3QV2A

Structure analysis of entamoeba histolytica methyltransferase ehmeth
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
320
structure length
320
Chain Sequence
b'QKQVNVIEFFSGIGGLRSSYERSSININATFIPFDINEIANKIYSKNFKEEVQVKNLDSISIKQIESLNCNTWFMSPPCQPYNNSIMSKHKDINDPRAKSVLHLYRDILPYLINKPKHIFIENVPLFKESLVFKEIYNILIKNQYYIKDIICSPIDIGIPNSRTRYYVMARLTPFKNEIQLHQEKESMISNYLDNNVNESYSIPSDLILKKGMLFDIVGKDDKRTCCFTKSYTKIVEGTGSIYCPIEPHFIPVKKAEDLLNKNLRYFTPNEIKKIHGFSSNFTTQIDGLTDKQQYQCLGNSVSCFVIAQLMEYLFDDLKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-cytosine DNA methyltransferase
molecule tags Transferase
source organism Entamoeba histolytica
publication title Crystal Structure Analysis of Entamoeba histolytica Methyltransferase
rcsb
total genus 98
structure length 320
sequence length 320
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00145 DNA_methylase C-5 cytosine-specific DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qv2A01
3.90.120.10 Alpha Beta Alpha-Beta Complex DNA Methylase; Chain A, domain 2 DNA Methylase, subunit A, domain 2 3qv2A02
4KRGA 2OZVA 1EG2A 1UWVA 4LECA 4PINA 1X1DA 4RVHA 4PYJA 1AV6A 5P8WA 5FWAA 1OR8A 2V74B 3OFKA 3KR1A 4PYOA 8MHTA 9MHTA 1M6EX 2AN4A 2F8LA 2P35A 4GC5A 4RYLA 4QPPA 5K0GA 1H1DA 2O57A 2CWWA 2B2CA 4P7FA 4WXHA 5BW5A 3FPGA 3CC8A 5K8VA 5EVJA 4IV0A 3EGIA 5CUQA 2BZGA 4UOEA 2Z6QA 5GM2A 5KVAA 5FHQA 2NP6A 4E2YA 5FA5A 1EAMA 3GWZA 4KDCA 4X63A 3M33A 4EVIA 3E8SA 3TKYA 3TM4A 4EMSA 1RJFA 2P7IA 2QRVA 4PWYA 2XYVA 3G8BA 3PFHA 4FSXA 4AUKA 2Z6UA 1XDZA 5EKXA 5E9QA 5ICEA 1JG4A 4DA4A 5KQSA 3NJRA 1T43A 1XJ5A 4YUZA 3E05A 4QDJA 1QAOA 5ERGB 4AZTA 2HWKA 1ZGJA 2GLUA 5CCXA 3GNLA 2HNKA 3JWGA 2FCAA 2VZ9A 1QAMA 4E30A 2NXEA 4OQDA 4ER7A 2PWPA 4YUWA 3O31A 4E2ZA 3FTDA 1JG3A 3KR9A 3M4XA 1EJ0A 4XUDA 1SG9A 3DOUA 4QTUB 1O9HA 1X19A 3B3JA 5E8JA 1N7JA 1P91A 3CJQA 3A7DA 2YUIA 4RTPA 2G1PA 4QQNA 2ZWAA 3GCZA 3I64A 5K0JA 2P3QA 5DM2A 3FPEA 5EHGA 3ER8A 2K4MA 1RI3A 2ONZA 3EVDA 5DTQA 5E1BA 3DXZA 2NXNA 3BGIA 4FSDA 5FWDA 2VDVE 4CTJA 3RW9A 3TM5A 3FTCA 5GM1A 5K01A 3G89A 3P71T 4PYIA 5CVEA 3ME5A 1RJDA 3UJAA 1I1NA 3KKZA 4MQ4A 3T7RA 3TOSA 4M37A 3GIWA 2JHAA 3LGAA 5DSXA 5HIMA 3BKWA 3P9CA 5DM0A 1YFLA 1G8SA 1R74A 4PGHA 3LPMA 3SM3A 2YQZA 3UA4A 4F86A 1WXXA 1WS6A 3SGLA 4Y30A 1JTFA 1G6Q1 1XDUA 3TKAA 4PYQA 3GRRA 4GOLD 4ZTBA 1UIRA 5DLYA 4RTRA 3GRVA 3MB5A 4QVGA 1G8AA 1YZ3A 3GJYA 3A4TA 3FUWA 1KPIA 4PIMA 4X1OA 2JH9A 2E5WA 3O4FA 3LDFA 2AS0A 2WA1A 5DTRA 3SVZA 2ZBQA 3CCFA 3A7EA 1JTEA 1VE3A 3EGVA 2PX8A 1X1CA 1FP1D 3K0BA 3P97A 1NE2A 1SUSA 5F2OA 3EVFA 2AOUA 1AQJA 3UJDA 3MAGA 3PFGA 3I5UA 3TRKA 2IH2A 3HTXA 4RV9A 1BOOA 2ZIEA 3I58A 3DMHA 3KQOA 4R8SA 1Y8CA 5E1MA 5DRTA 3VYWA 1ZKDA 3C3YA 3AWIA 3F4KA 4AX8A 5LQKA 5LR6A 4HG2A 5ICCA 3BWBA 4RTLA 3THSA 5DPMA 2GAFA 2ZIGA 3PX2A 5DWQA 3TMAA 4DKJA 4V0QA 2B78A 1SUIA 3TR6A 2IP2A 5F2NA 4OA8A 2AOTA 4BLVA 5HILA 4C4AA 2C7RA 2ZZNA 2YXLA 2P41A 4MIKA 2O07A 1WXWA 1Q0SA 5DX8A 2B3TA 5EC8A 5D1HA 3EVGA 5EPEA 3FTFA 4PYKA 3G2PA 4E70A 5EQJB 2BR3A 3EVCA 3K6RA 1KP9A 5DT2A 2DULA 2P7HA 3BT7A 4PYNA 4DMGA 3AJDA 3GDHA 3KQVA 4CKBA 4E2XA 2PXXA 3GO4A 3LDGA 4DCGA 3EVAA 2OPBA 1L1EA 3KQMA 4OBXA 5HOQA 3LCUA 3DTNA 1IM8A 3JWHA 3CBGA 3GRYA 2PLWA 3BUSA 2YX1A 3BXOA 2PV0A 4ER3A 1XVAA 1AF7A 3DLIA 3KR2A 4RSRA 5FUBA 1NV8A 3IHTA 1SQGA 4R6XA 5BP7A 3SR4A 3SXJA 5GIPE 3DULA 4GOMD 2JHCA 3ANXA 1D2CA 1VPTA 1TW2A 4IV8A 3HA7A 3M6WA 4WVLA 1Z3CA 3FYCA 5CD1A 1YF3A 4PYMA 5EEGA 2G8NA 3HM2A 5E1OA 3PB3A 2AOUB 3OE5A 3UA3A 5K09A 2C7QA 4C05A 2BR4A 3NWBA 3HCDA 5FADA 2FRXA 3AY0A 4NECA 4RTKA 1YB2A 2P3OA 2XVAA 3CJRA 2PX5A 5LQUA 4HTFA 4MTLA 1JQEA 3HCBA 3UWPA 3A25A 2UYCA 2ZFUA 3KQWA 3Q7EA 4GQBA 4HH4A 2FK8A 3DH0A 5DSTA 3SMQA 2LD4A 1SVUA 2EX4A 4XUCA 5EKUA 3R9XB 1NT2A 3G5LA 5EG5A 3FUXA 4EKGA 3IEIA 3D2LA 5DX0A 5EMJA 5MHTA 2WK1A 3EVBA 4E32A 5C9ZA 2OKCA 4DQ0A 3BGVA 1M6YA 3HA3A 4CTKA 2AN5A 3HCEA 3R24A 4BP3A 3HNRA 3G2QA 3KPVA 2AVDA 3LBFA 4FR0A 1JQ3A 3DUWA 4JXJA 3OU7A 2GA9A 5EZQA 5FQOA 5GOZA 3U81A 3UJ8A 4GC9A 2BH2A 1R8YA 3VC1A 5BXYA 1I9GA 2B25A 3P9IA 5HIKA 4OX9Y 2NNWB 2P40A 2ZBRA 2ZLBA 3A26A 4BLUA 2CMGA 4A6EA 4QQKA 3OZTA 2H00A 1QAQA 2YVLA 3KQYA 1ZG3A 2PJDA 2OXTA 1EIZA 2UZ4A 3MCTA 5LQJA 1KPHA 3H2BA 3UZUA 4CXMA 5DTMA 2I62A 3KHKA 4HTFB 2Z6AA 5G02A 1JSXA 4EQZA 3LSTA 4U7PB 4KWCA 3BZBA 2XYRA 1INLA 3OZSA 2AOWA 3IYLW 2YR0A 3G7UA 4Y2HA 2AN3A 1L3IA 2PX2A 2A14A 4RTOA 4KW7A 2IGTA 2ZCJA 2O05A 5FULA 4GF5A 2ERCA 3B89A 2GPYA 3X0DA 3MCZA 3OU2A 5T67A 3SSNA 2IDKA 3NTVA 3R0QA 1X1AA 3AXTA 3P2KA 2ADMA 5DX1A 3SSOA 3FUUA 2JG3A 3FPFA 1AQIA 3DMFA 4R8RA 4XCXA 1MHTA 2JJQA 5DM4A 5FQNA 1Q0TA 3MHTA 4RVFA 2Y1WA 1HMYA 4LWOA 1QANA 3LECA 1XCJA 2JHPA 3P9KA 3P8ZA 3R6TA 4X41A 1XCLA 5C1IA 5GIOE 3ELUA 2QY6A 2R3SA 3T0IA 4C07A 3DR5A 4RTSA 1N2XA 2V7EA 2ZBPA 2ZULA 4GBED 4KIGA 2NP7A 2AVNA 3BKXA 2P1DA 3MQ2A 2OB2A 1IY9A 4PYLA 2UYHA 1VP9A 3NVKI 1ZHFA 3IV6A 4P7KA 4YV2A 4MHTA 3EGEA 1XTPA 3DXYA 5E9WA 1RI2A 2FPOA 2AOVA 2ONYA 5M5BA 3ERCA 3B3FA 1JG1A 1KPGA 3PS9A 1UFKA 2JH8A 2CL5A 3DXXA 4P7JA 3REOA 4AZWA 2ORED 4CKCA 5CCBA 3FUVA 5K0BA 2C7OA 5T64A 1G38A 3NWEA 3AXSA 4C08A 3LKDA 4HGZA 4BY9E 5EZSA 1NBIA 3JWJA 3V8VA 4KIFA 1I4WA 3P9NA 4YV0A 2KW5A 3QOXA 4X60A 2AZTA 3KPYA 3NMUF 5DRYA 4QTTB 5GWXA 5DXJA 1R00A 2HV9A 2VP3A 3GRZA 2OB1A 4RVGA 3PVCA 5BW4A 4HC4A 5KYGA 3LBYA 1VL5A 4R6WA 2PWYA 3FTEA 1VIDA 1ZGAA 4R05A 5FTWA 1JR4A 4DM3A 3M6VA 3UJ9A 4RTNA 2UYOA 2ZWVA 4ATNA 3FYDA 3OFJA 3A27A 3FRIA 2YXDA 1QZZA 2G70A 1FP2A 1O9GA 2VDWA 1P39A 3HEMA 3OPNA 4FZVA 4RX1A 5IKMA 1YFJA 5K0LA 3UBTA 4OQEA 4PCLA 3TQSA 5EGSA 3RIEA 3E7PA 3WSTA 4ER6A 3OU6A 5CM2Z 5CVVA 3PX3A 3HVJA 4DZRA 1F38A 3QV2A 3MTIA 5U4XA 2B9EA 2PVCA 3TFWA 4ER5A 5CVJA 2PSSA 3G5TA 3PTAA 2GB4A 2ESRA 4MWZA 3DLCA 3G2MA 4G56A 3G8AA 5EOVA 5EMMA 1QYRA 2YTZA 1KR5A 2DPMA 3KQSA 4HRAA 1R18A 10MHA 3OCJA 1RI5A 2OY0A 3GGDA 1NW7A 1NBHA 5EEHA 4RTQA 4RTJA 5CIYA 5DM1A 4EKIA 2AOTB 3NDIA 5FA8A 3BWCA 1KIAA 3KR0A 5K0NA 3NVMB 1F3LA 3I53A 4CKEA 2IBSA 2P8JA 2ZZMA 5GINE 4P7GA 5EMLA 2UYQA 4DF3A 3HCFA 2FHPA 5LQAA 4RVDA 1VBFA 1BC5A 1ZQ9A 3LDUA 4K6MA 1XXLA 5D1NA 5DXAA 1WZNA 5E2BA 3M6XA 1TPYA 3HCAA 2FK7A 5GP1A 3GRUA 4E33A 2G72A 1B42A 3SSMA 1KYZA 1SQFA 3EPPA 5K0FA 2HR1A 3B3GA 4A6DA 3LL7A 2IH4A 4HSGA 5LQRA 2EFJA 3HP7A 4E31A 1O54A 3PLAE 3GU3A 4C04A 2PBFA 4F84A 4ER0A 3KPUA 3MERA 4PCAA 1BHJA 3UJBA 3EEOA 2PY6A 2IH5A 1NV9A 4GOOD 3HVKA 2NXCA 2PXCA 3ELWA 3SX0A 2HTEA 5K0CA 1X1BA 2OBFA 3OE4A 2EG5A 1EQAA 4YMHA 2R6ZA 4X61A 4GUAA 5JR3A 3MGGA 1RJGA 2OO3A 3BWYA 3FUTA 1NW8A 5EIWA 2I9KA 5HEKA 5HIIA 1FJXA 1DL5A 3Q87B 1HNNA 2CKDA 3ID6C 4IWNA 3LCVB 3G88A 5E9JA 2QYOA 1N7IA 3EVEA 3G2OA 2G71A 2PKWA 4KDRA 2EJTA 1IXKA 2YXEA 3DMGA 4LWPA 5FHRA 4V0RA 4FP9A 5HFJA 2PX4A 2O06A 4FT4A 2Y1XA 1MJFA 1PJZA 2EJUA 3C6MA 3KQPA 4BP1A 5LQNA 4PONA 3C6KA 4YUYA 4AZSA 4DCMA 2Q41A 1TW3A 3M70A 2VS1A 2IFTA 3CJTA 4YUXA 1DUSA 3B7PA 3KQQA 3LCCA 3P2IA 1L3BA 2BM8A 3HVIA 4QPNA 2H1RA 1D2GA 3P2EA 1BKYA 3UJ7A 5ICGA 4CWAA 1M0EA 5HIJA 1G60A 1JQDA 4PNEA 2ZTHA 3KQTA 4H0NA 1RI4A 1EJ6A 1VLMA 2GS9A 4M36A 3RODA 2ZIFA 5IH3A 4EK9A 1DCTA 3BWMA 2NYUA 1XDSA 1JG2A 2XYQA 2BR5A 3T7TA 5LQCA 3I9FA 3KU1A 3V97A 5EHIA 2P3LA 5EIFA 4AZVA 1R8XA 3M6UA 3HA5A 4KVZA 4P58A 2I7CA 5E8RA 4L7VA 3FPJA 1V39A 1ORHA 3NW9A 2BM9A 3ELDA 2N47A 3MTEA 3QOWA 4BLWA 1VP3A 3TPZA 3R3HA 1RJEA 5ICFA 2WA2A 2XVMA 4O29A 4OA5A 4YMGA 2QRVB 1WG8A 3UJ6A 2AOXA 5KS2A 3PT9A 1L3CA 2ZW9A 4XUEA 3ELYA 1P1BA 3FZGA 5FCDA 5B1SA 1KHHA 4YUVA 5K03A 2HMYB 2CMHA 3O7WA 2O0LA 4M38A 3VSEA 3DP7A 1KXZA 1R6AA 4IKPA 5CVUA 5K05A 3TLJA 1U2ZA 2ZVJA 3HVHA 1NKVA 4U7TB 1KYWA 3LX6A 2FYTA 3GXOA 4FGZA 4GOND 5E2AA 1G55A 2PT6A 3C0KA 4Z2YA 1FPQA 4RTMA 4FS8A 1P1CA 5K0EA 5F2KA 5KQRA 3EMDA 3FPHA 2C7PA 2XBMA 4GEKA 4QDKA 3T7SA 4RWZA 4LG1A 2VDUE 2PGXA 2AR0A 2GH1A 4OBWA 4F85A 4YV1A 5LSAA 3CGGA 3EEYA 4HGYA 2H11A 3CKKA 3LHDA 4C03A 1NW6A 3B5IA 3OZRA 2I6GA 4M7RA 2IIPA 3NDJA 2ZZKA 3FRHA 5H02A 2ZSUA 3CVOA 3ORHA 2IBTA 4C06A 3S68A 1NW3A 2PXAA 2QM3A 2IPXA 2IDJA 3JWIA 1PRYA 4E2WA 1SKMA 1VQ1A 1D2HA 1L9KA 3L8DA 5T6BA 1ORIA 2PT9A 1NW5A 3EMBA 3UFBA 5HZMA 1YZHA 1JSZA 3THRA 1WY7A 1RI1A 3EVZA 3VC2A 5JUWA 4PIPA 3BGDA 4PGGA 3C3PA 1FBNA 2QE6A 3KPWA 2NXJA 3UJCA 3KPJA 3ER9A 3E23A 3HCCA 4B17A 4POOA 4FT2A 1YUBA 2OYRA 5CVDA 5E1DA 3LKZA 4QVKA 5C0OE 5EMKA 4ISCA 7MHTA
chains in the Genus database with same CATH superfamily
5HF8A 3U09A 2OZVA 3OETA 4DEXA 1YDGA 1XEFA 4DR6B 1PYOA 2JJ8A 4HZUA 5LLTA 2YH2A 1PT7A 1QIJA 3QEKA 3RVMA 4HO1X 1V11A 1NW4A 1YRWA 4RYLA 3RO7A 1YJ5A 5ESXA 4MI9A 3Q5EA 4YT4A 2CLHB 1AUVA 2AMLA 5ALHA 4PZAA 3T9AA 3AI7A 4ZFNA 1E3WA 3QXJA 4KPEC 3E0XA 2DR2A 4K9LA 1U8CB 1TXGA 3MS7A 3VHRA 2G5CA 2O0KA 1T3SA 3I6BA 4IWXA 1F6DA 3C3XA 1HR0B 2Q0SA 1NE7A 2Q99A 3SJUA 3M2TA 4RVUA 3UPUA 4B3RB 4WZ6A 3TKYA 3FTPA 4EMSA 4YALA 1RJFA 3E48A 4JQOA 5JW6A 4IS3A 1L4GA 2X19A 5AI9A 2VHEA 1JUDA 2OFPA 4RJTA 1RWKA 3E9CA 4WFQA 5DOZA 3RV4A 4AO6A 1Z0UA 2HA0A 4ZZ0A 4HEJA 5KNDD 1DAIA 3A4VA 2Z6UA 3BK7A 1ML3A 4CLOB 2Y4NA 5EIHA 1JG4A 3VR4D 2GYUA 4G86A 5TQ2B 3NLLA 5CNKA 5LLSA 2B94A 3I28A 1XJ5A 1N6HA 4ROTA 4UUQA 4AZTA 4FMDB 2QD1A 2WM9B 4N40A 1ZGJA 1ZFNA 1ZO8A 3WC4A 4GPZA 3KTDA 1FXUA 5B1DA 1ZXBA 1UBEA 4YO8A 1MP0A 1C0IA 1NJ8A 3I9KA 2A9PA 3RFFA 3WRXC 5KBYA 3AW8A 4Y2QA 2QIPA 5LYJF 3CF2A 1IUOA 4ZP1A 3RJ5A 1OI3A 2VSFA 1FSPA 1O0BA 4Z4HA 3LBNA 4XD7D 3VHXA 4NE9A 1S3FA 3IIEA 3FSJX 2J85A 3IUJA 5FBVB 4DM4A 3EZGA 1CY8A 3PHHA 4UBMA 4K9KA 4LFCB 1SVKA 2EAUA 3VRHA 2EXXA 1H94A 1YKFA 4UREA 1QYWA 1EGMB 2IXEA 2JGKA 4U5QA 3QEBZ 3B9RA 3CF0A 3FPBA 1CZHA 4IR7A 3KQLA 1O6GA 3QEOA 5ITZA 5BUSA 2JCVA 4CF5A 1CJMA 1QGDA 3TOSA 3V42A 5A1TA 2OBNA 4RORA 3QA3E 1VL0A 4U63A 5JQGB 1E6KA 1U4NA 2D1TA 3OEHA 5HE8A 3AZPA 3DW3X 3UTDA 5HX7A 2J3QA 1RPAA 1G8SA 1HV8A 3W8NA 1O57A 3UMRA 3EIQA 4EUSA 2P9QA 3EDQA 4EG1A 3LK7A 5C35A 3HR7A 1CR0A 4J0JA 1QUFA 1YB5A 2IHUA 1N7HA 4L02A 4RKWA 5BVHB 4JDPA 3ILXA 4PGAA 4COKA 1AHPA 1NG9A 3Q7QA 1JDNA 2C98A 3Q8WA 1PW5A 4QLOA 4XFJA 3OJEA 1UXKA 5U1PA 4X6XA 1KQOA 4NCNA 4I4LA 1AKQA 3L5KA 5AMXA 2AS0A 1BU8A 2BEKA 1U3FA 2I9PA 2F1KA 3F2IA 3HG7A 5JY1A 2F43A 5HGXA 4P80A 4W1SA 1KYVA 3K0BA 1M72A 1AGXA 1H4SA 2GYYA 3I4LA 3W9SA 3JYQA 2HD4A 3R5JA 4E5NA 1BOOA 4MMXB 2V54A 4D3YA 5KTRA 4Q9AA 4QAQA 4XYGA 5DRTA 1EFAA 2P6RA 4HRXA 4MS4A 1XTJA 2H65A 2OG2A 3PHIA 5KHOC 1GM5A 2W0SA 1KKUA 2ZUUA 3UAWA 2IU3A 1TJ4A 3BWBA 1J0EA 4RMIA 4RSHA 3EQ6A 5THKA 4IH9A 4D97A 2GAFA 3PX2A 3VZDA 2QZPA 1V3VA 3DBRB 4U7DA 2HCBA 4Y6LA 2WZBA 2AOTA 1N3BA 3BSSA 4KMSA 4Q9LA 2NO7A 4U7FA 1WXDA 2H1WA 4N3GA 3ONWA 4KXYA 4J75A 3SZLA 4BFXA 2LRHA 1QSGA 4NYJR 3E2PA 1DC3A 1JFRA 3T9DA 2IHKA 3B9BA 3BT7A 3K9LA 3OWOA 1KFJB 4TRRA 3BMOA 3S40A 5KJ6A 2G9NA 4ZYYA 2JLYA 3O0TA 1YBMA 2PXXA 1O9BA 4AY4A 3N5CA 1K6MA 2Q3LA 3AFHA 5HOQA 2OEPA 2P5SA 2LPMA 3EAQA 4C29A 1U7OA 3L7KA 2H17A 1NLZA 4LQ4A 1B2RA 1LK7A 1VMAA 1ZD9A 3CUWA 3FGZA 1AXRA 2C2XA 1N0VC 1L7DA 2QIOA 4W9RA 3WKDA 1EWTA 1ZK0A 4D6PA 4JJ6A 4EUKA 1LSOA 1PL6A 1T0IA 2JFNA 3M49A 4ITUA 1HYEA 1GTJ1 2RGXA 1UWLA 1SC6A 3GGOA 1ZMRA 3M6WA 1E2JA 1IPFA 1Y7IA 1Z8HA 5AVWA 4NBTA 5NLLA 3MSXA 5C4MA 3Q6NA 1ZAKA 4DCSA 1EQ2A 5FADA 3AY0A 3E9YA 1KY4A 3G59A 4CU5A 4HYQA 4WACA 3CJRA 1COZA 1NNUA 4B3XA 4GVLA 4URHA 5I4CA 1PGJA 3S8MA 3ESQA 4QPCA 3UWKA 3KQWA 1DJLA 4G63A 3BC1A 4HH4A 4B2LA 3SMQA 5I8PA 4X66B 4PX9A 1MH1A 4U2FA 3KUKA 3EFEA 2APJA 4HXYA 3D2LA 1KFEB 3UT0A 3GLUA 4FFNA 3B1WA 621PA 1WBBA 4ERNA 5AXAA 1BWRA 4JL5A 1G7CA 2QW8A 3GJ4A 3QG5A 4ZVRA 1AZTA 2X5JO 3SR0A 4WGGA 4HSEA 2DG2A 2GFQA 1HE2A 5AI8A 5AT1A 1C1DB 1O87A 3M34A 3HFRA 1JEYA 3HY4A 4ZTZB 1D2EA 3DZBA 2GD0A 3KKEA 4KLNA 3ZGLA 3TUJC 2FMTA 3P9IA 3RS4A 3D7MA 3C7KA 2GBPA 1G3UA 1Q16A 4YP1A 1RKUA 2JK0A 3BE6A 4KQFA 4BLUA 5K2OA 1E63A 1JIQA 5CPFA 4R3WA 1SY7A 3P1JA 3MIZA 2W2VA 2G9QA 2DCMA 4JL6A 1W25A 1PCXA 3OQ6A 4IGIA 4OHRA 4FYMA 4YXWA 2R8PA 2BFEA 3BCUA 3FCAA 3CCCA 2BP7A 1CK4A 4JFAA 3IBFA 2GN0A 3V80A 4B9EA 5I7EA 1YJ8A 2QTCA 4Q3NA 1JSXA 3VU3A 4EPRA 1EHIA 3IP8A 1RAHA 3PGXA 3QWFA 3KT0A 4KWCA 4G3XA 4TKVB 3R44A 1LSJA 5F2EA 3TNLA 3B9QA 4Y2HA 1G17A 3CUEF 1K88A 1L5GB 1P2UA 4DCVA 3V8NA 1KMQA 1Z28A 1AQUA 1TUBA 2DFTA 2WILA 3HUDA 3K96A 4PZPA 5KCMA 2KQUA 4I3HA 4CQNA 4CQJA 2VKTA 5BMVB 2IYLD 1WMBA 1P8AA 2EW2A 2IU6A 2W6CX 4LXIA 2LCFA 2EL9A 1KVRA 2YZ2A 1QYDA 1ECFA 3QEMB 4ZO7A 5T67A 3OTOB 3T3NA 1A5TA 1F8GA 1C4KA 1WW8A 4E1VA 2R8XA 3C7DB 4B8ZA 5JBQA 5CB6A 4RD1A 1LF5A 2AC7A 4N6GA 4RQBA 4H4CA 4EABA 1RMQA 4MVYA 1DQZA 2VXOA 4JOQA 3U26A 4DPLA 4YX9A 4JGIA 2EWVA 1IHXA 3H99A 5KC8A 1D4AA 5DNWA 4EEKA 2QY6A 1TC1A 2GFIA 4HDOB 2QPOA 4PO1A 4RHXA 3VTZA 1GFWA 2EJWA 2HPAA 1KVUA 3N70A 4MO9A 1GADO 2C04A 3EDYA 3YASA 1E2EA 4CM9D 3UBMA 4X64B 2EZ4A 5DT9A 2DWUA 3IP5A 3TN7A 1OLUA 2DSNA 4Z53A 1Y3IA 2RH8A 3D8TA 3I2JA 3QH4A 3AH8A 2OVBA 4IOMA 1LPNA 4ROSA 4S0ZA 5GZ6A 5JWOA 2YJ3A 5CGZA 4WN3A 2FI1A 3KUDA 2JANA 2Q1YA 3QELB 4JASB 4TN5A 4AJLA 4XWWA 4AZWA 4JNCA 2OSBA 5GVSA 3CE6A 4G0WA 3E7XA 5MDHA 3F96A 3NWEA 1KI6A 3NTQA 4P54A 3IODA 4I7EA 2Q5FA 4ZJZA 2D0OB 4AC9A 4AZ0A 5BRJA 2BZ0A 3P9NA 4ND2A 4MOWA 4NQZA 1CY2A 4DLPA 2JGFA 5A4IS 4DA7A 5EKDA 1NPYA 1QIEA 5EIAA 1GNPA 4PAOA 2PNFA 1CUSA 3RVSA 4Q15A 2DOKA 5BW4A 3GFSA 2MCFA 3QWBA 4HC4A 3OBBA 1XTKA 5BSEA 3SN6A 3FZEA 1S8NA 1ISHA 3M6VA 1FDUA 4MQBA 3Q7SA 1IONA 4DM3A 3U61B 3UMYA 4LUCA 1LLCA 1I4TD 4W63A 5KWIA 5KSOA 3TXYA 1BTOA 1RFGE 2DX7A 4OU5A 4JK3A 1YQUA 5IK2A 4KACA 5CK5A 4EQ6B 4A8JB 4ER6A 2A9KA 1X92A 3T1QA 4GBMA 1RAEA 3PX3A 4AX4A 1E62A 2OMKA 3LNTA 2Y1FA 2DQYA 1DTEA 3WYGA 5LP1A 4FN5A 4LYGA 2GB4A 3ZX4A 1XQXA 1NUTA 2GRUA 3O4VA 5DFAA 1QYRA 2XH8A 2QNIA 4MI1A 2OAP1 1L8AA 5C1DA 2X23A 4B7ZA 1VLLA 4WNCA 2IXTA 4RTQA 3WGIA 1OYYA 5M29A 4PPQA 5I3CA 3JS5A 2FAXA 3KSMA 2M6SA 4WOPA 1VSVA 1ZSYA 4RCYA 2YS6A 2VF4X 3FLBA 1SOWA 4EKDA 4I8IA 3HZZA 5EMLA 2P0AA 1PGQA 1NR1A 3K1AA 1PLJA 2A84A 4RHTA 3HYRA 4OU4A 4RVDA 3WGVA 2ZUFA 3L6EA 1XK6A 1PJBA 1KARA 2I6TA 1Z83A 4IFBA 4DDUA 1HE5A 4UULA 5CPBA 3QKSB 1HOXA 2QQ0A 5DWVA 4M1SA 1N34B 5AKIA 2BBTA 1DAKA 2NV2B 2IS4A 4JN6B 3UUFA 1YONA 1VIVA 3SSMA 3MINA 1E1QA 2ZJ3A 2NUAA 2RCNA 1M2VB 3WLEA 3CKMA 3EYAA 1SHUX 2WT4A 1Y8QA 2V7XA 2NYAA 3B85A 4A1FA 3W90A 4MKGA 3W77A 1X3SA 3MERA 3ZWKA 4C5AA 3WWEA 2IPOA 1R5JA 1YQXA 4BNNA 1SKQA 3JCZA 3NJ4A 3GD7A 2VWGA 2Z43A 1T1IA 2MYPA 3IUNA 2R6ZA 2AF3C 2WFZA 3GXBA 3ZHQA 3MGGA 3HDJA 1NVMB 5EIWA 2Z3WA 1GU1A 1M8FA 3OJWA 2YVAA 4MV1A 5HIIA 4FYHA 3ZZTA 2QUZA 1RD4A 2PU5A 4ITVA 4A36A 4BMPB 2OBLA 4CM4A 5IN4A 1KZYC 1TO6A 2V58A 1O5OA 2DQKA 2NZ2A 1X2EA 2Z4TA 3F5DA 3GYBA 3R3YA 1ZVMA 3G2OA 1PZMA 3PUJA 4ND6A 4KFRA 4RAQA 2P6UA 5IXSA 2ZS9A 4KBFA 4V0RA 4FP9A 4JJGA 1XPRA 4CQMB 3R6WA 4B6EA 2Y1XA 1EUZA 3JVDA 2AI3A 1M6HA 3ZJYA 3JQDA 4XM2A 1OAAA 4YUYA 1F7UA 1BMDA 3RLIA 4AZSA 4EKYA 4GKKB 2ZRCA 1NOIA 1UXHA 4E5YA 1VI6A 2Y68A 2A86A 3CJTA 4UFNA 3MJVA 1QYIA 3VUEA 3K70C 5J4KA 2W8BA 1MX5A 2WF5A 1RYNA 1SCUA 5FOTA 2WYOA 4TXNA 2VBGA 3KXPA 4Z86A 4O6VA 5FLKA 1L4HA 5C5EA 1LJUA 2ZIFA 4LXQA 4OK6A 3IOEA 2BMWA 3OWHA 5IH3A 1A2BA 3BWMA 1V4BA 4PLHA 1XDSA 3QM1A 2EG9A 3DAFA 3KJHA 4NIMA 3OIWA 4IIXA 4EB6A 2QOEA 1CJVC 1KYTA 4JKYA 4TM8A 5H7XA 4N0PA 3B20A 2BN4A 1UKAA 1R4MA 2HZBA 3H04A 3O74A 1OV4A 2B4AA 3TVTA 1JDTA 3OT4A 4XAQA 2G63A 3PC7A 1EJ2A 1TZJA 5ITSA 3ZV5A 1PYDA 4W5HA 1AURA 2O5RA 1E7RA 4WXMA 4R2HA 5CB4A 1OLSB 1P1BA 4ALNA 3UNXA 5JXJA 1OE0A 2HEGA 2ZRHA 3DP7A 4ZD6A 4DNXA 4MKRA 4U2KA 3UCXA 3P94A 1K7FB 3EXHA 3FROA 4FGZA 2I2DA 1D1QA 1R6DA 2FYTA 4UVIA 3BE5A 3WIVA 1GQFA 2IWHA 1RYBA 3WLAA 1Y37A 3AF6A 3COWA 3DSRA 4NPCA 1N57A 2C29D 2FG7C 1SBTA 1A5SB 5IULC 2JEYA 2B5OA 5F2KA 3KELA 1K2VN 1KI7A 4LRYA 1VPVA 1RU3A 4P98A 2GESA 3PHBE 4UM8B 2FSUA 4JC5A 4B34A 4YRRA 5JNWA 1Z4JA 2PBRA 1PWHA 1VHJA 3AUKA 1RP1A 7REQA 1C50A 3PPWA 1U0LA 4M7RA 1JTVA 4JKOA 5BMVA 4EJ2A 1U8TA 1X9GA 4V39A 1EK1A 3KDAA 5EE9A 3S2GA 2IBTA 2DE0X 4GE3A 5G53C 2Z95A 4R71A 1NW3A 3EZYA 1JALA 1FRVA 3TEMA 1F8YA 4FB5A 5KJ1A 4AY6A 5JBIA 3PF8A 1W96A 4EY5A 1WJGA 3BRCA 3TEJA 1KWKA 2ZYDA 3N8DA 2HQBA 3L77A 1V9LA 4IKOA 1SQ5A 2VTVA 3ZWBA 3KPWA 5ERXA 4EFMA 3H83A 4EZBA 4HVCA 2ZR9A 1R12A 1X7XB 4FT2A 5H9WA 2I1QA 3TNFA 1DXHA 5FNVB 4QVKA 3D5QA 2BV3A 2HCJB 4KBYA 4PNZA 3V1UA 3HYTA 2VK1A 3LF2A 5FAKA 4UC0A 3SWWA 3T7AA 1R8QA 2ZAOA 4GYKA 2E2WA 3VYTB 1NQUA 4EJSA 3D1LA 1XTBA 1OSNA 1BJRE 5B1YA 3T4XA 4EW1A 4DCNA 2P35A 3HWRA 2I1VB 1ZH8A 2TS1A 3GK3A 4G4JA 3BTUA 2KLBA 3I01A 1N6RA 2VF2A 1YMUA 5TB5A 1PDWA 3CUUA 1JSRA 2B8WA 1C0KA 1EFDN 2A0FA 9GPBA 3TGWA 2CYAA 4CT5A 2QXYA 2ZE8A 5A3RA 5HFAA 1PK9A 2DFNA 2PGJA 5IAOA 5AKXA 1YJAA 2D2EA 4FJ0A 4ZGGA 4M8LA 1A88A 2Y9MB 2ZYHA 1ESCA 3MTAA 2QRVA 2H85A 2YHSA 3C3BA 1E2MA 3I5AA 3K8OE 3RYTC 3T1NA 3W06A 3HU2A 4OG2A 4WZBE 3HDVA 4E3WA 2X0NA 4B74A 4YRKA 3I9OA 1U9YA 2C8VA 5HQ3B 3IKTA 1J24A 1P81A 2GD6A 3FYSA 4YS6A 1GR0A 4AY5A 1VMKA 1MEEA 1QGZA 1B41A 2FWAA 2KE5A 3AUTA 1A8SA 4D9IA 2WF8A 2PDAA 4AT1A 5HJ7A 4O0MA 4YDRA 2O14A 4JVSB 4MR9B 4GRDA 1M1UA 2J5XA 2ZWPA 3WLRA 1E89A 2QTBA 3F5MA 2YHUA 1XMSA 3WBFA 4XUDA 1UAAA 2NTEA 5I9BA 4RK4A 4QWWA 2IQ5A 1SUPA 3FXAA 1E0SA 4MINA 4W82A 3CW8X 4BRUA 1U7DA 5FWYB 2XWQA 3B1YA 3GVPA 6ADHA 3RWOA 2WWGA 2YRFA 3SBDA 4QBFA 1ZUD1 3EVDA 3GMIA 4GMGA 4KVGA 1KI3A 4ZT5A 3BGIA 2HDHA 1JMKC 3QE4A 2GEJA 4FDAA 5DYTA 2ANBA 1ZWKA 3FNIA 2YDXA 3LLMA 5BY2A 4O08A 5K6TA 3BWXA 4HQ0A 4IHQA 4DSTA 4MQ4A 3T7RA 4Q4DA 5G4LA 4ZOAA 4BNIA 1ZD5A 4YEDA 4HZIA 4N5HX 2ZJ0A 3HL4A 1PS0A 1MU0A 4O2BA 2HA7A 4L4YA 4HNSA 5KQPA 4RD0A 3E3LA 3LQKA 3FVTA 3ND8A 2XJ9A 1XDUA 2O7QA 1B0UA 2C00A 2R5NA 2OESA 2Y66A 4TLCA 4I6JA 3W7VA 2CEAA 4R1MA 4RTRA 1KFBB 1I3KA 2AI2A 1A8IA 3FUWA 3QLVC 4YMUA 3W5SA 1NTRA 4NOKA 3UVEA 5EE3A 2Z56A 3W3AH 2HNBA 3H2SA 2CXSA 3TZQA 3BK2A 4CYMA 3L1VA 4R98A 2PH5A 4IP0A 4O2AF 3EC7A 3I32A 2H2HA 3GAMA 2X0EA 1QO0D 3VJMA 4D0RA 1Y8CA 2DYKA 4P36A 4KZPA 5BRAA 4NATA 4OP1A 2I4NA 4OMDA 5LA6F 5AVTA 2XE8A 4G0MA 3L8FA 3OZAA 4YP0A 3NG1A 1RTTA 1Y5NA 4H3SA 4MWEA 1SUIA 2C82A 4N0MA 2P9HA 1SCKA 2ZZNA 1KMNA 1NC3A 2DY0A 2WZQA 3DVSX 3PQ4A 1OREA 3RKRA 4JLAA 1Z73A 4F9TA 1E3SA 1FNCA 2WUDA 1ATIA 1E1DA 2HIHA 2P6OA 4ZV4A 5B7NA 4UOZA 1DRVA 1KP9A 5DT2A 2OCGA 2IU0A 4EX6A 4WRRA 5BW8A 1YCGA 4G5HA 5A9TA 2SECE 1CUWA 1HETA 1FNNA 2PH3A 2Q2NA 4OJKA 5CYFA 5AOAA 2OPBA 3THOA 4OBXA 4LJAA 2VQSA 4HUJA 3KKNA 2CZQA 4Q03A 2LUOA 2YX1A 4E4TA 1C2TA 2WVJA 3HFJA 3T5MA 3ZW9A 1AZWA 2WVGA 2CLLB 2Q49A 3LPNA 4LXUA 1DC7A 4PG8A 1JXAA 4IDGA 1SELA 1QMGA 1DWOA 1UDWA 1PFWA 4PZUA 2IGBA 5KYWB 1U9CA 4IBOA 1XU9A 4HDKA 4IV8A 2HHHB 5JG7A 5LQJA 5ELLA 3OKCA 2PFSA 1JB1A 4WVLA 3WGQA 1KORA 1ZI9A 1EAYA 5B30A 4QDUA 5I9MA 4BQNA 2FQ1A 3INTA 3OQ1A 2AWNA 3PQ3A 1JU9A 1MEOA 5E95A 2WD8A 5AVJA 2B4RO 4ZEWA 2PR7A 4ILEA 1RJWA 3AB3A 5AJHA 4RTKA 3HMQA 4HK4A 4MRPA 4PX3A 3NYWA 2XVAA 1BJKA 3SJZA 3ZR4B 1S2IA 3DDUA 3D2AA 2Z8ZA 2QP4A 2IUYA 3K8ZA 4H35A 5BOVA 5TS3A 4IXWA 1JF8A 2H51A 2IYAA 3A25A 2RARA 1T2NA 2B34A 2CVHA 1GXSB 2ZFUA 3JRXA 4IDBA 5DSTA 3VO1A 1NNI1 1WZCA 2LD4A 2PJZA 3OP1A 4LTDA 4P4UA 4TWAA 4XUCA 2AXPA 2VSNA 3A6JA 3AVQA 1UDXA 3ZHRA 1NXPA 2FZVA 1UF9A 3ESDA 1USUA 4ETNA 4QL3A 3QITA 2A9JA 2O2CA 3U1TA 5I51A 4F8JA 3IX7A 1A2OA 3ZD6A 3EEIA 3BX1A 3UMGA 1WMEA 1Z34A 2G7MC 1G8FA 3WKBA 2P68A 3ZCPA 4CTKA 3HCEA 1QRTA 3NATA 1UT6A 1A4RA 1T2UA 3R0ZA 3JAMA 3FHLA 4JXJA 1TLLA 2X0JA 2ZPUA 3Q9SA 4O4IA 5H3HA 2A33A 3OY2A 1G5HA 2JJ2A 4G01B 3U48A 4RXTA 4R3UC 5LJIA 5ECYA 5A4DA 1RRMA 2QJOA 5TIIA 3V2GA 1YBVA 2GXAA 2NACA 3T7JA 4X44A 5I45A 4B3SB 3OZTA 2WUFA 4QFBA 4D44A 5KAMA 3V1NA 5AVUA 3CO5A 2PJRA 1CE8A 1YCDA 2OLKA 2X0IA 3IR5A 4PYRA 1IFXA 1VL2A 1ZG3A 4NK5A 3X2FA 4CIDA 2ECQA 2O8FA 1QWOA 1YCHA 1NDHA 1KPHA 2RC6A 1SUBA 2WM3A 3L9XA 4JFRA 5HZGA 3UH0A 2QMYA 2JASA 3HRHA 2VCHA 1H0KA 2O4UX 3VOSA 3A3OA 3IERA 4N0QA 5TSDA 2UVQA 3CFYA 1EESA 3G7UA 4KLAA 3MWFA 4WZBA 1PAUA 4LF4B 4HNTA 2O2GA 3LT4A 3KQNA 1QQ7A 3GZJA 2DPHA 2ID4A 1U31A 5DKFA 1WCXA 2XF2A 2ERCA 2GMWA 4OQMA 2RI1A 3U4QB 1AMOA 4KKVA 2Z5FA 2ZWOA 1Q1EA 5E4JA 1UQTA 2XGGA 3AUXA 5EXPA 3DMTA 4FLFA 4PZ0A 1I0IA 2XV1A 4XCXA 4NZ9A 1KC3A 2HBRA 4QDXA 2M6KA 1U6JA 1UOQA 2G3YA 4WKOA 4M9XA 1PX0A 4LX8A 1L5NA 4FFBA 1YH3A 3WB9A 2A7XA 1I80A 1OIWA 1S2MA 1WUHS 1WTAA 3HH8A 2TMYA 1X7WB 4O4IF 5C1IA 5JISA 2JFXA 5M34A 4Q1FA 2WIGA 1GQ2A 5AW9A 1WKVA 3BIWA 1G66A 2R6R1 3DD1A 1BHSA 1V37A 3B9PA 4J0IA 4XFKA 1N2IA 4YO7A 1DKUA 2NVOA 2A0UA 1X8KA 4MVJI 2I34A 4HLUC 5DNVA 3ZJVA 2QZSA 3KE8A 4ESOA 2QVYX 5D85A 1B6TA 1DC5A 2CE2X 3EG9A 4BU1A 1UM9B 1ZOIA 4DUYB 5JU6A 4AAYA 4RYDA 5AOCA 4BPBA 2CK3A 1YI0A 3DVAB 1SUWA 3FUVA 3N6XA 2QNRA 4BYMA 4FGSA 4RMJA 4Q05A 4MDEA 3BREA 4ZCQA 13PKA 3KU4A 1VJ5A 2O52A 2VDRB 2UXCB 1KH1A 4PSCA 3B53X 1HQCA 4J76A 4L3VA 4MGKR 1TVKA 2FZEA 2YFHA 5EPOA 4MWGA 4NYJQ 3KPYA 4YFVA 5F4ZA 1Q0HA 4N8SA 4AJNA 5C46F 4BZZA 2E7ZA 2WQ6A 5GJCA 4PLVA 3QX7A 3L82B 1CG6A 2WSSD 3TTWA 4MVJM 4DYHA 3NDBB 4LYAA 2A9OA 1BEUB 1XZFA 2ACEA 4HDMB 4JIGA 5G0VA 3CB2A 3SHQA 3LRTA 2ASEA 2P65A 4INPA 4M99A 3FMOB 3NRCA 3Q3EA 2GRAA 2ZSFA 2GARA 3WMGA 4RSGA 4CEHB 1XEXA 1N5OX 4BQQA 5IKMA 1IN8A 4DGQA 1P9LA 1LJLA 3GFGA 4RL6A 5AK5A 4BV3A 1K75A 1TRHA 1O97C 4YCDA 5GONA 3FGOA 4P33A 4ER5A 4FYJA 2Y6UA 2OG1A 1YJQA 4H08A 2PO5A 3U7JA 1W88B 3QU5A 4P81A 2DPMA 5LFAA 1ISMA 4MP6A 1GARA 3DEIA 4QJIA 4BO7A 4MWSA 5THXA 1HNZB 3RJMA 2JAUA 1Z5GA 1B0AA 5DM1A 3ZQJA 2FB9A 4J03A 2FOXA 4URZR 4RZQA 5DM70 4ZYXA 4KX5A 2BDTA 3DTVA 4NE7A 4C7OB 1JI0A 1BRMA 2X8LA 4P7GA 1WX1A 2I65A 5TXGA 1QH8A 3HHPA 1NI4B 3IS3A 4QYTA 1E2IA 1RYMA 4DIEA 3CLVA 2Q3MA 3NDRA 1P5RA 1U0FA 4G0OA 4AJOA 3K70D 2FE1A 1N32B 3T06B 4JLOA 2IVZA 3LFHA 1L5ZA 2C4TA 4E51A 4PC7A 4H1TA 2J32A 3U3XA 4EARA 3Q3JB 3UQYS 2CNNA 3PBKA 2IH4A 3LUCA 1NN1A 3PUIA 3TXAA 2VQDA 5JNVA 3ZPXA 2ABWA 3FR7A 3GU3A 3OFVA 3OOEA 2RHRA 3PUVA 3KPUA 4RZXA 4CV1A 2EP8A 2RBKA 4WOKA 1E5QA 1SU7A 2WTNA 3CH5A 1OCEA 2ISSD 1G2IA 2PT7A 3D0OA 3IO3A 2WDPA 4NSNA 1WNFA 2NXCA 4R2MA 5BYJA 1AD2A 4YRNA 1FNMA 3KDPA 1TJPB 5COBA 2PMWB 3FCCA 3LHSA 4M7OA 3VU9A 3C43A 5J4LA 5JSHA 3SR3A 2P4HX 4JELA 4IWYA 5AJUA 4B09A 2AZ4A 2W22A 2CKDA 5EAIA 3Q8MA 2O7VA 2XKAA 5DISB 4XB1A 4KN9S 5HQJA 4J6EA 4MKXA 2LCIA 5FV4A 3D9QX 1Q14A 2Q0HA 2XNHA 3EBPA 3QOYA 2G83A 3BPSA 5F51A 1L7XA 3VO8A 2XBUA 3CZQA 3M70A 4ARCA 1BDMA 3Q9NA 2C5SA 4BX9A 1DEHA 3P2IA 4OHCA 3RWMB 3CR7A 3P2EA 1MDBA 1LRJA 4I5DA 4LJ9A 3AGQA 4BKQA 5BOSB 1JQDA 4RA9A 3BFJA 4LJRA 3FLAA 4F4UA 3V1LA 4YJGA 3RODA 2IZ7A 1JH9A 2GILA 1DKOA 2FE4A 4KR9A 1QG0A 5CX1B 1RBQA 2Q7DA 3W5IA 4QO8A 4BLTA 3TJMA 5JJIA 5B1EA 2UVPB 5EXEA 1SOVA 3ELBA 4INJA 4NV0A 2FFAA 1M76A 3LXUX 4FUQA 4RJKA 5DCLA 2R84A 1BCSA 1SG6A 3FPJA 2IPNA 2OORA 3TLZA 4CL0A 1S3SA 1SXJD 1UFOA 2I78A 3ORSA 2ZVDA 2A78A 1TT7A 1EXWA 2H2GA 4J1SA 2VDLB 1JEJA 1V5FA 2GPTA 3A9RA 4IZ6A 4DOMA 2PUJA 2V7UA 1G21A 2B2NA 2ADFA 1Q57A 2YY5A 3N2YA 1NLUA 2ZW9A 1BS1A 4IEFB 3KJGA 4E09A 4RY9A 4F3TA 5K03A 1C14A 2P3SA 2HMYB 4GP9A 3A0UA 3O7WA 4M38A 4UARA 5DXFA 1Q84A 5EP3A 3VSEA 1KXZA 3JQFA 4EGSA 4D9EA 1R0ZA 3NPAA 2O7NA 4GOXA 1J2YA 2O5EA 1F1BA 2K6GA 1AXEA 3FYUA 2R9VA 3L8YA 1EX6A 4XX1A 3ZXUB 4MH0R 1UL1X 4ZN6A 1GAXA 1U8ZA 2I7TA 3GFRA 2Y2UA 4A82A 1C3JA 4RDIA 1UAGA 3FPHA 3PGA1 1S89A 4C22A 4EKNB 4D3FA 3JQFC 2GH1A 4OBWA 5EMHA 1EDZA 5AKLA 2FWRA 1NWCA 1XL1A 5DF1A 2BLNA 4BEBA 2VF8A 4E0BA 1ZGZA 2G88A 2VH5R 2YJGA 3EHEA 5CXQA 1C1HA 2JLWA 4CT0A 2ZSUA 4I1PA 4HVTA 1CUVA 1SO8A 1ZMTA 1TNDA 4O8CA 1TJ3A 3U0VA 3WVNA 4EDHA 2JGDB 4XARA 2DETA 3CZ5A 5A71A 4DKXA 4B6GA 3PDCA 1YJCA 4W5JA 4OBBA 1RI1A 2VRNA 4K7JA 5F3DA 4DMCA 1UMKA 5B3KA 1UBRS 7YASA 2FEAA 2GJKA 4BB0A 4OUDB 3O7MA 3E22B 1K7YA 5JC8A 1IQPA 4MPJA 4J90A 3VTAA 1XZHA 2CHQA 4ECAA 5G0WA 1UT8A 1JYEA 3R4CA 2PQ2A 4UEJA 5L4LA 3X1KA 3R6LA 4KRGA 2N46A 2GKGA 3HNOA 3NQ41 1EG2A 3EWSA 4PINA 1GLNA 1X1DA 4RVHA 1G2QA 1KO5A 5TY0A 1P17A 2QU7A 1UXOA 3W6UA 1JWBB 2BMAA 2CFIA 2HHAA 3E58A 2V74B 1M1NA 2CVFA 2X0KA 3OFKA 1SQ0A 1RADA 4FMCF 9MHTA 2JA1A 1GILA 2XGMA 3BEOA 5AQEA 4A26A 4ZVNA 1H1DA 1MA0A 2CWWA 3V5NA 2XCSB 3PLRA 3PHCA 2HDNB 1C9NA 1W46A 2JLCA 2KLHA 5IAJA 2RAUA 1Y33E 2V4ZA 5FOQA 2LGJA 2R6AA 4UOEA 1XEXB 1SKYE 3MCAA 1E6CA 3NU1A 1NPTO 5LIRA 3UUEA 2PMFA 1FZQA 3R23A 4DV5B 2BEUA 3GEEA 3FSRA 1WULS 3N05A 1LTHR 2YDYA 3ST7A 3LLUA 4FR2A 3INGA 5C81A 2WKQA 2YN2A 4FW8A 4KVFA 3K9QO 4MTCA 4NV1A 4UBOA 5IF3A 3I52A 5AIAA 1OF1A 4QU5A 1ISPA 1R9NA 2JJ1D 4PY2A 1MLDA 3EPRA 2HA2A 4QSHA 1C8BA 3C4QA 5B4VA 3CYFA 2P2SA 1E4OA 5EHZA 2VDKB 1MOQA 4DLVA 1QOZA 4A03A 4YN3A 4R2LA 5BWBA 1K0UA 1VJDA 3JY6A 5EZYA 4DIFA 3AVYA 2Y05A 1JILA 1Y1SA 1YO6A 3I4FA 4ER7A 3EZ7A 2JZNA 5AXCA 5D51S 5TQ0B 3ZV7A 2ZUEA 4TTVA 5IK2D 4L0CA 1WQ4A 5MGNA 3VTKA 1SRQA 4ENUA 1HSOA 5LBTA 2LZ0A 4WCFB 4FNMA 3A2MA 2V9PA 2HT6A 1E5VA 1XZQA 1E69A 5CDUA 2PRKA 2Q2QA 1TCAA 2DUNA 2WMOB 4FTWA 5JASA 5HRAA 4WKGA 1OB2A 4TRMA 4UAGA 2BY4A 1NF8A 4Q21A 3TXXA 3BGOS 4ZO6A 1F2DA 4C7OA 3TCKA 3W05A 2Q6IA 1EUDA 3ZZUA 5JVDA 1P4HA 5SYNA 2HO5A 4CTJA 4RM3A 1EXVA 1QF6A 2J6HA 4JMLA 1YOVA 2BTQB 2ZGVA 4TYQA 4F5ZA 1P60A 1H2AS 2QMQA 1IK6A 4HT3B 2IW3A 2J30A 1TPZA 1W75A 3DC2A 2ZAYA 4H15A 4ITRC 3AUFA 1HDZA 1ZQ1A 1YTLA 2PVPA 2ZKLA 2FHSA 3DHYA 4GS5A 2YQZA 2Q3HA 4I6EA 4X8MA 1EUCA 4UE6A 5JADA 5L7WA 2D06A 4E14A 3OA0A 3C45A 1LX7A 1DKMA 3HY6A 4NJEA 2VNIA 5ADUS 2GM9A 4TSFA 1U0NA 2FXVA 2VP0A 4S0XA 1CEYA 4N5NA 1GL7A 4V2UA 2YRWA 2NO1A 1NNSA 2YXNA 4GR9A 1JJ7A 1PR3A 4JLUA 3HGTA 2JC3A 4J94A 3WLLA 2JBAA 3L0IB 4X7RA 4TN1A 3BMNB 2IKSA 3K0CC 2Y0EA 2MJLA 2QD2A 2NYVA 3GVIA 5AKYA 4FC6A 5JY6A 2WNHA 3FF4A 3OAAD 4Z9XA 3SZ3A 2ENWA 3K35A 4M55A 5A5DA 3IE0A 5LQKA 4JU9A 3AL2A 3PZRA 3BF8A 4K28A 5AW8A 4KGDA 2NT4A 2P9EA 4KSYA 4OQXA 3RIMA 4DIMA 4UHDA 4NKRA 3HHEA 4OREX 4V0QA 2IP2A 5FBLB 4I6GA 5BQ3A 2BI7A 1YZKA 3AMVA 4J0KA 4PPYA 5EHNA 5ERYA 3OSZA 2V5UA 3MJDA 2AH5A 1QVVA 2AHOA 2YCLA 1BWPA 3VYRB 5LQMA 3C6XA 1RQ2A 2KMLA 3EVCA 1GSOA 3MT9A 1AQ6A 1CQJB 2XMPA 1KGDA 1QF9A 2FVYA 4DMGA 4Z9AA 2K7ZA 1D3AA 2JLQA 3BDIA 4OHVA 1S8AA 2X7HA 2JAHA 1OXBB 3A36A 3M0EA 2QZ4A 3QVTA 4LVOA 5AKZA 1YRHA 1ZMBA 2VPXA 1Q12A 2JH3A 4RQAA 1GP2A 1GT91 2VBIA 5JD5A 4JBGA 3ONNA 3ZGNA 3JAWA 3WMFA 2R2GA 3FOEC 3BUSA 4L0MA 4W4TA 1IEQA 4R9RA 2SBTA 1XVVA 2FOIA 2VNKA 2Z09A 1HWYA 2H9IA 3O47A 4AKTA 2XZOA 1RWBA 1ZJZA 3IHTA 1DUIA 4YIKA 3GUYA 4K6FA 4WNIA 1XP8A 4RAOA 3TJRA 4BBJA 5GIPE 1G18A 4Y2YA 4RJ2A 2XHZA 3VR3D 4D8TA 3N8IA 2EV9A 2VP2A 1W49A 3JQ7A 4CG2A 2ATCA 1EA7A 3G1WA 1YF3A 3KTFA 2YMLA 3M89A 3I61A 3M3PA 1C3XA 1GPJA 3V1YA 2R7MA 3GWGA 2P4EA 2OT3B 4M0EA 1JLSA 3DBOB 3MWKA 2IOFA 2C7QA 4JOCA 3HCDA 1HSZA 3X1ZA 1M73E 2FW9A 2NV0A 3VVBA 2ZUCA 3WNBA 3R0XA 2ZTLA 3DL4A 4PS1A 1PF7E 4KXLA 5TEVA 1K8XB 5CITA 2QN8A 3RRMA 2O8BB 1H8HA 3DWGA 4MPTA 4R0NA 3TX2A 4ZTUB 1U7PA 3WKAA 1X7YB 4LMAA 4BUCA 3WQRA 1MV8A 2E3JA 3INRA 3LDAA 1DG1G 3R9XB 5EJAA 2A0WA 1Y3HA 4OXIA 4YCLA 2ADOA 2DLCX 1RWPA 1NY5A 2GK7A 5MHTA 2WK1A 4NXMB 3E3NA 5CW2A 4ICIA 4MIEA 3B1VA 1VLHA 5E7QA 3TEFA 2QN1A 3VGJA 4ARUA 1J0BA 3STYA 4ZMRA 4MW0A 1A27A 3BGVA 4BNHA 4EELA 1WUKS 3PRHA 5INTA 2W2LD 1J7KA 4O4HA 3GJ5A 3H11A 2ZI6A 3VNUA 1BFUA 5SZHB 3L04A 1CJSA 2GA9A 4Q6BA 3U81A 4GPEA 4XSGA 2PWZA 1DGQA 1JR6A 3TVYA 3AUYA 1M2FA 4J0FA 5EA2A 5L45A 4TROA 4K9PA 3PHJA 1L0BA 1Y3CE 1LLFA 3Q7RA 4IDCA 3KEMA 4NZMA 2CXOA 4BAUA 1TUEA 2ODQA 1DOAA 3D0QA 3P0FA 4GLLA 4IUYA 4LOJA 3SXPA 5IJ0A 3PTZA 1UM9A 1RLIA 2C07A 2PD4A 3H1TA 4C6RA 5KWJA 1NBEA 4WHMA 2P67A 1RVDA 1KSFX 3OFSA 4ARBA 1OXSC 1LJ8A 1V5WA 1W47A 2WSBA 4DDVA 2V3CC 2W6MA 4NBRA 1P2TA 2Z6AA 1TO1E 4JJKA 4KKXB 3TD2A 3ZDQA 3V33A 1VKHA 1VYUA 3MJSA 2HF2A 3IDZA 1DAGA 1FTQA 1WCIB 2LDXA 1MVOA 1KP3A 1M2OB 3HC7A 3HYNA 2Q3CA 2QVZX 4KX3A 4Z2AA 1PNRA 2FPGA 3RAJA 4JJZA 4BJ3A 2C8JA 4IVRA 3KOWA 3T5BA 5DYGA 2V1UA 5SYAA 2BTOA 3EMVA 4OHBA 5AJYA 1T1SA 1LBIA 1S3IA 1SKUA 3O8QB 4DLUA 4LVUA 4MUGA 3G0BA 5DX1A 3W9BA 4MWCA 4AMGA 3LA8A 3OUZA 4EMBA 4ZT3A 4LGVA 5JCJD 3I6IA 2AC2A 1HZZC 1QFMA 2YMMA 3CF4G 1V8FA 2XTAA 3QUCA 4NBNA 4Y7DA 4KPYA 3GEDA 3A6LA 3O9ZA 4HDNA 3P9KA 3E5RA 3P8ZA 2GN1A 4X41A 1ZVKA 3PXEA 4RA6B 2BFOA 3GZ4A 4AMUA 4URFA 4MAFA 1WE2A 4JA0A 4R4JA 1XD2A 4MVJD 3T0IA 2JIPA 3TMYA 3VYVA 1L7QA 4MV6A 4REMA 4KWTA 3H0CA 4I4IA 3TSOA 4QTYA 5K0TA 2YKGA 1VP9A 5IDXA 3BCRA 1ZHFA 1W0JD 3IEXA 4I50B 4G1FA 4HFMA 2WAAA 3KWJA 1DQNA 2WLSA 4F3KA 2OXCA 1T6YA 2C2OA 1SXGA 1J33A 3AVVA 4YT5A 3KVVA 1XMXA 3TNJA 4LYEA 4PC2A 2FKNA 3LO8A 3GJTA 2JH8A 3TUIC 3VZSA 4QRIA 2VJQA 4JU8A 2ORED 2PKCA 4X65B 5JDCC 1ZH2A 2RAVA 4WFJA 4NZZA 1WKCA 4OATA 5IT5A 4O3MA 1LPMA 1V6CA 2DEUA 3D6NB 1E1QD 1FYVA 2PRYA 3W5HA 1RE1A 2PLAA 3S27A 3DP9A 3QKRB 4X60A 3IV9A 4NULA 1A9PA 3GHYA 4A0RA 2ZI7A 3QI2A 5LZ7A 4X6UA 5KJEA 2Y1CA 2HV9A 4UASA 5CX4A 3I5YA 4HDQB 2C77A 2VTEA 4BKMA 4DLKA 4F91B 2WD9A 4AIRA 1IN6A 1IIRA 3VR2D 1LTKA 3Q7TA 2R1TA 2R87A 1PJ2A 4DCJA 4RTNA 3ESZA 3OFJA 1MABB 3OFND 3QLVA 3UAYA 2PZMA 3H5WA 3E7FA 4HLNA 2HA3A 3HLTA 1GFSA 1J4AA 4N12A 3KSZO 3SBEA 3K1JA 1BGWA 3U3OA 4BX2A 4RFSA 2A9RA 2JBAB 4CL3A 4LOHA 3OLWA 3RKUA 4OQ4A 1WQ3A 3ND7A 3Q6MA 1NVVQ 1KU0A 3JAKB 3RNOA 3JPWA 1DRJA 2IY8A 1KDPA 1Y6GA 3H18A 5AKKA 1KI9A 4UMEA 4KYTA 2JLAA 5LQSA 2BHLA 2V7PA 1G16A 1KZ1A 1DXYA 3PNPA 4BEJA 3MELA 1LNZA 1CYEA 5K0NA 3I53A 4YRFA 3HO1A 3T12A 2QRZA 3HJUA 1JHUA 3LPLA 3OJ0A 3OOJA 2IQIA 2WC1A 1TQHA 4IVPA 4EUFA 5BWNA 4B3CA 2VQEB 4MWOA 1BVYF 3MT7A 4X97A 3ROZA 5E2IA 2D0IA 3P96A 1EX9A 5CT8A 2FK7A 4EENA 5GP1A 2GPWA 4XASA 1HTWA 3RGWS 2GN2A 3HP4A 3UY4A 3T5TA 2NG1A 4IICA 5ES3A 1O54A 5FTMA 4GD3Q 4LTMA 4CMGA 2YYYA 1PWZA 2IUEA 3TW6A 3M5WA 4D25A 2CDAA 3N0XA 4X71A 2NV6A 1P0FA 2PY6A 2Y2VA 3H7AA 3LQYA 3SX0A 4DLTA 1APBA 1WVMA 3DM5A 4PZDA 3OE4A 1UC4B 5JT1A 2HF7A 3AONB 3E9DA 4AN4A 1J9ZA 3G17A 5JR3A 5KB3A 4QGBA 2J9GA 1UKZA 3F0TA 3I9JA 3OPYB 4HB2A 4JC8A 1FUKA 3DBVO 1H1TA 4IWNA 1C5KA 5KQGA 2GEUA 5E9JA 5LYJA 4KO8A 3Q10A 5J4VA 4O2RA 4W1QA 4HQNA 5TF4A 1EFUA 2V45A 3EVEA 4FDVA 5I4BA 1EEHA 5IAEA 1PQ4A 2G25A 1E1RA 1Z08A 2AZXA 3LLSA 3AKCA 1EBFA 4EI7A 1GZ7A 4TSRA 4ZOQI 3KOZA 1ORRA 1GUYA 4YAWA 2O3UA 3C6KA 4QFMA 4EUEA 1IN4A 3QJYA 3KZ1E 3KZXA 2P2GA 4BVBA 2IFTA 1NZDA 3BRSA 4YUXA 3V8QA 4QPNA 2QKYA 4RVNA 5FYDA 4AICA 1NHGA 1D6JA 2XXAB 2AFIB 3IVAA 1BKYA 3ILSA 1QC5B 3EF0A 1L4MA 3MMPA 3DUFA 3V4PB 2GS9A 4LXGA 1PBTA 2CVPA 3DAPA 3HJFA 4TMWA 1JA0A 2YZMA 4YRQA 3KX2A 5KSPA 3MGKA 4RZUA 3WA7A 3I62A 1YS2X 2M1XA 3FSGA 5A4AA 2ILTA 1OZAA 1F2TA 4JXKA 1NMZA 4YAIA 5L8VA 3M5DA 5HCNA 2GWRA 1KMMA 2X77A 3M6UA 2QN3A 2AMYA 2L19A 2JFFA 2VJPA 1NMXA 5EVCA 2I8AA 3FDFA 3WWCA 2D13A 2HSDA 2NU8B 1RIFA 1Z7WA 2G07A 1U5AA 1OPXA 2QPAA 4HB3A 3TSCA 4BLWA 3A6KA 2FOLA 4TYYA 3FMFA 4HBGA 4QOFA 2N1MA 1IY1A 3GUCA 4FXOA 1NQVA 1ZN7A 2X1LA 2K2WA 3OJLA 2CJXA 2XMZA 3RUIA 1SD5A 2C5BA 1IAQA 5FBKA 2UUOA 5DHQA 5AW6A 2O0LA 1ZVVA 5TVKA 4L9RA 2PL1A 4JP3A 1V6SA 4CCWA 4DIUA 3W5UA 1SULA 2ODTX 4F2DA 2G0TA 2HWWA 3MWDB 1YS9A 3IKJA 4JUCA 5FPQA 1ABFA 1UFRA 2REQB 2BGKA 3C70A 2QRKA 3RIGA 4AKEA 1TJNA 2IIBA 3RABA 3MTQA 1OW3B 1KJIA 1EE9A 3EGDA 2G76A 2C7PA 1GKYA 5AVXA 3TS1A 3CRZA 2BEUB 2J0UA 2V7QD 3IO5A 3ZS8A 2OFWA 4A16A 1ULAA 1H9BA 1WCYA 2VT3A 3HWWA 3CX4A 4LY9A 3ZNNA 1O95C 2G1JA 5CDGA 1EMDA 4JI5B 3ZWNA 4INAA 2YHIA 3ORHA 3CVOA 3WP0A 3ZX5A 2GXQA 1UBSB 3U4CA 1U3TA 2GPAA 4ZAXA 4C0WA 3OZXA 4BEVA 4OL0A 2J67A 4W5QA 1ICIA 2XCTB 2ZBDA 2K2QB 4AWBA 4CM8B 1SKMA 1UJ2A 4NABA 2CNDA 2PT9A 3EMBA 2YWCA 2ZWMA 3C14C 3HPQA 5H80A 1YRBA 1WY7A 3VC2A 3VH2A 3F3YA 4OD0A 1Z6QA 4QDOA 3K0EA 4PIPA 3BGDA 4UHBA 4DDKA 5A5EA 4A91A 1OLXB 3C3JA 3IBTA 4EGJA 3PDIB 1PJTA 1XKLA 1W0KA 2PX6A 4Z51A 3HCCA 1SHZA 5I7WA 3N59A 3UW3A 4PAMA 5LOVA 3GQBA 2FPMA 2J9FB 3AEUB 3WLMA 1V3TA 2D4HA 1H85A 2NZVG 3ISVA 4CLEA 4EBBA 2EBHX 3GCXA 3NOQA 3U3KA 3BL5A 4I55A 4TLAA 4QYXA 5K8TA 3HKCA 3FMVA 1PD1A 4Y2SA 1JKJB 1E58A 3KR1A 2QT0A 2WG0A 4EYOA 5ALYA 5CT6A 4G4GA 1PT5A 1A98A 1ZX1A 1VE9A 2GNAA 4R1NA 2WNIA 4OTZA 3PR3A 2Q9UA 4CM6A 1D0VA 1SWVA 1THMA 2RIRA 3TECE 2YWRA 3EVTA 3CVWA 3KSUA 3O4GA 2XE6A 4JITA 1PNVA 5ES4B 1X94A 2FSIA 2Y1DA 2I4IA 4H2DA 5TMBA 1CEXA 4A0GA 3GWZA 2Q5JA 4CV3A 2Z57A 4PZ9A 2HLPA 5C7LO 5IEBA 3R9KA 1QS0B 2OA0A 2BBOA 1Z18A 1C3LA 3EULA 4IUCS 4H7JA 3QXXA 4Y0VA 4ETMA 4CIYA 7ABPA 4NV3A 2IYZA 1RYFA 3IILA 4M88A 1QHXA 5KPDA 4N9QA 5A7FA 2JFVA 3BWVA 4OB6A 3TQTA 3UPTA 4YUZA 4Z54A 1N75A 3K32A 1XHEA 2NIPA 1AZLA 2M32A 1L4EA 3P4UA 3DLHA 2GLUA 3MN1A 1FQOA 2CLOB 3A1SA 4IJ5A 5U4QA 2H9YA 2Q5IA 8OHMA 5E6SB 3ZKAA 3TOVA 2WTUA 1SOAA 1CQIA 2QMZA 1NXWA 3EIFA 3DL0A 3GRCA 4HDSB 4KUGA 4BFVA 1JVSA 2ZIVB 1CW2B 1HGXA 2DAPA 3IT1A 3SKXA 4CIAA 5KO2A 4RTPA 2GPBA 1NQ5A 2R6GA 5AVOA 4G97A 3AEQA 3SCZA 4WNYA 2XCRB 3HB1A 4H7FA 1PT9A 3X44A 2ID9A 1XEWX 2OLEA 3ETJA 3L43A 5FWDA 2J08A 5J23A 5IVHA 2VXYA 2BMVA 3H5IA 1YK0A 3LFTA 1UK6A 4I2NA 5KTSA 1GPLA 1N2JA 2OORC 3F7MA 3II6X 4KK4A 1SBIA 2BI4A 3KS9A 1DEKA 2YW2A 1U8YA 3GLHA 2FSVC 3RKSA 1YFLA 1R74A 4OO3A 1O6FA 3VA7A 2XQFA 3UC9A 4TVKA 3KJIA 3PUXA 4FFMA 4GXNA 3Q40A 2WJPA 4IW3B 5DGIA 1Q1BA 1UFQA 1E2LA 4B6QA 2HCRA 3JD2A 2WJJA 1N77A 3RC1A 4TQ9A 4X1OA 2QRLA 3F7NA 1NBME 4TMTA 2V7GA 4UUPA 2IX9A 5BMOA 1E60A 4MUEA 3FHOA 1Z38A 2AW5A 1A8PA 4TS3A 5EKTA 1TA4A 3B2QA 4WADA 1VTKA 3V8RA 5KYXB 3IUBA 1P2BA 5A2QA 3OIDA 4HB0A 5TARA 4MQMA 5FV7A 2C4WA 2GETA 4YACA 1IL0A 4CG0A 4IXMA 4Q1DA 4BNDA 1MZPA 1JG6A 3D3KA 3KQOA 3OOSA 1N0WA 1GZ3A 2ZRLA 2ZT5A 3LWZA 2Z5GA 2O8EA 3C3YA 1HG0A 2C94A 4BTEA 1D6NA 5IANA 2AN9A 3B6ZA 2WAYA 3WICA 2A7QA 3THSA 2I22A 5KTPA 1QQAA 4GOJA 2MHCA 2ZIGA 4HV4A 4JYBA 3LC0A 2OOKA 5F2NA 1GSIA 4YAKA 1YZUA 3D5EA 1PHPA 3QRWA 2B9VA 1HKUA 3EJWA 3SJCA 1LK5A 3TLGA 2X3UA 3KD3A 3LT1A 4QU8A 3UOWA 3WI7A 1L5FA 1O58A 1YCFA 3PT5A 4MKIA 1BX3A 1F60A 1ATZA 1NI4A 4F3NA 3TTVA 2GDZA 2OHFA 4HNGA 4F3CA 1N2EA 1XA0A 4GUDA 4W8GA 3CWCA 5EUMA 3TZCA 1C7RA 3GO4A 3OD1A 1ZSNA 3IAS6 5IW8A 1WD5A 1GITA 1ZJYA 1GPYA 3FMIA 3Q1LA 5JH7A 3W2EA 1NVFA 1QHGA 3HXTA 4Q7KA 4GI7A 2ERXA 4JBIA 5JO0A 3VZPA 3BXOA 4B4UA 2HMWA 3NIDB 4WPGA 4CGZA 5AXDA 2EJBA 3FMGA 3TCNA 4B6PA 4N0DA 3DCYA 3HEAA 4Z1MA 3T15A 2W2KB 1U2SA 4URYR 5JXHA 1ZLYA 2AFIE 3LC2O 1A7UA 4D74A 1VPTA 3URKA 4XTRA 3OMWA 5LUAA 3CXRA 3R8XA 4TGLA 1JFSA 3G1UA 3TZ6A 1ORWA 4DJ5X 4BVHA 1U99A 4CLRA 1FYEA 4D1YA 1U2RA 2OZEA 1ES9A 2HPZA 3AK4A 1E7WA 3FB1A 3MD9A 3QVSA 3R3VA 5FPHA 2WY2D 1DT3A 5IX8A 5AR1A 1GD1O 1P45A 4EHNA 2CJPA 3V4VB 1H0HA 5FPKA 2D2FA 3DBHB 1HM5A 1JU3A 3VMMA 1MB9A 1PL8A 2HYDA 5ITZB 5CW1A 1I5EA 4MR9A 3C3MA 1BS2A 3TKLA 1CWUA 1GZ4A 1NNLA 2NTJA 2W8ZA 2X1HA 3IOCA 3NCHA 4LC0A 3JVUA 3HSKA 4NPAA 2EFGA 4WZBB 4P3NA 2WFMA 4CMBA 1U9IC 3MS2A 1X3LA 4DXAA 3WWYA 1X1SA 2QGNA 4NBSA 2V3WA 2X9QA 2QBYB 1SQ6A 4NZYA 1E9DA 3QIVA 1TF5A 2HAEA 4H1UA 4K9QA 3IJPA 2W83A 2XA9A 4L8LA 5C5DA 1M6YA 3OCWA 5HK8A 1Q7EA 4DT1A 3G0CA 1L8QA 4BN4A 2ZI5A 1W5FA 2I91A 3AM1A 3PXDA 1QFYA 1IUPA 4B3MB 2D62A 1DDGA 2BL4A 1OWLA 4I50A 1SD1A 2RHLA 1GPH1 4J0QA 3QVLA 4P93A 1NBWB 2DERA 1XFAA 3ZHTA 4Q9DA 1IUKA 3AEUA 5CURA 1E2KA 3EGOA 1YC5A 3F2VA 4DBLE 3ZU2A 1VJ0A 4AQDA 4BB9A 4FWBA 4JDUA 1BE1A 4JJEA 4B4OA 1OI2A 1EIZA 4BVAA 1JKJA 1W30A 3IPYA 1I2AA 3KCQA 1GLGA 3P9PA 4FGJA 1R6VA 4JQSA 5HBGA 3BS4A 2R2AA 2PS9A 3S2IA 1PR1A 2YWDA 3B8HA 3DZ8A 4TV9B 4EQZA 2LWIA 4I99A 4MGEA 5WRFA 5IH7A 1UPBA 1EUQA 2XYRA 1E3MA 5FL7D 2I4MA 1V2HE 2R7NA 2FFBA 1EZ1A 3UG6A 2Y1EA 3FNRA 3L7DA 3MUFA 1W35A 4RVSA 1WHTB 5CIQA 1KBOA 3CLRD 3H4IA 3AI3A 3U3RA 3CB4A 5B3LA 2OHOA 5GJBA 2GHTA 4DPMA 2OXIA 3J7TA 2NX2A 3PWZA 5DTIA 1Y1RA 4QICA 4WCDA 3OPMA 4C0JA 2WMYA 1LV7A 1PL7A 2ZYGA 4C2BA 1AH2A 5EFOA 3SSNA 3P4YA 4ZK6A 3GLIE 3E5MA 3AG5A 3W34A 4BN0A 5BN3B 3LCJA 5F9MA 1Y81A 4R8RA 3EGXA 4EVRA 4ZVVA 5FKJA 5FQNA 1A7JA 2C7BA 4MV9A 1JHZA 1G7TA 5K3OA 4NU0A 2Z5VA 5B58T 4KQEA 4DMHA 2XW6A 3R6TA 5L6LB 2W4IA 4H3VA 4MRMA 4RPHA 3WLFA 1N2XA 3PDUA 4KIGA 3NETA 4IAOA 2AVNA 4LMRA 4OAPA 5MF6A 2CUZA 5JOQA 1B26A 1ONSA 4J7CA 3BA1A 2WM8A 3DXYA 4RO0A 1YS1X 4TLEA 4BC1A 3WGGA 2IEAA 2QQEA 3ERCA 2JLUA 3ADCA 1PSZA 4NF2A 4IUBS 2AJTA 3WGLA 2FP4B 2Y76A 4P7JA 3PXGA 3L41A 4WFKA 1TJ5A 3ZWMA 3AKZA 2B3DA 1FU8A 1JIKA 2X8JB 1FVFA 4JUIA 4D4JA 1F2UB 1Q22A 3ESYA 1N25A 3BILA 2H5LA 3SF0A 3NHSA 1YOBA 1T91A 4O1MA 4UTXA 3B1XA 5DLPA 1IVSA 2IYQA 2AZTA 4R41A 1ZNQO 3D1VA 1G9SA 1XXHB 3KYIB 4QTTB 1K8RA 2Q4EA 1NVEA 4IDNA 1RAGA 1JA1A 4JOBA 1YR6A 3VR6A 2QLTA 4JV5B 2QLMA 1SXQA 3HRKA 3RRXA 1VL5A 2QLBA 5JZMA 3FCSB 4P38A 3M1YA 4F5EA 4JT2A 2JI4A 4R7ZA 4M8KA 1OTXA 2BFBB 2C4KA 4QO7A 3RSSA 2F2TA 4G8BA 5LP6C 2CXHA 4PVDA 4OSPA 5JXWA 1WDMA 3R9XA 1BJTA 1RRFA 4ESVA 1P39A 3PQ8A 3DNMA 3JR3A 2AKEA 5B2EA 1DIOB 1GUZA 1RYEA 2NPIA 3H4MA 3HWSA 4RANA 4QGFA 3OQBA 3SQDA 1N0UA 4QX6A 4B0OA 2HHCA 4CTMA 3MTIA 4IF6A 4YAOA 5JMPA 2B9EA 4Q4CA 5KYXA 1R88A 2JCYA 5BNTA 2O59A 2JA2A 3PTAA 3M6AA 2FZCA 2FP3A 3GCWA 5LMUB 2PRSA 2YIJA 3U1VA 3IH5A 5BN5A 2ANCA 2PS3A 3AWDA 2AQ8A 1RI5A 2D8AA 2OY0A 1HDYA 3GPIA 4PZZA 1TKCA 2O8EB 3A1TA 2YVUA 2Q2WA 1NX6A 4YIHA 5K1ZA 3T61A 1FFGA 4M0CA 4IFEA 4XCQA 1F3LA 1I5RA 3L7AA 4CKEA 1DO8A 1RRKA 2ZRJA 2YINC 4DJDC 2EX0A 4EFNA 2D5CA 5J4YA 4M0PA 2CMDA 2FHPA 1U7UA 3JQRA 3K8QA 3RUPA 3VJRA 1XPJA 2GZRA 3FNQA 3GEHA 5EIBC 3RV3A 5DXAA 1D2RA 1NLMA 1W76A 3I1YA 4AJ9A 1EBBA 2H5EA 1OTHA 4NEGA 3SEZA 4RDXA 5BORA 1D07A 1KE1A 4RH1A 3WP1B 2PX0A 1ETUA 5AO9A 3ESCA 2R1VA 3B3GA 1H4VB 5F1YA 1FLDA 2RHWA 3UB3A 1RQ7A 4DWOA 5A6VA 3WBJA 3TBFA 1V9CA 2PYZA 2FETA 3P19A 4RCVA 3IT3A 1O8BA 1RHMA 2VO1A 2UU9B 1DFHA 4EG6A 1TU4A 3KWMA 3M6MD 5F3RA 2WVAA 3ELWA 2FFJA 1TKBA 5CDTA 1N8NA 2ZM6B 4DANA 1MVLA 1UKCA 2OSVA 3HKEA 2C3YA 2NM0A 3D8RA 3AL3A 4FYWA 4HR7A 4MWDA 1C8VB 5EWJA 1IB6A 5C32A 1ZJ4A 2OO3A 1FDWA 3ZGOA 2ORIA 4AJPA 5TMPA 2I9KA 4MLZA 4S1OA 2WSYB 3ID6C 4MUIA 3G88A 3O4IA 4LOIA 3FVWA 2O0HA 2Q21A 5EFZA 3COJA 2V7QA 2KHZA 1WOMA 3U3ZA 2X2OA 1IXKA 5TJ9A 3KJXA 4MQ6A 3NH9A 1YB6A 4TWJA 4P5EA 1T2EA 4BIIA 2WKWA 6CHYA 2QM7A 3KQPA 1LI5A 1YVUA 2O3SA 2X4GA 2ZE6A 1NVBA 1SVWA 1KQ3A 1BG6A 3E18A 1C7EA 2LVBA 3B82A 3G5UA 5EY5B 1N2SA 3BHNA 4NFLA 3WK8A 5BYKA 5FLXA 2GA8A 1J1ZA 1IULA 1SGWA 3SP1A 2EQAA 2II6A 3QTBA 4L5JA 4B0PA 2HM7A 3U3DA 4KQ9A 3W5DA 5ICGA 3PGVA 4MICA 4HWPA 4X1YB 1T8SA 3SKVA 3LW7A 1TA0A 1LEHA 1VI2A 4I1RA 3KL4A 4QU9A 4GQAA 1M7HA 4BBZA 4S05A 4WY2A 1XJWA 1XFDA 3A9UA 3PL5A 5AVQA 3O2QB 4XJTA 4DBLC 2XIJA 2J3IA 3UHFA 3I9FA 4HXGA 3BB3A 1YHZA 5LB2A 1SKYB 4PN7A 4AZVA 1N1DA 1J8MF 1N5DA 1USKA 2QUBA 2Z9CA 3HA5A 1I94B 4BJ6A 1JQJC 1GYQA 1HQKA 1QKIA 5JS6A 4MVJF 2FPSA 4HQLA 1E0JA 2YJ4A 5LYYA 4YAGA 2CXRA 2QUHA 5CM9C 5EJ9A 4CL2A 2B5VA 4RGBA 1K6IA 4M1KA 1DEAA 1BW9A 2AUNA 4B8WA 1FS5A 2ZJ4A 4P83A 3I6ZA 1YBAA 1NC1A 2PSFA 3ELYA 1CNEA 3TPFA 4E5VA 2ZJ7A 4L8YA 5JPCA 1FUEA 4V0LA 1JJBA 1WW2A 1NI5A 3KEGA 3CIOA 2OGTA 1LC3A 2H1LA 1L4YA 1TK2A 2BLLA 4GOND 2SKEA 5E2AA 5EXTA 3SJAA 4D41A 4DRXB 4L74A 3PTLA 3MYYA 3GJ6A 2PT6A 4C7VA 4PPGA 4YECA 4YCMA 1Z3IX 4FS8A 1P1CA 1VSQA 4MUYA 3IQEA 2CN1A 1FF9A 4CF3A 4B48A 3UOAB 2LIPA 3ITNA 4RWZA 3SE0A 1NQXA 4E5DA 2IYSA 1J20A 2AR0A 1V7PC 4WD3A 2WTEA 3GL9A 5F1KA 4C9BA 1WSBA 1Z8FA 5JCXA 3GRKA 3NHYA 3NDJA 3TIGA 4CM5A 3H8VA 3ZK7A 1NVUQ 2Q8QA 4A0HA 2AI1A 2UAGA 3H17A 3K31A 3RC9A 2EWMA 4GM1A 4ONEA 5KAPA 2ONJA 1FVXA 1HZZA 1GNSA 1QVRA 2IPAB 4PC3A 5A0TA 1MO3A 1D5WA 4UU0A 2AXNA 4KWIA 5BNWA 2XAAA 3TR0A 4AP6A 1LNSA 3NOOA 5DBGA 5JC1A 1F0NA 4QXPA 4BIMA 3CRQA 3EVZA 2D4AA 1R4NA 3LT2A 1N5MA 1RP7A 1Y1TA 3AHGA 5HG0A 4WK4B 3RFCA 1PVDA 4DNFA 1AO3A 1EXNA 4C0KA 1FBNA 1LS1A 3UMJA 5HTOA 2J0QA 1JPJA 1C29B 1SCBA 5DI9A 1T5BA 3UMVA 3W5JA 3IHWA 3V7NA 4BQFA 4DRYA 1NLYA 2HLDD 2G5PA 1PI3A 2DUJA 3B1JA 3EXG2 4UZFA 3AUAA 4B17A 1FSGA 2UZ0A 4EHIA 1HEUA 1I30A 4CF7A 1YNSA 2HK9A 5LWHA 4OB7A 3R75A 5BT8A 1ZUNA 1AV6A 4IJWA 1XVUA 3A9WA 2QORA 5JAPA 1FYFA 2BP7B 1PFKA 3EMKA 5FWAA 4YWJA 3A4LA 4D98A 4CEIA 4S04A 2XUQA 1LW7A 2NQ2C 1IWOA 3CR8A 1JDBC 2R8YA 4ZCRA 2FUNB 2Z08A 2WJWA 1CDEA 4OVKA 2FPRA 1EEXB 4YJHB 2RGGA 3O8OB 4M3NA 5GM2A 3QKUA 2ZETA 2AZMA 2OL4A 4LTNA 3E5NA 4CIXA 1NSTA 3TZEA 4FDTA 3IESA 3QE0A 4HWOA 1SK9A 4BO6A 4LGMA 3OPYI 1ZD8A 4BFWA 1JPNA 1H9AA 4FZ3A 4L08A 2PVSA 4MCAA 2VSYA 3WRWA 4QKQA 2IK8A 2Q4DA 1Q3HA 4Y98A 4YI3A 4ZARA 3VH4A 1XRLA 4AUKA 1QH9A 3B12A 1T0BA 1XDZA 5EKXA 4C3UA 1QC5A 5CXSA 5E9QA 2GYWA 3FH0A 2HRZA 3HDGA 3LPCA 3QLTA 3RHZA 4UQLA 1A69A 1MOZA 4BNYA 3EIEA 1OXMA 1Z5PA 3UICA 2FCAA 3D2BA 3DR3A 1DOHA 2B36A 4QIHA 3R7NA 3RFVA 3UH1A 3UUGA 2V3VA 2OHIA 3K73O 3UM9A 4NG5A 2DFLA 1WMAA 3V55A 3LY5A 4Q4AB 3BMNA 4QRHA 1LPBB 4IMRA 5BSTA 1RC8A 2W43A 2E49A 4MRAA 1EINA 3SKYA 2FEOA 2HWXA 4AO7A 1N36B 3L8ZA 3WGHA 2DKNA 3BICA 5K8JB 4UTVA 1Z2DA 5JDIC 4L73A 3PJDA 5AOBA 5T3UA 4BBAA 1VB5A 3DXZA 4RY8A 5KU1A 1YQWA 1RT9A 4JEIA 1L7NA 4J7XA 1WETA 1M34A 3OC0A 3BZWA 3DE7X 4YGYA 3BL8A 5TE9A 3TW8A 3MWDA 3UANA 1ML4A 3IQWA 4U3JB 2J31A 1D6MA 5JATA 1D2AA 1ZOSA 3NTLA 3HUEA 3OD5A 4PGHA 5BSRA 5JZVA 3KZKA 4P3XA 3AI1A 4CUJA 5FWNA 5JH7F 1S7CA 1Y6ZA 3RRNA 3PDJA 2EZTA 4PYQA 2A4KA 3LL4A 1QRSA 2VDOB 1H9CA 2JD0A 3GJYA 3A4TA 3HUFA 4MQEB 1P1KA 2E5WA 4P86A 3PC6A 5J1TB 5K3FA 1WZIA 2UKDA 1DSSG 3E4DA 1F2TB 1Z0FA 1Y7LA 1JTEA 2RFLA 3MQ4A 1OAOC 3AETA 1JA9A 1XPOA 1Z2PX 2I2WA 4LVNA 1VLZA 5FNZA 2IEYA 2BFFA 1QZ3A 3FWPA 1QCDA 2CFTA 4MR8A 3PDIA 1GKKA 1SZCA 1U94A 3FFBA 3M9XA 4G89A 5EE0A 4RVOA 3VSBA 1MH9A 3B3QA 3ER6A 5DPMA 3HB5X 1PBNA 2AT1A 4PN3A 3HKDA 3HJCA 2X3YA 3N53A 3P0EA 4KLZA 4F0JA 5IG2A 2D1SA 2DWQA 3RJ9A 2VH1A 3VV3A 4CMAA 1PS9A 3I0MA 4LA4A 2YWGA 3HB7A 3PUHA 1FYDA 2FEMA 4MIKA 1BMFD 1GDHA 2XDQA 3DE5X 4MA4A 5JYEA 1JZSA 6YASA 1V25A 1FNDA 3CWQA 1CUAA 3OHPA 4C5CA 4DEYA 4C88A 1H6DA 2QRGA 3PCRB 5ALQA 4Q4JB 1S96A 4D9GA 2X58A 1C30B 3ECAA 5ADHA 4JGGA 3NAGA 4RDCA 2OAQ1 2AR9A 3WGMA 2GVZC 1UBOS 3C16C 1PQPA 4DWWA 1G21E 4DBVO 3EPJA 1VYHA 4GMFA 3QFFA 3AQ4A 2J8ZA 3PKZA 1UPCA 2PV0A 3EWAA 4GIBA 5KSZA 1I01A 3QMWA 3BWDD 3ZVMA 8ABPA 4YJ2B 2CUKA 3QW4B 1F5SA 2B69A 1C4XA 1T4MA 2OECA 3ILYA 3SXJA 4UZSA 2WFLA 3JTMA 2ZU0C 4PG4A 1U2GA 3DDOA 4RETA 1K4KA 3QXHA 1P1FA 4NJMA 3AERA 1LI7A 1YASA 1HA3A 3VOAA 4PYMA 3AKYA 1RXEA 4U02A 5JS1A 3SAJA 1FSZA 2AOUB 4ZI5A 2CMFA 3OE5A 3BH0A 3GFFA 1V6AA 3ICWA 3PGLA 2BHSA 4HH1A 3RSGA 4CIWA 1XDGA 1J5EB 3A4YA 3A9CA 3R9IA 3K1AB 3ZBTA 2EYUA 2F8SA 3OQHA 1C2YA 1FX0B 4Z9FA 2REXB 4RHEA 3RFUA 2B2XA 5JBNA