2ZRQA

Crystal structure of s324a-subtilisin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
b'QPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
molecule tags Hydrolase
source organism Pyrococcus kodakaraensis
publication title Crystal structure of Tk-subtilisin folded without propeptide: requirement of propeptide for acceleration of folding
pubmed doi rcsb
total genus 114
structure length 318
sequence length 318
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2zrqA00
1EGQA 1SCBA 1S2NA 1Y4DE 5K7SA 2PYZA 4M1ZA 1C9JA 1KDVA 2XTJA 3DYBA 4J94A 3UNXA 2SBTA 1GA4A 2W2OA 1ST3A 2Z2XA 3GCWA 1ZVJA 3LPCA 5AMXA 4WOBA 3SICE 1SBCA 1TM4E 3DVRX 1MPTA 1GTG1 2XRMA 2E1PA 4C3UA 2Z57A 1KDYA 3VYVA 1GCIA 1CNMA 2QTWB 3GT4A 4KB5A 2W2QA 3DWEX 4DJ5X 3EE6A 1WVMA 2Z2ZA 2P4EA 3AJ9A 1HT3A 1NDUA 1OYOA 4OMCA 3BX1A 3WIVA 4YN3A 2DQKA 1T1IA 1Q5PA 1C9NA 1XF1A 4H6VA 1WMEA 3DE1X 2ID4A 4FONA 5ARBA 5FBZA 1AQNA 4K8RB 1AVTA 1Y3FE 2PKCA 2WUVA 1TM5E 1OT5A 3AJ8A 3H42B 1IAVA 1TM3E 1GT91 1BH6A 2PWBA 3LXUX 1NDQA 3QFHA 3VV2A 3QMPA 3D9QX 2Z30A 1YJAA 1GTL1 2PQ2A 2V8BA 1Y1KE 1R6VA 3DE7X 3EDYA 3VSBA 2ST1A 5JXHA 5B1DA 1PFGA 1TMGE 1GTJ1 1Y3DE 1TO1E 2W2PA 3Q5GA 4HVLA 1SBTA 2DP4E 2X8JB 4NE9A 4CFZA 1T1EA 3GT3A 1BJRE 1SCJA 2ZWPA 2Z2YA 3HJRA 3I37X 3PTLA 3DW3X 2SNIE 2X8JA 1UBNA 2ZWOA 4I0WB 5FFNA 1SPBS 1TM7E 2IXTA 2TECE 1Y34E 4CG0A 4KG7A 1P7VA 1R0RE 1GNVA 4NMXB 5FAXA 1Y33E 1PJ8A 2SECE 2IY9A 1GNSA 3DVQX 4B5LA 3WHIA 3TECE 3A3PA 1BFUA 1GA1A 1T1GA 2HD4A 3BPSA 3T41A 1GA6A 1IC6A 1AV7A 3AFGA 1KE2A 3Q40A 1BFKA 4C3VA 1S01A 4H6XA 1C3LA 1V5IA 4DZTA 1VSBA 3DE3X 1C9MA 2WWTA 1WMDA 3VV3A 3QTLA 1SIOA 2PWAA 3LPAA 3TI7A 1SCDA 5ARCA 2GKOA 4H6WA 1SIBE 3F7OA 4Z2AA 2W2NA 1SBNE 3DE5X 3ZXXA 1KE1A 3DE4X 5JMOA 2PRKA 1AU9A 4GI3A 3BGOS 3VHQA 2WUWE 4HX2A 3P5BA 2WV7A 1Y48E 3CNQS 3I34X 5I9SA 2Z56A 1Y3BE 3ZXYA 4AKSA 4ZOQI 3TI9A 2ID8A 1OYVA 3A3NA 1AH2A 3D43A 2DUJA 1SUDA 4NE7A 5AVJA 1SUEA 1SBHA 4BWGA 5ARDA 3F49S 1SIUA 3WIUA 1SCNE 2SICE 1SUBA 1TO2E 3VTAA 2PMWB 1AF4A 1SUPA 1V6CA 1TM1E 1ST2A 1TECE 1WMFA 5JXJA 1SN7A 1DBIA 1SCAA 3DE0X 4JP8A 1PTKA 5AQEA 1P7WA 3L1KA 4DWWA 1JEAA 1EA7A 1SUCA 1PEKE 3I2YX 1SVNA 1THMA 3CO0S 4LVOA 2B6NA 4RYDA 4OMDA 3SQOA 1NLUA 1YJBA 3DVSX 3DW1X 3EIFA 1Y4AE 3A3OA 1BE8A 2W2MA 1LW6E 1MEEA 1BE6A 1P8JA 1YJCA 2G4VA 3OSZA 1AK9A 1R64A 1SBIA 1Y3CE 5SICE 3LPDA 1CSEE 2ZRQA 1KDZA 5JXIA 2Z58A 4KPGA 1SELA 3GCXA 4LVNA 5B1EA 2HPZA 4CFYA 5CW1A 4MZDA 4WOCA 1TK2A 1WSDA 4AKTA 1Y9ZA 3I30X 3PRKE 3DE6X 3DE2X 4OV6B 3F7MA 1YU6A 1S02A 1A2QA 3DDZX 3WQBA 5JXGA 1DUIA 1SH7A 1ZVKA 1SUAA 5AVKA 4ZARA
chains in the Genus database with same CATH superfamily
1W7AA 1PP4A 2RKBA 1Y6QA 2RG7A 3AMVA 4IG4A 2R6DA 5AK5A 3WJAA 2MSLA 1QTIA 5TQ0A 4MUYA 3UT5A 4MYCA 3A37A 2JFHA 2WT9A 4RD1A 3NATA 5TPZD 1ZHOA 3VO8A 4J0EA 3UJNA 3DLBA 4KWTA 2BMAA 4FYWA 1RJDA 3D6NB 3NTLA 1KMHA 2IHTA 4Q93A 3NT2A 5CT8A 2DBZA 1YS1X 4XD7D 1JN0A 4JYMA 4AO6A 4ILEA 1HI9A 1NDUA 1NV9A 4PBTA 4TMZA 4LC0A 4X1IA 3CUSA 3WYDA 5L3SB 1W48A 5FPTA 2DWPA 4YONB 1NI4A 4YT4A 3G17A 4BJ3A 2Q27A 1P8AA 3DV0B 1JEDA 3AJ8A 3NBKA 4PCLA 3OM8A 3QJGA 3QHQA 3PRYA 1IAVA 2Q28A 4GZLA 1NXTA 5AI9A 1PGPA 3EEOA 1HG1A 2BKVA 1PG5A 4K0KB 2P69A 1IHXA 1OJLA 2BGKA 4Q1DA 2R6R1 3HVRA 1T9GS 1QOPB 1IXSB 1NXVA 3ADBA 1VCMA 2RHJA 1JDVA 1VIDA 3CURA 4IAOA 4OM7A 1EESA 2GKSA 2Y0CA 2ZREA 2Y67A 3CX4A 3EARA 5HF5A 3ZGYA 1QWOA 5ICGA 1ADCA 3PVSA 4WCFC 4TMFA 2WSYB 5IEJA 5IK2A 5JC1A 1ARZA 4CLRB 4P5PA 3LW7A 5KTPA 1YZQA 4ZQCB 3W8NA 1AV7A 4RV5A 4OREX 3SE7A 2H65A 2Y66A 3PFFA 4Z53A 3IT3A 4NBUA 1RXYA 1V5IA 2DWUA 2FZVA 2ZULA 3E6AA 4BQFA 5AJUA 1U0BB 1KEUA 1UK6A 2YFHA 2ZUWA 3MIZA 4LC9A 3AF6A 2UUAB 4G1EB 1JS1X 1JR2A 2QGFA 2WM9B 2YC4C 1DELA 1LBTA 1XD9A 2C8KA 2PZJA 3EXHC 3QH4A 4CM6A 4XXHA 5JYEA 2Z8YM 4ISBA 4OYRA 2W2NA 3TSCA 1RYZA 3SIRA 4UM5A 4YCNA 4V0KA 4GT1A 4C4TA 2QYOA 1TYCA 1I3KA 3OKFA 4N4AA 4LXXA 1OWOA 4C4OA 3BIOA 2V7GA 2WUEA 1Y48E 1X77A 4NP6A 4OSOA 4DUZB 2IF0A 4HB2A 1UMCB 3H19A 3VR5D 3OQNA 2IL1A 2VC2B 3JPWA 1IMOA 5ECDA 3EJ6A 3H3XA 4O5OA 3DT6A 1W73A 3MGGA 4LJ5A 1GU7A 4TMVA 2G1KA 1RHKA 1IB0A 4HQKA 5GZ1A 4PQEA 3JPYA 2JLWA 4G24A 1T26A 4E5VA 1P19A 1E18A 3ONFA 5E4JA 5E9QA 4U7HA 3FDZB 1W4ZA 4LSGA 3CZ5A 2YICA 1GTMA 3HHPA 1J7KA 3D6AA 1ZK2A 2G1AA 2IYEA 2HJSA 4BBPA 2Y2UA 4N1AA 2W6JD 4YIKA 4YC7A 1KSGA 1ZJJA 1N2JA 2GSDA 4EJ0A 5DX1A 3HS3A 2Y1DA 4UATA 3K9CA 4YACA 5F76A 2GF9A 4RJJA 2Y68A 4LHZA 5CYGA 2X9VA 2WUGA 1DQPA 4FFWA 5BSVA 1WHSA 3TSAA 3AVOA 4EYGA 3KOUA 4G97A 3UJBA 2R48A 4XVHA 1J2YA 5ALKA 1Y9ZA 1W6RA 2EARA 3L7IA 3T38A 2ACWA 4AMGA 5BUSA 1S4QA 3ZUGA 2LIPA 3EGWA 3T1VA 5C80A 2H2HA 2Z8YA 5JDCA 3E48A 1GLGA 4PE5B 1A4XA 2WNHA 1QE0A 2XNKA 5THXA 3ROPA 3U9LA 2AT1A 2NLOA 3URKA 2YWRA 4C1NA 4J2HA 1BDMA 2ORIA 2XA1A 4XD7A 5TC4A 5TVKA 3TOSA 5B36A 2DT8A 5CDSA 3P0HA 1ZN2A 1R3UA 3QEJA 5DLDA 4TWJA 3WLQA 2HV9A 3CUWA 3GFRA 3P2JA 5KOJB 2PHZA 3CN9A 3EXEB 4HRAA 4D9MA 4DYHA 1EFHA 2BHSA 1VQ1A 2Q5IA 4MQLA 3STTA 4W7IA 2H7CA 4WQMA 3R8XA 3AJ9A 4AN0A 1K4KA 3GFGA 4OMCA 1XVIA 2ZVJA 4KFUA 2QDKA 4MVJP 2A3NA 4LQLA 4MICA 3W5UA 3ZHQA 5A2GA 5A4AA 1LNSA 5EHGA 5ARBA 2GJSA 3VMMA 1Q3HA 4DA6A 1I2MA 1OD6A 2IT1A 4JOQA 2GBCA 1B43A 4KR9A 3B2QA 3PQ2A 3O4FA 4N5LA 3NCHA 4QXMA 1GU0A 2EGUA 4A16A 3QMVA 4F72A 3GRZA 5FOQA 5DIZA 4IDHA 1TVKB 4H59A 1U63A 3GJ7A 3AHIA 3D1LA 2QSZA 1I30A 3Q15C 2J9YB 3ZWBA 3KQPA 2UZIR 4NBNA 3ROKA 4RJ2A 4ZYVA 3PXDA 4WESA 5DWDA 1QP7A 3ULKA 3RIXA 2B5VA 3U9SA 5JG7A 4C14A 4C4AA 3DVAB 5TJ9A 4X1KA 2IPXA 1CK4A 1SAYA 1K8XB 1ZDMA 2J0UA 5BWMA 4OVKA 1Q83A 3F8SA 1HZZA 4Q24A 1M7HA 2Q8QA 4DDHA 1T9GR 1QGOA 2X2FA 3EGDA 3H1BA 5BQFA 3P2IA 1MN6A 3WL4A 3M6VA 4RTKA 5IX8A 4ZCSA 2CF6A 4V38A 5C31A 4IR7A 1ISSA 2G3YA 2FJ0A 4FINA 1WXDA 1L5KA 3WQSB 1VYHA 3X2FA 3ZVRA 4B79A 4UTPA 1AMNA 3TQQA 2EL7A 2H29A 2WVJA 4TSKA 3SXUA 1BCSB 5I4CA 1E9CA 1NT4A 1NR5A 2DETA 1DAGA 3BSWA 3V1YA 3EMKA 3SHVA 1CY6A 3W2EA 2D1QA 2DY0A 3OESA 4BHTA 3Q11A 2B92A 3FTDA 3HSYA 4R16A 1PKEA 1D2EA 1TO2E 3LUAA 2AOWA 3TCNA 3NJ8A 4B75A 1GPJA 1GQSA 3N3AC 3KL2A 4R8VA 2WD7B 2I91A 4DLSA 3R3VA 4DFDA 1T3SA 1M76A 5D7BA 4NFLA 4XRRA 4BPBA 4P33A 3Q5DA 1UOPA 4L9SA 2JJ1D 4A0HA 2EKQA 2PJZA 5I51A 1FUYB 1NF3A 1Z45A 1NVVQ 1Z0DA 3FW1A 3OQVA 4RDHA 4V2UA 5E1DA 2WZCA 1KAMA 2PT7A 4CKYA 2NVWA 1JG6A 2AXEA 3GLHA 3PGVA 1G8GA 4XYGA 4XM2A 4Y6QA 5EP3A 1IBSA 2YFKA 3R5HA 4ND1A 2ZSFA 3GJTA 3U0BA 3FPHA 2X76A 3BD7A 1GUZA 3KT8A 4J8PA 4OD0A 4QTTB 1ZI8A 3OLWA 4I55A 4QBTA 1VYTA 2Q8PA 2ODNA 1X7YA 3LUCA 3A9TA 4PRKA 5KOYA 4IDBA 9GPBA 4ARBA 3Q3VA 1I51A 5EJMA 1PS8A 1S3IA 5JVDB 4EJFA 4DG5A 2OHHA 4YWHA 1EDZA 4FP9A 5A7GA 2AZXA 3VDQA 1CJBA 2VYVA 1TT5A 2NZYA 5T8KC 4PHFA 1AZTA 3TM4A 4H1VA 5CDGA 1DGQA 4E09A 3BGIA 2FRDC 3KB1A 2BONA 5L95A 3PXGA 3KZVA 2BELA 3CLSC 1ND5A 1IULA 4QARA 3L4EA 1XB2A 4OL0A 5BYJA 1A71A 3D54D 2YNMD 3WMRA 4P4NA 2D6FA 5K0LA 4YCAA 2DERA 1UZLA 3HDGA 3LQ4A 3RAEC 5TDHA 3A7EA 1KI7A 2MR6A 4PQRA 4G1FA 1QIDA 4LBVA 2AN1A 2AYXA 2G82A 5EVCA 3GFOA 3AIMA 3OA0A 2EYQA 1VCNA 1T1RA 5HYVA 1SBTA 2RAVA 4QXAA 4DZRA 5HQ3A 5NLLA 3V4LA 2XRFA 3QFRA 3WV4A 2NU8A 1HKUA 1FNMA 1PNQA 4LS3A 2G5TA 5DTIA 1RQRA 1P5HA 3ZTTA 3GZNB 5CCEA 2JLXA 4AS1A 1DCMA 3TAHA 3ORSA 3TSYA 2CVOA 1LRJA 3JRNA 3B5IA 3FF1A 3PR3A 4ZOLF 3ZWMA 1NSTA 1M1YE 1ZH4A 3SZRA 3EUWA 1Y7IA 3B9RA 1JMKC 2B98A 4MRAA 1Z5VA 2XGSA 2AV6A 4FKMA 2QVYX 1ZY2A 3F5DA 3BRCA 3CSDA 1LVUA 4RVUA 4LXYA 1PYGA 1XRPA 5JY1A 3ANXA 4FXOA 1X7YB 2VJBA 5B7QA 3EA0A 1U7WA 3FAZA 2HBZA 2XCIA 3P4XA 4L4XA 4N0EA 4RANA 1AB6A 3QYFA 4D42A 2HRQA 3RAPR 1Z4KA 2B9EA 3PLAE 3E3NA 4BKUA 4LA4A 2Q6TA 5JCOC 1JIXA 2JFVA 3RBXA 2A2ZA 3ORQA 4QULA 2OCKA 5J5CA 1FTGA 4LFAB 4AKHA 3ZXSA 3UMGA 1I32A 4BVKA 4BFTA 5FHRA 3L5OA 2CXSA 2W48A 2HMAA 4E46A 1WUTA 1AGYA 1EM8A 3VRHA 1I3LA 3RIGA 4BZQA 5LOVA 2WJPA 1IZ9A 3RQIA 1JIIA 2AQ8A 2P2LA 3MWLA 7AT1A 4S12A 4JLBA 2ZJ1A 3EWNA 1XCMA 3AEUA 3FUWA 4E5DA 1I94B 5IBQA 1NLMA 3IPCA 3ML1A 4WUTA 1HDIA 3JX9A 2YC2C 4ETMA 4NMMA 3VYUB 2NPIA 1XZPA 4GQIA 4YK7A 1KY3A 5GADl 3ONWA 1MEEA 1QH8B 5EJIA 1MC8A 5AKHA 4D57A 2WKRA 2ZDGA 3U7EB 4O63O 4QOEA 5KINB 2H2FA 1KU0A 3BDIA 1IQ0A 1EZ4A 1NC1A 2C4UA 3H6HA 5F33A 3NQ41 3T4PA 5CU7A 4D79A 1E5XA 1JVSA 1JT2A 1N77A 2BFAA 1HDOA 4L9RA 4LOLA 5KIAA 5CM8B 4DC1A 3AP3A 4NZYA 2VP5A 1KYZA 3QW2A 3WHLA 2DJIA 1FBTA 1OLSA 1ZC3A 3WDMA 5LNK6 1D9XA 1C3VA 1WRBA 2ZFUA 3KYJB 1SVWA 4FMCF 3EG9B 3WQRA 4W63A 1Q1QA 1HOXA 1H9CA 1E0AA 5H02A 5KYVA 5EGNA 3NETA 1MENA 1FP2A 1JPJA 4R41A 3RT9A 2NSJA 1QH8A 2P9BA 3PC8C 5FEMA 2OXTA 1ABEA 2ZWMA 4W7HA 5I6DA 1DMSA 5M2QA 5FWDA 2BD0A 1DXYA 3Q3JB 4WXRA 4DCPA 1SRQA 2FPLA 3PHIA 4QSMA 2VJMA 4Z4FA 4HL6A 4HXYA 1L3IA 2G8NA 1X42A 1JJBA 1NYQA 2MT9A 4KB5A 4ZXFA 3UKJA 5K20A 4GM0A 1XEXB 3EDQA 3GPCA 3GQBA 4JLVA 2HUPA 5E6UA 4OHXA 5JHHB 1W36B 4XPIB 4B3RB 1DAFA 2X86A 1YHZA 4MS3A 3UY4A 2DQKA 3DHNA 3AV0B 3VR3A 5JNTA 4PS1A 1PWEA 1YI8A 2ID4A 3DZGA 1PL8A 1QV9A 5HCNA 3HU1A 4O8ZA 2ZIZA 3R3XA 5D00A 2BC9A 1UOEA 1Q7GA 1MJGA 1RZ3A 5J4HA 3LLCA 1IOVA 2PFKA 2ZBRA 3ONDA 1B3RA 4TWAA 3MJVA 4AM8A 2Z5GA 3SK0A 3CKMA 3N86A 2X4LA 4OLJA 4PVDA 4EVQA 3ZD9A 4DIKA 4YP5A 4BO2A 2VP9A 1Q6YA 1EFUA 1ZYUA 3NT5A 2YUTA 3W9BA 1R0CA 4WOJA 3WB9A 4Q66C 3CVJA 3RAJA 3GA7A 2X13A 1I9CA 4PLPA 5E6SB 4TRJA 2V59A 1MAAA 1S0UA 2OLKA 3PT9A 2Q3LA 1DUSA 2ZBUA 1WEKA 1F2VA 1ZI9A 1P1KA 2BEKA 2NPOA 2O3RA 2ZI9A 4IDNA 4JODA 4MLCA 1KFKB 2OKGA 1ZMBA 2YV1A 1RM4A 3CHYA 4KCGA 4LZOA 2FEPA 2H16A 5IM5A 2G83A 4JLUA 3B1ZA 2J07A 4RDXA 1FJGB 1SCDA 1SR8A 2GK3A 3D81A 4H6WA 4KQKA 3SNHA 3I61A 2DQ4A 1WKCA 3GLKA 2XUFA 4BQSA 1BW9A 5COQA 1VKRA 3FNRA 1K06A 2BE7A 2YYAA 1BYUA 1YUNA 3RF7A 2PD4A 4QUIA 1XCJA 1VBNA 2K7FA 3I9V1 1JFLA 3KYDA 3IILA 3I6ZA 1FFSA 2V5AA 4PRZA 4RSMA 2PUBA 5GPBA 1N9KA 3RYIB 2VXBA 3D6TB 3PHCA 5CVEA 4E08A 3GAZA 5K3BA 5EIBC 1JLRA 2BMJA 5KSWB 1UFOA 1T29A 2EG9A 2BAGA 2E37A 2VA9A 3EEFA 4QDUA 4DC0A 4FSXA 4EMBA 4O4HA 4CJXA 2DPXA 2PMFA 2C97A 2OC9A 5FPYA 3OZFA 1YOVA 3PNSA 4F5EA 1EFVB 1KY5A 1FU8A 2BH9A 4CM4A 3DQZA 3CRMA 4UBOA 3BGVA 6REQA 5SICE 1HFKA 1YZYA 3PB3A 1NJ2A 3OZWA 4EHBA 1BDJA 4Z99A 4BASA 1FY2A 1YV9A 2X19A 2XR1A 5K3FA 1IEVA 1AV6A 1NFFA 4ZHSA 3W3AA 5BN4A 4Z1MA 4KH1A 5ICMA 2PKWA 3EC2A 3P8ZA 4Q82A 1U5AA 3D4PA 5ELMA 5AW5A 1SVKA 5E4TA 3CLUC 3U4GA 2XT6A 2X1LA 1NY6A 3Q9UA 3WLKX 1V16B 2NUTA 4Y9RA 5KJ1A 3PD1A 1ZQ9A 2HM7A 4ER6A 2IY8A 4Z9XA 3JV7A 4Z49A 3K15A 2C3OA 4EHNA 2VJMB 3WKEA 5BN5B 2CB9A 3RYFA 3GH1A 3C7TA 3DULA 3QUCA 1KIFA 1GPUA 4DCCA 4QGSA 5C1BA 2PQ6A 3BVPA 2QG6A 3TLCA 2E49A 1V8ZA 2VS1A 4KVGA 4X41A 5C1DA 2QGNA 3LQ2A 3TW6A 3QKIA 2PVPA 3E3OA 3F1KA 1HUQA 3PVZA 5FUBA 3GGCA 3QEOA 3OHPA 5ALIA 4BNGA 3G1UA 1V9SA 2AUTA 2JNWA 2ZB3A 4CN9A 3DBHB 3DUFA 3FSGA 1F8YA 3IMGA 1JDTA 2OXCA 4ZZ1A 2XBMA 1Z4PX 3KB8A 1XZ8A 4G8BA 4MWZA 5FTKA 2PLWA 3AVUA 5F1PA 5ILGA 5DFAA 1YDMA 1EP3B 2QF7A 1EBBA 2XB4A 5JRJA 3WK9A 1H94A 4I9GA 2E5WA 1UFVA 4YHHB 5FI3A 4YJHA 4CR6A 3H8JA 1LU9A 1VPTA 1U0GA 4Q1CA 4R81A 4WXHA 4MYDA 2D2VA 4WHMA 3T8YA 2ZRKA 3IP9A 5J1TB 2HAEA 1EFTA 4EFDA 4YRTA 2FR8C 1WVGA 3EWAA 5ICCA 3N87A 2DR2A 2VDKB 3JZMA 4REQA 2AKYA 2IELA 3DAYA 4MI3A 5HDBB 4IBOA 5ADWA 1YJXA 3PUKA 1Z75A 3GGGA 1RJ9A 4OUKX 2JF0A 1H8EA 1NQUA 2C7VA 2C8JA 3EC7A 2FP4A 2GAAA 1QIIA 3IOYA 2RD2A 4JZYA 1RHQA 2H4ZA 2HJWA 2O3QA 2R8EA 4X8OA 3JQAB 1XNHA 3OZUA 3OU6A 3W05A 2CSXA 4D98A 2XA2A 1GFWA 2WEKA 3H9BA 1IVYA 4Q6WA 5KWVA 5GJBA 2W6IA 4RK6A 4BMCA 1RAIA 3AZQA 1Q57A 2FG6C 4KNWA 4YCJA 3UHAA 4HB3A 4AJHA 3NGLA 3OC6A 2WFZA 4KWHA 1G18A 2V65A 2GF2A 1XVUA 2Z5VA 1R50A 2R11A 4OQNA 5FNVF 3GLVA 3PVCA 3GJSA 5HE8A 2XCSB 1T2UA 4JJ6A 1OYVA 4R8KA 1V37A 3FZGA 2WG2A 1XRLA 4EZBA 3UJPA 3KQWA 2HLNA 4P3OA 3G0BA 2FGKA 4Q4JB 4WKPA 4IUDS 4C6HA 5LZ2A 4G0YA 4D02A 4FOLA 4IEEA 3N28A 1JEOA 2QTLA 1KGSA 2NXJA 3GPBA 1DJLA 3HXPA 3HB9A 1G19A 4URUR 5DGXA 3DL0A 4BRUA 2J46A 5DLPA 3TW8B 4F84A 2C5EA 4KX3A 5C0OE 1JNYA 2JAPA 2Y1WA 1D2MA 4DCNA 2YTZA 3ROQA 1ZIPA 2P9HA 3CW9A 2W58A 3I53A 3HDTA 1KJJA 1NU8A 1K1EA 5KVSA 2V3WA 2QZPA 5ADVA 5JS8A 2XH8A 1RYNA 1T1JA 1ID8A 1OAAA 4CV1A 4O0LA 1KDZA 2IIVA 5K3SA 3ADKA 1L1QA 4E3ZA 4BVLA 2ODEA 4B3FX 2HPZA 1OILA 4XIIA 4MV8A 5T57A 4F04A 3JASA 4MZDA 1UKCA 1FFBA 2AG0A 2UZ1B 2V96A 2XZPA 5KYUB 4D74A 4MA4A 2BHTA 1FDIA 1YASA 1NSYA 2EZ9A 3S5JA 1BO6A 3CXUA 3T7KA 1V2HE 2V0GA 2IYPA 3WLIA 3LPNA 3GDGA 4NV3A 3LLSA 4S35A 4QEKA 3WTBA 1J0BA 1M2VA 1RHRA 4CKBB 1E9RA 3B6EA 4OP3A 4Y2VA 1ONPA 4C2AA 1YMQA 2PBFA 3LM8A 2LXNA 1ZVJA 1IVNA 2QX6A 3EBPA 3OZIA 4X66B 3L0BA 2ANCA 3NT4A 3CLRD 4EI8A 1I6MA 1MABA 1QUEA 5IANA 4YLGA 2B7LA 4B34A 1PT7A 1W4BA 1UDWA 1AJEA 2O1XA 4MWTA 3JRXA 3NBZC 1YE3A 4I4CA 2CLKB 2XCOA 3AEXA 4KAJA 4WZAE 3SE0A 4H6VA 4OBWA 5HNKA 2OHOA 1EINA 1D0VA 2V7QD 3B38A 3FBWA 3FUCA 4RLQA 3WADA 4D0LB 4BLTA 3VU1A 1E59A 3HL0A 4NE2A 4BO9A 3JALB 2NAFA 4FFRA 4WKNA 3FXAA 2JZCA 3D8RA 3SSAA 5FYDA 1JFVA 1VIYA 3IO3A 1AUPA 2UVPB 1RHUA 3GLHB 2NUAA 3LXRA 1J2RA 1QTNA 3ASZA 3KXPA 2GZRA 4II3A 2HK9A 4IJMA 2XVYA 4WEQA 4I1PA 2WILA 3FA2A 1X80A 3WGKA 3H5LA 2V7XA 4JS0A 1D5WA 1YDFA 2XE7A 1PF7E 4X6YA 4RGVA 5JAQA 1ZSYA 3W7BA 1N5JA 1Z82A 3BSYA 2HTEA 3WIOA 4GH5A 2IYNA 5LP1A 5KSOA 1CB7A 1DC5A 4EJSC 3TECE 1VRWA 5BT8A 2XUHA 1WCV1 1VTKA 2DQZA 3VR6D 1AQYA 2FPGA 1BVHA 1MPXA 3BFXA 1AKMA 4G3XA 4IXTA 4O33A 2W98A 2WE8A 4Z6KA 2II6A 3H18A 3VKWA 4TMKA 4XLLA 2ZQYA 1G0NA 1G42A 4UCFA 3A36A 3ADDA 3FPSA 1MRZA 2PWAA 1NL3A 4LDZA 2FUNB 2X2OA 3TKYA 1Y6FA 1CY0A 1JHAA 1L7XA 3UJ8A 1Q1BA 2IP4A 2XZTA 1P9RA 2R8OA 3OLYA 1N4AA 4BV3A 5LU9A 4II2A 1FCJA 4ZHQF 3T0FA 3LOQA 2FSGA 1QO0D 1TCBA 1KXJA 2BVNA 2QJWA 1O6CA 1UH5A 1T9ZA 3G6KA 3KVNA 1QHXA 4D80A 4P3KA 4PWYA 5F51A 3SHOA 3C8ZA 3JVEA 3RSLA 3JSAA 3ZCUA 1UT8A 3LFHA 4WKOA 2C2HA 5K51A 5BSMA 3K0CA 3W3ZB 5ELXA 4XR4A 3D3WA 3BMQB 2B8EA 2NXCA 1PAUA 3Q1KA 3AU9A 1ZUIA 2NUBA 4QXQA 3L49A 3S2SA 4BFUA 4E07A 2OB1A 3S2GA 5JAZA 3VVMA 1SD2A 4IUCS 5EWJA 1RD4A 2HO5A 1FVOA 2E4UA 2H08A 2PD6A 4Q9IA 5KTKA 1NOKA 3C3KA 2GH1A 2GSWA 5FPQA 3EAGA 1VE7A 4OHYA 2Q4EA 3MOIA 1SXQA 3GX1A 3TXAA 5K8CA 1LSJA 3KKPA 3L6BA 1BDBA 1P2GA 1SUIA 4IV8A 5FORA 4IFIA 2BGGA 3OTOB 3KX2A 4BMVA 3QPDA 5EE5B 1KSJA 2C54A 1UPBA 1QX4A 1UDXA 1PEYA 5T4HA 1WSDA 2RHOA 1RZUA 3CG0A 5BSFA 2OM2A 2F1JA 4LJ8A 4AC9A 3LYLA 5HZGA 4WBSA 1G5RA 4MUXA 3GJ4A 4KPFC 1WTCA 1J6UA 2OWDA 1TMOA 2PZBA 5E7JA 3KQLA 3I9V6 3IQHX 4HCJA 4JA0A 1XZEA 4CG3A 1F8XA 3KBBA 1GQFA 1PEDA 3SLGA 4RAOA 4CDMA 4EARA 1Z5NA 3FHCB 4EHFA 2W2OA 3PEUA 1FTQA 4MUEA 1DZIA 4K7JA 4CQMD 1JJIA 1FFYA 4ZI7A 2X8BA 4QOSA 4MGZR 2X2PA 4ZCIA 2P5TB 4IGEA 1ZGBA 5EPOA 3QPVA 4PG4A 3FB1A 2GNOA 2FSUA 3P9YA 4V0SA 2D1FA 1E62A 2RH4A 2HF8A 4JLOA 2NZ8A 2DR3A 2BFNA 3ABZA 1SWWA 3A9CA 2JLBA 1Y8RB 2NZWA 3IDAA 5HILA 5KWJA 4S1WA 2PXCA 3EC1A 4FGUA 1T8PA 4CM8B 4DR4B 1EVQA 2XKJE 3DH0A 3BH0A 1AKNA 3FBGA 2WUVA 3R7BA 4A1OA 4N03A 4O0MA 4Z8YA 3DP7A 2X7HA 3IKVA 2GD2A 4L8FA 5FTMA 2NUAB 5KMGB 3BJRA 1V11B 3O8DA 2OV1A 1FNSA 4J29A 1Z6QA 2GAFA 1XN4A 3JQCA 4GZ6A 4UMDA 1NC3A 5K3DA 5JAIA 3AIKA 4UXHA 2OXEA 3BGWA 2REOA 2VOJA 1M5TA 2Q1WA 3M81A 3PIIA 3AOEC 4QHTA 1P45A 4ALMA 2N1BA 2XB9A 1AHPA 4R01A 4PZCA 3AFMA 1FVHA 5DTEA 3G6WA 3LWBA 1SBQA 5E2AA 3ROEA 5JS2A 5BWLA 1EUQA 2W93A 3ZDDA 2NP7A 1GNVA 1P0MA 2X7JA 2FPPA 4E2ZA 3LS2A 3N0WA 2MSKA 2RBEA 1Q44A 3PXUA 2Q1XA 2PU5A 2O7QA 1SC9A 1NJFA 4KYUA 2HI0A 1IUNA 1SCQA 5EJ2A 5AUNB 4A0QA 2WJHA 1PJRA 4BNLA 1ZRNA 5A5VA 4DLWA 2J3LA 4N8DA 4HN9A 3O82A 1T8UA 2GBLA 2G40A 1XALA 2WJIA 4BFCA 1ZUNB 1F8FA 1RU3A 2ZKIA 2ZRAA 2ZTLA 3WWPA 2HYIC 2C82A 2BKXA 1G8YA 1XQ9A 3JATB 4S3MA 3RYHB 1T6BY 1JIVA 3WMEA 3WLJA 4UD6A 5AK4A 2A7XA 2AN9A 3OTIA 2GAOA 4I9NA 3L3BA 2BTQA 821PA 1RBMA 4CN8A 4DBLC 2GD1O 4LNHA 2XBLA 3OZDA 4M9RA 2B61A 4OHPA 4AP5A 3A4NA 3KWJA 5HKKD 4ALLA 3RROA 5LM3A 3DL4A 3V9PA 2ZUFA 2ZSJA 2DUUA 2GASA 1UDCA 4N0MA 3EUAA 4BWGA 1G7SA 4UVIA 1N75A 1Z06A 2LCQA 5AW1A 4AJ1A 3RKRA 3BL6A 1AF4A 3M9WA 3EK2A 2ERCA 1YZGA 4WBXC 5FPSA 1C4XA 2FRDA 1SCAA 2VHWA 3MRVA 1JLSA 2WM8A 3L7JA 5B4UA 4TMTA 1DRVA 1AM4D 1M2VB 1ZXLA 4LHXA 3AM5A 3PF9A 3HCAA 4HAUA 1DO8A 5G1OA 3DVSX 1NP7A 2C9DA 3AEYA 3T9AA 1U8ZA 4DZZA 1KH2A 3IEVA 2W2XA 1VGVA 2CLEB 3E7XA 4JKYA 4PRLA 1E3QA 3BCHA 1JAIA 1T5TA 4EENA 4PU0A 5HP4A 1VCHA 3DZBA 5TMEA 3Q2IA 3LHKA 1MX9A 3RHZA 2NU7B 1I3NA 5K6RA 2HSZA 1U8XX 3T5AA 3WP0A 2X8AA 1LVGA 1TZJA 1PR3A 1R7RA 5C46F 2EEPA 4JT8A 4XGQA 4EL0A 4W7SA 3ZE2B 5LLTA 1Q11A 1NHWA 1QSGA 4DM4A 2D1YA 3VH3A 4US0R 3SC6A 2BR3A 4RZQA 1U7TA 2Z2IA 1NZFA 4H15A 1M2WA 2GA9A 3FPJA 2C2WA 3CO5A 2DFLA 5ALVA 1C7ZA 1GGFA 3VDRA 4MUIA 2OTCA 4KBFA 4DIFA 2FTKE 1OH8A 3M1AA 3QBDA 3VNSA 4WN9B 4DHWA 3RK4A 3GNTA 1K66A 2Q1UA 5E38A 3IP5A 4LOJA 4GI7A 3IUMA 4B6SA 1ESZA 3JATA 4PO3X 1QE3A 1NVKA 4BOYA 4QDOA 1YB5A 1JMYA 3UYKA 4MVJE 1X13A 2BTQB 3KEMA 3LIIA 3WRXC 2P4EA 4EMSA 1NWHA 3R5XA 5IM4F 2PJRA 1D2GA 1DC4A 2CNOA 5LMCA 4IVRA 3DFUA 5H68A 4NU8X 5MFPA 4TKUB 2XUQA 4DMGA 4Y6LA 1UXJA 5LA6B 3G5TA 4BMZA 4RABA 1IDOA 3P0FA 1SOVA 3QYAA 4L4SA 4AZTA 2OPBA 3GBVA 5I45A 3HO6A 4Y67A 5IZ4A 4ZD6A 1P18A 2KBFA 1JLLB 2AW5A 4ZT5A 4HZUB 2C57A 3N2NA 1E9EA 5J59A 4YRNA 1Q14A 1XELA 1XEXA 5DLQC 5B53A 3RIYA 1QK5A 4RWZA 3BDVA 2XJ9A 1Y81A 3A1CA 3CUYA 3RFXA 4UHBA 2BZ1A 2GPTA 2OILA 3DBRB 2QDXA 3EISA 3GARA 5ER9A 2BM8A 3IBCA 5CA1A 1DKOA 4J0QA 4HUQA 5JRDS 4BTVA 1CD5A 1TUEA 4CG0A 3NBQA 1N1DA 1P7VA 4NABA 3FNFA 1C30A 4YAOA 1GEEA 4A7PA 4FR5A 3VI4B 2P1RA 3O4VA 5JAPA 2J6IA 3ZDAA 2OE2A 4FMBB 2IDKA 5DKFA 5FPHA 3REGA 4E5MA 2C8VA 1BE0A 3NDPA 4MYRA 3SVZA 2VHCA 5F9MA 4QASA 2C7RA 2JHFA 1JLLA 2BKLA 1MMFB 1TZKA 1GLNA 5BQ5A 3K35A 1VMIA 4YP9A 4DCJA 1N7IA 2CF5A 2J3IA 1Z2CA 3CVXA 1O95A 4JV5B 4FSHA 2WJAA 4ZAXA 1AQ6A 2Q9CA 3R3YA 1KPGA 3DUFB 3HJGA 3O0DA 4P4SA 3VR2D 3VHQA 3UOAB 4EB3A 2FFJA 4EQ6B 5C9ZA 1LDGA 1II0A 4R3NA 4QU0A 1P2UA 4N8SA 2WAMA 2AJCA 3KFXA 2X1MA 4EB0A 4I9UA 1FJ2A 1X1RA 3MT0A 4UW9A 1E1DA 1U04A 2IH5A 5D6NA 1WZIA 3EDMA 1YULA 4JVMA 3TB6A 3L8HA 3BJZA 3L0DA 2C4TA 3KQMA 4XCVA 3H75A 3L77A 4Q1BA 1GAEO 3AEZA 5D1NA 1IBKB 1Q7RA 2F9MA 1JLMA 3DW1X 4IDGA 4CU5A 3P97A 3B70A 3EW9A 1PLLA 3L1UA 4Q7EA 4WUVA 3TZCA 5KNCA 4FFDA 1RJFA 1AK9A 5B4TA 3IKJA 2C2GA 1OH6A 2E4VA 4MQUA 1G64A 3QWAA 3WRYA 1GG5A 4WBNA 3GDFA 1Z8DA 1VG0B 2XGOA 3Q7TA 4RD6A 2FP4B 1FSFA 4RMNA 5FA8A 4B8WA 4DT1B 4CL3A 2NU6B 4NCIA 1IWOA 1L7AA 1KKUA 1D0SA 3B9BA 3P0IA 3PGA1 2GXUA 2H1HA 3S4YA 2PR7A 2PPVA 1MDFA 3MLBA 5LD2C 1Z34A 4O4JF 1RJEA 4V39A 3LX8A 4EG7A 1THGA 1MAVA 2CLSA 3EQ9A 4ZOAA 3ZV4A 2JCXA 4LOHA 1QTQA 2QK4A 4KIUA 1E8DA 4KE6A 3AKZA 1I7NA 3OEHA 1AXEA 3ANTA 4C20A 6PFKA 3F3YA 1RT9A 3A4VA 4J94A 5CLIA 3KQYA 4CMIB 1MQ9A 3CNBA 4B84A 1HQDA 3RJ5A 3I6BA 3OT1A 3NBAA 3AERA 1J2TA 1RYHA 1C8LA 1RRVA 1K86A 1XTIA 3PUHA 3HUFA 1HT3A 3QU7A 2I1WA 4QUBA 1NBWB 3OZEA 3RWMB 2PDAA 3F74A 4O4JB 4Z9BA 3VC7A 5LMNB 1BW9B 3WICA 3HDHA 4FD2A 4UAVA 2X1VA 2BTEA 3HEAA 3GLFE 3U61B 3H7IA 3CX3A 4G2NA 4J16C 4JEHA 3I0NA 1QLHA 4QYTA 5AI5A 1GDDA 5IC5A 4H7EA 1MRSA 3KKKA 5LXTB 4HNHA 3ZDCA 1XK7A 3IV7A 3U80A 1X8KA 1OZ0A 5TY0A 1EE1A 3C97A 4PGFA 2BUBA 2EHDA 4RCYA 4N5HX 2PL1A 1B4DA 3BZBA 1M6VA 4AJPA 1MZPA 3M3PA 4JB8A 4NSNA 5C18A 1WHTB 3OQ6A 3P2EA 4HNQA 2PM8A 1M1YA 2NVBA 4QNMA 2CKDA 1A0OA 1BCRA 1SNYA 3WZLA 4JJGA 1DAIA 3A32A 3D6HA 2A78A 1PZNA 2O4UX 4RZXA 1OFGA 1NPTO 3DFIA 3ZEIA 4QL3A 1U2GC 3MELA 1S1CA 4FFNA 3VBCA 3STXA 3HNPA 3ORYA 3X1ZA 1PX0A 2CJXA 4AFNA 1ZMTA 3JQGA 4GQAA 2AJTA 3CGWA 3TOXA 3B9PA 3LKVA 5FD8A 4CGZA 2IV3A 2DY1A 1HDZA 3SLRA 1CJSA 621PA 1G6HA 3H05A 3PUXA 1ISHA 5JIBA 1VIAA 2ZBPA 4IYRA 1NVWQ 3PRHA 1BNCA 1JX6A 1N6NA 2CJFA 4PHTA 5D6OA 4NK5A 1UDBA 4CMIA 3PJRA 2NZUG 5L4LA 3TGLA 2FSVC 2W0SA 1CFJA 1Q3KA 3FKSD 1NQAO 1KMHB 3IAEA 1W0JD 5IJ0A 3IYLW 2PN1A 4CKCB 1ZHHA 4YUWA 3G2OA 5ALQA 3KNZA 4G0NA 5IXJA 5KZMB 1RKQA 2RGNA 1QO7A 3E23A 2JGEA 1UXHA 4FCVA 1XBTA 5JHGB 5JMPA 1NGSA 2ZR9A 2ZJAA 4RYDA 5GTDA 2E18A 2YOGA 4Z3OA 2XCQA 3CUKA 2H11A 3LH5A 1I0IA 3AUTA 4AS3A 5EKXA 5DXAA 5KNBH 4M0MA 3EXG1 2Z2JA 5L3VA 4V02A 3MCVA 4GMKA 1IG0A 1ZH2A 1WPRA 1HOTA 1U8TA 3GRFA 2OD7A 1LDNA 1JDJA 2R86A 4L78A 4B7ZA 4ZKDA 3UA4A 2COUA 5BMOA 5KKCA 1D2RA 2AW3A 1QQBA 1EX7A 2HT1A 4BU1A 3IAM1 4FHCA 3L6UA 1YK0A 2J30A 1H69A 1A2BA 3QLTA 4TTPA 5LA6A 4WBNF 1QHIA 1YA8A 4FYVA 4E2WA 2VUHB 4CLRA 1WZUA 1QR2A 1XL0A 1USKA 1CLEA 2AVDA 2J0EA 2V5UA 4QG7A 1OQAA 4Q4HA 1QIJA 4ITVA 3CC8A 3KKZA 1I4DD 3MAGA 4UCXA 3ZWAA 1TU0A 1ZITA 2R4UA 3QELA 3TH5A 1SH7A 4FZ3A 3RO7A 2E4WA 3GLIA 4DADA 1LBSA 1CUCA 2ORVA 3OZTA 3H1EA 4I4TA 1E1RD 4XTCS 4CFSA 1F2TA 3BKXA 3HU5A 4FR0A 4REOA 2FRVA 2G1JA 4ZVVA 5C5IA 2P65A 2GZMA 4M89A 2FOXA 4BRWA 5LD2B 1ANKA 2FUEA 1SOMA 2YYYA 5IAJA 1PL7A 4B87A 1CNMA 4LGMA 2A9QA 2IXEA 2YCLA 3IUQA 2DULA 1M1UA 3M83A 4YP1A 5IVHA 4O4IF 5JS7A 3SR4A 3O4JA 3T5PA 4DV6B 1PZGA 4L5BA 1PR6A 1UADA 3G89A 1EEHA 1WMEA 3ZLUA 5CLQA 1MXFA 1CR1A 3C4VA 3MOGA 4DPLA 4I6GA 1UQTA 1OBOA 1VL6A 2B8WA 2PSHA 2UDPA 3RTCA 2EV9A 4A0SA 2AYYA 3TZBA 1ZZEA 3PICA 3H7AA 4LY0A 5EI5A 2IPMA 2XUJA 2FJUA 3AONB 4FCTA 3K9HA 5AHRA 2Y0EA 1V5EA 1Y8QB 1YIDA 2DYKA 3W79A 2Q07A 4NMWA 2OD9A 3QMWA 3ZK9A 2HBRA 2Q2NA 3DEHA 4ZQBA 4ZDJA 2Z08A 1A1VA 3L0OA 4EHHA 4ZP1A 5KYNA 3C4QA 3HCEA 3NPMA 4O1IA 4R68A 4TTVA 3D8BA 4KXFB 4PO9A 4R2HA 5DHPA 1JXQA 1KBZA 2IXFA 1CS0A 1FW8A 4RULA 4B5LA 1GVHA 1SK8A 3B52X 3C1UA 2QUZA 3A3PA 1JALA 4LJ7A 3SVTA 1PYOA 5IJAA 1U6IA 1PHRA 1EFPA 1KKLA 4DNPA 2GXQA 2X40A 3HXKA 1RQPA 1PO7A 1SHLA 3AH8A 3U31A 4IG9A 5TQ2B 3RD5A 1K9VF 1U81A 5CDUA 1QH0A 1CRPA 3K53A 2DSNA 1B8PA 1L6IA 1SKBA 2Z0MA 4RA6B 4CNQA 1AKWA 3QRWA 4D3DA 5A3JA 2ADFA 1ISFA 1AS0A 1P1HA 2AE2A 2PSEA 4O08A 1XWFA 2ZR0A 3TGPA 1BX1A 2OVBA 4B4VA 2HKIA 1R9GA 3BA1A 3FLAA 5B30A 4QX6A 3LTNC 1YRWA 2Q41A 4WGFA 5BQXA 4B0OA 1VXRA 4MUHA 4BNDB 2YZMA 4P08A 4DC9A 4OGLA 3T9FA 4H6PA 2PKQP 4RF2A 3TRDA 5JTTA 5LIPA 5EY5B 5C51B 3ZJTA 4TKMA 4C29A 1TU3A 2ONCA 3KSRA 1R1DA 5JCXA 1N2EA 2CV0A 5KU7A 4IFTA 5AOAA 1PLJA 4Y1FA 1N25A 1I4TD 2QT0A 3KPYA 2LKCA 1FTWA 3H3JA 4TSFD 5BWOA 1UJ2A 1WV0A 2IZ7A 5DASA 1QYWA 3MAAC 2WAXA 3EIQA 3JALA 3TD6A 2ODWA 5K0JA 2YDXA 2J5RA 5DNEA 1V1RB 4MKXA 4L08A 2ZAMA 1K63A 3KLBA 4JJ8A 4LWQA 1JL3A 1WZNA 2HLHA 4KPGA 3VC3A 2PD3A 5M7EA 2IZ0A 4AO7A 2RB5A 4OXIA 3K70D 1UEIA 2F1HA 2Q1TA 3GGPA 5GIOE 1IN1A 4Y9TA 3UHOA 4HTFB 2YR0A 3NFRA 3NHPA 3NHYA 2FP3A 1F4VA 4KXUA 1JEQA 1NN5A 4I3HA 2CHEA 4LX0A 2JD1A 1UQRA 4IIBA 1MH9A 1NR7A 1XA3A 2GM3A 4F38A 2BJWA 4YQFA 2JCVA 2R60A 3C3YA 4QYXA 3R77A 1RM3A 3OEEA 4LTMA 3FUVA 1IHOA 1L7QA 2EFGA 4ENSA 3ETNA 4Y2JA 3PLNA 3LPCA 1GZHB 4WFJA 3LO8A 1VFNA 3ZKWB 3OJLA 3UBMA 4LF6B 2F8TA 1EAYA 1QZ3A 2XMSA 1QZXA 1EHYA 1LLFA 1WOMA 4HLQB 4MB0A 3OO0A 4PGAA 5EPEA 4K8OA 4PCAA 5LQUA 4OY3A 5IYZF 2J48A 4LYGA 3BWVA 3D7NA 1C8VB 2BR5A 1TL7C 1N2CB 1M6HA 4KFSA 2DQYA 2G0TA 1NUUA 1E1MA 1TEXA 2OGTA 4B83A 1WNFA 1OPRA 2O2SA 3OH8A 4BEBA 2YMLA 4FYHA 1C3OB 1F2UA 4IDQA 3ZXUB 1OH5A 4RIIA 3KHSA 2QUKA 1JG1A 3AKEA 4JN6B 3ZY5A 5B7GA 4TKZA 5IF9A 2V8BA 1KVTA 1DTWA 2PRZA 4KO3S 4XJXA 1XLWA 3A6LA 2Y1FA 1O3YA 1G8HA 3PCXA 3ZZ1A 4L2IB 1GYRA 4ZEOA 1UAYA 3H2YA 3EPHA 3ILYA 1OXKB 1N5LA 1A7JA 1BJRE 2LW7A 3D7LA 3ROZA 1FDSA 3IT1A 1GQYA 1NJSA 4IFEA 4QBIA 4AJJA 3A9SA 1JSCA 2GN4A 3BTSA 5CURA 1DBWA 2YV5A 4ZJZA 2D4AA 1RBZA 2X3FA 3ICPA 2AL7A 3IUBA 3KALA 4KLCA 3EQ7A 1S9HA 1MW9X 2M1ZA 2MYUA 4RLSA 2IHVA 1W6UA 3VPBA 4CEHB 1DEAA 3N2ZB 3E82A 4PGGA 5L7TA 3EZLA 1FNCA 5JC8A 5KYWA 4HRVA 3ONNA 3TQOA 3QVMA 1W96A 1VMAA 2A84A 2WOOA 3AR8A 2VPIA 4R9SA 1ZJWA 4CIVA 1XE3A 2PH3A 4CLOA 3QP9A 1SHJA 4JJFA 4BX2A 2YY6A 3SYLA 4BWYA 1M3SA 2B36A 2FMXA 4JCOA 5FYQA 2P4UA 3D6MA 3DPIA 4FT2A 4OIMA 4MKHA 4DNXA 3T1TA 2RGDA 4WK6A 2ZT6A 1RC0A 3I34X 4JELA 1P7ZA 3KPVA 1TIBA 4TLLB 1HDGO 2RGXA 3NI2A 2C98A 1L5NA 3A2LA 4GF5A 4H7KA 4OA8A 4POAA 3CNNA 2QX4A 3TD9A 1SCNE 1VJCA 3N2KB 4KAXA 4WOPA 2H3EA 3T3HA 4FFOA 1L7DA 4M86A 4CLXA 1F0YA 3C0KA 3E15A 4KUHA 5CR9A 4PPFA 1A9OA 5LQDA 1OBFO 4INOA 4J75A 3OCJA 2P1ZA 3F6CA 2QAGA 3KUKA 3RK0A 2PRYA 1WM1A 4MGEA 2R47A 4ZREA 4URHA 5HOQA 2OGZA 4PLVA 4XUEA 5KQPA 3NMUF 1WXGA 3VOSA 4AYTA 1IWBB 5KQGA 3ZVLA 2V7WA 5BVGB 4UMVA 2I2CA 5IDVA 1R00A 3Q88A 5G0UA 1DI0A 1NTRA 3QWFA 4OMFG 3N2KA 3V1MA 1NT2A 2Z8XA 1AIPA 2C7BA 4BKMA 4MINA 4IGKA 5BN1A 2QN3A 3IP8A 1BEUB 3H9UA 1Q0ZA 2WWXA 3LNTA 1JH9A 4AJIA 3F7MA 2ZSUA 4DQUA 1S02A 2PPLA 5EVJA 3R44A 1NY5A 1Q0RA 1QS0A 2O6LA 3DKPA 4NAVA 3WWOA 4AZ3A 4JLKA 1Y3IA 1CQZA 2PH7A 3PHHA 5AMXA 2A30A 1UODA 1LK0A 1ST3A 2FZ5A 2OORA 2R6GA 3DBLB 1SKQA 3QYJA 4N40A 2GK7A 4MV7A 4QDJA 5DN9A 2X0DA 1TYDE 1L6RA 3GB9A 4RDCA 1Q20A 4WJZA 5HMLA 2PT5A 1NJ6A 2BLNA 2H1LA 4IHQA 4UHHA 5K0SA 5CNKA 2NVUB 3UT0A 1X19A 3TBHA 1ZNXA 4GOMD 3SKVA 2R4QA 1GV1A 1GSIA 1Z73A 2G25A 3HKCB 3LPMA 4WZAA 5D2CA 1RC1A 4U00A 1C9NA 4M7WA 3I76A 1YR2A 4HFRA 2AOTB 4UC0A 4GI2A 4LECA 5IYZA 4DBLE 3GT7A 5JFOA 3VV2A 1K0FA 3M33A 2ZXEA 2OZLB 4FMCB 3WGTA 3TOZA 1GSOA 3UJ9A 1Y63A 3FCAA 4Z5XA 5BXYA 2H59A 2R1VB 4JI3B 2AQHA 1Y9JA 2LPMA 1MOZA 4L3WA 5SY4A 3W2FA 1RAHA 1TJNA 3BCUA 3IHKA 3H5AA 2Z4RA 5AXAA 1ZCZA 3OMXA 4L02A 3R6TA 1DMRA 2QLLA 3PGJA 4RVFA 5C5EA 3U4CA 3H83A 4YMHA 4TKUA 4DA9A 4NXMB 5KQLA 5DP1A 1ZZGA 1XZBA 3T7DA 3ZOZA 2C5FA 3TM5A 3GGSA 1KA9H 1Z4LA 4MRSA 4EA8A 4BNIA 1ZLXA 4CIXA 1Z29A 4IIJB 2A4MA 1JYEA 3FE2A 1M2OA 2GPAA 4RPGA 5DHFA 2CXTA 5HG0A 1QHFA 4CODB 1P33A 2VK8A 1ETUA 1X7XB 4U8GA 4IGAA 1KEPA 5CB8A 4ODIA 1EIZA 2AS0A 4JSRA 5TXGA 4YR7A 3SWWA 1WQ4A 5BSUA 3CBQA 1I4WA 4XDHA 2UUPA 5BSTA 3AERB 1S8FA 3PCTA 4BJ5A 2R7NA 1RABA 3ILXA 1FL9A 2Q7DA 3GP8A 1ECGA 2X14A 4R7ZA 5LP6C 4OI2A 5SZHB 2E82A 2F3SA 2QQFA 3EVGA 4P4UA 5JD6A 1HR0B 2AHOA 5KSYA 2ZRPA 3TL2A 1EVEA 2JK1A 1AN0A 1JDNA 3TTUA 1C7FA 2ODPA 2ZVDA 1LVHA 5C1OA 3U56A 5CG2A 4NE7A 1R0KA 2QRVB 3TTWA 3FCYA 3R8FA 2XB2A 4PRYA 2X0IA 2WY2D 5BNIA 3KWMA 3OJOA 1R5JA 3MIIA 4BMDA 3B5EA 3KSBC 1DBIA 2ZS7A 5FWYA 1QGUA 2PT9A 2C03A 3WRYC 2QROA 3I2FA 4YJ3A 1CVIA 3L9XA 2ZJZA 5KPDA 2VTDA 3T7EA 2RI0A 3P9CA 1X1QA 4GS5A 3CNLA 3AYXB 1BSVA 2AH5A 5EXTA 4ZVKA 2JGNA 3LC1O 4EB6B 2XDWA 1M8PA 1IZZA 3RHTA 3TYXA 4I99A 2NMVA 3B6MA 3K0HA 3PRJA 4ARAA 3GJZA 3UZUA 3I42A 1XK6A 2YZ2A 1XZLA 2NZXA 4L7QA 2HWUA 5FHQA 1PTJA 3K0FB 2O0JA 4ZQGA 4FZJA 1ZR4A 3EZXA 4YR9A 1KJ9A 3I0ZA 1FDUA 3PUIA 2CT8A 1SO8A 3UJHA 1PKXA 2LVBA 2G6TA 4S1PA 5M34A 4YDQA 3QTBA 4RKWA 1OFUA 1Q0HA 4YRLA 4ETIA 2Q5JA 4P83A 1MC5A 4Q18A 2QXUA 3VJMA 3W1EA 1NBIA 1XTRA 3V2IA 4ZK6A 5AVUA 5BOVA 1FQJA 2AMVA 1ZN9A 3EY9A 3JVIA 4GSKA 4PLGA 4YXWA 1GRNA 1NVUQ 3JQBC 1XKXA 1EUDA 1SUSA 2FCRA 3CWCA 1R15A 4MVJD 4MUAA 4RQUA 3DPSA 1UBCA 2BEJA 3EVDA 3OD1A 4LRXA 4MVJG 1TTHA 4TS9A 4TZTA 5HIAA 1JILA 1EWRA 1EJ2A 3LFUA 4Q48A 1I4EB 1VYVA 2OV3A 2HBQA 3DEAA 4X6XA 4XI9A 1WCIA 4M36A 5KJCA 3K8ZA 4H7PA 4RENA 3ZWQA 4J91A 4CI0B 4B09A 1IBMB 1JDPA 1OV4A 3BIXA 3ZLBA 4BRZA 1HPLA 2FN3A 5EXPA 3HB5X 3H97A 1P1BA 4G2TA 3QEAZ 4QDXA 5IS2A 1WSWA 4L74A 1U28A 4KRXA 2Q0XA 3A6DA 4NMLA 4EABA 2XMZA 4FQ7A 1G60A 3H42B 4C7XA 2O8DA 3WNQA 2GJ4A 1O94A 3G2JA 2YQ4A 1NDQA 1JI3A 3MXTA 4I50F 1GJRA 3LUDA 3UB3A 4JVNA 1YJAA 2XQKA 4HVAA 1YGPA 4MKZA 1V5WA 3D3KA 3OOYA 3EHDA 4FC7A 3RUFA 4CVNA 3A4MA 4ND7A 3H9GA 4EIWA 3QXGA 3F73A 1V8PA 2NM0A 1B8VA 4XD2A 1UK7A 3RUEA 1EK0A 5KMGA 1LCIA 1E1KA 5EXEA 2A33A 4ZZ2A 1COWA 3SHQA 4PFSA 4G0ZA 2AHRA 4RTMA 3NKLA 4B2PA 4BL5A 3KS9A 1U9JA 3BKWA 2IA5A 5T5QA 5DI3B 3VUFA 1NJ5A 1QVZA 2LDXA 1ZD1A 1MO4A 2WYIA 3EQ8A 3ISTA 2ZI6A 3I5UA 4PR0A 2FF5A 4GDMA 1VSVA 4AXBA 2CJWB 2ZJ5A 4I46A 4P32A 2DKOA 2ZE6A 4G5HA 2H1RA 2UVQA 1IRXA 4A8TA 4WTOA 1UDRA 4A36A 3DZHA 3DBIA 3LYAA 3W8EA 5I9TA 2VYNA 4EOGA 2IVFA 5JD5A 2P6MA 1IE3A 1NVTA 1P4GA 4XB6B 4JJAA 2XAUA 2CHQA 3EVEA 3LCVB 2IEYA 2Q49A 4M8KA 1RW4A 1T6XA 4L3VA 3AVPA 1SJ9A 3ZVNA 3RYFB 3QEMA 3A6HA 2VYND 2WHYA 3CLUD 3U5ZB 3D5QA 4W8HA 1XKLA 3NVDA 2V6MA 4ZGGA 1N8KA 3X1MA 1JG4A 1THZA 4YH1A 5T4FA 4E51A 3K0SA 4UZFA 1Y9DA 1PJZA 1XP8A 3D6UA 4MRVA 3FFTA 1PV4A 4EZEA 2W42A 4R5MA 4A73A 1LDEA 1UMDA 1V35A 4N7BA 5BR7A 4JUDX 5HK8A 1JAYA 3HI6A 3DL7A 2X0FA 3M6FA 1DPFA 4P54A 2YHUA 1GVNB 1K4MA 3DV9A 5J1SB 1P9OA 4F9FA 4U7TB 5BPHA 1LH0A 3GMIA 2ODAA 2D5CA 2A9RA 1Q91A 1YS7A 2DFDA 3H4VA 4WZBA 5EMJA 3R7DA 1DAHA 4NYJR 2DX7A 1QKIA 4NG4A 2ZRQA 2V54A 4NS1A 2JFXA 5KU1A 4HYTA 4PYNA 3EG9A 1OFVA 3VH4A 1PJ4A 1UBFA 2JC3A 3DZFA 1KZHA 1U2TA 1P4JA 1MEJA 1NE2A 1R0XA 1YQQA 4L0QA 2ZKLA 4M3NA 5LWQA 3IURA 2HNAA 3EGOA 1BEEA 5JNVA 1VCOA 2QQGA 2ZIXA 3NAZA 4UNPA 5H3CA 4AQYB 1DINA 3OZVA 4E5YA 1NUHA 3N8KA 2R8XA 1IEQA 2VDUE 3JARA 3IXLA 4AKEA 5KWEA 1KRWA 2Q4BA 5EOVA 2B99A 2BEWA 4Q0MA 4FW9A 1TD1A 4DIUA 1EP1B 2ZJFA 2QN1A 5LJLA 4ID9A 3LT0A 1E1QD 2FUG6 4L4ZA 3C6ZA 2IE0A 2ZIVB 2FEXA 4ZVLA 2BBSA 4I5IA 3WLNA 4XWOA 2VH2A 1NVVR 2J85A 3DMTA 1ZMXA 4MVJA 5KB3A 4YP0A 2XDAA 4TLCA 4DCSA 3IEPA 1TLTA 2DFKB 3C3DA 3R6WA 3DMYA 2CXXA 3HBFA 2C9OA 3V8MA 2FPOA 1E92A 2YWFA 3KSMA 4QHYA 3WHKA 1JHUA 4MX8A 4WBNB 3RHFA 2FK8A 2ZUEA 1OH7A 2B4RO 2QYTA 2QLMA 3A70A 3DLCA 3AUKA 1V41E 3VH2A 2B1QA 1E3SA 1DXOA 2W6QA 1QP8A 3O21A 4IOLA 4L1KA 3GIWA 5C37A 1WTAA 2W9XA 4YBZA 4L4UA 1J0CA 2VAWA 3HN7A 4D41A 4BP3A 4FLEA 1YBAA 2O3JA 3DFFA 4QGGA 2ODBA 5LB2A 1H3EA 3ZHOA 1DJPA 2FSHA 2FMKA 3H99A 1CV2A 1A9XA 2BGWA 2J9XB 4HB4A 3NUGA 1F4LA 2FSPA 1WXQA 1H3NA 3LBIA 4I7EA 4O2AA 4C0KA 2JFBA 3EVTA 1USGA 2YN4A 5GJCA 4QRDA 2CLDX 4X60A 1Z08A 3EUFA 2I0FA 3CLVA 4O4LB 1IN6A 1UPAA 4NH0A 2OBBA 4DARA 1KJQA 3BMOA 2J3MA 2R7KA 2YNMC 3IOCA 4A0RA 4D8VA 5JJCA 4WINA 1M10A 4UUMA 5T4EA 4JMLA 1PR1A 5FBKA 5JYBA 3K6JA 3EA4A 3UQZA 1CHNA 3SNKA 1Q12A 5IDWA 1ZVMA 5FLYA 3GVIA 5DHSA 1SD1A 4ZO7A 1E4YA 1DRWA 1OLUA 4R1TA 5E9JA 4DMUB 1ACJA 4GPTA 4DQDA 2ZCVA 1ACLA 2NT4A 4OFWA 1CS0B 2CMKA 4O2AB 2J9RA 4R7TA 3V2HA 2OUIA 4FT4A 2R5NA 2CXRA 3E4CA 4YRPA 2D2XA 2GPSA 3E8SA 2PUGA 1Z56C 2IQIA 1XZNA 4HAOA 4MVJM 4A9AA 3EEIA 4L5IA 4EPYA 3W5BA 4JR2A 2VHJA 1A97A 5HJ2A 5J2TB 4OX9B 2UXCB 4G56A 3KZ1E 1XTQA 5ILQA 3GLFB 1PEAA 1DC3A 2H8KA 1J8QA 2OBNA 3G2NA 3P9SA 4L22A 2PZLA 4LMPA 2N75A 4II7A 3QQPA 3IRVA 5CK5A 4P53A 3TIXB 3TZ6A 3I62A 1KDOA 3AFIA 4LMAA 1YB1A 5LZ9A 3IIJA 4RVNA 3RT7A 1ZRHA 1M8FA 4F06A 3U3ZA 1K68A 3OPQA 2V6IA 4PXYA 1KSHA 4YYEA 4BP9A 1RI5A 5ED0A 3NM5A 3ESCA 4ENQA 1KZ7B 1PZFA 2JAXA 2RGCA 4YAEA 1EHCA 1P2DA 2M98A 4QYMA 3TLMA 5HRAA 4IIGA 1N7JA 1XZKA 1Z0ZA 3OA2A 2R0QC 1V5GA 4HLCA 2F7SA 4N5DA 6LDHA 2H06A 3KPWA 1Z2OX 3QVVA 4C0XA 1J00A 2GCPA 2NVOA 2VL7A 2GFIA 2QP9X 4RE5A 3H0CA 2GEDA 1BX3A 3V7FA 3G7NA 4RIGA 3WWZA 4DT1A 5JO0A 1HY3A 1H8HD 5TX7A 2GPJA 1TE2A 3HEBA 3U3KA 2PH1A 2F1KA 3HJHA 2P5YA 3AKCA 3UAOA 5G0TA 1YA4A 3KKQA 1K08A 2JJ2D 5JH7A 3DNPA 3LQRA 1ORVA 1CIPA 3TTTA 1IUOA 2DSTA 4FEEA 1N0IA 1AS2A 3OHSX 3X1WA 3E05A 4MR8B 5K9ZA 1I7QB 1YZUA 4NI5A 1K6XA 1IJKA 2QUHA 3LUHA 2BI4A 5HS6A 3GLFA 1F17A 2ZR8A 4P92A 4PZZA 4QYWA 2IEBA 1WU8A 1ZK3A 2CN1A 2ENWA 3A14A 3B3FA 1NJ1A 3E22A 4G1CA 4HGPA 4R1QA 5DULA 4HQNA 1EWYA 5AFSA 1QKKA 5SZKB 1E77A 3LVBA 2RK6A 1EQAA 1MAUA 3GVXA 1UBNA 4PHCA 2B4AA 2P2CA 4HZGA 4MR8A 4U6NA 1SPBS 4XRGA 1QHYA 2FVYA 1CJVC 1AKTA 1GGJA 2IS2A 3RFFA 3UF0A 1O6FA 1LPMA 3DQQA 1N92A 2AKEA 2J8ZA 3IIMA 4Y2UA 2VQ6A 4PF1A 3B89A 2RE8A 1GGNA 5K01A 3W77A 1OMOA 3ICQB 3J81k 4DLKA 5I9NA 5C8ZA 1PJ3A 3B6JA 1RC8A 1R74A 1TPZA 2YIVX 4IWNA 2GHQA 1U5BA 1IOWA 3Q3CA 4P7FA 3U3RA 2VSYA 5G4KB 3KYCA 1F1BA 3IQFA 4V0NA 5AR1A 1KWKA 3FCEA 2YRFA 3BGOS 2Z6QA 1NATA 2AOTA 3K0KA 2NV6A 1C3JA 3KUUA 4YCDA 1YS2X 1EBFA 4UDYX 1X7DA 2Y27A 1NBOA 3F8TA 2J1LA 2YJ6A 2QR3A 2OAQ1 3N2LA 1XMIA 4QJBA 1L7VC 1KC3A 3DE0X 4G9BA 2B4KA 2CJYA 2XCTB 3DOJA 3MWKA 3HPRA 2ODQA 4FHDA 3F9IA 3JQEA 3IQGX 5IFLA 3HCNA 1E0DA 1NIPA 3KR1A 4JQSA 3LW8A 4Z1OA 4PAWA 3DZKA 1XVAA 2GXSA 4UXJA 3BJIC 4YROA 3KUDA 1BE6A 2VNKA 4IWXA 4BATA 4C4RA 2IOFK 5DT9A 1ZOPA 3S1LA 5BO5A 4NOJA 3BSFA 3RSCA 4HEQA 4R8LA 1E3EA 2ETXA 1XU7A 1YR7A 2HV8A 2W8BB 2G88A 3D2LA 9ATCA 3TQRA 3KSZO 4F6RA 1KJZA 1NXWA 2YVAA 1K6MA 4U7PB 2DHQA 3RB8A 4B7AA 1SQ0A 4O5AA 5B7NA 1OJ7A 1NRJB 2VCYA 3CONA 5D86A 5KNBA 3NGMA 2Y4NA 3GLTA 4B33A 4OMUA 2PBRA 3C1TA 3LUKA 2JRLA 1HO3A 5THQA 3VR5H 1NHGA 1IN7A 1A3CA 3ZK7A 3M9LA 3GLIE 1EYZA 4MJ7A 4F3RA 2HHJA 1Q2XA 1ZGGA 2BUCA 3HJBA 2B21A 1KY4A 3EMBA 1EQUA 3OOSA 4B3XA 5KYWB 2W8BA 4UVDA 4WOBA 1MPTA 1PQYA 2C29D 2G5GX 5FFFA 3VYSB 4EW2A 1XVLA 2I99A 4TQAA 4FVTA 5G2OA 3X44A 2GESA 3HGQA 4ZVMA 1WMAA 1W1UA 1Z5PA 3MCZA 3FB4A 4JI8B 4MLZA 5JBIA 1E1QA 5DNDA 4X1IB 3OCYA 3LY7A 4QYSA 3E22B 2B25A 2G67A 4HNTA 1UBHS 4RK1A 1T43A 1VIMA 1ZIOA 5FI0B 3VHLB 3O9MA 4XEUA 4YRRA 1CW2B 1FX0B 4RY0A 4EYSA 4HADA 3V5NA 2Q3JA 2O3TA 3SJUA 1KVQA 1DOHA 4N0QA 1HEYA 3H2HA 4JIMA 4QQ8A 2XYVA 2QRNA 4WZAB 4AX4A 3HY3A 3ETHA 5EJ6A 3HUUA 4DG9A 1Y4UA 1VJGA 2A5YB 4G1VA 2IHKA 3B6ZA 4MS4B 2X0KA 2I34A 5J4YA 1ETHA 4TSFA 4JGGA 2CNDA 3NHMA 1HYBA 3I9KA 2CVPA 4E4YA 2X23A 3ETCA 4BO8A 4A6XA 4YI3A 2GUWA 1MQSA 2HH9A 4IIEA 1VC2A 2KYRA 3AR5A 3I6IA 4M60A 4FE3A 4H6XA 3KP1A 2D06A 4MMXB 4QU9A 3UWSA 3H9EO 1I0LA 4KNYA 1WMDA 2X8LA 5HIMA 3CTMA 1MP0A 1ULHA 1ULSA 3FVRA 2VAMA 1WBBA 1Y6RA 1T5IA 4I1VA 1VZ2A 1E2QA 2AE1A 4RACA 1C1YA 3QY9A 4F2WA 4LZZA 1FC0A 1A96A 5J40A 3G85A 3IAXA 1DKMA 1SC4A 2HIAA 1O9GA 1VI6A 1SXJB 4L72A 4N3GA 1HNXB 1KK1A 4JT9A 3LX4A 3RRMA 2GETA 1X7XA 1N7HA 4DKJA 2AN4A 4BNTA 3HR7A 3IXQA 4RHTA 3CF0A 5FEUA 2J3DA 4RETA 3GCZA 3ZBQA 1EJBA 2PYIA 1SCKA 3MWDA 4OOFA 1QC5A 3W2GA 2B94A 2IIQA 5AQEA 1DX4A 4P1ZA 3WZMA 1J2UA 2D7CA 4YAFA 1ADFA 3IV6A 2VP0A 1S8AA 2YJZA 3F4BA 3LRTA 1WBDA 1NRIA 3PDUA 4CCYB 5A5GA 5I3ZA 1ZGHA 4M7RA 1N2SA 5CJJA 5CVJA 1ESEA 1SIWA 3Q6MA 4XIGS 3WOHA 2Y9PB 1XCBA 2ZE5A 4ZODA 4LJ6A 4QYIA 2VR1A 1ODKA 4FZ5A 2K7ZA 2R8BA 3KSDO 4JBGA 1EDBA 4WLNA 1XZMA 4WOKA 1YSCA 2I8AA 4NK4A 3ROFA 3DE6X 1E9AA 2WJWA 1DP4A 8ABPA 1TLLA 1UBSB 3RHSA 1YQGA 2QTHA 3O3MB 1E4OA 1OU0A 2H4HA 3OJWA 1DUIA 4MRMA 4D6PA 4KXQA 1WDLA 2VT2A 1O94D 3VOBA 1E2HA 2JGRA 4RH3A 2LD4A 2BFWA 5HBGA 5JJLA 2Z2XA 2J9FB 3NVKI 1XQ1A 3K8OE 1U7HA 1TM4E 1KMNA 4GEGA 1UMCA 1C4WA 5L40A 2M6LA 1J5EB 5AJTA 1O94C 4NOLA 4BVBA 3IQZA 3A0RB 4M0DA 1ZRMA 3CZ4A 3ZDQA 1B26A 3BBLA 1VSQA 3EXEA 4CQLA 3FYUB 4LCJA 4RHCA 4WVLA 4YV1A 4N76A 4OU5A 4BZWA 2ERXA 3RVJA 4Y6OA 4O8CA 5KQSA 2Q6KA 4RMJA 1B6RA 3N0XA 1GPWB 2BL4A 3AB7A 4P58A 4KWCA 4L75A 3PPXA 1QK4A 4YUZA 4KJXA 3FNGA 4IDOA 4A2CA 1QRUA 5CDYA 2FLWA 5I7SA 1GUYA 4LGYA 1S4MA 4DF3A 2IEDA 2XMGA 1TQ2A 3AY7A 1T2AA 4R69A 5G4KA 4G0MA 1G8KA 1R8JA 3UO8B 4ZQEA 2HOQA 1WEHA 2QJRA 3VNAA 3B51X 5F1OA 2ZJ8A 5EJFA 4DLVA 3G5LA 1C1DB 1PFKA 4MULA 2YV2A 2QLTA 1X8XA 1FP4A 4UE2A 4L5AA 1B8OA 2LRHA 2TECE 3ER6A 1CEQA 4IDAA 4Q3KA 1GN9A 3EJWA 2BEWB 4V3CA 1CEYA 1X6VA 4ZDIA 1VL8A 3CBGA 1B23P 1M5RA 4Q7LA 3UT6A 1TIPA 4B6PA 1F3OA 4NNPA 4ACBA 2Q45A 4GQBA 1R5BA 2I3AA 2XOKA 4M0CA 3FKSA 4UXIA 5E8RA 3O1JC 3W3AH 1LY1A 4A2QA 1KBOA 4EPRA 5ALMA 5EJ7A 5LP6B 2Q62A 2F3RA 4PR3A 4RAQA 4EYQA 1A4RA 4MGYR 4XSGA 1WA5A 5CEEA 3GI1A 2H4FA 2ZIAA 3LLUA 1IIRA 1P3JA 4V0QA 3DUWA 1YZ3A 1AK2A 2IYOA 1VOTA 4CLOB 2V3VA 1L5MA 5A6SB 3W4IA 1RJGA 4PLFA 3SS9X 3LK6A 1FMLA 1PT8A 1RE0A 4IMPA 1B3BA 2A14A 3NHBA 3GEGA 3ZI4A 3UXEA 4C21A 2YRWA 3IDZA 2HMYB 1XMJA 4P2GA 4O4JA 4TMWA 1HX7A 3F78A 3U4HA 3JAKB 3RGGA 5TQVA 5FV4A 3BTOA 2ZANA 3FVWA 3HB1A 4LVOA 4ZPJA 3FVTA 1Z6XA 3RTDA 4WN3A 3WL6A 2QRHA 2PSSA 4OGKA 1GITA 1T34A 5C35A 5A1JA 1XZIA 4EG4A 3EMDA 4ILKA 3I4FA 4DR3B 4ZYTA 4N3NA 6YASA 4AULA 1KZGB 4X3PA 1WCYA 3UEOA 4G4JA 4ZEXA 3ISVA 3PPIA 1MJNA 5I9IA 2JDIA 4BMOB 1XXHB 1YKFA 4MKGA 3JCZA 1DT5A 1LW7A 4JEIA 2OCYC 4Y2TA 4Q4AB 4GWKA 1YFLA 5JJIA 1PGNA 3SQNA 2BY4A 2PXAA 2A8YA 5I5EA 1NVXQ 3AR4A 1P4RA 1EG2A 1YZFA 4G86A 4OV6B 5HGXA 4F12A 5KBYA 4LJAA 3IEMA 3HSSA 3WQBA 1T9AA 4AY3A 1SXPA 3ZNQA 4G65A 4PZUA 3VV3A 3ZZNA 1E8NA 4MUJA 3SF0A 3H1TA 2ZSAA 1KS2A 1ZN7A 3G8CA 2OR3A 3ZWXA 3SXUB 3DCIA 1IUKA 2UYGA 4NCXA 1W2HA 2A92A 2FHPA 3THWB 2QZ9A 4OOEA 2J3QA 3TZHA 4C3UA 4W6ZA 3MJEA 3O73A 2Z6UA 2XKAA 1K92A 2BFEB 4D43A 5JADA 4AROA 1E79D 2QD5A 5IDXA 1EVKA 4EO4A 1N78A 1U02A 4B3TB 1V9LA 2ZJBA 2GHTA 2P90A 5EWLB 3SMVA 2REBA 1BN7A 4EKDA 5K0FA 1X7HA 1DVRA 4DMCA 3S1AB 4Y0VA 4MWBA 2DVMA 3ZCPA 1UIMA 4BIMA 3DBRA 3QMPA 3ZX4A 5CA1B 1EVZA 2AK3A 2VPPA 3H04A 3Q7PA 2R8ZA 4M1OA 1CZKA 1NRWA 2COEA 4LI3X 2G7ZA 3NEYA 2AFHA 1TCVA 3T5CA 5A9SA 1JHOA 2CBGA 4PC7A 3TIIA 1XWWA 3BM5A 5FTLA 2WTUA 1YJ5A 1GNPA 1XTZA 2P8SA 4QD3A 3OOWA 1USUA 3PEWA 4KTTE 2YV3A 3N2IA 1P0FA 2ZWOA 3I73A 4QTYA 2ZPUA 4KTVE 5DI9A 3HM9A 2HHHB 3HKDA 3AF1A 5LCXA 4KG7A 1CVLA 3MXOA 4PPYA 3AHJA 4CQNA 4I5FA 4FBLA 5A9TA 1YCDA 1O0BA 2AFVA 2HJGA 1WKVA 2HDOA 2JFPA 1G9SA 4XSHA 2L19A 1NLYA 1TVMA 3AXTA 2JASA 4NDNE 4WW0A 4DV1B 4KV7A 3NNSA 1C81A 1E1CB 1JEEA 4Q4HB 3RC1A 2GARA 2RGGA 1D7AA 3PIDA 5E0KB 2PMCA 4G0QA 3I8XA 2AGVA 3ORFA 1JQAA 1XT6A 2GJ9A 4MXDA 4HDRA 1PS9A 4PY2A 5GQSA 1QPBA 1P5ZB 1ZONA 2O2ZA 4JMPA 1XR3A 2CVQA 5LC1A 4U6SA 2GN6A 4MH0R 4MUKA 3K31A 2A9OA 5FWXB 3JVDA 3AF2A 2WTEA 5D85A 3OQMA 1T5LA 1K5GA 3GLSA 1DS6A 4AJEA 5KVQA 5JLAA 3U7RA 1J8DA 4KZKA 2X22A 4RLHA 3BXOA 3G5MA 4ZO4A 4E21A 3K1TA 2J31A 4GO1A 1XRSB 1NG1A 1HDEA 3J80A 2D8AA 3MEQA 3H86A 4LE2A 1T5SA 1WMBA 3HVKA 3SQOA 3NVAA 1C9DB 3SFTA 1IXRC 3DO5A 3V46A 4D9JA 2YS6A 4EGFA 1DKQA 1A2KC 3BMNA 1KI4A 3GJ6A 2N46A 3IAS1 3H4TA 2V6JA 2WPDA 2AC4A 5HKBA 3O31A 1W94A 3HYTA 4UDOA 1FRNA 3JQ6A 3ZDYB 5HXAA 1C0EA 3FHJA 1QAMA 1QGAA 3EXIA 1MA0A 2AYZA 5DGDA 2A0FA 3N2GB 2MMGA 4M37A 4X20B 3TEMA 4IXNA 5EJ8A 1TEZA 3PRKE 1RLUA 2ZJ7A 4AJKA 4GBJA 2WAAA 3KUCA 2Y3IA 2ZI7A 3PD0A 3PSAA 4E6EA 3IVGA 1PUXA 1I0ZA 1Y82A 3E5MA 1GY8A 3DMNA 2V4ZA 3C4JA 3GVHA 1S2NA 2VHYA 3D7MA 4G0PA 4JUCA 1GEGA 3ZDRA 4OA5A 3R0IA 2CK3D 5BUCA 1SA0A 1W5EA 2P35A 3ND9A 1VGRA 1WHTA 2GPNA 4DW8A 2OV2A 3GEDA 1ESNA 1Q0PA 2B37A 4P98A 5CAEA 1Y1TA 5IW8A 2DPYA 1FTSA 3EE6A 3FWHA 4HNGA 3KT3A 4XM1A 1X87A 5ALHA 3I01A 1ZFNA 2PY6A 1M2EA 1B16A 2ATXA 4CU2A 3DE1X 2ZYTX 4H4EA 2VJPA 3MINB 4GE3A 1Q19A 1QU2A 1ZH6A 3PX3A 3WA7A 4Q1VA 5LP6A 1H0RA 1KI9A 5ALFA 2OCDA 1GIAA 3T4XA 4TKVB 2EKBA 4XB2A 4EHDA 4Q9JA 4K3VA 1Z4NA 3TG8A 1R0WA 3PGLA 1JA1A 2A5LA 1JSLA 2G0NA 4QT0A 4DJEC 2AMYA 5AHWA 4DMHA 3OE7A 2FR1A 3KKEA 3UMFA 5I01A 4R54A 3SHWA 3H0EA 3QNUA 3JYQA 3WK5A 1M7BA 3GDHA 1CJKC 1XTBA 3IQIX 4OHCA 3U3JA 3GEBA 1TJPB 2JFNA 1UQUA 3QE9Y 3QLJA 4H0NA 2HWXA 3DXFA 4KDRA 4URYR 4A27A 3NOVA 4A15A 4HNAA 4DLAA 4WH0A 3HU2A 4DS3A 2KWIA 3Q9LA 1VG1A 2YXDA 1GYPA 3ETGA 3K5IA 2JGJA 2Q9BA 1DT3A 3PUZA 5AWFC 1EDDA 2ZT7A 1H2EA 4FJ0A 4E2FA 1Y7LA 4JNKA 3HY4A 1J9EA 5T8KA 3UWKA 1IN5A 4GG1A 1S2IA 2JI7A 2WC1A 1J07A 3H2SA 3SP1A 3UAWA 3VZDA 4IDPA 4BQRA 4ZI7F 3NRBA 4EUKA 1XHEA 3QPBA 2WU8A 5A4KA 2VDLB 2BE9A 2DHRA 4U7FA 1IZ8A 2QX7A 1JIKA 3TKAA 3Q2OA 1WQ3A 4OXQA 1XXLA 5KTMA 1E1NA 4FYKA 4BO3A 1NPDA 2FN8A 3E5RA 1E2FA 3TLBA 1N9ZA 3IPAA 1SB8A 3NV9A 2WTNA 3PQCA 4ZCQA 4D4IA 3NM4A 3PX2A 5A9RA 4YJGB 2FQYA 4OU4A 3DAHA 4UFPA 1HT1E 2P3OA 5AIAA 4IL5A 3CUEF 3KZKA 1AGNA 3OZCA 5ALEA 3K9GA 1JDBC 4I4TF 5H80A 3W4JA 5FH9A 2HSEA 3GLIB 3C5WP 1JWLA 4MDYA 2AG6A 5CMLA 4A8PA 3KFVA 2F17A 4QE3A 1ZUD1 4KV9A 5LSAA 4Y1RB 2VH5R 1R5NA 4JOBA 4LYFA 4N9QA 5AM1A 1ISMA 2BFCB 1NW4A 3VGJA 4ZOEA 2GCOB 1R4ZA 1CUHA 1SWVA 2JI9A 2LUOA 3FD8A 3MB8A 3AHDA 3Q3HA 3PDIA 4MR9B 1AMUA 1QONA 3KQQA 1GSAA 4N65A 4WZBE 2BGTA 3ZNNA 4M8NE 8ADHA 3F5SA 4O4IA 1U8CB 4KSBA 1FJHA 4F85A 2GN9A 3NNNA 3RSZA 4KVFA 5H9WA 2VSNA 5AKZA 1MJHA 4NHOA 3UUGA 3GFSA 3TQFA 5JPCA 3OAAD 1HNWB 2PCJA 4EG6A 1SGWA 4PYKA 1RP7A 3AEUB 1CY4A 1N33B 3EVNA 2YFYA 2BKAA 2JLSA 4RM2A 5AW8A 5JYCA 2C0CA 7GPBA 5KAMA 3NWOA 3ACCA 2VHVA 3TF5A 2PSFA 3C3CA 4C05A 2VDVE 1RE1A 2V7UA 2OUKA 4H18A 4NECA 5G02A 2Y4OA 4DWOA 4WK2B 4CEIA 1G6Q1 1GGKA 3EXHA 4KMSA 3UNXA 5GJWC 3SICE 4AQ7A 4C5CA 1UKAA 2I6SA 1WDMA 2C61A 1Q84A 2EP5A 4J0GA 1T8SA 1JH8A 3L02A 1G5PA 3MWDB 4R2WA 2RBKA 4R3WA 4BDTA 4BPRA 4KR2A 1JXMA 3MTJA 2ZTHA 2IH4A 2BHLA 3G79A 1KP9A 4LNAA 2AI3A 2REQB 5A7FA 2CB0A 1F60A 2OHXA 3HVJA 2C96A 3I4CA 3TQHA 3DAOA 3AFNA 5TIIA 2AQIA 2O6HA 5SV2A 2HCBA 1KU6A 3AHEA 2VPZA 5EINA 5B37A 1I1QB 1JPUA 2PQ2A 2FI1A 1MG0A 3AEKB 2XECA 3CW8X 3T3DA 2ADMA 1PZEA 3KVYA 1CWUA 4CMAA 3AILA 2NN3C 3Q87B 4M88A 5ALUA 4A23A 1Z2AA 3UW1A 3MT9A 3HLKA 2F8MA 4DRZA 3T4EA 1Z7BA 2J0UB 3G0HA 3L7YA 3PQDA 1QPZA 1OROA 4NEQA 3EXFA 3IUSA 3AR3A 2OK7A 3IHTA 5JZ9A 4EA9A 3NX4A 2WHQA 2AIRA 3QITA 3BQMB 4HNAB 3OF5A 3R23A 4F71A 1ZA1A 4XYLA 1U3CA 4HXFB 3HDJA 3RU3A 5HS4A 2QSUA 5HVNA 4FM9A 4QUHA 5EE9A 3Q40A 2OBXA 3C6BA 1IOZA 3DXZA 3ELUA 1SHKA 2GAJA 1S01A 4Q3LA 4YAJA 3TW0A 1BA3A 1VPVA 5DYGA 2JLQA 1SXIA 3AF0A 3IEUA 4MMYB 1P2BA 2J6CA 1CZNA 1F20A 4WEOA 4OGWA 3RUCA 5TQJA 1OAOC 1M9NA 3WNVA 3T95A 2VPYA 2H1SA 3GC6A 4TVSA 3FYTA 2R62A 1W0JA 2GCNA 4OHBA 4C3ZA 1EGMB 1LWOA 2QMQA 3SZOA 3OFSA 3EXIB 1VKJA 2WD7A 4Q02A 4RVGA 4UU1A 4AUKA 3C3WA 1EVYA 1ZKMA 4OP1A 1G291 3ZYZA 2H3HA 2OGWA 4NYIR 4WV3A 3ZHBA 3IUYA 5LUBA 4NZ9A 4TYPA 1UP6A 5EKSA 3DF9A 3I1JA 3P9XA 2DFPA 3GCDA 4MA5A 3TDKA 2AOUA 4I4IA 2FX3A 2EFYA 1PTJC 2J0VA 2OV8A 3FGNA 4U9IS 4LHVA 4OAPA 2CD9A 1VE5A 4XCXA 4ZOLB 1RLIA 1JJAA 1H2ZA 3WOVA 1SVNA 3HFSA 2G7MC 3H2BA 4RPIA 3WSWA 1XEWX 1JW9B 5KUTA 2UVDA 1YS6A 1T36B 1T4CB 2ZUCA 3D8SA 3U5TA 1OI4A 1ZVQA 4C04A 3NP9A 4EHKA 2CCGA 4AZ0B 5CT9A 3QKRA 1Y42X 2I5PO 1B6GA 1XYGA 3WMXA 2V9ZA 3GD7A 4ESEA 3ENQA 1E89A 3ZH9B 4UM9B 2FW7A 4JYPA 3INNA 4MLPA 2ZW9A 4ZU1X 3WLSA 3CU5A 3OIWA 4MR7A 4AP9A 2J9GA 3I64A 4HDSA 2IUFA 1R8QA 4FNGA 3TNLA 1KIAA 3HNRA 4GZMA 4MQFA 4B6RA 1SHZA 3B85A 3KE8A 1PJTA 4D3ZA 3OLCX 4ZOBA 3O8BA 1P3Y1 3LKZA 2WJVA 3LT2A 3A6PC 4WXMA 1SMKA 3DEYX 3W6UA 4BZXA 2G80A 2HZBA 1R0LA 1E7RA 1ZVKA 4QAJA 1XMOB 2OCPA 2HC9A 3B48A 3FYHA 3KAKA 4IS2A 4LJYA 2QSYA 3WSTA 3LECA 1U3GA 3NTOA 3U16A 3L7OA 1K5HA 4EPTA 1NF9A 1F6DA