1FYXA

Crystal structure of p681h mutant of tir domain of human tlr2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
145
Chain Sequence
SRNIYDAFVSYSERDAYWVENLMVQELENFNPPFKLLHKRDFIHGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TOLL-LIKE RECEPTOR 2
publication title Structural basis for signal transduction by the Toll/interleukin-1 receptor domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 42
structure length 145
sequence length 149
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 1fyxA00
3UB4A 4DOMA 3UB3A 3OZIA 1FYXA 1FYVA 4W8HA 4OM7A 4C7MA 4EO7A 5H3CA 3UB2A 1T3GA 4FZ5A 3JRNA 1O77A 3H16A 2JS7A 4C6RA 4W8GA 1FYWA 5KU7A 4LQCA 2M1XA 4C6TB 2J67A 4C6SA 2Y92A 4C6TA 2Z5VA 5FORA 4LQDA 4LZPA
chains in the Genus database with same CATH superfamily
5KIAA 1G98A 2HZBA 4BP8A 1UK9A 2BC9A 2YWCA 3TJMA 4BNDB 2H7VA 4BV2A 4ECAA 2RAPA 2ZBFA 2NUAA 1DCKA 3A58B 2P35A 3I9OA 2VYFA 4ZCLA 4E2XA 3D4OA 2VDQB 1G1AA 2D8AA 2OOSA 1TA0A 2K7FA 2JVJA 1WB5A 2VPZA 3E2MA 2YS7A 2VA9A 4AAYA 1C9JA 1PGNA 2OG1A 3B1XA 4FI3F 2H16A 4DLAA 2EERA 1DQZA 3G6WA 1U9JA 4M2LA 2V0GA 1NMXA 1W4RA 2I62A 1JA9A 3ZH2A 4BEJA 3T3NA 4HI0E 2UZIR 4M9QA 1CNFA 3TOZA 1KQPA 4AN4A 3OCJA 4ZMSA 3H9QA 2KBEA 2W37A 4FSHA 3NWPA 1Y8QB 1PFKA 4WA8A 1EGQA 2ZKLA 3N87A 5DV9A 5IBCA 1SRQA 1SPXA 2V45A 3U60B 8ATCA 2YFKA 2PT7A 3HZHA 2VDKB 1HNNA 3DJYA 2GVNA 3EZ2A 3HDVA 1FYVA 2YJ4A 3O75A 2C07A 4NS4A 4O02B 1RC1A 3HUFA 1C4OA 5JNVA 4JHXA 2PYZA 2M6KA 3DEYX 2NPFA 4EITA 1THGA 2BW0A 1GIAA 3FCXA 3Q11A 2OYCA 1ZIPA 4KV9A 5FWAA 4Z4FA 2JI4A 2P4QA 3NUGA 4UU1A 2IUTA 5CT8A 2DWQA 3C14C 9MHTA 1Q7EA 1R1DA 4P33A 3DB1A 1ZM7A 2JCVA 4UTNA 1CJKC 3QKWA 1OXBB 1Y63A 1RCTE 3KZOA 3R3SA 5A05A 4NAHA 2GASA 3FLMA 4JLDA 3WYFA 1TRHA 3DHVA 1K3UB 5HZMA 3QYPA 3BWYA 2A94A 3QKSA 1M7BA 3G2MA 4ZAYA 4YV0A 1NT2A 2Q4OA 1V95A 2WMYA 4U9UA 1WB9A 4NYIQ 1JYFA 5JZBA 3E48A 1PT7A 2ZJBA 4B79A 4CFSA 1COWA 1WV1A 2HWWA 1KI9A 4NCXA 1GKKA 6REQA 4RLQA 1DOAA 2FAXA 5DXAA 3M6AA 1MVNA 4JU8A 3IT0A 3INGA 1XNJA 4OQDA 3EEOA 3U2QA 3O9ZA 1LSUA 4KAJA 2NZWA 2QRPA 3BWVA 1SHKA 3T9AA 4EHDA 1ZY2A 3GIDA 1EINA 2VDWB 3FSJX 5FA6A 3ADPA 1G3UA 1GKLA 2OBBA 2VZ0A 1P1HA 4ZA2A 1XFAA 2CYCA 3SGLA 1UKZA 4EX6A 3GFQA 4GI7A 4LYJA 2RGXA 2ODNA 2QORA 1X7XB 2MOKA 5J2UB 2ETVA 3TR6A 2H4HA 2FV8A 2BR3A 4JQYA 1Z4OA 5L3ZA 3TPCA 1VG8A 1P2FA 1U31A 2GERA 3GAAA 4XSVA 2IYAA 4C4SA 3EVFA 1LX7A 1OT3A 3CF4G 1VXRA 5LU9A 4MQ4A 4LOIA 1VG9B 4LY3A 5TRTA 1XHLA 1OLXB 3EXFB 2WSMA 1JHAA 4JJZA 1RI3A 1PR4A 1V5IA 1CZUA 3O90A 4JVNA 4I0WB 4MWCA 2I7VA 5GZ1A 4KP7A 1YGPA 1WDLA 5H3HA 1QTRA 2OMKA 1B76A 1IUNA 2PZAA 2VRWA 1GGKA 4R2IA 2IVZA 2YZMA 3AUUA 2WFLB 4AY4A 4DWJA 4WXYB 2Z6AA 2O59A 4OOFA 5JDCA 4F2HA 1IOWA 1Z6YA 3OECA 2ZUEA 4LV8B 1TZJA 3C7CB 3NBMA 4NOJA 4XGKA 3PICA 1MN6A 3P20A 2ZBQA 4EFLA 5KNBA 1Y6FA 1AKMA 4XGQA 4P38A 2QXTA 4KK4A 4C21A 3RIYA 1U90A 5G2OA 2G1KA 1SZCA 1TK3A 1CEXA 4EJFA 5M2QA 1W85B 1Z5PA 3MD0A 2KMLA 3DQZA 3HP7A 4QDZA 4G67A 5F1KA 2DPYA 4M0PA 1U8UA 5ICGA 2XUIA 5ALHA 3D2BA 1KEEA 1QVVA 3WLQA 1Q1NA 3OZEA 3EUWA 4XASA 3H1BA 1OI3A 2BGIA 1X7WA 3EOAI 3MAGA 2ZWMA 3VBEA 5HCNA 2VJYA 3WV4A 2J6IA 5JR3A 2FP4B 5F7JA 1LC0A 2IIVA 4LCJA 3HCFA 4EJ6A 5ITSA 1U2QA 4LVCA 4BTLA 5GMOA 3F74A 3I8SA 3EMDA 3GJ8A 3NM4A 4MICA 4W63A 4F4IA 5COQA 4W5OA 1XZFA 3KZCA 2AOWA 7GPBA 2ANCA 1GCAA 2ZJYA 3HV2A 4AJIA 3PF8A 4ZV4A 2QTBA 1X1SA 4QU0A 3LSYA 2X7JA 4EYSA 1JR2A 2Y0EA 4F9GA 4JI8B 3FVWA 2VP0A 3WWZA 1ZXLA 1A9SA 1OFVA 2H9IA 4BZZA 5LUAA 1KEEB 3M2PA 3CZMA 1JQLB 1KJ9A 1QYIA 2WHPA 4WXHA 4XDGA 1A2QA 2ZWIA 5F4BA 2H31A 2J5BA 2BGNA 4RZ2A 5C5IA 1EFLA 4WJKB 2ZS7A 3D4BA 1AQJA 4REOA 2QM0A 1KR5A 3B20A 4ETMA 1RMYA 2EGHA 2ERCA 4M9XA 2YV2A 4K9LA 5M34A 1BOOA 1NNEA 5EP2A 3PP8A 3RS2A 4GSYA 4M9SA 3W6PA 1F7UA 4I3GA 3IH5A 1OR8A 5LXTA 2B9VA 2IS1A 1GG2A 3GEBA 1LNZA 2DY0A 3TX2A 3W8RA 3NONA 1ZM2A 3NPAA 4Q47A 1B6SA 2FWJA 2OQVA 3QBTA 3SE7A 2VUIB 3HYRA 5FNZA 2WHPB 4Z3KA 1GCIA 1XEXA 4U8GA 5BYKA 2B9EA 2OO5A 3N8DA 3I1JA 1EX1A 1T9CA 1M76A 1P0MA 3BAZA 4DJFC 1KYZA 3PUZA 5HQJA 4MKIA 1H4QA 1TEHA 1XEAA 3FDIA 3PHLA 4Q4DA 1P8JA 2W2PA 5AOAA 4A2QA 4F3KA 3KDSE 4ZCMA 4QBKA 2AR0A 4DR7B 3RIMA 1PSDA 4EUNA 1KC3A 1DJNA 3HKEA 3ZD6A 3H0KA 4HTFA 5EVJA 1BTOA 1LPAB 1Z73A 4BQSA 5LXTB 1RWPA 1VPDA 3AERA 3ORRA 3MXOA 5I7OA 2P6UA 4MWOA 3BDVA 4PONA 2AD5A 2V6IA 4TTRA 4C78A 4UARA 3JVIA 4RKYA 4Y6QA 2JLSA 4M1QA 1NPTO 4G63A 4K9KA 4FYIA 4BQRA 2IC5A 1T29A 2O0LA 1XEXB 2VCEA 1M1NA 1OTYA 4M1YA 4Q05A 1HTBA 3FY4A 4JDPA 2GN6A 1Z5VA 4JEHA 2OWEA 1G4UR 1P0QA 3KEGA 1KE1A 3QPVA 3V00A 5K0FA 1U2TA 1Y3CE 1PD0A 1ZN2A 5DISB 4UCWA 4M89A 4ABTA 3WADA 4CLRA 4AC9A 2FW1A 3HKEB 3E7WA 4XVUA 2Y0CA 4MI9A 3AKDA 1XROA 4HTFB 3LMKA 3GL9A 4AF6A 4G0YA 3FYSA 3GFVA 2Q21A 3SHQA 1B00A 3INTA 2BGGA 4E94A 5CX1A 4DPKA 5KJFA 1EVIA 5CT6A 3VR6H 4YP6A 1BXGA 2LVBA 3DR5A 4BRUA 3VR4A 3C3JA 1BW9A 4O4LA 5ENVA 4FDMA 1GTMA 1WBBA 5EFZA 4RTQA 2HCTA 1W4CA 4FOOA 5C3MA 1GVHA 2YNMC 3LCJA 5A9SB 4LYHA 2MHCA 1T9AA 5CCDA 2C4MA 4FW9A 3ROXA 4F8JA 2WDPA 5JLAA 2QNIA 2D5CA 4K6GA 5G40A 1HR0B 4TZ0A 1JAZA 1HQYE 3QQ5A 5FI3A 5HJ2A 2KE5A 3UHPA 3I9V1 3D4LA 4TSFD 4YP9A 1Q0RA 5EZSA 4JSTA 4R54A 2VKTA 1FQKA 1G20B 1JWAB 5C52B 1ZX1A 1QWOA 4EI9A 4ZU6X 1RW4A 3KZMA 2FG5A 1ULTA 1LQ2A 1X2EA 4IJVA 4KDCA 5LD2C 3CURA 1BW9B 1ZIXA 2RKBA 3UUFA 4FYHA 3CVXA 1DBPA 1CZOA 2NADA 1YZGA 3AI1A 1TM3E 3GO4A 3ZI4A 3M1YA 4QVIA 1WCIB 2AN3A 3L0ZA 3VU9B 3UXYA 4HLUA 1LLQA 5SY9A 3F6SA 3E3MA 3R3UA 1CDEA 5GJCA 1PWZA 3GBPA 3PXXA 4JBHA 3HMKA 1ZJZA 4FBLA 1PBTA 1B23P 2NW6A 5IPFA 2FSFA 4FFVA 4M0FA 3USCS 3AL0C 2FEPA 1N2JA 1LD3A 1WCWA 1Z4NA 5DO9A 2HV9A 2IYYA 4L5IA 1ZJJA 2BFCA 2UXBB 3QUCA 3SMVA 3WYNA 1QGAA 3AVUA 5JD3A 1FNCA 3TQRA 4X1KB 3A4LA 1U3UA 4DCUA 2LE0A 2DC1A 3R5TA 1XTSA 5EE9A 2R8EA 3VOBA 3KQKA 1O94D 3MT7A 2CVPA 3DLHA 1UMBA 1G8MA 3Q40A 3FA2A 4GBJA 1QF7A 2XWPA 3KFVA 3Q9NA 3Q7SA 2NSJA 1RE1A 5J2TB 4RIEA 4MWEA 4ZT4A 2BTOA 2EBUA 1XIVA 3OLYA 2JI7A 2VF8A 1YVDA 2XTNA 5DM2A 5ILGA 2QVLA 4DR3B 4JXJA 2Q2WA 1ZP6A 1AUOA 1FW6A 1QLHA 2A8YA 3DV0A 4P7BA 1ECLA 1VM6A 4XIGS 3T7CA 1JLRA 2OCPA 4AXBA 4HDKB 2N3ZA 4DZZA 1TM7E 2BHLA 2NN3C 2PRKA 5CIYA 2RE8A 4F3TA 3PNLA 1HNZB 3PGA1 3TO5A 4FX2A 4IQ4A 4P86A 1Q17A 3ECAA 4MUIA 5H4HA 1KAMA 4BV9A 4CQMD 4CV0A 2XTMA 1W7AA 3IXLA 2FN8A 3P45A 1L1FA 5AW2A 2G3YA 3HGMA 1EXVA 4MUNA 1J21A 2FWRA 2PLFA 3LRPA 1HDGO 1TK2A 2RJOA 5IUKC 3AHFA 2PMBA 3FZGA 4DA7A 4OEHA 1MBZA 6NULA 2C8KA 3PKJA 3SJ7A 1UBUS 3DKIA 1AN9A 2V1XA 5LIRA 3AVYA 4KE8A 7REQA 3VR3D 4CG1A 2QLMA 5GONF 2R47A 4PYKA 2GX6A 4RXUA 4MR8A 4KYUA 2AK3A 2FX3A 4CBVA 1JMVA 3L8CA 3UZUA 1BRMA 1V8ZA 2YWEA 5AK4A 4EARA 2PUFA 1FPMA 1GG5A 3KAKA 4G4GA 2QIOA 3MAJA 5JMWA 3FAKA 3AB7A 2ZXEA 3KB2A 4EB8A 3NTRA 4OGKA 3MTIA 5AICA 4LJAA 1IFXA 1GQYA 2CVHA 3O3CA 1K9VF 1NULA 1BX0A 1UZUA 1XQ1A 1YACA 4R1TA 5TY0A 1XKQA 2YHBA 4XQEA 2XTAA 5K20A 1E2PA 2W8BA 1E1KA 2MWMA 3L1JA 4U63A 3EBPA 3WMEA 4ESHA 2GPSA 4QXRA 3KYDA 3MRXA 1OE0A 1T35A 2HQBA 2YHUA 4JLBA 3UWKA 4YRPA 3M6MD 3G9UA 1PL6A 5JSKA 5AVQA 4II7A 3RVNA 3PX7A 3QELA 3T3OA 1KIAA 5IBPA 3Q7EA 4ZHQB 5B4UA 2IBTA 4MQBA 4QGFA 4KBGA 4YPVA 4Z0TA 1IUOA 4FMBB 5KHLB 2Z6UA 2A9JA 4HZGA 4AN0A 3L6EA 5B30A 3L0IB 2CF5A 2FKNA 4MVJF 5JQWA 4ZT6A 2PJUA 3U3OA 2DECA 1SCNE 2FX2A 2GBPA 2XYHA 4XUGB 1CUAA 1GFWA 3VU3A 2CNLA 1O0SA 3A7EA 4UC0A 3ZWXA 2W8BB 4OPMA 3K5HA 1UT8A 1E9BA 3PDIB 1AOXA 3TZLA 3GRZA 2BGLA 4MVJG 1H5UA 2H2GA 4MUYA 5BP7A 3I39X 5LNK6 1XL1A 1E92A 2J7KA 1E3TA 2O2EA 3MIIA 3S1AA 1GTL1 1KJNA 1D03A 1XHFA 3JR7A 4KIJA 1J8VA 2O57A 4YCAA 1L5MA 3R75A 2QROA 1X15A 1XL0A 1TUIA 4XIFA 3OTHA 4G4JA 4L9SA 1AB6A 2L82A 3S2UA 4BLQA 1DKPA 4DCSA 5LL6P 3OX4A 3CR3C 2QVGA 1K63A 4JU9A 3ZOZA 4PAGA 1DUVG 2FUG1 3IP6A 3VZCA 5IASA 4KR7A 2H1LA 3A37A 4Z9YA 4GLJA 2NAFA 4TMXA 2QM7A 2JI8A 3Q2OA 4PY2A 3WHPA 221PA 3RWMB 3TBHA 5H80A 4H1HA 3UGQA 4PM4A 4UCQA 5FOSA 4WXPA 4B3HA 3U7IA 4AS1A 4URHA 4R7ZA 4XPZA 3DBRB 1U2DA 2HC9A 2ZQYA 1BWPA 3FAZA 4B7CA 2B4KA 2HA4A 2XXBA 5A0FA 3VPSA 2GO7A 4X84A 1RZRD 1XRJA 3OQMA 1L4YA 1TM2A 1F06A 3ZDEA 3OT4A 3RJMA 4QDOA 5ALNA 4WZZA 2JLXA 3GAZA 4HDRB 2PJZA 1OY1A 1RWOA 4DLTA 3G0CA 4I2VA 3BMOB 5IULC 1MHTA 1RQXA 1OHHD 3TDKA 1R3DA 2VPYA 3B6MA 4Z4CA 3SLKA 3JYNA 2GEJA 3K9LA 3TGWA 5LLSA 2GPNA 2QRGA 3K3PA 3SR0A 1EUYA 1CY0A 5KYGA 1L5FA 2N47A 1YJBA 2R97A 1FFXA 1DKRA 1QAQA 3PKZA 2P6OA 5DGCA 3PF9A 3S28A 4EQ6A 1EVJA 1YK1A 1Q91A 2XYRA 4L0MA 4N18A 4L7VA 4KUGA 1ULAA 4AP6A 4B6SA 5IT4A 1UBKS 1ZI6A 2F1KA 1JR3A 2WIGA 3C3AA 4R84A 1EAMA 2PWZA 3PR2B 3NDIA 2QUBA 3TTSA 3FSGD 2C1ZA 5KTYA 3BHJA 1QUEA 2WW8A 4Y1EA 5TXGA 2PGNA 1FRVA 3QXJA 2UUAB 1SCQA 3H3FA 2K4MA 1T3HA 1I5EA 1SG0A 1ITZA 1BS2A 1DTWA 1PVVA 2G25A 2NVWA 2PEYA 2I0FA 2Q5JA 3NRBA 4NABA 3W6NA 5SZHB 1UM9A 2ENUA 4FLMA 4ZRMA 2HPAA 1UJ4A 2CLLB 3PNBA 1WHSB 4JYPA 1WY5A 4G8BA 4P53A 5FV7A 5B7PA 1FFXB 1YS7A 1ZXBA 1YA6A 1MJGM 4MJLA 1B93A 1NBMD 3EXIB 4EHAA 1F7VA 3JYHA 4J4HA 621PA 2JKVA 4OGGA 1KU0A 3NQ41 1K88A 5FUBA 4EG5A 3B3QA 1NV8A 4CTNA 3A36A 3UPDA 3K1ZA 5LR6A 2JFNA 4IGKA 3F2VA 3NIDB 3R9KA 4D6PA 3WXBA 4CR6A 3C5HA 2AFIE 3EF1A 4HAUA 2JVIA 3TD6A 4Q4HB 1EYZA 3CZAA 4Q37A 4BGIA 1APBA 1T6XA 4R3WA 4WADA 1WXWA 1X2BA 4JBNA 4J03A 3AGQA 5ULLA 1NR5A 1NVFA 3CKLA 3U40A 3CT6A 4RTNA 4B3FX 3WMGA 4W5RA 2HPHA 3WQRA 5BSKA 3VO9A 4DNFA 1UZLA 4V24A 1QZTA 1Z07A 2DT5A 3NRJA 3PHGA 3UJ9A 4CT5A 2CLIB 2I55A 3HYTA 1N7IA 1ZAYA 1Z0FA 3H75A 1DC8A 3OP4A 3VZSA 5EJ7A 2PLWA 5JZMA 4JA2A 3GLQA 2F9FA 2FPIA 4PZUA 1YZLA 3MYRA 4I9GA 5L6MB 2VJPA 2YN4A 2ANBA 2OM2A 4TKZA 1U1EA 4IJUA 5AJTA 1G18A 5M3BA 5IRCD 1A69A 2YYZA 3BF8A 1TVMA 4RIGA 5K0BA 4WZBA 4G25A 4YJFB 5U9CA 3JRWA 3IESA 1UXGA 3OIYA 1ESNA 2JCGA 4IDGA 5DF1A 1E6LA 4C6HA 1E79D 1RCFA 3K6JA 3G1WA 3DEZA 2D5LA 5JCOA 3KKOA 1Q19A 1TT5B 2BSAA 3JQQA 4G86A 2HKIA 4MCHA 1YB5A 5EHGA 1IB6A 1DO8A 2HGZA 2VHCA 2H1FA 3QIAA 1YTLA 3CLUC 3L8ZA 3KCQA 4IM7A 2XKJE 3GHYA 4P92A 1DEAA 1SWVA 2CHEA 5FLYA 1SOVA 2RBGA 4Q00A 4MGKR 3IEIA 4B17A 4UEKA 2QZJA 3CE9A 4RMIA 4MKZA 5LN1A 3ABRB 1NQUA 4MKXA 4OVKA 3USZA 4A10A 5AIBA 3WMXA 3NJ8A 3HXKA 1WW2A 2H5IA 2G8NA 3FJYA 1CJCA 4QU9A 1GG8A 4KKXB 4EYEA 3Q15C 1K8YB 3A1VA 3AHCA 4ZJUA 2QGFA 4FZJA 3VKGA 1ZSVA 1ZXXA 2GYYA 1JQEA 4DEVA 4RL6A 3FOWA 3FTDA 4H3KB 1VIAA 2HIHA 3B12A 4P3OA 3SM9A 2IY8A 4MQFA 3ZJVA 3MD9A 3ESBA 4YO8A 1TM4E 3IVCA 3TTTA 1B2RA 4O8ZA 5E9AA 5ELLA 2AGVA 3RK4A 1S2OA 1HT0A 3R24A 3FPEA 3F7TA 1KMHB 1LNQA 5J5AA 5EWLA 3ZWYA 1G5IA 4PO1A 1N2ZA 3HRKA 5JARA 5FL3A 4H0FA 3C6MA 2H57A 4IZHA 3RAJA 3T7IA 2JFGA 1OAAA 5KQPA 4KO2S 4AZWA 4LJ6A 5HIAA 7MDHA 1Y1RA 3CWZA 2IZ6A 3BCHA 2QL7A 3IERA 3DOJA 3UCXA 2IS4A 1TTHA 2TMDA 1ZL2A 1YKFA 3EYAA 1TEXA 1NJ8A 3L1IA 1N2CB 5EEGA 1RS0A 3BH6A 1VMDA 2BKEA 5AUPB 5CAEA 5I7FA 4YY3B 3FKSA 3SHTA 5F23A 3UMVA 4FKMA 3RUEA 1LKZA 2JGAA 3C43A 2VS1A 2CHUA 3NBAA 4YCMA 1X0XA 5BN3B 1WA5A 4OP2A 2WOJA 4PYQA 3EIHA 3M34A 3QA3E 1UDRA 4GM1A 4O0LA 3WGTA 4F12A 1RWVA 5EWLB 2Q5HA 4OOEA 5GPBA 4D9IA 1EIWA 1SH7A 1CZHA 2PGLA 4HB4A 4EO4A 3MGAA 4KZPA 4I3HA 2OB1A 4LXIA 2Z30A 1P91A 3CUYA 2YUIA 2A78A 2ZIAA 1N78A 1JHUA 3IVMA 3ZCVA 1MNQA 4AI6A 3ZNPA 1FUKA 4PXSA 1DOZA 3G0IA 3X1DA 2YKGA 1O77A 2E21A 2PPVA 3D0KA 4HEA6 1ENPA 4Y1RB 3SQDA 2HYIC 1FTQA 3GU3A 1U1FA 2YOGA 5IVKA 3R0ZA 1C81A 5CG2A 5D1HA 5HIJA 1EWTA 4RK6A 3UA3A 4GL2A 1ZD4A 2VBCA 3LNCA 1M0WA 3NM5A 4DHEA 4Q3OA 4LDPA 5LOVB 3PC8C 4P0TA 5ALWA 1L5OA 4C88A 4WK6A 1TZ2A 2EL7A 5A0TA 4C2BA 1W0JD 5A1TA 1P2SA 3IHLA 4FPXA 5M04A 1EFPA 3ABIA 1W73A 3SS9X 2AZMA 1G6HA 4J1TC 2PKEA 2X8BA 3K8OE 1EP3B 3QJYA 4G5OA 1DQPA 4YONB 3SS7X 3PNKA 2R7AA 4D41A 2FSUA 3K1TA 5BMVB 1Y9AA 3KKKA 1YUBA 2C77A 3A32A 3AEXA 3H8JA 3K6KA 3QXSA 4JLSA 4RZXA 3T1QA 3VO8A 4CKCA 1R10A 3KZNA 4RFLA 4MVCA 2B8TA 5L7WA 2XVAA 3OQIB 3RTEA 2G1UA 3OPYI 1U2EA 1JAYA 2Q2OA 2Q6LA 3F6PA 2TSYB 3BBPA 3RJ9A 3VPHA 4CM4B 1Z6QA 3EWAA 2D2FA 4PO3X 3EPHA 2GS9A 2O8EA 4DM4A 2FZ4A 2K87A 2QMUA 4NKRA 4I1OA 3N2LA 4HDMB 4FDLA 4YQYA 2ERYA 3R44A 3OBIA 3ACCA 1E2JA 3PGKA 3Q7TA 1MGOA 2D0PB 1LV7A 2J9RA 5HQ3A 2BMWA 3LM8A 1D6NA 3OKCA 3MB8A 4HYEA 3STYA 1H5NA 4FYXA 4MP3A 1YC5A 2VPXA 1R50A 4UJ3A 2XYQA 1GQQA 1V0JA 2YFHA 2ZTUA 3EGVA 4M99A 5EWJB 2GA9A 1NE7A 3D1LA 4NAVA 2UUPA 1C7ZA 4W99A 1MOQA 3G6KA 3S3TA 4AG5A 1NWHA 4DG9A 1DT5A 1F2TB 3H7AA 4XSGA 2E6KA 1BVYF 2MYUA 3RYTC 4CKCB 1CP3A 1TAUA 3C3KA 4MA0A 2Q7OE 5BO5A 1QM5A 2ERXA 1CDZA 4RCVA 1NUUA 1ETUA 5ICSA 2ZRLA 2YV4A 2X14A 2CNBA 3BWMA 4X8OA 2F6RA 3F96A 4FFOA 1NUHA 2ZI4A 1BDIA 3UV6A 2QAJA 1DJQA 1IQPA 1ZCBA 2I8CA 1I4WA 4YIKA 4IDPA 3D8NA 2A92A 4DRXA 3PWZA 1N6IA 3IHWA 3IQWA 4L4XA 2NLOA 2JS7A 2MTBA 2Z56A 4B81A 5DI3B 2PZBA 1PFWA 2C2MA 3FTNA 5BNWA 1PL7A 1KQFA 5LYYA 4NU0A 1ZK3A 4N8DA 1JU9A 1YQEA 2VH2A 4FMDF 5EFOA 4G5HA 2XXJA 4DEYA 1JVBA 3WC4A 4YMGA 4Q02A 5EI5A 1OI2A 4DFDA 3C2QA 3AKZA 1EJ2A 3ICVA 1IM8A 2QAIA 3NAGA 4KXVA 1O8BA 1CUGA 3HO8A 4WCFA 1NW7A 3R7WA 1QQ6A 2A9KA 3ZKAA 5TMBA 1ZVVA 3A2KA 2AE2A 3NVDA 1DKLA 3ADOA 1VMEA 4D9JA 5D6NA 4K26A 4U1RA 3TB4A 3EIUA 2C2WA 4GBGA 4PC3A 4F56A 3WRYA 3CHYA 3I5XA 3EGOA 3ZI7A 2GM4A 1YL7A 3KZXA 4LMRA 3A1CA 2BM0A 2WDZA 4WZAA 1FDUA 3IAHA 5FYQA 2ZCVA 1RM3A 2AVNA 3Q6MA 4D3DA 4L8FA 3OZAA 4QGHA 3T7SA 4EM6A 4E6EA 1I6MA 3WL7A 4KAAA 1DV1A 2H0AA 2HFJA 5AOBA 3M4JA 3KL2A 1RPNA 3E9MA 3O6VA 1DLJA 1E5XA 5AR1A 2ECFA 1KY4A 1P9RA 3O4GA 4K3UA 1FMTA 1GYQA 3RB8A 5LQCA 1UFOA 1PG5A 5AW0A 4HFNA 3F1LA 3H9GA 3MTQA 4WCFB 4TS9A 3SKXA 2WWYA 3E5MA 1RXVA 1TO1E 4DV0B 3K0FB 5ALXA 3A1FA 3I2FA 1CB0A 2W4IA 3JQGA 3TOVA 4MPTA 2GFIA 4EP1A 2Z5LA 1KEVA 4GS5A 1QG4A 3MJFA 4WLVA 2AC2A 1N7JA 4PYJA 2VXOA 5J58A 3U4MA 3WMWA 1F5SA 1VFNA 2CZCA 1GZUA 3OWOA 4JMLA 1S3GA 2BM9A 2C96A 4GU5A 4WZAB 4PX5A 4ZEVA 1X1TA 2ZZMA 1YJAA 3KTDA 3PB3A 3F5QA 4TWAA 5JAOA 4CL0A 3EIFA 2YVLA 3ZJ5A 5LMZA 1N33B 1Q0ZA 2HU2A 3A6KA 3O9VA 4FWBA 4LHYA 1FU8A 2B8JA 2BDEA 2ZTVA 2H2WA 2NPIA 3RYHA 1E20A 2WWWA 4KRGA 4N54A 2F64A 3NASA 2ADFA 4JIMA 1BA2A 3BN3A 3DE0X 4GOKA 2AQIA 4H60A 1F8GA 3TBFA 3MBOA 3IAS6 4GPBA 2PL5A 1BJKA 3F7OA 1JXAA 1RJ9A 2QN1A 3ZK7A 3BKXA 1DBVO 1D0IA 4F5WA 3DLBA 4H77A 4RU1A 3SYTA 3B6JA 2PZ8A 3DMTC 4C4YA 3WGGA 1TZBA 2B69A 4E1AA 1WABA 1YNOA 2YHIB 3CNEA 3KQNA 4BMCA 5K4HA 4GZ5A 4TZ6A 4RGBA 2ZETA 2X0IA 3BB3A 3B70A 4IJKA 2EX0A 2R1TA 3DGEC 4JY7A 3PHHA 4C04A 1O54A 2HCRA 2W6IA 4JLOA 1SU8A 3BD8A 5MFZA 3C48A 1X9HA 3DWIA 5L3VA 1UUFA 1VC2A 2V7TA 4TYWA 3PXCX 2BZ0A 3LHFA 2AK2A 4LJSA 1YFJA 5IU6A 1BGXT 4RELA 1ZOPA 3IAM1 1S4QA 5CG1A 4PWZA 1G9SA 2A9FA 5EJFA 3LECA 1G5TA 1MQ8B 4NE2A 4DOMA 4JOSA 1RJ9B 2P2SA 2WD7B 3MG9A 2PGDA 1HYBA 1NF3A 2ZUUA 3QH4A 5B1DA 3F8TA 4X00A 3TW8A 3V8NA 3TLJA 3TXYA 2BFPA 2J1LA 2P2DA 5DHFA 2QDKA 3ZDRA 2P91A 4QXMA 3AEKB 4ED9A 1IBCA 4JXZA 2O3UA 5FUYA 4MOWA 3NV9A 4J2OA 2O8NA 1ZGGA 2R1TB 5L4SA 3GBVA 1G8KA 4C0WA 3QF4B 1HE5A 2FQWA 2JLUA 2M32A 4G01B 2C7GA 1TCBA 1XDGA 1ZNQO 3BB1A 3E1SA 1CTQA 1E63A 2GXUA 1TW2A 2PMEA 1DAGA 2ZULA 1B6TA 2ZJ1A 2AV6A 2HF7A 2D54A 4L4RA 4Z7NB 5ADVA 1O08A 3AI2A 2HDHA 1KQOA 2JH3A 4IMPA 4LX8A 4E3WA 4UE6A 4HWKA 4Q1DA 4C4XA 1RM5A 3K0AB 3NTOA 5D3MA 2J5RA 3K1AA 2IUFA 3L7NA 1H4VB 3UBTA 4HGPA 2CXPA 1X6VA 3IMFA 4JXKA 3SM3A 2JL1A 2VQ3A 1LU9A 3CUUA 5BSHA 1YAJA 4QFCA 4L5BA 4JGBA 4LF5B 3ZWKA 4TXNA 1YK0A 3CJRA 3IOYA 1LEHA 3PWSA 4FYVA 1L4LA 2MSKA 4FE4A 3W9BA 4QZVA 1MU0A 1A7UA 2QX4A 4BVAA 3SWWA 2I6XA 2OECA 1LVHA 4LRYA 4BE9A 1VA4A 3MAAC 3AR6A 4ND4A 5C5EA 3IP3A 1SZJG 4MYDA 4E70A 4KQXA 2ZK7A 2V9ZA 1KZ9A 2W6MA 1P8AA 5SYMA 1DCFA 1MRNA 3SFTA 5IZCC 1T4GA 4EA7A 1FRNA 1N9GA 2EAUA 5D3MB 2VUUA 3ANMA 4B2LA 4JCCA 1T9BA 4OUKX 5AHOA 4ARUA 1JR3E 1JT9A 4DJ5X 4K9OA 3RRZA 2QBYB 3OCXA 4N41A 3M0EA 3PNMA 2AMFA 2OFWA 1QGED 1XMOB 4JGIA 3UMSA 4J43A 1JTEA 4M6WA 3KOXA 1Y6GA 5CA1B 1G2PA 3NDJA 2EQAA 1A5BB 1OX4A 4WWHA 5ALPA 3H9EO 4HDQB 3MZ0A 4UJ5A 1IY0A 3BGSA 5DYYA 3UFXB 1EXDA 5COAA 1VLMA 2B7CA 2FPSA 4YRTA 1XNRB 3N53A 3NUZA 5K0LA 5GV7A 3DV9A 1ML4A 4IHAA 2WMNB 3QKIA 4IOMA 1QWSA 2B37A 4L9RA 3TMAA 3K73O 5DSZA 3BE5A 4J9VA 5TIIA 4BV8A 1Z36A 2DRIA 1FMFA 3C6XA 1D2CA 1N5IA 3AWDA 2B1RA 2C2OA 4HWOA 5EMKA 1BD4A 5AKLA 2Z1NA 1CYDA 1BMTA 5LU8A 5EN4A 3HKCB 5B1EA 4BNYA 1JLMA 4FEAA 3IBSA 2PS3A 1ECBA 3FTPA 2UYHA 5E1OA 3PQ7A 5MHTA 4DG5A 1G38A 2GPTA 3LK7A 1XI2A 1UWCA 3LCUA 1K5PA 5B2FA 5L4NA 1FXWA 1SVWA 3MW8A 3WYCA 3G68A 3KJZA 3EIEA 1YQ9A 4QT4A 3IQIX 5JCXA 1W36D 2ZWOA 4H2DA 1V1MA 1W2HA 3H99A 5DNEA 3FDFA 3U1BA 4YHHB 3GJZA 3ADKA 4FBMA 4REQA 3GDFA 2H6EA 2GAOA 3NH9A 1QTQA 4BLTA 1C80A 1GR1A 4F6LA 2Z2ZA 3ZJTA 2H5LA 3TOXA 1UMDA 3ZQUA 3UN1A 1Q7TA 1T24A 4CZ2A 2H2HA 1PKEA 1FXUA 4RDHA 3TLEA 5C1BA 1B0UA 1BCSB 1QO0A 1WXFA 2V7BA 1YD7A 2B61A 3SYRA 2H3HA 2FJPA 1HQCA 5J5VA 1QCDA 3SEFA 1L8XA 4G1UC 4LK3A 4AUMA 3ZDBA 4WZBE 1GV0A 4BEBA 1ZIDA 4PO9A 1VECA 4S1OA 3OZVA 1DWQA 3HCEA 3IBFA 2WWXA 5G4LA 4QX6A 3Q9LA 2ZUCA 1BQ4A 1GRCA 3PRYA 4JCOA 1GFIA 3NI2A 2MINB 2QP4A 1EZZA 2WWTA 4JAVC 2HI0A 4WBSA 1UMKA 3BE8A 3T8YA 1YRAA 3R5XA 3RVOA 1BHQ1 2F2TA 4J7CA 4C7VA 2WWGA 1TZMA 2NQTA 2WVAA 1W6RA 1JVNA 1N57A 2NYRA 2B99A 2B5OA 3BMQB 3EUEA 4WKOA 1SBCA 4OU5A 1UMDB 1RM4A 1I94B 4U3JA 3BIOA 3GF4A 5E1MA 3IA7A 2PXHA 2IEBA 4KVAA 2DFDA 5IHPA 2I67A 3A7DA 4OK6A 2WU3A 4MGEA 1KEKA 3QLTA 4L8YA 3AILA 2C5HA 1OX5A 3DE5X 1T6BY 3TPFA 5AK5A 1EDOA 4CU5A 1CZLA 2OZKA 5HK9A 1U0GA 2O2HA 3ORHA 4PG4A 4XE5A 1A7KA 2WIFA 4R6XA 3WKCA 2JJYA 4AICA 4C6TA 4OAQA 1PL8A 4QUKA 2B35A 3EZYA 4X7BA 4YRDA 3JY6A 3REFA 3INYA 4DDKA 3ROPA 1W5BA 2JD0A 2WA2A 1I4DD 3RHZA 1O94C 2JGNA 2JHPA 2VCYA 4LQLA 1U0BB 1MW9X 2WPDD 2Z3WA 3OFSA 3TLGB 1FSZA 1P4HA 4JHLA 3EEBA 4E4RA 3CKYA 3VYVA 4JJFA 1JECA 3NEJA 5JS1A 2ECKA 1S1CA 1DAHA 1GUYA 1UMCB 1JFTA 2J46A 2D6FA 3GXOA 3PU6A 1TW3A 5KNDD 3G0DA 4W8GA 2HR1A 4J2TA 4FFBB 3DEAA 1PK7A 3ONWA 4AIIA 4FFMA 5FXMA 1CUJA 1JAHA 1MJFA 2C4HA 2E82A 2I2BA 2P1RA 4ZEMA 2GCIA 5C18A 2WB2A 4MA5A 1J2JA 3QY0A 4KLNA 5C9ZA 4YYEA 3II6X 4EENA 1JEYA 4H3VA 1P0IA 5J9FA 2H2FA 4BVLA 1CIPA 5KKCA 2PEZA 2WRZA 1J22A 2Y93A 4UDNA 2FB9A 2WJWA 3ZQKA 4AF8A 3VDRA 4DA9A 3FCYA 4PZDA 2ZSFA 3H5LA 3V8PA 3PGLA 1YE3A 4LS3A 1U0FA 1HY3A 3O5AA 1J42A 3D2CA 4ZVPA 4BFTA 1GQSA 3FYUB 1N0VC 4H31A 3T9CA 4EOGA 3SBOA 5AW9A 1T4BA 1F8XA 1FK8A 5G4KB 2C7BA 1CQIB 1ODCA 2ZRGA 3GYBA 2DSTA 3C1AA 3BK2A 4TX1A 1TMOA 1L1RA 1YL5A 4LCBA 4AMUA 2YJ5A 2G1JA 2ZTHA 1JEYB 1I6LA 2I99A 4UTPA 2CWDA 4I46A 3TR5A 4R1SA 4KEAA 1DINA 3P96A 1B74A 4HPJB 4LYFA 4S04A 1FA9A 2ET6A 2X4DA 5JNUA 2YN0A 1WU7A 3EDCA 3LRXA 3PC6A 2BH9A 1TYDE 3KETA 3N0TA 2OZPA 3DG9A 3QNWA 1BYUA 2FWNA 1C0PA 1ZYUA 5CBPA 2ZYAA 5EJ8A 3ED1A 1VPWA 2Q3CA 3MK31 4UZFA 4FKZA 4J8PA 4G41A 3LVBA 4IIXA 4K5QA 4NG5A 4CCYB 3GN2A 3M2TA 3GPLA 4IIUA 4L2IA 1GYRA 4M3NA 5F1OA 2EU8A 2IXFA 4RJKA 1KMCA 1BO6A 4DTCA 2DXIA 4Z86A 5HJ7A 2QXYA 4BOYA 4IUCS 2PZLA 4YXWD 1J06A 2YRWA 4FHZA 1UBRS 1OXVA 2VF7A 2NXNA 4ZKEA 1FBNA 4MITA 2WICA 2R4QA 4Q6BA 3RUFA 2XNKA 5LZ2A 1NBHA 4DLKA 1Z35A 4GOLD 2ZYWX 5KPJA 4GLFA 1ZRNA 3UJ7A 1J2RA 4TMFA 1F2DA 4F84A 2Q29A 3LTEA 1NJSA 2AC7A 2WYVA 2EFEB 3HDYA 4RXTA 1NLUA 3DQQA 2Q49A 3OC6A 4FI3C 4IH9A 4D42A 5IDQA 3WBBA 4PYIA 4YJHB 2JCBA 3GNTA 5C5DA 4MYSA 3DEIA 4N3GA 1MX3A 1N7GA 1SUSA 2JGDB 2Q07A 3N2NA 1AKNA 5EYPB 4EECA 2Z6VA 1DEOA 4WECA 4X66B 1UFKA 3I73A 3THXB 2PV0A 2G0TA 1DBRA 1M73E 2XOKA 3HA2A 5JJBA 2BI4A 2I80A 1KZ7B 3G13A 3G85A 3OIGA 1B2LA 4DYHA 1XAIA 5JI2E 1CE8A 3NETA 4QJ5A 5BVHA 2OBNA 2Z8ZA 3AVOA 1ZDMA 1FLVA 4CLOB 4CM5A 3DPIA 4EFMA 5IT5A 2UXDB 2AMLA 1UC5B 2JZCA 2NT3A 2OXCA 2EG9A 4WKNA 3G8BA 2CNKA 4ND1A 4TT3D 4XYBA 5BWMA 3A4YA 1VZ2A 2PN1A 3SY8A 4TQUS 1PR2A 5FTNA 3WK5A 2GM5A 1M5UA 2IYFA 4CF6A 4F4FA 2FY8A 5IWAB 4A03A 5BORA 4UDOA 1DJLA 2YV3A 5CH8A 5A5DA 1XSEA 2O8VA 4D3XA 2QLLA 5GIPE 2AKAB 2XNDD 3TLXA 1P1RA 1JIXA 3PUJA 3KJGA 3PQ2A 1SUDA 2CXNA 4I81A 3KWJA 3KNZA 5FX2A 1HWYA 2GCNA 4OH7A 4WUVA 4OXQA 1F38A 4KN9S 3BXHA 3KJHA 4EA6A 4XD2A 3Q12A 3WNQA 1W47A 3ZCUA 2FRDA 4OXNA 3MTDA 2QLFA 1CFZA 1ODJA 1Y3DE 3MUNA 4JB2A 2R6JA 4UNSA 4F91B 1NU6A 4F96A 1NSYA 1OROA 4F86A 1YDHA 3RSFA 2VT2A 4LE2A 5IN4A 5CP8A 2NXJA 3WAKA 1FP4A 4HNVA 4HC4A 2FA9A 4WGFA 3EG9A 4K46A 1SIUA 1H05A 1M0TA 4ZQHA 1DNPA 1NWCA 1R27A 1CX9B 1K5GA 2DFNA 5EUBA 3CE6A 4BZQA 1P9OA 4D1YA 2R5FA 2ESRA 1KI1A 5T7BA 4FFSA 3IXMA 3MNFA 2PH3A 1ARZA 3A0UA 2XIJA 2ZTLA 3PUVA 1JWLA 1LI7A 1I4LD 1Y6RA 1ONBA 1L4UA 1DJPA 2G4LA 3DC7A 2J8ZA 2HNAA 4FN4A 1T5OA 4BGVA 3THWA 1B73A 1N0UA 2D0OB 2Q6OA 1X3SA 4AECA 4RZUA 1GPMA 3MCZA 4R2WA 1JF8A 2V6JA 3PEYA 2PH5A 3K1YA 3N2ZB 2JHCA 3COWA 2IZZA 1G5HA 3KJIA 5DX8A 5F21A 3ZLJA 1F17A 3BH0A 3ST7A 3KYCB 1U4OA 5LCXA 4WBNF 4FQ8A 2ZIXB 1O9BA 2AMVA 3ETHA 3DAPA 5E3IA 3ITDA 1XQXA 1DP4A 1XHEA 3A2LA 2C59A 3Q8LA 1QQBA 3WL5A 3ZHYA 1V16A 3OVMA 4R0MA 2XZTA 4YIHA 2WE7A 3NANA 3ZV5A 5KAPA 4MS1B 2VWQA 4KFTA 4ATNA 2IF0A 4EVQA 4GVXA 4IEIA 4NZNA 1SVSA 2HJWA 3RV3A 3I64A 4D02A 2DFVA 4IVRA 2ZE7A 4PX9A 4CTOA 4YUXA 4TLLB 4NESA 3VGJA 1KFJB 1N25A 2RK3A 3L0BA 2NO6A 2IXBA 2QYTA 2GAAA 3TLYA 3V1KA 3TTXA 4L3OA 4BFLA 4XWOA 3VNRA 4D8UA 3ICOA 4OQXA 5DN6D 1ABBA 2A84A 5LA6A 1VIYA 2F1RA 5GONA 2JB9A 2O6LA 3ZGZA 1LSSA 1YQGA 4TTVA 4WX2B 3FSRA 2GAJA 4NMXB 4ZP1A 5H3LA 2YVAA 3UTCA 1E1QD 1N9ZA 4MUGA 1A4UA 2F62A 1J8YF 1JDTA 4XLLA 4XVCA 4DV2B 2Y6UA 4I9FA 3TSZA 1KXZA 1V16B 1O96A 3P9ZA 3H2SA 4JR0A 4LVUA 4WIAA 2O2GA 2UXCB 2PX5A 3HLYA 1U3DA 4QOJA 1SHUX 3UUGA 2DULA 3BIJA 4P54A 2VOEA 4F4DA 1SELA 4M46A 4KQKA 1MJNA 4FWIB 3G2OA 4H7IA 4I99A 1IH8A 4GPEA 4TUYA 5IT9A 3V1MA 2XMZA 2I6TA 4CM3A 1R9MA 2NV6A 4M87A 3U4QA 5K0CA 2IXEA 2TRSB 3IIEA 1EUQA 3NT4A 5GONB 2AJBA 1UC4B 1U4SA 2JI9A 1A9ZA 1FEZA 1GAEO 2KI5A 1G66A 1LS6A 3BMNA 3QVSA 4G0PA 4BZXA 2YXBA 3SXPA 3U3JA 4Z4EA 2W71A 3QPAA 1HF3A 1T4DA 3HWX1 4RD2A 1Y3AA 4TRRA 3S6JA 5LKAA 4P4NA 5LQNA 1PFGA 3GP5A 1YCDA 2FHPA 4N7RA 3S55A 1T8UA 1XUOA 3L4KA 3RBXA 1O96B 3M4YA 3W06A 1SG9A 1PQ4A 4AKTA 1OLSB 5DTQA 2AFVA 2PIDA 4GYJA 1QE5A 2PUGA 2O7QA 1QFMA 1Y37A 1YR1A 2QMQA 1J2YA 4RA6B 4X41A 2NVUB 3IPXA 5HOEA 4C7OA 3RVDA 4N8EA 5A71A 3UCFA 5KVVA 3P9CA 4O4HA 3ZGOA 5IVHA 3E58A 3I2YX 2BCJQ 3H83A 5E1DA 5BPHA 3ENZA 2BUBA 2JFYA 3RVRA 4BB0A 3OZWA 5LP6F 3GLHE 2KM1A 1TJ3A 1OJ7A 3ROKA 3TSCA 4N76A 2Y4NA 4M36A 2X0FA 4EMSA 1WUTA 1A1SA 1AGXA 2XD4A 2XMSA 5AI5A 4CIAA 4QXAA 2E4YA 3VR5D 2AH5A 1U3FA 3NT5A 3NYQA 5ALLA 4EKYA 3BB4A 3OPYA 3BD9A 2Q8QA 3X3HA 5E1BA 4Z1MA 1NQVA 1QBKC 3EIXA 5B7NA 3GH1A 3GVIA 2G0AA 4A4DA 1E8DA 3KQWA 2VF4X 3QEJA 3OWHA 3R5FA 1JPJA 4OXIA 4C43A 4O4HB 4IUYA 3QBJA 3BE6A 2PIAA 3QKUA 4HWTA 1TMYA 4QOGA 3FLEA 4D0LB 3AB3A 1YCFA 1LPOA 2OCLA 2VSOA 3ZYCA 2FMXA 1CSEE 3AVTA 1E2LA 3CTPA 1XZEA 4GE0A 2SCUA 3AEQA 4S2EA 4XZ3A 4IXNA 2IZ5A 4J4TA 4OQPA 4Y6OA 5DLQC 3TL2A 3UAVA 4DR1B 4I1VA 4GI2A 4ISBA 5EIBC 2EKLA 3U3XA 1NBWB 1CUCA 1K7YA 2ZE6A 4PU0A 3UWDA 4NBLA 3UJCA 1NVUQ 3IMCA 4JUBA 3MBKA 2DOKA 2PTGA 4GDMA 1DV2A 3VI3B 1DIHA 1L7NA 1BHO1 3M6XA 2VTDA 4AQDA 4CMGA 2EZTA 3SBXA 3OZFA 4PZLA 4ALLA 1XCGB 2BR5A 2P4UA 4N65A 1NW3A 1FS4A 1QX4A 4WCDA 5CNIA 2EIXA 4N1AA 2N9UA 3PE4A 2Y05A 2A0UA 3CF0A 3AU9A 3OPVA 2B1IA 4OB8A 4AXXA 2RHDA 1SHLA 1GGFA 4GYKA 3W4KA 2WSSA 2SCUB 3D7SA 3EXAA 2AA3A 2OLEA 4MVJH 5AKXA 3R7BA 1VCOA 2Q6VA 3ZVRA 1YB2A 3TWOA 4J3NA 1WOMA 2QEQA 1YMUA 3BJEA 1QGZA 4RM3A 5KJEA 4BV3A 2JIZA 3DVRX 3W5CA 4RX1A 7YASA 1H6DA 3HBLA 5DHSA 3ZI0A 4MS4A 4LOAA 4V0QA 4ZJZA 1M6VB 1LSOA 2HL6A 4MLPA 1EVQA 3EVNA 4TWBA 3B1JA 1G17A 5AVKA 2YJ3A 4IGEA 4KLRA 2X5JO 3VXKA 3MOGA 3ISVA 4ENTA 2GH1A 1K7XB 1UANA 1U8AA 3N3AC 5FDFA 4BQFA 5INTA 4MA4A 2A9OA 1L8AA 3FD8A 4R69A 4ZANA 3SN6A 5JSZB 1LDMA 5KJCA 1KK1A 3CISA 2PS1A 4ZDJA 1SQSA 3LZDA 4D4IA 2YRXA 1GTSA 4E0BA 1YS4A 5A6SB 3N0RA 4BKMA 5LMCA 2AB0A 1K3FA 1POWA 2C4TA 4IBOA 4UPEA 2MSWA 4RO0A 2O3JA 2CLMB 1LBIA 3DPUA 4CU2A 4C87A 1P7VA 5I48A 1ODSA 2JCXA 1OWLA 3BHIA 4XFKA 1VYUA 1A72A 1GPYA 2XCOA 3VR6A 2BTQB 3CH5A 3TMKA 1ZRHA 3GGJA 3K2BA 2C04A 1EG7A 1G21A 1LFAA 5B3KA 4NYIR 5HKOA 1EESA 2GK4A 1KYWA 1WVIA 3RTGA 2UVPA 2J9FA 2X0KA 1H66A 4QG7A 3DO5A 4AY5A 1W5EA 2FEWB 4UQLA 1P31A 2IY7A 4FDVA 3ANTA 3QVJA 2GJAA 3KK0A 4US1R 1KQGA 1SBYA 3QJ5A 2QL9A 3CKMA 1QDLB 3DP7A 3Q8WA 4NE9A 4Q9NA 3JD4A 5TPZA 2VK4A 3STWA 3TIIA 1AGYA 1LK7A 4L02A 4E13A 4FILA 1YVUA 2IXTA 4JI6B 1O5IA 4G4SO 3KD3A 3BFPA 4XRRA 1N0IA 1ZCJA 3D3KA 3UOAB 2DE0X 3ZR4B 4Z51A 5KB3A 1E4EB 2PZJA 2UYYA 4OY3A 3C74A 3AY3A 4LEIA 4D9BA 5JV5A 1LI4A 3TN7A 1GTRA 3WKDA 2C29D 2B98A 1H2FA 2PLRA 1E7MA 2DR2A 3KAJA 1HOXA 3RJTA 4B6QA 5DHTA 3WP0A 1H0HA 3BL6A 4JEIA 4F8EA 2GZAA 3EZFA 1I2ZA 2OHFA 4XGNA 1QIJA 2W6JD 1C30A 3IVRA 4HCJA 1E5VA 2QAGC 2PKQO 2QJFA 1AMUA 4D0RA 5DYGA 2A58A 1LVGA 2V65A 1R5NA 2M6RA 2XUJA 4WK0B 2CXSA 5CDSA 4D9NA 5REQB 2YJZA 2PDAA 1S7CA 2QIPA 1VHJA 5E6SA 3W8FA 2PL3A 2R8PA 4NU6A 4XM1A 4RTLA 4E08A 3RM3A 3FOCA 4ER6A 1GNRA 2OCDA 3FBGA 3U81A 3S8EA 3K09C 4JBGA 5AKYA 5JFTA 5HIKA 3O4JA 4G5XA 5G1NA 3WNBA 4G84A 1EIZA 3ZEAA 2Z6QA 5KQRA 3EXG2 1K8ZB 2EBWA 5EKDA 5CCBA 2YYYA 5E6RA 2CLHB 2WHQA 4Z53A 3TOSA 4DSAA 2H7YA 1AKEA 3D8SA 2PMFA 4LF9B 4QXQA 3V8QA 5C7YA 1E59A 3ASUA 3AESB 1RI1A 3LC2O 4I7EA 1XX6A 2EJBA 2FZWA 5KYXA 2AJCA 4INOA 5AW3A 5E6SB 1ZN8A 4X94A 2QMZA 4JI1B 1E1YA 1XKLA 2P2YA 4UE2A 1GEGA 2AEFA 3N5KA 4BUJA 2P40A 2BVNA 2FN7A 5CCEA 3PTAA 1QAOA 4ER0A 1PZGA 1E6WA 1LBSA 2IFTA 3QKRA 3AJ9A 1R00A 4I4CA 4CM9A 1C1XB 2QSYA 1DQSA 4H6PA 1D2GA 1UPXA 3IQHX 4MPJA 4X63A 3ZD8A 4TKVA 5GINE 2BMJA 4NYJQ 1UKCA 5E6RB 1UXOA 4P3KA 1CY6A 1JEEA 5F1YA 4FGZA 3Q3VA 4YJKA 3PJRA 3EIWA 3B6EA 2OGSA 4V1CI 4OI0A 1LW6E 1SCAA 4B4DA 1T9HA 4FQ5A 4GX5A 2J4DA 4KV7A 4QOFA 5TC4A 3IQXA 3N8IA 1AMOA 1MJHA 3UUWA 2E5WA 1AUPA 1VZ3A 3DUFB 1M75A 1Z08A 4IDEA 5JVDA 3REQA 4B43A 1AG9A 2UUCB 1EAYA 1US8B 4H59A 3JU3A 4KPUA 5LBIA 2CL0X 3TCXB 1OZGA 2HA5A 3FHLA 4A23A 1YRBA 3MMPA 3QE2A 2ZS9A 3PI7A 4RQTA 4ZAXA 1I30A 3UG7A 1I2DA 3I01M 1NVXQ 3Q3CA 5JAMA 1ZW1A 1VGQA 2ODTX 1O6GA 4HNSA 1VL1A 2QA5A 1KZGB 3LFTA 1G42A 1T8YA 5I4KA 3WP1B 1COZA 1HV8A 1A8IA 5A3RA 1JI3A 3KOOA 3PVSA 4B87A 2JGFA 2PD6A 3ET4A 4X90A 4Q21A 2ZBVA 2JLAA 5AM0A 1CVIA 3FDJA 2DCMA 1TD9A 3CEHA 1DPFA 1XZLA 1NMYA 1Z9BA 1QPBA 1BAPA 3M89A 1ORTA 1V6AA 2NXCA 3OCYA 4HFJA 4IJ6A 1UOPA 4EG6A 2ZTMA 3C3DA 3U7GA 3O3NB 1N1DA 1GM5A 2XEDA 1D9XA 2F1JA 3DWGA 4MMXB 4DW8A 4YNBA 3HNRA 2AZXA 1ODLA 3BREA 3CLRC 3DO6A 2QLJA 1I1NA 2ODQA 4ND8B 2O2DA 2BDTA 2W83A 2XYVA 3QUAA 4RQBA 1E89A 3T4UA 3JATB 4JJGA 4K2AA 3HY6A 2Z43A 3JYPA 5IN5A 9GPBA 4L0QA 2ZSJA 4K88A 3ZQ4A 4L76A 4N7MA 3EMVA 4HWPA 5K3DA 1HNWB 5AW6A 5FWXA 1QH1A 2E9SA 2B4RO 2EJTA 2VHZA 3F9RA 3QHAA 3I52A 4E32A 2Q9BA 5AVJA 3THYA 1TA9A 5E0OA 3SQWA 4DABA 2XWBF 3EODA 4W4TA 1VJTA 1QFSA 4X93A 1Z12A 1DG9A 2QTAA 4YAEA 2OXIA 3VJLA 1YUNA 2AG5A 5IYZF 2QX8A 1U8EA 2YVKA 3OU2A 3VNQA 1TUEA 4FUQA 4HAXA 1QX3A 3HKDB 3GT3A 3NKFA 1QBGA 2IPXA 2PFKA 3CPSA 1ZZEA 2DF8A 3E6AA 4L6AA 2R85A 3FUUA 1O0BA 4KO4S 5HIIA 5ER6A 1NJGA 2LRHA 4CN9A 1N3YA 2Q5IA 3PRJA 4NV3A 1REQB 1KMIY 1GO2A 2BHSA 1JG3A 1EK2A 1G9XA 3FVVA 4UM5A 3WJ2A 3HK2A 4RGQA 1DO2A 1U2RA 3KTFA 4R2HA 1BC5A 5FWXB 1U7OA 1E7SA 4ZVMA 1F0NA 4OI1A 3LP8A 4X6XA 3VYRB 3ZWAA 2ZRJA 3QOWA 3THYB 1QB7A 4MCIA 3WYEA 2YR0A 3LPNA 1PNVA 1P1IA 1JVSA 4KQCA 4I9NA 5JISA 2WJ6A 2J6CA 3OICA 4MKGA 1R74A 1S2NA 5JNLA 2O8FA 3PXBA 4TRNA 5HF5A 4X7RA 1MXFA 4N0DA 3HA3A 4OMDA 3AI7A 4BKRA 1XZQA 2BEUB 2W6PA 3QU9A 1X1QA 3TAHA 4KAFA 1AK1A 1BHSA 1CUSA 4INJA 1U9ZA 2HRRA 4WLNA 4Q1AA 4QNMA 3ZC3A 1QRRA 1SVOA 1FL9A 1VB3A 4D0NA 4J0QA 4WL0A 3KUDA 1RRPA 1OOEA 1SKUA 5LQMA 3C1TA 2GEKA 4Y9SA 5A7HA 3THOA 3RTBA 3Q0EA 3HR7A 4LSMA 4M7RA 4O4JF 1BN7A 2PWAA 3PNYA 2ZSUA 1RR6A 1TI7A 2LUOA 1FYEA 2V59A 3RYIB 1GZVA 1L7AA 2PVSA 2FMUA 1N5JA 3N0WA 2R1ZA 5I9TA 3IOMA 4Z4GA 1ZCFA 2I2AA 2NNWB 3D5EA 4CGYA 3N5CA 4ZAVA 2JFOA 2LWIA 1GPJA 1FQJA 1E18A 2W6ZA 3PFBA 4PZPA 3AUAA 3GIWA 3ZHVA 1ZK4A 1O87A 2Q3JA 3KQUA 2EZ4A 1K4YA 4LMAA 2VVTA 3PFFA 4MI6A 4XYMA 4D9MA 2AYXA 3KUCA 2XDWA 4PXAA 4OATA 1AHHA 4YUWA 3U5TA 4LY6A 3AYXB 3FWPA 1Q50A 2FSIA 2PAAA 4PO8A 4EY7A 1IXKA 3E9NA 4YCDA 5KJ6A 1DKQA 4R1PA 1K27A 3SZUA 3EGDA 2G17A 4HNHA 3ZZ0A 1CJTC 1WMAA 4LIPD 4UW9A 1FFCA 1W1IA 1L6IA 2OYSA 3D1VA 3KQSA 4HUQB 2HA0A 4MJ7A 2AL7A 1SULA 2QW1A 4EGAA 1SXJA 1UFRA 1P18A 2EYUA 1D4FA 4EJSC 1JFVA 5CB0A 5IANA 3ZVLA 1A9YA 1HLPA 3ZHBA 2SNIE 4FONA 2DT8A 2HPVA 2ZJ2A 4FFPA 3G49A 5G0WA 1SQ6A 4E2ZA 1O97C 1RZUA 1M8PA 1ZC4A 2E37A 1E1DA 3GMSA 4GRAA 4PICA 3VHQA 4P83A 1JYEA 1PVDA 1U9CA 5EESA 4IYRA 4D8WA 2XUFA 4TL8A 4YQZA 1V1JA 2EFJA 1TLFA 4I5IA 4K3VA 4MUEA 1UPFA 1L8QA 1KIFA 3GZNA 4UDYX 5KWVA 4XDYA 2QUHA 1Y5NA 1NN0A 3EGDB 1YZYA 1JKJA 1M6EX 2XIQA 2BGRA 3RK0A 4D3YA 3KZKA 2RCYA 3BJZA 1QIGA 2X9GA 3JQ8A 3OMLA 1WX1A 1Z7WA 3AVQA 1Z0AA 3H2KA 1HGXA 3OY7A 3FFTA 3QKTA 4PAQA 4I55F 4RVOA 3R7FA 4C4ZA 1V11B 2RKOA 3BK7A 1H5QA 2ZVDA 3GFBA 3RC9A 3DCJA 5BV2P 3KOZA 3PC8A 4AJHA 5CDFE 1XD9A 4HVLA 4DKXA 2ZYSA 1FYXA 4X6LA 4ZVNA 4DQVA 2IOYA 4EX7A 5F9HA 3PE6A 1X38A 1DS6A 5LUBA 5JQGF 4OREX 1YHYA 1B42A 1QB8A 3H2YA 1PDVA 1T8SA 2W6NA 2P0YA 1QJ4A 4B40A 4JXXA 3N2IA 1ZINA 4NE7A 1E77A 1VHLA 1T0BA 1OI4A 2FSHA 4Q16A 1ZNXA 3RF6A 3GZNB 2O50A 3KKQA 1M1YA 2GZHA 1QUFA 2VQDA 3HCWA 3R5KA 3K70B 3CUEF 5JXWA 5TLSA 4F72A 5TB5A 2C98A 2G9RA 2NYVA 2WKSA 1MEEA 4NJEA 5BRJA 2RMKA 4JV5B 3GUCA 5C4IA 3MTEA 2R6AA 5JOQA 1D4OA 1P77A 1FP1D 1S6YA 1O3YA 1QRDA 2CW5A 4RACA 4RSHA 4UBOA 4OHFA 1H9AA 4B0PA 4M9RA 3RC1A 5CGQB 1O1YA 4S1PA 4JFAA 1XLTC 4BP1A 1MKYA 3X1XA 1PEDA 1V8OA 4HYTA 3R77A 4L07A 3DZFA 4LISA 4R7GA 4CIDA 1KKUA 4IVNA 4J76A 4ETNA 1DL5A 3Q8MA 3M33A 2J4FA 3KLNA 3PQ5A 4HRAA 1ECGA 1MV5A 1ZR4A 5C3UA 4U7JA 2VO1A 3GGSA 5JNRA 1WMEA 1TUGA 1F14A 5B1HA 1FU4A 3BGDA 2GNOA 4MP6A 3HXTA 4OFXA 3FKQA 1URPA 3OQPA 4K9RA 4W9NC 1XELA 3LVFO 3EIQA 5HG0A 2MYPA 4NJEB 1YR7A 1L5HA 5M29A 4MMYB 4IDBA 1SCUB 1PUXA 4C4AA 4UM9B 1BCRB 4C14A 2PX6A 4JOBA 1PR0A 2W93A 2EQBA 2R1UA 2PX4A 1XD2A 1O9HA 5EUQB 4CGZA 2XCSB 4QM6A 4JELA 1VYVA 5EMNA 5K3OA 4GPZA 2NU7A 2V0CA 3RSGA 4UAUA 5I47A 5IF9A 1E9AA 3PKIA 4RV5A 2B7LA 2ZYVX 3QEMB 1BMDA 1D2NA 3KPUA 4QFBA 5T4BA 3A28A 3QI2A 5FBQB 2VJAA 2PXAA 3MINB 4NMWA 3GCDA 2P67A 3LKBA 4OK5A 4DMUB 1V1RA 1XCMA 3GRVA 1USKA 3T6KA 1VP3A 2G76A 2B4QA 2D7JA 4E5SA 3WX0A 4CT0A 3IKLA 1F0KA 1NKSA 4ANFA 3QHQA 2JIDA 2NO0A 3Q98A 1GEEA 4DS3A 5ALMA 3K31A 3ZE1B 1E6KA 1JQAA 2EDCA 2V6GA 3K1JA 4LYAA 4PFKA 4WT7A 2B5WA 3T38A 3UUEA 1XN4A 1WNFA 4E5MA 3A1UA 1SXQA 3P26A 5IKOA 4G4IA 4ZJYA 5KTNA 1E5LA 1WXDA 1SPBS 5KYYB 3RAGA 4NDAA 4BQIA 1KO7A 2C82A 5ES3A 2EGUA 4IKEA 1KWGA 1UAAA 3DD1A 3KZ1E 1L9KA 2WUEA 4R40A 1ZBQA 1J99A 1P60A 3QVKA 4JBLA 2IXGA 1DFHA 3EK2A 3L8EA 1G19A 4NC9A 4ZT7A 1DUSA 4IV8A 1PV1A 4HEJA 2J09A 3MMZA 2Z8YM 4JASB 4X3PA 4BB9A 1RXEA 1ZHOA 2GJSA 3OFNA 1K7CA 3DD5A 4H7DA 4HX2A 4RORA 4YRBA 3ELWA 3FUWA 3WHLA 3B3AA 4G1CA 2O20A 4E2FA 5J4HA 4CEHA 3EPRA 3UGTA 3EQ8A 3U3KA 4B6OA 1Q3TA 4WXMA 2VDLB 3N8NA 4ID3A 3ZWBA 1CU1A 2C8VA 1CY1A 1LDBA 2HUPA 3C5VA 3E27A 1NTRA 1FQOA 1N5OX 2Z1MA 3FHCB 4GR5A 3OH8A 3OLWA 4Q39A 4AJOA 2JK0A 4BNUA 4CKYA 1NUTA 6ABPA 2C31A 4LGCA 2CMDA 1EP1B 2W2KA 1EFDN 1NW5A 3IQZA 3SX2A 4BVEA 3ZHSA 1G21E 5CW2A 3S44A 2X5XA 1MVOA 5JRDS 1TIKA 3DXFA 4JSYA 2WQ6A 2VK8A 2WD8A 3FI9A 4PTLA 4CJXA 1KERA 1I3CA 1P0PA 4HG2A 3AF4A 3P2IA 5THXA 3K0KA 2PGAA 2XAAA 4D9HA 1USWA 1U8TA 1TEVA 3FB4A 3I0MA 4TXLA 5DBEX 1WMFA 4AZ0A 2ZYDA 3GH3A 2XBLA 4GKBA 3DMTA 1MFZA 2QR3A 3JASA 5K3CA 4OSEA 3I3OA 4UHKA 5CFMA 3WGIA 2Q1WA 2IEDA 3ZXYA 3DHEA 1EX9A 2IEZA 2PD3A 4EPXA 1TCUA 4TVSA 2W2KB 3RVPA 1Y8AA 1HFKA 1UBJS 1HFEL 1MQSA 1R5BA 2EX1A 3CWCA 1NXQA 1TA4A 3F97A 2HSJA 4ITVA 4OFWA 1TJNA 3U7QB 1A9XB 4IWYA 1GGNA 1ANKA 2BV3A 3PWTA 4EGQA 3HU1A 3ZWDA 1M8GA 4Y2YA 4C9BA 2Z98A 4YCNA 3AW8A 2C57A 4LNHA 4C76A 4F8YA 5AJHA 3WLAA 1KGSA 3ABSB 1U0JA 5I01A 3HXQA 5HNKA 5DNYB 2YCBA 3I4LA 2I78A 1TPYA 4JUDX 3PYMA 3G5MA 3KKPA 2SICE 4G5QA 4UATA 2I6GA 2NU9A 2W6OA 2M9MA 3VISA 1W52X 4XM2A 4ONEA 2DBQA 1J49A 2OORC 4EY5A 4ZK2A 3V4FA 1GTG1 2BHRA 1JPVA 3CF6R 2K6GA 2O2ZA 3FBTA 4HEHA 5B3JC 5TVKA 4DMCA 3ZLUA 4V2IA 3A4IA 4O25A 2ATIA 4UE3S 1XYGA 2BJWA 4RK7A 3MT8A 3ZUGA 4OGWA 1H3FA 4HYQA 3CS3A 4MVJI 4O4JB 3SQOA 2QQ5A 4MVJM 1I24A 1NX9A 1CRZA 1R7RA 2HWYA 3OUUA 3MGCA 4S1WA 2V7PA 2REQA 4GI1A 4ZAZA 1EFVA 4OLJA 5FJIA 4M9CA 3VKHA 4KIFA 4OQMA 4MO2A 5I9LA 4CMJA 1ULSA 3LX4A 4N39A 4ZGBA 4NNOA 4DA8A 1GY8A 2W22A 4RANA 3NTVA 3KSZO 2N1MA 4ZDWA 3BSSA 3MCAA 4WFJA 5FPYA 4GAEA 3D59A 4UMVA 5IM5A 2ZJ5A 3VZQA 4YT8A 4A8JC 1MPTA 4DMKA 4PZ9A 1WXHA 1KMMA 4Q7EA 3UOWA 3R9IA 3TCKA 2V7QD 2PSJA 3E8MA 121PA 2FKAA 3CRW1 3HLKA 3ANNA 3CZ4A 1NQXA 3A1NA 4P3PA 2M1ZA 5EIWA 4CIVA 3GUHA 3ER8A 3TLAA 1V5EA 5IZCA 4CXMA 1EKXA 1XMXA 2H4FA 5EKXA 1FTSA 1P75A 4NCHA 5JUWA 2BUCA 3ETEA 4K03A 5C1OA 4HNRA 1NR7A 2DP4E 4ZI3A 1H23A 2BI8A 2HF9A 4J07A 3QU5A 4C22A 3KG2A 4UNQA 4YRNA 5JIBA 3HSSA 1RQPA 3UNXA 2NM0A 2OL4A 2V6BA 3S27A 2CNWA 3EBLA 3J7TA 2QZPA 3Q2KA 1PAUA 2FUNB 4PS1A 1EXWA 1X39A 1B8NA 3ORSA 4YMIA 5IM4A 3PFNA 1GILA 1E2NA 2OC9A 2RSLA 3N2GA 1D0VA 3H2IA 3TD9A 2Q50A 1KR2A 4N5LA 4QBGB 2IW3A 4ZGWA 3E1GA 4KDRA 2ACWA 1IZZA 1DAEA 1I5OA 2BHTA 2DTDA 3MELA 3FGNA 4RPIA 3E7PA 4NFYA 5I5GA 3ZLTA 2XQFA 3ANSA 4CETA 3VU8A 4W7IA 4D6XA 2HWUA 1ISSA 2ASEA 1WWKA 2OV8A 2BH2A 1ADBA 4XGIA 2JC3A 2I4NA 3DE4X 4M9ZA 4KGDA 4MAAA 1GQOA 4F5DA 5LQKA 5JADA 4RK1A 1QGYA 3CN9A 3IAFA 1K7SN 4QULA 4WE3A 3HUDA 3TLKA 5BUQA 2G9NA 2GHTA 3N7AA 3HKBB 3I32A 3BDIA 1XCJA 3CVOA 4B76A 3N2GB 4NCNA 1CUWA 2XCQA 3L7KA 4RSMA 3JARA 2NX2A 4ZI7F 13PKA 1RKQA 2ZG6A 3H8SA 2RC5A 3C5EA 3JW8A 3S2FA 3LUKA 3DFFA 2BIFA 5DM0A 4EATA 3ML1A 1QG2A 1Y3IA 1RRGA 1RJWA 4FR0A 4JQOA 5KX5A 1GGVA 4MO9A 1BD3A 3NP9A 4Q5IA 4UEQA 4BEWA 1USIA 4NHEA 3UT0A 2K2WA 1V8BA 4UM8B 1Z88A 3CA8A 4CM7A 5EIOA 4FJ2A 4V0RA 3K5WA 3L01A 4YDHB 1J00A 1XZGA 1XOIA 4CL3A 1T2VA 2GK7A 1VCIA 3TEJA 3I9NA 4OHMA 4XWYA 1EA5A 1YZTA 4KQEA 3HCDA 4TSFA 1TYBE 2CDNA 2ACVA 1QNFA 2B82A 3JARB 3GT4A 2C7VA 4FIDA 1NQTA 1RADA 4Q3AA 5DP1A 4KVZA 3RG8A 3AVXA 1D2MA 2Y1XA 1PFVA 4Q4JA 2EOAA 3NHYA 5EJMA 1ORWA 1XBTA 2GSDA 1J0DA 3F6YA 3A1EA 3C5CA 4IH4A 2ZRBA 5IKMA 2C3OA 3KPWA 3VYSB 3D64A 1ACJA 5CFPA 3K9NA 3FKSD 3ILXA 4OI4A 1T2UA 1OLUA 3B13B 1X92A 2O54A 1LCIA 2ZIZA 1NFRA 5LYJF 1ZK1A 5FLKA 2IHZA 1JQBA 1F8UA 4EIWA 4KNYA 3A6JA 4M8KA 3VPAA 3ZWPA 4FHEA 1U3WA 1FFBA 1ULUA 2E4AA 4L0CA 5CB8A 1FZTA 4EELA 1EFHA 1YJCA 3PPYA 1JAIA 2IOFK 5E6UA 2IWHA 4FNOA 1CQXA 1UPCA 5WRFA 1E69A 3EX7C 2X6QA 3R4CA 1CQPA 4Q4JB 3WIBA 1ENOA 2PKXA 2FVYA 4FX5A 4KGZA 4N0EA 2R6HA 4HH3C 5CA0A 4BNHA 1XEWX 1OYOA 3GLUA 3VC2A 4W7SA 2Y1LA 3O0TA 1II8A 3G5TA 1O94A 1PU2A 3RVJA 3KUXA 4GHWA 1PUJA 4ZO4A 4A8TA 1PF7E 4AKHA 3HSYA 5FAKA 1GL7A 3P1JA 1E2QA 1Y5RA 1SBNE 2CCKA 3NBFA 4NCIA 4QUIA 3ZHTA 1OMOA 2QTZA 2PNJA 2C4NA 5F3WB 5DIZA 1KE2A 4YCJA 2AOXA 2Z4RA 1HEUA 2P2CA 3K2IA 4ACAA 1SCDA 2J5QA 2DQSA 4H7HA 4BQEA 3ENWA 4P80A 2VT6A 1JBEA 5JAHA 2D1SA 3L3BA 3T0FA 1Y9DA 1HTWA 3P0FA 3HYNA 4B4WA 1E2EA 2JVKA 1FVOA 2XBMA 4MHSA 3T3EA 4CQMA 1NLYA 1KZHA 2QNRA 4DCJA 1NVGA 3PE3A 1QH8B 1MABA 2F43A 4D9KA 4YMUA 5FB3A 3A9TA 3QTLA 1UFQA 1ADFA 3PQ4A 1GN9A 4FZRA 3HJHA 6LDHA 3UA4A 3FPGA 4EJ0A 1SXJE 3ZV3A 1VPVA 1IN7A 1D07A 4COKA 1Z7EA 1FIUA 3P27A 5HK8A 1YVEI 1UJNA 2BT4A 3E4DA 3M9WA 1VPLA 1KRWA 2QP9X 3TIVA 2XUAA 3TRJA 3VR3A 3T5MA 4JX8A 1WZIA 4IIYA 1WUKS 4B3GA 3WLRA 5FIUA 4LOLA 2ZUDA 3H1GA 4FE3A 3GGOA 4PPGA 4BX8A 3LQ2A 3ND8A 4EFNA 3Q3HA 1CHDA 5G0TA 3U31A 1I33A 3HR8A 1MABB 2HLDA 3LO5A 4AMGA 2FNAA 2Z9CA 3RDPA 1IHUA 1KO1A 1J25A 4O2BF 2B3DA 1W96A 1JDUA 4WBNB 4FXPA 4JC8A 5A3SA 3WJ1A 3L9XA 1D8AA 1CNMA 5IZ4A 5HMLA 1P2BA 2A6PA 3NOOA 1JI0A 3NTLA 1HDZA 2AQKA 3QVGA 2YC4C 3WFZA 4DBLC 4DDUA 5SZIA 1ADJA 2CCJA 1SQ5A 4OYHA 4ZC8A 1KMQA 5AM2A 2Q4RA 2H8GA 4N47A 1MTZA 1R0ZA 5A5VA 3HWRA 6AT1A 4WNYA 1S8AA 1ISFA 1VCMA 2H63A 2PBZA 2QSJA 4O63O 2VTVA 2E4VA 1M1YE 1EUCA 2GHIA 5DYWA 1BWRA 3GA0A 3G59A 4IG9A 4NQRA 1ZO8A 4HBGA 1OZ0A 4PYOA 3IEMA 1QLWA 3BFVA 4P4GA 1KSGA 3MTAA 3UB2A 1AF4A 1Z3IX 3V8BA 5BMOA 3IDFA 3TW4A 3Q72A 1ZM4A 1E62A 3AF1A 4KDEA 4M4SA 5JNWA 1UODA 3EGXA 3QVGB 3KYIB 4UVGA 3GDWA 3H5IA 2DR0A 1N2HA 1H2HA 2QRVA 1KYXA 1HLGA 3MPOA 1PS9A 1IB0A 1ZUNA 4BAZA 5CBKA 1A4IA 2V3VA 2P4SA 2WTNA 3GAMA 4FINA 3HCNA 4MR9A 2IUYA 4GM0A 3T7TA 1QR2A 4RPJA 5E4JA 2BEWA 1EUCB 4EFKA 4QDTA 3W4IA 1YGYA 2I7TA 3F6CA 2NZ8A 3LOUA 4DSTA 1D09A 3DE7X 1MGPA 3WB1A 4BNJA 5C8YF 4G89A 1N8TA 2XMDA 2O07A 4R5MA 1TPZA 5F78A 3WGHA 3D6TB 4CV2A 3TR0A 2FWAA 4PANA 3EGXB 2HA6A 2WAAA 5I4BA 2IE8A 2P9FA 1QGOA 5D7NA 2YY7A 3CUSA 5CVJA 3UMMA 1A77A 3PUXA 3ZDYB 5LFAA 4RKRA 3EXHB 1A5AB 3I9V6 3EZGA 2OG2A 1NYLA 5HBRA 2AXQA 2PCJA 3LG2A 1UIMA 2YWBA 4CIWA 4MW2A 4B9EA 5LP6B 3RBZA 2J3DA 3FWYA 3PD0A 4IV5A 4EG3A 2H48A 4G4SP 1CK4A 2IITA 1J0EA 5JYDA 3MLBA 4KHPB 1YCGA 5ALOA 4K7JA 4H16A 3SR3A 1SC3A 1Q0LA 3KB6A 1QSGA 2Y1FA 4WPGA 3ZY3A 5LZ9A 2R86A 5DI9A 1X42A 4D4HA 3OU6A 4EB3A 2YQ5A 3A6LA 4B3DA 1S1MA 4Y7CA 4URZR 3AFNA 4OA8A 4J29A 3WWYA 4ERNA 8AT1A 1ONSA 2CXQA 3LDHA 3ZXUB 1E6UA 2FPWA 2GARA 4EPVA 1P62B 3G9XA 3E0QA 1CUIA 4LNUB 4RTSA 5FQOA 2G4CA 4KITB 3RAEC 4PRYA 2HRQA 2GFHA 2LDBA 1J6UA 3K2EA 4ZQBA 3NG1A 1E61A 3ETDA 5CLIA 4ZO8A 3RU7A 4RCYA 4DARA 3GG9A 4HFRA 4YI5A 2GAFA 7ABPA 3O8BA 3KJXA 2V1UA 2XVZA 4QELA 5HE8A 2DQYA 5IC6A 4DDMA 5KTOA 3LRTA 4X71A 1P72A 2ATXA 2BDUA 5KSYA 1E2HA 2F9MA 5HUJA 4V2UA 3GLFB 5EKSA 3DONA 3T06B 2G7ZA 1ZSYA 1XALA 1NBMA 4DZRA 1EU1A 1UBLS 3LK6A 3RVKA 5HJEA 3F6RA 3LT2A 4JKIA 4LGMA 3GRYA 1ZH2A 5D51S 5J23A 4MLDA 1RM0A 3JAMA 3Q7PA 2RGBA 2ECOA 3IIJA 5L4LA 3IQFA 3ZCSA 5G0SA 4B31A 2AS0A 3IAAA 3TQCA 4D25A 1H65A 4GR4A 1C8KA 1CWUA 4J2HA 3QWAA 1NDQA 3MQ4A 3ZGYA 3FE2A 4WNIA 1HDRA 3A2NA 1DFIA 3AL2A 3LQQA 1XPJA 4QC2A 4JLPA 4Q7MB 1GSHA 1TYEB 1VMAA 3BZBA 3KT8A 3QG1A 5B37A 2FLVA 3H2HA 2AOVA 3KTAB 2OQIA 1OQAA 3OLVA 2AQHA 4QRDA 5DHAA 2IEAA 5EZQA 2LR0A 3CGWA 3TEMA 3HEBA 1Q21A 4INAA 4LY0A 1XZKA 2C7OA 2Y9MB 3FBWA 5J4KA 1OKKA 1W9HA 4KOAA 1P7WA 3BIWA 1S2IA 4DLVA 2VQ6A 2AWOA 4JT8A 1A8QA 1YQDA 3M49A 2JFUA 3CC8A 3C6KA 1XVIA 3GEHA 1JJFA 2Q1SA 1X14A 1C29B 4UHCA 5B53A 4A3SA 2PO7A 2V7WA 2QGZA 5FJJA 2AUNA 1QQ7A 1LBHA 1EFRA 2QMHA 2FMKA 3CNLA 3K0CA 3O3MB 1PNTA 3ZY4A 4CF4A 1MQAA 1KDVA 2NZVG 2ZVQX 4MNTA 1HE2A 3E8SA 4E3ZA 1E79A 3PXDA 4MARA 3ID6C 1BU5A 1RAHA 3WGLA 4MH0R 4TWZA 2IEYA 2O7SA 3IR7A 1OA0A 1BXZA 3ZBQA 3E70C 1RTTA 1XJ0A 3HFRA 4KVFA 4MPRA 4RS4A 3ZS8A 1UXKA 4BATA 3BPSA 4PGMA 3KWFA 1Z28A 2R6R1 4KXMA 1ILWA 3NXSA 4JN6B 2ZM6B 1RWMA 3LUAA 3M81A 4N3CA 5JG7A 2WQZA 3UOGA 2YZGA 5COBA 1SIOA 1KJIA 2X1HA 1KFKB 5JS8A 2VOJA 2BBOA 5CFRA 4R9UC 2L42A 2HMSA 3FPLA 3ISTA 1SFRA 4KUEA 4EKIA 4XQ9A 1W93A 9LDTA 1OFIA 3IQGX 1ABEA 3OJ0A 4FWTA 2RD2A 1DELA 4GZMA 4QYWA 2Y1DA 3C6QA 1GAQA 3PEWA 2P27A 4TYQA 1GL6A 5IWCA 2DU8A 1Q2XA 1N2GA 1SHJA 3W0LB 5BSVA 3VRHA 1ZNWA 3AL3A 5DGHA 1XK7A 1R0XA 1RNLA 5EJAA 3FPBA 1TJ4A 3K9GA 5TMDA 4ZN6A 1VJGA 2F48A 3BXXA 3GCWA 4OHUA 2A33A 2GN8A 3L07A 3EXEA 4DDTA 1SVKA 1YB1A 3U4GA 1NUSA 3H11B 3MWJA 4Y2TA 7MHTA 2YDYA 3DZDA 3NNSA 5JSFA 4PC1A 2C9ZA 3CCCA 4IF6A 1YRWA 2OV4A 2C20A 1E3WB 1F1JA 3ZQ6A 3U4HA 2GUWA 1TZKA 1GRQA 4P8RA 2XB9A 5AKEA 3QBDA 5TQ0A 1XXHA 1EP2B 1E9EA 1Y5IA 2WR8A 3GUZA 1KEUA 1O7JA 2P79A 2ZQZA 3AONB 3DNPA 3EH1A 3KLOA 2DQ4A 4KQIA 4RNDB 3TK1A 1NTOA 5FUMA 3QEBZ 1XJQA 1GADO 2JD1A 3EZLA 1JQDA 3K9WA 1CJUC 4KACA 3V55A 4F92B 2FJ0A 2EP5A 2PUWA 2VYND 4B6RA 5JAZA 5LQJA 2DAPA 4MVYA 3TG8A 2SECE 5TARA 4Q3BA 5LP6C 1E2BA 4LFCB 4BMOB 4Z3OA 1DC3A 4CMIA 1NVTA 2FE4A 3OPNA 4WAUA 4RFSA 1C7IA 4JI7B 1EB8A 3AHEA 3P8ZA 2QM8A 4I8DA 4U5QA 3MQ2A 3NGLA 4E1BA 3DE1X 1YZFA 1NIPA 1FTYA 4LZWA 1A9TA 1GZSA 3TRIA 4X44A 4GKJB 3BORA 2R6ZA 5BN5B 4W5NA 2ZJ3A 3BEOA 1WW8A 5BR7A 1PJCA 2DUNA 4Q7JB 5F3DA 2FR8C 3SEQA 1XU4A 1ZUIA 2J3EA 1UL1X 3DL2A 3CYFA 3HA7A 4PRKA 3S2IA 4I4LA 2VDJA 2G9QA 4PGGA 4TL9A 3ESRA 3PCRB 3U0BA 3GJQA 2X8AA 4G2NA 4A8HA 1T3LA 1LBTA 4LWQA 4X45A 1N3BA 1W0JA 1ZJYA 3OURA 2Z5FA 3OFVA 4FGKA 1CNEA 4OHRA 1O58A 5CVUA 1OYVA 3CUVA 3N0XA 4PLCA 5ALEA 4AU1A 4XI9A 5DIFA 5LDDC 4MLCA 4CCAA 3MFQA 3WGZA 1OIWA 2KHZA 1DEHA 2FWIA 4BO8A 3GA7A 3CIOA 4PZYA 3VR2A 2NUBA 4KU4A 1K7FB 3CB4A 4EO7A 1ZZGA 2JF0A 4JYZA 1EJ0A 3F5SA 3NOXA 4MRRA 4G97A 1Y4DE 4K9MA 3SHOA 3KR0A 1GA4A 1NZJA 4KTTE 2OA0A 3NTUA 4CDMA 2V03A 4E88A 2ZB3A 1QRTA 2UU9B 3I34X 1Y8ZA 1NP6A 3FGOA 4R31A 5A3JA 3QHPA 1FMCA 4XAQA 4YUVA 2AWNA 5BUZA 2B2CA 4GX2A 5IKEA 4GFDA 1DX6A 3EDQA 1NA5A 1OJLA 3OE1A 4IIFA 2M1XA 2CMKA 2OCKA 3HNOA 2RK6A 3G0GA 4BMNA 1X80A 2GF2A 1TNDA 4CMBA 5ILOA 2WM8A 2WSIA 1NQWA 4PIPA 2RB5A 4AWAA 5KDOA 5EJ2A 5JBQA 1USUA 4ARCA 2Q8PA 1NBIA 1U0HC 4KW7A 3F47A 2FFJA 4ZPJA 4KOEC 1IJEA 4DRYA 3TNFA 1OIXA 3S99A 2FPKA 2ZI7A 2QVCA 2A0KA 4PF1A 4HB2A 4P1ZA 1KU6A 2BKXA 2W6CX 3QRWA 5FL7A 2QUKA 3EWIA 5ITVA 1RFLA 1XRMA 1FDWA 3CUKA 1EEHA 4DQ0A 5MN6A 1LLUA 5KNCD 1WY7A 1JJ7A 1MRZA 1X7YA 3M3PA 4M38A 1QTIA 1SXIA 3LT4A 1OVMA 1Z26A 3IKJA 3RBAA 3INRA 4NI5A 1TAQA 3DQPA 2FZEA 3UW1A 3AR9A 1WXGA 1X80B 3FNGA 2I2FA 2W2XA 3IEPA 1HETA 3OCZA 2X19A 4L73A 4DCVA 2AHRA 5IYZB 1AO3A 2C84A 2JGJA 3AH8A 4PWYA 4G07A 1R0KA 5GM2A 3IHKA 2VHXA 3VI4B 3COJA 4MW1A 1UBFA 3FPJA 3UH0A 4DA0A 1X13A 4TZKA 2CLOB 3JZFA 3K30A 1HC7A 2R8RA 4EUEA 1I6KA 2DQKA 1NVKA 1YQXA 3DOHA 3KEMA 4L75A 3K09A 1RAIA 3KHTA 4HMPA 5A4JA 3F71A 1S89A 4RZ3A 3WLTA 1L4HA 5DGTA 2KLBA 1MNAA 4GMXA 4XA8A 1K6JA 1WL8A 2JH9A 2WMOB 3P9IA 4OXYA 4RWZA 5GWXA 3B89A 3RNLA 4RMNA 4YAUA 2WI8A 1UP7A 4GWLA 5BN4A 1XF9A 3H3JA 4GSKA 3BGIA 2R6GA 4UFPA 1GV1A 1N4AA 2BGMA 2L19A 2DPXA 3SVZA 3WYGA 4OI2A 5BURA 5ITWA 2CZGA 1FDOA 2JGRA 3GJ0A 2AF4C 1QZ3A 4Y18A 2OAQ1 4NMLA 3W3AH 3ZCXA 4B4UA 5HZKA 3QE9Y 3BTVA 2TS1A 2GRJA 2P9ZA 3E9EA 4O4LF 2NSDA 2PUVA 4PLVA 1DTEA 4KR2A 2GR9A 3JD1A 4LSZA 5AQEA 4FHDA 3ZCTA 2ZJAA 3GJXC 1I7NA 2X86A 3D4NA 3A6GA 2IUUA 2J5XA 1E99A 4K1XA