2ZRQA

Crystal structure of s324a-subtilisin
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
QPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Crystal structure of Tk-subtilisin folded without propeptide: requirement of propeptide for acceleration of folding
pubmed doi rcsb
source organism Pyrococcus kodakaraensis
molecule tags Hydrolase
total genus 114
structure length 318
sequence length 318
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2zrqA00
1TMGE 1Y4AE 4ZOQI 5FAXA 5FFNA 4OV6B 1HT3A 3QTLA 1BFKA 1Y33E 4AKSA 1C9MA 1EGQA 1AF4A 1V6CA 3WIUA 1NLUA 4C3VA 5B1DA 1KDYA 2X8JB 5ARCA 1SBTA 2PWAA 1S02A 3LPDA 1YJBA 2PWBA 2X8JA 4WOCA 1C9NA 3VTAA 2Z56A 1AVTA 2ST1A 3UNXA 3SQOA 1GA6A 3QFHA 2TECE 4M1ZA 1KDZA 1SELA 1GNSA 3GT3A 4LVOA 2ID8A 2P4EA 3AFGA 1CSEE 3AJ8A 3I37X 1V5IA 1KE2A 3TI7A 2W2OA 3A3NA 1R6VA 1SBHA 3AJ9A 1GTJ1 2PQ2A 2ZWPA 4JP8A 3PRKE 2SECE 1SIBE 2ZWOA 1SCNE 3OSZA 4FONA 1PEKE 4ZARA 2W2MA 3HJRA 2HPZA 2Z58A 1SIOA 3DDZX 1SIUA 1WVMA 3F7OA 2PYZA 1TK2A 1JEAA 1NDQA 2DQKA 3TECE 3CO0S 3LXUX 1Y9ZA 5CW1A 1OYOA 3DE3X 4KB5A 1SBCA 3DE5X 3DYBA 2WUVA 3BGOS 5JXHA 3DE2X 4NE9A 5AQEA 1SUCA 1BE6A 3WQBA 1Y4DE 2Z2XA 1YU6A 1T1IA 3Q5GA 4HVLA 3WIVA 1AQNA 2WUWE 1THMA 1Q5PA 1GNVA 4HX2A 3GT4A 2E1PA 4MZDA 3PTLA 1NDUA 4BWGA 5JXGA 3VSBA 4OMCA 3LPCA 3DE4X 4KPGA 2SBTA 1TECE 1YJCA 1SUEA 1R0RE 3EIFA 1OT5A 4I0WB 1GA1A 4DJ5X 1TM3E 2PKCA 2HD4A 1SUAA 4CG0A 2IXTA 1DUIA 3DWEX 5AVJA 1Y1KE 1TM1E 3DE0X 4H6WA 3DE7X 2DP4E 2W2PA 3EDYA 1Y3DE 4Z2AA 1TM7E 1BFUA 1KE1A 2DUJA 5ARBA 4H6VA 1SCDA 5AVKA 1WMEA 1YJAA 1AV7A 2XTJA 3WHIA 1ZVKA 3Q40A 1P8JA 1R64A 5JXIA 1C3LA 1Y3BE 2Z30A 3GCXA 1UBNA 2Z57A 3I34X 4YN3A 1AU9A 3D43A 5I9SA 1VSBA 1AK9A 4AKTA 1SUBA 1BH6A 3SICE 3DVQX 2PMWB 3VHQA 3DVRX 3CNQS 3I2YX 1SPBS 3L1KA 1Y3CE 1Y3FE 1SN7A 3F7MA 3F49S 2ID4A 1SUPA 2G4VA 1T1EA 3DW1X 3QMPA 4LVNA 1SCBA 3T41A 1XF1A 1SBIA 3DW3X 3A3OA 4RYDA 1WMFA 1GA4A 1TM5E 5JMOA 1ST3A 1LW6E 1PFGA 1GTG1 1BJRE 1ZVJA 1S01A 1SUDA 1C9JA 1T1GA 2Z2YA 2ZRQA 3D9QX 1IAVA 1TO2E 3VYVA 4WOBA 2QTWB 1P7WA 1SCAA 2IY9A 1PTKA 3BX1A 4KG7A 4GI3A 5B1EA 1GT91 5ARDA 3DE6X 1GCIA 1BE8A 2XRMA 4CFZA 2WWTA 2W2QA 4OMDA 2Z2ZA 1MEEA 1SVNA 1A2QA 4NE7A 1DBIA 4NMXB 4DZTA 3BPSA 1SH7A 1KDVA 1TO1E 5FBZA 1PJ8A 2PRKA 3P5BA 3GCWA 1Y48E 1SCJA 4J94A 5SICE 3LPAA 2V8BA 1GTL1 5JXJA 2B6NA 1ST2A 2SICE 4H6XA 3DVSX 4DWWA 1S2NA 4K8RB 1AH2A 1SBNE 1CNMA 1IC6A 3A3PA 3VV2A 1WSDA 2WV7A 3ZXXA 2SNIE 5K7SA 2W2NA 3I30X 1MPTA 3VV3A 4CFYA 3H42B 3DE1X 1WMDA 1TM4E 1Y34E 3EE6A 3ZXYA 1P7VA 4C3UA 2GKOA 1OYVA 3TI9A 5AMXA 4B5LA 1EA7A
chains in the Genus database with same CATH superfamily
5K3CA 1J9ZA 2QN8A 4IFTA 2BGTA 1PW5A 4MA4A 4BLTA 3PC4A 4V1CB 5COBA 2HUPA 4JLPA 1CG6A 4GEGA 1KL7A 3O1LA 4JOBA 5FFNA 4LRXA 1OH8A 2GA9A 4V0RA 1WZCA 3WMGA 4E1VA 3UAZA 5JAPA 1CY1A 1A2OA 1V6CA 1VP9A 3JVIA 2X9NA 3TJMA 3WIUA 4CM3A 1QGUB 2WJJA 1ZP6A 1TF7A 2OEPA 3P96A 5B1DA 1JAHA 1TFRA 5KOYA 2QBYB 3M1LA 3JVUA 2R8PA 5ARCA 4EX7A 3LCVB 4WOCA 1VYTA 1Y82A 2ECOA 2REBA 3DVAA 3WIDA 1TYEB 5IMSA 3CVXA 4TX1A 1UBFA 1ODLA 1P2GA 2JNWA 3GVIA 3ONDA 3VXKA 2X5JO 2QVBA 2AYXA 4F5YA 5DWDA 2IE0A 2AZTA 1OAOA 4DSOA 1G63A 4EFNA 3M81A 4F2PA 3W8EA 4QQFA 1OC2A 1U7PA 3M4YA 1UXIA 2CLFB 4J49A 4XTRA 1J5EB 1XHEA 3V1MA 1V7ZA 4AN4A 4B0PA 4KPFC 1YJ8A 1BGXT 4JEHA 1RLMA 4BIMA 1EJ6A 3C3CA 3E3NA 5HCNA 3S0JA 3AZPA 1O87A 3GT3A 1G9SA 1U8EA 1PL7A 2AOTB 2I3ZA 4ZAGA 1DMSA 1L7BA 1NV9A 2CZGA 3RJ9A 4EKNB 3PS9A 5IAGA 2FQYA 5F5LA 1NF9A 2OKCA 2X5NA 3G02A 4J1SA 4DLZA 1H5NA 4F8JA 4J2TA 3R6WA 4FFSA 2J07A 5AICA 5KAMA 3QXGA 1NUPA 3UHOA 3HB0A 4E4RA 2VF8A 3AUTA 4MVYA 1UQRA 4DM7A 3IVXA 5A3VA 5CG1A 4RK6A 3ZG6A 2WJ6A 1SVMA 2Z04A 5EPUA 5K0NA 2ZR7A 2E82A 4ZCSA 4XX1A 4PRLA 1VHWA 3Q9NA 5U9CA 1N78A 2VHJA 2I4LA 5A5GA 3U7HB 4C4TA 1OLXB 1QYRA 5BR8B 3BCRA 1NVGA 3OQVA 4KXVA 4U8GA 1U0HC 1DC7A 1L5HA 1MHPA 1SA0B 3E81A 4EEXA 5LMNB 1KEEB 2X86A 3MS2A 1MEJA 4P4UA 1Y9JA 4HAOA 4FWIB 1R5NA 2PSFA 5IEJA 2EZTA 2QZSA 2VDUE 2R00C 5FPQA 3QFCA 1RKBA 2B61A 3AL2A 1AZSC 1N2HA 2CB9A 4PS1A 5SYAA 3X43A 1KBZA 4UNQA 4H31A 1JHAA 4IG4A 4XJTA 2ICAA 2NV6A 3LQ1A 3UAXA 3O2SB 3PWZA 1AT1A 4F72A 2C1ZA 1HKUA 2JFHA 5EJ6A 2A9FA 2FKNA 3J81A 3QW2A 2VAWA 2CXRA 2J32A 3KXLA 1X0VA 1Z07A 2QN9A 3CF4A 3DDZX 5FTKA 4B6SA 1E9FA 2XOEA 3B6ZA 4BFCA 4UM9B 5CX1A 2C4NA 2HGZA 3GMDA 1F8FA 3F7OA 3A4YA 5IFLA 1L5GB 4PINA 1PS9A 3C85A 4GWGA 2A9PA 5SYNA 3JPWA 4TS1A 3AJRA 4UHFA 1CUHA 3PJFA 2EJUA 5D6OA 3VHRA 3CF6R 1I2ZA 3T12A 1ID1A 3U3DA 3EXIA 5INTA 3RVPA 3VDNB 4DMKA 2ZITA 1SC6A 4M37A 4O1HA 4NZOA 1XELA 1ZZGA 2ZB7A 3MNFA 3GBPA 1EKXA 5KQLA 1NVBA 3ZE7A 1ZXLA 4U9IS 4NCIA 3ML1A 5CIQA 3SIRA 3WSTA 1SBQA 1OVGA 2C4TA 3CB4A 4WFJA 3LYHA 3FFAA 3EHEA 3WLPA 4PYKA 4GMDA 1LJ8A 2GZDA 4RADA 2YS6A 2IHKA 1EU1A 5I48A 4XJXA 1F2TA 2ZUVA 3FMOB 5FA8A 2CCGA 1JFFB 1K4MA 2EFYA 3FUWA 3B8EA 4X24A 5CYFA 3GI1A 4Q82A 5H9VA 3L02A 2ONCA 3FVWA 3JQDA 3IBTA 3V3KA 1E7QA 2O7NA 5FOQA 3KR9A 3GJXC 5ECYA 1EDBA 2RJ3A 1F60A 3LC1O 3ROPA 1WB9A 1AMUA 4TXMA 3AFOA 4HMPA 4EO4A 2HCBA 3L6EA 4NE2A 4EUNA 5THKA 5DSXA 4CUZA 1U2DA 2Y3IA 2ZIXA 3M7IA 3R3WA 3BN3A 4BVJA 4D3ZA 1Q0SA 2XMQA 2Z3ZA 3BWCA 4RFSB 1DHRA 4OHBA 5CLIA 5DLDA 4MVJG 2REOA 3U3ZA 4I55F 1E3TA 3H2ZA 4UVDA 2GK4A 1YKSA 4OTZA 4ZQBA 1PZMA 1VXRA 1OIXA 1QE3A 1T8SA 5HNKA 3JQBC 1PS0A 3DJFA 5FTJA 3VMMA 2QGZA 3I01M 4HSEA 2YRFA 2JRLA 3UAVA 4UEKA 3IIEA 3B60A 5BXYA 1Z33A 3AZQA 4HRAA 3RREA 2AFIE 2VYVD 3GLIA 2OXFA 2P2ZA 2SHKA 2PGXA 1E9AA 1FFGA 2DBZA 2R60A 1T91A 4B3BA 4DF3A 1M76A 3ZCQA 3TW4A 3BJEA 4FYIA 1HDXA 1UDRA 3TWOA 1NQTA 1M66A 2E89A 2XWBF 1BU8A 3R3UA 4UTPA 2QD4A 2GSDA 3CZ4A 2BKVA 2D2FA 2D2IA 2WINI 3CZPA 1WUIS 3GN1A 4KNWA 4QE3A 2W70A 3BIOA 1S7CA 3R0JA 4BNUA 3ORHA 1BHSA 1U1GA 1T1JA 4OK3A 2WWYA 4AO7A 3RD5A 4K9MA 1H0RA 3ZU3A 1NL3A 3OKAA 4FXOA 1KMCA 5HOQA 4B9EA 1CP3A 1PNTA 2QWXA 5JSZA 1ZJYA 3DEIA 2POCA 1HOTA 4ISCA 3VR2A 1UKVY 4PFJA 1AGYA 2Q2QA 4YXWD 1G8MA 5A62A 5K4HA 3JATA 5DYTA 1RTTA 3R7DA 4YP0A 3ZTYA 2PD4A 5GIPE 3ZLBA 4W8OA 4DEXA 3V7UA 1YE5A 2BOVA 2C78A 2OSVA 2BEUA 3L6UA 2XVZA 1XI2A 2YZKA 1L5SA 2Z2JA 3GEIA 3IAUA 4AJEA 4F3KA 2CYBA 3OBIA 5I47A 2X5OA 1R5OA 5GJCA 5E9QA 1PT5A 3OQ6A 1FP4B 1P4GA 4KVAA 2OCKA 1R6TA 3QG1A 3RJ5A 5TS3A 4JI3B 3RVKA 3VKVA 4ASUD 1UWCA 2Z4TA 3IKLA 5F64A 3VPAA 2W2TA 2X0FA 3OM8A 1Z25A 4DJEC 3TSOA 4C6HA 4CKYA 1ZXXA 5B53A 3IEMA 3TW8A 3H1BA 1JHPA 1I2BA 1YQXA 2OK8A 2QTLA 2YZGA 2OAP1 3GIDA 1LLCA 3G2KA 3QFFA 2P62A 4RANA 3EXFB 2H1LA 4TLEA 3DHVA 2NUBA 1GSHA 3F78A 3KCQA 3LC2O 1PJTA 4U0KA 3VH2A 2ERCA 3P26A 1DZ3A 2DBRA 1KO1A 3BYZA 3EQ6A 3F67A 3I76A 3PGVA 4WFIA 4YXFA 1Z2CA 3SJBA 5I01A 1KOFA 2FEWB 4GYJA 4FDMA 3Q1KA 4TYNA 4ZRNA 3N5CA 4O4HF 2W90A 3D6MA 3RYFA 4NYJR 1C4KA 2JI4A 4E5VA 1P4SA 1P3JA 1R9MA 1VIYA 3K0AA 2QX6A 4COKA 2MDTA 2QZZA 3I83A 2O8CA 2V97A 5K6AA 1ADBA 3EVNA 1DWUA 2XEXA 3NBFA 2VBCA 1QPBA 3PR2B 3Q40A 5EJMA 3QA3E 4EY8A 2C3UA 2RSLA 4LOJA 5IKOA 4IJWA 3X1KA 4OU4A 1FVFA 3THWA 2ZPTX 2CDAA 2VL7A 4EA7A 3UJNA 2AVNA 3BDIA 3K32A 5DI3B 2Y0PA 3KSBC 3S5UA 1XVIA 2IUEA 4LJ4A 1OZFA 3WICA 4EUSA 4YN3A 4MW0A 1PJRA 1URPA 1XKLA 4LSZA 4D02A 1JB9A 1MFPA 4WKGA 3T5PA 4CLDA 4I8XA 2WTUA 1AOXA 1ZESA 1CZKA 2XVMA 3BIJA 5K2MA 1VSBA 1HG0A 1EFKA 2VRWA 1IIRA 4Q5IA 1FEZA 4G84A 1M74A 5FWXB 1SUBA 2P8SA 4BP3A 2F3RA 3HBLA 4LHVA 2HK9A 4KIUA 3VHQA 2DG2A 3LKZA 1HFKA 2B1QA 3CNQS 1JAZA 3DXXA 3V8MA 5ADHA 3VZDA 1Z8NA 5EJAA 4NWIA 1H93A 1A71A 3KFVA 4B7AA 1UPBA 3Q6IA 4Y2XA 1N5LA 2ADMA 3E05A 5KYNA 4IRXA 1VSQA 1H85A 1E5LA 2NSYA 4Z3OA 1K2WA 1EQAA 4NAHA 1MQAA 5ALYA 1WABA 5JFGA 5C18A 2JGDA 4H08A 4DQDA 1DELA 2BY4A 2QVCA 1V4NA 4PAWA 2WJIA 1I32A 3AVVA 2F8TA 1UDBA 3JPYA 1CT9A 2O9JA 4LTNA 5CVDA 5EP4A 4A6EA 5ICEA 1U8XX 2Z6VA 2R7MA 2Q3JA 1CEQA 2BE7A 5JPCA 4ZV7A 1QWOA 5LWHA 4P5EA 3VYUB 1M7GA 3DMTA 4H27A 1CZLA 1TQ8A 3AX6A 2C04A 1FP6A 1RFGE 3HVUA 3QVOA 4GIBA 3IMKA 3M5WA 4FCVA 7REQB 2CV2A 2Q27A 1E2GA 1EX7A 6ADHA 2QV7A 4QBTA 2AQIA 3TD6A 1JDBC 2VP4A 1X7GA 5JPIA 1JHMA 4Y2JA 4NOLA 3WLLA 2YWXA 3LU1A 4IGAA 3TG2A 1USVA 1YR1A 2NYRA 3JAKB 3JQ7A 1GTG1 2KBEA 1GPDG 1UBTS 2VXYA 5E7QA 5FNVA 4BEJA 1WD5A 1I3OA 3IMGA 3W6NA 1THGA 1Z6GA 3DTNA 3FPHA 4TSKA 3TZQA 2O3RA 4AB1A 2RHDA 2O23A 4ZCRA 5E4YA 2EHDA 5KX5B 5JAHA 5BQXA 3BREA 2WU0A 3OPYB 1GFWA 4M2LA 2PXHA 1NR5A 4AYWA 5BOSB 2IXFA 4P1ZA 2GJKA 1OJ7A 2GO7A 3P0FA 4MB6A 3L7OA 4D74A 4R3NA 3CVVA 4GKJB 4YRLA 3AF6A 4LV5B 3ETNA 4FYVA 3FNRA 4RY9A 4OU5A 4XVRA 4BO4A 2EV9A 1FP2A 4Q7JB 1A4UA 3M6XA 5DCUA 2B1RA 3FLMA 5A9TA 5JC8A 4IBOA 1DIBA 4YMIA 3L4EA 3PFWO 1BOOA 3PRHA 4O4JF 4P32A 4XFKA 4DG5A 4R8LA 3DLIA 3IUSA 3KB8A 3BX1A 4GNRA 4I1PA 3ND9A 4CEHB 3P9ZA 4G09A 1CY6A 3DPSA 2BR5A 3JRNA 4G23A 4OGWA 1XDBA 2P6RA 1Z5NA 1P1FA 3F6RA 3MRTA 1BS1A 1G8HA 5EFZA 4LX8A 1I4DD 1L7PA 4WSOA 4M1EA 5FBVB 3LM8A 1ZNZA 4W82A 4TRRA 1OX6A 3B1WA 4Z4CA 1NVXQ 1II9A 4DYHA 4V39A 1JR6A 3UH1A 1YH3A 2Z4SA 3KJNA 1SVNA 1J2JA 2A9JA 1KMIY 2OR3A 2VWQA 5HF6A 1DWPA 4HDCA 4AJLA 1E3MA 3WL7A 1ULAA 1JA1A 3ITDA 2IYRA 3QFSA 5IT5A 1C8KA 2O2IA 4KRGA 3U3OA 2F43A 3WZMA 4J3JA 1XR3A 1Z12A 3I9OA 4UAUA 5JH7B 1PKEA 1L5ZA 1RYEA 1E0SA 1XDUA 3HEMA 1FP7A 1EG7A 1Q2UA 1ULHA 2OWDA 2ZJ8A 1VSVA 1YUBA 1Q2XA 2BTQB 4M8NE 3SR0A 1WKBA 4ABYA 1A72A 1XEXB 3OP1A 4J94A 4ANFA 2FF7A 2C4KA 1QC5B 4IMJB 2IPXA 2GXAA 4OHXA 5LQKA 1K63A 3A6JA 2ASVA 1H4SA 3GARA 4YNBA 4WNIA 1IUOA 1C29B 5IXYA 3HRIA 3EDQA 4LI0A 1OI3A 1SU7A 3DO5A 1TPYA 4N6OA 4EJ2A 2G09A 1UC9A 1U8TA 3DFZA 3R4CA 3KCNA 4AMUA 4P0PB 2E18A 4Y8VA 4MUGA 4BFXA 2EWWA 3KR2A 2QX7A 3OKPA 5AJYA 2FI1A 3VH3A 4B7XA 2QN3A 3BHIA 5JC1A 1KZ9A 4PLGA 2OBYA 3MINB 1GZ5A 1ZJ4A 2NZ8A 2WV7A 5LSAA 3ZXXA 4EPTA 3ROMA 2AFHA 4KOAA 2XY4A 3C3KA 3G88A 1CPYA 2NADA 2ODBA 3I01A 3CH7A 4RHXA 4YQYA 5EE9A 3SIPA 4P98A 1E66A 5AHOA 4RS4A 1F8UA 2WIFA 3LVBA 4MUFA 1UP4A 4BO9A 2UYQA 2G8NA 3PFGA 4G1EB 1YTUA 4NRDA 4DT1A 4W5HA 2PLNA 3TLZA 1ZI9A 4HWOA 2B5OA 2WZBA 1W47A 3R20A 1OCEA 1T2UA 3DAFA 1XTRA 5IM5A 4F1KA 5KEIA 3T9FA 5DDIP 4K6GA 4Q1BA 2GSWA 4KLAA 2WF8A 1YZUA 2D1RA 4FN5A 3IILA 4TVKA 3WGIA 2QG4A 1OFUA 1V1MB 2WOOA 1D9XA 3FF4A 4KVGA 3EG5A 4OHCA 4UXHA 1HXHA 4IWNA 3H87A 1PAUA 3ZXYA 1YQ9A 3ZHRA 1YV9A 4OK6A 3NC4A 1D4ZA 1E60A 1UODA 1PFVA 4I1YA 2PMFA 2C5EA 1YR9A 4UEOA 5AM4A 2E3JA 1B1CA 4MKZA 4YVFA 4REMA 4DRXA 4AJ2A 3G79A 1EFRD 1A2KC 2YWJA 4MAMA 2E49A 4X0EA 1NP6A 4XPZA 4CLOB 1QCCA 1TMGE 3W78A 2O06A 1NN0A 1TJNA 2CNOA 3HA3A 3T5MA 3ZQKA 1IEVA 1JJVA 4H1HA 4CM9A 3B53X 2QI9F 2Q8QA 4UBOA 3RLIA 2HZBA 2PMEA 1QB7A 1AO0A 2QNBA 4L7QA 1NYTA 4Y2SA 2Z1DA 1L2TA 3OE7D 3QITA 1DS6A 1TQ4A 4OA5A 1ORIA 1QORA 2CWDA 2VXOA 1S02A 4X9XA 3VO8A 4I7EA 1SG0A 2SKDA 2HF7A 2X8JA 3FSEA 3AKCA 4NK4A 4EELA 2C4VA 1O95C 4BN4A 1K66A 2GJSA 3Q3GE 4PPGA 4LNUA 5JS6A 3F73A 1QQAA 1GG2A 5G41A 3UWDA 2IS1A 2WR8A 5DBFA 1UANA 3VMFA 1GPKA 3BM5A 2QPLA 3HRKA 4E5UA 3HYLA 3K2EA 3TOZA 4RH3A 2O6LA 3G9QA 1DQPA 2JFPA 4JU9A 2WTEA 1KH1A 4B2LA 4ABTA 3A58B 3IP6A 2XDQA 4ADSG 3VHXA 3QEJA 1PR0A 1Q1AA 2X40A 5EUMA 2CUKA 2VHXA 3SBXA 1WE2A 1ILWA 5LZ4A 1FSZA 3OOJA 3D31A 4N76A 3IIIA 1DBQA 4QSMA 5AOCA 4JLJA 1Z0AA 3GRPA 3ZK7A 3PK0A 1DO8A 3ZZUA 4F3YA 3THOA 4CL3A 1QP0A 2X4LA 4OVKA 5HBGA 1Z6QA 2RH4A 3RWOA 1GGEA 4D9NA 1E62A 1PQ4A 3NTLA 1LRKA 2I6QA 4L22A 4ND8A 2OXTA 3K53A 3NHYA 4H3SA 1TAUA 4ZOEA 2AD1A 3MJ4A 3SR3A 1U98A 3AHGA 3PDJA 4XWAA 3TI7A 1I7SB 3THYA 2V0CA 2ISCA 1CF2O 2P2SA 2F8SA 2VPQA 2WYIA 1A77A 1C7IA 3I04A 4UEWA 2ZOSA 2CJPA 2PX3A 4GMXA 4WZZA 1GXSB 3PXXA 1P45A 3GPLA 1CE8A 1LPNA 2GVNA 2I4TA 3EUAA 3A26A 2DH6A 1WU8A 3V8BA 4PSDA 5DRTA 5FHRA 1JHOA 1JDBB 3KV3O 1SWVA 5JHHB 5K3BA 3BGWA 2FUCA 5M04A 2J08A 1N3YA 1WW2A 1ORRA 3ITEA 3OOEA 4INAA 3VVLA 2HN9A 4BB5A 4F7WA 5IKEA 2Q62A 4CM4B 5IC6A 4LTMA 4ZZ2A 4YFYA 1T2FA 4O29A 1OD6A 4HQLA 1PEKE 4J0GA 4XWTA 4HADA 4P35A 4D9KA 2W6IA 1GZ3A 3KKQA 3UANA 4RTRA 4KN9S 1J2RA 4QREA 3TRHA 3OCCA 1OF1A 4NNJA 2LTAA 1KP3A 2IIQA 2QTZA 3CF4G 2I87A 2O2ZA 2PZMA 4RJLA 5EMJA 1DAFA 5JZVA 3HTXA 4IQ4A 4FGZA 1POWA 3TNJA 4KNVA 3CNEA 3RTBA 1E1DA 2NO6A 4FE4A 3NORA 5HZHA 2QZ4A 2JFUA 1NLMA 3VO2A 2J6IA 2NQTA 2X9QA 4KODA 1W87A 2BUAA 1T8RA 3RBXA 3I8SA 1CY8A 4BGDA 4HLDA 1CUWA 4U2FA 4FFOA 5C32A 2QOEA 2WM2A 5TMDA 1NM5A 4UHCA 3IEUA 3GYGA 1QH9A 3HYTA 2XBUA 3REQA 4QYWA 2DWUA 4UUBA 2OM2A 5CT6A 2E9SA 3ES9A 2EW2A 2BGNA 5AFSA 2OC9A 3H17A 5BWMA 5JVDF 1P9RA 3O83A 4BOYA 2JDID 4EHHA 5JRZA 3U3MA 5KKCA 5KSOA 5CW1A 2K5UA 5ERYA 2ZBEA 3DE3X 5FI1B 2JIDA 3DTVB 2Y4NA 2UVPA 3DE5X 3ER6A 3HA7A 1OXTA 4I55B 4LQ4A 4ZO8A 4RVOA 4XH9B 1PDWA 5JU6A 2DWQA 1RRPA 3RBVA 3TSAA 1K8QA 3DBRB 2HF9A 1R5JA 3WMRA 2PBFA 4N6GA 2ZIZA 4OP1A 5D3KA 1E3DA 1QFSA 2H65A 1F6WA 2FE4A 2OPBA 4JA2A 4N7BA 4WZBB 3D3JA 3Q2KA 4QDJA 3VVCA 3DG9A 4ECEA 5KINB 4P7BA 3WZLA 1RBMA 5JV5A 3MT7A 2WHQA 2PVSA 2VHCA 4CDGA 3ZVKA 1AQNA 1LWNA 3LLUA 1J2YA 3RT9A 4HX2A 2L2QA 1F5NA 1SEVA 3K3PA 2Q1SA 5JNVA 4KZKA 3ZX5A 2FEPA 1AKVA 2UUAB 3OF2A 1ICIA 2Y67A 5C34B 1KAOA 3U9TA 1KO8A 3OT1B 1TUIA 4BXOA 1AF7A 1TDJA 4J16A 1M3SA 3TMYA 4BKRA 2VHTA 4ON9A 3SC6A 3QXSA 1MRNA 1HURA 1SQ6A 2KI5A 4S12A 4AY5A 3DKVA 3N2NA 5U1PA 2PT6A 3LBFA 2X4GA 4A8JB 4C4PA 3FZQA 5CFZA 1OWNA 3KQQA 5L3SB 3A9SA 4IEFB 4FZJA 3O8DA 1JVBA 4DG9A 5FB3A 3H5NA 3H7IA 1Z7GA 2BFMA 2C77A 3WNBA 4BNJA 4EFKA 5JXGA 1EESA 4NDAA 5TQVA 1P1JA 4NEQA 4OYYA 1MO3A 3H1GA 2MR6A 1Q57A 4G07A 4Z6KA 3ZWXA 1E2FA 1YHNA 1E9RA 3NAGA 4IJKA 4O2BA 5CEEA 4HDAA 1AKUA 5KCMA 4RK0A 4W9NC 2IDZA 2HXGA 1MXHA 2HPVA 4P0TA 4KZPA 5TQ0A 1JHQA 2I3GA 3NONA 4URZR 4QPNA 5A4MS 1BW9B 5EJ7A 2YY5A 5B64A 2OD9A 3JVDA 4OHPA 4TYMA 1GGMA 3OEHD 5EUCA 1B8NA 4WERA 4YBRA 2CHVA 2ETXA 3V2UA 5B36A 1JKJB 4KDCA 4IIDA 4R1PA 1HTBA 4E09A 3MT8A 4HXFB 3VZQA 3I2HA 5AESA 3PPWA 3B13B 4HS4A 4BVEA 1IG0A 3O8QB 1WW8A 4IRMA 5EWLA 3GLVA 5BN3B 4B1FA 1RPJA 2UYGA 4I0WB 3IQWA 1FRZA 2OBMA 3KG2A 4Q4HB 3W5AA 3VBCA 1Z2EA 4OQYA 1AGXA 5P8WA 4OP3A 4O4HB 2BGIA 2O2JA 4YP7A 3GFGA 3S5JA 3O8BA 2XAAA 1NUHA 2C96A 3LWNA 4B4VA 2C2ZA 1W2WB 3L4BA 2FMIA 2OQRA 1SUAA 5T8KC 4PLPA 4ZI5A 2OVFA 4C30A 1JJIA 4HX9A 1NF3A 1YRLA 6REQA 1DJQA 1B43A 1TM1E 2FPGB 3WGMA 2WSSD 2QI9C 2JGEA 4JLKA 4LCEA 3C8DA 5EJ9A 1X2BA 3RYHB 2DP4E 2WTAA 3E3OA 4Q66C 5G53C 1CNFA 3FTCA 4ZC8A 5FBHA 1G5QA 1KJIA 2NVUA 1HC7A 3CEJA 4D3DA 2IYPA 4WHMA 4CTMA 2O14A 1WSBA 4CR6A 1XK7A 2XB8A 3TOVA 3HQ4O 3ZK9A 1JHZA 1JP7A 1SU6A 2BZSA 1J97A 2JCXA 4HWTA 1A88A 3UJ8A 4B9AA 2GF0A 1GGVA 4EWLA 1EIZA 1AUOA 1US8B 1Z8FA 1ZRMA 3PP8A 1Y1PA 4QRHA 4BNDB 4HPJB 1ZINA 4CHGA 2IH5A 1N0HA 3BTOA 1XZHA 4N49A 2WT8A 3A1FA 3ON5A 3FH0A 3AHHA 4JT4A 1CZRA 3ZU6A 5CDFE 1NU6A 3MILA 3U2QA 4YUXA 1CZNA 2PGDA 2PVCA 3WB2A 4KI0A 3WIEA 1W36C 2AV6A 3KQPA 4MA0A 3GNSA 4UDYX 2WHYA 3OM0A 4NYIR 3MUFA 3PIRA 3EIHA 4D2IA 1CF9A 4WIAA 1NW4A 1O94A 1U7UA 2UZIR 4CKEA 3OLYA 2HB6A 3WGQA 1EFTA 3ADDA 4L4YA 2G17A 1TEZA 1LVGA 2DTEA 2V58A 1DAOA 2Z57A 3BH7A 3DEAA 3DZKA 3PNLA 4FOOA 4IXTA 3RC7A 2NO7A 3VKHA 2HNBA 3HB4X 3WNCA 2WK1A 3F3MA 3C15C 4UJ3A 3VPFA 4JITA 4AECA 4RD6A 2ZI3A 3X1YA 1ENOA 2FPRA 1I0IA 1KEZA 1M6VB 1UBCA 2BMJA 1FW8A 2XGJA 3I0ZA 1V35A 3KEQA 3QMWA 3ZCRA 2A4KA 5HKAA 1A9SA 4QDKA 2P6MA 1DKOA 1KFJB 3IP3A 1RD4A 4C4RA 3WKCA 4FFRA 1QIGA 3GBSA 1WSWA 3DVRX 4M46A 1O89A 4N5IX 5AK5A 4KCGA 4RPLA 5GJBA 4FC7A 2X6RA 4Y6GB 5KQRA 1MO6A 3NFYA 4ACAA 4CN8A 3U26A 3SI7A 4GH5A 4X6XA 2ID4A 3MF4A 4ZQFA 4JAVC 2RK3A 4RKRA 4UVGA 5IWCA 3L8GA 2CBZA 2I34A 1VGRA 2HTFA 2KLHA 2I29A 3L7BA 3QLUC 4XCVA 4BVGA 4NR0A 4LF5B 1TT5A 2VTVA 3KUDA 4EG7A 3D5EA 3PHGA 3ZWCA 2AUMA 4ES6A 3WTBA 5ITWA 3H6HA 2XVXA 3C3EA 4BQQA 5KDDA 4I3GA 1MRZA 2PRIA 1SBIA 1TKRA 2O50A 1D09A 1R3UA 3OQ1A 2Y93A 5CBPB 1UQTA 2YYAA 2CN1A 1R7RA 3W3AD 4ZI7A 5CB4A 3AMVA 3D5QA 1Z5PA 4LXTA 1YNOA 5HJEA 9MHTA 3DFIA 4G5GA 5IJWA 3RFFA 1N2CB 1B42A 4O4JB 2XQJA 1C1XB 3R0XA 3UTCA 1TJ3A 4TXNA 5DBIA 1BDBA 1PTJA 1T34A 3GGCA 4R84A 4V1CA 2GM3A 4NZPA 2OO5C 4PZ0A 4YPFA 1SUDA 3GELA 3ABZA 3AIKA 4D4IA 1FYEA 3I2GA 1FYDA 2NM0A 3HJNA 5B1HA 1OH6A 4E0BA 1QGUA 3O5AA 4J3FA 3GUHA 1RQ2A 5J4YA 5EYPB 5IPFA 1IVSA 1ULBA 2HHLA 1ZJ6A 3GD7A 4B7ZA 4KH0A 5JJLA 1YRYE 3VVBA 3SS9X 5EHXA 2FUG1 1KRHA 1VL0A 4EABA 1QHNA 2CLEB 2QTWB 3MUEA 4CCWA 4Z4EA 2H5EA 1S8AA 5J1TB 1UM9B 4ZT3A 1Y7LA 4EYSA 4X91A 3ZYZA 2O0KA 1JKMA 2AF4C 3P9NA 1XA4A 1VYUA 4ZJYA 1C4WA 3MGGA 3LHDA 4QWMA 3H86A 1P0QA 5GPBA 2BZ0A 3ZWWA 5B1EA 5K8IA 1RXVA 5LPNA 4XUGB 5BN1A 2R25B 5KTMA 2F9MA 3D5TA 1EGAA 4KQ1A 3IULA 3I42A 4WOPA 1EQ2A 4N5NA 2QR2A 3WAKA 2PUAA 2QLTA 1Z6ZA 1MW9X 3WMEA 2AFIB 1E69A 2VJCA 2XRMA 3KHUA 4UTOA 1JZSA 5BT9A 4PGGA 1WR8A 3BXEA 4EI8A 721PA 1S8NA 4CF6A 4DKXA 4OHYA 1DWQA 2W2QA 1OAAA 1V47A 3V1KA 3EASA 5A06A 1W93A 3ZZNA 5DX0A 1EFCA 4DCJA 3FM9A 1EVQA 1I9CA 1ZUNB 1SCQA 4DLKA 3NHUA 1WPQA 4I99A 2VT3A 4M9SA 2JKVA 4HLUC 5F21A 3EBPA 1NNI1 3A1WA 2VJDA 4P2GA 2C2MA 4DXAA 5ALMA 3CX4A 1QRTA 1RXCA 4W1SA 4B17A 2XE8A 2JI6A 4WE3A 1O0BA 3RKRA 4QKQA 1CY7A 3ZHXA 2W00A 2ZU6A 3ANLA 1E9BA 2DQSA 2G83A 3ILSA 1J0DA 3PZRA 5FXMA 3SC2A 5JAMA 1U3VA 3COSA 3EGVA 3GCWA 4X45A 7AT1A 1X1CA 3K1AB 3M4NA 4CMIA 2Y1EA 4KIFA 4NBLA 5CPBA 2X7XA 1FCJA 2GVDC 4DMRA 2VK4A 3I52A 4RY8A 1SA0A 1AE1A 2IU3A 4NJMB 5EGSA 3RB8A 1IY0A 1G2OA 1DOZA 1PFUA 4TV9A 4CLXA 5A5VA 1IY9A 1I24A 2H92A 3SOZA 4UDXX 1N9ZA 3KELA 2QRLA 3IQZA 1RZ3A 4NBKA 1F7UA 2DPLA 1ES9A 2EDCA 3QVLA 3UJ7A 4ZJZA 4D8WA 3QWFA 2RHJA 1T9GR 5I9BA 1ZM9A 1S2NA 1BCRB 1HOXA 4MKGA 3IQIX 1SBNE 2PR7A 1DL5A 1IC6A 2ID7A 3E5HA 1I9GA 4CF5A 1TM2A 4JBLA 4MP8A 1JR2A 2Z3WA 2PT9A 3C4VA 4JLWA 1DQYA 2GCEA 1WU7A 4K9PA 1ULSA 4LMAA 3MK31 4I4CA 2BYTA 1UMBB 4RORA 4X64B 1EWVA 2EFCB 3AY3A 1TTQB 3DBIA 2VHYA 4UCXA 4HZUB 4LY3A 5EESA 3ZH2A 2XE4A 2FFBA 3GJSA 3P0IA 3QUQA 3TD9A 4D56A 4ESOA 3ESAA 4FIDA 4J0DA 3EB9A 2PKXA 4LOLA 4N65A 4Z7NB 4ZYYA 1XZCA 2GHRA 1HQYE 4NI5A 4YRJA 1U8AA 1ECGA 1AGRA 4L51A 5LP6A 2P30A 2VSYA 5H83A 1M7HA 3VX4A 3Q0TA 4YAOA 1XEWX 3V8NA 3EZ7A 4Q4DA 3ABQB 1Q7GA 2CLOB 4QOFA 2DECA 2Y1WA 5FPHA 3OZUA 1I30A 1H9BA 1L0BA 3E9RA 3HLKA 1GPH1 3OURA 4QIHA 3ZHTA 2HV8A 3CRQA 1RRGA 3MVEA 1WM1A 1YJXA 4JYZA 2ODQA 4PC6A 4NBVA 2BFPA 5HX7A 5DGHA 1PEDA 2HR1A 2XF8A 3CZMA 4RPIA 1M6EX 3S70A 2NXNA 2NUAA 1CJKC 2X2PA 2Y1LA 4D4LA 2J3DA 2NOAA 1P5JA 4BASA 4MKIA 3AUKA 1H42A 1YQEA 1HE3A 2D0PB 3C6BA 5KWEA 3LQFA 2ZBVA 1RMTA 1YRHA 1ZCZA 1CJSA 1QDUA 4MUJA 1Q16A 2OCLA 4RZXA 2FP4B 1A5ZA 1PZGA 3BL5A 3O03A 3OU2A 4UEJA 3T0FA 2X5KO 3K9NA 1XTTA 1C9MA 4ND7A 4RFSA 1ZMBA 2QM7A 3K1YA 3UK0A 1B73A 2FVYA 1UDAA 3OMXA 1KDYA 1DUVG 3BXFA 1LNZA 5ESDA 4MW1A 5DHAA 3GRFA 4JS0A 1XZBA 2P91A 4INOA 4J1TC 1XEAA 3T1TA 1GAEO 2DQ4A 2NXWA 5DNWA 16PKA 1DAIA 3T3IA 5K0CA 2ATVA 4CVNA 3HXLA 4R71A 5KTPA 3M9XA 5IK2D 4Q9DA 3R8CA 1RYMA 4D3XA 2WHEA 4NPHA 3T7CA 1FTNA 3ZXSA 1VLJA 3EW9A 3MD0A 5AKEA 1KI4A 1LJLA 1T3SA 3A9RA 2NYVA 4XGQA 3QE2A 4YBZA 1B7GO 1TJPB 2NYUA 1Z0IA 4ZU1X 3KQHA 2ZAOA 4LV8B 1YCFA 2FOLA 4JR1A 4KR2A 1JQAA 2ZBGA 2IZOA 4JJEA 1IK4A 1TU3A 1KA9H 1S2MA 2ATXA 2VDNB 1NJ6A 2VPXA 3AONB 1L1FA 3C97A 4UHEA 4F9GA 4RA6B 1SXPA 2SKCA 1CF4A 3P94A 2YHIB 3WDLA 1J39A 2WAAA 2FN8A 2QLFA 1DXQA 2Q2WA 3IGFA 3MTJA 2O8BB 4XQGA 4ETIA 3L7NA 2VZLA 1II0A 2WFMA 2OD2A 1D1TA 4PZAA 1A97A 3ZQ4A 4BFUA 4TKVA 3GLFE 4KO3S 4QGAA 5CT9A 4ZTUB 2VJYA 2G08A 2AHOA 3ISTA 1PWZA 5KYVA 2IHNA 1K4YA 1UFKA 3Q7PA 5DBOA 1T3TA 2EQBA 4Y2YA 4X7RA 2J3LA 5JSYA 1RAEA 2P3SA 2XIQA 3CCCA 3EGCA 3QOWA 3V4FA 2EFGA 5CCDA 3DT9A 4BNFA 2HCRA 3WSVA 2QAGA 1IVYA 2Q3FA 1U6KA 3A32A 3DLPX 3IV7A 2AFVA 3JW8A 4K3VA 4A8PA 3L41A 4BJ5A 1FP4A 1HH4A 1WHSB 2FR8C 2PZFA 1N4DA 1YVRA 4YWHA 4AFNA 4COOA 2IEIA 3Q15C 1UJ5A 2J4CA 5DGCA 1OOEA 3TAXA 2ZE8A 2BP7B 2XX3A 3R6DA 1W34A 3C43A 4IIEA 4KQ6A 4MS4A 4C0HA 1XO1A 3EXFA 2R8EA 1CK4A 2VDPB 1U7XA 3I3OA 4OX9B 2GD2A 3H2SA 2PUFA 3OUUA 3MS4A 4JBNA 1G3QA 1UQUA 3PGXA 4KMRA 4HWGA 5EZSA 1KZ7B 2GLTA 3IS3A 2HHHB 1SRQA 1Z4PX 2HIGA 2RGBA 5J4HA 2HXSA 3N0XA 1ZM4A 1ONOA 1YONA 3DOFA 3CURA 1X80B 3SLRA 3FYHA 2ZPUA 5ESWA 5JJCA 3CLSD 2HA6A 1WKCA 1GUDA 3CCBA 1MIOB 4P81A 3RT7A 4U7HA 2XHEA 3HCRA 5DBHX 4DMLA 4ENTA 3W6UA 3CRW1 4BO5A 3QM1A 2YW2A 4JLAA 1AS2A 1XQ9A 2PL9A 4II2A 1DE0A 2PANA 3MQ4A 4IUDS 3ZY3A 3GP8A 3NCTA 1JU3A 1T9KA 4U5QA 2X0JA 2WU1A 3GDGA 3R3VA 2ZB2A 4P3PA 1NVUQ 3L0BA 1QDEA 2EERA 5DI3A 1OYOA 1HL3A 1VE5A 2CB0A 2E55A 1AUVA 2H1WA 3NM4A 3AI1A 1I2AA 2R5WA 4PR0A 4YLGA 1Z4NA 5IN5A 4F6RB 4R2JA 2WUVA 4LOAA 2BM0A 1P44A 4E2ZA 3QV1A 5ICSA 1PJLA 5FUMA 4C6TB 5LN1A 1KEWA 3AYXB 4IVNA 3ZPXA 3B9RA 1QONA 1P75A 3H6KA 4O2RA 5DVZA 1UBUS 3O0DA 4YO8A 3VAYA 3OD1A 4D5EA 2JLAA 1EJ2A 1YU6A 3DOCA 3NIFB 2XD9A 1H94A 2YJNA 1FS5A 2O6HA 4NATA 4BLVA 4KPEC 1NG9A 4PZZA 1GNVA 1JMVA 4WKNA 1A9OA 1CLUA 1LBTA 4GM1A 4YJ2F 3VFDA 5ICMA 3EVCA 2GM9A 1II8B 4OHUA 1S1CA 2FN3A 2J9YB 4MWTA 1VJ5A 2B2CA 4IICA 1WCYA 4DCTA 1ZW1A 2Z6UA 3NG1A 3N53A 2R1VB 1NATA 1OJLA 4BGIA 1FFBA 1W48A 2RBGA 2IS4A 5CA1A 5E3IA 1R0ZA 4RABA 4NF2A 3VJMA 3IP7A 4BDSA 3GZTB 3PQFA 4JL8A 1IJEA 2WFZA 4BUZA 4EFMA 2UUPA 4CHTA 3WLTA 2OY0A 3R41A 4P82A 4QG7A 3Q3CA 1SD1A 4PLTA 1OFVA 1Z68A 4ZKEA 1NRXA 1K6EA 1TUBB 4QODA 3UMBA 4BN5A 4GKKB 2BMDA 1VCMA 3MT9A 3QX8A 1XD9A 2I5PO 3R8XA 1SQSA 1WPGA 1UKEA 4RE6A 1KI3A 5CLQA 2WNHA 5HBRA 3C8UA 5ABPA 4L5AA 1ISIA 5C7IO 3DQQA 5AVQA 3L46A 1RLUA 1U02A 3JAKA 1DADA 3E70C 1Z3CA 3WQQA 2D54A 2DT8A 5LB2A 3S2SA 1JEJA 1IZYA 3AP3A 3WWZA 2H08A 5IT9A 1U28C 3L4KA 4JFAA 1UDWA 2CFRA 1K98A 2QXUA 3PHHA 5JRDS 3Q7QA 4J7CA 1ULTA 3WLQA 3MYYA 4QXRA 4IRUB 4OH1A 4G5SA 4NBUA 3ZVLA 3U56A 3SZGA 4OQNA 4QJ3A 2EZ9A 3NGXA 1GQYA 1NIJA 3G82C 1FUKA 5KX5A 1AQYA 2LKDA 4M38A 4N40A 4X66B 1HETA 5THXA 2C8KA 3T7TA 3FGOA 1Q0LA 2FJ0A 3K5IA 5HIAA 2E37A 1JAYA 1XZAA 3OIWA 4JI6B 3RIXA 1RRCA 3C3PA 3PUXA 1W4CA 3EISA 4YCNA 1S9HA 3G1TA 1MENA 5IAOA 5IABA 5BORA 1M6YA 2CXOA 4XKJA 4NMHA 3QU4A 1TI7A 2O3TA 3TO5A 1SUIA 2YH2A 5H9WA 1X1QA 3H19A 2PKCA 1RDFA 1RQNA 2VYVA 4CL2A 3WGGA 1G7TA 1ZAKA 2BH9A 3HBNA 2WYWA 4Y7DA 1LDBA 5DLEA 5CG2A 4KHPB 4BU1A 2F48A 4NL4H 3V1LA 1BDJA 1UBSB 3W7BA 4ZZ0A 3PUKA 1ICEA 4PZ9A 5JZOA 1KYYA 3T34A 5KU7A 1AKYA 1M2VB 1LK0A 3LNTA 2P77A 4NCKA 3FUVA 4YACA 4Q9NA 3ZHYA 5IT0A 1NNEA 3ZJVA 3LFTA 1Q14A 3BD7A 1FB5A 2ZSEA 1AB5A 5LLDA 3GEEA 1BFUA 3NP9A 3DKPA 3CO5A 4MDYA 4ZYZA 1A98A 3QE0A 3OVMA 1NGSA 1TUGA 3HUDA 4JBYA 1J09A 4OAPA 4BMOB 1N8SA 1QHHB 4HNAB 3OQNA 5EEGA 4RTLA 1FMLA 5JH7A 1JYEA 3T1VA 2O8EA 1C0KA 1PZFA 1YKFA 4F3RA 2GN0A 3QK7A 4CQJA 1SZDA 4K6HA 4AF8A 4F1WA 1A7UA 4CR7A 1GM5A 3H2JA 3AHIA 2YYYA 1GAQA 3KOXA 4C6TA 1RYNA 2JFGA 2FWRA 5FO0A 1VPEA 3NVMB 4Y2GA 3LV8A 3WLMA 4ISBA 1FFCA 3UC9A 4EG3A 1CHDA 4ASUA 5SZHB 2PSDA 3EARA 3S2UA 2FGKA 4TL6A 4J0FA 4CM1A 4F5WA 2C3OA 2OV3A 5CFPA 2H7CA 4Y1RA 2GI4A 1MG0A 3W0LB 3GBVA 3JVEA 4GKAA 2C59A 2IHTA 1BA2A 3SWWA 3HG7A 3NDJA 1QLWA 3EPRA 2WD7B 4OSOA 5FJJA 1N0VC 2DFLA 3HCDA 1EVYA 2R7KA 4YS6A 2AG0A 1TZMA 3DT6A 3H9JA 4ZI3A 1P0PA 4NY1A 1NVMB 2GN4A 2I2BA 3SFTA 5AHWA 5BQFA 2UXBB 1XMIA 3SICE 3TGLA 4P3YA 3N39C 1N5OX 4AZ0A 4EL0A 4EKGA 3MINA 4RTKA 3P2OA 1U6IA 5AJTA 3A9UA 4CETA 5HF8A 4IXMA 1UZAA 4F3TA 1XTJA 3VDQA 1I51A 2XMGA 1EUCA 4RGQA 1SG6A 4RZ3A 1W46A 1X3SA 3N2GB 2DBYA 3Q6MA 4JVSB 3WVNA 1OB2A 3QE3A 2QUKA 3DCIA 4LWOA 2Z6AA 2J9RA 4QD3A 1FQKA 2QYHA 5JQGA 4NCXA 5BW5A 1BWSA 3LZ6A 3AR3A 1OFUX 1X15A 1XMXA 3HVIA 2DCMA 3IXLA 4YUYA 5IDXA 3HN7A 2ANBA 3E03A 1RJWA 2P9EA 2B4TO 1V1MA 2CXSA 1JIUA 2Z9CA 1U2TA 3CCFA 3EF1A 1N5RA 1SIWA 1QTRA 2XVYA 4KXUA 3T41A 1Y81A 2A3NA 3V9AA 4C4AA 1GR1A 4OI2A 4LVUA 2XXAB 3H5VA 2XB6A 1YWGO 1XMVA 4C43A 3BWBA 4B76A 2EKPA 4MR9B 3WADA 1NUTA 1T6BY 4OQQA 1E2JA 1D6MA 4CKZA 3MIIA 1T9CA 4MV0A 3W5DA 2Z09A 3CLKA 3CUYA 4OXYA 4CMCA 2QQ0A 3ZBUA 4NBSA 1FFWA 1Q3HA 2PUDA 1FMFA 3JTEA 4Q01A 4YJFB 1ZGGA 3AUXA 4Y9RA 2J3QA 1U8CB 4FCTA 4GPAA 3FZNA 3ZJ4A 1MKYA 1QO0A 4X1OA 5ETJA 2XXJA 1FJXA 3AI7A 4WT7A 3F6BX 4U2CA 1W1WA 2YV2A 2F4VB 5E8RA 4LWZA 4BX9A 1E98A 4KEAA 3TBFA 4CMJA 1G6Q1 2ZRQA 4L6IA 3L49A 2OGUA 3U4QB 2BHTA 2VP6A 4YRRA 4Z7OB 2OGSA 3KLOA 4CV2A 2R6GA 4RTQA 3D6UA 2EARA 3O91A 3TD2A 4G5FA 5EC8A 6ABPA 3WDKA 1W25A 3AVTA 2AN4A 2WA1A 2WWXA 3AOEA 3EG9A 3VYVA 2Q6IA 2YNMD 3FETA 1FVHA 2O2CA 3T1NA 4ZVOA 3G9TA 4YYEA 4MVJI 4UHDA 3RF6A 2VDOB 4YMGA 5JYEA 2NSHA 4KSYA 7ABPA 2JAOA 4LXXA 4RLSA 2KMLA 1CJBA 1L5OA 5BPFA 3IQXA 1I94B 4MP6A 1T35A 1NA5A 1Z75A 3Q7TA 3AVOA 3JQQA 4HZGA 5CXQA 1UXGA 4MI6A 4M1WA 4QQNA 4Q1DA 3SBDA 4DRYA 3TSYA 3D4BA 4D0RA 1V5GA 1S0UA 2RHMA 4RSRA 1VJCA 4LZNA 1BE8A 4MYTA 2GF9A 3GRRA 1Z0JA 2W4MA 3CUSA 4I1VA 3WL3A 2I6UA 3ZHCA 4EOGA 4DR5B 4ESEA 3FYUB 3NVAA 1CR6A 4X97A 2RONA 1GYQA 1I5RA 3C5EA 2B7BA 1S2IA 1EBBA 3AHEA 1PF7E 4P3XA 4LQCA 4UW9A 4NARA 3RTDA 3UB3A 4F9FA 1EK0A 2IKQA 2MINB 1QV9A 3I9LA 1F4VA 3QG5A 2DKNA 4JBXA 4TMKA 1DC5A 3CA8A 3SIWA 1SOAA 3DLCA 3FN4A 1TTTA 5KVVA 1HT1E 4JLUA 4DMCA 3ZEIA 4Z4FA 1YCHA 2C8JA 5FBZA 4CQNA 3WRXC 1XWFA 3TF5A 2EZ4A 3TB6A 3NOOA 3IE1A 3ROFA 5A3QA 2FPKA 1VL5A 1IPEA 3RCBA 3UHJA 2XODA 3GZJA 1R0KA 2VXBA 4B34A 1U9IA 2B36A 4K9LA 4QYTA 4CM4A 5CDHA 3UWKA 5LNK6 2EIHA 3DEJA 4NCBA 1S8FA 2IXDA 4NVRA 5G3ZA 5KHAA 5TT0A 5DK4A 3TQSA 1X8KA 3C8HA 3EH1A 5I9IA 4Y9UA 5THQA 1NXSA 4QRIA 4KYUA 1HE4A 2L18A 2OM6A 2YHSA 2Z5VA 3H3XA 1KZ4A 4UFNA 3GW8A 4MEAA 1TZJA 4MOWA 2EJBA 2OAGA 1RYYA 2ZRGA 8OHMA 2XYGA 4M4SA 5HGXA 1WMSA 3K71B 4BFYA 1MX5A 1VE1A 4PF1A 4BE9A 5TPWB 4EHAA 4C0QC 3RUIA 2E5LB 1NI5A 1D2GA 3F74A 1KRWA 2J0VA 2PMBA 1KO4A 2AN9A 1AIPA 2QGNA 3CVOA 1L5RA 3D8RA 3DB1A 5DWQA 5AW5A 5TF0A 4CF4A 1P6QA 3AF3A 4UNNA 5CFNA 4N8SA 2FRVA 1Z0ZA 1XD8A 2UV8A 3I61A 5J58A 4WCFB 1B2RA 4X93A 1W4AA 3F9RA 2CJWB 2DSTA 3RGWS 2FZ5A 2Q5IA 3ADOA 3QNUA 3VV3A 1QZZA 2C00A 3OD5A 4PO1A 4BKUA 2WUEA 3K5PA 2I7XA 5B4UA 2F8MA 3Q0IA 3GX1A 5NULA 4ZEMA 4I55A 5LXTF 1JAIA 2DFVA 3GLHB 4F0JA 4RDCA 4CQMB 3GJ3A 3QI2A 4GR9A 1KPIA 2WIDA 3DHWC 1YMQA 4RGBA 4DC1A 4XWOA 1L8AA 1VG1A 4QBGB 5B58C 3ANYB 1I7QB 3MAAC 5KS2A 4JMLA 5ESXA 4XVUA 3NRBA 2Q1UA 1QM5A 3FPCA 4CMKA 5IC4A 1GAWA 5F7JA 2DJIA 4TWJA 1N1MA 1IBLB 3HMKA 2LWIA 4LFAB 2WPDD 1NXTA 1HDZA 2IYWA 3HACA 4DILA 1FVOA 2FPOA 3A70A 3IE0A 4QUAA 1HPLA 4LBVA 1NQ5A 3FNBA 4GLOA 2F3QA 2W0SA 3OCXA 3PEEA 3PZBA 4EYEA 3M1IA 2WZDA 5CRIA 4BVAA 4N39A 5EHZA 1VBKA 3CNLA 1AZWA 2HA7A 2RG7A 4JR2A 2DPXA 1UOEA 3C3XA 4NQRA 1IXRC 1SG9A 2MSNA 4A8JA 4JUAA 4B75A 1LUAA 3F0TA 3RUDA 3LYLA 4PNZA 1NNLA 5A7FA 2YXEA 1KU0A 1YVEI 3CJRA 5TGZA 1M0EA 4FFMA 1TK3A 4KDFA 1I33A 3WLOA 4RL6A 4R1TA 4RTSA 2HH9A 4X7PA 2VP2A 4RELA 2A5JA 5HG0A 2ZBDA 4MX8A 3SDBA 2X77A 3QU9A 2F55A 8ABPA 3QFHA 1M6NA 4ZICA 1EFRA 1VRCA 3EA0A 1UEJA 4REOA 5G1PA 3SFVA 1C5KA 3D54D 3KJFA 3TEFA 2VO1A 4LEIA 2R3SA 2FSSA 2JLBA 1P80A 3FPBA 2JHAA 2YASA 3OPXA 2NU6B 3IHTA 3LUCA 4Q3NA 2ZIWB 3R09A 1PLKA 3H1PA 1M0WA 1YO6A 5GV7A 5IWAB 1JKJA 1G55A 2B20A 5D1HA 5TARA 1U2ZA 2KJQA 3OE7A 1TCBA 4TXLA 4GI2A 2CDCA 1RBYA 1KSGA 5DGXA 4F04A 1JPNA 2HSDA 2PH5A 3DEHA 1SAYA 1T26A 5BN3A 5IZCC 1R8XA 3G9XA 2ZTMA 4GQBA 4K05A 3KTFA 3OAAD 2R2GA 5MN6A 4Q4HA 2VH1A 1UXJA 1O8BA 3AP2A 3S2YA 1OGIA 4U2GA 5AHRA 1FLAA 3SBOA 2ZUFA 2CBXA 1JFSA 2XQKA 1D03A 2IS2A 1A8HA 3VYWA 4KRXA 2QQ5A 4DGQA 1VB5A 1ZCJA 3E5MA 4OKIA 3OY2A 4KWIA 4OXRA 4RPJA 2JFVA 5SY9A 3TLYA 3UHAA 1O1YA 1J1UA 3OEED 3TMAA 5JT1A 2FPGA 3B5IA 3K72B 4ZYLA 4CMEC 4KBYA 3WDMA 1E1CA 1K8RA 2QLMA 2WKQA 3IBGA 5I7AA 1BN7A 1RQRA 4A91A 3UQYS 1HF3A 3HGTA 4EMUA 2W2MA 3H1TA 3IIJA 2Z5GA 2C99A 4YCLA 3ZD7A 3TSZA 4CWAA 2HMYB 4J8PA 2J3KA 3DO8A 1AHPA 3KBOA 1ZN9A 3IVMA 3ZY5A 4ER7A 4XIGS 4KFRA 2R8RA 3NT2A 4IHAA 3LVFO 1GOTA 5CTJA 5JE8A 1QDLB 1YFZA 2HU8A 4ME6A 1US8A 3GV0A 2FEKA 4X3PA 1M73E 3DHNA 2UDPA 3ZLUA 4FCWA 4LTDA 2X2OA 1IYZA 3G8DA 4B2PA 3JQPA 2R96A 2HWXA 3FUCA 1YAHA 5FBRB 3JAMA 1DFHA 3RHTA 4L28A 4FT2A 3B2NA 3H2IA 2JJMA 4PZDA 1UK6A 3WGKA 3SSAA 4BQOA 1NW8A 3G0CA 2CNKA 4ZOCA 3PX3A 1J33A 1XRJA 4KXXA 2PHZA 3OZVA 1ZI6A 2AJLI 4UAJA 3D6AA 4YJ2B 1RW4A 1YBAA 2ZJ6A 4EW1A 3KQOA 4KQFA 2QTFA 4IXDA 1WO8A 2IXEA 2WAMA 4G37A 1P5RA 2IYZA 4U9UA 4GL4A 3RG8A 1S3GA 2O57A 3HJHA 4MICA 3HN6A 4TTSA 1DTSA 1YBHA 3KL2A 4PC7A 2APJA 2XYPA 4UOZA 1AURA 3IAHA 3IAAA 5F35A 3EC7A 4JXJA 3U13A 1PK7A 1M6VA 3DE2X 1J7JA 3LVQE 5D3MB 1KIMA 3PIDA 2FG5A 4D4MA 3FUXA 2PAAA 4ZYXA 1ZOPA 2OT3B 3O1HB 4FC6A 1XAGA 4AKIA 3DQPA 4RZSA 3E8SA 2WDZA 2HJHA 3DWIA 4YASA 3H5TA 1DEKA 2IEBA 1MABB 1NWCA 1XE3A 1Y4DE 4QPZA 5F7OA 2C54A 3ZWBA 5JBNA 1K27A 3U7FB 4L73A 3GUZA 1L7DA 4H3HB 3HJBA 4M9XA 2R7LA 3FE2A 1IDOA 2H3HA 1V5FA 2VPWA 4EJSA 1NF8A 2CLDX 5CAEA 2EX1A 2NSDA 4QUKA 4GGPA 3GD5A 2WKSA 1FYWA 1O58A 2GBPA 2Q3CA 4G1MB 3T06B 2CJXA 5L6LB 2YMMA 2ZAYA 3UUFA 1WW3A 2E7ZA 1OU4A 2E1PA 2RGCA 2JDIA 2I8CA 3TINA 1L9KA 2BHSA 2V7BA 3EIUA 5FR1A 2RHLA 3KL4A 5DZSA 3W5JA 3CGWA 4P34A 2D7JA 1AKTA 4GBED 3T4XA 3KB6A 3IO5A 4NJEA 3V55A 1P0CA 2HU7A 4TTQA 4BWGA 4BLUA 2FCAA 5AVXA 5CJJA 1ZH4A 1H05A 2PUVA 4LYHA 4W6QA 3PEYA 1BMFD 2XBMA 1GPBA 3L4SO 4EW2A 2I91A 3LPCA 4BVFA 1J1ZA 3R76A 1V8OA 2YFKA 3GFBA 4YP6A 1Q1QA 4N41A 2RI6A 4GKBA 4ZVLA 3WKEA 3R3HA 3VTZA 1PU2A 2XJ9A 1GKIA 1YGYA 1S96A 2PBZA 4EZEA 3JZIA 2V6IA 1U8ZA 3EIFA 3MOIA 3EXG1 4IIYA 1OA1A 2F6RA 4J4BA 3NPAA 1GSOA 1WXIA 1IJFA 1PNOA 4KWEA 2BGRA 3IOBA 4NCAA 1VZ2A 2WICA 3C7AA 1E20A 3CXUA 1H5QA 1TMKA 4D5GA 2WJGA 5DIFA 5H1YA 1FNCA 1R18A 4QVKA 1BXKA 4BAZA 4IIUA 4PSAA 1U99A 1N8TA 2GLUA 4R6XA 5ALWA 2BONA 1O77A 1T6XA 1P62B 4TL9A 3KWFA 1UM9A 1YZGA 1PJ3A 5TXGA 2G28A 3I39X 5ITZA 1TM3E 2G80A 2PWPA 3IPYA 4PGHA 1R6UA 3C1TA 3UKJA 2FW8A 2P35A 2X8WA 1XKQA 3M4ZA 5KJ1A 1N2OA 3LLMA 1W5SA 1QRDA 3ZI0A 4FOPA 3E2MA 4PX3A 4D4JA 1N7IA 2Q45A 1FC0A 2HFKA 5AW3A 2GTPA 2JIPA 5BSEA 3HDTA 1YZLA 5JCPA 1BEZA 4HJRA 4GYKA 3FYSA 4FI3F 4PU0A 1GFIA 4L72A 4E14A 3JQCA 4L8VA 4JY7A 3LCUA 3WKAA 3OCUA 3TQRA 2FSUA 1Q0UA 3OEHA 4EQ6B 1E32A 4PFSA 3AM1A 4Y6PA 2ZG6A 1NQWA 3BORA 4U7JA 3O1JC 4KBFA 1EUQA 1KE1A 3PXUA 2HA5A 3X1XA 3AF5A 1QYWA 5GOZA 5LYYA 2RCYA 4IEIA 4NV0A 4IHKA 1YRAA 3K4HA 3N86A 1KAHA 5IXJA 4OGLA 5C1PA 4R5MA 1H2XA 1V11B 2Y9MB 2ZRFA 5EKSA 1XG5A 2R8YA 4PCAA 3ZDXB 3EGXB 1EFDN 3LQYA 1G3IA 3TL3A 2B35A 1IHXA 2D5CA 3C3AA 3G59A 3PYLA 4U7GA 1M10A 4RY2A 1MAWA 3C39A 5HIJA 2C5FA 2ZRLA 2BGJA 3CUKA 3EIEA 5IF9A 1Y3BE 1FXWA 3WS7A 4DDMA 5CK4A 2PU7A 2WSSA 1WP9A 3HBAA 1NKVA 5DKFA 4TQUS 4XVHA 5FLYA 1REQB 2J9XB 1JFTA 1HQCA 1H8ED 1L6RA 3QPAA 4JODA 3VX3A 3WG9A 3R6TA 1V7QA 1JHDA 1YNSA 2PUCA 4AWBA 2Z1NA 1YK0A 2RH5A 4FFVA 2PX4A 3QEOA 1Q6ZA 4I5FA 1L7AA 1U4SA 1TW3A 3BHMA 1R0XA 2QMOA 3DULA 3HYSA 2ZRPA 4QYSA 5AKIA 4B81A 2ATIA 5D00A 1BH6A 3H8JA 2E5WA 4MGEA 4DTIA 2XSZD 3OHMA 1PVDA 4HAYA 5D7NA 3THSA 4CNQA 4B79A 3I2IA 2O8DB 1VL2A 1VI2A 3MEQA 3LW7A 4EP1A 4EW6A 4M0FA 4F5ZA 4AW9A 1WG8A 4G0ZA 2BDEA 1Y3FE 2WIJA 3D3NA 4MQ4A 4YYZA 4HEA6 1XWWA 5LP1A 3BFKA 4G01B 3K20A 3REGA 3TMKA 5KC8A 3QSYA 3W79A 3AETB 5KX5F 4DV5B 1D2RA 1KYIA 1YQGA 1SD5A 5H80A 4ZK2A 2NAPA 3G5UA 2ZI9A 3CLRD 5BV7A 1FDWA 3DMNA 4G6ZA 1VLZA 1QJCA 1UKCA 1HDRA 4YECA 4EG8A 4E1BA 1XEFA 3OJOA 4JX8A 2F1RA 1VKOA 2PU5A 2WV9A 2YBEA 1N0WA 3MB8A 3NALA 1FNMA 1JHVA 3OZBA 2PG3A 1O0SA 3JQGA 2FETA 2IU0A 3S7ZA 2HU5A 3AR7A 4B2IA 4DZRA 3LUBA 5BOVA 3A3OA 2VJKA 5A71A 2JFYA 3KOZA 5C7YA 3L1HA 4AMYA 1MAUA 3DUFB 4RMIA 1XMJA 1XRQA 2Y1KA 1JJ7A 2X4IA 2A14A 2YRXA 5CDUA 2VBGA 2VNJA 3ETEA 5M7EA 1GGHA 1Q84A 1S7GA 1D2HA 1GNQA 2REXB 3RU9A 5CU7A 3QU5A 5CLHA 1ZVJA 2FP4A 4GICA 1CUEA 1E9EA 2G0NA 4MUMA 2A9OA 3R7WA 4QJ4A 3X1WA 1TVKB 2PEYA 3BQMB 4LIPD 3NJ8A 3TTSA 1PQPA 1M9NA 1N25A 3M1AA 4L0DA 3THXB 2VYFA 4Q9KA 1KYQA 3QEKA 4L8GA 1N2GA 2A33A 1A96A 1EFPB 1NE7A 4DW8A 2YVQA 4ACBA 1Y4ZA 5HP4A 3UMSA 5FTMA 3O0TA 1MGOA 3DKIA 2OENG 2WRZA 4QUEA 1X1TA 3K94A 2ANCA 4XQ0A 5C53B 3K1JA 1E2UA 1ZQ1A 1NI4B 2YHBA 3GDOA 3OECA 4GDMA 3V2HA 4OH7A 1YFJA 1HUQA 3W3AA 3FFBA 2HPAA 1I2CA 4J6FA 3RUEA 1D5WA 2BFBA 4Q7KA 3PCTA 4WK6A 4F45A 5C5DA 1C0EA 1ZHOA 1YE8A 1ZU5A 2W9XA 4Q9AA 5ARDA 5G4LA 5T4HA 4TMWA 3ZOZA 1RLTA 3TN7A 1XV5A 5TNXA 5JLJA 2QTRA 3BMQB 3OIGA 2HK7A 3EBOA 4TXJA 4KFCA 2C5BA 4S1OA 3B82A 1OIVA 5IJ0A 1NT2A 3KOYA 4MV8A 4Q03A 3TVDA 2P2NA 2XA2A 4EGSA 4BPBA 3SKVA 4RNDB 1UBMS 1WCV1 3ZQJA 4DANA 5BURA 3AESB 1EFVB 4L0QA 2A9RA 1U31A 5L3RA 5K03A 2E48A 5B3JA 4QM7A 1MUUA 3U7EB 3FPJA 2E1RA 1WETA 2V3CC 4QLBA 1EP9A 1XMPA 3A4TA 4L0CA 2RE8A 2CT8A 3QBTA 1WBDA 3ZGZA 1W5BA 3T7KA 2HQBA 2QW1A 5IBQA 3IHLA 3LRTA 2ABWA 2GCOB 4AAYA 3KQUA 3DCNA 1V5WA 2DVMA 2SCUA 3HC7A 5HMLA 1N2BA 3NNDA 3COWA 1XTKA 3ILHA 1PR4A 3RSFA 2PL5A 5KHOC 3NVKI 3A1TA 1RAGA 3WLAA 5DHPA 4KAJA 2CL5A 3KKNA 4BQEA 3QOFA 1U0LA 2X42A 3NHZA 2XOKD 2PLFA 4TMZA 5J59A 4ERNA 2CF5A 3H9QA 2WVGA 4WDQA 1V16B 1TYDE 4QQ8A 4DBVO 2YQ5A 2G1UA 1EUZA 1QGAA 2DFNA 1NU8A 1UT5A 4FNAA 2E2WA 1DBVO 2V7UA 4EVQA 2SICE 4S2EA 2G6BA 5LXTB 1TVEA 3FCUB 4AUKA 3BE8A 4YR9A 2AC7A 3BT7A 3LX6A 2A8YA 3H9BA 2XKJE 3OWOA 2PZLA 2JHFA 3DYIA 3LL7A 5DH9A 2WYHA 1ZA1A 3HCPA 4IIJA 2BKXA 5TVKA 5C7LO 1TLFA 2L82A 4BNIA 1X80A 2WF9A 3OI7A 4HATA 3BHJA 1H69A 4ARAA 4PX2A 5ALIA 1KDOA 3P8ZA 4X1KB 2FPLA 1Q11A 1MIOA 2FMXA 2RAFA 3A06A 5G0UA 3VC2A 2C8VA 4BMSA 3V2GA 2A9KA 4L1KA 2BRUA 4RLHA 3UFXA 4MCAA 3WX0A 1Y6QA 3H05A 2QVGA 1HFWA 3AL3A 3ESQA 1YL6A 2COEA 1L8XA 1VHLA 4AXXA 4DNQA 3D81A 3Q11A 3QSGA 3U6BA 2MIIA 5HDQA 4RF4A 1UOQA 4R7GA 3KJHA 1MH1A 1WMBA 4FI3C 4YUWA 4K1XA 1K1EA 4OAOA 2WG2A 1MB4A 1F3LA 3NKLA 2YIVX 3JD1A 2H4ZA 2CCKA 4LF6B 2ZJAA 1KORA 3MWDB 4B6GA 3AR9A 4F8YA 4RVGA 3DV2A 4LS3A 1QYXA 4GLBA 5HA5A 1KDPA 3LBYA 1K7XB 1U5BB 4QUJA 4HR7A 4JJ7A 1QOQB 4B73A 3G5AA 4DR1B 4I4LA 4N7JA 4NU0A 1JH9A 3AL0C 2GKOA 1P91A 2Q99A 3WO0A 1IAQA 3BGVA 5AMXA 2BGWA 1VKJA 2ZYHA 2DFPA 3BMNB 4XB2A 2HLNA 3PRYA 3GLKA 2AQHA 5FOUA 3L7MA 2H2WA 3O4VA 4Y1EA 3C3YA 1UM8A 1TJ4A 2F2TA 1K75A 1QFMA 3AW8A 2FPPA 2IL1A 4XSVA 4B35A 4LPSA 4YMHA 2A5GA 3AWIA 4X8MA 5K0SA 1RMYA 4OV6B 4XTCS 3NTQA 1ABFA 4YAIA 1U0FA 1I80A 4R1LA 4KLRA 4B4OA 4FGJA 2N47A 2R1VA 3T1OA 1XZLA 3S3TA 2XQGA 1X77A 1J8FA 3W05A 2A7QA 4QO7A 1T4MA 1QTNA 3SVTA 5M34A 2GJ9A 1SR8A 1E9VA 1SBTA 3I5MA 4QA9A 3E82A 4HZIA 3VZCA 4CQLA 4DDWA 2QIPA 1XMQB 3F46A 2VAMA 2H3EA 1VDZA 4JJAA 1Z4JA 1TUBA 3MTIA 1CDEA 1X3LA 4YCJA 1PIWA 3IT3A 4GZ5A 3CX7A 1V7PC 4XLLA 3LLCA 4G8CA 3RC1A 4GP7A 5JS2A 1BSVA 1T8PA 4EITA 2G3YA 3H1FA 4TN1A 2CNDA 3LF2A 4BKMA 5MN5A 4ILEA 2RHRA 4E2XA 1P4JA 1E2IA 1JG1A 4OP2A 3ZBQA 5IULC 4C7OA 2RDMA 1RS0A 2QL5A 4MCIA 4JT8A 1IZ0A 1KY4A 2WLTA 2DPYA 4GPBA 4Z0HO 5JNUA 2PUBA 1C7RA 2D3TA 3EZYA 5CCXA 2V0GA 4Y18A 1U81A 3ZV3A 2XI4A 1VHDA 3MTEA 2VTBB 4BO3A 1GTRA 1XLTA 3VPCA 3R6GA 1R4MB 3FNFA 1N2SA 4D6PA 5BVHA 2DHRA 3P2KA 3WMWA 3Q8KA 2P4EA 1SXJC 3LBNA 3NOVA 3ND5A 4C3ZA 1QMPA 3FMFA 5BR7A 3E0XA 3O94A 3P9YA 1JQKA 4M9RA 1TZKA 1JFRA 1VGQA 1ONBA 2W2OA 1ZICA 2ZTHA 1JXQA 1UZUA 2G9UA 3F97A 2ZTSA 5I4IA 4KP7A 1KWGA 3VI4B 1JQ3A 4LDPA 3HCBA 2CLHB 1V4BA 1WL8A 3S2EA 1OTXA 4LAFA 3IV9A 5IAKA 1S9DA 2ES4A 4L0MA 2VJMA 4LMRA 2NQ2C 1H9AA 1W4BA 3E5RA 4G4SP 5IK2A 2Q1WA 2RHCA 2VK2A 3EQ9A 5J43A 4TYWA 2D2EA 3DNPA 1U7OA 5AI5A 2JFQA 4GBJA 3TIVA 1P9OA 4BFSA 1C4OA 1DG1G 2PS0A 2ZJ5A 2IYSA 3B9PA 4NIMA 2VJOA 4MRSA 1O6BA 2DHCA 3SJAA 4IDDA 4FBGA 3A9VA 4AUMA 2J3HA 3Q7EA 2YWEA 4MP3A 3JQ9C 3D02A 3OHPA 2ZYGA 3RNOA 1PWHA 3WYCA 1GFSA 2ZRJA 2MCFA 3TRFA 5FKJA 3M3PA 2H0RA 4EKIA 2WPNA 4EB6B 3MHPA 5DCYA 3ZDQA 3ROXA 4NECA 5A1TA 5JZ9A 3Q3IA 4X00A 1JDNA 1U8FO 2QRZA 1ZUD1 2W6OA 3H2YA 1MW8X 1NMXA 1YS1X 2ERYA 3A6ZA 1T2NA 2MSLA 3V00A 4P38A 4W99A 3W5UA 2FRXA 1RWQA 2C9CA 4IGIA 4POAA 5KYWB 5CD1A 5T3YA 2KYRA 4MTCA 1KVQA 3O2QB 1LSSA 1K06A 1IUNA 4FD3A 2RC5A 1F20A 3RSLA 2BBTA 3FAKA 3BRQA 4TMYA 1Z37A 5MGBA 2ZJFA 4M22A 4YRDA 1KY3A 3OWHA 1J21A 2BFCA 3B5JA 4QJIA 5JY6A 3N6RA 3F8SA 1XCPA 1YZFA 3I72A 4V24A 4WXMA 4RCVA 5J63A 3U09A 3OTQA 5G0WA 3EAGA 4LSGA 5FWDA 3AT1A 4EVRA 1NDHA 1KZ1A 4ENWA 3ZWDA 2AZXA 1Y37A 3CGGA 5IDVA 3LP8A 2P65A 2QX9A 2WD7A 1EXMA 4PSUA 5CT4A 2I7CA 2FKAA 4XXHA 3OQMA 1LXCA 3REFA 2DSNA 5FCDA 2A30A 2JGMA 3L79A 4QYMA 3RIEA 4GGMX 1LWOA 2P9BA 2QUIA 4M54A 4RENA 2JD2A 1MP0A 2PGLA 1WCIB 3KT6A 3PITA 4B8ZA 3DAYA 4B3GA 3I5XA 1G8KA 2QTVB 3BMCB 4YJGA 1I5OA 4TGLA 1C1DA 5K3DA 2OXRA 2Q5EA 1N0IA 1Z3IX 1QR6A 5F76A 3LOPA 4UMFA 3RRYA 3UMGA 3DH0A 2H7VA 4TWZA 4EATA 2P9GA 1R4AA 4IGEA 1RQXA 1B76A 3BIWA 5CB0A 5KNCD 1ZD2P 3OEYA 1UWVA 3INYA 1GV0A 4F12A 2J0SA 4K86A 4ZANA 4LCJA 3RTEA 4LF8B 2KQUA 2ZQZA 4C5AA 3IC5A 4DDVA 4X20B 3NT4A 2CK3D 2VUTA 2Y71A 2WIBA 4P4SB 4R0VA 3BEDA 1TEHA 4UCFA 5L40A 1X2EA 3DLTA 2EW1A 3Q4GA 2XXAA 2GCPA 4J0QA 3ZR4B 1W44A 4MR9A 4HGYA 3PFCA 2JEZA 1JIXA 2VP9A 5ALKA 3N70A 5E6RB 1ZIXA 3D59A 4AU1A 3LYAA 3NBAA 1G5TA 1RJ9B 1BGVA 4WESB 4BGVA 2IEYA 1QH8B 3MQ2A 4X1YA 4YMSA 2ZROA 3K9LA 5D84A 4JIMA 1T36B 4L4ZA 4N5MA 1GD1O 3CPHA 4N5HX 5CYPA 2DH5A 5FHQA 1SUEA 4UTVA 5JZSA 4G89A 2R8XA 2XECA 4V0SA 2B4AA 1P2VA 1T9BA 5F1PA 4Y9DA 4JYCA 5BQOA 1R27A 3NNSA 3WJ7A 1YVDA 1LS1A 3EVTA 4TS4A 1CUJA 3E7FA 3TTVA 1E58A 3ZKWA 4O1MA 1H2YA 2D8AA 5E8JA 5F52A 3F4BA 4RKEA 1MEOA 1DIRA 1GVHA 2CNLA 2LP4Y 3NHRA 4FR2A 4TSRA 2IPMA 2XCTB 4LHZA 3AINA 4XE5A 5JI2E 3RC8A 1RPTA 5HS4A 3E84A 3EIQA 4YRPA 1Z5VA 1VLVA 1NJ1A 4MH0R 3KXPA 3ZGYA 4CM8A 4ETMA 5DNCA 1JBEA 1M2WA 2NZYA 3EUFA 3HFSA 3JQAD 3SJCA 1G7RA 5JS7A 4DJ5X 3N6XA 1NJ2A 2ZZMA 1DKPA 1P60A 3B12A 3BF7A 3G13A 2BHNA 3LT0A 3MMSA 4IHQA 1R9JA 3EZ2A 1JXMA 1YRWA 2C3PA 2XDYA 4GQAA 3UWPA 1QIDA 4C76A 2E5FA 5KYKA 5LMZA 2B5VA 3O9ZA 1WDLA 4DR4B 3RJMA 5AVJA 5JANA 2NU7B 2WFLB 4FP9A 5LDDC 3CMCO 3GUUA 3U4CA 1T10A 2MYPA 3LGSA 2WHPB 3FR7A 3K7EA 4N4AA 3T3HA 2C8LA 1I6WA 3QTBA 3K09C 3X1DA 5J2UA 5MHTA 3V80A 1Y1QA 1OFGA 2V6BA 5HIMA 3FYUA 1W52X 1RXWA 1FIUA 1DDIA 1L3IA 5JFOA 2Q50A 2IFTA 2IP4A 3EF3A 2DPGA 2W8BB 1SUFA 1L5MA 2MINA 3DBVO 3H9CA 4I08A 1JVNA 1NSFA 4IZOA 5B2FA 1J2EA 2BUBA 2P7IA 3USZA 3W5SA 2FQ1A 2IPOA 3X2EA 4RO0A 3EMDA 5BN4B 1D2MA 1ODTC 3W3AH 4WA8A 4FLMA 4XGIA 1SC1A 2G07A 2P9QA 4DQ0A 5JNTA 1ABEA 1D1PA 2X0RA 5CM9C 4EB8A 4ZQEA 3HPQA 5D5QA 4NX2A 4BGEA 5B6IA 4QNNA 1QZ3A 2CC2A 5EL0A 1GU1A 2I55A 4TTTS 5TF4A 1E2QA 4K9OA 4BLPA 2MTBA 3INRA 5EWMA 1SKQA 1OYYA 2W0MA 3ETDA 5MFPA 3LDGA 2ETVA 4FU0A 3KALA 3O3NB 4JB8A 4J9UE 5JSQA 2F17A 4BB0A 1W96A 3HKCB 2UUOA 3DGFC 3KKLA 1I7DA 2G9VA 3IPAA 2O7SA 1TLTA 2O8BA 3PNQA 4LHEA 3DTTA 5CJ2A 1OWOA 2QE7D 3ULKA 1QGYA 4BFLA 4BO0A 2A88A 3TKLA 5ALTA 5HWSA 2ZCVA 1IHDA 2D59A 4UARA 2ZSIA 3ZIAA 4DIFA 3ZNNA 4GR5A 4UNPA 5T41A 1AHIA 4WUTA 4AN1A 2JCGA 3VPBA 5AJHA 1OAOC 1DKUA 2RK6A 1DT5A 4H77A 2Q8PA 3L8EA 4IOLA 5DYIA 1XB2A 2PMWB 3CS3A 4XDHA 5GZ3A 1GDDA 1ESMA 2N9UA 3JV7A 2ILVA 1X9HA 3KPJA 3QFTA 2HSWA 4DCVA 2EWMA 3SCZA 2IUSA 3ZWAA 2FDXA 2EOAA 4UVEA 1SN7A 4YUVA 3IUBA 2FQWA 3G0GA 4FQ5A 5F4BA 1MHTA 4F21A 1RBZA 1EDOA 1AB6A 3JQFC 4G0XA 4WCFA 5EVCA 4C1BA 3ODGA 2CJWA 2B7LA 5JZMA 5KYXB 1FFYA 2BFFB 1KY2A 2FHPA 3E7WA 5CDFA 2W58A 3ZU5A 3HNPA 2FLKA 4L3OA 4JC8A 4O59O 4WXRA 3SHQA 3U44A 3K16A 4Z1MD 3CRMA 2PFSA 3BE6A 1LBIA 1SKBA 2I4NA 4YAEA 5K0JA 2AR9A 4TTAA 3LPLA 3CNOA 3GWGA 3NYWA 1G20E 3PA8A 5A04A 2G8LA 1FDSA 3F96A 3GUVA 4KXFB 1SK8A 3HB9A 4HYYA 1ENYA 3PT5A 2GF2A 5DCWA 5I8ZA 1QO7A 3F1LA 3HJTA 5BN5B 4JL6A 1E79D 1CC1S 5EEHA 1KO5A 1THTA 5TEWA 4PZPA 2XGSA 3AJDA 2A0FA 1BC5A 2FWJA 3QKRB 2F8LA 4RJTA 3D7KA 4YMVA 5B2ZA 4PQFA 3IR5A 1ZGZA 3K1ZA 2IYQA 4QXMA 5DV9A 3IBCA 2ZT7A 3EY9A 2B1JA 1Z18A 1CFJA 1Z2NX 1QH0A 2OQ2A 3G2HA 3R5TA 4NFYA 4NZYA 3SSNA 4A23A 2I6FA 2NLOA 3EGWA 5EGNA 2VJAA 4QL3A 3K6SB 2FR0A 2NSLA 4DV3B 1XRRA 1EWTA 4XUCA 3QVKA 3ZHOA 3TG8A 5FUVA 3Q8XB 3HCNA 5MN4A 4C2UA 3AP1A 3MYRA 4ZDWA 5C80A 5FEMA 3P2IA 3VJKA 4ARVA 4BCDA 3SZMA 1YR3A 4A0HA 1C9KA 5DCLA 4WDRA 3KRTA 3B52X 4KO1S 3BFXA 4RU1A 2XQIA 4R1NA 5IJAA 3E18A 2Z6QA 3CKKA 2I8AA 2AF3C 1AHNA 4FDLA 3H2KA 3RKSA 3B3JA 1WMAA 1A1SA 1ZGBA 3G9UA 4ZAZA 1AMNA 4ESVA 2HYIC 1MORA 3IAS6 4M0DA 1FYXA 1IU9A 1SCAA 3VSDA 3ZNQA 3RRMA 4WLFA 5CW2A 5JXWA 3ZHUA 2C4HA 4I66A 3G0DA 3LHIA 2WWIA 3TLAA 4Y6LA 1ZXBA 2V1UA 3V8RA 4H60A 1ETUA 2Q1XA 3TZKA 2RAVA 2H31A 2C58A 2ZIAA 4O25A 4FE7A 5CNMA 2IV3A 2X5XA 2YMQA 4XAQA 2NGRA 2ZCUA 4NFHA 2NU6A 3D8SA 3RAFC 4NXNB 2GESA 2XHZA 3QBDA 2EP7A 2FTKE 3DMPA 1FFDA 2YXLA 2KPOA 3CR3C 3ZGLA 4DV1B 4B71A 2QLNA 1CEYA 5L8VA 2YHUA 3QE4A 5L4SA 4ARUA 1Y6RA 2M6RA 1Y7PA 1J22A 4DZTA 3UM9A 1YMUA 1SZJG 5D7BA 3C2QA 2YNMA 1IRIA 2QRGA 1OBHA 4BE4A 4UOEA 3N87A 3N7UA 3RE1A 4OJYA 2DGDA 4K0KB 1T9DA 1TXGA 4YA6A 2WBLC 5BQ3A 2D6FA 2QMEA 3QKSB 2ODAA 4OK5A 3OKCA 4BJ1A 3ZHSA 3GZNA 3ICWA 5LZ9A 1ZIPA 1W7AA 3ZWNA 4XEHA 1EXWA 4DE5A 4AS3A 1EAMA 1PP4A 1QKJA 1P7PA 4BECA 2B6NA 2BM1A 3ELUA 4QUIA 3PIIA 4LHWA 3MGCA 2PMKA 3FTDA 4DWWA 4DDTA 5JROA 4KQ2A 2HIHA 1HE5A 1LQ2A 1G19A 3EXAA 1E6LA 3LHKA 4KNYA 1QPZA 5IEBA 1ADFA 1P1IA 2MU1A 4GVPA 4I5DA 4HNHA 1FZTA 5HTOA 4CKCB 4LFCB 1D7OA 1RQGA 3A10A 4JB3A 1L4FA 1C3XA 1NMYA 5E7JA 3ZD8A 2N1BA 5AVUA 5JNLA 4IQGA 4BNYA 1RADA 2CMHA 2PZKA 2JZOA 2P5YA 3TCKA 3PEVA 4JEMA 2WSBA 3MZ0A 4TPKA 3UT5B 2I7VA 3I30X 3O82A 1GN9A 2ZU0C 1EWRA 4L9RA 5CMLA 2QN1A 4XEUA 1BQ4A 2YN0A 2JLVA 4UHKA 5A5DA 1ZJZA 5B1YA 3JYHA 4NPCA 5CDYA 4R8RA 4J29A 1DKQA 1WXXA 2EJVA 3EIXA 4JX9A 2Q5HA 4KE6A 4KHZA 4KR0A 2MR5A 4L5JA 4F91B 1FFEA 1B93A 4YRBA 3NC1C 1DJPA 5D3MA 5AW9A 2YVLA 1VE9A 2ZQYA 1NW7A 3PVCA 2FSVA 3L06A 2FRDA 1FUYB 2H59A 5J2UF 3FOZA 1Y8ZA 4F9TA 3IUYA 3HSKA 1QYCA 2C2BA 2JFFA 2GN6A 4D96A 5KI6A 3M5PA 3R23A 4HB4A 3RVQA 1GL7A 1FTQA 2O8VA 1BJKA 1QR2A 3T1YB 1N2ZA 3KKPA 1O96A 3HP1A 3IPCA 4MQFB 6Q21A 1IY1A 3CTMA 1JA0A 1TGVA 1PBNA 2RGEA 4DA4A 4H7FA 3K4PA 2ZLBA 5SYMA 3NTRA 3SF0A 4E46A 5K4AA 3FLEA 2UU9B 1JPJA 1VC2A 1YQWA 4HDRA 3X3HA 3U3RA 2W48A 4UFPA 4HVAA 5E7IA 4JP3A 2YMPA 2JC3A 3DVAB 1Z4OA 4GOJA 4MV1A 4M60A 1NOIA 4I2NA 4RQBA 2G1JA 1ZNQO 4W8GA 1IQPA 3OCWA 4GKVA 5FNZA 4B87A 4C