2ZRQA

Crystal structure of s324a-subtilisin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
QPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Crystal structure of Tk-subtilisin folded without propeptide: requirement of propeptide for acceleration of folding
pubmed doi rcsb
source organism Pyrococcus kodakaraensis
total genus 114
structure length 318
sequence length 318
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2zrqA00
1TM1E 1T1IA 3T41A 1EA7A 2P4EA 4JP8A 1SN7A 1SUCA 1SUDA 5JXIA 2DUJA 1PJ8A 3D9QX 3H42B 1GNSA 3CNQS 2IY9A 1Y3BE 1MPTA 3DE1X 3AFGA 2G4VA 1WSDA 3A3OA 3WIUA 3I37X 2V8BA 3SQOA 1Y33E 1AU9A 1JEAA 4ZARA 1BH6A 3DE4X 1TMGE 5JXHA 1SCAA 1DUIA 4C3UA 5B1EA 1NLUA 5FBZA 2Z30A 3DE5X 3LPDA 2SECE 1GNVA 2PMWB 1PTKA 1S2NA 5SICE 5B1DA 4K8RB 2DQKA 3TI9A 4DZTA 3I30X 1BFKA 1SCJA 1SIBE 3VV2A 1SCDA 3DE6X 1EGQA 1TM5E 1Y48E 1SUAA 1BJRE 4MZDA 3GCWA 1GA4A 5AVKA 2ID4A 2W2OA 4GI3A 3Q5GA 4YN3A 1CSEE 1XF1A 3A3NA 3DWEX 3AJ8A 4H6WA 1YJCA 2GKOA 3BX1A 3VYVA 1LW6E 4CFYA 3WHIA 1AH2A 2ID8A 4KB5A 3Q40A 3BPSA 3QFHA 4LVNA 4WOCA 4BWGA 1TM7E 4KPGA 3DVRX 2Z2ZA 3WQBA 1TM4E 3LPAA 5FAXA 2WUWE 2PWAA 2WWTA 1Y1KE 2X8JA 2WUVA 5JXGA 2PRKA 4H6VA 1ZVJA 1SUBA 3F49S 1WMDA 4B5LA 1S02A 1Y3DE 1T1GA 1AVTA 1WMFA 1SUEA 1SBNE 5ARBA 4HX2A 1R64A 3I2YX 3ZXYA 1YJBA 1TM3E 1SIUA 1P8JA 1Y9ZA 4J94A 3P5BA 1C3LA 3D43A 1P7VA 4CG0A 3QTLA 3HJRA 5AQEA 4C3VA 3DDZX 5JMOA 1THMA 2PWBA 3DW1X 5AMXA 1SBCA 3PRKE 3GT4A 2Z57A 1BE6A 2W2MA 3A3PA 1SH7A 1SELA 1R6VA 3LXUX 3ZXXA 1OYOA 3DE3X 3GCXA 1SPBS 1WVMA 3VHQA 1OYVA 1R0RE 1TO1E 3WIVA 3OSZA 3PTLA 4HVLA 3DE2X 2ST1A 4CFZA 5ARCA 1PEKE 5AVJA 2WV7A 3F7OA 3GT3A 2W2PA 4RYDA 1SBIA 3DE0X 3VTAA 1SCBA 1SBHA 3QMPA 2PQ2A 1V6CA 3UNXA 2ZWPA 3DYBA 1KDVA 5CW1A 3EE6A 2W2NA 2Z56A 5I9SA 1DBIA 2X8JB 2SNIE 1ST2A 1GT91 1TK2A 1GA1A 3DE7X 1BFUA 2IXTA 5ARDA 4I0WB 2PKCA 3VV3A 4H6XA 3VSBA 1SUPA 1S01A 1KDYA 1GTL1 1TO2E 4NE9A 4NMXB 1KDZA 3DVQX 1HT3A 1P7WA 4DWWA 1C9MA 1GTG1 1Y4DE 2XRMA 3AJ9A 1AK9A 4FONA 1CNMA 1IAVA 4NE7A 1SCNE 5FFNA 1V5IA 1AF4A 3TI7A 1YJAA 1ZVKA 1KE2A 1NDUA 2TECE 1WMEA 4WOBA 1IC6A 1SBTA 4ZOQI 4AKTA 4OMCA 4OV6B 1GA6A 3F7MA 3LPCA 1AV7A 4DJ5X 1Y3CE 1GTJ1 2SBTA 2B6NA 1YU6A 3BGOS 1VSBA 2DP4E 3DVSX 1MEEA 2SICE 1Q5PA 1OT5A 2W2QA 1C9JA 5K7SA 2HD4A 3EDYA 1TECE 3TECE 1KE1A 3CO0S 4AKSA 2ZWOA 4Z2AA 1A2QA 1UBNA 2Z2YA 4LVOA 3SICE 3DW3X 2PYZA 2Z58A 3EIFA 1SIOA 1GCIA 1SVNA 3L1KA 1C9NA 4M1ZA 2QTWB 1Y34E 3I34X 1NDQA 1Y3FE 2E1PA 4KG7A 1AQNA 2HPZA 1PFGA 1BE8A 2XTJA 4OMDA 5JXJA 1ST3A 1T1EA 2Z2XA 2ZRQA 1Y4AE
chains in the Genus database with same CATH superfamily
1N9GB 4J16A 3G0OA 2GT1A 4O2LA 4LN1A 2WNSA 2XF2A 1XD9A 2WD7B 3ET5A 1XVVA 3D8RA 1ND5A 4G89A 1SUDA 3C5VA 1CUZA 3CINA 4JAVC 4AF6A 2BTOA 3A32A 4DCGA 5TNXA 1N5LA 1GNSA 2FHSA 5EVCA 4XB6B 1G4UR 3VO2A 2H1VA 1HDIA 2JZOA 2ERYA 4PLGA 3U7IA 3CSUA 3OWXA 1R1DA 1XZEA 1XMXA 3U4HA 1BGVA 3E2PA 4W9NC 3ND6A 2OQIA 2P7IA 1KK3A 1LZLA 2A1UA 1ZN9A 3KJIA 1X8KA 1XZIA 3ZY4A 3QOWA 3PC2A 3G2LA 3OKCA 2P0YA 4EKIA 1W87A 3LC0A 3WRVA 3H9JA 3UW3A 3NHSA 4P8RA 5JRJA 4OYHA 4DLRA 3W05A 2VAWA 3RS5A 1OZAA 4RPJA 4B43A 3K31A 2AUNA 2QRNA 1R3UA 1B76A 3PQ6A 1R0SA 3OX3A 4HGOA 3KDPA 3PQ3A 3UXMA 4C3OB 4R2XA 2VRCD 3U9TA 5A4IS 3WRXA 5KWIA 1RWKA 2F1KA 8OHMA 2OR3A 1LH0A 4P36A 2XYHA 1PLKA 2NYAA 4HFNA 4MYHA 4Q1AA 5ELMA 4AM8A 4J03A 1KI8A 3WNCA 3TTYA 1RE1A 1D1PA 3KZVA 3LS2A 4I5EA 4IY1A 4U9IS 3SVZA 5IM5A 4Y2XA 3VXKA 2ZTUA 4FFBB 5HCUA 4YCMA 5B37A 2XE6A 1GTMA 1PJZA 2AMJA 2NO9A 3L8EA 4PLYA 4IBOA 1UP4A 4WA8A 1EMDA 2E3JA 2IPLA 3VX4A 4DR5B 4ZAXA 1QV6A 3QA9A 3KQQA 1F17A 2BR4A 2Z30A 3T7JA 5AVXA 4HDQB 5KNCD 4NFLA 2MWMA 4FR5A 4J0KA 2XUGA 4Z3KA 4ZDKA 1GAWA 3QIAA 8GPBA 3NMUF 3AL2A 1TK9A 1NBEA 4LGVA 4BVGA 3IKJA 3CUSA 4S0ZA 3ELYA 1A9XA 1MO5A 1OI4A 1CJVC 1OTYA 3IIMA 1EKXA 3N8IA 2D06A 3B1ZA 3I30X 1FYEA 3ND9A 4O2AB 3O9VA 3P7MA 4UZEA 4W7HA 1EK5A 3TOVA 1PX2A 1HL3A 3KAKA 2JKZA 4HDSA 1M8KA 4DMFA 1TLFA 2FV8A 1RRVA 3RTGA 4C06A 3ICQB 3AONB 5EE5B 1U9YA 2PS9A 2QGZA 3ZGZA 2JLSA 4YP7A 3O4FA 5CFZA 1TU4A 4PZEA 1RWPA 4E12A 4HNVA 4D81A 1FS6A 3DZDA 1A4XA 2GARA 3C4JA 4MQEB 1L5HB 4QD3A 4Z4GA 1AY0A 1YI1A 2FPRA 2PZFA 3ZC3A 4ARZA 5AM2A 2Q41A 3S1LA 2PL1A 2LDXA 1DMRA 1JSRA 3PGVA 5A03A 3QU4A 1K97A 3CXRA 1P5FA 2OXFA 2RHTA 1E9EA 1QNLA 3EBLA 4GPTA 5I4BA 2Y0DA 4YAIA 1GA4A 2ZCVA 1PJTA 4G1BA 1TD9A 4FT2A 4UJ5A 4YJDA 3S5UA 4CG3A 3AZQA 4DLPA 1S89A 1J99A 4KE7A 3U7EB 3HR7A 3WP0A 3I9V6 3OCXA 5EUBA 4LSWA 4CNBA 4K81B 2HY7A 3O8NA 3LUJA 4GFDA 3HGQA 3V1NA 5L6MB 2ZYIA 5KBYA 1P45A 4AMGA 1Z5UA 2FFHA 5CVJA 1ECBA 2PX8A 3VYVA 3AJRA 4ALJA 4QXQA 4TTRA 4X92A 3KQLA 3FOFC 1L3IA 1CUEA 4DQ0A 2H31A 3ZWPA 3A70A 5E2BA 2BF4A 4J0EA 3PC8A 2Q1SA 4N6GA 1VDMA 1YL6A 5B3JA 4NE2A 3QMWA 3GDGA 2PPLA 3CW2A 4JX8A 4P81A 4QRIA 5EE0A 4ZKEA 5TMEA 3WIEA 3ZHZA 6Q21A 1KDTA 5C5CA 3LMKA 1ENPA 3ZK8A 1O8CA 1DIOB 1ATIA 1SG0A 4OY3A 3MS2A 4A91A 1N5JA 3IBFA 1J07A 2VO1A 1Z4IA 4JI4B 4PNHA 5HIAA 4E07A 1KGSA 2UYQA 4WGGA 3WK7A 3TIVA 3G5TA 3RKUA 5AVUA 5DCYA 4ZGBA 3VRHA 4JYZA 1QZTA 1PL6A 1LI7A 4UFNA 3PT9A 1RPNA 1RWXA 1INLA 3WA7A 4S1VA 1Y98A 1LWOA 2ZUVA 3FWZA 1CWUA 2DHQA 3KVNA 1KKUA 3OZIA 2KE5A 2B4KA 4JVNA 3CLRD 5TGTA 3NQ41 1H2ZA 1Z6XA 5FI3A 3LW8A 1I3MA 5DYTA 4JR1A 1A9OA 1SRQA 1AVTA 1E7QA 2FX5A 3KOYA 3WL6A 3JX9A 1E9CA 5F2EA 5IMSA 3OO0A 5KVAA 1ZUWA 5ARBA 1EU1A 1FP2A 4DJJA 4RK1A 2QW1A 1KZHA 3QE0A 4F56A 1QHEA 4HMPA 3E3NA 2RGBA 1XIVA 3R5HA 1H0SA 4BVEA 3AK4A 1CZHA 2COUA 3KNZA 1CEEA 3NNDA 4LVCA 2PAAA 1LV7A 3IHTA 1P8JA 4GAEA 3VNQA 1M0EA 2PGJA 1VMIA 3DOFA 3N5KA 4MS1A 5LQNA 1MT0A 3MCWA 3L82B 1PJSA 1Y37A 3RODA 1AMOA 3LOPA 5TRTA 4FZ5A 2R79A 3CEPB 1Q12A 3NETA 3FZQA 2LCQA 1G4HA 3JZMA 3DZ8A 3UUFA 4CG0A 4CCYA 4TT8A 1PR4A 3GGDA 1UC8A 2R47A 4R0NA 3E2IA 4TSFD 1FLAA 4W5HA 3TJMA 3FUUA 3HVRA 3BCSA 5CGQB 1YKGA 2VNSA 2ATCA 3PUXA 5JJCA 2XYGA 3U61B 1RCUA 2WAYA 2J4DA 3VR6D 4B6QA 2WILA 3WGUA 3ETGA 3S1AA 2ZYSA 3BXPA 4W5WA 1XRJA 1E5QA 1Z0JA 1BHSA 1VG9B 1VDZA 3QXHA 3SJAA 3IX7A 2R5NA 5HQJA 4IFEA 3RUFA 3O92A 2YH2A 1ADBA 3NB0A 3UK0A 3OVMA 4QPCA 5LQRA 2SKDA 3A6ZA 1E3EA 4EY8A 1EVQA 5EWJA 5LZ8A 1QRSA 1JA1A 2PLAA 4FOTA 4UTPA 4N01A 1OH6A 2R751 3F6RA 1SQSA 5KZMB 2IYEA 3H9EO 1HDCA 3OPYA 3JW8A 5JC8A 1SM4A 3L6BA 1U98A 1NI4B 1OYOA 1Z4JA 2EZ8A 4GPZA 1D6MA 1S4MA 3Q98A 4F3CA 4JLDA 4R83A 5C7YA 4FFLA 2C99A 2WHPA 4X8HA 3QU5A 4L6IA 4J16C 1NLYA 4PYIA 2IYAA 1BEEA 4IIDA 5TMPA 4Y6SA 2DPYA 3DBRA 4PVDA 2WZCA 4II7A 5DTJA 2FWRA 2XT6A 1TAHA 2NADA 2VPIA 3R4VA 4P38A 4JI5B 4Q48A 5IW8A 2GEBA 3AERB 2VAMA 5LBIA 3RT1A 4I1OA 4B6EA 3Q88A 3PHBE 5FA6A 3AY3A 1F6WA 3S44A 3INRA 4C4ZA 1C0IA 4FW8A 1IZYA 1OI3A 1BG6A 4KYVA 1GR1A 2C77A 3X1XA 3L49A 1O9GA 3UUGA 2VHQA 4ZAYA 3PHGA 1NMEA 4NBRA 3HRHA 3F7OA 3IOEA 4KV9A 4I4TB 1MAAA 5DEOA 1DKNA 4GECA 2DHDA 1N5MA 2Z04A 1M2JA 1SAYA 5HGJA 4CDGA 3LH5A 4KBYA 1I4OA 1MO3A 1M10A 1K7SN 2I71A 3CRNA 4JD5A 4QYTA 3LW7A 4X5OA 4Z9AA 5K6TA 1OFUX 4M76B 3K2IA 3QPBA 2HDNB 4W9RA 5JAUA 4OXKA 1CB0A 6REQA 4FFDA 4JEMA 2DQSA 4X9XA 4OFBA 4JT9A 3MERA 3WRXC 5FV7A 1PWXA 2O2EA 1KJYA 1V8OA 4TVBA 3WTBA 4CBVA 1WMSA 3C3YA 4FIZA 1Z62A 2GVDC 4P5DA 5LA6F 4QODA 1JR2A 3QLJA 2O06A 3PRHA 3OHPA 1LLCA 4COKA 1A1VA 4I7EA 1KZ7B 4RHEA 1ZJ5A 1XE3A 3PB3A 3L6EA 1HQDA 1JFVA 3KL4A 4HWRA 1OV6A 3RROA 1YE8A 3KZMA 1A5ZA 4HXYA 2RH9B 2WR8A 3HM9A 1YZGA 1Y7HA 2H18A 5FWYA 1KXJA 3P0EA 5TEWA 4LZJA 2OHFA 2HFJA 1KZ1A 3DD1A 4UE3S 1J9GA 2ZJ0A 4BLRA 1Z2PX 4D8TA 3AU9A 1VSVA 3LSYA 5F64A 1PW7A 3KSZO 2AUTA 3WIDA 1GPMA 5IX8A 5IM4A 3L01A 4D3SA 4JGGA 4PLTA 5ARDA 1AC5A 4QZVA 2HKIA 2HJRA 4XCVA 4RACA 4NOMA 3N2IA 3ES9A 4NFSA 5EE9A 1ZCJA 3MG9A 3P97A 5KC9A 1OC4A 1S3SA 1MCZA 1TOAA 2QMHA 3QVWA 4YRBA 2QT1A 4Y0VA 1ZM3A 2UDPA 1GTL1 4RTPA 4NMXB 3NATA 1NF9A 4GU5A 1DPFA 1DJLA 2Q5EA 1IWPB 3QKSB 1LX7A 2CFTA 4JJAA 4PO3X 4AN1A 4ER5A 2PO5A 2NOAA 2AKYA 1FTGA 4UM8B 5DLQC 2XRZA 1QG2A 4MW2A 1ORVA 1V6SA 3ZZ1A 1RI2A 4Z8XA 1NLZA 3WGTA 4BV8A 1BKSB 3ILXA 1A04A 3QWAA 2R1VA 3EG9A 2OQVA 3VUEA 3OUTA 4ZJZA 3C3BA 1ZMOA 3MJVA 2IE8A 3DTVD 1U3CA 1BMFA 2IYTA 3EDMA 4LZLA 4AK9A 3TLAA 5C2JB 2P30A 1CNMA 2G8NA 3OQ6A 5C31A 3AHIA 3W2EA 1DCMA 3GJ5A 1DTWB 1JV2B 3Q41A 1V11A 1NQXA 3E9QA 4FGSA 1DBWA 1FFAA 2GJAA 1A8QA 4BAUA 3TI7A 4UEQA 5HA5A 2HK9A 2FZVA 4DDHA 3M3HA 3UENA 1XTZA 2AYZA 3KKMA 4KMRA 4TTSA 5CR9A 4Q1DA 2ZT7A 4D0NA 3QRWA 3IEXA 2TECE 1OAOA 5J5VA 2ONKA 1EDBA 4RZHA 4L2IA 3F6YA 5LCXA 5EA2A 4C22A 1QQAA 5ES3A 3CPHA 4L22A 3P9QA 4JC8A 3KFXA 2YV1A 4IV8A 4MQMA 1G4AE 3MJCA 4WOKA 4HZUB 4JYAB 4UATA 3ECSA 1EINA 1Y3CE 1YFKA 2EW2A 2PRJA 2VQSA 1N8SA 3RRMA 1N1GA 1OXXK 4LBZA 2O2ZA 5TR9A 3UJCA 4JV5B 3KFVA 2ACEA 2FQQA 4XVCA 2BFPA 3C5CA 2MDTA 3MB5A 1HNWB 1T8YA 2DP4E 1Y9JA 5CB8A 1W30A 1B42A 2V58A 3RNLA 4OI2A 1QK3A 2SICE 3WNZA 4EJSA 1QGZA 4G9EA 4QHYA 3RANA 3IMEA 3SJUA 1MO2A 1JEEA 2GM9A 3D8HA 3IJRA 3L0YA 4LZWA 1O97D 3BGIA 2NTEA 4BUCA 2E85A 5KYUB 1BMTA 3RYIA 1TIKA 1CETA 1ZD9A 3AG6A 1JVSA 4R98A 2IHBA 2GDZA 1Z34A 4GR9A 2HGZA 4U6QA 2RAVA 3PVSA 2J59A 1JEJA 4XLTA 1J25A 2FPIB 5J2TA 5IN5A 2ADFA 4ZHQF 2HA7A 1W2WB 2W70A 2B8JA 3B2EA 2OFWA 4I1VA 4R6WA 1UKBA 1Z0IA 2EX4A 3RAPR 3U3MA 4YMGA 1SU8A 1XDSA 1U1DA 4JR0A 4IX9A 3RYHA 1DWQA 1E3LA 2JFZA 1O8BA 1NQUA 2P1RA 4CMIB 3BILA 3B1YA 4INPA 4OL0A 3DOEA 3DTVB 1QZ3A 1X77A 5KSOA 4TQGA 3SFZA 4AX8A 1G0OA 1XTVA 2RHGB 2VJDA 3GRVA 4W8GA 1A8SA 4XWAA 4YROA 5GONA 4C4PA 5HS4A 1JR6A 1C0LA 2A92A 4B6RA 3FPAA 4OTZA 5KVVA 1KI3A 4ZPJA 4YPVA 1KY4A 4GVPA 4ISBA 2R60A 3E3MA 3M2TA 3CYFA 3K8QA 3OZTA 4MVJG 3FGZA 2YIJA 2KLBA 1Q3KA 5AW8A 1RZVA 1ZAYA 4M89A 1ZZGA 4ESOA 4N3NA 5E3IA 1JTFA 4KR9A 3PFGA 3PUVA 2G8LA 4TQUS 3CUVA 3SDZA 3PNQA 1PLJA 1WVGA 4CN9A 2E2WA 2I2WA 4MTLA 4CQMA 2AK2A 1A72A 5BUCA 3IBCA 4AYWA 4QUKA 1XV5A 3E7XA 3TXYA 3HQ4O 4JI3B 3C3CA 2BISA 2AWOA 1KQ3A 3UOGA 2LRHA 5DMXA 1HBJA 4NYIR 2H2AA 3ROZA 2KJQA 4WWHA 5MN6A 1TYEB 5FIUA 3PS9A 2DXIA 5CDFE 1NRIA 3GJRA 4RQBA 2WHEA 3EIWA 2AZXA 2BSAA 3FFWA 2OXTA 1XPOA 1ZK3A 2O6LA 4HQNA 4XRGA 3R9XB 2C5LA 3TH5A 4Q82A 1IPEA 1HEIA 1V25A 4BMVA 1UFVA 2Q3JA 5KYTA 1B74A 1R16A 3UBMA 1AUQA 9ABPA 4IQGA 3FCEA 3PG5A 1QUFA 1YIAA 3NTQA 4Q7JB 2IYLD 4MR9B 2NU9B 1IN8A 1VKZA 3H5VA 3ZY6A 2IP1A 2A1IA 3L4KA 4HGZA 1II8B 3MWDA 3E0XA 2FR0A 4XGNA 3VR4D 4E7PA 5BV2P 3MS7A 2XKKA 1EFCA 3RU9A 2P4EA 3R24A 2PH3A 3C98A 1FVXA 1P2SA 1XVTA 3DKVA 1L1FA 1WDLA 3A9UA 2COEA 4H3HB 3VHXA 1WKCA 1Z33A 2CXRA 3Q8XB 1OFVA 4LECA 5DU2A 5C8YF 2QMYA 1SULA 4CTOA 1TTTA 4RFVA 3TXAA 2VJLA 3RO7A 2I3BA 4NCJA 4OJNA 1X3SA 1U7XA 2CGEA 4NMMA 3RGWS 3U7JA 2Y1XA 4BLWA 4D3DA 5BR4A 1QTIA 2LKDA 3HCCA 1N2XA 4MAFA 2HHJA 5HMMA 3NVMB 3ZJUA 1DT3A 1E96A 3C3EA 4US1R 1HF3A 4DJAA 2MYTA 2AD5A 1Y1QA 1VG0B 4KXXA 2CLFB 4DDVA 1I7NA 1LB1B 2XB2A 1UBLS 5HKAA 3SZMA 1N5RA 1Y33E 5JS6A 4RIEA 2FPXA 1DQSA 4R1PA 2AS0A 1Y6QA 3UJBA 3M5DA 4AJJA 4KSYA 3E23A 3NPMA 3KZCA 4RF4A 2ANBA 2J87A 1RJ9B 1SZPA 2GB4A 3U44B 3PK0A 4GVLA 3ICVA 4RENA 4DMLA 4O4LF 4LZNA 1AE1A 3VZCA 3W6OA 4CWAA 2WKSA 1X1DA 2IZZA 4BNTA 4CN8A 2DJIA 4PYMA 4D4MA 2B5VA 5I3CA 4A0RA 3W5BA 1RAEA 1UUFA 4KIGA 1YBAA 2EP8A 3PD0A 1M7GA 4MW6A 2PSDA 2JLCA 3TR5A 2NU8B 1ZFNA 4QDTA 2B1RA 4GQBA 3TDMA 3WV5A 3OCWA 5K8LA 3UJ8A 5CAEB 3IQHX 3CUTA 3IAUA 1OR8A 3RKRA 3OJXA 1QMGA 1QQTA 4P3PA 1U7TA 3T5AA 2CDRA 3Q10A 4LY6A 4UVEA 2HADA 3WYGA 4XWYA 3OG9A 3IURA 4D9GA 2RHMA 2DQYA 1GNVA 4IDHA 4ZI7A 3CX6A 3Q7PA 1V3QE 3RS8A 2EVWX 1IQPA 4NH0A 3SLGA 1C3JA 1NVWQ 1L8AA 5A6SB 1XR3A 2H57A 4GKBA 1VE6A 4GMFA 3RC2A 1E1DA 5JS7A 5DHPA 1EK2A 3GLKA 2EHJA 4HDMA 4WZBB 4RGYA 5B1DA 4UPDA 2G88A 2CT8A 4PGHA 1JALA 1CQIA 1ZDMA 3OWHA 1Q6YA 4IWNA 3VAZA 4AFNA 2D74A 1YUMA 1OLSB 1OWOA 1QONA 3A2NA 5DISB 5K03A 3SSMA 1LV8A 3O2JA 3H86A 1J9EA 1Q92A 3N8GA 2V4ZA 1F2UA 4N0QA 5IN4A 1Q0HA 1MVLA 1EDEA 4Q5IA 2MSKA 4EY6A 3CBQA 3HWWA 5A4KA 1RTTA 2GF0A 1CFZA 3CCBA 1Y48E 3MBKA 2AFVA 4RSGA 3S8MA 5KYKA 4DIUA 1PFKA 3H2YA 1SGWA 4CMHA 1SB8A 4G2NA 1HE3A 2A7QA 1AS3A 2HXSA 3LKVA 1GN8A 1BX1A 3KEOA 4E5DA 1DQPA 2FPSA 3I76A 4QBTA 3CRW1 3ZDZB 1X7XB 4C08A 2REXB 2NXEA 1QYWA 5HSGA 4Q4HB 4B8YA 4PIMA 3M9WA 6NULA 5FAKA 4JP1A 3L7OA 3HA5A 5TVGA 1RJWA 2CLIB 2ID4A 3PXBA 5JU6A 4GI3A 1QQ7A 5COBA 4UVGA 2OPHA 3SEFA 4E5YA 2XMQA 2G70A 1CSEE 2EF1A 4PANA 3SBXA 2WIGA 2VK4A 1CY6A 2ZI5A 4N5LA 1GXSA 3T5DA 4UHEA 3NI2A 2FEAA 4JT4A 4MI3A 2GYWA 2PKRA 5KNDD 2I2AA 2RHLA 2B8WA 4A7PA 4E4RA 2NTYC 3IPYA 2FP3A 3VZRA 5DGIA 4UOZA 1LQUA 3AKYA 2N1MA 3WXMA 4G1MB 4DNPA 5CT9A 1XEWX 3CNLA 4J9UE 2HQRA 1CK4A 1Z47A 4U9HS 5BYAA 3E9EA 2ZBQA 4PRLA 1PR9A 5FJIA 2YIVX 1JBEA 2IT1A 1P19A 3EQ7A 1OA0A 4RWZA 1WETA 4F86A 4HBZA 3AB3A 3OZEA 1Y9DA 5FUXA 3RFCA 7AT1A 5JVDA 4ZEMA 4QOGA 1E9AA 2AR0A 4EJSC 1O58A 3FAKA 1WXDA 3LPAA 4L9WA 4O2BB 2GSDA 5JFTA 4AQ7A 2IYNA 1IVYA 1P72A 1EGAA 3PUHA 3T1YB 4AKHA 1G64A 2XUQA 2HUNA 2PUCA 2JAOA 1V5FA 3LUAA 1U2TA 4XDHA 4Y6LA 4BCBA 2QDXA 2Q9AA 3K7EA 1AN9A 3EGCA 4BNGA 4U7TB 2ZXUA 1IZ0A 1UBSB 4OUDB 5JXGA 4RS3A 4GEGA 3DHEA 4R8LA 3O8QB 1N0WA 2BE7A 3VTZA 1XELA 3D8TA 4M1QA 1SUBA 2YXNA 3OCZA 4JB0A 1N8NA 4M1KA 4E2YA 2HK6A 2W6IA 1JFFA 1LFDB 3WAKA 3S81A 4QJIA 4RTNA 1O3YA 1U7DA 2IU0A 1YZ3A 4Z4QA 1R66A 3JAKB 5HKKA 5H82A 5IJ9A 3VZPA 1VJRA 2E87A 5JH7A 5ENDA 4YLYA 4HQ0A 5BN4A 1UF9A 2C4MA 3SP1A 2WD8A 4RQUA 3TLEA 4YT8A 2JDID 2PIDA 1DOZA 2X8AA 3CCFA 1PJ2A 3HLYA 2XQJA 3IIKA 3ZCPA 1LD3A 1KYXA 3R74A 1GPYA 2IYWA 2ZU6A 4G4JA 3ZXYA 4YP5A 5JALA 1N92A 4D74A 1O0BA 2OHOA 3NIGB 4Y2VA 4YJ2B 5E6SB 2X4IA 3NP7A 1JFSA 3BIOA 3HO8A 4XWGA 3DLCA 4OHMA 3O8LA 3PNPA 4XFJA 3VYUB 3X44A 4AQDA 2P90A 2DTXA 4K46A 1NUAA 1K75A 1Z4OA 3WLHA 1FUIA 5FD8A 1VA5A 2PDAA 1B0UA 4ML3A 4P5EA 4KACA 2CJFA 5DBHX 3U7GA 2ZYGA 4KXYA 3RVPA 1SXJB 4F5WA 4ZAFA 4KO1S 5DZSA 1QHNA 5E4TA 4AY3A 1ZAKA 4B6GA 4BQOA 1G21E 2DSTA 2OC4A 1CY7A 5AH0A 5AMXA 4EW2A 2AN4A 1CC1S 3OEHD 3GQBB 2ZRFA 1I3CA 4G63A 1T2UA 1AKEA 3M9LA 3Q8WA 3LT1A 3EGXA 1MG5A 2FNAA 2H08A 2XNJA 2Z57A 1L7AA 3ASZA 3QM1A 3Q11A 4WD3A 5HFAA 1OAAA 3TWOA 4EHBA 2W2MA 2PXAA 3CJRA 4C7BA 3H18A 1G8GA 1VFPA 1Z0UA 3P2MA 1XJQA 4JL6A 1KO1A 3IFSA 4YT2A 4Z6KA 1RCFA 1PEDA 1QZUA 2VPTA 3W9YA 1MD9A 2Q1WA 3IMCA 2CXPA 2H1IA 3OOHA 5JY6A 5K2MA 4JP2A 3FB4A 3V1YA 3NONA 3ZV4A 1SC6A 1SPBS 4RESA 4CCAA 5L4NA 4RA6B 4P3OA 3AEYA 3GRKA 1Q1QA 5KTTA 1GARA 2OGZA 1E9VA 3WSVA 4F2PA 2GJSA 4I8XA 2AHRA 2VJAA 2VXOA 4MPDA 4UD6A 1G20A 2O8VA 1E9FA 1QCYA 1ID1A 4Y0NA 1GRQA 1KEUA 3SYKA 4KE9A 4B4DA 4Z51A 1XBTA 3GN1A 4AUKA 1MA3A 4EHJA 2I4IA 1QAOA 3GJYA 6GPBA 2DYKA 5TQ2B 5L51A 2FOIA 1PZEA 1IONA 5EP3A 1TJYA 4URVR 3QITA 4DJEC 1TE2A 2RK3A 4ZANA 3SJ7A 3CZQA 4Q12A 1EVYA 3H8JA 4FFRA 5K09A 1K4YA 2BP7A 1HV8A 5CNJA 3RHSA 1R3DA 1Q95A 2ZB2A 5IBPA 4P4SA 4Y9UA 4RV4A 4F5YA 1FUUA 1N5KA 3WS7A 2FHPA 4EHIA 4MYUA 2HK8A 3R7FA 2VZ0A 3M6VA 2ZVDA 1FDSA 3WMXA 1CQJA 1TO6A 1U6KA 2Q07A 2AXNA 3W77A 2HM7A 3NNSA 3VKVA 4QLBA 3GUCA 2UXDB 1GRRA 1ZD3A 2H2FA 4D5GA 2IXDA 4E1AA 3AESB 3NHWA 2BUCA 4IEIA 1TMYA 1D2AA 1KVTA 4LMRA 3RVDA 4BLUA 3NRJA 1U3DA 1W1WA 2FSFA 3CN7A 3VNAA 4DA0A 4D57A 3FKSA 2CFRA 4GKVA 4NCBA 4ZYUA 5CDUA 3S1SA 3FSGD 2HBZA 2P9HA 1GG8A 3E9CA 3UB3A 4LQDA 3WLIA 4IINA 1BYIA 3UQYS 4TTAA 3LLMA 4WEQA 3SC2A 4TRNA 4ZCMA 4I50B 3KP1A 4K7JA 3EXIA 4OMUA 5ETJA 3GGCA 2H9IA 3RG8A 2WSSD 4DSAA 1PD0A 5K0CA 1YI8A 3AW8A 2YQ5A 4ME6A 3IMGA 2MINB 5IF3A 2I2BA 1NV9A 3QVTA 3F98A 4IXDA 1JYEA 4Y7DA 4D4LA 5AW0A 1WXQA 5HPYB 1MQ9A 1NN0A 2V7UA 1BSVA 2AXPA 3NGXA 2B36A 3W90A 4QOHA 3W2HA 2XUJA 3ZE8A 1GZDA 1Q0SA 1JDBC 3UC5A 2WBLC 1ZVVA 2BFWA 4ARCA 2RB4A 1JDZA 1C9MA 1G3RA 1WZ2A 3QHPA 1ML4A 4DCCA 1VHDA 4YBRA 3PI7A 2RJ3A 4EELA 1U3FA 2FMTA 4CEJA 1M75A 1RMYA 4IIJF 1WAMA 2AI2A 3DOCA 1ESNA 2ONZA 4KDCA 3L43A 4N8DA 3I12A 3TL2A 3VBCA 1XZQA 5MFPA 3P4XA 3C3JA 3CVXA 5AM1A 2CUKA 3FJ1A 4ZT7A 2ZB8A 4HWGA 4MR8A 3JVIA 4F3NA 5IHXA 1YBVA 3KB2A 3VKUA 3OFNA 2XTAA 5KTOA 2QJOA 3BDVA 4JLBA 2CY0A 1YJAA 2BE9A 2EBUA 1HORA 2GM5A 4MVJP 3IOYA 4V0LA 1IUNA 2IZ0A 4JENA 3WO1A 4C87A 4DA8A 3MGCA 1P61B 4F06A 1E1NA 1ZNWA 2DFLA 3K6JA 3MINA 3ROFA 1OI7A 3RYTC 3AI3A 3FNHA 3HVJA 3WLSA 3ZHVA 3DYVA 1IC6A 4F6LA 4QAQA 3RC8A 4U2CA 3IGFA 3UG7A 5HTOA 1Z0ZA 2YHBA 4GMXA 1WE2A 1J8YF 4TMKA 2LD4A 1VJGA 1Q19A 4X95A 3ZE7A 5C53B 2C5FA 3EUEA 3VPBA 3O8OB 3TFOA 2DG2A 2B20A 3WIOA 4Z54A 3TKLA 3NW9A 2SCUB 1JKXA 1KEZA 2XXJA 2OBNA 4LGCA 1LY1A 3ENQA 1YU6A 2VP5A 4TKUB 2AN1A 1IIBA 4V2IA 2RHJA 1E2HA 1KYQA 1DBPA 3BWEA 4KO4S 4MB2A 6ABPA 1QO0D 2OV6A 1DG9A 1YQDA 2GHTA 4MROA 1A69A 3TB6A 4AG3A 1C1YA 3QVJA 2X7JA 3FTCA 4OGLA 1RJEA 5K0ZA 1IATA 4X1YA 1B2RA 5CX4A 4ZCTA 1ZC3A 5LLTA 3CNEA 4YXFA 4UCFA 2OB2A 4DMCA 1ZMXA 1ZL0A 3EVNA 3FCUB 3PRJA 4V0KA 1ECFA 1PZXA 1WW8A 4OD0A 4Q05A 4MH0R 5C35A 3G8BA 1MH1A 3S7TA 5SY6A 3CCCA 1YHYA 4IL5A 1TECE 2QBYA 5CK5A 2P4QA 3AJAA 3HCDA 3TFQA 1P4RA 3DCJA 4K1LA 5KCZA 2IZ7A 4QUIA 3M82A 5C37A 1NURA 3B36A 3MWLA 3SZOA 5EZYB 1HZJA 3E58A 1A7UA 4MEJA 3GWGA 1Q2XA 3GRUA 2BHSA 4ENVA 1VE7A 4JI7B 1L4FA 1CDEA 4GYYA 3ZEAA 9MHTA 2C84A 1ISSA 4OB8A 2RD2A 4D3FA 2VKQA 4IHJF 1J39A 3C7CB 1KYWA 4OSPA 3C3XA 3NEAA 3CURA 3E9DA 2YVAA 4KLAA 3NDJA 4GI1A 1ND6A 2F67A 3V4ZA 1G59A 5JEDA 4F45A 1TDJA 1YRAA 2VYVA 5TJHA 2PVSA 2ZUFA 4OM7A 3B3QA 3GLRA 3M6MD 5JAZA 3GH1A 1WXGA 3BSFA 3R3JA 2DCMA 3MMPA 3L1KA 4ESVA 1XU4A 2FE1A 2IH2A 2C4TA 2WJPA 3DHYA 3UCXA 1G8FA 4HEA6 2YZ7A 2ZFUA 4NARA 1JG2A 2EYUA 1HFKA 1UDRA 4DIMA 2HU5A 1NDQA 3CISA 3MT8A 5GV7A 4TKVA 3I09A 3KV3O 2X1VA 4Y9DA 1DC3A 5BW6B 3U3JA 2DAPA 4KWEA 4I8DA 3Q2IA 1UKYA 4NENA 4DSUA 2FK8A 3O21A 1GT6A 1IM8A 5BO5A 3OE4A 4DBVO 5KKNB 1X7HA 5ECYA 1YT5A 2QNRA 2I66A 3MCAA 3ICWA 4G5XA 2KYRA 4I46A 4B0OA 4TTPA 1M7HA 3JWIA 3SYLA 2AZDA 2ZJ5A 1GPWB 3WSWA 3DNPA 3ZJ4A 6PFKA 2PD3A 3OJOA 4N0PA 3GNLA 1YZLA 2NIPA 2YRWA 4LQLA 4MUBA 2OFFA 2E37A 5C4IA 1IXRC 2J3MA 1W36B 3DB1A 1E9RA 3IERA 4IXNA 4YJ3F 2GD0A 4ZCPA 3SKXA 2JG3A 3B82A 1WMAA 1CUXA 3Q3VA 1ZINA 2QUHA 2XXAA 2R66A 1UWKA 1P9LA 1XCJA 1M76A 5HF9A 4DLBA 3GLTA 4CR7A 3PFBA 5E1BA 5E3JA 1EFVA 3KX2A 4DM4A 1SKAA 4JP8A 4P83A 5AVSA 1LJUA 3GF4A 2QX6A 1VMEA 1I4EB 3E6AA 4PG6A 3WMFA 3A1SA 1LU9A 3RUCA 4WKNA 1MORA 2Q6LA 3KTAB 1GZVA 4Y98A 3UAZA 4UQOA 3LKZA 3CVWA 2P2CA 3SJBA 4RTSA 1Q6ZA 2OSVA 3AVOA 2NVUB 1XTQA 1QKIA 4MGHA 3K0CA 4BNUA 3HZZA 1Q3HA 2A6PA 3PCXA 1AZLA 2L19A 3BREA 3TBKA 3UGKA 1N34B 4YUVA 1KS2A 2JD1A 4M9SA 4EOGA 5DLYA 4R2IA 2Y77A 3HU2A 2GSWA 5HF5A 2C4KA 3MGKA 2DZDA 4ZEVA 2XGMA 1B3RA 5DSXA 5BY2A 2UUCB 3MSCA 1MAUA 2NUPA 3PP8A 4JBNA 4EUEA 2VEDA 3R5JA 3SX0A 5LR6A 3ZWKA 1L7EA 2ZSEA 3L06A 2AKEA 3GCGA 3INYA 1WHSB 2ZSBA 5A71A 1O95C 2V0CA 3RHFA 3K30A 4U7JA 4EMSA 3VVBA 1BH6A 2C8KA 2KX7A 2VP6A 5CYPA 4LV5B 1OZ0A 1I2DA 2MSNA 4WBNA 2FZCA 2KM1A 1USWA 2RBKA 2VTDA 3G02A 3OZDA 4MVJD 4TXMA 5CJPA 2Z1NA 1ZG3A 5GV8A 5KDOA 1ATZA 1P5JA 1XRMA 1YZYA 2VK2A 2YWXA 3QY9A 1O5TA 4QUGA 5HJ2A 3STTA 3FUTA 1XMVA 3NHRA 2YZKA 3USZA 3A6HA 4EMBA 2VTBB 4MJ3A 1JHAA 3SQOA 4XWWA 1ISMA 2JLBA 1ZBQA 2FUG6 1M67A 2YJ5A 3R3UA 4M7PA 2PUGA 2C98A 1KARA 1JLKA 3AKCA 5HKBA 4OHXA 3CE6A 3BGVA 1BCRA 2WFZA 1HYQA 2C95A 2GPJA 4O2AF 3OZVA 5IVDA 3VU0A 3B5IA 5KMGB 3OMLA 1PWEA 4CMAA 1UC5B 1XP5A 2BKAA 5AUNB 3QMMA 1F4VA 3R6TA 4M1SA 4Q7KA 3I1JA 4N39A 4OQ4A 2VHZA 3HDTA 4LK2A 2QTTA 4RIGA 1IY0A 1P1FA 4DILA 3GGOA 3QOXA 3G0GA 3SR0A 4RPHA 1R6AA 2AZTA 3FMOB 4A6XA 2QE7A 4YRLA 3FB1A 3BQ9A 3CRMA 2UVDA 5ADWA 3LC2O 3UJAA 1KEEA 1DO8A 1EVKA 3RSFA 3A06A 3KDAA 3IELA 1YACA 2I99A 3OPQA 3FZEA 3U26A 3E0QA 2Y2VA 2GX6A 1JECA 2CWWA 2I80A 2OP1A 1ODTC 3HN2A 2GFHA 4WXMA 3CJQA 4CI9A 4R1SA 2YTZA 4JZYA 4BMYA 4IZOA 1P3DA 4NJOA 1DRVA 2L2QA 4JHLA 4EG6A 3KKKA 2HHLA 2ZRKA 5TJ9A 1G55A 1WOYA 3WADA 5A5VA 3NG1A 1D9ZA 1IYZA 1OGYA 4MIOA 1ZRMA 3I0NA 3T0GA 3VH2A 1UAGA 1MA0A 1FYWA 3IEPA 3GRYA 2H2GA 3JSAA 4QL3A 4XYMA 2NSYA 1M2OB 4F7WA 2WG0A 3E1KA 4R2MA 4XVUA 1N78A 1LK0A 2FEXA 4TL6A 2Z4RA 4QDUA 3IODA 1EBUA 4Q3LA 2B21A 3C3AA 1OH7A 2JGAA 1K86A 2GI4A 2XTNA 3OO1A 3TTVA 4S05A 5GM1A 3IP5A 1COWA 2X0RA 2XD9A 5IBCA 2BTEA 2BRUA 3MCVA 1USUA 1Q1NA 2HCRA 2MMCA 3Q40A 3QFHA 2JI4A 1ODKA 1K5GA 3A3KA 3ABOB 2WJAA 5TQ0A 3FLAA 4YRIA 4TLLB 3NH6A 3A58B 4KAXA 2OPBA 3HL4A 2D4HA 4OQDA 4ZK6A 1WXEA 4Q1CA 3WGIA 4P58A 2O2IA 4DV4B 1QF6A 3EOBI 2HCJB 3IYLW 1KERA 2VVTA 3T6KA 3NVKI 2PA3A 4D42A 2XNKA 1J2RA 4V1CB 1WABA 1WS6A 5I01A 4AZ3A 2Q6OA 4Q7MB 1PNOA 3KFLA 4UNSA 4CDRA 1G2PA 3QJYA 1OCEA 1F2TA 1UWLA 4K9LA 4KXMA 2XUDA 2V7VA 1KI2A 2Y1DA 2J0VA 5CW2A 1E2GA 2H00A 3EHEA 3C4VA 1B6SA 1N0HA 4H6VA 4S1TA 5B3KA 2JIOA 2D59A 2Q6KA 1EDZA 3I6QA 2EKDA 1RM3A 5IP5A 1RAHA 4MS4A 4EAAA 1P91A 4KXQA 2DWQA 4TMWA 1D8AA 5K0EA 3UJPA 4QGFA 1YMVA 4D6YA 4D79A 3RYCA 1Y0BA 1BAPA 2A1UB 2AOUA 2H59A 3ND7A 1PRYA 3OIFA 3CUUA 2JLZA 4JS0A 2IS1A 1AXGA 5AKJA 2HRZA 2PU7A 4HB2A 2DPLA 3K1AB 2R00A 3ODGA 2C7RA 1ODIA 4HX2A 4KXVA 1WX1A 2A7XA 5IAOA 4DMRA 4QTZA 1E1KA 4RSMA 1D2EA 3WL5A 3EYAA 2PBZA 4CTKA 1Q77A 5M3BA 4L6AA 4AICA 2RHBA 4D8YA 4I4LA 2D7DA 3MFQA 1GL6A 1WO8A 4A1FA 4A8PA 4H0FA 5ELLA 5CTJA 1GPH1 1KAGA 3EA0A 5LU9A 5DM70 3O4RA 1GG9A 4X6UA 2ZRJA 3RQIA 1XMQB 4II3A 3NWBA 4R1OA 2VG8A 1KA9H 1Z2NX 5IZCC 2XIQA 4QDXA 4ETIA 5ALRA 5AQEA 2G7MC 3ZUGA 2C7QA 3DDZX 2NSLA 3EMBA 5LP6A 5JSHA 2VPZA 4ILKA 1ICEA 1Z6TA 1CZRA 1ZXBA 2GD2A 4IEEA 2OCYC 3KSBC 1DLJA 1MF7A 5DTMA 4JYMA 4ZZ0A 1WY5A 2I54A 3GB9A 4K9PA 2FUG1 3OZXA 4OQYA 5C7OO 1FC0A 1YR6A 5T4BA 3LLUA 2IL1A 3FOAA 5DXFA 4GKKB 1FFDA 4PBSA 3DBLB 3UV3A 3GNSA 3FR8A 4Y6OA 4AXXA 5DB4A 3A1WA 1LLDA 4PU0A 1L4HA 3KLPX 4HWPA 3ZD9A 4B2PA 4E3WA 4CKWA 2W4MA 1E20A 1VZ3A 4HDSB 2JCSA 2RH4A 2AJDA 3BMCB 1MQSA 3TLYA 1P7YA 1V7QA 2A9JA 2WM8A 1DL5A 4CGYA 5JOQA 2PSFA 4RULA 1NMXA 4QWMA 1S5PA 4JBXA 3R09A 3Q8LA 5I3ZA 1M2HA 2RK4A 1G8SA 5CLQA 3VVCA 2VA9A 4BMSA 2DWPA 5EJ7A 2BONA 4CHTA 4PTZA 2DUNA 2WABA 2HSJA 2I65A 3FKQA 1BVRA 4QKQA 5BV7A 4LDRA 4D0GA 1NSFA 2QN3A 3QV1A 5DBOA 3TAXA 2GZ1A 1TO1E 3SE7A 3GFRA 3TL6A 3OSZA 4HGQA 1BGWA 1BZYA 4TMZA 1F2VA 1RYMA 2WJ4A 4I19A 4HJRA 4YWHA 5AVZA 5K3AA 1H5UA 2I7XA 2QD2A 2XA9A 3I9KA 3K0CC 4EBBA 2Y66A 4RF2A 3M1LA 3OCCA 2CZCA 4EO4A 4I4TF 4E6EA 1R0CA 5TS3A 4JI6B 4M3NA 2AC7A 1Z88A 1I36A 1BD4A 2WINI 3PD7A 1GPJA 2V7QA 4QSHA 4HRYA 4L4XA 2B1QA 5DT2A 2C96A 3HKDA 3EQ2A 3EW7A 4ZT6A 4IDPA 5E8RA 4FXPA 3JCZA 1SCBA 4F2GA 4B8ZA 2DKOA 1RAAA 2O5VA 2EQAA 5AM0A 1DCTA 4EMTA 4NMWA 1TW2A 1Z0SA 3QE4A 4YT4A 2OV2A 4FYKA 4UARA 4PN7A 2IYOA 1A7AA 3I4CA 1LDYA 1FP6A 2QZ4A 3L46A 3Q6IA 4J4TA 4P08A 4PFJA 5BQFA 5J43A 3LL7A 4DJDC 3BTUA 1WWKA 4QPZA 4KU4A 2ZBEA 2PT7A 3BMOA 4UUQA 4R31A 4X1KA 3MIIA 3OQMA 1G1AA 3TTSA 3EW9A 3TF5A 1U3UA 1V8PA 2K4MA 1RXIA 3OWOA 3VZDA 1AA9A 1CS0B 1F3LA 1RIIA 3AUAA 3FF1A 3KU1A 4G8CA 4E08A 4OHUA 3EPKA 1FL9A 1YRWA 4UNIA 4I66A 4E1VA 4R2JA 1OI2A 3QW2A 1A8PA 5AKIA 1T36A 4NU0A 1DAIA 5HP4A 4GS5A 2X0NA 1E66A 4LYJA 1WDMA 1C3OA 2BT4A 4M21A 4F6RB 3TRHA 3GMSA 4IJUA 4L1KA 3D2CA 1LWNA 2OBFA 2XB8A 4DV2B 3SFTA 2CHVA 1NNUA 4JBIA 2YJTD 5EGSA 2OY0A 3PFFA 3ZDXB 1JDUA 1KYYA 4G67A 1JA9A 4BZWA 5AKKA 1MABA 1GGEA 1PJAA 2H7YA 2H48A 2ZWMA 3L04A 3QYAA 4MSUA 1KDZA 5ALZA 1FUEA 3U4QB 3BRCA 3I2GA 4WKOA 1W5SA 4F92B 3SI7A 4OQNA 2ECPA 4F93B 2DJ5A 1QRRA 4BGIA 5C1PA 3VOSA 2I8CA 2QN7A 2V6BA 1D6JA 4R9UC 3HEMA 4AROA 1TKBA 3TQRA 3JQFA 1L4BA 3O7MA 3K1YA 4GI7A 5K3EA 3MBIA 2ZR0A 4CCYB 3A6FA 1REQB 4FHDA 5CNMA 2HT6A 2GJ4A 2NYRA 3UHPA 1HQKA 2QAGB 3FCSB 3KJGA 3QVOA 4B6JA 1NXQA 5GWXA 5JCJA 5C5IA 5JC1A 3ZU5A 1TU0A 1RIFA 3S1AB 5IKPA 4HR7A 4R2KA 3ZW9A 4KGDA 4HAYA 5KJEA 1F9AA 1SB9A 621PA 4U3JA 4J6EA 2I22A 2OV4A 3E5RA 5B2FA 5DHUA 5HVNA 5EMMA 3SS7X 3IV7A 1FK8A 4N6OA 3RJMA 2HNAA 1KVUA 4BKUA 4M9RA 3KE9A 1SBTA 4KX3A 4MWSA 4QXAA 4LBYA 5EWJB 5BSGA 1C9YA 2FMXA 2XQGA 3OURA 4X00A 4XPIB 5IU6A 1P39A 1T3HA 2A9KA 5ALJA 4B7UA 2OG1A 1RXWA 4OB7A 4BXOB 4BO7A 1V6AA 2PX5A 1YULA 4GHWA 4D3XA 3DEZA 3DLPX 3HMQA 1U2ZA 4NAVA 2B4TO 1T0IA 3EF1A 1DRJA 3MJTA 4DCJA 4G4SO 3OTQA 4CDMA 5JS8A 1S2LA 3KQUA 1RKXA 4OOEA 3UMBA 1GQSA 2QTFA 4Z0PA 2XX3A 4M0LA 1VSBA 1YV9A 5JYEA 2DBYA 1N25A 4JUFA 5FYDA 1DZ3A 4IMIB 3K9GA 1KMCA 4G1UC 4HNGA 2IYVA 3F47A 3L4SO 3BHJA 5JY1A 1I7DA 1GYPA 2A59A 3IB3A 1UWCA 3AXSA 3JWGA 1D09A 1E2UA 1HH4A 2HUPA 1MRZA 1Y8RA 2WYIA 3L0ZA 3PUJA 1BMFD 4GYWA 4TLMB 2OKGA 5I7EA 1FSFA 2GCPA 2DU8A 1G66A 1EHCA 2QP9X 1IY2A 2IH4A 3ZNNA 1E2MA 2B2XA 2CLMB 2WAOA 5JCZA 3AUKA 3TRFA 1PZFA 3TZCA 2J9XB 4AF7A 3DHVA 4PF1A 2CJWB 4DCMA 2QTZA 2R00C 1K66A 2CV1A 1UFOA 1LI4A 2JD0A 2XOEA 3ORHA 4PBTA 3D2BA 3HRIA 4IW3B 3D7KA 2OBYA 1ZXXA 4PYKA 4H1WA 1TUGA 1M2NA 3MAJA 4XX1A 5IT9A 1NLFA 1XPUA 1HA3A 1D4FA 1JU9A 3FNGA 2DHRA 1S9HA 3G82C 1CJUC 3I1YA 2H4YA 5CEFA 3V4PB 5M5BA 1XZNA 1UQTA 5JIBA 1WMBA 4XYLA 4KUEA 4MI6A 3GJQA 1L9KA 4GQAA 5JLJA 3K2BA 1A2QA 2E49A 2QN9A 1W4BA 2UZ3A 3KQOA 1QC5B 1RI1A 2H1HA 2PMDA 1TVKA 3R1IA 5AHWA 1EE2A 3AQ4A 1PHPA 1I7LA 2AG8A 3Q85A 5DNAA 5ISMA 1BW9A 1DTEA 3PIDA 1MUUA 4GGMX 4R8SA 5LP6C 3GA7A 2WWVD 2HI0A 3R75A 3PVCA 1HT1E 2FMFA 5EEGA 1NNI1 3FVWA 3KLNA 3ODPA 2BC9A 2QYSA 4TMXA 5H0IA 5G0VA 3U4DA 1OWLA 2X8BA 4CV0A 2P3OA 3DMNA 4R1TA 4IIYA 2VHYA 3A28A 4GO1A 4YS6A 3QEAZ 2HSEA 1EP1B 3DTNA 2CV0A 4D4JA 3S55A 2O05A 2AD1A 1I80A 3MM4A 3Q9UA 4LNUB 2AK3A 3HA3A 4XASA 2EQ5A 2A0UA 2ZR7A 3O8RA 3BZUA 3NBXX 3N70A 1J22A 3GOHA 1ADJA 1NIPA 5U9CA 1TPYA 1VHLA 5F3DA 1YS4A 1ORTA 1NZFA 3PEVA 1F60A 5FOVA 4KR7A 2EWVA 3PL1A 1V8BA 2FETA 3QPDA 4LXUA 5HS6A 5IAJA 3TIFA 4TM8A 2G28A 3I01M 3UFXA 3JQEA 1U0FA 3LYUA 1JXOA 4HDKB 4QYXA 3UA4A 3EG9B 821PA 1W75A 4BLPA 2D3WA 2P9FA 4N48A 1T9AA 2BEWA 4E3ZA 2H7XA 4X93A 5DHRA 2NVBA 3RV4A 1XLWA 2JFHA 5HNKA 5CFRA 3LRXA 1QS0A 3OCJA 3Q87B 4EK9A 4DB4A 1O0CA 5JD6A 4A1OA 1B8OA 4KO3S 4GF5A 4YP1A 4FT4A 2VF2A 2CEAA 4PGAA 1V11B 1FX0B 2YXEA 3IXQA 4TRJA 3WKEA 3W06A 1DKQA 1OBVA 3AH8A 3C39A 3BN3A 3BOSA 1D2GA 1QHSA 2CUNA 3ICOA 4J6FA 1W8IA 2JFYA 1WSBA 1ZH4A 3E05A 3JVVA 4REMA 4ZOCA 3D9QX 2FXIA 2UYCA 2XNSA 4JB3A 3O93A 2I7TA 3A04A 3CX8A 2B7BA 4A36A 5HRAA 1FYXA 4DKXA 5K0JA 4L2IB 3EFBA 2OZKA 4KN5A 3CKYA 1ARZA 4CQMD 2ZJ1A 5K3CA 4I3GA 3RVMA 3CRZA 3KTFA 1T0PA 5TV2A 1DG1G 1WSAA 3P8ZA 2WFAA 1DCFA 1E4EB 1H2BA 1KF0A 2ZVPX 2XDAA 2O3SA 3DMPA 1P1HA 3D31A 3PQ4A 1AGNA 1L4EA 1IHUA 3WGZA 1VLQA 2JARA 2P78A 5KYUA 3FTFA 3MOSA 2RGYA 3JZAA 4XM2A 4DA7A 1UM9A 5ELXA 3EF0A 3OIWA 4MYDA 4QJ5A 4XZ3A 2P7HA 5JMPA 5DNUA 1G0NA 4RD6A 4QDJA 3P9IA 2O7QA 5D2CA 1Z39A 2G72A 1IL0A 3BHNA 3WWYA 2GA9A 4HN2A 3ASYA 5IK2A 4ENQA 2FGJA 2PYIA 1O4WA 3WHLA 4C4RA 5J23A 1FXWA 2A30A 3AIMA 5EJ4A 1CF2O 4WDQA 4BX0A 1RMQA 2GYUA 3T61A 3T9DA 4BNVA 3KEFA 2FXVA 1NOKA 2VDRB 3EODA 2ZCUA 5EHIA 3RSCA 4BMPB 4B35A 2CBGA 3A10A 1XF9A 3H5LA 3KD2A 4YRNA 2ZRBA 3OE7D 3OT5A 1QIKA 3A6DA 4I5IA 4MP3A 2PE5A 1TJ4A 2BTQB 2JD2A 4BBJA 3WLRA 1C0KA 3BWDD 4W5RA 1X1BA 1EQ2A 2VHTA 1X74A 1V35A 3GQVA 2NTVA 1NQVA 1H6AA 4G0ZA 4K8RB 4QEKA 1EHIA 1TFUA 3HE3A 1T3TA 3L3BA 2HSGA 3ESCA 4QXPA 5ALMA 5GONB 3L8CA 1VMAA 4BBPA 2R8RA 3JQFC 1YRQA 1M1YA 3PTZA 1SIBE 1I5RA 3IQGX 1AUOA 5FOSA 2GRAA 3I0MA 3VV2A 4AP9A 4DB2A 4N8SA 3T12A 2OGWA 3A4VA 3F2VA 2JEYA 3COZA 1FXUA 2GEVA 2E6KA 1GU7A 1UIRA 3QGMA 4MUYA 2OXCA 5KYGA 1RI5A 2WTEA 4EARA 2AVNA 3WJ7A 3ZIDA 4UKDA 1QGUB 1FSSA 2QD3A 3NHKA 4MAMA 1VLJA 5BNFA 3U19A 4H18A 2C0PA 2IF2A 5HF6A 1XA0A 4BO4A 2QX9A 1GAEO 1P9NA 2FE4A 4CQMB 4RS4A 1JNXX 1G7CA 4HWOA 4YXWA 4BNHA 1OXVA 2Q3CA 3MMZA 3TZQA 5AVQA 1YOVA 2NXWA 2QG9A 3T5MA 2QKYA 4WRRA 1GIAA 1J7JA 2V4UA 3LY9A 3F90A 1Q0RA 3E7PA 1NW9B 4LJ8A 4UDXX 1ZJ6A 3WIBA 3WP1B 1MKYA 1YZHA 3U7QB 5JWHA 3ZYCA 2F3QA 2PXXA 3OLWA 4RGVA 4DG5A 721PA 3N05A 3CLVA 4X3CA 2GKOA 3NORA 4WK4B 2RGGA 1OYWA 3NHLA 2DTEA 3BMQA 5DBFA 3NWPA 5JE8A 2PS0A 1ZUD1 1JAHA 5HZHA 4NP6A 3BPSA 2IZ1A 4F7DA 1GD1O 1G20E 2A67A 2J5RA 4M53A 4O2BF 3RVSA 1OREA 1ZIXA 1SOAA 2CCJA 2PMCA 3DVRX 5EYPA 4PYLA 5I9BA 3T1HB 3Q7QA 2Q6VA 1CG6A 2V7PA 2WMNB 2XYVA 5CM2Z 5KOHB 3MWDB 1GTZA 4L8VA 2RG1A 4UHHA 4UXHA 1CUIA 3I45A 5CLLA 1RBQA 5KQLA 2EJVA 2GK3A 2X8JA 4MNTA 2VSNA 2FEMA 1S96A 3OCYA 3VHXB 3O73A 1YS2X 3WVNA 4YMTA 2UYHA 1Y6GA 4IJVA 2XB6A 4WI1A 5K01A 4Y1FA 3PDWA 3JXEA 1IAQA 3TO5A 5LOVA 4QOJA 4IZIA 3DLHA 2O3QA 1NNLA 1YQ9A 5T4EA 4YRJA 3ISTA 4LCBA 5FWAA 1NVTA 4DSOA 2EAUA 3FDXA 1P81A 2FOLA 4US0R 3T3OA 1AKWA 2LVBA 2HMUA 4XB1A 4EB6A 2PRYA 4Q4AA 2FKNA 1WD7A 4FEGA 4NOJA 1R5NA 1WDKA 3N3AC 4RDCA 3AP3A 4EI7A 2PD4A 2JGRA 3W5DA 4IGKA 2WP0A 1NW3A 3FSEA 5CG1A 2H29A 1L6RA 4WQMA 5CXQA 1CUFA 5KPDA 4D25A 2HRDA 2O2HA 4CM7A 4G0VA 2ZLBA 3V4VB 3GR6A 1F3OA 1P7ZA 4MPTA 1ORDA 4JSRA 1AZSC 4AJ9A 1DHRA 2VCYA 3GMIA 5FBKA 3TBFA 1V7CA 3CX3A 3KQMA 4HCJA 4C01A 5B4VA 1TM3E 3RIMA 1GADO 2PKEA 3TKYA 5HM8A 4G01B 3NYRA 2ZJZA 4J7UA 4ZAZA 3VH4A 4L85A 4E51A 2G06A 1XTTA 1VB3A 2XF8A 3AHHA 3DVLA 3E35A 2XEXA 4LHXA 4LX8A 1ZJJA 2BELA 5EIWA 3BSWA 3B1XA 3KHSA 2WMYA 4KQHA 3ANNA 3WLPA 4OF4A 4KN8A 1PGQA 4YJHB 3TD9A 1ZISA 3VISA 4BTLA 1PJCA 3CRQA 3LK6A 1GCGA 3ZDEA 1UXKA 2GHQA 4BO8A 5I47A 2PQ6A 5KYWA 4ZI7B 3DT6A 1HY3A 3L07A 3NDPA 4M87A 4NL4H 2AHOA 1Z3IX 1I0LA 2CXXA 2OZEA 3KR1A 5THQA 1PE0A 2QTHA 1P31A 3AY0A 3L0DA 1U81A 2AV6A 3AJDA 3QBTA 3D3NA 3QWHA 1HZZA 3UHJA 4DADA 1SEPA 1UFRA 1NF3A 2ZI4A 1W25A 2YWJA 4C2UA 2W6ID 4TKMA 5E6RB 4P5PA 1CQIB 3OX1A 4Y6GB 1YR1A 1ZGAA 3N2KA 1ZVMA 4D97A 4FQ5A 1V2HE 2QWXA 1KBQA 2INGX 4OQXA 1RQLA 1SH7A 2MR6A 3STYA 3MBOA 1D4AA 4MIKA 4EFLA 5HKKD 1H4SA 4RJKA 1WUTA 3EB9A 4JZKA 5L3QA 2QEQA 1FNCA 4WCFC 3AEXA 2A5LA 3ZXUB 4DLYA 1ELOA 1F2UB 2F9MA 3QHQA 2I9PA 1G3QA 4RXUA 1JKMA 4O4JA 1OTXA 5H3CA 1J2YA 2VNIA 3ZTYA 1RAIA 4XIJA 1T3LA 2EGUA 1YTUA 1SQ5A 4DMGA 2GM4A 2QGFA 1VLMA 3GJ0A 2CL6X 2ZR8A 3ZHRA 5AQ1A 2BEUA 3ZGYA 4MKGA 4Q47A 4UTRA 3G0IA 4B83A 3HB1A 2NUTA 2ZS8A 4EX7A 4Y8VA 1IJFA 3Q1KA 1E9SA 1E5VA 1PQPA 4HQKA 1E1YA 9ATCA 4MX8A 1GQYA 1HE8B 2Y9PB 1WSWA 1L5KA 2O8FA 2EU8A 2OHGA 3EXFB 3TG8A 1BX3A 1COZA 1E3QA 3RIEA 3PLAE 3QNWA 3LX4A 5IYZA 2BSQA 1K6EA 5CP8A 5FJJA 4KQIA 3OEWA 1GXSB 1PEKE 3JASA 1SOMA 2OT3B 3FRIA 4IJWA 5A3VA 1T0JB 3UY4A 3KJZA 3CVUA 3LCCA 4ZA2A 5ALNA 3PUYA 5H4HA 4LI0A 1DXHA 1EG2A 1JQJC 2D2IA 3R7WA 3TLJA 1ISFA 3LQKA 3LXMA 2O8DB 1QP4A 3REQB 2YN0A 3OF2A 1HLDA 4V24A 3KSRA 3SM9A 3ZN2A 4FFVA 4V1CI 2MTBA 4JQSA 5REQA 3BWBA 3FNEA 5B3AA 4NMHA 3A6JA 3NRBA 5CLIA 1YA8A 1B00A 1EUCA 1VKJA 3CZAA 1LQ2A 1W6RA 3D5TA 3EVFA 4INAA 3DYBA 4HBGA 1GGMA 5FTLA 3PJDA 3QBJA 3E3LA 4TTTS 1DBQA 1SZDA 1FW6A 3SDBA 1LSSA 1XNRB 4EEZA 3DDWA 3PA8A 1XL1A 5BRNA 1VLLA 3SS9X 1RHKA 1NJ2A 3FJOA 1P9RA 2C3PA 4FDVA 4WNAB 4A9AA 1GNLA 1YCGA 3BKXA 2X6QA 1RZ3A 4HMQA 2QT9A 2WA1A 3C5HA 3PZBA 4Q21A 3PYMA 2P5UA 1D7OA 2WC1A 4MUIA 2LXNA 4LISA 3VDQA 3RAFC 1JFFB 1HEUA 2R5FA 3M2PA 3IAEA 5E7IA 4HAUA 4DW8A 1VECA 2AJBA 2IVFA 4IIVA 4NJMA 2M6SA 3DPSA 5C32A 3EFEA 4EA8A 1DC7A 2HSWA 5JH7B 1IEWA 3PJFA 5HIKA 4TMTA 3B6MA 4UULA 1O0SA 5AKLA 3TDKA 4RELA 4A6DA 3ZI0A 1NUHA 2HBRA 3TSCA 4HVCA 4XR9A 4DR4B 1JQ3A 2OXEA 4J3JA 5NLLA 2P9EA 4FYXA 1GL7A 3DVQX 1FDOA 3ZZNA 1NI3A 4GDFA 1X7DA 4NBNA 2PBFA 3N6VA 5KSWB 3E7WA 1IHYA 2Q6TA 2BL4A 2ORIA 4HEQA 3VR2A 2JK1A 4XSHA 2DB3A 1G3IA 1L5LA 3ZYZA 2X1LA 3PWKA 4G0OA 4X44A 5ECWA 4CU5A 4PG7A 1E3TA 4AQYB 5IJAA 1X8LA 4S1WA 3KEGA 4L57A 2O52A 4LDQA 3GFGA 1P9OA 1WNFA 2YMQA 1N33B 5C4MA 4AUEA 2ROQA 5HK9A 5SYNA 3U6KA 4RHXA 1SU7A 1NRJB 1X42A 1G9TA 1HQYE 2FEKA 1LKZA 2PGIA 2XNDD 1U0RA 2XR1A 1SQ6A 3QQPA 5AJHA 1R2QA 3AUSA 1ZXLA 3LOQA 4RPLA 2G1KA 2Z98A 4UAVA 1YR9A 5HUJA 4F4HA 2H0RA 3WE7A 1AZTA 2CVZA 2LV8A 1UJMA 3VM6A 3MQFA 3INNA 2ZULA 3V8EA 1HYEA 1NDUA 2C2BA 2DR0A 3RSHA 3SMQA 1RM0A 2YIMA 3HLKA 2ZAGA 5CITA 2ACKA 3E3OA 1OXTA 1XQYA 1ORRA 2NZ8A 2QN6A 4CM6A 2ONCA 2RGNA 4FIDA 1P0FA 1JILA 3LCRA 3DJYA 4KLCA 4U5XA 4R2HA 2G0NA 2R1UA 2PNFA 5F7XA 3TDNA 3ZZ0A 4PCVA 3MOIA 3OOEA 2GPYA 3B7WA 5DBIA 2B6NA 4HZIA 2DX7A 3BGOS 1JEYB 5T7BA 1M0SA 1X92A 2VP2A 4FU0A 2A35A 3TMKA 4P6VF 3MTEA 1GG2A 3U7RA 2GN1A 2FN9A 2OMEA 2AYXA 3N74A 2IUTA 2BH9A 4HGNA 4ZDIA 2OZLB 3DL0A 2P41A 2ETXA 4JJ8A 1C9JA 2IGTA 1WZUA 4XUCA 5B6PA 3EA5A 1DX6A 4MWEA 3H5TA 1E59A 4EPTA 4BFLA 5KYNA 2Q50A 1ZJZA 2YRFA 3LHDA 2RGWA 3OZCA 4OP1A 2J0UA 2XOKD 3O4JA 3OFND 5A2GA 1N1EA 4DCOA 5IHPA 4OU5A 2CK3A 4PZ9A 4Q4JA 3PEUA 5EZYF 4I9NA 3RS4A 1MX3A 1WEKA 2GN6A 5BN3B 4C1NA 3UCFA 4Z1OA 1UK9A 2K7ZA 3MJEA 4P4SB 1Y81A 4DLXA 3TPFA 5BSTA 1FE8A 4BB5A 2CNKA 1IM2A 3IT2A 4CYMA 3P19A 2VK1A 2WHYA 1CQJB 5E1OA 5AR1A 5HTKA 2O7NA 4R6XA 3R0ZA 2QPTA 3NM4A 4INZA 5TPZA 2VH5R 3FNBA 5KHLB 2OYCA 4ZO9A 2OYSA 3D6NB 1FP4A 3U48A 4EHAA 4WACA 3EVTA 4LOKA 1Y9AA 1PR2A 3FKJA 2EDCA 3NBKA 1UWVA 3DMTA 2C9ZA 3E2MA 2FW1A 3GFFA 4D98A 2A5JA 2W11A 2PYZA 4AY5A 4FS3A 1TA4A 4G0WA 1U0LA 1SXIA 1M9NA 3F5SA 3IAM6 2XODA 2GK4A 3JARA 1TF7A 3OZWA 5AFSA 3ADDA 2G71A 4I5DA 4CM9D 4D92A 3OLVA 4PFQA 4H16A 5ALPA 3UW1A 2B1IA 2ZIXA 5ICEA 4JI0B 3ZLVA 4AJ4A 4EFMA 3L40A 2B61A 1GKUB 2ZCJA 1HZZC 2P3SA 2D1YA 3SC2B 4A5SA 4YYEA 1RFLA 5G0WA 1YE5A 3E27A 5CPBA 4BBAA 4PAGA 2QSUA 3MWKA 5T5QA 4AMYA 2EATA 5DN6A 4FJ1A 4F4FA 5A04A 4E5VA 3F3YA 2B7LA 3RRJA 1E62A 4D4KA 1AGPA 5JYCA 3ZHSA 3SQXA 3MC1A 4OCZA 4DUZB 1JB9A 4ZVKA 3UGJA 5EZQA 3AMVA 2Q46A 2ZJOA 1BS9A 3OD1A 3NFYA 3R0IA 5IJXA 3H5OA 5M7EA 5CIWA 1ST3A 3KYBA 1KP3A 4CEJB 4ZOLB 1R8SA 4HQRA 1UOQA 4TYYA 2OXIA 4NR0A 2CUTA 4GXQA 1HNZB 1R4AA 1KEKA 2ZTSA 5T4FA 4KIUA 1JJBA 2EIHA 4JQCA 4YAEA 3W3AH 2VHWA 4IO1A 4MR8B 3ZU6A 2E4WA 3KT0A 2J45A 3L9XA 2ZAYA 2JHPA 3P2YA 2F64A 3IQDB 4M0KA 1UH5A 3NDBB 2UXCB 4B44A 4B40A 1ZOIA 4INJA 4Q03A 2VHEA 4YR9A 4FHEA 4AI6A 2VDNB 3ZGVA 3WGVA 3PIIA 1WY7A 1TQ2A 1IBRA 4KNVA 3ACCA 4ZRDA 2VYVD 3ROKA 2DT5A 3OQPA 2E5LB 2DBQA 4ROSA 1E1MA 1SHJA 1V3UA 3MINB 3F4BA 3OF3A 4BFWA 3EVAA 1GNTA 1OFUA 2PEZA 4MCHA 3UTCA 2FW8A 1GFWA 3PX2A 4WUTA 1XZDA 3EHDA 4N0EA 2SKCA 2A94A 4FHCA 2C97A 4XIIA 4G09A 4PG4A 4PPGA 4FOOA 5FL7A 3DWFA 4JJ6A 2GPTA 2CL7X 3I37X 1N6PA 1W85A 2JEZA 4NZPA 4YV0A 4ZD6A 3HU5A 2C5SA 4FOLA 4N5DA 3QKUA 1MC1A 2QIPA 3JQAA 1DCKA 1Q20A 3H1PA 3FHTA 1JEAA 221PA 1ZCAA 1UBCA 5MGBA 3RBVA 3K6SA 5BNZA 3GWZA 3WYAA 5I7VA 2I3ZA 4YECA 2QV7A 4ZCSA 4C43A 1JDPA 1U9JA 2I4RA 2VT2A 1DIHA 4X1YB 1LNQA 4WLUA 2C31A 2H3HA 4EYQA 5JPCA 4DTIA 2CYBA 1E2QA 4IZ6A 1SCUA 5TE9A 3UWKA 2HLNA 4ZOAA 5KJ6A 4BZZA 3ESDA 4CG2A 5HYVA 2YY7A 2IPOA 2YFQA 1N6LA 2YICA 4PG5A 2QBYB 2BCGY 3DEIA 2BGWA 3T5TA 3LT0A 1DADA 1PZGA 3VJLA 5LJIA 5DHSA 1AIPA 1KFCB 1WZNA 4YALA 3TD2A 1CPYA 4DHWA 5J5AA 2BFBA 1P2TA 2IEDA 3AYXB 3D4OA 1GY8A 1YK0A 3HL0A 4OBWA 5CXXA 4C5CA 3E5MA 4D6PA 2ZI7A 2C3MA 1JIUA 1VRCA 2P6PA 5EXXA 2YOFA 4CVNA 4A8TA 1JIQA 3VKGA 1BFKA 3A14A 3LTEA 4DQDA 1AKRA 1XZCA 2AYYA 2P4UA 3O1HB 4HO1X 4LZPA 5GIPE 2W6JA 2X0FA 1ZKMA 1M1XB 1XQVA 1JH8A 5EKUA 421PA 4EDHA 4QYIA 1F8XA 1Z08A 3FW1A 4R71A 2HYIC 1V4NA 1SCDA 1XRLA 3T4UA 3UWOA 1EFPB 1KDOA 5FUVA 1R4MB 2G1AA 2PHZA 4JCOA 4RV9A 3WLEA 5B5SA 5CIYA 1FDRA 4TL7A 1DKMA 2W5UA 2WSBA 4FYWA 1SJ9A 1Z5ZA 5BUSA 1KTVA 5ERXA 1KOFA 3I9MA 2Q0HA 4E4TA 1N1DA 3IAXA 1N0VC 1QV9A 2BI4A 2X2PA 3IAAA 5G3YA 3HYCA 1TJ5A 2FLVA 1I1HA 3R40A 4LHWA 1NYLA 1KP2A 3HBAA 4ZQCB 1EG7A 1OKKA 4JOBA 1LRKA 1W5TA 5I5EA 3HPQA 4TKVB 1VL2A 3DHNA 3FYHA 3L8ZA 4YN3A 3I1FA 2IK8A 1W1UA 4M37A 2PUAA 2RGNC 3KT3A 3SSOA 3FVQA 2X5KO 1L8QA 2O1XA 1ODCA 1E6WA 1HDRA 2XSZA 5EQDA 2CZQA 1NUTA 5LBTA 1LW6E 3LM8A 5F76A 3CUKA 4MV1A 4TM7A 3FBGA 3WHIA 3HP4A 1AH2A 1PQWA 1VLZA 4ON9A 4N4AA 2C5GA 3HWX1 4BNWA 4GP7A 4WOCA 1GILA 1QOZA 3CWZA 4FSXA 1ZU5A 2EKBA 4UM5A 3RDPA 4A92A 3H5WA 2Z5GA 4L15A 4TT3A 4L7QA 1I2ZA 2M6KA 4NOLA 4MR7A 4I4CA 3LXXA 4MGYR 2KBFA 2TMKA 4LMBA 3RWMB 1ZO8A 2GAAA 1F20A 1SUFA 3PD1A 1FBNA 1XNJA 2F59A 4HGYA 4XJVA 2DFTA 4B3SB 1L7PA 2QE7D 5KU7A 2YN4A 2XZLA 4RTOA 2NZUG 4KJXA 3LWDA 4L08A 1C8BA 2BR3A 4W82A 1JR3A 2X23A 5ADUS 5DBEX 4Y9TA 4CR8A 4XH9B 4L16A 4PO9A 4CQNA 1ZVJA 1YJQA 1Y8QB 1V9LA 1Y82A 4UPVA 1U0EA 4DCTA 3AEZA 2WU1A 5EQFA 4YDHB 1P2DA 3U9SA 1Q22A 4GIBA 2QF7A 3K5PA 3GW8A 4L73A 4WLFA 2ZZMA 4MMYB 4NV0A 4IFBA 5FHRA 3UPDA 5E0OA 1FFBA 2L42A 3AUTA 3F1KA 1E3DA 4HXEB 1MIOA 4BQIA 2YKGA 4W6ZA 3EDRA 3HNRA 1DJOA 4ZVSA 4AXBA 2GZSA 3M1IA 2TMYA 3NNNA 2TS1A 3U13A 1A4RA 3GFTA 5ER9A 5H83A 1NOJA 1V1RA 4B48A 2H07A 2J9RA 3HYRA 4RXMA 3IV9A 2BCEA 3RSLA 4PAQA 1GR0A 5KNCH 3DMTC 4I6JA 4F8YA 5CB4A 1COWD 2J30A 4J1QA 1ZYUA 3C7KA 1UKZA 2WVGA 5G0SA 4FLMA 2FN4A 5EHNA 3QVGA 3VC2A 5LFAA 4DR7B 1J5XA 3AI2A 3I5XA 3GO4A 4LOAA 1Z2CA 3D43A 1ADFA 1N9GA 5IG2A 4O1HA 5ICFA 3UUEA 3ZEIA 5K5EA 4WASA 2WD7A 2I1WA 4MP6A 4MA5A 1T34A 4UREA 2OCPA 1FOEB 3CF4G 4EA7A 3AO0B 1NQOA 3ZBUA 4UMFA 4BHTA 3I32A 3E53A 2QW8A 4JELA 5IBQA 2O3JA 1IJBA 2Y92A 3DFUA 5GP1A 4HX5A 4K87A 5IC5A 1X70A 1OU0A 2WM9B 4BTVA 4EKDA 1EUDB 1AV6A 2OB1A 1K7FB 2MSDB 1BCRB 2DMRA 4U7PB 1QORA 4WECA 5B6JA 3NU1A 1FFHA 5J59A 1E3WB 3BE4A 2XRFA 4C4YA 1THZA 2BGIA 1UOEA 4QFDA 3FPFA 2X6TA 1V45E 1H2XA 3DD5A 2NO1A 3QVVA 5CDGA 1ZGHA 1Z36A 2PZBA 4AG6A 4RANA 2ODBA 3G0CA 3L5OA 4DG8A 3F74A 5M29A 4W8OA 3R6WA 5DLDA 3H1BA 1E63A 4RDHA 2IEGA 2G82A 4LRSB 4D9MA 1QNFA 3DVAA 3NYIA 2A8YA 2PGAA 1KEEB 3CH4B 1U5CA 4PQFA 3X2FA 3PKIA 3NUQA 1PWZA 3RBZA 3X2SA 1XZFA 3F46A 3B89A 2VYQA 3FPCA 3IE1A 1M34E 2R8YA 4BDSA 2BFNA 4YCCA 2ZBFA 3ZLTA 4URHA 1EX9A 1OASA 2DKNA 1AQJA 2XCSB 1VRWA 4PLHA 4INOA 2IQIA 5DNEA 4JWKA 4NRDA 4BWFB 1ISPA 1L4MA 1K3FA 1KO8A 2QUAA 3DZBA 5B4UA 5BRJA 3B6IA 3S2UA 1K3UB 1JT9A 1EX7A 3DG9A 4BMDA 4E5KA 1BFDA 4NIMA 3GT3A 1TL7C 3QEOA 3GBPA 3AZPA 5IJ0B 2QK4A 3HACA 3PSHA 3NH9A 4CTMA 2JI6A 1XA4A 5DYNA 4L4SA 4F4DA 2H1RA 2PAFA 1CQWA 1SBHA 4JIMA 4OP3A 4KDEA 3ABZA 3PC7A 3CH7A 1AKNA 5TQ0B 1ZSVA 1YR3A 2ODAA 4LRUA 5T6MA 2NV2B 3PQDA 2WP8J 2RGUA 2RB5A 5BR8B 1V6CA 1NA5A 3R23A 4QHSA 3UNXA 3N58A 2WW8A 3GIWA 1OU4A 1XCLA 1NATA 2ZYAA 3DCNA 4M1OA 3M3PA 3IS3A 5LU8A 3LRTA 3KQNA 4RD4A 1EFDN 1L5HA 4GSYA 4B7CA 2WWYA 2LNDA 4UHCA 1DJNA 5D8DA 3KPYA 3HBFA 5A5FA 2NUBA 5GPBA 1P1KA 1E2KA 3FZYA 3LO8A 1W2HA 4EW3A 1PQYA 2X7HA 3I2HA 5AM5A 1R5BA 3W8NA 3GJTA 3UXHA 2CD7A 3ZWQA 4BNMA 3FMPB 2ODPA 4ZI2A 3H1FA 1WUHS 1Y5LA 4PZYA 4F3KA 5LM3A 4N5MA 4N0MA 4AY2A 3B6ZA 2DH5A 2I87A 3LBIA 1VGVA 3EVBA 3QLVA 3WBJA 4K6HA 4RXTA 5IKEA 4B45A 4IV0A 1VP3A 2CHGA 2QUIA 3EK2A 4XQGA 2C2XA 4H6XA 2Y0EA 1N2JA 3E7FA 3LWNA 5K0LA 1ECGA 1PEYA 4A03A 4XM0A 1JIVA 3VR5H 1YBHA 4JUCA 4WVFA 4XJSA 3VR6H 4YDRA 5L3ZA 3BEOA 2V7QD 2CNNA 5CYOA 4ALIA 2H16A 4OLBA 4J2HA 2PCJA 3M6FA 1DV2A 2Z95A 2ZYDA 4HKTA 3MGBA 1GFZA 5I7AA 3V97A 4BMXA 2YASA 1I4DD 1O9HA 2BFEA 3GLIE 1OAKA 4HXFB 4CKZA 3V2HA 4ENRA 4O4IB 5JATA 4GEKA 2EOAA 2WWRA 2QL7A 4PPQA 3NAMA 3OIGA 3GLHA 1AS2A 1NPTO 2WSMA 4F72A 3S2FA 3DUFB 1N2CB 4CLDA 3EGDA 4DA6A 5HQ3A 4P92A 5A05A 1X15A 3AT1A 5LP6B 3PQ2A 2WM3A 4NBVA 5BXYA 1RXSA 1Z9BA 3DS8A 4GQIA 1SURA 1XT6A 4NSNA 4ZYZA 2WKQA 2A4KA 2QZ9A 1KYVA 3CT6A 2G1JA 1TJNA 2AA3A 1VLVA 2GNAA 4DR2B 2JHAA 4K6OA 3IQIX 5FCDA 1PT7A 2WU0A 2AE1A 4UM9D 5IUNC 2V55B 1OLOA 3CFYA 2P0AA 4UVHA 1RYEA 4FI3F 2WI8A 1B6GA 3GRAA 4U2KA 4I08A 2M9MA 4KBFA 4ZQIA 1ZLYA 1T5DX 3NKLA 4DJ5X 1KZGB 3UV6A 1AKVA 2V7EA 5TC4A 5JEEA 2IA5A 4LY0A 3QZUA 2GDJA 4MYSA 4E70A 1ITZA 4JVSB 4OHVA 3DTTA 3I6IA 3FOEC 3DSRA 4ZVUA 3MMNA 5I9IA 3I72A 4HFMA 2FMKA 5G2OA 1TKAA 4Q7LA 5J2UA 2ASVA 2PUWA 1X87A 5FOWA 3HTXA 3PEYA 1Q5PA 3I8SA 3GRZA 1RYHA 3GA0A 2O8BA 1C4WA 3IEKA 3AR9A 1XU9A 4KGVA 4O0LA 4TUYB 1O1YA 2I29A 5KTSA 2HSDA 3VJRA 3H17A 1B15A 2Z4SA 3W4IA 2C29D 5KWEA 1T3GA 4RSRA 1I2CA 3AUXA 1K98A 5EP4A 5IWCA 1LVGA 4MWOA 1EE1A 1Z6AA 2WTBA 4ZVPA 4CR6A 5JCJD 3IT1A 1EVIA 1GPDG 4B3MB 4WZAB 3VSEA 3U80A 4FWTA 1RKUA 1RQPA 1YQGA 2WPNA 1ULTA 4JN6B 1MXHA 3OCVA 4B32A 3WK4A 2BLLA 3TECE 4DV0B 4JJFA 4IDBA 4NABA 4K3UA 2A14A 3H4TA 3QI7A 2YINC 5K3DA 1J0BA 4PC2A 5EGNA 1GG5A 4JXKA 2A33A 4KX5A 2RIRA 3KSMA 1U4NA 1HE4A 1UDBA 1ZWKA 4OBEA 1RBYA 4R3NA 3V7FA 4BN4A 5LNK6 5GJCA 1DVRA 1FNSA 3I04A 4X1KB 2V1UA 4LVOA 4UMDA 4I5GA 3D6UA 4MJXA 2D0DA 3SICE 1Q0TA 5IASA 3ZG6A 1XHEA 1IZZA 3DMRA 3R7BA 2GBPA 1IPHA 1Q83A 4NJEB 4Q9HA 3SPXA 1R6DA 3AERA 1SKBA 4XFDA 1TPZA 1TF5A 2VBCA 3TQHA 1MJNA 5IM4F 3T1TA 1T36B 4I14A 5U4QA 5D3ZA 2RK6A 4UM9B 1E3IA 3A25A 1OD6A 2GN0A 4G2TA 4M8IA 3SQMA 3WYFA 2BBSA 1TW3A 3CRVA 4HH4A 5FR1A 1TI7A 2IV3A 3G89A 4M1ZA 2QTWB 4M2LA 1CY8A 2ZVJA 1GDTA 3LHFA 4KDFA 3K4HA 5CFLA 1MEOA 4YX9A 4GVXA 3ROMA 1I32A 1LFAA 1T13A 2EKZA 1DDGA 1T2AA 3QUQA 3VAAA 4XB2A 5AW4A 3IIIA 3A6LA 1TQ6A 3PSAA 4WY8A 4NBTA 2V9ZA 3PE3A 1MABB 1XP8A 4P2BA 3CUEF 3I9LA 4G56A 1KNXA 4DLUA 4A27A 2EZUA 2NPIA 2UUPA 4LDPA 4NZOA 3TRIA 3C24A 4B9AA 2YNMD 4ZYLA 3VO1A 3DQPA 5EWMB 4C0WA 2Q9CA 4L0MA 1PJ3A 1DEAA 3G68A 3P27A 3KV1A 3MT9A 5I48A 1ZGZA 1PR3A 3U2QA 4HFJA 2DTDA 2IUSA 4MKIA 4TXLA 3C3KA 5ES4B 4FYMA 4RVNA 3CXUA 1CERA 3K0BA 1T5BA 1U7UA 2ECQA 3V4OA 1QHHA 4GKJB 4BTEA 1XKQA 1XNHA 3NBYC 1J4AA 1FMJA 2GYYA 1FB5A 1P60A 3PKZA 4YCAA 3TSYA 4EUHA 4J0CA 1XTSA 2P67A 4GM0A 2ETVA 4LZOA 2A58A 4B8WA 4PZAA 3R9KA 3FMGA 4L7VA 1NLMA 3DONA 4U3JB 2EG9A 2HIHA 1QG0A 3P4YA 4MS3B 4E5PA 2P6RA 1KFKB 3MYYA 3R41A 5AI9A 1RADA 1KFJB 4ER7A 1KVQA 4MCJA 2X58A 1Y3BE 4XGQA 3V7YA 5CM8B 1MAVA 1QIIA 5HJ5A 4EGAA 1JQDA 3EVDA 3QUAA 2CDNA 4EYEA 1F9EA 1XRQA 1YCDA 3NDRA 3QJ5A 4H4CA 1RPJA 4MUXA 1C4OA 1XK6A 1F38A 2JIMA 4PSUA 1HDEA 3Q4GA 4J0FA 4UJ3A 1AB5A 3D8SA 4NI5A 4C7JA 3TLBA 5FPYA 3LUGA 1R37A 4QO8A 4LG1A 4KI0A 4J91A 4X66B 2O0JA 3IVCA 3H8VA 4OYRA 4RZ3A 5BYJA 1J8QA 2L82A 2Y1LA 3OC0A 5FTWA 4ZEXA 4DWJA 1QR2A 4FDAA 2CKMA 2HPHA 2YJ4A 1X14A 2ZE6A 4M4SA 4HRXA 4UXIA 2NTNA 3FI0A 4LXHA 4XM1A 2Y71A 3T3EA 3AZOA 4AMBA 4TS4A 1J2TA 4MB0A 5E4YA 3GT0A 1MOQA 1VPVA 1JRLA 4W7IA 5EY5B 2P0EA 3FSJX 3NX4A 1MOZA 1UJCA 4MUHA 3ZJ5A 3BJRA 2YZGA 2PRIA 2C42A 4H08A 5J2TF 3QLVC 3TBHA 2VUIB 3HJTA 5LZ2A 3HCOA 4KQEA 5G1OA 1KQGA 1FTQA 1ZS9A 2BD0A 4GW3A