3EDOA

Crystal structure of flavoprotein in complex with fmn (yp_193882.1) from lactobacillus acidophilus ncfm at 1.20 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
150
Chain Sequence
b'GMAKKTLILYYSWSGETKKMAEKINSEIKDSELKEVKVSEGTFDADYKTSDIALDQIQGNKDFPEIQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQMKNYRGEVASFFTSAGTNHKAYVSHFNEWADGLNVIGVARDDSEVDKWSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative trp repressor binding protein
publication title Crystal structure of Flavoprotein in Complex with FMN (YP_193882.1) from Lactobacillus acidophilus NCFM at 1.20 A resolution
rcsb
source organism Lactobacillus acidophilus ncfm
molecule tags Flavoprotein
total genus 44
structure length 150
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12682 Flavodoxin_4 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3edoA00
1FLDA 3D7NA 1H69A 3LCMA 1T0IA 4YAWA 2MTBA 1TLLA 4U7HA 1AKVA 2GSWA 3NLLA 5LJLA 3TEMA 4QOEA 1YOBA 1B1CA 2F1OA 2OHHA 4OXXA 4PTZA 3F6SA 4M0CA 3OJXA 2Z9CA 2R97A 2FVXA 3NHKA 2M6RA 4QOGA 4C0XA 1FLVA 3OX3A 1JA1A 3TZBA 1J9ZA 4FGKA 4N65A 2QX4A 2KLBA 5EAIA 4GI5A 2A5LA 3ZHOA 4ESEA 4BMOB 5LJIA 2BMVA 5BUCA 4QOIA 4ZVKA 3QFCA 4Y7CA 4Y9RA 5LMCA 2BPOA 1J8QA 2FDXA 1SQSA 3R6WA 3ESXA 1AZLA 2BZSA 2QWXA 3EYWA 3FX2A 3JSXA 2MWMA 3B6KA 3NHWA 3OWXA 1AKUA 1CZRA 1RTTA 2D5IA 1ZWKA 1J9GA 4ZVNA 3HLYA 1FUEA 1QRDA 1BU5A 2N1MA 1AMOA 2WC1A 2QR2A 3S2YA 1ZWLA 3UXEA 1X77A 4DILA 1OBOA 3ES9A 2BN4A 4FGJA 1CZLA 1OBVA 4S24A 4YAOA 1F4PA 3FW1A 3RPEA 1FLAA 1KBQA 4D02A 3HR4A 4F8YA 3L9WA 3B6IA 4NULA 5JROA 2HNAA 4R81A 3LT5A 2B3DA 1XI2A 2FCRA 3ESZA 3NHJA 3NHFA 4QODA 4H6PA 2Z9DA 1QHEA 4U7FA 3GFRA 4PU0A 1YKGA 5FX2A 2QX6A 3K1YA 3NHRA 1E5DA 4FGLA 1NNI1 1QBGA 4N9QA 2HPVA 3ESYA 4QOFA 4LTNA 4C14A 3F2VA 4QOHA 1RLIA 1RLJA 2ARKA 1OFVA 4N82A 1YCFA 1T5BA 3NHUA 4Y9UA 5NLLA 3FJOA 5TGZA 5LBUA 4DIKA 3NHSA 1YCHA 2V5VA 4HS4A 4HEQA 5ULLA 1DX9A 1XYYA 4GR9A 4J8PA 4FX2A 2FZVA 3B6JA 3OWHA 2Q62A 1FTGA 4XDHA 1C7EA 2XOEA 4NLLA 3SVLA 3W7AA 2Z9BA 1YDGA 4QOJA 6NULA 2FOXA 2KQUA 1CZNA 2XODA 4CF6A 1JA0A 1VMEA 3UXHA 1D4AA 3KEGA 5LVAA 4C0WA 3U7IA 1KBOA 3N3BC 3GAMA 1AHNA 5B3KA 5LLDA 2MT9A 1FVXA 2V9CA 4XDGA 3GFSA 3EDOA 1I1OA 4U7GA 3K20A 5LBTA 5FUQA 4LTMA 4YQEA 3F6RA 5NULA 1DXQA 4GQIA 1DXOA 1BVYF 1QR2A 4CETA 2HNBA 3QE2A 1V4BA 3KAPA 2FZ5A 2Z98A 5EA2A 3L9XA 5F12A 1FLNA 4YALA 2QMZA 5B3LA 4H2DA 1CZHA 3GFQA 4LTDA 1TIKA 1CZOA 4LAFA 2QX8A 2X2OA 1FX1A 4C76A 1WSBA 1AKTA 2FAXA 3W79A 3W77A 1WSWA 1ZX1A 3W78A 3OX2A 3B6MA 2OYSA 1C7FA 3G5MA 1H66A 5FA6A 1CZKA 3NFRA 2FX2A 2OHIA 3U7RA 4YAUA 4PTYA 4ZVLA 1CZUA 2QX9A 1AG9A 3FNIA 3HA2A 3KAQA 3O73A 3OX1A 3NHPA 4LA4A 2FLVA 2MOKA 5F4BA 1RCFA 1AKRA 4ICIA 1AKWA 5F51A 1XT6A 2V5UA 1AKQA 1D03A 4BMPB 3OVMA 5A4KA 3FVWA 3KLBA 2RG1A 1SG0A 5EMNA 2X2PA 2AMJA 2R96A 1GG5A 1YCGA 3NHYA 2M6SA 3O2NA 3OJWA 3TE7A 3N3AC 3P0RA 4DY4A 1J9EA 3NHLA 3F90A 1D04A 4ZVMA 4YAFA 2ZKIA 1XYVA 3N39C 2Q9UA 2QMYA 3QFRA 2W5UA 1YRHA 2OHJA 2BF4A
chains in the Genus database with same CATH superfamily
1MVLA 1ZISA 4ZJZA 1VKRA 3P0JA 2D13A 3AR9A 5TQ0A 3FGPA 4LF7B 1O8CA 4KR9A 2R6R1 3FDZA 1LDBA 4IVNA 1U2GC 3DYIA 5EJ8A 1AUOA 2H16A 5JCXA 5J59A 5JV5A 5KJFA 1I3CA 1ORWA 4CCSA 1LPOA 3D6AA 1UKBA 2JFHA 4JJ4A 4ALLA 4EHAA 2Q8QA 2PX0A 4AN0A 4EUNA 1GJRA 3W4IA 1AKVA 4V1CA 4NHEA 2QG6A 1M10A 4IXTA 1GLVA 4QOEA 3QIAA 1XQ1A 3L41A 1QIMA 1U0EA 2EZTA 1N6KA 2PZFA 4HYTA 5LZ9A 2X0IA 4ZZ3A 4L9WA 3ANLA 3FHTA 3OJXA 1KERA 1U2DC 1DTWB 4RIFA 4B4WA 3ZVLA 3VTZA 2VHXA 1HE8B 4FMDB 1ZCAA 3L0DA 4LJ9A 4GGMX 4CUKA 2CCKA 2R7MA 4E31A 1GZ4A 3BJEA 3KKEA 4G4GA 4HG2A 1F1JA 3JSAA 4UTZA 3TFWA 3AF2A 1ORVA 9ATCA 4IP0A 2PXCA 2X0DA 3RK4A 3RR2A 3JYQA 1G9XA 4JLKA 1E69A 2YOHA 2DU8A 4OU5A 3NBMA 4XUEA 5TSDA 3ORHA 4NKRA 4GI5A 4YI5A 3V3TA 5C7IO 1LKZA 1Z06A 5IAEA 3ZU3A 1MN6A 4V0OA 1RKUA 1F1BA 1PNVA 1C9DB 3KDPA 4MQFA 2DJ5A 1YIDA 3C7TA 4UULA 1LNQA 1A1SA 5EFZA 2C77A 4S1OA 4Z3DA 3F7TA 4UREA 1HZJA 1G7SA 4L0CA 2Y1XA 4LJLA 2C4NA 5CYOA 2BCEA 5I8ZA 3RC7A 5LMZA 2ZBFA 2PJDA 2DFLA 3MCTA 1XEXB 2RHWA 5F1OA 1SKQA 1MENA 3BD9A 1W5TA 2D1YA 3M9LA 2BEVB 3E9QA 1QHGA 4J1TC 1ZGHA 5IF9A 1JYSA 4RE6A 4EG7A 1BA3A 5LJLA 3C45A 4R3WA 4ZT6A 1YGYA 4R6XA 3V80A 4YRNA 3OAAA 4XGRA 2AZ4A 4QLBA 3OQOA 4TV9A 1VIVA 2QMHA 1I2AA 1RJ9B 5DH9A 1Q0ZA 1XRSB 5IYZF 2QLFA 4S0XA 2R8ZA 5E3JA 5JZBA 5KKNB 4DG9A 2B4RO 3BMCA 3L1JA 3KXKA 2QVCA 1QO9A 2R8OA 1BHO1 1RFGE 2ERXA 4IICA 3EPJA 3B6KA 2UVPB 4TYYA 1VMAA 1G21E 1JE0A 3NATA 1ZOLA 5HJEA 3G9UA 1WM1A 1C1DB 1JDUA 3R6TA 5LM3A 5FL7A 5GVRA 4Z5XA 3HXOA 2BHRA 3O84A 1CFJA 2VUTA 3K71B 3MOGA 1NRJB 2I29A 3LUKA 3JY6A 5C53B 1VCIA 4XUGB 1ISGA 5KOIA 4Q3AA 1WULS 5CLJA 5COQA 1EA7A 1XD2B 3EGDA 3AUAA 3FPEA 4Q7JB 4G9BA 3RIXA 4MUJA 2V54A 2UUCB 3INTA 3DYBA 1O96B 3FTPA 3UGQA 3BQMB 5GADl 3NTVA 3GLTA 1SVNA 3LUAA 3Q11A 4E7PA 4QOSA 5ITVA 3UMMA 2JH8A 3CZQA 5JFTA 4OBWA 1XZJA 2M98A 2R0QC 3BOSA 4WOKA 3RVNA 2B4QA 1ISMA 3GFVA 5IXSA 4QUAA 4C89A 1LBEA 1ZESA 2ODWA 3TLEA 3ZGNA 1J2RA 4IO0A 4DGQA 3PNBA 4IDDA 3GUHA 3T5DA 2O57A 2PHZA 3LDAA 3UV7A 3D3KA 1YR6A 1A9TA 1IZ9A 2A5FA 1G1MA 2BN4A 1CIPA 1CZLA 2GD0A 1FTWA 3A58B 1VPWA 4J94A 1XDWA 3GLVA 5BN5B 1D6NA 1JR2A 3G7NA 5CHYA 4BCBA 2FEPA 3BTUA 4TL6A 3IP9A 2IBTA 5T3UA 2OO3A 4POAA 5EQFA 1QZXA 3EH1A 5HQ3B 2AK3A 5MFPA 3QVGA 3LVBA 1I4TD 1XE3A 4JL8A 3VNUA 1V6AA 2X3YA 1UXKA 5FHQA 2JASA 4YT4A 2E4WA 1PUJA 2OVBA 2K87A 2ECFA 2PD6A 4KXNA 3VR4H 5CDUA 5IDYA 2PL5A 1AOXA 4P2GA 3AIIA 5K0JA 1D6SA 5EIFA 4F5DA 1GVHA 3PFHA 3HSYA 1Z4QA 2PIDA 1PI3A 1KQFA 2X9VA 2YC4C 3B2QA 4KPGA 2O20A 4PX9A 1HUQA 3Q1LA 3RYFA 1TMOA 1ISPA 2FP4A 4I6JA 1PV1A 2OZEA 3DTVA 3GJ3A 4TZ0A 2AJCA 3UGTA 2OXTA 5JD6A 1RYMA 1Z0UA 3C4QA 4KIWA 3FVVA 3ILVA 3JAKA 3CNHA 2NTJA 3BFXA 4FMBB 4N03A 4P7FA 4RKWA 4DABA 4ZCMA 5KYWA 2H3EA 3KQKA 1S2GA 8ATCA 1U28A 1PS9A 5FQNA 1XMXA 3H42B 3K32A 4NPHA 4ERXA 1FRZA 3ZBUA 4G0MA 1RYHA 1MAVA 2BR3A 1Z12A 2YXBA 4D8UA 1X9HA 4LHZA 1R7RA 2B2NA 2F2TA 3G6WA 2Z04A 4MDHA 5DHUA 3UFXA 3AZPA 4RD0A 4P7JA 4EAAA 2Q2VA 2QZ9A 1S96A 2IPXA 3FI0A 3SQMA 3EXG2 1EFDN 2ZVDA 1OLOA 3FKSD 3L6DA 2EVWX 5E1MA 3VKFA 4CM9A 1TF2A 5J23A 2I6UA 3DTVD 4KSBA 4PGHA 3CVUA 1Z6ZA 3ZWQA 1QQ6A 2Z3WA 4GOJA 4QFDA 4RW0A 3ZI7A 3F2VA 2YHSA 4BJ6A 3HK2A 2FW1A 3OLCX 4C7OB 4MVJD 4R1OA 1G5TA 1P33A 1Z17A 5T8KA 5WRFA 4EG1A 1TZCA 3KPYA 4KREA 4X60A 3AB8A 1ISSA 2O7QA 4MGYR 5TDHA 1GCIA 5DIZA 4YPOA 1V8BA 2YQZA 1D4FA 1NQTA 3BHNA 3WHPA 1J06A 5DEIA 4LF9B 3JTEA 3RVKA 3K96A 4UNIA 1WJGA 2WE8A 4DSNA 1XF9A 1F20A 1N57A 3M6UA 3WL6A 1IMJA 3E3MA 4WNAA 4BL5A 1KGDA 1N6IA 3TL2A 1MB9A 3U1VA 6ADHA 4Q3OA 2CV2A 1IZYA 1CDEA 1C7ZA 3UAZA 5ICMA 3A6PC 4LZPA 3BG5A 4OAQA 1T0PA 1L5HA 5IKOA 2J0UA 1WAMA 2O2ZA 4LN1A 3ZEAA 2J3HA 4G1EB 1E99A 4OU4A 1YVEI 4P3PA 3W2EA 3THXB 3P0IA 1KVQA 2FR8C 2VUHB 3OG9A 1PFUA 1XK6A 3A7DA 3CUSA 2PANA 1MLDA 4PN3A 1MB0A 4LJ7A 4FKZA 4EHNA 5INTA 1RKVA 3LUBA 1C9MA 3VZSA 4FLFA 4F3NA 2WU1A 4MQUA 2XOEA 3EF0A 1F2DA 3CZ9A 2HO5A 5IUKC 3VR1A 2X14A 2Y76A 2ATIA 6YASA 3WI7A 2GCEA 2A0WA 1B8PA 3NVKI 1HEYA 2VJOA 4BAZA 3AVWA 1ADCA 1O87A 4OB7A 1EIZA 4M2LA 2J7KA 4WZBB 1XZBA 4DMRA 3EXEB 5FTLA 1F38A 4GSYA 3UMCA 5JE8A 2GBFA 2YZMA 2I2BA 1E7WA 4MO9A 3UHAA 1UBLS 1W0JD 4FFMA 1CZNA 4FFDA 3CCFA 5EJAA 5KAMA 4GD3Q 1PRYA 4MV1A 5SZKB 1D4AA 3CWZA 2Y1OA 3OJOA 5E4FA 2QN1A 1JWAB 3G8CA 3W04A 2RBKA 4M9CA 2PD4A 3RVJA 4C0WA 2JFBA 1E9VA 2VP6A 3S2GA 4JH0A 1E6KA 2HA4A 3EFHA 3CJQA 4Y98A 3KQHA 1LJLA 2G82A 2WVHA 3ZWNA 5B3LA 5K3FA 2HLDA 3PXAA 3UXMA 3MQFA 5BQFA 1UOOA 2R7AA 3FZNA 1JG6A 3H1PA 1TCVA 4EJSC 2V9CA 3LMKA 3T7EA 1QGZA 5AQEA 2OO7A 1D8TA 2WV9A 4P33A 4PPNA 3BIXA 2AOWA 2GOYA 2GBLA 4JL6A 4RZHA 1E7SA 1PZHA 2VSYA 2ZXFA 2R79A 3PT9A 4D56A 5IH7A 1ZM7A 4EQZA 2MU1A 4HZUB 3PZBA 4JI4B 1AUXA 2OMEA 3MXTA 3T3GA 3E53A 2E48A 4BMZA 2VQEB 1FEZA 3C8HA 2GTIA 4MVWA 1J6UA 4PO8A 4YQEA 1QF7A 1U63A 4A8TA 4I46A 3LLVA 3CLKA 4LE1A 1UP7A 2IYEA 4D99A 1DV2A 3HABA 4A8HA 2BYTA 3U7QA 1UBJS 1P1JA 2QPLA 1EUQA 2PRJA 5JY6A 2LD4A 3PE4A 1BVYF 3UUWA 1RPAA 2B4YA 2OM2A 3BIOA 3I3SR 3P27A 4Z7QB 3DKVA 3HNRA 3IIKA 3QE2A 3KBOA 3T9DA 4PVDA 2PGJA 2IZ5A 1C8BA 2CLSA 2ZAOA 4WDRA 5CT6A 4Q4JB 1Z2DA 1I10A 4OA5A 4UNPA 3KQQA 5DNDA 3EX7C 1CUAA 3ETEA 4QFMA 4RQUA 2VP9A 2OBLA 1XCGB 4R2LA 4YPFA 2Z98A 4D3SA 3DCYA 1T4CB 3W0LB 3LL7A 2GFIA 5LYJA 3R7AA 4BNTA 5C7YA 4ZFNA 1JHMA 3SCZA 3AR4A 3CF6R 3X2SA 1QDLB 4NCAA 4EJ0A 5HSGA 4NZMA 2OAEA 3CVOA 4IWNA 3HXPA 5GJBA 4H6XA 2YNMA 3Q3JB 5E7JA 2ZGVA 2BFFB 4MA4A 5JAOA 7REQA 5A06A 3UCEA 1XRQA 4ZOAA 1KE2A 5HDBB 2ZIXA 3DZ8A 4X20B 1NBME 4JB0A 2BHTA 3DHWC 3JXEA 4WZZA 5EUBA 1JHXA 5AW5A 5B6PA 3BMNA 4B48A 4JUBA 3OLVA 1MJ5A 4EKGA 3U9SA 3TZ6A 5B58C 2V7EA 4GLJA 3MSXA 5C81A 1Y3AA 3NC4A 4IGFA 4X6LA 1UDCA 4M0LA 3G1TA 4YJ3F 4MVYA 5FF9A 3WGKA 2E18A 4OTZA 5BN3B 1VJDA 4IFEA 3BK1A 2QQEA 5EP2A 1GPKA 2JZNA 3FUCA 1DIAA 1OH8A 2REBA 2C2OA 5IJ9A 1NR1A 3H9GA 3MHPA 2Z08A 1H3EA 3W78A 4FR5A 1DE0A 4PLHA 5LN1A 1V7ZA 3AIOA 1R64A 3CMCO 5JVDF 3DAHA 3EEIA 4PAGA 4G0NA 3WWYA 2I6XA 4FJ1A 3ONDA 1EGHA 4QBIA 4H17A 1O77A 1WDWB 3DDNA 3CF4A 5BR4A 3IEVA 1CZKA 4BFZA 4ZI7F 1SIOA 1WZCA 3U7RA 1JHVA 4RL4A 3G8BA 4LV8B 4TMXA 1JEYB 1U2GA 1PYGA 3DBOB 4KYIB 5DKFA 2HU2A 4PTYA 3A7EA 3HCRA 3AJRA 4BIIA 2OCDA 1U1DA 3T9EA 1M2VA 1BFUA 2WB4A 1L3CA 4HDMB 1AG9A 3DO6A 4WLVA 5A3JA 2YKGA 3F5FA 1SIBE 5L3SA 3FSRA 1XIVA 1O58A 2XLBA 1FNNA 3TIVA 3VDMA 1FVOA 4KIFA 5AI6A 4D9NA 5BR1A 3C5VA 4ECEA 4TKUB 3AILA 5EKSA 1N3IA 5FFFA 3MCUA 2VZ8A 3QF7A 4JGBA 2NVUB 4HT3B 1U7OA 3LVFO 4TKLA 1V3QE 4NWIA 2D7JA 1OXTA 1PZFA 1U2DA 3WIOA 4D4IA 1WF3A 4HDOB 4RPCA 3NT4A 1FFSA 3T7RA 2JJ1A 1C7QA 3ODGA 4Z86A 1WMAA 2I99A 2OB1A 4RTOA 4W5OA 4R1TA 1UXHA 1OFHA 1P61B 3CSDA 2RFLA 1TD9A 2FGJA 4QSMA 5REQB 3AT1A 4GVPA 4R2IA 3MGAA 1SKAA 5ALNA 3QQ5A 4W5JA 1SKUA 3E3AA 3PRKE 1UUFA 1X8LA 4QNNA 4B4VA 5BW8A 2VXOA 3PFIA 5AK3A 3HA3A 3REFA 4QHYA 2XNKA 3GN1A 3VZCA 3EIHA 1U3VA 2EDCA 3OEHD 5A4KA 4HRAA 4FMCF 2HTFA 2UZIR 3TLKA 4D3ZA 4ZDKA 3KRTA 4GW3A 3GLQA 1F8GA 3KB2A 3KTAB 1K3FA 2YQ4A 4I1YA 4RL6A 5IMBA 2OA0A 3HEAA 3WLAA 4EFLA 1NOIA 2OFFA 3WL4A 2I3ZA 5DWQA 2I1LA 1WR8A 1VI5A 1PQ4A 1WLSA 2JFNA 2X2PA 3KR0A 3UPTA 2QK4A 4RFSB 2RAFA 2DR2A 4J1TA 1W4BA 4MV7A 3RAPR 3K5HA 4B82A 4QBKA 4Q3NA 3VZBA 2QN7A 2NUAA 3M6IA 3QYFA 1LI4A 1QH1B 3GJSA 1HE5A 4BCCA 1H2ZA 4R5MA 5BN4A 5LDDC 2VJMA 4EG3A 1A82A 1ZIDA 4PQRA 3ROPA 5LUAA 2I76A 3CGWA 4UDXX 4ARIA 5IBQA 5KPDA 3R5KA 8ADHA 3U4GA 3WB1A 1Y8QB 3CVYA 2Y6VA 3TO5A 1W35A 3BSWA 3M1AA 5FOQA 1SH7A 5AXBA 3JR7A 1ABFA 3W2IA 2O2SA 4FEYA 1MPXA 3GFTA 3BXOA 1CJBA 4KBFA 1Z7EA 2DHCA 1FFEA 1NXQA 3CW9A 4N6NA 4BTLA 2DFNA 2PM8A 2OHJA 3RV4A 1KQNA 1PZGA 3QP9A 4CKWA 1X9GA 3Q1KA 3SYMA 3W3AH 1O97C 2QLMA 2YJ3A 1ZD8A 2CDCA 4HAIA 2BF4A 2OXIA 5JH7B 2P35A 1RJGA 2GSDA 1N7HA 3BHIA 3E05A 2Q28A 3NAGA 2PWAA 2Q27A 4FDAA 4JBXA 1RVDA 4O08A 4WXEA 4B2PA 2IYRA 3N05A 4HDQB 3S99A 4F84A 3GGSA 2X4GA 5ERGB 3BCRA 1JH9A 3Q3VA 1UJCA 5CW2A 1S2LA 2ZUEA 3MILA 1YTLA 2R1VB 2ZQ5A 1TLLA 1V7CA 3EFOA 3HMQA 1AK1A 3BULA 4PSAA 3HPRA 4BQOA 4LQDA 1P3Y1 2HA0A 4MV5A 5DJ5A 5HM6A 2VRCA 1YQEA 2ALJA 1J2TA 2J3IA 1YL6A 2Q41A 2XSZD 1U0GA 1KORA 3TQQA 3ZQKA 3N75A 2CFOA 1OLXA 1XQ6A 4M0CA 2FQWA 3EVDA 4TM8A 2IEAA 1ATIA 1ZZEA 4N7MA 1Q95A 3TLMA 4QO7A 2FVXA 3CRQA 4IIFA 3FM9A 4WLNA 2L42A 3T9FA 4EVIA 1K0FA 3LY9A 3V42A 4ZEMA 4GBGA 4C29A 2G8LA 1CUHA 1GILA 1SZPA 2HWKA 2OCPA 1XFDA 3RYIB 1ULAA 3S8EA 1L4LA 2R60A 1UKYA 3GHHA 3DW3X 3P0HA 4E1VA 5A0TA 4FGKA 4N65A 4M46A 3VVLA 2NT3A 5BSRA 1TKRA 2WPNA 4PS1A 3A8TA 3WLPA 5A5FA 4EG8A 4IZOA 5LQDA 1O57A 1GZ3A 1Q57A 1V5GA 2HLPA 3FYUB 4JYBA 4D9KA 1DBIA 4NBRA 1SCDA 4F5YA 3OE7A 2RAVA 3T5AA 2C83A 4S12A 3KHTA 2HK6A 1PR6A 2X9GA 3D8BA 2C5GA 3HDJA 3GMTA 5F73A 5JD3A 3TK1A 3SDZA 2E4AA 3BICA 3G2HA 4JQSA 5BV8A 4GMXA 4L5BA 3L0SA 2FPRA 3UJNA 3GLIA 1GTVA 3MGCA 3EEBA 2BGIA 2JB9A 4E46A 4WY5A 2ZSUA 4RXTA 3O1HB 2AW5A 1DZIA 5TQVA 3FTFA 2GJ4A 1J8MF 5B53A 5LMUB 2JJYA 3CZAA 3IIJA 4BGIA 2XGMA 2FA9A 3IBTA 5FO1A 3K0BA 4IDBA 3I1IA 4C2BA 4CEIA 1T35A 4CEHA 2GYWA 4Z4EA 1UT8A 3KQSA 4JI7B 3C5WP 4FJ0A 1NW9B 3ZV7A 3I45A 5DTJA 4AKEA 2GZRA 3VH1A 4E5KA 1RAEA 1G20A 1VE1A 4Z8XA 4LFBB 2GPSA 3MTBA 4JT2A 5DPMA 4UFOA 3WKEA 3QSGA 4OXQA 4CMCA 1AF4A 3NHWA 2RJNA 5KQPA 5LR6A 3O5AA 2GZ2A 3EBLA 3FYSA 1U99A 2IP2A 4FINA 3WSTA 5A4IS 4AT1A 4QGGA 3BWCA 1TYAE 3RSSA 4OBXA 1GGEA 1G17A 3KNZA 1N5LA 3L7KA 4AZVA 3MVEA 2Q8PA 1L0BA 2FSVC 2E5WA 4ZVNA 3KVVA 1M2HA 1IE3A 5JXIA 2IEDA 4H7EA 4CMKA 4HTFB 1RXYA 2V0GA 2PT6A 4L3VA 1KO5A 3EPRA 3ZE2B 1DBPA 2XEDA 1AS2A 2WTAA 3K9WA 4EFMA 4TXHA 3NHBA 4NK4A 4C6TA 3U31A 1YHZA 2BELA 2JI9A 4YMHA 1L3IA 3DP9A 3NW9A 2APJA 4B8WA 3VVBA 2PUCA 4IDNA 4WVLA 4GP7A 3X0DA 5EIEA 1LDMA 1XMQB 4Y3UA 4DILA 1JN0A 2QU8A 3AZOA 3GGCA 1E1RA 2OHVA 1Z83A 3I83A 3KP1A 4R83A 4YXFA 2O2IA 2XZLA 4PRLA 2QAIA 2R751 3D2BA 1Z4OA 2WIFA 4A6PA 3TGPA 2FR8A 3AU8A 1FDWA 4N12A 4RKEA 2D7CA 2EJCA 3QJYA 2JRLA 4XQ0A 1X7XA 4UXIA 2R2AA 2RK3A 1X15A 5DP2A 4O4LA 1WBDA 5I7RA 2QJRA 3FTEA 2ATXA 1EBFA 2VL7A 2ZJOA 1QH0A 2R6GA 2GN2A 4L51A 5DSTA 4K40A 3T34A 4BEBA 1E3JA 2ZZMA 1JQJC 1LTHR 4BKRA 3NIWA 4TUYF 4Q9KA 3UW1A 3BAZA 1SK9A 3RC3A 4EFDA 4JQOA 4NZPA 4IFIA 2QT0A 3C98A 2WILA 4BWFB 3LY7A 4DRYA 5HBGA 1T5HX 3JZFA 1EVKA 4C3UA 1Q20A 3FTQA 4HMOA 3C3BA 5FUWA 4BRUA 5FNVF 4NJEB 1E8DA 4R1SA 5IJAA 5H8WA 3L77A 4RA9B 4DMFA 5JALA 4JMPA 3PNPA 1W4CA 2AUTA 1SBZA 3MS4A 4RY9A 1I8TA 3PCTA 2YFKA 2O8CB 4ABYA 1ZD9A 4QYMA 3VHXB 2YFHA 5EJEA 2Y0DA 3EXAA 3WA7A 5ALYA 2XMBA 4G0ZA 2EQAA 2HJWA 2IP4A 3M4JA 2YWJA 4OMFG 1T9GR 3HI6A 3NBZC 4HNQA 1DU4A 5SY9A 2O5RA 2GRJA 2Y92A 4GQAA 4PZDA 4YLYA 3BE6A 3UZUA 4RDIA 2I7VA 3OPMA 1JJAA 1PFWA 3L5KA 1G3QA 3WNCA 4EI2A 3T3OA 2J3EA 3IAXA 3IQZA 3QU2A 5K8CA 3MT0A 1NJGA 4M1EA 4BO2A 4ZVSA 1M7GA 3G3EA 2QAGC 1B74A 3NYRA 4RV5A 1KOLA 3GMSA 4HN9A 4BV9A 5HIAA 1RQLA 2OOSA 4YR7A 1NVXQ 1LZLA 3ON5A 4LYFA 3ULKA 2IOFK 4XTCS 2NU9B 4TX1A 3BDAA 3EZ7A 3TJMA 1KDVA 5AHXA 2ZAYA 5CIWA 4RHUA 5AI0A 1J42A 2XBMA 4GNRA 2P11A 1X9IA 1SCBA 2P6UA 3DV2A 4KMMA 4FM9A 3HB4X 3KYDA 1U9YA 3EQZA 4RSMA 3MLEA 4B33A 2J9FB 2VHCA 2XAUA 4UOZA 3NPMA 2R6DA 2G88A 3F6YA 1NP6A 4BFLA 3HADA 4DXHA 2CB0A 4QATA 3E8XA 2J33A 1R0YA 2HK7A 1QIIA 2CVZA 4F7DA 3EGWA 3PFKA 4MV8A 2W2KB 1PT9A 3P2KA 3AHDA 3FYTA 5LA6F 4BO1A 5EIXA 2ONKA 1CXZA 1XTQA 2IV2X 2NYRA 2W4IA 1QP7A 3RS9A 2YBDA 1P0IA 1T4DA 3O9ZA 4TMYA 5CXSA 5EZSA 2VT3A 1QE3A 4DR3B 1LRLA 3PDHA 5C31A 3HYTA 2I0FA 2NZWA 3PQ5A 3C6BA 3CUTA 2A0KA 3THWA 1RW4A 4NY1A 5YASA 4OP3A 1I7PA 2VYCA 5KUTA 2AMVA 4FFBA 5EJ9A 5AK6A 3TB4A 1PN3A 3VVCA 2QT9A 3ZV5A 3KOZA 2FPIB 3FSGD 1K06A 1H2RS 1LBIA 1N1EA 1OI4A 2R87A 2XQVA 5KCMA 1RMYA 2PVCA 1WA5A 3LFHA 4E6PA 5L7WA 2QQ5A 3TVYA 1Y33E 1EP3B 1RVV1 2XUAA 1UFRA 5BWNA 2BR5A 5JRZA 2G5GX 1GV0A 2AOTB 4J0HA 3SY8A 4U00A 2YRXA 1W1WA 3JAWA 4JWTA 1RXCA 1XCJA 5JD5A 3A2MA 3DBLA 4MQFB 2ILTA 3ENNA 1JYEA 2FUG1 2Y4NA 4MINA 2HTEA 5DHRA 2DBYA 2IL1A 2P3OA 4B6JA 1N2EA 1RPTA 1WO8A 1VMKA 2CC2A 4XWTA 3W9SA 3UJ6A 1UBGA 2NZYA 3UK0A 2FOXA 1LNSA 1Y8ZA 1L5NA 2UYYA 1E5QA 3KEGA 3SR4A 2G67A 4QGFA 2MINB 2W70A 2FWRA 1UPFA 3SQXA 3FRIA 2VRBA 3IODA 3A1VA 4J75A 1Q3KA 1BJKA 4RHFA 1IM8A 2EJVA 2PKQO 4CIYA 3CY6A 5JYEA 1OF1A 2GEKA 2WFLA 2NU7B 2AI1A 3FRHA 2WB2A 1JB9A 1UM9A 1X92A 3GGGA 5FI0B 3I3OA 3P9KA 1ZXXA 2IHYA 3ANMA 3LHFA 4L15A 4Y6SA 3JS5A 4PNEA 5G4LA 3BF8A 2OXEA 1RRFA 4JLDA 3TTTA 4YRLA 1TVMA 1BIFA 2QPTA 1O6CA 2CHGA 1X80A 2BEWB 1A9RA 1NJSA 2CXSA 3TVDA 3FNFA 1EX1A 3D6UA 1EGMB 2SICE 3BMXA 3DNFA 4MQEA 3Q8LA 2C7RA 3UT0A 5ARDA 1UR5A 2RC5A 3T15A 5LNK6 4FHCA 3PFWO 5MDHA 1UOQA 1Q6YA 4UE3S 1TL7C 1MAAA 1QORA 4P7GA 3SFVA 3DEIA 5H4HA 2BM8A 1QV7A 2G4LA 2W2PA 4KQJA 5KU7A 4QO8A 3MJRA 1R8SA 3DEAA 1PYOA 1ZONA 3MSCA 4Q0MA 4ZQEA 4AJLA 4PG8A 4WECA 4WGGA 2QP9X 1DFIA 1RQ7A 1FFDA 4M54A 3RUCA 2WVGA 5IDWA 1QC5A 3BXEA 5CA0A 3P9IA 2D2VA 2ZI9A 1J2YA 3TL3A 3C4VA 1HT2E 2O3RA 3QJGA 4Q19A 3DDCA 4E14A 3DH0A 3VO8A 4M4SA 2ENWA 2XUGA 1DWPA 2Y6UA 5JC8A 4FD2A 2X7XA 1T8RA 2P40A 2EIXA 5D2CA 1Q74A 2ZI5A 5ALOA 3FPBA 1E2NA 2FQQA 1WSAA 3ADOA 1SHUX 3MJTA 1X7WA 3FGOA 1L5RA 4RJJA 4YBRA 4UM8B 4ZOCA 5K99A 1SXPA 4BO4A 6Q21A 1O95C 1IK4A 1XA0A 1I1QB 4EFKA 4DQUA 2HCBA 4Z2AA 2QE7A 1UJ6A 4TMKA 3RIEA 3GJ5A 1QYXA 1ABBA 1UKEA 4F9TA 1UKVY 3M1IA 1XKLA 1TK9A 2W98A 4R8RA 3CNBA 5CCXA 3IILA 3HHPA 4Q4AA 3WO0A 4FGZA 4I66A 5G53C 3QRWA 1X1RA 4DC1A 1QIKA 1G4HA 1Y5RA 3UWMA 4LZZA 4V24A 4B2YA 3DVRX 4MEAA 5H80A 3UM9A 2BKXA 3K09C 1Z6XA 3H7IA 4TTSA 4O4IB 4CMJA 5CEFA 1ONBA 2YY5A 2OZVA 1OT5A 1U7DA 4MUYA 3ZE6A 4EB8A 4XOUA 4AC9A 1GM5A 1Y4AE 3LQ1A 3Q87B 2ZRLA 1WPRA 3ZNOA 3PUYA 4X3CA 3DUFB 4RWZA 4NCBA 4AMUA 4BQFA 4FZ5A 4HVAA 1ESDA 1WHTA 1OR8A 2QE7D 1MV8A 1DO8A 1PGQA 2Y1LA 1RPJA 4MI6A 2I55A 3O8LA 3SE0A 4F8EA 3BUSA 1GD1O 2DAPA 3CEPB 1QCDA 2AX4A 4L8WB 1N2IA 1KKMA 1I6WA 2H48A 3A6KA 2DGDA 3BB3A 3HNOA 2Q7OE 2J87A 4TYWA 1HMYA 3B1KA 2P6OA 3JYNA 3P4XA 2XT9A 3TW8A 2O07A 3LT4A 3O0DA 5AM3A 3B2EA 4YAGA 1ES9A 3EF1A 4B5LA 2QTHA 1JKJA 1E1QA 1SA0B 2PMDA 4Q4LA 1DIGA 3FAKA 4QJ4A 3TDKA 3GEHA 4QPPA 3ZY6A 4ROTA 2NZUG 4MKRA 3RWMB 2BMDA 3FROA 1C30A 4YMLA 1KARA 2KSQA 4MW7A 5B2FA 1SWWA 4ZTUB 3ITDA 1C3EA 3RREA 4DUGD 2IYZA 2ASVA 2Y66A 3L8DA 4UEJA 4KPFC 2Q1XA 2TRSB 3T35A 7MHTA 4GKVA 3VX3A 4PYKA 3FPAA 3PA8A 4JVNA 1KIFA 1S2IA 4XGKA 4ZGWA 4C4ZA 1P5JA 1ND6A 4C08A 1GLNA 1O97D 3AQ4A 1NMYA 4F4DA 4RTRA 3LBIA 5DWDA 3SE7A 1BYUA 3R3SA 1DBVO 1H4SA 4M0KA 4B31A 5A7GA 2VP2A 3CW8X 1HYQA 2CEKA 1J0DA 2HBYA 4YJFB 3FTCA 4YFYA 3K72B 4H4CA 2FDRA 3QX7A 3GNLA 2VNKA 3GFFA 2P3SA 1U5BA 3HBNA 4IUCS 5E7MA 1UMCB 4RSRA 4HLQB 4BMPB 4F6LA 2VUIB 3IAAA 3NTRA 4PQFA 3CZ5A 4KVAA 1E2MA 4IIBA 4TRJA 2BI7A 4JP8A 3UJ9A 5IBRA 1SUCA 1IIRA 3LO5A 3DJFA 3SC2B 3FPHA 3UJPA 1A72A 3TUZC 2XCOA 5CPFA 1OXBB 1RZRA 3AV3A 3I72A 3W6PA 2AMJA 3K9GA 5L3RA 2O7VA 4IG4A 2ERCA 2C94A 5SZHB 5TMDA 5BW5A 2WM8A 3BZUA 3KAJA 2EJUA 1LDYA 2XF8A 3MQ4A 4AQYB 3ERCA 4ITUA 3IUNA 3VR3D 1OX5A 4BX9A 1W2WB 3W5HA 2DFTA 4PYMA 3ONWA 4S3MA 4HVTA 1K6IA 1G5HA 3A2LA 3JD4A 2VCEA 3P0RA 2YYYA 1VSBA 4FNAA 5E2BA 3WGQA 4B2LA 4LVCA 1XXHE 4DGSA 4JR1A 2GKSA 3O4IA 3JAMA 1SHZA 1ZA2A 3OQBA 4NZZA 2AOUB 4NONA 1IY1A 1DAPA 4P86A 4P08A 1T1SA 2PGLA 3BA1A 3K1AB 4L2IA 1DKRA 2EAUA 5DI3B 3E5MA 4EUHA 2AUMA 1RZRD 2LZ0A 5IFKA 1CQPA 1YQQA 2Q9UA 1XVVA 4K6MA 1BS1A 3ZVRA 2X4LA 3PXCX 1NC1A 1MJGA 4CLXA 4P0PB 4NU6A 4YYZA 2O59A 3R74A 4DLRA 4NU8X 1LJ8A 4ZAGA 5BY2A 2PLFA 1X7ZB 2FSVA 3G0IA 4DDWA 1QQ5A 3I9NA 2H1FA 3L0BA 3UUFA 1TQHA 1OV6A 1B15A 2Q4EA 4M38A 1AKNA 3UKDA 1KQGA 4DB4A 1NBMD 1WMDA 2QTFA 3JWJA 1N6RA 5AKEA 3TLGB 4UHKA 1EUCA 1GT6A 2W2XA 4OQEA 1TEZA 1T0IA 4YAWA 5JJCA 1K3UB 4U2GA 2OY0A 1VG0B 5JJBA 3R5JA 1S2OA 4HWKA 4XVQA 5LC1A 3I6MA 3HGTA 3PGMA 3ZIDA 5DTEA 4NE9A 1QDUA 1JDPA 3IP6A 2DB3A 4QD3A 2OXCA 3BJZA 3TQRA 3ZGYA 4INZA 2W8BA 2A94A 3ADDA 4CN9A 2PZMA 2A9FA 2JVJA 2WM9B 2X41A 1PR0A 4B79A 3AUUA 4A0HA 1WMEA 2CXNA 3GZNB 3IO5A 3K8ZA 3GLGE 2VNJA 5JNRA 2AFIA 1CRQA 2Q0HA 1DQZA 2OHHA 2WSIA 3EGCA 4MZDA 4YMSA 3RHTA 4DCJA 3R9WA 1UBSB 1W96A 3ZBTA 3WQHA 3DAFA 4YAIA 1KOGA 2DR0A 1LLUA 2CYBA 3F4BA 4QBFA 4Z9FA 2PD3A 4X8OA 3FYDA 3OX3A 1JA1A 4NYMR 4KQIA 4RS3A 1R8JA 4BAUA 1U0BB 2V0CA 4L6CA 2ADMA 5JSQA 4XSHA 2YWCA 1AMNA 2XNDA 4A8PA 1C4XA 4O29A 1M54A 4LMAA 4TSFA 2X0EA 4BVBA 1PR3A 1OX4B 4PYNA 3ZXYA 4CQLA 2ZCUA 3RYTC 2GNAA 3AW9A 5K6AC 1JE1A 3A9WA 1EP1B 3OC0A 2AKEA 4EUFA 1HMPA 2AG1A 2FP3A 2PZLA 4I1SA 1Y6QA 4AROA 2A5YB 4KQ9A 3K53A 3BGWA 3V7YA 1AUVA 1RKXA 4INAA 2O0MA 4IIJB 4XPIA 1L5SA 3CNLA 4F96A 1OWLA 1UBCA 1A4XA 1UK8A 3OU7A 1QQAA 1YK1A 4LZOA 1D1PA 2CDBA 1EE2A 4RK0A 1C0KA 1KAEA 1RXSA 3V4LA 7REQB 3VUEA 1CRPA 4YP7A 1U6KA 3KV3O 4DZRA 4P35A 1O4WA 4QOIA 2R6AA 3HJUA 3OM0A 1FQWA 2QRGA 3TOSA 1UAAA 2ZTMA 3R3XA 3V7FA 1VQ1A 4RMNA 2ZRKA 4H16A 4YI3A 4K88A 1VE7A 1R5OA 4N4AA 2XNDD 5LDHA 4TSFD 3NUGA 3E3LA 1O5OA 3VU0A 4I4TB 3ZPXA 1MXHA 5FI5A 3WKBA 1E2JA 5BR8B 3R3ZA 1MB4A 3EMKA 3VOAA 1HNZB 2FJ0A 2WSSD 1V26A 1UXGA 2F64A 3OTWA 1PVDA 3RYHB 1YR7A 2H1HA 2MWMA 2FK7A 3LUHA 3KWMA 4IIVA 1JAHA 4J0EA 2RCNA 3T5TA 4C05A 5LLTA 3ZDBA 2IEGA 2QAGA 2I03A 1TCAA 5IJZA 3EVAA 4E33A 4UQOA 1X0XA 5JO0A 5HP4A 4BNDA 2VBGA 3OFSA 3ML1A 4GWGA 2P9ZA 5KQSA 2ZKLA 1GXSB 3RG2A 4ZOLA 1WZUA 5JG7A 2CMFA 2F3UA 3ZCXA 4TTIA 1PTKA 3SFTA 3WJAA 2Q9CA 2EF1A 2RARA 2NZXA 3KSMA 1O03A 4AQDA 5KQGA 1NDUA 5I9IA 3R0JA 4X1YB 4XXHA 1QRDA 3AIMA 4GL4A 4FFLA 2V55B 1O4VA 2CLFB 4JUAA 3WS7A 5DN6A 2BUBA 1WZIA 5A5GA 3C8DA 1GN9A 3L4JA 3HM2A 2V1XA 3C0KA 1XZDA 5DNEA 3MUFA 4KOAA 1SC9A 4L0MA 3VJLA 2MSNA 3ZZUA 1DQNA 1ZNQO 2ZRPA 3BCUA 4CF3A 4DPLA 5A6SA 3ASUA 2JC3A 3ZWPA 5AW1A 4R54A 1DJQA 2ZB8A 2ZTLA 4HQLA 1AN9A 5DEOA 1MC1A 4G0XA 3DR3A 1QWOA 2I6GA 3Q3HA 1VB3A 4LYDA 4WOJA 1S3FA 1ZEJA 3MWFA 4ENPA 1XAGA 2WWXA 2IZ1A 4DIUA 2IHZA 1N2JA 1E7QA 3CVJA 5LP1A 4S24A 3EZLA 3GG2A 4G1UC 2JRCA 5ENZA 1YFJA 1DC8A 1TVKA 3ZZ1A 4ZU3A 2W8ZA 1QJ4A 5D87A 1YUNA 1H1DA 1SC3A 3VR6D 5IBCA 4N76A 1ST3A 1BJRE 4D57A 1Z25A 1BMDA 1GPDG 1Y6ZA 4EJSA 1PK9A 4M1MA 1E1LA 3GARA 3KPUA 1DKMA 2HZBA 3KQTA 3TZEA 3SK0A 3ZDAA 3K5PA 3QKSA 4DV7B 3QPBA 1X70A 1PDWA 3WMWA 3EQ6A 5K9ZA 3L9WA 1HYBA 3MMXA 1EM6A 5AP9A 1J25A 2Q5LA 3COWA 4C78A 3UK1A 3HI4A 3TG2A 1Z63A 3L1UA 1VZ3A 3NYIA 3NV9A 2IYQA 3N2GB 3JWHA 3VV2A 4QECA 3ILXA 3LT5A 4UUAA 1EZZA 3K0AA 2PS9A 1QOPB 3I5YA 2I6QA 3HB9A 4JJ6A 1CF9A 1DPGA 2CT8A 4LRUA 3WYEA 4RZQA 1YB2A 1C3LA 4BU1A 3QU4A 3T95A 2QDKA 1JLLB 1GHTA 1H2FA 1UPTA 3OCVA 3PVSA 3TAHA 3LUJA 3DLAA 3RTDA 4HY3A 5KI6A 4DIDA 3DMFA 1BE0A 4JT9A 4AIIA 2X8AA 2LBPA 3U13A 3ECSA 3V8QA 4AF8A 3CLTC 1LH0A 1UBRS 2A2ZA 5TPWA 5EWJA 1CUYA 4RY2A 4AXBA 1RT9A 3G2LA 3U40A 4FCTA 3LXUX 1M1NB 1COWA 4W6QA 2FSSA 2B36A 2AC4A 2BKUA 2JLCA 4CHTA 5LYYA 4QYSA 1YJXA 3DDUA 4GVLA 2ZULA 2Q07A 3RC1A 4ANFA 4QUDA 4UNRA 2XTMA 4XB2A 1C3JA 1SXIA 1JYFA 2GCOA 1JMYA 3G1WA 3PFFA 5FIUA 4C14A 5DE3A 3HV0A 4MB2A 3N8NA 3BSSA 1GADO 2Q9AA 1RBQA 1TKBA 3QMMA 3U3RA 3HWSA 4P83A 3MUOA 3B20A 1RLJA 1XAHA 4KFRA 3BB1A 3PPXA 1FDRA 4NMHA 3QI7A 2ZCVA 4GPBA 4ZEWA 4XYLA 1A8HA 2O8DA 1A9QA 4MCAA 4Q02A 4J0KA 4DJAA 2ZR7A 4ZYVA 1XCBA 1HQDA 1XKXA 6REQB 3FTNA 2DQSA 5ALJA 2XYVA 3FJOA 1DVRA 1TQ8A 1B14A 2CLLB 1T0BA 5CR9A 1COWD 2CWWA 4UBMA 4J3NA 3T3DA 4JLMA 1UXOA 3OQIA 3PDWA 3QFHA 4HVLA 5C7OO 4RQBA 2QG9A 4DSUA 3HDYA 5KVQA 3QYJA 3E35A 1RM5A 3F6EX 1O95A 2IT1A 1GTMA 1DNPA 4QARA 2PJRA 4GICA 4LNUA 3ZHXA 4M0DA 1J21A 3QM1A 3O8QB 4UTVA 1EB8A 2HPZA 1OX6A 2A0YA 3OSZA 4G8CA 3JZMA 3O95A 4O4HF 5KNDD 4ZV7A 1VB5A 1ISIA 4BFWA 3NDIA 1EXVA 1NBHA 1L3BA 2OFOA 3JV7A 1PFVA 4PLWA 1P2SA 3BXHA 3E23A 3PCXA 4OVKA 1KWGA 3OI7A 1WCIB 1ULZA 4OHKA 4PLZA 1O9BA 4QBGB 3SM3A 4U63A 2VBFA 2CYCA 3L0CA 4J43A 2MMGA 3K09A 3CHYA 3H9EO 2PWZA 1ZMXA 1ADJA 1TU3A 3CZRA 3COJA 3R7FA 2QRKA 3NVDA 1QLHA 3D2AA 3OFNA 3EY9A 1E9AA 2GXSA 3RNOA 1E2GA 3ZWCA 4BFVA 1KP2A 1Q0HA 2Q3LA 1PW7A 1YRLA 2PA3A 3LUFA 1RXUA 1XP8A 4GXRA 4KMRA 4LY3A 4ZT2A 3N8DA 3TTUA 4HQOA 3QE4A 3WBJA 1YIOA 2OSVA 3CNQS 2RHHA 3DDOA 3GLIB 1SAYA 1OFUA 2R1TB 3AI2A 3L8EA 2DTEA 5FLYA 1GGFA 4X1IA 1GQRA 2C29D 4JU9A 1OI3A 2Y0CA 5FKJA 1LVHA 3D4LA 5KTSA 4UKDA 4AJ2A 1AHNA 3E84A 1NX9A 3I05A 3R6DA 5THKA 1W581 2P4QA 1F2VA 4AJ4A 5EJFA 1Z5PA 2FQYA 3DPIA 4H59A 4IX1A 3OIYA 5JSHA 1O5TA 4M6WA 3OFND 2XNSA 4FN5A 1XTBA 4HAYA 5DBEX 2IGTA 3IPCA 4KQWA 1W4LA 1IBSA 4U7TB 5KVCA 3ESQA 1AVTA 3L79A 2WHRA 1YDFA 3UAGA 2HAEA 1FSPA 2K5UA 4BEJA 5FUQA 2BY4A 1UDBA 2OZLB 3WSVA 3ZNPA 1KMCA 2BC9A 3GUVA 4RVOA 5F7JA 1JFRA 1YRQA 4MVXA 5FWDA 5NULA 3KTDA 2E49A 2P2SA 3Q0TA 4GE3A 4QE3A 4DA6A 2RGUA 2AN4A 4IHJA 4A1OA 2QJTA 1LC3A 1E2DA 4IV5A 2RGDA 1T3GA 4NCKA 3VJKA 4AZ0B 3EWAA 4C1BA 1EVYA 1SCQA 5CFOA 1A5SB 3SLRA 5A9TA 2HQ1A 3F0TA 3MT8A 4G4SO 5CLHA 2G71A 3GUZA 5AMXA 4KFCA 2G83A 2G9RA 3IEUA 3RUIA 2RB5A 1QLWA 2P79A 3INYA 3IVCA 2CF5A 2E4YA 3W6UA 2P6RA 4D5GA 3QTBA 3DAGA 1BS2A 1HZZC 2FZ5A 4KTVE 3F71A 1TMGE 1NSFA 1ULUA 5TQ2A 3WLOA 4G1MB 4RMHA 3TNFA 4NNPA 2HRBA 2CDRA 3PWTA 3ZDCA 4MYDA 4PFKA 1K86A 2QW0X 3N0VA 4WMLA 5AVKA 3FJYA 2ZT5A 1WVMA 4O3MA 1CIVA 2B8TA 3BGIA 3PR3A 4N7JA 4EMTA 3HJFA 2J8ZA 2Q5EA 1ZGJA 4UM5A 4OF4A 2HRRA 4PBSA 1DKQA 2FPGA 3CF4G 4X61A 5ALPA 3RT7A 4EW2A 4UAGA 3ABIA 4XLZA 5HF6A 1AHPA 4HNRA 1DADA 2EWWA 1T5LA 2J41A 4FMDF 1I14A 2QI9F 5BRNA 4DCOA 2ZRJA 1T8PA 3N8KA 1SPBS 1DC5A 3HYRA 1E5TA 2EW2A 4HUTA 3TRDA 3AG6A 5FQOA 2C8JA 3H87A 1R0SA 3PHCA 4MV3A 1C3OA 2NSHA 3S40A 2PPVA 5IT4A 3IHTA 3LQ4A 3TGWA 2OK8A 4V1CI 2XMRA 5KPJA 1HE1C 4F91B 3HP4A 1GPWB 3F3YA 3QMVA 3RB8A 1ZMTA 1GPUA 1CUDA 1OC4A 4Z6KA 1MNQA 3NHMA 1ZX1A 3UHFA 4D9MA 3SHWA 2CKMA 2I80A 1KKLA 3GLHA 1BTOA 2CFIA 1E6LA 1KS2A 3EXIB 2X0JA 1TU4A 1K6MA 3A3NA 5DTQA 2FZLA 3SMVA 5ISMA 2IXEA 3NOQA 2JHPA 5IUJC 4Z0TA 5FDFA 4YLGA 2QYTA 2XD9A 5D7BA 2W42A 1K08A 2XTZA 4I0WB 4EA7A 5CG2A 3FMGA 5KMGB 1DJMA 5CNMA 1CULC 3V55A 4KXXA 3ED5A 5A62A 3AKYA 3D7RA 4EMSA 2GJAA 3HCPA 4JB2A 1UODA 4YMVA 1TF5A 1U31A 1S9HA 4NBNA 1ZGZA 1FVHA 4MB0A 3VNQA 1OY1A 2JHFA 4GLBA 4DXAA 2X40A 1EWRA 4EB6A 2MDTA 4PGFA 1RYZA 1DLIA 2PH3A 3AETB 4RABA 1YK0A 2DMRA 3MINB 4ENQA 3WHIA 1WB4A 4FW8A 4JGIA 4XCVA 3EFEA 4QDXA 4DIMA 4ZMRA 3MWEA 3WYGA 2QMUA 1AZWA 4ZVQA 4G07A 2JFOA 1DO0A 3P45A 4LA4A 2H54A 5AOCA 3UV6A 3EH2A 2MOKA 3L4SO 1Y4DE 4EOGA 2V96A 3PD7A 5DW3A 1H8HA 3ENVA 3HUTA 4LVUA 2JKVA 1G21B 3OU2A 4H1WA 5JWRA 3FOZA 3BEOA 4MW5A 1T8UA 3SR0A 2WAAA 4NHOA 1XC7A 4BX2A 3T7IA 3JALB 3MNFA 2HNKA 4RCVA 4ND2A 3BJMA 4OLHA 1EUDB 1XHLA 2DJIA 3DLPX 3HEBA 1UXIA 2WWIA 3IOCA 2VQ6A 3LJKA 4CODB 3L8FA 1ESZA 1XV5A 3DG9A 4G09A 2Q2WA 1IAVA 2GNPA 5K6AA 4QFBA 3AHJA 3WWCA 1MEOA 3SBDA 2IZ0A 1J2EA 1PG2A 2GN4A 4K2HA 3CRW1 2Y93A 2OLEA 1S4MA 1OMOA 1P45A 4HLCA 3JARA 4TSRA 1KTIA 3GRKA 1SG0A 4PINA 3TR6A 1HY3A 4Q3LA 5JNLA 4ZAYA 4I4LA 5KAPA 3U37A 2JCXA 1ODSA 4KDEA 4WT7A 1R37A 2A9JA 3P97A 2B30A 1Z08A 1NRXA 1Z6PA 2JHGA 2MSLA 2OM6A 3CQ9A 3L7NA 3MBKA 4RYLA 2C1EA 4W7IA 1DO2A 3H1GA 3EVCA 1GFSA 4BDTA 2FW0A 1PV4A 3GJ6A 5AJXA 2GEFA 3P71T 3Q0IA 4MKIA 2CJFA 4C06A 4Q1FA 4JNCA 3HLKA 1T9HA 4Q93A 1IBMB 4RHEA 3ICQB 2LNDA 3DAOA 1K97A 2EJWA 2UAGA 3H8WA 1EUZA 2WWTA 2Z2JA 3Q5GA 4O1HA 1L7QA 1J8FA 1VYUA 3K9HA 3NKVA 3HKCB 2CE7A 1EXNA 1P60A 1P75A 3A6GA 3IURA 4O0MA 5EQDA 2ZE7A 1FW8A 3B52X 3F6CA 4NH4A 1J07A 4WINA 5KYKA 2CLKB 2Z4TA 2GVZC 2IOFA 3QFRA 4RORA 1ZGCA 1FSFA 1BYIA 2QLJA 3GEMA 1D7OA 1IN5A 2PX8A 3BRSA 3CSUA 3DKKA 2WQZA 3OM8A 1FCJA 4JP2A 4EQ6B 2AZMA 1NQ5A 2HFJA 3ZD6A 3ZU4A 2OBNA 2ZSDA 4J0FA 1KR2A 2ZK7A 1CR4A 3KQPA 3O75A 2C2MA 5JNSA 1DINA 3WWEA 3K4PA 4ZOEA 1H2XA 4P7BA 4B7XA 1M2EA 4GFDA 5CBPA 5LU8A 3ELDA 1EAMA 2TMYA 2MYNA 3O8RA 4A10A 4UNNA 3A1CA 1SCUA 3NTQA 2AXQA 1ZCJA 2Q1TA 3UFBA 4BUCA 4H0NA 1UC9A 1EKXA 2GNOA 4Y67A 2HIGA 3QKRA 3LW7A 1SO8A 3IXMA 4IRUB 5KX5B 1YRAA 3D6JA 4XVCA 2Y9MB 1WXXA 2Q3MA 3C5HA 2IS2A 2LW7A 3ET4A 5EHGA 1VM6A 4K3UA 4Y9DA 4DG8A 1E2IA 3FCAA 5EJ2A 2C2XA 3C3MA 4DM3A 4BQRA 1SQ0A 1E2UA 1P9NA 3LHDA 3EXFA 4MVJI 1PSZA 1RYYA 1JG7A 2A58A 2LVBA 3NTXA 4O4JB 4TWBA 5KYYB 4ESOA 1R66A 4DTCA 4YDQA 1J9ZA 2DWCA 2XIJA 4PS0A 4C6RA 3A3OA 3ACBA 3DD1A 2D06A 2CYAA 3B9BA 1DDIA 1I4DD 3DWGA 4MR9B 5FFNA 2IXDA 2WKPA 5EY5B 2HEGA 2PNJA 1DQPA 4NYJR 4OMCA 2JIOA 2QRHA 1UMDA 3V2GA 2F62A 1QAQA 1X87A 3DXYA 5JARA 1XZEA 2NPIA 3O9VA 1CQIA 2FFBA 4QELA 3AY0A 3KL2A 4EF4A 2CUNA 2FW8A 3LL4A 3WKCA 1PEAA 3C74A 2HEIA 3NHZA 1ZBQA 1Q0TA 3NJ8A 1ZKDA 4N0EA 1WF6A 2IIQA 4HNGA 1KPGA 2AOVA 3I4LA 2BOVA 3LF2A 3WYFA 5CDGA 5KNBD 5KOJA 4KBYA 1FF9A 3IQEA 4F38A 4R3UC 5J4VA 1BCRB 1U80A 4KXMA 1SQFA 2E2WA 2Z09A 2FN3A 5AVYA 1JV2B 1X7YA 2QDXA 3S7TA 2AS0A 3NO4A 4FS3A 1U1EA 1PBTA 1DZ3A 4PGMA 3RJ9A 4B3XA 2WT9A 1OKKA 1DOAA 5LMCA 1MNAA 3V46A 3R6WA 5I4BA 4P4LA 2W11A 5J3JA 4IDCA 1C9JA 1IZZA 3SZRA 3A1FA 4RLHA 4EVQA 1SXJE 2WVAA 4YECA 3N7AA 2FZEA 3T41A 2AXEA 3QF4A 4BLSA 1RTKA 2YICA 3LY8A 4IHKA 4C21A 1DRWA 2H2HA 2P0YA 3D6FA 3OZGA 5I9MA 1A4UA 1AKUA 3FR8A 4R1QA 4U3JB 1JIVA 3LBNA 5KNCD 3O2JA 1K89A 3ITEA 3KT6A 4JLSA 4OUDA 3ZGVA 3OU6A 2D5IA 3L8YA 2HSWA 3AESA 1UFQA 4DLZA 3G2OA 2I9KA 3ABOB 2VHWA 3EZNA 1Z0FA 4QJIA 5FUXA 3UJ3X 3GNSA 4RTQA 2EJTA 2P9HA 1LK5A 1P1KA 4IRMA 4E3ZA 4QC2A 4UD2A 1OKKD 1N5KA 3C3XA 5CLLA 3WV4A 1P1CA 1T9GS 5AW8A 2YY6A 1P62B 5KQMA 3AJ9A 3PIIA 2GM5A 1KAQA 1JLHA 4KPUB 4AY3A 1D2MA 3WYCA 1YL7A 3WGVA 2OL4A 4FMPA 3FETA 1GU7A 3DVAB 5IVPA 4ONEA 2AIRA 1II0A 4K1XA 4U6QA 3KO8A 2AFRA 4I9FA 4L78A 5DTRA 4AULA 4F2DA 4YRFA 3VYWA 1NSYA 2W22A 1ESCA 2EX1A 2XBLA 1SUBA 1FNCA 1Q0RA 4NECA 4U39A 1EINA 4MRRA 4KGDA 3VSEA 1KOJA 1PCXA 1HL3A 1LWOA 2AXPA 2LXNA 1H2YA 3PLNA 1NNUA 3S27A 3H6HA 4CF5A 2UYHA 4D0RA 1GTZA 2VPPA 1YGPA 2R8XA 5K0FA 2C7OA 2REQB 3KV1A 4HWRA 2PFGA 2AEJA 2X8JA 4UDYX 2COUA 1XKTA 1UEIA 2VIIA 6LDHA 2EKLA 4GSLA 1AQ6A 1U7TA 2P7HA 3HFRA 3HR4A 3IE2A 3ZKAA 2PE5A 1M2GA 4H7KA 1Z88A 3U5ZB 4B4DA 2O5EA 2RHTA 2Z4RA 5C4GB 4YJ2B 1R15A 2ZUCA 1W9HA 3UMSA 4S0ZA 1GKIA 1M1YE 4D3DA 1RMQA 1DJPA 1XNGA 2ONZA 3DLCA 4AQ7A 1BDMA 3HTXA 3PDIA 3NWPA 1NUUA 2VA9A 3C7KA 4R2KA 1IZ0A 2XHEA 1RQGA 1RKBA 3X1WA 4YRKA 1NATA 1ZKMA 5KVAA 5IXJA 4RU1A 1QRSA 2OUIA 1LA2A 2ZS9A 5F76A 3HA7A 5JMTA 4W1QA 4ZKEA 3UG7A 4MCHA 5G0TA 4N5IX 3IAS6 4Q7KA 1W52X 1OFUX 3IXQA 1M34E 4YTEA 1EHYA 3JTMA 4OBEA 2AMYA 1GRRA 3OZEA 1NKVA 3TI9A 4D9FA 1H4QA 2O8BA 5C4MA 2IDZA 1JIIA 1YUMA 2JCYA 1V5FA 1PL8A 3DDHA 4WXYB 3S68A 1W36C 2AF3C 3GA0A 4BP1A 4GDFA 3DV0A 2ISSD 3NHRA 3G0HA 1VL2A 1T6ZA 3FCOA 2ZUBA 3JYOA 3LNCA 4G36A 4RTSA 1V8PA 2A67A 2DR3A 1WMFA 1EJBA 1GPH1 2WPDA 2FH5B 4TVBA 2VRNA 3BL8A 2MSCB 2YN0A 5K0TA 1Y9DA 1QIEA 2GAIA 1RI3A 3HN7A 3LCUA 4RDHA 2R2GA 4M22A 3QBJA 4KV7A 3HDGA 4IDQA 5T6BA 4F9FA 1Z6GA 3MMSA 3JX9A 3NNDA 3TI7A 2OC4A 1QK3A 1RWKA 1SUWA 4YACA 4C43A 2Y0BA 3QWHA 1MQAA 2AHOA 3UJBA 2J3KA 3TTXA 5IJWA 1DAFA 3M6LA 1P8JA 1RMTA 3M0EA 3V7UA 2N47A 3KYCA 4F4IA 1EIWA 4F8JA 1YDWA 2OWDA 4ARBA 1LV7A 5HK8A 3Q5EA 3SS8A 1BMFA 2DWQA 1HZZA 5BPFA 3KQYA 4HUQA 4XAQA 1JXOA 4WESB 3D43A 4JENA 3WLSA 3SYTA 2FDCA 5EWMB 2AFVA 1Z18A 3OLWA 5CXUA 5FJIA 1RNLA 4D0LB 1BN7A 3PC4A 4MIOA 3WHLA 4F7WA 3ZGZA 2AFIB 1D5CA 4EO4A 2HSEA 2A7QA 3EIEA 4JBHA 1ML3A 3DTNA 5L95A 3WFZA 1NUHA 2EEPA 2I62A 3KLOA 4GR9A 1UAYA 4TV8B 3QVTA 3PR2B 4WXMA 3M4NA 3GJRA 4HATA 4WCVA 1HA3A 1E1CA 2W43A 4MQBA 2G40A 1QUFA 2XAAA 3V00A 3KPWA 2QM0A 4K03A 5C46F 5FAKA 4A0SA 1HBJA 1TT7A 2AMLA 4YJGB 4CXMA 1RU3A 2JGDA 1KKUA 2D3WA 1JXMA 3BIFA 1MA3A 4GZ3A 1XVUA 1XGKA 2AQKA 3KU4A 3QWFA 1K5PA 5U1PA 5EJ6A 4IOKA 2F8SA 5FPYA 5HQJA 3MN1A 1OU0A 1RCTE 3SQNA 3MELA 3HG7A 1H2EA 1DARA 2JANA 4PPGA 5AHRA 5HILA 4LJAA 1MEEA 5HGJA 1LBSA 3OOYA 1FXWF 3ZJVA 4YQZA 3KAKA 4JC5A 4OGFA 4OXNA 2YWGA 4PLGA 2GFHA 1Y3HA 2CFCA 2ZYUX 3H2JA 3DT9A 3O8OA 4YCDA 1DC7A 1MAWA 4L5YA 8LDHA 1EFVA 1Z13A 2EFYA 4MARA 5CYFA 1EYZA 1PGOA 2QHXA 4XB1A 2Z8XA 5AUQA 3ZWMA 4BCDA 1GZUA 1I7NA 5IKXA 2EGUA 2ID4A 3MOIA 4D9EA 4IG9A 4RK7A 1YULA 3C39A 3DFMA 4MGEA 1EK1A 3W8DA 1FNBA 2XKJE 4KR0A 4Q9NA 5JJLA 3KCNA 1QMGA 2Z8ZA 3A9CA 4CEJA 3C3CA 3E3OA 5DNWA 2GXUA 1K6XA 4WN3A 5TEVA 3UMVA 4D43A 1QRRA 3IQFA 2ZJYA 4QXAA 4BZXA 4U7GA 4I8DA 4ZIRB 5AJHA 4BRSA 5I7WA 1YSCA 3DLTA 4LJYA 4AJ1A 4HH1A 1MORA 1EBUA 1LWNA 3BWMA 3MZ0A 1KJWA 4MOWA 3FRJA 4LFAB 1KVUA 2I66A 5CAEA 5E7IA 4JSRA 4GMDA 3BWVA 2VH2A 1NP7A 3OQHA 4KO1S 4PO3X 3NBFA 1WKCA 2OCLA 4X64B 1AQJA 1ZG3A 5EJIA 5HM8A 4ZOLB 2ONJA 3T7CA 3DKIA 2ZT6A 4CETA 4QU0A 1QXSA 4I9GA 2UUOA 1V5EA 4QPNA 2CHVA 4M0MA 5C8YA 4B5KA 3EZXA 5JH7F 2WYWA 4CLOA 3ZG6A 3E5HA 4E6EA 1LVGA 1JB1A 2G9VA 2IODA 3HC7A 2B7CA 4UHEA 5SICE 2HGZA 4Y1RA 1C1XA 1C4OA 4DSAA 1SUPA 2VF4X 1CY0A 4FC7A 1SEPA 4V0MA 4IYRA 4E11A 2VPZA 3N5CA 1X13A 5AO9A 1BXRB 4E5DA 1S3GA 1L7AA 2O50A 3SVZA 3UTDA 4HX5A 1PZXA 4E2ZA 3WR5A 2YINC 2WTEA 2H5JA 2HJRA 2P9EA 4KJXA 4OI2A 4D0GA 2BHSA 4AS1A 5CM8B 2G7ZA 5HW0A 2JJMA 3KJNA 2HM7A 3OZXA 2OCGA 4L6AA 4KXYA 2CNLA 4KVGA 1C9NA 2O05A 1CUSA 1GL7A 3FUXA 3O31A 4R7TA 1VPEA 1JIQA 4JQCA 1TM5E 2ESRA 3TSAA 1YQWA 4P98A 2W48A 5UKDA 5I9TA 2O0KA 3TD9A 5JMWA 1BWPA 1WPXA 1N0VC 3KFXA 3JQGB 1Y1QA 5CX1B 1PKXA 3B3JA 3S5JA 4LWOA 4PO1A 4NXNB 1ZK1A 3PKIA 4HOYA 2J4CA 3IUPA 4DJDC 2IU6A 2M1XA 4FQ7A 1SIWA 4LHYA 4KR7A 1VA4A 1KETA 3F98A 2XWSA 4Y0VA 1TJNA 3TW0A 1QR6A 1K7YA 2C2BA 5I9NA 4PWZA 1NBIA 4ZJUA 3QGMA 4G5FA 3K8YA 4MP3A 4UXJA 1MAHA 3DV9A 3EA4A 1TT5B 1R3UA 3CX8A 1C7RA 3V9AA 1FJXA 1N6HA 2XNJA 1ZSNA 2DFDA 3ABZA 3CRNA 3RJTA 4ZO9A 3ZCPA 2P7IA 3F9IA 3B6MA 3UMBA 4XSVA 1IMOA 1EGVB 1JHQA 3ICCA 2IH2A 4G84A 2PKQP 5BYBA 1SOAA 3WB9A 4ZQHA 3DBIA 4HAOA 3VR2D 2FX2A 4CGYA 2O9JA 3L04A 2QTMA 3MWLA 5KWIA 2CK3A 1CQJA 3Q9SA 2OV4A 1YQXA 2FVYA 2F3QA 3UHJA 2W9XA 3ANTA 2G9NA 3ZDZB 3TLBA 5K03A 1FX0A 5ADVA 4JMLA 2HWXA 1Z0SA 2WJPA 2P27A 1GZ5A 4BXOA 5DYTA 1BWSA 1ZUNB 2JVKA 2C5EA 2X5KO 2YMMA 2ZAMA 4JJIA 4PNHA 5CLIA 3ST7A 1NXXA 3IVRA 4LRSB 4S1PA 3PYLA 1WV1A 2PS0A 2B8WA 3Q41A 4D0NA 3OT1A 3JD2A 3IP8A 5DCLA 1JKXA 4LZJA 3GJXC 2WWFA 4B74A 1U8CB 4AVYA 2WIKA 2XTAA 3KE9A 4MUKA 1TA0A 2PBRA 3Q4GA 1U8EA 1Q92A 4MLCA 3KBBA 4X44A 4OA8A 3T7KA 2V3CC 1WVIA 5IU6A 2UZ0A 5F51A 3DZCA 2BJHA 1HRKA 4DBLE 2FGKA 1G18A 2CEAA 2NXWA 3C43A 3V8BA 4FD3A 2BP7B 2GKGA 2VDPB 1EU1A 2VJPA 3BXZA 3P2OA 4JXJA 1KJIA 1BDJA 3D8HA 1D03A 1EFUA 3M6VA 4YRRA 3OVMA 1MIOB 2IPMA 1WZ2A 2YFYA 2VR1A 3L0ZA 4P0TA 2XH8A 4FOSA 1EP2B 5HFAA 2EF0A 2VK1A 4FI3F 5TRTA 4EF5A 3F3SA 3I1FA 3GAZA 4HRVA 1EFHA 4D8TA 1UOPA 2RG1A 3IKVA 1XMIA 4YRIA 5EMNA 1RM4A 2VJLA 2MYPA 1NVFA 4WD3A 4B47A 4NESA 5BMVB 1VFNA 3FB1A 3V2HA 3IDOA 4UEOA 3HVJA 4I2VA 1YR8A 1KL7A 1DX4A 4HVCA 1EAYA 1W19A 5C9ZA 3IEXA 1SXQA 1PQYA 3RVBA 3FDIA 5JNUA 4A16A 2I7XA 1E3SA 3MJDA 2YCLA 2L2QA 4RXMA 3WFIA 4NX2A 4KU4A 3O8BA 4XOIA 2MCFA 3UICA 4B83A 4BE9A 1ZSYA 4RF4A 1UADA 2ZT8A 4R68A 1PNRA 1IYZA 2BBSA 4OMDA 2QSYA 1WDLA 4KO3S 3RG8A 5FOTA 2X8BA 3EVBA 4B3CA 4YQFA 1RP7A 4KDFA 1MJNA 2HDWA 1SZDA 3E9MA 3G13A 3Q7TA 1I9CA 3QYPA 4Q21A 3VXKA 1NMEA 3P9ZA 4O2AB 2YUTA 4X7RA 5KSZA 3HXMA 2JKYA 5ALSA 3UB2A 2ID9A 1PD1A 1W46A 4DWWA 3JQ7A 1HYGA 1VL5A 3C4JA 3IJEB 2QZPA 3T4EA 3L2OB 4YCCA 1V4VA 4U7WA 5JASA 1KI6A 2ZCJA 2YYZA 3C5EA 4QTUB 3V4PB 1Z2EA 3P19A 3AVQA 4ER7A 1WCV1 1U1GA 2YZNA 1ZH0A 2XMDA 1FLDA 4AZWA 4C7XA 1JMKC 4QDUA 4Z7OB 4E3WA 1M2OA 5KZMB 4DR4B 1Q16A 5IJ0B 4P4GA 3P9SA 3O1JC 1PAUA 2HK9A 1G2OA 4WN9A 2G3YA 2IE8A 2CLOB 1WG8A 1Y4UA 2PYZA 3BB4A 4Q9AA 5CA1A 1F2TB 3OOHA 4MW1A 2UYCA 4BEVA 1GU1A 3QELA 1L7OA 4ZCSA 3TEMA 3F6PA 4Y18A 3VYVA 3WK4A 4EYEA 2NM0A 3CUEF 1YZGA 3TGLA 3UWKA 2HQBA 2PKWA 2NUPB 3I53A 3OBBA 2B3TA 4PFQA 1E2QA 1PO7A 2BFMA 2JJ2A 1NLFA 5DB4A 1EEXB 4H7FA 4MWBA 2HJHA 3LFUA 5IM4A 2GESA 4LRXA 4E22A 1G8FA 1OHHD 2C8VA 2CL6X 2IXTA 3CGGA 3Q3EA 3KXPA 2DOKA 2IXAA 1FP7A 4KQHA 2VDOB 1AXRA 5BXQC 3HA5A 2VCHA 1GY8A 2JGFA 2UZ1A 3L8GA 4FWIB 4Q1DA 5F35A 3ZHTA 3FKQA 1O5IA 4A5OA 1W0KD 5JQGA 3ETJA 1GKLA 1Q2UA 4BMCA 1JQ5A 1PJLA 3M89A 1HE4A 1LK7A 4QU8A 3RSQA 5ES4B 4FYHA 3AEYA 4FZRA 1F8UA 4PC1A 4OSPA 4FX5A 5D01A 4WVFA 5AIAA 5FT9A 5F7OA 5E2IA 5CU7A 4WSOA 4XWYA 1J2JA 4TYNA 2WJGA 1N1GA 4AM8A 2Y1WA 2JJ2D 4FOOA 2PH1A 2VQ3A 1WS6A 3RTCA 2QUHA 1JSXA 1Z5WA 3GX1A 1Y7HA 1AF7A 2R5NA 3FZYA 4UUQA 2WICA 3KB8A 4EGCB 1VE6A 2BFCA 2IDKA 2J46A 3B9RA 1E79D 4J07A 3MCAA 2FX3A 3CE9A 2G72A 3KVRA 4JJ7A 3WJ2A 4DOMA 3I6IA 3H19A 5EE1A 4DV2B 1C4KA 2ZYTX 1KRHA 1R2QA 3I2JA 1KEEA 2IH4A 1E4VA 4Q16A 1C3OB 4PRKA 1PJQA 3DB1A 1U6JA 2ZTUA 3ILHA 3RIHA 4IJMA 4TMVA 4D4JA 1SB8A 5EFOA 3ZXIA 2P0AA 3RLIA 2UUPA 1DIHA 1IOLA 2W6MA 3UNXA 1H9CA 3ZX5A 3OTQA 3HJBA 2QY6A 4QDTA 1XMJA 1CEQA 3EC1A 4G5XA 4QQNA 1TA9A 3P26A 4UU0A 5F5NA 2GR9A 1LBQA 3ENKA 3EQ9A 1W6UA 3NZEA 1RTTA 4QQFA 1BX0A 1FC0A 2AOXA 3D0QA 1I32A 1JSCA 3BE4A 3B82A 1DCFA 2H7XA 5I9SA 3I39X 4R2JA 3I5XA 4FDVA 5ELLA 4KWIA 4ALMA 2LIVA 2G1PA 4IYJA 5JCJA 1OV4A 1VOTA 2BM1A 4HGYA 4J90A 2OYCA 3VV3A 4B76A 3MS2A 5CH8A 3IHLA 4CM8A 1W36D 1P4GA 1ZOOA 3G2MA 3PQ3A 3FY4A 1R16A 3EIXA 5K51A 1HC7A 4TV9F 3FLMA 4XVHA 5FHRA 5ICFA 3L40A 3BKWA 1TJ4A 4ZPJA 3ZHRA 4RULA 4A0GA 1Q77A 5ENVA 2GLXA 4G1VA 5TS2A 5BUSA 3AXTA 4E70A 3JWGA 5JLJA 4A2WA 3FGNA 3VOSA 1OGIA 4U7JA 3DMDA 1JKMA 3M3DA 3O8NA 4HDKB 4QXOA 3A31A 6CHYA 4AZ3A 2BH9A 1WU8A 2QUZA 1M6VA 2ZIWB 2HHJA 2XZOA 1X3SA 2XNHA 3UCFA 5BNTA 2Z3ZA 3LC1O 1H3FA 1UPUA 5JCJD 5CFLA 3EULA 2TYSB 3C1AA 2PKCA 1U5AA 3B1WA 3O47A 1R4NA 2ZUFA 4XJSA 4HKTA 4JN6B 1E2FA 2QUKA 2Y1GA 2DT5A 4TXMA 4DANA 1I4EB 1FFXB 2EBHX 3V8NA 1NLMA 1V3VA 3EGXA 5IANA 1AJEA 1EPUA 1FUYB 5E6UA 3TKLA 3H1AA 2Q3DA 4ND8A 4KN6A 1C80A 4PWYA 2XYPA 2OB2A 3TJZA 1G6Q1 3MA0A 4ARCA 2A5GA 2C9CA 3JARB 3BREA 3EXG1 1KHHA 4MWSA 3M6XA 5EZ6B 3GELA 3T5MA 4G25A 2QTVA 1A9ZA 1JDVA 2C58A 3E5NA 5HUHA 4LJKA 4D0SA 1GVNB 3SHQA 2YTZA 5HWSA 2PUJA 1N5JA 5IFLA 3RRXA 3RV3A 2CSXA 3O3NB 2VNAA 3GQBA 3QITA 2GCNA 4QUEA 1CF4A 4HAZA 4U4AA 4UPVA 2Z9DA 3TLJA 4CIXA 3UKJA 3GVCA 2ON6A 3HUFA 4U7FA 1NOKA 2C2GA 2Q99A 5ECYA 2CDAA 2PMWB 3TTVA 5EHZA 5DI9A 3IO3A 1VPDA 5AICA 2JCGA 4P93A 2X9QA 4NMMA 2NV6A 4R1NA 5E1OA 2QBYB 1ZUWA 2Z2ZA 5IWAB 4BKUA 4N41A 1S5PA 4O4IF 5LZ5A 3KS9A 1JHZA 4YONB 4NBVA 3UWDA 2QL6A 3AK4A 1MZVA 3HVUA 4KV9A 1RC0A 4W5RA 1NBAA 3NWJA 1DRKA 2I4NA 4JJEA 3U61B 4V0KA 1FSZA 2J85A 2Q46A 3KJHA 1T9KA 1T8TA 2WAXA 4R2XA 3UAYA 3WNZA 2J9XB 1PWHA 3D6TB 2HIMA 1CX9B 4INPA 4KQKA 2JKZA 4MQ6A 3O0TA 2Z2YA 3R0XA 4XX0A 4LCEA 5BYKA 3WQQA 1K3TA 1SEVA 2OG1A 1KO7A 4LRYA 3EVTA 4GHWA 3TR0A 3KZ1E 1SBYA 2HRCA 4MVJF 5C34B 1PG5A 2G4VA 4K3VA 5LQUA 1ZRHA 5AKHA 2CSUA 1ZCFA 3LS2A 2A7XA 3RBZA 1W75A 1FJ2A 1IRXA 1K8QA 2GYVA 1B0AA 1BHQ1 4XH9B 4ZAZA 2VN8A 1PEKE 1XWIA 4AP5A 1Q1BA 3H1BA 4I55A 4TS4A 4OFZA 4OEHA 5AJWA 3WLLA 2CXOA 3S8MA 2CNNA 2BM0A 4HS4A 1DBRA 1ZOPA 1N6NA 4IDFA 5K8IA 3T1TA 1KJJA 1GKUB 3V1MA 5CVTA 3EF3A 5EJMA 4OLFA 2WTNA 3KSZO 3LF1A 4GS5A 4EABA 4TZTA 5I48A 2RONA 5FBQB 1U1IA 1U6IA 1QP4A 3RRBA 2QTBA 2VZEA 1ZMOA 2X0FA 1Y82A 2FZWA 2HQOA 4NJMA 3RF7A 4IRXA 1L5OA 2V7XA 1JXAA 2PL1A 4NAUA 4BO8A 2CD7A 3IVGA 3C3AA 3L0OA 4JVMA 2H06A 4R8SA 2P9BA 3N2KA 5DK6A 1RWPA 5H59A 3PQDA 4J7AA 5K0LA 1PJCA 3DT8A 5K3SA 3SVLA 1YI8A 2F4NA 4TQGA 3AJEA 5HMMA 4F72A 4BFSA 3ICOA 3FFXA 3N0TA 5DVZA 1G8KA 2CGEA 3GD5A 3H4MA 4LOJA 3SQOA 2HCFA 3IP3A 3WIUA 2Q6TA 2WU3A 3DFFA 3LUDA 4Q4HA 1NU8A 2HBRA 3NNNA 4NDNE 4IDGA 5AK5A 3SP1A 3TH5A 3ZJYA 421PA 1XNRB 2BUCA 4S1NA 5TMPA 5KOYA 3TG8A 3E03A 1M1UA 5TLSA 2PXHA 3ESRA 4WZBE 2ETXA 2QRVB 4EHLA 2PLWA 3TQFA 4X6XA 2G17A 3HSKA 2WUDA 4JBNA 2IYAA 1QTNA 3MCWA 4NSNA 3G0CA 3ZIAA 1WHSA 5TQJA 4UEKA 4MGKR 4EPRA 2SHKA 4MKFA 4WKPA 3H3XA 4U0JA 5H5JA 3P4UA 1IJFA 2LTAA 3QU9A 1K9VF 1ZRMA 2XVMA 1QOZA 1MABB 5FB3A 4YRPA 1TADA 3CA8A 1EI9A 1P74A 2B98A 2DSNA 4OFXA 5LLDA 2X42A 3FOCA 2H2AA 2JEOA 2SNIE 2MT9A 4MPPA 1TQDA 5L51A 4NYIR 4OHCA 2J30A 1TEHA 2DTXA 5TNXA 5FOWA 2ZITA 3CCCA 1CR0A 3F3MA 4X91A 3I0NA 4CMHA 3QF4B 3NRBA 1AUPA 1A7KA 1XXHB 4OHWA 4GBED 3NGXA 1ZN7A 2ORED 3ZW8A 4ZVVA 3I34X 4C5CA 3ZLTA 2HI0A 4EG5A 4N5LA 4OYYA 1CVLA 5DNVA 3ZWKA 1KVSA 4B6QA 4IIYA 4BKPA 2XLCA 1OJLA 2NT4A 1CR1A 3SN6A 3UT5B 2IVZA 3TW6A 2AFHA 1QGDA 3MOSA 1QUEA 2W6JD 3QKIA 1VCHA 2D1FA 3V6LA 5KOHB 3DEZA 3UXYA 3SX4A 1KYYA 1RXEA 2FRVA 3MF4A 4QUKA 4YUZA 2RMKA 2RHBA 1SXGA 1JVSA 1TCCA 2HFKA 1T8WA 3EE6A 3I2GA 3KZKA 3LA8A 4LJSA 4JFAA 4R7GA 1PK8A 4D3XA 1G64A 4MI1A 4EHBA 1VFPA 3R7WA 1HDZA 3EVZA 2IFTA 4YCMA 2GPBA 3IOMA 4CKCA 3T0GA 10MHA 5ECGC 3AEKB 4REMA 3QUCA 4QTTB 3RTBA 1EHCA 3ILSA 1EXMA 4X92A 2SKDA 4XASA 1Z39A 5FULA 1WXFA 4EGFA 4G8JA 1JFFA 1ADGA 1BFKA 1O2DA 1YQTA 2PO5A 2XQJA 1BVRA 3KOMA 4FQ5A 4M86A 4US1R 5F12A 3THRA 4E5MA 2H0AA 2J5RA 1PT6A 4FDMA 3AWDA 3IEIA 3D0OA 4GEGA 1LSOA 2HLHA 1P0QA 1YNSA 4CM3A 4M53A 4R8LA 3DBRA 5AVQA 3PUVA 5COAA 2DQZA 2VKQA 5A3SA 3CUVA 3VAYA 4QZVA 2P41A 2MYUA 5I6DA 1BS9A 2X8JB 3EIUA 1XMOB 2ZJBA 4XFKA 3VKHA 3R9KA 2FWBA 3CNEA 4Q1BA 4GU5A 4FGSA 3IAM6 2OFXA 1HQYE 4I5GA 3TZCA 1EFPB 4CIAA 3K9QO 3AOEC 2QA5A 3CBQA 5T6MA 5DNYB 3SZUA 4WL0A 4JXZA 4JX9A 3A4VA 2W83A 3TLAA 5C35A 2Q7XA 4E1BA 1Z36A 3PB3A 1IBRA 1I2DA 4Q3DA 2GTPA 5EMJA 1MB2A 1OWMA 3U9LA 3TOZA 2CLHB 4A6EA 1I4WA 1NUPA 1DRJA 1RDFA 2GZDA 4M55A 2WM2A 2DH5A 2JJ8A 2ET6A 1JU9A 4IIJF 4UPDA 5EVJA 3RFXA 4AG5A 3R24A 4E5SA 2RSLA 3L6RA 3O8CA 2PQ0A 2Z1MA 3G2QA 4RK1A 4CI0B 2XX3A 3G5UA 3N7TA 2AD1A 5FA6A 4Q15A 4G89A 4F3CA 3DCJA 2ZWMA 3QPAA 2HJSA 4JUCA 1MH1A 4RVUA 1ND5A 1HLPA 2VLIA 1JG1A 2CNDA 3HCBA 3PTAA 3ZDYB 1KEWA 3JPYA 2O8EB 5DDIP 1EQAA 3BJIC 2QVBA 5BQXA 5AK0A 2OQIA 2ZI3A 3K0EA 3OKFA 1X8JA 4I4TF 4K26A 2QX7A 3A9TA 4W5NA 1OBHA 3VNSA 2FFQA 4OM8A 4XEUA 2BM9A 5K7SA 1T2NA 3NVMB 2ZIEA 4PLYA 521PA 5D1HA 3QEOA 4PQYA 4PLTA 1PJZA 3RS7A 3C1UA 3OX1A 2PZ8A 1PV2A 1E62A 4R01A 3Q12A 5EIBC 5L8VA 1ZZGA 2A4KA 4B0PA 1H6CA 4HMQA 2WV7A 2N9UA 4G26A 1H94A 2B6HA 4OHBA 4MR7B 2P30A 3NVAA 2HCRA 3PGJA 5LQKA 3QVKA 4HX2A 4IKEA 2I4IA 2IIVA 2QW8A 2FQ1A 1XT6A 4G4SP 5EINA 3FHCB 3SSMA 5DNCA 3O1IC 2C7GA 3E61A 1UDXA 2VPTA 3PHJA 4ZOBA 2V5UA 1KNQA 1WKBA 3DO8A 4WW0A 2FW7A 4PSKA 5JWOA 3GDGA 4AMYA 4MYHA 5TX7A 5LLSA 3RIMA 2J9GA 5AVVA 4BNFA 4UARA 4IGAA 3NHAA 4IV0A 3KLBA 4JUDX 4JBWA 2EBUA 2C7BA 1WBBA 3UJAA 4ZAFA 2RAUA 5F7XA 4BPRA 2XUFA 5E9AA 4X1KA 2Z0MA 2R96A 3H8VA 4B3IA 3GIDA 4L3OA 1D2CA 2JFPA 5HKOA 4X5OA 5BQ3A 4MW4A 1T1IA 4PIPA 1ANKA 2RGBA 4AW9A 1PR5A 4EEKA 2QYOA 4GT1A 2GEDA 2HF8A 4FMCB 4WAUA 4M7WA 4BUJA 3DEKA 2JI4A 1E9SA 3OCWA 3PX3A 1YBMA 5B1DA 3H16A 3RU9A 1GUZA 3R3HA 4IIEA 2X7HA 4CG0A 1E2LA 3PRYA 2DPHA 3NIFB 4YPVA 1GR1A 5I45A 1NJ2A 2C9ZA 4LPSA 3I58A 4IVRA 2YJ6A 4G8DA 4X94A 2HW8A 4ENVA 5D6NA 4CG2A 1RAGA 2NO4A 5KYUB 5TMBA 2WFMA 2PUEA 2OENG 2O48X 3GNTA 3N39C 5FI3A 3IOBA 3HKDA 1T5TA 1GITA 2QAJA 1UOEA 3RSOA 4TLMB 4F5WA 5ILOA 2G63A 1U2PA 3HKBA 1TYEB 2ASEA 3SZLA 1YRHA 3WE7A 3AKZA 1A9OA 2NUTA 1OCEA 1SKYE 2BEUA 2Y2UA 3DVLA 3OEWA 4D4HA 5JZVA 1QB7A 4JI6B 4HAXA 2C5AA 1EFVB 2PH7A 2YVQA 4KAXA 2IV3A 4KPYA 1MO4A 2JLBA 1Q2XA 1NUQA 1BA2A 3LPLA 4H08A 4Q3KA 3PD0A 4XIIA 1I7DA 3ROFA 1P72A 2B35A 2B5OA 2JHCA 3AKCA 1VLQA 3AP2A 3E70C 1W6RA 2QQFA 3KELA 3Q2OA 3T12A 5B64A 1XJ0A 4UTXA 5DLY