3EDOA

Crystal structure of flavoprotein in complex with fmn (yp_193882.1) from lactobacillus acidophilus ncfm at 1.20 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
150
Chain Sequence
GMAKKTLILYYSWSGETKKMAEKINSEIKDSELKEVKVSEGTFDADYKTSDIALDQIQGNKDFPEIQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQMKNYRGEVASFFTSAGTNHKAYVSHFNEWADGLNVIGVARDDSEVDKWSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Putative trp repressor binding protein
publication title Crystal structure of Flavoprotein in Complex with FMN (YP_193882.1) from Lactobacillus acidophilus NCFM at 1.20 A resolution
rcsb
source organism Lactobacillus acidophilus ncfm
total genus 44
structure length 150
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12682 Flavodoxin_4 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3edoA00
3B6KA 3FNIA 4PTYA 1OBVA 4N65A 1AHNA 3NHFA 4GI5A 2MWMA 2KQUA 4DIKA 3LCMA 2Q62A 1AKVA 5FX2A 4GQIA 3K1YA 5LVAA 4F8YA 4FGLA 3NHKA 1TIKA 1YCFA 3B6JA 4S24A 1YCGA 1CZRA 3L9WA 6NULA 5NULA 1CZUA 3NLLA 4QOGA 3B6MA 3TE7A 1XI2A 3N39C 3L9XA 1FLNA 1D03A 2Z9CA 2ARKA 3GFQA 4C76A 1DXQA 1NNI1 3FJOA 3NHRA 4QOEA 4QOHA 5JROA 1H66A 4QOJA 4U7HA 2FCRA 4ICIA 4GR9A 3ESYA 3ZHOA 1XYVA 5FUQA 2MOKA 3TZBA 5LLDA 1D04A 3OX3A 4YAWA 3NHYA 3JSXA 1FLVA 1J9GA 4HS4A 1FUEA 2OHHA 4PU0A 4XDHA 4YQEA 4FGKA 3NHLA 1JA0A 2HNAA 4QODA 1RCFA 3FX2A 4U7GA 2Z98A 5F12A 3F90A 4H6PA 2V5VA 5EAIA 3U7RA 1ZWLA 1QRDA 2D5IA 2F1OA 4QOFA 4QOIA 1WSWA 2BPOA 2R96A 1DX9A 4YAFA 3HR4A 4CF6A 3UXHA 2FZ5A 1BVYF 1YKGA 3ESXA 2QWXA 2QR2A 1AKWA 4D02A 4H2DA 1B1CA 2FOXA 5EA2A 3KAPA 2MTBA 3KAQA 1KBQA 2FVXA 3GFRA 4C14A 3QE2A 1ZWKA 1WSBA 1FVXA 1H69A 1FTGA 3OX1A 1D4AA 5NLLA 2FAXA 3UXEA 2MT9A 2QMZA 3NFRA 4DY4A 1T0IA 3QFCA 1GG5A 3EDOA 3NHJA 2FX2A 4NULA 3O73A 5LJLA 1DXOA 4C0WA 2BN4A 3W79A 3HLYA 4FGJA 2RG1A 1FLDA 1CZNA 3D7NA 1SQSA 3RPEA 4ZVNA 5F51A 5LMCA 1TLLA 3N3BC 4LTDA 1CZKA 1X77A 5EMNA 3FVWA 2BMVA 5LBUA 3SVLA 3FW1A 1BU5A 2R97A 1JA1A 3F6RA 4PTZA 1AKUA 1OBOA 1YOBA 2HNBA 2V5UA 2ZKIA 4N9QA 1YRHA 1I1OA 3ES9A 3F6SA 2BF4A 2Z9DA 1CZLA 2XOEA 3S2YA 1AKRA 1QHEA 1AG9A 1ZX1A 1J9ZA 3ESZA 3W78A 3W77A 4CETA 5F4BA 3OJXA 4BMPB 2B3DA 3W7AA 4YALA 1FX1A 1AKQA 1KBOA 4LTNA 2HPVA 3OJWA 3B6IA 4J8PA 1YCHA 3NHUA 2XODA 1E5DA 1RTTA 4FX2A 3LT5A 5B3LA 1FLAA 3F2VA 2M6RA 4ZVKA 5LJIA 1XYYA 2QMYA 1XT6A 4R81A 4BMOB 5TGZA 2OHIA 3NHPA 4C0XA 4ESEA 2M6SA 2OHJA 1J9EA 1AZLA 2QX6A 4M0CA 3OWHA 1F4PA 4Y9RA 2FLVA 4HEQA 2N1MA 4Y9UA 4N82A 1CZHA 3NHSA 2BZSA 4NLLA 3GAMA 3NHWA 1QR2A 2KLBA 1AMOA 1C7EA 1SG0A 2V9CA 2A5LA 3TEMA 3P0RA 1CZOA 3OWXA 3N3AC 2Q9UA 1J8QA 2WC1A 1T5BA 3QFRA 4LTMA 2FZVA 3OX2A 4XDGA 5A4KA 2X2PA 1VMEA 2QX4A 1YDGA 1C7FA 2FDXA 5BUCA 3U7IA 4Y7CA 3R6WA 3HA2A 3K20A 3O2NA 1OFVA 4YAOA 2OYSA 2QX8A 4ZVLA 3G5MA 3KEGA 4LA4A 5FA6A 1QBGA 4YAUA 4LAFA 3EYWA 1RLIA 2W5UA 3GFSA 1V4BA 3KLBA 5LBTA 4DILA 1RLJA 5B3KA 2X2OA 3OVMA 4U7FA 2Z9BA 5ULLA 2AMJA 4OXXA 2QX9A 4ZVMA 1AKTA 2GSWA
chains in the Genus database with same CATH superfamily
1V6SA 1KE1A 3CS3A 1LC3A 1VLMA 3E48A 4HSEA 3EGOA 5IYZF 1KHHA 4QPZA 2IHBA 2J9RA 4J0KA 4TKUB 2FW8A 2XTZA 1VJ1A 3HVJA 1ZVVA 2ZT8A 4QG7A 3DZHA 3T6KA 5KTYA 2H3EA 3PPXA 1T5OA 3D6JA 2WP0A 3G68A 4CHTA 1E3SA 3QPCA 4W5WA 2Q99A 5IDVA 3ECCA 3TNDA 3Q98A 1GFSA 1QU2A 4JGIA 1YRWA 1KSGA 1YUMA 4B7UA 2VQFB 2ASEA 2XQKA 3LXUX 1BSVA 4LI3X 5LQCA 2UV8A 4HDCA 1JEYA 2E9SA 5SY4A 3A9RA 1NBHA 5HTOA 3PQ7A 5D1NA 3N07A 5CDTA 3KETA 3V42A 1T8SA 4GM0A 1HV8A 2MR5A 4JCCA 3K1JA 1CQJA 4I9HA 3TMAA 4D92A 1SCUA 5GZ6A 2AFIE 4MQUA 4CMBA 5AD1A 3KLMX 5H70A 1R0YA 1FYVA 1DEXA 1LPOA 3HBMA 4OSPA 2W2XA 5EKSA 5K1ZA 3ZV7A 4QQ8A 4Z4HA 3GFGA 3QKRB 3HVUA 1UC5B 2XWBF 1NQUA 4CQMD 1NF3A 4E08A 1EXMA 3I4FA 1EFUA 1RPZA 2R1ZA 1UKZA 1DFHA 1T4DA 3KKPA 2G4LA 2A7XA 1UR5A 5K4HA 5DK4A 3NJ4A 2O8FB 4C4YA 1MENA 3IV6A 4YIKA 5JAUA 1X7WB 4HDKA 1YE8A 1KMCA 1H8HD 1FSFA 1AO3A 1BKDR 3A31A 5FBLB 2D0OB 3B9QA 4HMQA 1X8KA 3WSVA 3KJQA 4IW3B 4EL0A 1SUIA 2ERCA 3L7DA 1N1EA 1O89A 1XEAA 2J85A 1R4MA 3H1EA 3K72B 3U39A 3YASA 3ZGLA 5JSFA 5J23A 1DXQA 2WF8A 3G9UA 3OAAA 3FJOA 2QTAA 3UTDA 5EE1A 3C43A 1H6AA 3QMWA 1PV1A 2OHVA 3CUYA 5E8JA 4DZZA 1XRJA 3VPCA 1CJTC 3DTYA 4TLCA 2QSUA 3WRYC 4DPLA 4YRSA 5I8WA 1YK1A 3NAQA 4M1TA 3JQBC 1MW9X 2QW0X 3ILXA 3G13A 3ENNA 5I3ZA 3V1TC 4NQZA 1QM5A 3GMDA 4XOIA 3BIJA 3SYNA 4G24A 4D3YA 1XWFA 1ZHHA 5AVRA 4HNAA 3BUSA 5F7ZA 1R4NB 2UYGA 3G0IA 5JQGB 4GVPA 4KPFC 1G9SA 1M8GA 4L8FA 4FE4A 2CGEA 2CVFA 4X97A 3PS9A 1C4OA 1P6XA 1HE5A 2HV8A 2WU0A 4MW5A 3SX0A 4D3SA 3CNEA 2IEIA 2OV2A 3AI3A 2Q50A 1IM2A 3GDWA 3O4JA 4I5EA 1IFXA 4YJGB 1Y3DE 3UB2A 3W1WA 1WQ3A 1PJ8A 5C1IA 4JMLA 4BP9A 3C98A 3K30A 3OEWA 4LZJA 3UXYA 2AHRA 3B5EA 4AY4A 4AZWA 4ARZB 3T4XA 3K2QA 2A9JA 2V03A 4GYWA 1UUFA 3TTTA 4OKSA 1JL3A 1SC6A 1VPLA 5AW4A 3VU3A 2J08A 4WX2B 1RAAA 1JDUA 2JD1A 3DT6A 4MITA 2X1MA 4X60A 1GUFA 1GGFA 2H6EA 2VP9A 3FTQA 4DJTA 4DR5B 1N34B 3PLAE 1XPJA 1P3JA 2Z4TA 2IYYA 2C4HA 2IVFA 2XD4A 3U80A 4RZSA 4EZBA 3CJTA 3ACCA 3CR8A 1P0IA 1WMSA 2JJ2A 4JBLA 4MV6A 3NYRA 1E2UA 1O58A 1T9DA 3BAFA 2GM9A 3GRRA 4N0MA 1EE9A 1FX0A 5IRCD 2PS0A 4Y2TA 2XI4A 2QSJA 5CDYA 2OHFA 3DCNA 3UICA 1NVWQ 3JARA 1V6CA 3N6VA 3F90A 3ZCPA 1R5OA 1S3FA 3L4SO 3W2IA 1QKKA 1AZTA 3ICCA 1CQXA 3KSMA 4O2AB 3GPBA 4M0KA 3OCVA 4RLFA 5B1IA 3IUJA 4LDPA 4M86A 2WT4A 2DFNA 1EAYA 3CZAA 1V4NA 4I6JA 5KDLA 3I9LA 2B9EA 1HYEA 4NCBA 4Q4AA 3D8HA 4XPIB 4ZODA 4NNOA 5JLAA 3OCZA 3I6BA 5A7FA 3E1KA 1EFHA 1N5MA 3CCCA 1AN9A 2B8JA 1F3LA 3MOIA 3WL4A 3WYNA 3FOWA 4CMIA 4X8HA 1D2HA 4JJ8A 1OWPA 1Z4JA 4DEYA 4WK4B 2B4YA 4OIFA 2AKYA 2YVQA 3VKVA 4FXPA 4YAFA 2VNAA 2NZVG 4MKXA 2WSLA 4MVJH 3ULKA 2BMAA 3CRVA 3EZXA 3QVMA 2ZQ5A 4GGOA 4BMZA 2NQTA 3GD7A 1U3FA 4FZ3A 1B93A 1IHXA 1MN6A 3COVA 3STWA 2O48X 4ATNA 3C16C 4X1YB 1BVYF 5A04A 5HCIA 2YS6A 4JC0A 2WKSA 2X6RA 5KYTA 3K70C 3EF0A 4BRWA 3TZCA 4MW6A 2E49A 2J3DA 2JEOA 3IBGA 2BMJA 3AHCA 3ACDA 4KYUA 4O25A 1KI9A 3WKAA 5CM9C 2GMWA 3M4ZA 3BX1A 4J4BA 5G4KB 5GONB 5KNDA 4HS9A 4RW0A 5ITWA 4BVEA 3AIOA 3RHSA 2Q4EA 1GPWB 4TN1A 4PLVA 1KAGA 4IMRA 5BYBA 4PRKA 3U3ZA 1U8ZA 3X0DA 3JCZA 4CKEB 3FB1A 5JANA 4NI5A 3NBXX 1ENOA 3KB6A 4FCTA 3T1QA 2WMOB 3DWEX 3PDHA 4B9EA 4C05A 3UK7A 4F97A 3L4BA 1KYQA 4MRSA 5DI9A 5ISMA 4CV2A 3AF6A 2O0HA 1X1CA 3GLHA 3VC3A 5CT8A 5JZ9A 5GADl 2ID8A 4PSVA 5ECYA 3S7TA 3ZVKA 5NLLA 2QTVB 1BDHA 4HB2A 2IH2A 5IKPA 4TMWA 2Y77A 4RNDB 4BV2A 4DMRA 3O8OB 4JI0B 1SAYA 1T9CA 2BUBA 1Z8HA 4WKCA 3SY8A 5HJ7A 4B75A 3GJZA 3MS7A 5ALRA 3WSWA 1M6NA 1IH8A 3KKQA 5ALEA 2OLKA 2RIRA 2WKWA 4Q3CA 5I4IA 1EX7A 1HTWA 3JYLA 1NJ6A 1M6WA 4YX9A 4L27A 3ZCUA 1QIIA 2FDCA 4GYJA 3AVUA 1Q7CA 4LC9A 3CLUD 4A27A 5BV1A 3IDAA 3PHLA 3QVGA 4IICA 4UBMA 2UYCA 4M0LA 2HIAA 4DUGA 1CJSA 4OATA 2O8CB 2EJBA 2CNWA 1NMEA 1GZUA 4NBSA 4N01A 4BFYA 5EJ7A 2WU1A 1GPH1 4J6EA 3KUDA 2F1RA 2QENA 1JEDA 4ZMSA 5CDSA 2KPOA 1LZKA 1I6MA 1SO8A 4P98A 3USES 3GBVA 4ADSG 3P4UA 1TJNA 4AN0A 1W49A 2JH9A 1X9IA 3GA0A 2ZBPA 2PGAA 1XDZA 4WTOA 1ZD3A 2GYWA 3SX4A 4B45A 3H3FA 5D00A 4C0JA 1T3ZA 3DZBA 3RPEA 1D1PA 1HFKA 3P9PA 2YWHA 2E89A 3M6IA 1P31A 1G5QA 3S44A 1N5DA 1OROA 3SXPA 2B21A 3BE8A 3KZCA 3FMIA 3SSAA 4P4UA 3UENA 1CR2A 1GLVA 3DVQX 3ETEA 4NWIA 4M1OA 4BMCA 2NXNA 5ICCA 4TS1A 4LTDA 4P7KA 2EWWA 4IX9A 1GQFA 2Y99A 1S9DA 1XCMA 1E8MA 3N5KA 4M1ZA 2AZ4A 1V8BA 1A82A 1XEFA 1AGRA 1H2XA 4XIIA 5CFQA 1M8JA 1PSZA 5FBHA 4DR7B 3O8RA 1S8FA 2PGXA 3KTOA 5G4LA 4PTZA 3OQIA 4I55B 1V9CA 1VDZA 3V8RA 2Z0MA 2QVBA 3FTCA 1T25A 3TJRA 5MGBA 1MABB 1FNNA 4YCMA 2DQSA 2NV6A 5EJIA 1PYDA 3M4NA 4KGVA 4HAOA 3SPXA 2IHKA 3ND6A 2PGJA 2W9XA 4GR4A 2O7NA 5DZSA 3W5VA 5JTTA 3D5TA 1CZLA 3FUCA 3LFHA 4D1YA 3H99A 1HT2E 3E5NA 1I5EA 4NX2A 1GTSA 2VK8A 3O47A 4ZTUB 1N32B 4YONB 4V0ME 4DIUA 1G8JA 2N75A 1UAYA 1ZX1A 3AHFA 1OX4B 5A9SB 1W29A 1X2EA 4KBYA 1GA4A 4JENA 3C7DB 4EFDA 2FE4A 1M1XB 1RCTE 1AT1A 4E5SA 3RYHB 1Y3BE 3GY0A 2NMVA 3H5AA 1TO2E 1J99A 2PZLA 4DV5B 4G0VA 1VJTA 1HXHA 3TVTA 2AVDA 1DBIA 1LDBA 3V9PA 4MVYA 3ZOZA 4RTKA 2NUBA 1P1IA 4N5MA 4HDMA 5DXAA 3ZBPA 2AIRA 4NDNE 1T0PA 1I0ZA 2RH8A 3GUUA 1ULBA 4HDSB 4FT2A 4PYOA 5DSXA 2O2XA 3A10A 2F9LA 4UD6A 4RORA 2BKAA 4KO3S 4MOWA 1SVNA 4LK3A 4Q9LA 2FR0A 2XZTA 4C3ZA 1NVXQ 3EA5A 3GGOA 2QQ0A 5DULA 2GKGA 2FPGB 5IK2A 2PZMA 1WE2A 4BNWA 4F4IA 2KMLA 4ZO6A 4PFQA 3T4EA 1EQ2A 1WBJB 3L6DA 3LT4A 5I5EA 1TO1E 3CUVA 2A4KA 3H7AA 4X9XA 3ICPA 2WYHA 1XD2A 4K9QA 1NJFA 2NW6A 3EBLA 4G41A 4HDRB 1MH9A 1E5DA 1JVSA 1SJ9A 3NONA 3O7MA 3QP9A 1QHNA 4V0OA 3AUSA 3CUSA 4YRDA 1BEZA 2OV6A 4HVTA 1U9CA 3Q15C 4OGWA 1E6CA 2W37A 1MC5A 3DC7A 5DCLA 3SAJA 3ZCQA 3CN7A 3ZJUA 1DQZA 2BVNA 5C5IA 2OXEA 3DT9A 1OQAA 4PG4A 2EU8A 1FBNA 5G1PA 4XCVA 3WISA 5JFGA 2Q5HA 2PXCA 1MXHA 1Q74A 4CIBA 3ORQA 4RV5A 3GRYA 2IHZA 1E2FA 1VKRA 3NT2A 2C9DA 3SS8A 4BMOB 1VPEA 2V3VA 1R9MA 1M5TA 1KP2A 1P1FA 1IWOA 2MU1A 4TXHA 3W7VA 4C0XA 5JXHA 3AR6A 3A4VA 4OF4A 3OSUA 1QQ6A 1NQVA 6REQB 4KSBA 2H0RA 2BJHA 2CBGA 2H2WA 1ICIA 1GZ5A 1W4LA 3IKMB 1JNXX 1F0KA 2BZ1A 1MHPA 3GR6A 2OMKA 3IT3A 2H3HA 2N1MA 1GVNB 5KQGA 5K6RA 2OBNA 3HXLA 3L41A 5T4FA 2PUBA 4G63A 3I53A 2WF5A 4Z1OA 2NU8B 3ZGYA 5LFAA 4OL9A 1OI2A 1WX1A 1NR7A 1SBYA 2RJOA 3BTUA 3MXOA 2A5GA 4TRNA 1G9XA 1W5TA 3Q3HA 3VU1A 4QDKA 5TX7A 3UY4A 13PKA 3CG0A 3ADDA 3IAXA 1URPA 3WDLA 4CEJA 4JLAA 2C2KA 3FRJA 3TN7A 3SZUA 2EZ8A 3E5MA 3HCAA 1GQOA 1BIFA 1EJ0A 3UG7A 3RS2A 2A5LA 4JLJA 2VP3A 1PR9A 3X2SA 4EYGA 1T4CA 4F3RA 3GRPA 1E18A 3CKLA 3VU0A 3OWXA 5C34B 2YRWA 4R2IA 3C6YA 3DP9A 2NU7A 4NXMB 2OK7A 1VRWA 2ZAMA 4KR3A 2JFQA 4TX1A 2WVHA 4OQDA 1CFZA 3T5TA 1ZGZA 2O7VA 3IPCA 4OY3A 4OQYA 5DX1A 1ZA2A 4Z49A 4X45A 4RTLA 1I2CA 5JNWA 4K5QA 1SXPA 3I5UA 4P33A 2VHUA 3PVSA 1FBTA 2VHZA 1IXRC 2QVLA 1GAJA 2R68A 3UT5A 4TV8B 4ZARA 3DOEA 2DR2A 3FETA 2JKYA 1N6IA 3O2QB 1N7GA 1K7XB 3URMA 1FUYB 3CKKA 3JYPA 1PEAA 4QFCA 2BDUA 2V7XA 2JCGA 1KOJA 2PRJA 3MBIA 4R6WA 5GM2A 4E3WA 4ALMA 4PLCA 2J30A 4MA5A 4AW9A 3A6EA 3ANXA 4NNPA 5KCZA 4QQRA 5WRFA 4AJKA 4QRHA 3KSRA 1P2GA 4O2BA 4Z8YA 3ZHVA 1XC7A 4PN7A 2OOKA 5C37A 4PS0A 5AQ1A 2OYSA 1MJFA 3ZGVA 7AT1A 1POWA 1QIMA 2KWIA 2O50A 1V41E 4EB6B 4F5YA 1JFRA 2VTBB 3I6ZA 4FP9A 1CC1S 3MWDA 1SOAA 5EFOA 3DDOA 4BNUA 4DJ5X 1BJRE 4B9AA 3CVVA 2I1WA 1QTQA 3JAKA 4K6MA 2Q2QA 3WDMA 2WMYA 2IU6A 1W59A 2QLBA 1G17A 4YRLA 4CT4B 1REQB 1Y8ZA 4Q5IA 3A11A 1F9EA 4DDWA 5JI3E 2N42A 3GNQA 4IG9A 1GGKA 3MWYW 4TT3A 4REMA 4R71A 5IDWA 4JL6A 3SFTA 4XSVA 1LBHA 4KH0A 5AI9A 1P2SA 1KR5A 3U1TA 4CV1A 4MEBA 1KXJA 1VHDA 4JXKA 4WOPA 3MRSA 5JAZA 1YR2A 1AV7A 3GUVA 4NZOA 2DTXA 5CNKA 4BS9A 3VI4B 3VQTA 2IJGX 2Z57A 1UWKA 4U1RA 1J0EA 4Y6GB 5D84A 5MN4A 1YO6A 4F21A 3UMYA 2VAMA 5BQFA 2WFMA 1VKOA 1K8XB 2YVAA 5LLTA 3AEZA 1Y0BA 2FZLA 1SUWA 1X0VA 1KJ8A 3MS2A 5B3KA 4QVIA 3IH5A 3HWSA 2AMJA 4DVJA 3TEFA 5AKYA 2AZTA 1R2QA 3RC2A 3RKUA 1QX4A 4EI7A 2VTDA 4O6VA 5ECDA 2P1RA 2HSEA 1IIRA 3GLVA 1OYVA 2BMWA 3BHIA 3O4GA 1WR8A 3UANA 1YAHA 1X1SA 4IFIA 1X94A 4IDOA 1B6GA 3TNYA 4OSEA 1BX1A 2GT1A 3VR5D 3H97A 3NTRA 5E1BA 1MEJA 1QHHB 2CLCX 3BGIA 3CZ5A 2CL5A 3D6AA 1R8XA 1Y1SA 1ENZA 1KMQA 3KCQA 3CINA 3ROXA 1LI4A 3PE4A 4B44A 2GNAA 2W93A 1ECJA 4BPRA 1D8AA 5TMDA 1BGXT 2Q5LA 1G20E 1ZD5A 3Q2IA 4XOUA 3QXXA 3TXYA 2D2XA 3KZ1E 3LYHA 4J0JA 2AC7A 2CYAA 4MQ4A 3SSOA 3U3XA 3V4LA 3RVKA 5B57C 1XOIA 1JMYA 4BGEA 2FB9A 3SE0A 1J5PA 3TL3A 4EDFA 1QMGA 1Z25A 1IPEA 4MRAA 1CB7A 2HK8A 1AV6A 1B0AA 3TBKA 4QM6A 3HDJA 4YCCA 2P9BA 2FSSA 4J16A 1NUUA 4NZNA 2C8JA 3SHQA 4KQ1A 5AUNB 1MX3A 4JUBA 5HUJA 4QQNA 5JS7A 3D8UA 1XKLA 2BLLA 4JBHA 4NNJA 4K46A 3WGTA 2L69A 3Q6NA 3R7LA 3L1IA 3UAWA 3NJRA 1EZZA 3RIGA 4DJJA 4GLOA 1WUTA 4KQXA 4L4YA 4O5AA 3U7HB 4QTZA 4IJ5A 3EA4A 3WK4A 3WVNA 3AFMA 4QOGA 1GTL1 2ATCA 3GJ7A 2BBSA 2C20A 1CKEA 1OAAA 2FX3A 1XI2A 4QYIA 1FLNA 4I4TB 3UKJA 3W0LB 1FRZA 2HWKA 1U8AA 1L4LA 2V7BA 3BF7A 4DSOA 1C3EA 5G3YA 3E3LA 5SYMA 1JAHA 2F8LA 1K6JA 3K0AB 5FBRB 1XZQA 1LLDA 1KA9H 3N6RA 2IIPA 2YX1A 4DNPA 2CLSA 1NASA 1GGHA 2AE2A 3A26A 3LPMA 1GY8A 2YN2A 2Z6VA 4OX9B 3CUKA 1JPNA 1YIDA 3BXXA 3AR4A 3JVUA 4EEXA 5JY1A 2IBTA 1G6HA 4J9UE 1EPUA 2DKFA 3ISTA 2FCRA 4H77A 1LVGA 1LKZA 4DRXA 1UPCA 1Y5RA 4LVNA 4CKWB 3RJZA 3HA7A 5C46F 5JCOA 4KC0A 1WD5A 2CKMA 3HJUA 1XYVA 1A8QA 1A9YA 1X1DA 5CW1A 3WBKA 4NBTA 5ALFA 1RYHA 1D0SA 4GDMA 2R6AA 4XZ3A 1M8FA 4E7OA 4XX0A 3B8EA 5HG0A 2YZMA 4QPJC 4HAWA 1K68A 3FNHA 3FNGA 3IR6A 4R54A 5LYJF 4JB0A 3GPCA 2VJOA 1XKXA 4KVFA 4ZV7A 5CLHA 1F4LA 1PKEA 2WHPA 3B13B 5CCDA 1FLVA 2OLJA 4WQMA 3KX2A 1RHRA 4PR3A 1XN1A 3NTOA 3PEEA 2Z2ZA 4RH3A 2HHLA 4B09A 1VDMA 2C95A 3VO1A 3F1LA 3T3DA 2DUJA 1FJXA 1JPUA 4NPAA 4DLRA 1P5RA 3OQPA 4HK4A 5HILA 1SKUA 1T9AA 4KIJA 4EFNA 1ECBA 1G60A 1ZNZA 4ER3A 1V5IA 5BSKA 1TXGA 4MA0A 4WXMA 6PFKA 4CU2A 4JB8A 3I42A 3M6WA 4YYEA 1P29A 2YFKA 4NF2A 3D59A 2PX4A 1E3WA 1X70A 3PP8A 1RZRD 1FQWA 4QJIA 3V9AA 2XWSA 1FFEA 3QUTA 2ZZNA 3GAZA 5HZKA 5TQVA 1UIMA 1P7YA 2W2LA 1I5OA 1T1EA 1VGRA 2GN9A 3OFND 5K3SA 4EATA 1ICEA 4N8EA 3OLXA 3JVEA 4M1EA 3ND9A 5DGHA 3H5TA 1C80A 4JLOA 1U4SA 4K86A 1XRQA 2ZKLA 2HQ1A 4DDHA 3FBWA 3D6FA 1U9YA 4L5JA 3GLFB 5TIIA 4KREA 1Y6RA 1ZWLA 3GJ0A 3R6LA 4JEHA 4QUGA 4KPYA 2Y76A 4IDQA 4J1SA 4NS1A 4P2GA 1XLTC 2GYVA 2XMBA 2X86A 4XXHA 5EWJB 5LIRA 1HY3A 1K5HA 2XUQA 3NH6A 4IM7A 4Y6RA 1EDEA 3GU3A 4ZOLF 3U09A 2V4MA 3PGKA 5G0WA 4F46A 3CONA 4RVCA 3TQCA 4KQIA 4BMSA 4Z51A 4EP1A 2CMKA 1WSWA 1SXHA 3CO5A 1F2UB 3HWRA 4NENB 2X5NA 4OK3A 3CX8A 1VQ1A 2CF5A 1KO5A 1FSZA 3GEIA 1UBRS 3MB5A 3K9HA 2QUKA 4HGPA 1ST3A 3N58A 3IV9A 2CUTA 3ZHYA 4E2XA 2I1QA 3HSKA 4Q7LA 4EW6A 4BVAA 4IXWA 4J0QA 5M34A 1W0KD 4A5OA 1JR4A 4AURA 3ESXA 2IVZA 1NBIA 2YV1A 2FOIA 1CUGA 3U7QA 5AT1A 3UH0A 3CH5A 3U4CA 1UFKA 4MRPA 5I9LA 1LDGA 2WNHA 5FUYA 4CI9A 3HNOA 3A9WA 1DC8A 1QG0A 2UZ1A 3EQ7A 2V9PA 1WULS 3P9NA 4EAAA 1E6WA 4R69A 2PSEA 4MYHA 1E3MA 1E2BA 4B7AA 4ETIA 1MO6A 2PVSA 2J4CA 3KAPA 2NO5A 4F4DA 2V6FA 3COZA 2WG1A 3ZHCA 5KSYA 1ZWKA 1QR6A 3IAHA 5GMOA 3ZU4A 1B74A 4YJDA 3AHJA 2CEKA 3ILSA 1E5VA 3HDTA 2X8AA 2QRNA 4X8OA 2IHNA 2CDCA 1KDZA 1P8JA 1EFRA 2C7PA 4KUGA 3TSZA 1D4AA 3M6MD 2YV3A 3OLQA 3ZU5A 2ZI3A 1H85A 4BVGA 4EG1A 1MKYA 1RRPA 3ZEAA 2FAXA 3L1HA 1J56A 3RH0A 1YB1A 3C8DA 4PNZA 1OLXA 3RV4A 1ADBA 3O9MA 5JO9A 3FFXA 4MO9A 3A25A 4LVCA 2PX8A 4RXUA 3U3RA 1VL1A 3EPKA 4RU1A 4DV2B 3R4VA 2EEZA 1G7CA 1ORWA 4B40A 5L4SA 3FCEA 4N6NA 1MQ8B 3GEBA 3HKDA 3QX8A 4HWOA 4V0RA 3RDPA 2H07A 2FMUA 4DPKA 3R0QA 5BOSA 1HL3A 1WL8A 3DDSA 3QIAA 2FPOA 4JOSA 2C2HA 2JKVA 2ZAYA 3ZC3A 5CA1B 5ALUA 2PHZA 1DWPA 4DQXA 1ZN9A 4GPTA 5KSOA 3GMSA 5KYNA 2DERA 2C59A 2ROQA 1OGYA 2BL4A 3NRBA 4KIFA 5IXYA 1UJ2A 1PFUA 4L50A 3IMEA 3Q3GE 1IEQA 1O8BA 3FKSA 4I4IA 2PFKA 2HJGA 4MIKA 4S35A 5L9AA 4TVBA 4K6CA 4P86A 4HGYA 4BB9A 2RGYA 1P6QA 3UK1A 4EMBA 3ETNA 4F1WA 4RY0A 1SIOA 2XCRB 1BHQ1 1M34E 1W5EA 4Z4IA 2UYYA 1DPFA 1T1RA 4REQA 1M0TA 1E9DA 3KKLA 5E6RB 2FLWA 1ZZEA 3DYBA 4M8SA 4UM5A 4CR8A 2C9YA 1T36B 4FUQA 2ZPAA 5AYVA 3UJHA 2EYQA 3WGLA 1NWCA 5ES3A 1FXWF 1UFOA 4CG0A 1O96A 1LDEA 1Y3AA 2HI0A 1FFWA 1HZZA 1AQLA 5E7MA 8GPBA 1L7PA 1FTSA 2ORYA 1FJHA 3KZMA 3NC1C 2SHKA 1BW9B 3LKVA 5K3EA 3WAGA 3IR5A 5LBUA 4EBFA 2G83A 1R12A 3UFBA 2D4AA 3P8ZA 3DOHA 3MMNA 4V38A 2PSFA 1GLNA 4MVJI 3I73A 4IHKA 3LBHA 1COWA 1QHSA 2FQ1A 3EPPA 4LYFA 4Y1RA 2CVOA 3IEUA 3QW2A 3WYAA 1KAQA 1UXGA 2DY1A 2R87A 1IZZA 2XEDA 3MWGA 4FW8A 5B6PA 3M34A 3WFIA 1OBFO 1IY9A 3SZRA 3VNUA 4H18A 1KVQA 4OFXA 3UAVA 1CRLA 3ES9A 2CMHA 1G7RA 4R51A 3WFZA 3W8RA 6ABPA 2B4KA 3O3NB 5DVZA 2V7QA 1BFUA 3CVUA 3Q1KA 4LXQA 3EC2A 5KB3A 1LRKA 2AQIA 1M6YA 5J2UA 2TMYA 4AMZA 9MHTA 2G28A 2IXFA 3H2BA 4HDOB 1HEYA 1MJHA 1R27A 4OSOA 4UZSA 5EXPA 1B0PA 1KHTA 1P45A 1WCWA 2CK3D 3CLTD 2E0IA 4M37A 4BNNA 3RU9A 4C03A 4DBLE 1K5GA 3FYUA 1DUIA 1ZD4A 2AXPA 2W6OA 3AF4A 3V4PB 3TPZA 3VOSA 1N7IA 2PIDA 2FX5A 3B1WA 1JKIA 1MC4A 3HFGA 4P0PB 4EELA 5JMPA 3VDRA 4P4TA 2WE7A 3OE7A 5A06A 3JZDA 4GU5A 5IH7A 3UT6A 1L4YA 1WJGA 4I8DA 3VSBA 4DLVA 2NUAA 3TEJA 4LE2A 3RQIA 1AKQA 3MFQA 3B5IA 4DCTA 2C94A 4EPRA 1SOVA 3VUFA 4DJAA 3P2OA 4OOFA 4LTNA 1NVBA 3IT1A 4XFDA 5FFNA 4DABA 4DMGA 5B7QA 5LWHA 4PX3A 2C88A 2AMFA 2YC4C 3ESAA 1PF7E 4FK8A 4EHFA 1EFLA 4I9UA 3GGCA 1P7PA 3SIXA 1P0QA 4MEJA 3ESBA 3KOXA 2Y6VA 2XODA 3E84A 1VLJA 4I1SA 2PR7A 3EIHA 4MP3A 5ETJA 3W9UA 4DDMA 3N8IA 4UHBA 4C2AA 5KTNA 1JU3A 4Z99A 1XROA 3A28A 2VQ3A 3F2VA 1K7YA 1ZMXA 3SNHA 3PRYA 2AFRA 1H2ZA 1SZDA 2B3TA 2J9FA 2VAPA 5C5CA 2Q6KA 3ZNNA 4WCFA 3EIWA 1MO4A 2GRAA 4Y0NA 4XQ9A 2DCMA 3I1IA 5JDIC 3ZJTA 4RK0A 5FWYB 3BDIA 3ZDRA 5KJCA 3VX3A 1QVVA 1T4GA 4FBMA 2G0TA 3TRDA 3U16A 2GK6A 4PZZA 3ADBA 1DBRA 2DTDA 2OHJA 2I55A 5AIAA 2JLCA 2V8BA 3MG9A 1KIAA 3CA8A 4EJSA 3S5UA 4I2NA 3SJZA 3S81A 5EVCA 1O95C 3EFHA 3PQDA 5EE0A 2HYIC 4AN4A 1E96A 1QVAA 1ZIOA 4FYHA 3A1DA 5EZ6B 5TJHA 3G8DA 3WIDA 5EXEA 4L4XA 4MR9B 4RY2A 4N82A 1PFKA 5DTMA 3VPSA 3W8DA 2WDZA 2QMHA 1VLVA 3KQTA 3H4VA 4J0FA 1M1UA 2A1IA 2GZ3A 1M1YB 4X20A 1Q15A 2GLTA 3Q12A 4F3CA 4BRZA 4QLAA 3R8CA 3NDRA 3ST7A 4R7TA 4HH1A 1OFUX 4MS1B 3UEOA 2DBVO 3I6IA 2F64A 1GRCA 2CFSA 4RKFA 1Q7GA 4NPHA 3WFJA 4CLRB 1YR1A 3FOBA 5SY6A 2RHJA 4QXOA 3RS5A 1YR7A 3IRVA 3K5IA 1C3VA 3QA9A 3SBOA 4TXLA 1EXWA 2F3PA 2OXRA 3OQBA 2ZSFA 4HZUB 2AD5A 2AR9A 5JZSA 3R5KA 2CT8A 5KQLA 1TD9A 3REOA 4JXZA 1Z4MA 4QGGA 4Q9DA 3AEUB 4C7VA 2Z09A 3R09A 5KBYA 3OP1A 4G8BA 3NBZC 3IP7A 4ZVPA 4LY9A 4LPKA 2PAFA 1SQGA 2DPYA 3W1EA 3IXLA 4DL9A 1XZBA 4Z0PA 5DHPA 1UOQA 2XVYA 2Q5JA 1FC0A 3JQAB 3G1TA 3GJQA 4RH1A 4X7PA 3DKVA 1VCMA 4DM3A 1S2MA 1DKLA 2HLNA 4A2PA 5ICSA 4I3FA 4RCZA 1LJ8A 3TNFA 4HNSA 5SV2A 2D0IA 3LX8A 5EC8A 1ZH6A 2I4IA 3GIWA 2RHMA 3ZY2A 2RHHA 5TSDA 1EM8B 2EV9A 2BM8A 1Z07A 2H8KA 2J3LA 4YCBA 1JZTA 1AB5A 3C4JA 3Q6IA 3STUA 3WQSB 3G2JA 1R9JA 5JJ5A 1E8NA 1W5SA 2O1SA 2XRMA 3ENQA 2H5JA 3RIHA 2PUCA 1BVUA 4G9EA 2DUUA 3UJBA 3OMLA 2EKPA 3A9TA 3ORYA 3TSAA 1MB9A 2YY5A 1QONA 3AERB 5IP5A 1ORDA 3G5MA 2IXGA 3FWYA 1M2WA 2X76A 2XJ9A 5JFTA 1RKBA 2NADA 5IJ9B 1EBFA 2I4OA 3L0CA 1E7YA 3D7RA 4RQTA 2FETA 2H63A 3DV2A 2A3NA 3B1JA 3GIDA 4AJ4A 1KS9A 1A97A 1T15A 2F3RA 3IOCA 4NP6A 2BKLA 3JQ9C 4X0EA 4JJZA 1E0SA 1JEAA 3LLCA 5FO0A 2CHVA 3GBSA 3ITEA 2B2CA 3A9VA 1BOOA 1R4ZA 2RBKA 3CT4A 3K0FA 4NU0A 1TM2A 2GCGA 3LUJA 3S27A 2H2DA 3ZYCA 1V1MB 1SVWA 5THQA 2VHQA 5CLFA 1JKXA 1WPGA 2YYAA 2XIQA 4H3SA 1HETA 1NQAO 1U8UA 2ZIVB 3H2SA 1VXOA 1JNYA 1NTOA 2R62A 3CTPA 4TMTA 4AF8A 4PHHA 2N47A 2GAIA 1VGVA 1QG2A 4XW2A 4CM8B 2Q0XA 4G84A 2P65A 2VIIA 1DIHA 3D31A 4C3VA 5HEKA 1L7OA 2JJQA 2RHOA 4ZAFA 1PV4A 1IBSA 1NU6A 1RQLA 3N8KA 4PRZA 2OEPA 2VQDA 3K70D 1M0WA 2WFLB 2WI8A 1L7DA 2QZJA 4ISCA 4NK4A 4OA8A 5F73A 3TB4A 3P9IA 2QG9A 1E89A 4IY1A 1GQQA 4J0CA 3KJIA 4ZJPA 1U80A 2FP3A 1JJAA 1BCRA 3F7TA 3OJEA 5DSZA 3J80A 1EFDN 5C4IA 1DE0A 3HUDA 4L15A 4GI5A 4RD1A 2N3ZA 3I64A 1F1JA 4EJ6A 5AP9A 4LFAB 4PXAA 4XVHA 3E35A 4RVSA 4EVSA 2D2VA 4RCYA 2I87A 4C2TA 4ZVUA 3G5LA 4FDVA 5IN5A 4FN4A 5CFOA 4X1IB 4DR1B 4EQ6B 1FFSA 1DDGA 2DAPA 1ACMA 2JNWA 2X22A 2XQJA 3RIEA 1L7RA 1KJZA 2YZKA 2ZIAA 3L8CA 1WZUA 3IQIX 3PPVA 1L1QA 4MUMA 3T54A 5C80A 1OE0A 3NPMA 5TQ2B 2M6LA 4M98A 4C29A 2O23A 1OXMA 2QT9A 4P92A 2Q7XA 3MJVA 3O5AA 2QTCA 4B3DA 5KJFA 5C3UA 1VYVA 2B1RA 2BCJQ 2H11A 2J5BA 5IXJA 1HFJA 1CIVA 3AM1A 3WRXC 4HO1X 5C0OE 3DQPA 1D1SA 4NAUA 3THRA 4TWIA 1JFFB 3HLTA 4TKVA 1CWUA 1OLUB 3MCVA 3OCYA 2HT1A 3F98A 4TL6A 1O2DA 2GN6A 2GJKA 4EHLA 2SCUB 2GF0A 3NQ41 4DG9A 4XLTA 3RU2A 3EDMA 5FNVF 1ADFA 3ZE6A 4N5LA 5I45A 6NULA 2VDLB 2GXUA 1JDTA 3RJMA 4QEKA 2VHWA 3K32A 3SQOA 5G02A 4B3HA 3BKWA 2G9RA 1CZUA 3MTJA 1EINA 1C1DB 3KCNA 4R31A 3ZU2A 3ER8A 3CO0S 1KJQA 5B3JC 3A4IA 5CCEA 2XGJA 4UHCA 4DWJA 1O9GA 3L9XA 2EQAA 5K2MA 1RC0A 2FEMA 3OZSA 1KEPA 5LZ7A 2LBPA 4UD2A 2JI7A 1G8YA 4R9UC 4N76A 3W90A 1ZO8A 1XTPA 4MQFB 3CZ4A 4UUPA 4YRQA 4Z7QB 2HHAA 3BSFA 3HZZA 3PRJA 3FJYA 2GETA 2ODQA 2I4NA 5AR1A 5JZVA 4RULA 3V33A 5KKNB 3GGPA 2AJBA 2Z4RA 4TQ9A 3AUUA 3B51X 3B9BA 5JMOA 4QOJA 4X8LA 3L8MA 4HMPA 3U4QA 4OI2A 4E5KA 3PIRA 1FRNA 2YWEA 2EBUA 4ICIA 4OHCA 1LRLA 1S5PA 1JLKA 4LJ5A 4MH0R 3ESYA 1KWGA 3GFPA 3ODGA 2R7MA 3BQNB 4URYR 5TEVA 1BOFA 5EESA 2XUAA 4J3FA 2ZJOA 3RYFA 3V2IA 4CL0A 4CR6A 4H1WA 1H9CA 2IEGA 1V3VA 1QP4A 1EHYA 4HKTA 2VDVE 4KQ9A 1JWBB 3THYA 2A14A 1BE1A 3QPAA 521PA 4PIVA 5LXTB 3EFBA 1UJ5A 2P9YA 3NOQA 3PA8A 5KSPA 3NHYA 2YHAA 1TU4A 4RGBA 1Y6GA 1PDWA 1K7EB 4CLEA 4LQCA 4S2EA 2ISQA 2H59A 2X58A 4UVHA 4AO7A 1T5IA 3ZPXA 2HREA 2W8ZA 2OVFA 3K0SA 2Z2XA 1NUAA 4MZDA 4U2CA 2XHEA 2HDNB 1DELA 2NXEA 2BM0A 2NZ8A 2R1UA 2BONA 4JGGA 1N0UA 4FGKA 4FBLA 4N47A 5M04A 3A9CA 3FFWA 1TPYA 1I3KA 2WD8A 2NV0A 1XN4A 2PDAA 1DIBA 3D64A 4B3CA 4R1LA 4WKGA 2IUUA 3PHBE 3COPA 4R9RA 2J5QA 1IY1A 3JV7A 2OK8A 3LHFA 3FIUA 4NE2A 3VPDA 4A5SA 4UTNA 1I6KA 2P62A 4FYWA 3UJ6A 8MHTA 4E12A 2PUJA 2VWQA 2BFCA 3FDFA 1BDBA 2CD7A 2ZE5A 5AVSA 2XWQA 4XFKA 3QBTA 4YUYA 2L17A 2V7GA 2TRSB 3LZCA 4TV9B 4UEOA 1NC1A 2XRFA 3OZUA 3ZCTA 4B5LA 3ADOA 3GZNB 2C4KA 1NI3A 3MJHA 4JCOA 3WB1A 3N2GA 1QAQA 2QZ9A 4U2BA 5EIWA 3WR5A 1W6RA 2G8NA 4ARUA 4FYVA 1P8AA 5DLYA 1RC8A 3JQCA 1TA0A 2ZJ8A 4ZRMA 2IXAA 2EL7A 3OQ1A 4URWR 1RRCA 2EX1A 4FLFA 1NAIA 4JDPA 5JZMA 3KVRA 2PMKA 2FR8C 1USIA 5BN1A 4WL0A 3B85A 4FQ5A 4GEGA 2TSYB 1IHOA 3U56A 2B61A 5KTPA 1OPXA 3OESA 4KXNA 1GSAA 5I9BA 3SBDA 4KQ2A 2PJUA 1PX2A 5BWNA 2XMPA 3I62A 5K6AC 2IIQA 2PYIA 5CYOA 5FBQB 1B41A 1LGYA 3F0TA 4CU5A 2PK3A 3NV9A 4RY8A 2Z6UA 3A6FA 2DP4E 3F6EX 4BRSA 1I3LA 1MBZA 4NFSA 3ICVA 5EFZA 1G1AA 3P4YA 4G5QA 3C2QA 1TOAA 1IVNA 1UAGA 4KI0A 2CLDX 4FMCB 1IZ0A 2YFHA 3WYFA 1YHNA 1RXCA 3QJ5A 3JQ7B 5TB5A 2XT6A 4E6PA 2JANA 1L4KA 1KO8A 1IBKB 3L0PA 4B3JA 3NYIA 3EY4A 1BHO1 2FK7A 3EXHA 3B6EA 5ALJA 1GOTA 2FF5A 4CEHA 2GBGA 4POOA 3MTQA 3DMRA 1KFKB 1CBUA 2FPIB 1FVXA 1TU3A 2P5UA 1BVHA 5C8YB 2YMPA 4LDAA 3BMNB 3ONFA 2CV0A 3KJZA 1CEQA 1FTGA 1HUQA 3GK3A 1PJ4A 5BT9A 5KNBD 3LK7A 4IHJF 4IP0A 3BFKA 1W8IA 4ZT4A 3P2JA 5JCJD 3ADPA 3HJTA 1AS3A 5LNK6 5ADHA 4GMGA 3DHNA 2FUEA 4LYYA 1O57A 2VLBA 3E9DA 5EP2A 4QGSA 1Z29A 3GLIE 3ZLVA 3GC6A 1B8VA 1THMA 1WY5A 2X6QA 4XASA 4YMVA 3STHA 5BYKA 1G2OA 1CUFA 2ZR9A 2O1EA 5BSVA 4CQNA 4R8KA 3EASA 2B35A 3PQ5A 1W34A 4ZQEA 2FW1A 1KH3A 3I28A 4M9UA 1XPOA 2ZRHA 1BFDA 4IDPA 1ANKA 4D82A 1QRAA 1JDVA 2QG6A 2B1QA 1YR8A 1QH1B 3OT1B 3C8HA 4NU6A 5A4FS 2CCKA 3ET4A 1IJFA 3RYIA 3T5PA 1ZMOA 2YJTD 2R79A 3I3SR 2E21A 2J6BA 1XZKA 1LF5A 5HDQA 3W79A 1KTIA 4FLEA 4K9SA 3HXTA 3I0NA 4QWMA 1MQSA 1GYRA 3IOMA 3ABRB 1VJ5A 4PXYA 3TOSA 1UOEA 2WSIA 3X2EA 4UBLA 2CDBA 1JSCA 2F43A 2PWBA 2Q1TA 3VYWA 5FWXB 1EUDA 5DTQA 3UUGA 1AMUA 1M2OB 1G291 2G8LA 2J9XB 3UV7A 3VV2A 3WL6A 1JFTA 4EB3A 1E4EA 2WOJA 3CF6R 3EXEB 1OWLA 3ICOA 4X8MA 1QAMA 2CB0A 3D4NA 1R0WA 3E1GA 4P08A 3SR3A 1MX9A 3NP7A 4KWTA 4UFNA 1G5FA 4U6SA 3WAKA 3IX7A 4LZAA 2II6A 3C48A 3JVVA 1PDOA 1NXXA 5IANA 1SZPA 3OCJA 3JWPA 2VWPA 4LKRA 1OGIA 4JSRA 4UKDA 1MT0A 1QANA 5B3LA 4TQUS 3BXHA 1Q0UA 1UMBA 3E82A 2I4MA 1RJDA 4B6SA 1KKUA 3NVAA 2XB9A 4IWYA 4ZI7B 2NQ2C 3E8MA 3VKGA 1QGAA 2CVPA 3E4DA 3W5IA 1OJ7A 2G06A 2CDAA 2CLEB 3B1ZA 4LJLA 1A4XA 4QHTA 1AKUA 1YOBA 1DBSA 4U4AA 4ENQA 3ERCA 1VSUA 3LUCA 4L0CA 3WX0A 4CIDA 4H6XA 1UZAA 1K97A 3F9IA 1YRHA 3IO3A 2WIJA 3ITDA 1YA4A 2F3UA 1YS2X 2JFFA 3O9ZA 2C96A 3I09A 1M54A 4XARA 3OEYA 5C1BA 3S2YA 4DCGA 4QUBA 3MTDA 1M66A 3S2SA 1DKMA 1QF6A 5HQ3A 1MG5A 2K6GA 4TLAA 4X3CA 3FCCA 1UPUA 2V98A 3I2FA 2QP4A 4D4JA 3AV3A 2PZFA 2GBPA 3QMPA 3DMDA 4OQNA 5K0LA 1C7IA 2PQ6A 4BXOB 4LRSB 1BA2A 4YMTA 2PPVA 4NOLA 3L6OO 4L0QA 5JJBA 4L73A 5LMUB 4QHYA 4RY9A 4UU8A 3ZS8A 3D6TB 4CEIB 4IIXA 1QOQB 2BDTA 2H1VA 2AG5A 1MLDA 2VP6A 4WBNA 5C32A 1K0UA 2ZSHA 4NAVA 1X1RA 2EJCA 2ZOSA 4H7DA 4Q3AA 3C45A 3UT0A 2YINC 5H4HA 4OB6A 3IAM1 4DSZA 5EKXA 4Z5XA 1GYQA 3OQNA 4RK6A 3RADC 3IBTA 3G8CA 3HCOA 2PGLA 3IUYA 4P4NA 3UK0A 3D6VA 5JPCA 1YSCA 5DNAA 4FFWA 3P9SA 1JYFA 4YV1A 5IX8A 1BH6A 1V2HE 2G1PA 2J4DA 4JOCA 3IBCA 2ODPA 2EDAA 2VATA 3OY7A 4G5HA 4HQFA 4HR7A 1ESEA 1G6OA 2YDXA 2QTRA 4JP5A 2RGNC 4U2EA 3QOFA 1KNQA 1NW9B 1PQ4A 3EOBI 2PRZA 3NHBA 1JAZA 1G98A 2G3YA 4J2OA 4JFRA 2NYUA 1CUYA 1V4VA 4R05A 3ZDZB 4EF5A 1XRMA 4AMGA 2ZETA 3LUHA 7MDHA 1Z17A 5CJ2A 4EENA 3BJMA 2QTZA 2M6RA 2P0AA 5JNTA 5IMBA 2B1GA 1KY3A 2J87A 2A0KA 3OLWA 4TTSA 1XDBA 3QUBA 5D6OA 2WWVD 4ZEWA 2FPPA 4BX2A 1DIAA 3C3KA 4UUQA 1EQUA 5BN3B 2ZTVA 1LPPA 3BTOA 4C1NA 3ZXUB 4LMBA 1E79D 1SGWA 2G63A 5CDFE 5JR3A 2DLCX 4JXJA 3TRIA 3AETA 5BMVA 6LDHA 4EHAA 4YT4A 3E23A 3W6UA 4A7PA 2GHIA 2IL1A 2IGBA 3NBQA 1JI3A 4GGPA 4OGKA 4CKCA 4KPEC 5FUBA 5ICMA 1II9A 1E7RA 1MZVA 2P3SA 2X8JA 5CB4A 1E2JA 4D6PA 4EB8A 1OPRA 4F9FA 2N46A 1MH1A 5DIFA 2HH9A 4PC3A 4LF5B 2ZS7A 4DC0A 2AJTA 3DE5X 1X3LA 4B32A 1YK0A 4LGMA 3IE0A 2NZWA 2R8YA 3P52A 1UP7A 4L85A 3TWOA 4Z1MA 3W6PA 2RE8A 4F5WA 1Z0UA 3N2ZB 3PXAA 4L9SA 3KXKA 5H3LA 4GI3A 3C6KA 3I39X 4RAQA 2HJ9A 4IUYA 3SMQA 3KQHA 1XQVA 2W8BA 1A71A 1NN5A 2HMWA 2JFVA 3FCXA 2MYUA 2XDAA 4MVJF 5LDHA 1USWA 3OHPA 3T0GA 5G53C 4NU8X 4OH1A 3A3OA 1SXJC 1JVBA 3HU1A 3KKZA 1O6GA 2W6QA 1Y4DE 1E7WA 1FVHA 1OTHA 2B82A 3HCPA 2V9CA 1RYBA 3CW8X 4I6GA 1DLIA 1R6DA 2J7KA 1CZOA 2O0LA 2PGIA 3IA2A 1C2TA 1KGDA 2F4NA 4NFYA 1BU8A 4UMDA 2J0UB 4BNDA 5A4JA 5LQAA 5D3MA 4N48A 2FGKA 4E5MA 1LFAA 1E2DA 1FMTA 1HE1C 4MDHA 2AN1A 1CR6A 1EFVA 1ZOSA 2Y1EA 3IURA 4QICA 2Y71A 3RWMB 4B48A 4C6TB 2V5AA 2IYNA 2QUBA 3OJFA 3OFSA 2ONZA 1E7QA 4QXAA 4WZBB 5E3JA 4ARSA 2ZE8A 1GPDG 4RV9A 4RVNA 3VJKA 2BEUA 2YHUA 3O94A 4XVQA 4H4DA 2ZI9A 2Y1FA 1XXHB 3FAKA 1Q1AA 1RHMA 2A78A 3GAAA 3FDJA 4RVFA 2Z30A 3GT0A 1YZLA 4XVRA 3W3ZB 5DM60 5EKUA 2XDYA 2FW9A 2IZ6A 2VXYA 3AY7A 4WXPA 5F2KA 1LNSA 2ODWA 5A4AA 4TYNA 2QTHA 1F8GA 3QWFA 3U7IA 1IZ8A 3EVTA 4DLKA 1NI5A 1W85A 3HXOA 4LI0A 4QGAA 4Q4JA 4DUPA 1J2EA 1CRWG 3R5TA 4BNHA 4IGEA 5EWLB 4DLSA 1L4FA 3Q7RA 4G1MB 2QYSA 5TT0A 4BMVA 1I4WA 4JP2A 3GT4A 1PWXA 4J3JA 8LDHA 2FQQA 2E4UA 3AUAA 1M1NB 4UBKA 4BVBA 1TVCA 2X5KO 1M6VA 1F2DA 1W0JD 4LRYA 2CXHA 2QIPA 2IF0A 2BFAA 3M5DA 4M2LA 4XGKA 3GP5A 2IP2A 5ILOA 4MUJA 4ND7A 2FEXA 2XNHA 5AKHA 1Z5PA 4GC9A 4DC1A 1GXSB 3BERA 1IYZA 4LXUA 4CRWB 1WM1A 1JBEA 5IKEA 3LDFA 2ZWIA 3PYXA 1NVTA 1QCCA 1V45E 4CM9D 4DW8A 4PLTA 3LQ2A 4WFKA 2OECA 1NSTA 4GX2A 4HLDA 2GKOA 2CW5A 3DZFA 2A86A 4XWTA 2ZYDA 1CDOA 4MR7B 4UOZA 2Q3JA 1YT5A 3V5NA 4RSHA 2YASA 2FW7A 4LRUA 5EHQA 2J5RA 1H4TA 2C07A 3VX4A 1FFCA 1OFIA 3DHVA 5FFFA 2PM8A 1H3FA 3IJ5A 5BSMA 4F45A 1LWOA 4TUYA 1CRQA 2IOQA 2JHFA 2ZANA 1Y8CA 1KYIA 3KYJB 1KYWA 3ZKWB 4MUXA 1DKQA 3PDCA 4F1KA 2DLNA 2AJLI 1LSJA 1UINA 1CTQA 1U2EA 2WNIA 2VPPA 5TPWA 2MSEB 2VQEB 2A58A 1VI5A 5JAMA 3P2KA 4FYXA 4KAAA 1BMDA 3V7NA 3DMNA 4DJFC 1NVVR 1J0CA 3LC0A 2WW8A 1DO0A 1V48A 2I7VA 1KO7A 3UMMA 3L6BA 3KKOA 1AU9A 1DC4A 3FNIA 3H5IA 1PCXA 2A5JA 5FOUA 1AQYA 5KVCA 1AJEA 2ATVA 1D2CA 1QO0D 1X1AA 1UMCA 3L82B 2CJPA 2JRCA 2AW5A 2F7SA 4ZK2A 1PEDA 4F4JA 2HMUA 4MHTA 4HV4A 3LF1A 2QU7A 3FDZB 5KWJA 3L0SA 4L6IA 1L1EA 4RVDA 4YUAA 3WGNA 4R1SA 4YO7A 4BX3A 3AIKA 4R8RA 3I5XA 2GILA 1HLFA 3RF6A 3DXZA 1JEQB 1P3Y1 3QJGA 1TZJA 3VJLA 2VP2A 1QDUA 3GCDA 3A0UA 2DE0X 3G0GA 3H87A 1L5SA 4N3NA 3WQHA 1U2DA 1NAHA 1N77A 4O29A 4JYAB 1Z74A 4BB0A 4QELA 2H06A 2VYNA 4GPZA 4BE4A 4EI2A 2PCLA 3QX7A 2E37A 4IIGA 3OQOA 5F5NA 4AU1A 2BBWA 3PC8A 3WYDA 2HOQA 5BPHA 4DCUA 5DW3A 1YCFA 1S8NA 4RMIA 3BK2A 1S1CA 3K8OE 3OCWA 2MYNA 5EZYA 2HIGA 3ZX4A 2PV7A 5CBPB 4R2XA 3R3XA 1C4WA 2X3UA 3B6JA 2VZEA 3U1VA 3T9FA 1PS8A 1AS0A 5ENZA 1Z2DA 2B4AA 2IZZA 1UJCA 1G2QA 4OQMA 4TVSA 1CLUA 1F38A 2VRCA 2BJVA 2ZSEA 3R3VA 1R0ZA 4OJYA 4W1QA 3VVLA 3DLIA 2VDRB 1EFCA 3D43A 4MYUA 5K0TA 2A67A 4HP8A 1ZITA 3RS9A 1LX7A 4XD7A 1LBTA 3AEKB 3MT8A 4BGVA 5BNZA 4URVR 1UXOA 3WGMA 1U0BB 4QKQA 3V46A 3NT5A 3A1WA 3T8YA 3HMKA 4EY3A 1JQJC 4RDHA 4G0NA 4GSKA 4S1OA 3QLUC 1FFGA 2HL6A 4JKYA 4ETMA 3SHFA 1M10A 1SZJG 2YJZA 3TW0A 1ONSA 5HKKD 5HFNA 1OWNA 1E6KA 2WJPA 4LYDA 2WG0A 3GEGA 1ONOA 1GRRA 3K09A 1MXFA 1CCWA 2JGRA 4QTXA 2X42A 5AM0A 1H1LA 1WAMA 4YLGA 4EA8A 4N5DA 1TJ4A 1X38A 3G9TA 3HVHA 3PCTA 3SWWA 3ZIAD 3HN6A 3TAHA 4M8IA 5AHXA 2AXEA 3TSYA 1TIPA 2BR5A 1WQ1R 1ZI9A 3TZBA 2IY7A 4HYQA 2ORIA 4OHXA 4YTEA 5F9FA 1IU9A 1W47A 4O3MA 4K88A 1XFDA 3GF4A 1BS9A 5HIJA 3PQ6A 4J4HA 4P3KA 2X0DA 2HA5A 3L40A 2YS7A 4BQQA 3I5YA 2C8LA 4F7WA 4YECA 4RFVA 2ZAIA 1UQTA 4Q9AA 3M81A 4RAOA 1EWRA 1YMQA 5HQJA 4K28A 4UCXA 3C1OA 3R76A 3WWZA 4I14A 4L2IB 4B6FA 1PZMA 1RP7A 2CSUA 2PD6A 4H1UA 4LJ4A 4PU0A 3TIXB 3IAFA 1BCSB 3TD2A 5TGDA 1QK3A 5ALZA 5GJBA 2ZIFA 3C39A 1ZM3A 4B80A 3WMWA 4K1XA 4PCVA 1WXGA 5JVDB 3L6UA 1T5HX 1VG9B 1TEVA 4CTJA 2UZ3A 3OT4A 1ODCA 2XGGA 4NYJR 3QSGA 4TRJA 4M83A 2IEZA 1Y9EA 2H7CA 4BO2A 3ZD6A 5E8RA 1CFJA 1IBCA 2Q3CA 1EK5A 1P19A 2QLMA 1N7JA 4I6EA 1OXVA 3KXDA 4P4SB 4C7OB 2QM3A 3WGOA 4KXQA 4P31A 1ZH2A 2H4JA 2ZR7A 3LHSA 4W7SA 2I2DA 4K9LA 2HUNA 1BEEA 3E7WA 4G85A 4WH0A 4WESB 4YJKA 3ZQ6A 1VLLA 4EUEA 1G20A 2D5AA 1V39A 2G9NA 1PGPA 3UMVA 5LQDA 4LY3A 1W2WB 1P7CA 4FSDA 1PVOA 3V7FA 2WYVA 1W88B 3P0HA 1GTG1 3JQDA 2PWAA 1GPUA 1QRDA 1QZZA 1U0RA 5EIEA 1IXZA 1B26A 3HCWA 2F4VB 3OIUA 1XPUA 1XKQA 1XIVA 4RJJA 1MOZA 4LWQA 3HWX1 4CTOA 4RIHA 4O4IB 3EG9A 4EK9A 2VTKA 1ZIXA 4CLHA 1ZRSA 3QELA 3RS7A 1YL6A 4ILEA 1L7MA 2IQ5A 2Q21A 2RK6A 1JJFA 4JSTA 5E2IA 2YIJA 3UWDA 5JEDA 1LJUA 1Z5ZA 1XEWY 4W5HA 5FAXA 1NSYA 2RC5A 3DUFB 1C7RA 3HR4A 2IBSA 4G0UA 2WWGA 3VVMA 1UC9A 3FMVA 3LY8A 3Q9SA 1WP9A 3DWFA 1UCFA 4GWKA 2ADFA 3GZTB 4NJMA 4RLHA 5K7SA 4KFRA 1WB9A 1YIOA 3T52A 1XRSB 5DH9A 4HMOA 3EPLA 2EJVA 2IYRA 1R0XA 2OLEA 2QWXA 4RADA 3KT6A 3MCAA 4B43A 5A2GA 3VU8A 1BXZA 3NM5A 5BV8A 3HCDA 5IXSA 4L76A 3ZXXA 5IVDA 5JCXA 1BX0A 2FI1A 1INLA 1O9HA 1O95D 3AUKA 1W4BA 5TGTA 4IS3A 2IW3A 4BHTA 1RD4A 2ZYWX 2PWPA 1KI2A 2FOXA 4KO2S 1GUDA 4UHHA 4MGKR 2AQ8A 2BT4A 3OPXA 1SA0A 5EG5A 3RFVA 4GRDA 3ZS9A 4PZEA 9ABPA 1UDXA 2EHDA 4HAVA 1KZ7B 1NUTA 2R6ZA 3DLHA 1IBRA 3G1UA 2C5GA 2FMHA 2IK8A 3GELA 2QXTA 1L5ZA 2J6IA 5KYWB 3IB3A 3MGCA 5EPEA 4NY1A 1PQPA 4ZC8A 1XZIA 3INYA 4L02A 3FTNA 5EMMA 5JD5A 2GPTA 1VL8A 2VQSA 2QW8A 1JUDA 4MUBA 4L4UA 2PX5A 3CH6A 1QTRA 1CY1A 4OUDB 1TEZA 3PQ3A 3I2HA 3AIMA 3KUCA 2I2AA 2FV8A 2I8LA 3VZQA 4DCNA 4NYIQ 1XP8A 5FADA 5LQNA 3OQVA 2DB3A 1P0PA 5COQA 1MPTA 1VA4A 3BIXA 1DFIA 4OBWA 4KNWA 4PCUA 5EY5B 4DADA 1HX7A 1YAJA 1JKJB 1K2WA 4US1R 1XZEA 1CUEA 1XVIA 5JSZA 3NEYA 1M72A 3GUYA 1N7HA 5C4GB 1XVLA 1PZGA 2G08A 3EEYA 3NUQA 4RABA 4RPHA 4CG1A 1UFQA 2SBTA 1P2TA 2HO4A 3EYAA 3C1UA 2ZVJA 5DIZA 3WNZA 4J1QA 4B4UA 4DR3B 4BLPA 5CB0A 3Q0TA 1CP3A 1YJCA 4ML3A 4FOOA 4BNIA 4C0WA 4C6RA 3ZW7A 2B8NA 3CJRA 4JLWA 2WUGA 3VH2A 5AOCA 3GMTA 4D42A 3E7XA 2Y0BA 4QDXA 3ZU3A 1U7UA 3NC4A 3NETA 2I2CA 4RPLA 4EX6A 4P6VF 4F5DA 4AJNA 5CB8A 5JSHA 2CHGA 1I4DD 4E13A 1GRNA 4AJLA 1X7ZB 4R0NA 1J09A 2Q4BA 2R60A 4UVDA 3OEHA 4OU5A 2D3WA 1V1RA 1Y42X 3DEZA 2YBEA 3ZV3A 3GUCA 1E1NA 1CY4A 4G1FA 1V8PA 1Y1PA 2JGMA 2FCAA 2WYIA 4YMSA 3FMGA 3IOYA 4DLXA 1H8EA 1TEHA 3CLSC 4U0JA 5DX0A 4AS1A 2X7HA 4KYTA 2NLOA 4C4TA 1I6LA 4DA0A 3BRSA 3B60A 4KN6A 3B1XA 3KL2A 2H48A 4X6UA 4JVOA 2ZSUA 2DJIA 3DUWA 4OK6A 4X7RA 1RKQA 5HIMA 5C4MA 1NY6A 4E4YA 4ENTA 1E60A 3G7NA 4H7PA 2H1IA 3LNCA 2WTXA 4KSYA 4UEJA 2JLVA 1AHIA 2PRIA 5FPYA 1MF7A 4XM1A 5EP4A 4US2R 4FS3A 4BO3A 2H2AA 4MJ7A 3RFFA 1JEYB 4IJKA 1ZJJA 2YXNA 3UJDA 5EHGA 3SICE 1OI3A 1P4AA 5L3ZA 2YWJA 1N92A 5TPZD 4C1BA 1CQJB 3OUUA 1SCUB 5I7AA 2D1FA 4HGNA 3N2NA 5SICE 3ED1A 3DDHA 3GFTA 3HADA 3HKEA 3R3SA 4JB2A 3DE4X 3HJBA 4RZXA 2I54A 4ZDKA 1PJ2A 4QYMA 4MDFA 1Z13A 4FYKA 1J9ZA 1KI1A 1GGJA 2OCIA 4WRRA 4AROA 4BUZA 4CBVA 5LP6A 2Y93A 5F4BA 4PSCA 3VTAA 3ANYB 4ZQBA 3RS0A 4BO4A 3L07A 4MIOA 2DBQA 3B20A 1IHDA 3K2IA 2EL9A 4UM7A 1BS2A 1DQSA 1WMDA 3LHKA 5CTAA 4KK3A 5FV4A 1QP0A 1FYWA 1TW3A 2ZRAA 1C9KA 1B8OA 1HZJA 3KKEA 1X9HA 2EZTA 1Y1LA 2DWCA 3BM5A 2XMCA 1X2BA 2EKLA 5B1DA 4AT1A 4ERNA 4F84A 2Y1CA 4B4DA 1RNLA 2X77A 4FOSA 4HDKB 1SQ5A 4I46A 2Y1KA 1QX3A 2O0MA 4RDIA 5EJAA 3CRMA 3EPRA 3O82A 2VSQA 2HA0A 3A4YA 3BRWA 4TGLA 4Y9TA 4A23A 2BGIA 2P2CA 3ROTA 5JWOA 1E77A 5IKMA 1R4MB 1QHYA 4EYSA 2XBLA 2HPVA 2VDUE 4MS3A 4EPYA 1HSZA 4BUCA 2HJRA 2C2BA 1XVTA 1H2HA 3LX6A 3A6ZA 4J2HA 4YDHB 5BYJA 4K3VA 4RHFA 2PSSA 1PQUA 4NJEB 5IAOA 5J4LA 3WHIA 4HYEA 4KR7A 1WS6A 4GMHA 4CG3A 1CUAA 3FJ1A 2IXDA 5AM5A 3GRFA 3QPWA 1HYHA 2C0QA 1SK9A 1UQUA 1P7ZA 3RE1A 4GM4A 3BWXA 1TM7E 5IM4A 1GRVA 4ZT7A 1YQQA 4JJIA 4HNAB 4ESVA 1XVVA 2QV7A 1GM5A 3KLOA 3E70C 1JLHA 1PFVA 1XKTA 4J1NA 3CW2A 3ZJ5A 1UBLS 3IP5A 4X6XA 4FUTA 4I4CA 1M2VA 1M34A 1U65A 2ZJBA 3M89A 3G6WA 2Z8ZA 4M0DA 5CT5A 4PQEA 2W2PA 3DONA 4QGBA 1YVEI 1A9OA 2GVDC 3V8QA 1F2VA 2JAOA 1MB2A 1E3QA 1OY1A 1PWYE 1F4PA 3KPJA 3HCRA 3ILYA 4JI8B 4HEQA 1PD1A 3NP9A 3RASA 3FCOA 4JC8A 4WZBE 1DB3A 4PR0A 5E9WA 1PK9A 5IAJA 1B3BA 3PL1A 2ZGVA 4FFOA 4QQFA 8OHMA 2R6HA 2QP3A 5DWDA 1XCLA 1P5HA 1LH0A 1HOTA 4QDOA 4Q39A 5B58T 4L5AA 1O03A 5E2BA 2H1WA 2O9JA 1J20A 2BP7A 2P4QA 4G81A 4YCAA 3RYCA 3CSDA 1A2QA 4C4RA 3UAGA 5BN5A 4J3NA 1UM9A 2NVWA 1UZNA 4CIYA 1KJJA 3H6KA 1FX0B 1UQRA 2EFDB 4QHSA 5JWRA 2ZUTA 1DKRA 5AK5A 4D8TA 4R84A 4AL4A 2QV0A 3OZBA 3CSUA 3X1WA 1DAEA 2PZGA 3JARB 3ROZA 4BNVA 3AJRA 2X5XA 1OI4A 1X3SA 2H17A 1GJRA 3QIVA 1N78A 4X1KA 2AQHA 2QT0A 2PYDA 1DAMA 2XJ4A 4F12A 2WF9A 5J63A 2P8JA 3CG4A 1Z3IX 2Q5QA 3I83A 2I65A 4PYQA 3PGLA 4IWNA 1IZ9A 1U8XX 1J8QA 3NEJA 3KL4A 1SCBA 2G1UA 3IPAA 4Q4AB 3OH8A 1STOA 3LC1O 4M9XA 3H3XA 3LCUA 4D6XA 1KVTA 3GEHA 5CM2Z 1N33B 3E8XA 2BEJA 4CMIB 2FYTA 3M6AA 2ZB8A 1Y7PA 3W4JA 3DFKA 2NTJA 3Q8XB 3ZZNA 3EAFA 4ZHQA 3WRVA 3REGA 3HCFA 2EFYA 1RPTA 2VT2A 2OCAA 3IJEB 4M6WA 4H1TA 3D3WA 1P1HA 3R9IA 3BGSA 4EY4A 4QT4A 2ZRNA 2QAIA 2NIPA 4JLKA 1HOXA 1MTZA 3PRHA 2XNSA 2DWQA 2GSDA 3PX7A 5LQSA 3SK0A 5IYZA 4CFZA 2Y1GA 4RJ2A 1ZONA 2H08A 3D4PA 3HB5X 5T8KA 2C5SA 5CEJA 4F11A 4E1AA 3SQNA 3ZTWA 2REOA 2QRVA 4UOEA 1Z5WA 4EY5A 3MSCA 4EKYA 4TS4A 1N0VC 3DH0A 3A06A 3IMGA 3E9QA 3K6SA 4P83A 3ZDFA 1O5OA 4XIGS 4DZTA 1UBCA 3R9XA 3DVAA 1N2GA 2C5LA 3HGTA 4FMDB 3HI6A 1JIUA 1QCZA 2CNKA 3GLUA 3I5AA 1R5NA 4EPVA 2H5IA 4HQOA 4X62B 2AT1A 5K8JB 1V0JA 4JA2A 3SKYA 4RF4A 3GLHB 2F17A 3FOAA 1EGQA 5J2TF 2C3MA 1LD3A 3PT5A 2OAQ1 3TCNA 4OOEA 2GHRA 1TT5A 3OQHA 1Z5NA 1Q3HA 1RMQA 2OC4A 1XFAA 2B25A 3VHXA 5BVHA 3SR0A 4CQLA 4Q12A 3FYHA 1CVLA 1W96A 4FPXA 5BW8A 5IT4A 1WVMA 2X2OA 4W9NC 1RI1A 2AI2A 1NV9A 3RRXA 4JT9A 1TEXA 1FDWA 1HMPA 4I08A 3SE7A 2MR6A 2PUWA 1CS4C 1ZM2A 2V55B 4JT4A 2M9MA 7REQA 1VHWA 3LKDA 5L7YA 2D8MA 2AEMA 4OLJA 3QVGB 1OBVA 4ZKDA 2B4RO 4IEIA 3Q11A 1JEJA 4KHZA 4N65A 4P4GA 5EPUA 1AK9A 3CZQA 4B0OA 1IHPA 3IUPA 1WCIA 2QMEA 3IBFA 1B8NA 2EZUA 1H94A 2X7XA 1GKUB 1XHFA 3I58A 4JJAA 1E9FA 3Q40A 4CMKA 4IFTA 1UWVA 2A9PA 1LTQA 3HVRA 4YQYA 1R0KA 5KKCA 3F49S 3NPAA 4FEYA 2J0EA 1F48A 1RI5A 1E7MA 3EAQA 3LCMA 1CYDA 2AC4A 4MICA 3M9WA 2LCQA 2WSBA 1J8YF 4IRUB 4RQUA 1AB6A 3A6GA 4KH1A 4L07A 1V9SA 3PC7A 4BWYA 4LUCA 1JU4A 1ZVJA 2XNJA 2YCLA 5ELLA 2FWBA 2B1IA 3KB2A 1Y5IA 4GKBA 2IEDA 2PTGA 2QRUA 5JDCC 2IXEA 3IIMA 4E03A 3IUBA 4FFLA 2HWYA 4BFTA 4DMFA 1Z6ZA 3O38A 4Z9BA 1Y33E 3DOUA 4OQQA 2WSSD 2XMGA 3D4IA 4UZEA 3ER6A 3DQZA 4ED9A 3E05A 5HM8A 2DT8A 2BM1A 2B4TO 4WVLA 3T3PB 4AYWA 1QFJA 4HRYA 4JHLA 4C43A 4MS4A 2V0GA 2HSZA 1EA7A 3M6XA 4Q9NA 2JFPA 3ROFA 4EG8A 1B23P 1ESDA 1GO2A 3TL2A 1S1MA 3TTYA 1CZRA 2GWHA 2C61A 1DIRA 3P2YA 2G0NA 4NCAA 3OQIB 2E87A 4EUKA 2Q0HA 4KXYA 1IEVA 4GICA 3GAFA 5IJXA 2DUNA 3TQTA 1E9SA 3ONDA 5C52B 5ANRB 4RHXA 1L4NA 1VBNA 1VPTA 2ZW9A 1SUEA 3GVPA 5C7OO 2RJNA 3FPEA 4DQUA 5HIIA 2AOWA 1Z8DA 2FNAA 3AJ8A 1GNPA 2PXHA 3K53A 4AC9A 3EA0A 3AFNA 3ZZ1A 5F78A 1C41A 1CQPA 3U4IA 4B6EA 5HK8A 3VSDA 2X0IA 2ZB4A 3EUFA 4GOJA 5AW1A 2ZI6A 2VT6A 3W5DA 1B16A 3KB1A 1U1FA 2W2NA 2C4TA 2QEQA 5L3VA 3PQ2A 1BMFA 1T2CA 3AM4A 4Q82A 3T4PA 1DTSA 5B3AA 4BO9A 1JA9A 2PY6A 2VF2A 1VE3A 3DPIA 3QLTA 4ZEXA 2JVKA 1KZ1A 3GWGA 3SYKA 5DHRA 3N6XA 4BMXA 5ENDA 4RVHA 4E6EA 1TNDA 3RIYA 5DNYB 5IJAA 4U7JA 1EB8A 4HWTA 1USGA 5KVAA 1ODTC 1IULA 1LQUA 1G8GA 3DJYA 1KQ3A 4RANA 3TKYA 1NBMA 1XMSA 4HDMB 1ZBDA 2Q5IA 2FZ4A 4L72A 3SVZA 4R0MA 1JT2A 2RGBA 1DOHA 1RYMA 3IXMA 4XLZA 4YT5A 4UUAA 1U1EA 3U9SA 4EHBA 4G8CA 1VECA 5JV5A 3HBAA 1CY2A 5IEJA 1OI7A 3ONWA 3P9YA 2ZVQX 4CUKA 2BZ0A 3QH4A 3PQ4A 4HFJA 3T7RA 1J9GA 1Z7WA 3R9XB 3F3MA 1BHJA 3QITA 2OHHA 2XCTB 2R2GA 1XD2B 3THWA 1TKBA 3KFVA 3F9CA 2X14A 3N8GA 1WTAA 4LXXA 2Y3IA 5AVOA 1KJ9A 5JD3A 3BE4A 4FC7A 4JBYA 5GJVC 3V2HA 4B3BA 4D9MA 2AOTA 5BVGA 1ZSVA 4E88A 5A3SA 2WPDD 4CYMA 4Q01A 3PRKE 2A9QA 2ZRIA 1NUQA 3E0XA 3W8FA 4DLUA 1QMPA 2Q1WA 4C7XA 3SVTA 4EVQA 1U28A 2TECE 2DPMA 3COSA 5IUKC 4Y2PA 5HP4A 1SBCA 1M2GA 1ZHOA 1NW3A 1WHTA 3DAGA 4LVOA 5DYGA 2PVPA 4KR6A 3QKIA 4DQVA 3VZCA 3HRKA 1ZM4A 3MGAA 3MWJA 1I13A 4MGZR 5EIAA 3PUJA 4IBOA 3E61A 1Z6AA 1C9JA 1NYRA 3IP6A 4BE7B 1ESCA 1U2GC 2FSVC 5ADWA 3R75A 4LWOA 5F12A 1XTRA 2ZT7A 4AG5A 1C14A 2GJSA 2ECFA 2FQYA 4IUBS 2PANA 4D3XA 1LUAA 4TROA 1KMIY 3DWGA 2WKRA 1Y9DA 1G5HA 3H2HA 4WKOA 4H08A 4Y3UA 5EIOA 3U7RA 5JPIA 3ZGXA 1AKNA 1QYWA 2H2HA 2VBIA 1KEVA 2P7HA 4D8WA 3ED5A 4KRXA 1Y80A 2GR9A 2D5IA 2OE2A 3L7JA 4G97A 3GCWA 1ZG3A 4JELA 3K96A 1H0SA 4G4SP 5ESWA 1D7OA 4AYXA 5GZ3A 3JQAD 3L05A 3OQMA 3IP1A 4FR5A 4V0LA 2ECKA 2DH5A 1IOLA 3K0CA 4KFUA 3M6VA 4KWIA 3R0ZA 3VR5A 2BHRA 4BJ6A 2GFIA 4CEJB 1UADA 2GJAA 1C8VB 4G5GA 2VJLA 4OM7A 1QBKC 3UMJA 3VR3D 5JAIA 1KS2A 2JIDA 3LUFA 3E1SA 4CF6A 5CA0F 3UUWA 3UJ8A 3O8QA 2GBLA 1T4CB 1M6HA 1GADO 4N0QA 3KG2A 1RXUA 2I6XA 2LDBA 5JSKA 3TW8A 4F7DA 5FDFA 1IE3A 1VCOA 2NU7B 2HLDD 3HABA 3NIBA 3QG5A 1JQ5A 1CVIA 4URFA 2HHCA 5BW5A 2R751 1E0DA 1J0XO 2PCJA 4UEQA 1NE2A 3A4LA 4H31A 5LQUA 3MLBA 4DHWA 2G7MC 3IP9A 3FHTA 1QZXA 2BGRA 2PL3A 1Y9ZA 5K9ZA 2XA9A 1Z36A 3F8SA 3UT5B 3UZUA 3X1ZA 3A6LA 1IDN1 1XTKA 3NHZA 4KTVE 3B7GA 4WFIA 3ZIDA 1L7EA 1PJRA 2A0XA 5FV7A 4ZZ3A 2VDPB 3QE2A 1WXIA 4GG1A 5JJLA 3AJAA 3TFQA 2FJPA 2HC9A 4I1OA 3HH8A 1VMDA 3NAGA 1ZKDA 1TCVA 1F7UA 3M5PA 4MV3A 5H1YA 1QIEA 2DR3A 2MYPA 1XLWA 2UYHA 4MPTA 4O2BB 5FI3A 4E4TA 4OBXA 1G16A 2WJAA 2Q07A 1SXJD 5EGNA 3I2GA 4XI9A 4RFLA 5L4NA 1LBQA 1GIAA 2JIZD 2Y0DA 3KUUA 4WKNA 3ZWOA 3TAXA 3MWDB 2XDQA 2TMKA 3OPMA 4MVJE 2Q4DA 3F6PA 2R9VA 1AOXA 4ZI7F 4K9RA 4JJ4A 3AT1A 3JXEA 2NX2A 4FGUA 3VZSA 3TGPA 1H5QA 2X9LA 1F7VA 5KYKA 3C6MA 4E2WA 1W4RA 3A2LA 3EUAA 4NULA 5KX5B 3E15A 2IWRA 2YN0A 2WWHA 4WJZA 3GHHA 4V0KA 2FK8A 4LJ9A 1RHJA 1VIDA 3CWQA 1Y5LA 5I9SA 3WICA 4EO7A 3SDSA 3RVJA 4BUJA 3GVIA 1VCHA 1CG6A 3OEEA 1TQDA 2NSHA 2WU4A 3K5PA 3R3WA 1A27A 2C2MA 3EJWA 3N76A 1CUJA 3ZR4B 3B2QA 3H2GA 5JXGA 1J25A 5HF6A 5KTOA 4BIMA 3IB6A 3QUAA 2I6UA 2ID4A 4BO0A 5IH3A 3HBJA 1F0YA 2QVZX 3ZZMA 1QTNA 5C8VA 5LMCA 2JLXA 1TL7C 3AU9A 3OI7A 4D56A 4QULA 2DQZA 4J9VA 1U8CB 3ECAA 1Z7BA 3D3JA 1NP7A 3QVLA 1YDFA 4HT3B 3OF5A 2YWCA 2YJ5A 3FHCB 2D62A 2XCQA 4RTNA 1G3MA 3AESA 5A0TA 4LCEA 2EKQA 2YYSA 3PD1A 3NB0A 4Z9XA 4ENUA 4AZVA 2XTAA 1JEOA 2ZJ3A 3ZHSA 4OXKA 3QPVA 3ILVA 5LQMA 4WLUA 4JUDX 4NV3A 1YGYA 2Z5FA 1A4RA 5KDOA 2JAHA 4IXTA 4K9KA 2WMDA 2VKTA 4RL4A 4QUAA 3RRYA 3ZJ4A 1FSSA 1A5SB 2HK7A 3K1AA 5CIWA 4DS3A 1T0JB 1N5JA 1ODKA 1JHMA 1P9OA 1U7PA 3OIGA 1RXWA 4LMRA 2GGSA 3QUQA 4DEVA 4H6WA 4ONEA 2FG6C 2JAPA 1L8XA 1JECA 1ZU4A 3DAOA 3HJCA 4UPDA 4DRYA 1RZVA 5HRUA 3FPSA 2WWXA 2ZK7A 4UUOA 1EVYA 4NAHA 1TJ3A 3VYUB 2XAUA 4ND1A 2QZZA 1K4YA 3GG9A 2X5JO 5DBHX 1RT9A 3LQ1A 5EQJB 5K8VA 3ESZA 5CD1A 3FM9A 4AKIA 2QK4A 3K2BA 1WNFA 1D6JA 2R48A 4J7XA 3Q3EA 3Q7TA 3OJXA 4IIJF 4LY6A 4FKMA 1JILA 1O4WA 3DBLA 3IGFA 1Z6YA 3B1FA 4G37A 1K6MA 2B3DA 3HWWA 5AKLA 2IP1A 5JSQA 2VPWA 4GZ3A 4ECAA 3RC7A 4C22A 5CJPA 1I32A 3CVOA 3CNBA 1B6RA 1E2QA 1WY7A 1XRLA 2IX3A 2XB4A 5ALVA 2E2WA 1OZAA 3LL7A 4YT8A 4NBKA 2JVIA 2V7EA 2AQKA 2J7PD 2DZDA 4QYIB 2JLUA 2O3QA 2R8XA 2H65A 1VHJA 1W19A 1X39A 2XB2A 3OLZA 4IILA 4KV9A 1FNCA 5K09A 5L95A 1YFLA 4YCSA 3AVVA 4O0MA 5G2OA 4UNIA 4FQ8A 3GLIA 3NWBA 1PNOA 3R0XA 2MIIA 4YJ3F 4OO3A 3VR5H 3ZHQA 3CXUA 2D7CA 2D00A 4Y30A 4ZO4A 5DP2A 1WZ2A 3UKDA 2PEYA 2GUWA 5I7EA 4DRXB 4AD8A 1DCMA 1R66A 2PA3A 3G9ZA 2JIQA 4L4RA 1UZMA 2QD3A 1QNLA 1UL1X 2ZRKA 4NCHA 2CXXA 2E1PA 4RXMA 1XDUA 3AKZA 3PJRA 5F9MA 5AW5A 3IIEA 3NKVA 3TXXA 3C97A 1LNQA 1IWPB 2H54A 4LIPD 4XX0B 1U94A 3KFXA 1XT6A 1TJYA 1D2AA 3L1UA 2VSXA 3S4YA 2O1WA 1DO8A 2OHIA 1HK7A 2WHPB 5AJZA 4A4DA 3HJNA 3EDCA 4ZP1A 4E3ZA 1JKFA 3OM8A 4FWIB 4YRPA 2H00A 4CCYA 4NYJQ 4NL4H 4EKEA 2Q9CA 1WKVA 4ZOBA 4GMDA 2HIHA 1TC1A 3CB2A 2VUUA 3ZQKA 4CF5A 2HHHB 3LSTA 5A3JA 3IQDB 3UAOA 3KYDA 1B4DA 4JVMA 1V3TA 2E85A 3CR7A 2QOEA 4DQDA 1D3AA 2QM0A 2VDQB 3MINA 1NPDA 3L4BC 3SMVA 2PUEA 1C81A 4REOA 4BO5A 1CEXA 1CY0A 1CUZA 1XCGB 3EWSA 1E3WB 2ZYRA 3EQ9A 3TRFA 1X6VA 3NO4A 3WAJA 1HEIA 4ZK6A 4DLNA 5JUWA 5DRTA 1YJQA 3RT7A 2YOFA 1S2OA 2D74A 1AMOA 1RM0A 4EY8A 3IAUA 4KXLA 1U7HA 4HG2A 3DTVA 3GP8A 1PLLA 2CE7A 2GARA 4CT5A 2HK9A 3IMKA 1QIDA 2JHAA 4ZYWA 1KEWA 4CV3A 1QKJA 2JH8A 4D0GA 1Y82A 3MAJA 3QXGA 3G49A 3P9KA 1R15A 2JGAA 1FZQA 3FCAA 1RQ7A 1Y3IA 3C1AA 1T5BA 3DLAA 1E20A 3LP8A 4L9WA 4BNLA 4N3AA 2FZVA 4I8XA 1NFRA 2CYCA 5EINA 4UM8B 3FAZA 2NUPA 2ON6A 3IMFA 2GFHA 4G86A 4WN3A 1Z8FA 2QX4A 4HH4A 4ZCPA 3EMKA 2G1KA 4X90A 4DLYA 3ZBUA 3KOMA 3Q10A 4OIMA 4V0SA 4O63O 5K0FA 3GLHE 3OSZA 2ZSDA 1M73E 2YTZA 3NTQA 3PNKA 1J1UA 1C7JA 1MEOA 3KUKA 1VL5A 2OAEA 3EXG1 3DL4A 3L7MA 2HU7A 1PT6A 4M1SA 2X8BA 3S2IA 3W8EA 4EGAA 4DOMA 4J7UA 3H05A 1VJGA 4D4GA 3KOWA 3UA3A 3IHKA 3OZ7A 1EK0A 4Z6KA 3U7QB 3KQUA 1ES9A 1GZSA 1GGNA 1PLKA 4UMFA 1GTJ1 3EQZA 2B20A 1NPYA 4ZVLA 3GP3A 2EFEB 4DDTA 2IV2X 3RSOA 1U8TA 3Q7QA 4MKRA 4RHYA 2PRSA 5CFLA 1EVZA 2UZ1B 3KHSA 5EUCA 5FP0A 1KDOA 3ETLA 4ZMBA 2REQA 1M2FA 2HJHA 2FFBA 2QN8A 2W48A 5EQTA 4EAQA 1GTRA 1FJGB 1YZTA 4MRMA 1ZCFA 1U1IA 1IM5A 2OVBA 1U6IA 3DVSX 3EFOA 2NWQA 1RWPA 4NEQA 3TFOA 1U7TA 4S1VA 2WHXA 1HG1A 3SHOA 3LS2A 4MW0A 4UBOA 5CBKA 2B99A 4UEKA 3CVWA 1TQHA 3ZLBA 2CJYA 4MUEA 5B5SA 4CL2A 3QRWA 3C3BA 3EVGA 2OD2A 2O7QA 1M1ZA 4QASA 2EHJA 3OOJA 3Q4GA 5CDFA 3DD1A 1ZISA 1G6Q1 4JI5B 3A1UA 1OLXB 4JL8A 3LE8A 2C7VA 2UZIR 3C5VA 1YBVA 4DVGA 2K7FA 5T6MA 1VB5A 3K9WA 3N1UA 3N2YA