTE 4PBRA 3DYVA 1G18A 3ACBA 3VR0A 2I9PA 3ZI4A 4G2NA 2IOQA 3U7GA 1HDGO 2UUPA 1YA6A 2QT0A 3JZFA 3QE2A 5EIWA 2P9GA 3I1FA 1V3VA 2B5WA 2HMSA 4OI4A 1FJXA 1CDEA 1N0IA 3BMCB 3MINA 4OI2A 3W5CA 5THXA 3T1YB 2YDYA 2TMYA 1I4DD 1ZGJA 1SUAA 5E1OA 4HLUC 2OA0A 3ZE1B 3ER8A 4GF5A 4OJYA 3I2FA 4PRZA 5EZYA 1KI9A 2DYKA 3GX1A 4OHVA 2IV2X 2O2XA 3BB4A 4M7RA 1A9PA 1CUSA 2H11A 5F1KA 5BN1A 3PXXA 4QELA 1KE2A 4HNUA 2ZULA 3EG9A 1J21A 4GVXA 4E11A 1OMOA 5KEIA 3DCIA 2YN2A 2H1VA 4RM2A 1QFMA 5A02A 4G1BA 1N2ZA 3IVCA 4A5SA 1BX3A 2VYCA 1WCYA 4FT4A 3C8ZA 3DDWA 2H6EA 2IOFK 3GBVA 3QENA 2WKSA 3LVFO 3O91A 4BXOA 5KYVA 4YAGA 4G89A 4UNQA 5JWOA 4A03A 1VHWA 1JEJA 1R9NA 1AUVA 1YI1A 4F9EA 2AK3A 1SVIA 3EK2A 4LJ4A 1UP6A 2OHVA 4KN9S 4GWKA 4NCNA 1NF8A 5KX5F 4MV5A 4P8RA 5A5EA 1NLFA 2AWOA 3GNSA 4Z7JA 1EK6A 2JI8A 1V2GA 2O48X 1M7HA 3L40A 3K6SA 4BVLA 2JNWA 2O8NA 3A04A 4I5EA 3KSMA 3NHJA 4RIIA 4WY8A 2DB3A 4AP6A 3R75A 3I42A 5THQA 5HFJA 8ADHA 5KSWB 4TV8B 2C0QA 3ZWYA 1EJBA 3JYPA 1R0ZA 4XPZA 5IWAB 4U8HA 2AZDA 3OCYA 4YFYA 4LMBA 3SJBA 3GW8A 3QHAA 4D3XA 1IZ7A 5H9WA 1NBAA 3ECSA 2LKDA 3I9NA 3QYAA 2H0RA 2V8OA 3H7IA 3EOBI 4CMIA 3H83A 4CDRA 1WXDA 1B43A 1CHNA 3I62A 1ST3A 4EEKA 2WU0A 1VHTA 4H7HA 5FTNA 2PAFA 1X15A 5ENDA 3KBBA 3OX1A 4IZIA 2WZDA 1EFPA 1EFRD 3CVOA 3MG9A 5LZ5A 4EF5A 2UYCA 1WDTA 3A26A 3EJ6A 3GFFA 3QE3A 2P9CA 3ROXA 4X71A 5AKLA 1RNLA 1JLLA 5TEVA 5IG2A 2WP8J 3VKGA 3FOBA 3EXG1 5FPPA 3ZCQA 3V7NA 2JJQA 2HQOA 3D2BA 1U0TA 2PX4A 4H6XA 1HYHA 3JV7A 1GN8A 1ZNWA 1H6AA 3CZMA 4BE4A 2RCNA 2H2HA 1UBTS 1T8YA 2G1JA 5ES3A 1U63A 1ECJA 2EJTA 5REQB 1PCXA 2VH2A 4MX8A 4C0SA 2AJCA 3L01A 1R7RA 2HHJA 3C5VA 3GEHA 4HZIA 1X3SA 2FWNA 1CUFA 2VF5X 2XR1A 4N7JA 5JJ5A 2XY4A 1E9RA 3QU9A 1J2EA 1MXFA 3TUJC 3EVCA 1QIMA 5CIYA 5TDHA 4OGKA 2Z2XA 2DPMA 4NAVA 2H4XA 1S4MA 2VXBA 4QGBA 1H9CA 4B6PA 2VHUA 2HNAA 1CQIA 1MO2A 4K3UA 1OPRA 4M9QA 3D6AA 1PJZA 1ZNZA 1DG9A 2YWXA 1XPOA 1KEVA 5JNLA 4JXJA 5DX1A 3W9YA 3C45A 3FIJA 1NI3A 4ZI3A 2YY6A 2JLQA 3B5EA 3E5RA 3VZBA 2QL6A 4DB2A 4G5SA 4DA7A 4DYVA 3EXEA 4XQEA 13PKA 1WD5A 3IBFA 1FDTA 2R25B 1NE2A 3EYAA 4G01B 5CT4A 4CKCA 3UMJA 4DLXA 4ZVNA 2HQRA 4ITRC 5F9HA 5SZHB 4MW0A 4MHOA 4BLQA 3ENZA 4JQCA 2XNDA 4D74A 4BVHA 2JVJA 3D0OA 2HL6A 1YC5A 1P8AA 4HT3B 1E6UA 1F2UA 1VG9B 2D0IA 5JHHB 1ZICA 3L0SA 2ADOA 5C7OO 4G6ZA 3ENWA 3E4CA 4H27A 1TU0A 1MD9A 1NX6A 1Q84A 3OHSX 4Z7QB 4KFRA 3O4FA 3AIIA 4RF5A 4LJ5A 1HH4A 1DAKA 4KPEC 1ADYA 1X39A 3WC4A 1FUIA 1Y7TA 1D1QA 5EESA 4RQBA 1MDBA 3BXHA 4R01A 2OECA 3HBLA 3M7IA 3TSOA 4QKQA 3WLAA 4XJTA 3CLHA 2AC7A 1E3WB 3RLFA 2FK7A 3WK9A 4DGSA 5LLTA 3ZCRA 4YQEA 4IZOA 1XFDA 4I8XA 4R1QA 5L6LB 4K81B 4HO1X 2E7ZA 3HVIA 4QT4A 3Q8LA 3A1TA 3LGSA 4OIFA 1R6DA 3G88A 3AB7A 1YB4A 2J5XA 5AWFC 3LP6A 3C85A 5AOCA 3JZAA 3TZEA 4KPFC 3BFKA 1D07A 4NECA 2NXEA 5G41A 4D92A 2HPVA 3L7YA 1GGNA 2FYTA 2V03A 3GRZA 3AOGA 1N5KA 2Z5FA 1XHFA 4R6XA 1PL7A 3A7EA 3WISA 1UJ5A 1IEXA 3DTTA 1Y4ZA 1PT5A 3E2PA 2AG5A 4H3HB 3UG6A 2YCLA 3V80A 3U44B 4HX2A 2EFDB 4M9SA 1PSZA 4MUYA 4GKJB 2H92A 2E6KA 5ILOA 2GD2A 4UATA 3I45A 1MX3A 3A9TA 4KXLA 4O4HF 5JATA 3AU8A 4KE7A 3BB1A 2R6GA 3FWPA 2C1ZA 2VJBA 3M5WA 1K7FB 1Y6QA 1MW9X 4AM8A 2Q9BA 4ERXA 2Q8PA 2P8JA 4WN9A 5G0SA 1Y6ZA 4D3DA 1WXQA 5F51A 1TZCA 2HA7A 4FQ8A 4HRVA 1R0CA 1AQYA 3JYOA 4J0FA 4LZWA 4F7DA 3MQ4A 4KTVE 2NU8A 1N2GA 4F8EA 1O77A 1F0KA 4LE2A 2DBVO 2CHQA 5JXGA 4TSFD 1CF9A 3EPLA 1OX6A 3FUTA 2CJWA 2WWIA 1XJWA 2P5UA 2GPSA 3GROA 5CMLA 3H1GA 4TQ9A 1BCRB 4M8LA 4RFSA 1TLTA 3EGXA 5LMNB 4G9EA 4K40A 1NNEA 3FVWA 2RI0A 2ZRKA 3MCAA 2FW8A 1ULSA 1JG2A 2BELA 3L7NA 4HATA 3CS3A 2BGLA 5MF6A 4JY7A 3SYMA 3ZE7A 2H9AA 4CUZA 3AUKA 3PNLA 1AGYA 3GVIA 4TTSA 4TM8A 1H2RS 3B13B 4K9LA 3TE6A 4L08A 2DETA 2C3MA 1GG9A 5ICGA 4EQ6B 1W5AA 4IEIA 4EA7A 4GM1A 2DE0X 3IUMA 5TT1A 2Y92A 5IJ9A 3SJCA 1JAIA 1YR7A 1OGYA 2ZTSA 2Q07A 3ZQ4A 2VK1A 4HLUA 3T1OA 1W5BA 2WKRA 2CXTA 3FYHA 2VRCA 4JBGA 4L15A 1OBCA 3VPFA 2IC5A 3HYRA 4UM9D 1KK1A 3FWZA 3NFRA 2GM9A 3HJUA 4W9NC 4H1WA 4HPJB 3INNA 3JQ8B 4OH7A 2LUOA 5DHPA 5BYBA 5GONA 1L5OA 2GXSA 2ISSD 5AW9A 2ZM6B 3I01A 3CZ4A 1XLUA 4AG3A 1PG5A 1QAMA 3LF2A 3CJQA 3A0UA 4HWKA 4HNQA 3AJEA 1Q50A 3VYUB 2ZSDA 2JIDA 3VMFA 1FRQA 2QRZA 4I1RA 1MP0A 1SQ6A 2WNSA 3BSWA 3DAPA 5WRFA 5EE0A 2BJVA 4Q1CA 2OGUA 3E15A 4INOA 1Z