3QV2A

Structure analysis of entamoeba histolytica methyltransferase ehmeth
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
320
structure length
320
Chain Sequence
QKQVNVIEFFSGIGGLRSSYERSSININATFIPFDINEIANKIYSKNFKEEVQVKNLDSISIKQIESLNCNTWFMSPPCQPYNNSIMSKHKDINDPRAKSVLHLYRDILPYLINKPKHIFIENVPLFKESLVFKEIYNILIKNQYYIKDIICSPIDIGIPNSRTRYYVMARLTPFKNEIQLHQEKESMISNYLDNNVNESYSIPSDLILKKGMLFDIVGKDDKRTCCFTKSYTKIVEGTGSIYCPIEPHFIPVKKAEDLLNKNLRYFTPNEIKKIHGFSSNFTTQIDGLTDKQQYQCLGNSVSCFVIAQLMEYLFDDLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5-cytosine DNA methyltransferase
publication title Crystal Structure Analysis of Entamoeba histolytica Methyltransferase
rcsb
source organism Entamoeba histolytica
total genus 98
structure length 320
sequence length 320
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00145 DNA_methylase C-5 cytosine-specific DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qv2A01
3.90.120.10 Alpha Beta Alpha-Beta Complex DNA Methylase; Chain A, domain 2 DNA Methylase, subunit A, domain 2 3qv2A02
3BUSA 1EG2A 2IH2A 1XTPA 2ZZKA 2PBFA 3ORHA 1KP9A 1T43A 4KW7A 3SR4A 3PLAE 2BR3A 3R9XB 5DX1A 5MHTA 1JR4A 1I1NA 1INLA 5ERGB 3LX6A 3DLIA 3HA5A 2PX4A 2VDVE 2PWYA 4HH4A 4KIFA 4PNEA 4MIKA 3EVGA 2O05A 5K0FA 2OB1A 2E5WA 3OZTA 5CVUA 1UFKA 3T7TA 3P2KA 3CCFA 3SXJA 5E1OA 2AOTB 2PKWA 4OA5A 4P58A 2PWPA 2AR0A 3HNRA 1NW5A 3FUTA 4PIMA 4ER3A 4DKJA 4GUAA 3CKKA 3GGDA 3R0QA 3MTIA 1IM8A 2ERCA 5DSTA 5GWXA 2ZZNA 4CKCA 5H02A 1SG9A 5DXAA 4AUKA 4Y30A 2AN3A 4DQ0A 2IH4A 5E8JA 3R24A 2PX2A 1WG8A 2GS9A 3H2BA 5HIJA 4HTFB 3V8VA 1X1CA 4YUWA 1FPQA 2NXJA 3OPNA 3KQOA 5EKXA 4EK9A 3LDFA 1NW6A 3TLJA 3TFWA 1O9GA 5GIPE 1BKYA 2DPMA 2FPOA 5ICEA 3KPVA 1X1AA 3TR6A 3FUVA 1I9GA 5EC8A 5K0GA 2JHCA 4HRAA 5F2NA 4RVFA 4DF3A 3LECA 4PONA 3C0KA 1VE3A 3NTVA 2FRXA 2WA1A 3BWYA 2B3TA 5FWAA 3RODA 2IBTA 1SUIA 1YUBA 2AOXA 3G7UA 1FJXA 2G70A 2P40A 3CVOA 3KR2A 4BP3A 4ER7A 5FCDA 4HGZA 1WS6A 3I9FA 4G56A 3QOXA 4QTTB 3G2OA 2O0LA 5E2BA 4IV8A 3TM5A 4RTLA 1RJDA 2PT6A 4E2ZA 2QRVA 1JG1A 5LQJA 4QPPA 2UZ4A 3KQMA 1RI4A 3IEIA 3FPHA 3HCAA 4KDCA 2PY6A 2OXTA 3FYCA 3HTXA 3O4FA 4GF5A 2ZBPA 3IHTA 3GU3A 4XCXA 4M38A 1X19A 2PGXA 5CVVA 4QPNA 5GP1A 4MWZA 3P8ZA 3UZUA 3G2MA 3I64A 3NVKI 3PVCA 4OBWA 5EHIA 2UYOA 2PJDA 3M6VA 3VSEA 5K09A 2FK8A 2FK7A 4A6EA 2YXLA 3EVBA 1M6EX 4PYKA 5T64A 2OYRA 3THRA 5K8VA 4RTNA 3MB5A 4NECA 2OO3A 4RTQA 3AY0A 2UYHA 3HP7A 2ESRA 3GO4A 5IH3A 1MHTA 2AOTA 3D2LA 3NWEA 3LCCA 4PGGA 5HFJA 3I53A 2Z6QA 2YR0A 3SM3A 3BWCA 1Q0TA 5KVAA 4FT2A 1JG4A 1L3CA 1ORHA 1U2ZA 2IPXA 2ZW9A 3BGVA 1QAQA 3EVAA 1N7JA 5FHRA 2EJUA 3ER8A 5EMJA 3FTCA 2P7HA 3SGLA 2O07A 2ZTHA 5DRYA 3DH0A 3UJ9A 3OFKA 3KKZA 2AN5A 3C6MA 2OBFA 4P7FA 4DM3A 1AF7A 3P97A 1EJ0A 2HR1A 1VQ1A 1TW3A 2GB4A 3OFJA 4PINA 3P71T 2BM9A 3ERCA 4OQEA 4HG2A 5DPMA 3A26A 4GC5A 3R3HA 2K4MA 1R00A 3DXYA 1RJFA 2Y1WA 3K6RA 3KR1A 4DA4A 4KWCA 4U7TB 3EVEA 1KYWA 2ZIFA 3B3FA 1JQ3A 1VIDA 2P7IA 3KQQA 4E70A 1NE2A 2ZZMA 1Z3CA 3FTFA 2V7EA 4MTLA 1D2CA 4UOEA 3GCZA 3DXZA 3TQSA 5DT2A 1SQGA 3G2QA 5LQCA 5EMLA 3KU1A 4RTSA 3P9NA 4BLUA 2YVLA 3BXOA 2ONYA 3SMQA 3DUWA 3SSMA 2I7CA 3AJDA 1VPTA 3I58A 4M37A 4RVDA 3EGEA 3KPYA 5KQSA 2OB2A 1QZZA 4XUEA 5DXJA 1KYZA 4EVIA 3C6KA 4YMHA 2KW5A 3L8DA 2FYTA 2AOUA 5T6BA 3KR9A 4Y2HA 3FUUA 4MQ4A 3SVZA 2NXNA 3U81A 3C3YA 1O9HA 3B5IA 4EKIA 1NW8A 1ZHFA 1EIZA 3G5LA 3DXXA 2P41A 4X63A 2CL5A 1V39A 3F4KA 4XUCA 5G02A 4C03A 4A6DA 1AV6A 3NDIA 2O06A 3FRHA 3G5TA 4QQKA 2OKCA 5HEKA 2CMHA 2G72A 2DULA 4OA8A 5DTMA 2ZBQA 3UJ8A 4CTJA 4HGYA 3HVIA 3JWJA 1NBIA 4WXHA 5F2OA 2VDUE 3JWHA 5K01A 5K0BA 5EMMA 4E30A 1QAMA 4X1OA 3OE5A 3KPJA 2EFJA 4Z2YA 5FADA 2B25A 3GRRA 3NDJA 5CM2Z 5HILA 1P91A 4PCAA 2JH9A 3HCEA 5EPEA 1M0EA 2HTEA 2BZGA 4CTKA 1NV8A 5E1MA 3BGIA 3UWPA 3EVDA 3UA3A 5K0JA 2XVMA 4LWPA 5E1DA 5HOQA 4EKGA 4PWYA 4WVLA 2QYOA 3LKDA 4AZWA 1HNNA 2PXCA 1L1EA 2P35A 5HZMA 5K0EA 5DM4A 1ZKDA 2NXCA 2ORED 3FYDA 3BKXA 1KPIA 3HCBA 3MQ2A 3O7WA 1R8XA 1VLMA 2GLUA 1WXXA 3QOWA 3CJRA 4RWZA 4GC9A 4ER6A 2C7PA 4MHTA 1UWVA 1SUSA 3GWZA 5DLYA 2N47A 5FWDA 1JTFA 3UJAA 4YUVA 3UFBA 3A25A 5FHQA 4AX8A 5C1IA 2I9KA 4E32A 2P8JA 3UJ7A 4FZVA 5EG5A 3PTAA 3OU2A 5ICGA 4L7VA 3MCTA 3DOUA 3UBTA 3UJBA 1RI3A 3KR0A 2PT9A 3P9KA 1FP2A 3M6XA 5HIMA 3TMAA 3EMDA 3OU7A 4LECA 4GOND 2LD4A 1B42A 2BM8A 3M33A 3GXOA 3UJDA 3DMFA 3TRKA 4HC4A 3KQTA 4YMGA 5EQJB 4B17A 4C06A 5IKMA 3O31A 4RVGA 3KQSA 2O57A 3CBGA 3MGGA 2G1PA 1IY9A 1QAOA 4C07A 2CKDA 3Q87B 4CXMA 5FA8A 5GOZA 3MHTA 2HMYB 3FUXA 4PIPA 3CJTA 5C0OE 1Q0SA 2B2CA 5JUWA 3X0DA 3OE4A 3TPZA 1NW3A 3NVMB 4QDJA 2P3QA 1DUSA 4GQBA 4IV0A 3WSTA 4GEKA 2ZWAA 5BP7A 2UYCA 1RI5A 2AVNA 4PYIA 3G8AA 2ZIGA 3KQPA 5T67A 1EJ6A 9MHTA 3DMGA 4H0NA 2JJQA 2P1DA 3REOA 3KPWA 4QDKA 3JWGA 2VP3A 2YQZA 3BGDA 3HA3A 3CGGA 4PYQA 3FZGA 1PRYA 3LKZA 3BWMA 5FTWA 4R8SA 2NXEA 2G8NA 2PXAA 4IKPA 2ZCJA 1G55A 2HWKA 2A14A 5EHGA 1QYRA 5KYGA 4V0RA 1RJEA 1M6YA 2NP7A 1XDZA 1YB2A 1YFLA 2XYRA 3TKYA 5DM0A 2PXXA 4PYOA 3HEMA 3G89A 1JTEA 3B3GA 4RYLA 5EEGA 5BW4A 4RSRA 1L3IA 1DCTA 3PFHA 3B89A 4GBED 3OCJA 4XUDA 3GRVA 5CVDA 4YUXA 1YF3A 1R6AA 1O54A 1JG3A 2GA9A 5EGSA 5HIKA 3T0IA 3P9CA 4IWNA 5EIFA 5KQRA 3LBFA 4HTFA 1JSZA 3ANXA 4RTRA 4PYNA 4RTPA 4FGZA 2EX4A 5EOVA 2PX5A 1N2XA 5FQNA 1FBNA 2H11A 3RW9A 3ER9A 2ADMA 3HVKA 1VL5A 3EPPA 4F84A 3A7EA 4AZSA 1G38A 3EVCA 1PJZA 3MAGA 1XCLA 3UJCA 4KIGA 3ELYA 1OR8A 2R3SA 4C05A 4FSXA 2Z6AA 2YXEA 3NWBA 3NJRA 2NP6A 5K03A 3LDGA 2UYQA 2C7RA 4FR0A 2Z6UA 4YV1A 4OX9Y 1ZG3A 5M5BA 5U4XA 4OBXA 5JR3A 2WK1A 4EMSA 2IFTA 3A27A 1FP1D 5D1HA 2QM3A 3GIWA 1QANA 5DX0A 1TPYA 4LWOA 3GRYA 1IXKA 3MTEA 1R18A 4KRGA 4QTUB 3TOSA 2AOVA 1F38A 3ELWA 4PYLA 2QE6A 5D1NA 4GOOD 4QVGA 3GRZA 2B9EA 3OZSA 3Q7EA 5DM2A 2C7OA 4BY9E 2OY0A 2GAFA 3LBYA 5EZSA 3V97A 4E2YA 2P3OA 2CWWA 4BP1A 5GINE 2R6ZA 2YXDA 2NNWB 3DP7A 4RTOA 1JQDA 3G88A 1XXLA 3HVJA 1SKMA 2B78A 3E8SA 10MHA 1NBHA 3HM2A 3LHDA 4DZRA 4EQZA 1KHHA 3LL7A 3THSA 2BH2A 3IV6A 4BLWA 4O29A 2OPBA 1XDSA 2VS1A 3UA4A 4C08A 4RTKA 2JHPA 2IBSA 3CJQA 4C04A 4E2XA 4YV0A 3PB3A 1YZHA 4K6MA 2ZVJA 4CWAA 8MHTA 5K0LA 2ZSUA 5E9JA 2V74B 3DR5A 3C3PA 3HCFA 1ORIA 3KHKA 3TKAA 5CCBA 2IIPA 3JWIA 1G8AA 2QY6A 3NW9A 1JQEA 5LQUA 3P2IA 1P1BA 1WY7A 4PYMA 4RX1A 2PLWA 1G60A 1KPGA 3GNLA 1G8SA 2JHAA 5BXYA 3M70A 3PX2A 1BOOA 2EJTA 5ICFA 4QQNA 3M6UA 3HCCA 1XDUA 1P39A 1WXWA 4RV9A 2AN4A 2F8LA 7MHTA 3K0BA 5EZQA 3P9IA 1NW7A 2AS0A 3LDUA 3HVHA 4P7GA 3DULA 3LPMA 3GJYA 4R6WA 1HMYA 1R74A 2IP2A 3BWBA 5B1SA 2JH8A 2EG5A 4U7PB 5LQAA 3B7PA 3HCDA 3OZRA 4FT4A 4YV2A 3FPGA 2AOWA 5DWQA 2P3LA 3FTDA 2YUIA 2I6GA 5EVJA 3A4TA 5FQOA 4C4AA 4X61A 2GH1A 3ELDA 5DM1A 1D2HA 5F2KA 3KPUA 2VZ9A 3UJ6A 2ZFUA 1VBFA 3E23A 4LG1A 2YX1A 3MCZA 3TM4A 1SQFA 5K05A 3SX0A 1XJ5A 1L3BA 3PFGA 4FP9A 1NKVA 2GPYA 1KPHA 2BR4A 5CD1A 4X41A 4F86A 5E9QA 5CUQA 2H00A 2HNKA 5K0CA 4DCMA 5CCXA 3S68A 3EEYA 1ZGJA 1YZ3A 3KQVA 3R6TA 3EGVA 4FS8A 4ISCA 3DMHA 1XVAA 5EKUA 3EVFA 5E9WA 4ATNA 1VP9A 5CVEA 1JSXA 3T7SA 3E7PA 2XYQA 5GM1A 3G8BA 4RTMA 1KR5A 5CIYA 1F3LA 3AWIA 3ME5A 1JG2A 4ER5A 3G2PA 5DTQA 3MERA 3HA7A 3FUWA 5LSAA 2AOUB 2AVDA 2XVAA 3P2EA 4GOMD 5E2AA 3BKWA 5EMKA 4AZTA 2NYUA 3SSOA 1DL5A 2WA2A 4JXJA 4DCGA 2FHPA 5P8WA 3FPFA 3FPJA 2PVCA 3NMUF 5GIOE 5LQNA 2FCAA 4P7JA 4CKEA 5EEHA 3SSNA 5FA5A 5DRTA 4R6XA 1BHJA 2XYVA 3M6WA 2ZULA 3B3JA 3EGIA 5DSXA 3PS9A 1NT2A 5LR6A 1TW2A 2PV0A 2ZLBA 2G71A 3LGAA 5FULA 3DLCA 2XBMA 4OQDA 1G6Q1 3FRIA 3GRUA 4ZTBA 5K0NA 4QVKA 3AXSA 1AQIA 1XCJA 2ZBRA 5FUBA 4E2WA 2H1RA 3E05A 4ER0A 4RVHA 2IDKA 5ICCA 1YFJA 2PSSA 3LCVB 2AZTA 2HV9A 5E8RA 5E1BA 3BZBA 4M36A 1VP3A 1NV9A 3ID6C 3LSTA 3VC1A 3VC2A 1KIAA 4YUYA 5EIWA 3ELUA 4PCLA 4FSDA 3LCUA 1EQAA 3KQYA 3OU6A 2PX8A 3A7DA 1H1DA 3EMBA 5C9ZA 1X1BA 1UIRA 2Q41A 3QV2A 1D2GA 1R8YA 1SVUA 4M7RA 2BR5A 5CVJA 1ZQ9A 4PGHA 4DMGA 2YTZA 2IH5A 2IDJA 5HIIA 3VYWA 4X60A 1I4WA 1WZNA 1N7IA 4E31A 3AXTA 4R05A 1EAMA 3PX3A 2IGTA 4POOA 5DTRA 4V0QA 4RTJA 3BT7A 1ZGAA 1MJFA 1RI1A 3FPEA 4F85A 3M4XA 4P7KA 1Y8CA 3FTEA 2OZVA 2Y1XA 3GDHA 2CMGA 4HSGA 4AZVA 2ZWVA 3EEOA 1BC5A 4KVZA 4CKBA 5LQKA 2ZIEA 3DTNA 3T7RA 2QRVB 2JG3A 3CC8A 1KXZA 4BLVA 4GOLD 4YUZA 3PT9A 5KS2A 3IYLW 5DX8A 1X1DA 3KQWA 3RIEA 3EVZA 4KDRA 2ONZA 1L9KA 4E33A 1AQJA 1RI2A 2I62A 5GM2A 3I5UA 5BW5A 2VDWA 4R8RA 5LQRA 1P1CA 2C7QA 1RJGA 4PYJA
chains in the Genus database with same CATH superfamily
1U0RA 1ZDMA 2IH2A 2CXNA 3F3MA 3L4SO 1D6MA 1U3GA 3Q6NA 1K92A 4KLCA 5U4QA 4DDMA 4MYDA 2AMVA 2B4TO 1KH2A 4ZYUA 4JUAA 2X6QA 3R9WA 1I1NA 1CNEA 1ESMA 3LX6A 3R9XB 4GRAA 4II7A 4C0XA 4EW3A 1OTYA 3ZLUA 1YUMA 3QBJA 4HB0A 3CLTC 3ZHBA 2HDNB 3JQ7B 4AY5A 1LPPA 1E99A 2AL7A 3FROA 4I1PA 1NNEA 2XUZA 4OCZA 4UM5A 2B6NA 1PT7A 1QZTA 2NV6A 4XYMA 1Z2OX 3CZRA 2I3ZA 4Y1EA 4TV9A 2N1MA 1XMPA 4MR9B 4JC5A 4AQYB 4Y30A 2AN3A 3ZC3A 4ZCSA 3UMVA 5E8JA 4WCFB 4WCVA 3SYKA 4TKVA 3RCBA 5LZ4A 3DE7X 3BMNA 3HUDA 3KDSE 5DOVA 3ZLTA 2YYAA 2GESA 3WLPA 4AP5A 1AH2A 1N1MA 3KD3A 1ZMBA 3NCHA 1F0PA 2UZ1B 4OI1A 3A1TA 4TTSA 5JY1A 1FTQA 4QT4A 2FV8A 4MVYA 3HLKA 4YAKA 2EZTA 2ZUCA 4WXRA 4HRAA 5JZ9A 2GCOB 3NJ8A 2WTAA 1L5YA 4MVJE 3FJYA 3EW9A 4NBVA 5ENZA 3U48A 1NASA 3QVVA 4TLAA 2P68A 2HBRA 2HC9A 4PONA 1VE3A 1W5SA 4B4UA 5J4LA 4U7FA 4LNUA 3KLNA 4L3OA 1CUHA 4OP1A 2QGZA 1U11A 4E51A 2QW0X 3C6QA 2B8WA 4TQUS 3QOXA 4X85A 4BDSA 3DBRA 1U98A 4RH0A 1NHGA 1Z34A 4YMWA 3IPYA 3GJ7A 5TQ0B 1BEZA 4U9IS 2ZYHA 5AW4A 1E9VA 3EGWA 3OURA 1X77A 1TC1A 2FN3A 3V8BA 3R0ZA 1G2QA 4GX1A 5EGNA 1IDN1 5LQJA 3IR5A 4XJSA 3HCWA 1E4EB 2W2LD 3V7UA 2X9GA 3TAHA 4D46A 2H6EA 5KOHA 1EWYA 2XMCA 1UBHS 4XFDA 3TNJA 1R4MB 2QYSA 3W79A 2X14A 4TKZA 4KH0A 3AR3A 1CJVC 1EFUA 1IH8A 1KZ1A 2OK8A 3OZ7A 4BE7B 5DN9A 5INTA 1RLOA 2Q4BA 4Y3UA 4EY8A 2IEYA 5C7OO 1U3UA 1R9NA 1VLLA 2I3AA 2MYTA 2IHNA 2F4VB 3UKOA 4DJ5X 1PUIA 4B8YA 3TG8A 5JSZB 2LRHA 3U49A 2J9XB 1FF9A 1J1IA 1FOEB 3ADPA 2PK3A 1Q92A 4GYWA 1HOTA 3CM0A 1DJMA 3RU2A 1WUIS 2A4KA 2V65A 2O8CB 3HP7A 1E1CA 3I04A 3A10A 2ZRLA 2DBVO 1HT3A 1D1SA 3AYZB 3WLKX 5DSZA 4O2AA 4UOEA 1YS9A 2C7VA 4FT2A 1U2ZA 3G82C 1BE6A 1USGA 2MR6A 2X8JA 1BD4A 1IEQA 3N8NA 3N75A 4Q37A 4RHTA 5FHRA 4C4TA 5FV4A 1QP0A 5HK9A 2EV9A 5IXYA 1HH4A 1P7PA 3PDUA 3V1UA 4JLJA 2AN5A 4ZCLA 2EG9A 4C3OB 1JA1A 3SJZA 2CJXA 3LX4A 1TW3A 3IAM1 3FHJA 3OFJA 4PINA 4DM4A 1Q21A 1AC5A 1GSAA 1RQLA 2K5UA 5TT1A 3B8EA 3U7QB 3KCQA 3MQFA 4MA0A 2MR5A 3K6RA 4G5YA 4ZVRA 2ZRGA 4YXWD 3B82A 5EESA 3IUQA 4F4HA 1FFWA 1Q11A 1P2BA 3PUKA 4N9QA 4MUYA 3MTGA 5IVPA 2XVXA 2R84A 5LYJA 3DHNA 1IWOA 1R2QA 1UP7A 4R5HA 3OX3A 3L8CA 3HH8A 4R40A 2JAOA 2QZSA 4BNXA 1BFDA 2FFAA 1GGFA 2I7CA 1VPTA 4M37A 2KMLA 3JR7A 5EJAA 5KQSA 3AI1A 4DCVA 3GLIE 1EE1A 5DXJA 3DE6X 2DETA 1WHTB 1Z8HA 3EOZA 1AKWA 4N76A 4FW8A 3H5IA 5A4DA 1EP2B 2YKGA 5EJFA 3MMZA 2IOYA 2K87A 3PP8A 4UEQA 4WZAB 3WY9A 5EC8A 4PO1A 5FPTA 5FOVA 2WUDA 3EPJA 1M1NA 2CL5A 3TVDA 2FE4A 1X0VA 4RD4A 4C43A 5CLHA 4B3XA 4BP1A 1GPNA 2OKCA 2NO1A 1COWA 3OFNA 3UJ8A 4ZZIA 5IHPA 2BFNA 4HGYA 1X8KA 3R09A 4GGMX 3AI2A 3DFZA 3WLFA 2PLNA 4GGOA 2X5KO 1N5MA 3EBOA 5KTSA 4Q3BA 2PMWB 3UJNA 2VT6A 2FZ5A 4X6YA 3QJGA 4ZFNA 3ASVA 4QIHA 4J16C 5KDOA 2C2ZA 4DARA 5I4IA 3DAYA 4NU0A 3ICCA 3LUDA 3O8LA 4H9GA 5A4FS 5BR4A 3RT1A 4BFTA 3FM9A 1COZA 3HCEA 1NR5A 2JFOA 1T8UA 3LUBA 1ZUWA 2VDOB 3PT5A 2CK3A 3QTTA 4NONA 4QUDA 4YAOA 4IR7A 4NCNA 5ALPA 3CSDA 3EVDA 1OREA 1GZSA 4L9AA 4CIXA 2H57A 3I5AA 4ARZA 1V0JA 3EQZA 4PWYA 4N41A 1V4BA 3LKDA 4ZMRA 1UKAA 1S8AA 2OLJA 1EQ2A 3A9CA 1BDHA 2AXQA 4PVCA 3UAZA 3BE5A 1Y7TA 4KLNA 4GWGA 3SI7A 2ZXFA 3T7EA 2BYTA 1DMSA 1HDEA 1M73E 2JJ2D 4I50A 4CN8A 2RI1A 4GC9A 2DE0X 4I6EA 1A9YA 3K09C 4ZQCB 4QPCA 2DBYA 2XXAA 2JFWA 4Y2UA 2ZJ5A 2D62A 5JEDA 1BDMA 2VDLB 1TAQA 3DTYA 5IAGA 3FSRA 2PUWA 2QJWA 4MQ5A 2H5EA 5KNBA 4GLBA 1GPUA 1RPAA 3O9VA 4FFRA 2X2EA 4PXAA 1PWYE 1T4MA 4HYQA 1B42A 4HDKB 4R0NA 4HNHA 3T61A 1DJNA 5GJWC 4I3HA 5HVNA 2OFPA 3PU6A 4B17A 4JUBA 1BFUA 3ZU5A 4MCHA 1ZUD1 2GBLA 1B8NA 4OUDA 3QENA 2I6TA 3QHAA 1I13A 2CKDA 4P8RA 4DRZA 1G5IA 2B6HA 3M4JA 1DOAA 5JATA 1T1JA 2A2ZA 4FHCA 3PUYA 3HO8A 4LQLA 3KOYA 1M2VB 1K7YA 2C7GA 5BWBA 1Z5UA 3NXKA 3WL6A 4LXXA 2Q1WA 3U39A 3I2FA 4M8LA 4GU5A 3RUFA 1W2GA 1Z6YA 4I8DA 4MJXA 4WOJA 2H63A 2DFVA 1F20A 2SCUA 3NYRA 4XWAA 1VYHA 3O0DA 1E2JA 4OFXA 1HK7A 2IXDA 5IPFA 1BRTA 2FSVC 2VXCA 3Q10A 4GZ3A 2WVAA 3BFXA 4DIMA 3C5VA 5TNXA 3E8XA 4IKPA 4LFCB 2MTBA 4ND5A 4RANA 4BV3A 1PJ4A 1J21A 1PVDA 1LS6A 1ZKMA 3BEOA 3BORA 2P2GA 2BN4A 4FFWA 4NTZA 4WAUA 2DTXA 2JKYA 4Y2XA 1Q44A 5L3SB 2D2FA 1UXIA 3UWMA 2NP7A 1SIBE 4URVR 2HMVA 2J0QA 1ML3A 2R44A 3OPYB 1GPBA 4CMEC 2IS2A 3DUFA 4X64B 1JALA 4Z2AA 2W90A 1ZRHA 2B1GA 1PI3A 1J5PA 2HNBA 2WWVD 4F11A 5JZOA 3OCJA 5H9VA 4RACA 3KSBC 5TDHA 1N57A 1QIFA 4MJ3A 2RB4A 3TXAA 4UATA 4WCFA 2ALJA 2C0CA 4JC4A 4LI0A 4A92A 1E2LA 1FVFA 5K6TA 4A0FA 4WNAB 4RTPA 4FNOA 5I4KA 4MUEA 2R6DA 4BVEA 1N2XA 1HE5A 1QE3A 1DBWA 2BKLA 3LUAA 2BEVB 1MABA 1O6FA 1DKUA 1G20A 1N8KA 4XVUA 4L0QA 5C34B 1PJZA 3GIDA 1G38A 1FMFA 1UBCA 1NUPA 1MA0A 3PNVA 4UQLA 2J09A 4ZCQA 4E08A 4BKOA 4EQ6B 1DO0A 5KINB 1R15A 3QIAA 1P0CA 4LKRA 4RBNA 3GUZA 1Y3AA 4QYIA 2WIDA 5BYKA 5JR3A 1O58A 1V9LA 1A8UA 4WZBA 3VVMA 3TL2A 4ZPXA 4EHHA 2IL1A 1BW9B 3CLSD 1NU8A 2BY4A 1GNVA 3I04M 4DJJA 4LFAB 4QC2A 2ZE5A 1K1EA 4CT5A 1HUQA 2OWEA 2PKYX 5TV2A 1WD5A 1KIFA 4PYLA 4AMUA 5KYNA 2OQIA 4ABTA 2B9EA 1G18A 4LF4B 1FTGA 4IMPA 5TQ2B 4YR7A 1Z0JA 1WXGA 1FYDA 4M9UA 4PPNA 4RZ2A 4KIWA 4WESB 1WV1A 4DCNA 3A9TA 4EKNB 4UTRA 1YACA 1NBEA 3L7MA 1U7HA 3DM9B 1I7DA 3KAPA 1TCCA 4O29A 1XDSA 4HAYA 5NULA 4IS2A 4K03A 1A5SB 2C5LA 2D5AA 2P4SA 3CSSA 4IHQA 4E2XA 3HBNA 4MWEA 4G0UA 4Q9KA 4KX5A 2F3SA 2IBMA 4JFAA 2FZGA 4Y6OA 3L6CA 4HNQA 1RWNA 1PGOA 3H7AA 5K0LA 2YJ4A 3ZY6A 3WK4A 4D99A 4PXSA 1WB9A 2FW9A 2I71A 1WPRA 3ANMA 3DC7A 3TZLA 3VX4A 1LDNA 2EOAA 3MUEA 3ASZA 4EG7A 4ZYWA 1UXKA 2J0VA 4RPJA 4ZU1X 3AUFA 5DBOA 5JWOA 3AEQA 4M46A 3V3KA 1NUUA 2BONA 2JHAA 4CCAA 4IGAA 1K7XB 1Y3FE 2GWRA 3ZWOA 4FDAA 4YP1A 1KSGA 4DWVA 4EVRA 1C30B 4CQNA 1E60A 5CH5A 4Y2QA 3JPYA 2J67A 1WTCA 1DC5A 5EZQA 3T9DA 3HHEA 4G84A 4MKGA 5BYBA 1I51A 3EDCA 2EATA 1MB2A 6PFKA 3EPLA 3BXGA 3GJZA 1KH1A 2AFRA 3CEHA 3WLQA 1ULBA 1T6XA 4MKRA 3U7QA 2GKOA 3B7PA 1YBVA 4PW0A 4X5OA 1LFAA 2HU5A 3D7RA 5B30A 2QTAA 3CA8A 3FTDA 4V0NA 5ALLA 2WJPA 4MYTA 1TAGA 4KI0A 3O4IA 3Q3JB 4MDYA 5CU7A 1RZUA 3WLJA 4HNVA 4WKPA 1WUKS 5MFPA 1GCOA 3CWCA 2HDOA 2H08A 4F0JA 2IYQA 4KNVA 4Z6KA 1L6RA 4LZPA 4UPVA 1SPXA 2PGOA 5ALOA 4LZLA 1CQJA 1CS0A 3C16C 3H84A 4NNOA 3HXQA 1QYCA 1WMAA 3VJRA 3MTBA 1TQ8A 4HAXA 3EIEA 2B35A 1Z4IA 3REQA 2LCFA 3I8XA 5CCXA 4EB6B 2AJTA 6REQA 2JLQA 3GPIA 3BCUA 1P0IA 1CUJA 1J1ZA 3Q7IA 3EVFA 3GCDA 4I1VA 2OCXA 3GFTA 1VLQA 3T7SA 3BF7A 1FNNA 4NG4A 2CL7X 4F92B 4G81A 4R1LA 1F8FA 2BUBA 3LLUA 1K2WA 3MJDA 3ME5A 2FPGA 3DEJA 4ZOCA 4WL0A 4BQFA 1O0SA 3EXEB 5LSAA 4B7XA 5IBRA 4G1FA 2WWTA 2NAFA 3OI7A 3GLGB 1W2HA 1VC2A 2W43A 5B36A 1TZJA 2FZWA 3O84A 2Q4OA 2B1IA 4YALA 3JQFC 4X7BA 3NASA 2PVCA 5CHYA 4CU5A 4G1VA 2XT6A 1G8GA 2JFPA 4ZVVA 2VCHA 1EGMB 4DFDA 3RHFA 1SIUA 3TQTA 2Q27A 2OL4A 3ABIA 2F8SA 1DPFA 3EWAA 5EWLA 3B3JA 3OIUA 4MI6A 1GU7A 3U2QA 3H05A 4Z0HO 5KEIA 4JU9A 1NT2A 2Q3FA 2YV4A 1RKBA 2P5SA 2B4QA 5FULA 3PQ8A 4JI2B 1XLTA 1T5TA 1YE3A 3AT1A 2FW8A 4CR6A 5HKLA 1YAHA 2G83A 4IL5A 2XGOA 5K0NA 3TTWA 4F97A 5E7JA 2GN2A 2K6GA 3PQ5A 1OZHA 2GVDC 2GMWA 3QU5A 5IWAB 3FOWA 1NATA 1TZKA 4M0PA 1DG9A 5DCUA 4MPDA 2V1XA 3LSTA 4LYDA 1E2FA 1LVGA 1P2UA 3AR9A 4JZYA 4PX5A 1ZH6A 5AHXA 3WAGA 3EG9B 3HYNA 2XZOA 2N46A 1BXKA 1PKEA 3GMIA 4FSDA 2CCJA 1GN8A 3ESYA 3E53A 4JJ4A 5DGHA 2ZRAA 1E64A 5C9ZA 4BGIA 1KEUA 1DBPA 4KQHA 1KFJB 1R8YA 5CTJA 3UAGA 2CFRA 2P9TA 4JLVA 4NR0A 4EUFA 3FR8A 2IEZA 3Q8WA 4ZKDA 5ALNA 1UODA 3HABA 3PXUA 1UMCA 1ZIOA 3ABRB 1N2SA 2XYHA 1Q1AA 3R7LA 1VI6A 2WIFA 4RS3A 4E31A 1HNWB 2CYAA 2X9VA 1BKSB 4CMCA 4ZOLB 3ZIDA 3HB7A 3K9CA 1L7PA 3MT0A 4LXQA 3WWCA 2PJUA 3JZDA 1QR2A 2DFNA 5L3RA 4MS1B 1H0SA 2RAVA 2JCBA 1RWWA 1Z0AA 1IVNA 4MQ6A 3EA0A 5JCPA 1F4VA 2ZCVA 1SHUX 3DTNA 4FUQA 4Y18A 2Q3DA 5TGDA 1KXZA 4ENVA 5ADWA 1DTSA 1Z2EA 3PT9A 4D74A 4YCAA 2JFVA 1D7AA 4PG5A 1BXRB 2VH5R 5AW7A 2ZXUA 3GFPA 1P5JA 4FWTA 5DW0A 3L7JA 4N5NA 1SCKA 3RASA 1L7VC 3D3EA 5J58A 2BRUA 1V41E 1PG5A 1P1CA 5KSYA 5LQRA 1EDEA 1BOFA 1QTQA 3C3WA 3LMKA 3L43A 1SG6A 4PF1A 1NJ8A 2XGJA 3F7NA 1PK8A 2QLNA 1JKIA 5K1ZA 4HV4A 4M1MA 3C85A 5K8IA 4X71A 1VLHA 1INLA 4HH4A 2WB2A 1RS0A 3DZDA 2AQKA 2AW5A 3H18A 3I2GA 4ND8A 3SHWA 5KKCA 2HZ7A 3EWNA 2HV8A 3OZTA 1XPJA 3SD7A 1SCBA 2QKYA 5BN5A 2CBXA 4BXOA 1UFKA 1THZA 2F8TA 1CZOA 4DIBA 2O3TA 3C3KA 3HPRA 2X0DA 2J6HA 3S2ZA 3UIEA 1FE8A 3UXHA 1S3GA 4D96A 4WNAA 5KSWB 2OV4A 2GAOA 2Q8NA 3CKKA 4TWIA 5JD4A 1CZKA 3NTUA 3SHTA 5LOVF 1CSEE 1URPA 3DVRX 2Q3LA 3ITKA 3HO6A 3ILSA 4OM8A 1SUCA 3Q5EA 1Y6QA 2AJBA 1UEIA 3R7SA 3SBDA 3P0JA 3WYFA 1R5BA 4ID9A 1H3FA 2I8CA 3V8VA 2Z3VA 4MKIA 5ITWA 3AU8A 1VJCA 4RV4A 3AI7A 2DPGA 3QVKA 1E8DA 3V4VB 3D6UA 3HADA 4EPTA 4J0FA 1OH8A 1GR0A 4QODA 5LC1A 3PE6A 4WCDA 3PDJA 4UREA 2X9QA 4DA4A 5DLDA 3FFTA 2PGNA 2C3YA 2I8LA 2JIOA 2LPMA 4LV6A 3LC7O 4NNPA 4ZWNA 4HQ0A 3HVUA 5DNYB 3WGZA 1XVTA 4KYTA 2BEJA 2BFFB 2G0TA 2XLCA 3TDNA 1BXGA 4X91A 2IBTA 4TTQA 3BWYA 4B9AA 5E0OA 2VXYA 3CUUA 4P1ZA 4HQLA 1YL6A 3QKRB 4N3NA 1Q84A 2H18A 3T38A 4NY1A 5F12A 4QOSA 1NVKA 1J7KA 3DFIA 3IO5A 4HK4A 4HDAA 2Q45A 5F1OA 3S29A 2YOGA 3BXEA 2EF1A 3OE1A 4AB1A 4BNLA 4G2TA 3GJSA 4KV9A 4R84A 2DHQA 1YO6A 5IC6A 3D4IA 2IXAA 1W4RA 3UC9A 1W0CA 1K5GA 4O4HF 3T3EA 3MCUA 4BV2A 3ISTA 2ZS8A 4HB4A 2PUJA 2J9FA 5BOSB 1QHNA 4WDQA 5IS2A 3NPAA 1L0BA 1MQSA 4MB6A 4U39A 4U3JB 3GLRA 1KMIY 5G53C 4FBLA 5JCZA 2PGXA 4YAGA 4JR1A 3G2MA 1CDEA 2A1UB 2RHJA 3O4RA 4Q7JB 2VPYA 3MSXA 3T3DA 1N3IA 4TQAA 3PCRB 3WQSB 2QR3A 3C5WP 2FAXA 3HEBA 1P4RA 3ODGA 1FRQA 1PV2A 4INPA 4NMHA 1LC0A 1UMBB 3SF0A 3W5UA 3RRJA 3ROZA 1O03A 1MHTA 3GUYA 4DDVA 4LK3A 1GAXA 1T1RA 1DZIA 1C30A 1I2DA 1W0KA 3NWEA 1QS0A 4H0CA 4ZPJA 3T0GA 4RULA 1J5EB 1VYUA 9ABPA 5ALWA 4KR0A 3ZWCA 2A88A 1MNQA 1VSUA 2R86A 3L05A 3ZDFA 1ZBDA 4NIMA 4XJVA 4WUVA 4NXNB 2AA3A 4EJSC 3EVAA 1R9JA 4BGEA 3VO9A 3O2QB 3FTCA 2RGBA 2ZUWA 1Q7EA 2JFQA 1ISFA 4E5DA 4IWYA 4V0LA 3KVOA 1U8AA 2AMJA 4TKUB 3BSYA 2WP0A 3CRVA 3FDFA 4TKMA 5JJLA 3HN6A 1H1LA 1Y80A 5ALDA 3AF5A 2K4MA 2OTCA 2WOOA 1RJFA 4A8JB 3IXLA 3E3AA 3HB5X 3SIRA 4WNYA 2HT1A 1ZOPA 4IAOA 4Q03A 1VDZA 2YIMA 4MR7A 5FAXA 3WLSA 4EAAA 1V2GA 2OZPA 1Q91A 3D7SA 3JQQA 5DISB 3SN6A 4H7DA 2ENUA 2QMUA 4FEGA 1KZ6A 4LQ4A 1P7WA 3AUXA 4CKXA 2GN9A 5F98A 1TYCA 2GAJA 3WXBA 6LDHA 3BMXA 1JN0A 2AG6A 4EVSA 2I1WA 4OLHA 5U9CA 1YBFA 5DBFA 2DTEA 3DF7A 3PI7A 1CJMA 4AF8A 1APBA 3TUZC 2F3PA 2ASEA 2CUTA 2J3LA 4Z7OB 1N8NA 3JTMA 5AW2A 5ALZA 1MGPA 4XLTA 4XB1A 1KYVA 4ZP1A 3T5AA 2PSEA 4RPKA 1SURA 3DF9A 1QHHB 2P65A 2P9CA 2CLIB 3IUBA 4NYMR 3OX2A 3BIJA 2REBA 3E3NA 3PXDA 4UD2A 1UJCA 5DTMA 2QI9F 1J39A 1G3RA 2G07A 2JGLA 5AJYA 1MA3A 1GRRA 3NWPA 3BB3A 5CXSA 1MLDA 3E58A 4NICA 5BQXA 5H9WA 1UBEA 3OE5A 2MT9A 2V5VA 2PJRA 2I6QA 4QNNA 4R16A 2C8JA 1RE1A 1HYBA 4YRDA 4GKJB 3IKLA 5CAEA 3C6BA 4JLKA 4Q39A 4N4AA 3AIMA 4Q3DA 4WEOA 4L7QA 4RABA 3QA3E 3HXOA 2VXBA 3ZZTA 1PR6A 1IL0A 2YASA 3I30X 4BMNA 1U0NA 2K7ZA 1DFHA 3RNOA 4OAQA 4XCVA 1SWVA 4L27A 3SE0A 1FP7A 3RSGA 2MIIA 1TTTA 3VR5D 4FZRA 2PXCA 4PY2A 4C6SA 4CT4B 1K6EA 1PJ2A 2HMTA 3DSRA 1MP0A 4PR3A 5DM4A 2EFYA 4LHSA 3OZBA 4GRIA 5C1DA 1OZ0A 3OUUA 3TR5A 1VPEA 3FDZB 4HDRB 1KAOA 1VJRA 3GRFA 1PGNA 2JAXA 1PJAA 3VKUA 1DEAA 3AFGA 1AGYA 2V6BA 5JH7A 4LGVA 4Z0PA 4RS4A 5IKOA 4ERXA 3JU3A 3G68A 2X5JO 4MRRA 3H9EO 2C9YA 4LJ6A 5C32A 4NFHA 5ITZA 3NIBA 1W0JD 2EFEB 1FP2A 3OQ6A 4Z4FA 1C4XA 1FNCA 1BO6A 1QVRA 3QFFA 1BVUA 1JKJA 3TRKA 3PUIA 5DLQC 3U3ZA 1N25A 1LDBA 4MS1A 4N7JA 3CY6A 3CZPA 3W34A 1YBAA 3T41A 1V43A 1IY9A 1WUTA 1CDOA 1YOVB 1RW4A 3PPXA 4DADA 1C9JA 3W9UA 5FA8A 2O2HA 2FEWB 3OPMA 4OPMA 2VHCA 5JOQA 1K7CA 1B1CA 2VH1A 3ACDA 4H1WA 4TS4A 3OE7A 3QNWA 5H7XA 4F56A 1DJQA 4OMUA 3WS7A 3LC2O 3KB1A 3ZU2A 4IV0A 4K9NA 3QEKA 1ZSYA 2AVNA 1A7KA 3G8AA 4M6WA 3LVBA 3LZDA 1NTOA 1RZVA 2ZRMA 3QYAA 4GE0A 1DTEA 1PFQA 3PNLA 1MEOA 2CNNA 4PYQA 1HQCA 3EG5A 4AJKA 2QAIA 1KJWA 4II2A 1SXQA 2I66A 4N65A 4F4CA 4M9ZA 4B6GA 1T2AA 3NBXX 1ZCAA 5KQGA 1F17A 5JJBA 1KSFX 1V5FA 5H0IA 3OHSX 5H3HA 3VR6A 1YB2A 2DPYA 1U7TA 5KKNB 1XCOA 2OD7A 4XCQA 4HDCA 2JAQA 1TA9A 2C97A 3ZJ4A 1OFUX 4D8UA 4AF7A 2A9PA 3HWSA 1U2DC 1V8FA 2DVMA 3WYNA 3R5HA 3GMSA 4KE6A 4V03A 1BKDR 2QLMA 2FZKA 3FYUC 3VV2A 4EATA 2O4UX 3U4QA 2PUBA 1JSRA 4DV0B 2VR1A 3P9CA 5EIFA 5KQRA 1AV7A 1F51E 2WU1A 3DTTA 1LZLA 4KLRA 1XMOB 1YIAA 1JB1A 1NY5A 1PD0A 1F9EA 3FVTA 1TVMA 4KHZA 4D3DA 2B21A 3ZGZA 2HKIA 3EZFA 3F5FA 3FSJX 3QVGB 4L4YA 3GC6A 3NOVA 3SDSA 5C4IA 1PQ4A 1ZH2A 2NPIA 4J0CA 4M98A 3P26A 4MWTA 1PNQA 4KQXA 2FTKE 2HH9A 4YMUA 5HKOA 1HQKA 2Z6VA 5B7PA 1Z7EA 2YXEA 4D6XA 3OQJA 5K03A 1TU4A 5HCIA 2WWIA 4MA5A 1NUSA 3OBIA 2CD7A 4RGVA 4XIIA 3C8HA 3V7FA 4X92A 5D1HA 4IGFA 1K6IA 1NQVA 3TNFA 4BLTA 1ODTC 3UAWA 5DTIA 1A2OA 2BUCA 4BNUA 5BNWA 4FFSA 5CA0B 5EZ5A 1XD9A 3K32A 4J91A 5DHTA 3X1JA 4QT0A 2HN9A 5DM2A 3ACBA 2RHTA 1N0HA 5AOAA 4IIFA 3D7KA 5G2OA 6AT1A 4XD2A 5B6IA 2HQOA 5GINE 2UXBB 1U2QA 2H4YA 1JQDA 3HVJA 2C8LA 3ESRA 4Q24A 3EDMA 4URYR 4DSAA 1E9FA 1I5OA 5I8ZA 3FPSA 4YDRA 5AKKA 1W19A 3NHMA 2W2KA 2I4NA 1NOKA 1Y5RA 4ZQIA 2X86A 5KAMA 1RKQA 3JQEA 2AZDA 3UA4A 4L28A 5JBNA 3ZHQA 4LE1A 3IJRA 1DO8A 4H3HB 3MINB 1RMYA 2X0JA 3PB3A 4FCTA 4XI9A 1DKQA 3J7TA 4OJNA 1RXUA 4N5LA 4OP3A 5SY9A 4I4TA 3OA0A 2A1UA 2OCGA 2ZVJA 3DT9A 3NT2A 3QG5A 3HL4A 4FGUA 5IVIA 5C18A 5LQMA 2XUGA 1H4QA 5HUQA 4CV0A 4G86A 1MQ8B 4ZICA 3ORRA 1U94A 1V2HE 2D1QA 2JJ1A 1J8FA 1IWPB 3F47A 3INTA 4OXXA 1UMBA 2JVJA 4Q0MA 3CLKA 2PS0A 4KAFA 3I2JA 5SZIA 3TNDA 4AI6A 1UPFA 4S3MA 1Z0UA 2RGRA 2V4ZA 1QG0A 5CT9A 1EQUA 5IRCD 1CJSA 1TLFA 2VJNA 1DELA 3UK1A 1UL1X 2YWDA 3WLIA 4A15A 5JJKA 1PEDA 2H0AA 2IVFA 3BL5A 3D5TA 1YASA 3TLYA 3PGJA 4NAVA 1VE7A 5MGBA 4FYPA 1YJBA 2C3MA 1HKHA 3IS3A 2AN4A 3VDQA 2R79A 4D9NA 3SJ7A 1TT5A 5DK6A 4TKUA 4BNTA 3OCXA 3D0OA 3DULA 2XW6A 1DG3A 4TRRA 3ZYZA 3PNQA 4QGAA 4DLPA 1Z88A 1W6RA 4FT4A 3D3JA 1R12A 3SQNA 3VPCA 4OSEA 2P3LA 3W5VA 4A8JA 1I7PA 1G42A 3UJPA 4C4AA 2HA2A 2GH1A 1IZ9A 2NPFA 3D5EA 1MCZA 1CRPA 4YP0A 1E9EA 2C2OA 2FZ4A 2P6PA 2ZYWX 3LCMA 5ALJA 4KK4A 5LB2A 1OB2A 1OH6A 1S1MA 1CHDA 1A88A 3SEFA 1DC8A 5FBKA 1PJQA 1FNSA 2F62A 5FI5A 3PQ2A 3DS8A 3QG1A 2BP7B 3IKVA 2HNKA 1ZGCA 3O92A 4IDHA 5JDCC 4LJ5A 1W1UA 1A82A 1ZGJA 4BO8A 4E11A 1G3QA 3U44B 4KQKA 1ECFA 4S04A 5KMGB 1U5AA 4CKBB 3P0IA 2QUZA 3EFBA 3CKLA 3HBLA 5JLAA 1FXWA 2QN9A 5KPDA 3L6BA 2YWJA 3ZTTA 1FVOA 2Q5JA 1KZ9A 2WZCA 2JA2A 4GPAA 4R8VA 3LGSA 4B34A 4PBSA 1N3YA 1IG0A 1N92A 5DTQA 4DREA 5ILOA 4R1TA 3FUWA 2ACWA 2AOUB 2EGHA 4FXPA 1NJ6A 4E2FA 1IBCA 1QFMA 2WA2A 4HLQB 4AY3A 3GLIA 1C0EA 2FHPA 2FPWA 3H9JA 4LMBA 3NMUF 2H1WA 3FZQA 5LQNA 3AM1A 3WRYA 1U31A 3IDQA 4B4DA 3VH1A 1MD9A 1S8NA 4PFKA 1VMDA 2Q8PA 3N76A 4Q9JA 4EA7A 4U8GA 3BRCA 4IQGA 3U4IA 2ZULA 1CUZA 1BWSA 1NDUA 3GVXA 3N0RA 1DNPA 4RESA 3KEFA 1WLSA 5A7GA 5LR6A 3QWAA 3EUAA 4GPZA 4KP7A 4YJGB 4FFBA 4W5TA 4CJXA 1KDTA 2RFLA 2REOA 4QOFA 1NBME 4PBRA 3OEYA 4H60A 1XCJA 2XYPA 1GCUA 2WF8A 3DCYA 1D2EA 1Q19A 2XMRA 4X7RA 5AVRA 2AZTA 2CSUA 3IJEB 3R8CA 2W2QA 5E8RA 1C4OA 2NPOA 1EK6A 3BZBA 2Q6OA 4O25A 4EG6A 1JQJC 1H5QA 2PAFA 5EIOA 1MR3F 4MJ7A 4W4TA 5F4BA 4HWSA 5JRZA 5CYFA 4X97A 5EMHA 5E2IA 4ENUA 3G0OA 4FD3A 3AF0A 4WPGA 3ZK9A 5IDVA 5I5EA 2FKAA 1TVCA 1GQQA 3RYFB 3VR4H 1POXA 1HE3A 3G13A 5DN6A 2VPQA 4BLRA 4EEZA 4JLSA 2F67A 1D2GA 4P4UA 3E9MA 1IJBA 1NMSA 4MO9A 1A9QA 1KDYA 3MHPA 2NU8B 5JCOC 4CKWB 3SQOA 3ZVKA 4HLUC 4G97A 3WKBA 1N7IA 2HA0A 4PCUA 4EJFA 3PDWA 1T29A 3DKIA 1JUDA 1H0KA 3OPXA 1W5TA 3PWKA 4KN8A 1NWCA 4QNRA 2O0HA 4Q4DA 5A06A 1JAHA 2FG6C 3R8XA 4POOA 2EKLA 3PUWA 4F85A 3GBPA 2GEBA 2GPAA 4BVGA 2G4VA 4QRDA 4BBAA 1JKMA 2DWPA 4CIWA 3FTEA 3O8NA 1Y5LA 3BXXA 4DR7B 3IQWA 1A77A 3STWA 5BW6B 4XVHA 5EIBD 5DM60 1OLXA 2JAHA 4GM1A 4NYJQ 5LL6P 4BFVA 4BEBA 5DLEA 5C8ZA 3PITA 4RXMA 4KQCA 2R7NA 4HB2A 3I4FA 4E33A 4D5EA 2FJPA 5FL3A 1SBYA 1QF6A 2CHQA 2ORVA 4YHBA 1NFRA 1YH3A 3LRTA 3OIYA 4KFSA 4MQLA 4ODIA 3OQPA 5AQ1A 1IBMB 1KS9A 3BUSA 1DQSA 3FFXA 1MPXA 2HLHA 1XE3A 4K3UA 2HRZA 2VYND 4P81A 3F6EX 4B82A 3LXXA 4HAWA 3HA5A 2CNWA 5JS8A 1Y0BA 3GVHA 4MVJM 1Q7BA 2BGWA 6GPBA 3JQCA 3L0CA 1BGXT 1F6BA 3UXYA 4DKXA 3T95A 1Q77A 3E22B 4M54A 4QUEA 3ZLVA 4A2CA 2HPVA 2AEEA 3ENWA 1FL9A 1RPJA 3I83A 3IODA 2VEDA 5L3QB 3WMFA 2XRYA 1WU8A 4QBKA 4XPIB 1BVRA 1EM6A 1AG9A 1GUFA 1YWGO 4B87A 1WSWA 4BE9A 1RP1A 5DK4A 4AO7A 3FXAA 1EYZA 5FT9A 5AXAA 1GYQA 5E95A 4O4IA 3HV0A 5B5SA 1TZCA 4MRNA 3OP1A 4DR4B 2EEZA 1QRUA 3FCYA 5LA6A 3SG0A 1V6SA 3CEJA 4XJTA 2AJCA 4NNJA 1CZUA 3V42A 2Y4NA 3RVJA 4QTYA 2OGSA 4U63A 2EAUA 3FUVA 1E5DA 5G3ZA 2Z9BA 2JHCA 3QMVA 4MVJI 3GGOA 2OKGA 3JD0A 5EKSA 1YVEI 1PD1A 2ES4A 2Q9CA 3KKLA 3KYDA 4ZT2A 3W7VA 3MD0A 3VMMA 3VPDA 1YR2A 1IHDA 4I55A 1Z7WA 2HHLA 3AQIA 5AMXA 5TC4A 1BD3A 1E63A 3R3VA 2OV8A 1PL8A 3VX3A 1KI4A 3TFOA 4Z4EA 4GHWA 3U5TA 4KPFC 4XGQA 4AKIA 2C59A 2EJCA 2PYZA 3M5CA 3Q0IA 3BK1A 3B6ZA 4FI3F 4KXMA 3NOQA 2VQEB 1TYDE 1YB6A 1ZSVA 4LJKA 3LYLA 4YP6A 4M9SA 2JKZA 3BTOA 3A1FA 2AD5A 4DMHA 2OO7A 1QIIA 4QPPA 1XLVA 4W82A 2RIPA 5DGDA 1ODFA 5A4JA 4DBZA 3QXXA 3VYRB 2EKZA 4KTTE 3F7OA 3HCAA 1RQRA 4RVOA 5CDGA 1KOGA 3A3NA 1XF1A 4Q48A 2FOLA 4UVEA 1KKUA 3KCNA 4G9BA 4P2BA 3P0RA 4QXRA 3SBXA 5A5DA 1YS6A 3G2LA 2ZTVA 5K6RA 1EUCA 4F21A 4NRDA 3EXHA 4ZOLF 1ZRSA 2DT5A 4U2CA 4XUGB 1E3IA 2G08A 2Z5LA 3SAJA 5JMPA 4YACA 3SC4A 1F7VA 2GPTA 2PRJA 2FK8A 2IWHA 4DY4A 4KRXA 4GKBA 4E5KA 1M6EX 2CXXA 3AF4A 3O8QB 5GV8A 3ZPXA 2X4DA 4EYQA 4KU4A 4YT4A 2O3UA 5AW8A 3GBVA 4XKJA 3LY7A 2JZOA 3AY0A 3DV0B 4IICA 4C6TA 2HA6A 1L4GA 2W0SA 3E1GA 2E55A 1HLDA 2GUWA 1T3GA 4PN3A 1IXSB 1GUDA 3WKEA 4YRJA 2QX8A 3COPA 4HDQB 3O8BA 2Q6VA 3MOGA 3WDSA 4BFCA 5I7WA 3CZ5A 5EHQA 3KVRA 5FV7A 1JE0A 3QMWA 1QTRA 3PEFA 3L7AA 2D8MA 3UJ9A 1WNTA 5L4LA 2QTCA 2E85A 4Q1VA 5AM2A 3ZCRA 1UIMA 4L5CA 2PZMA 4TTPA 3NLLA 3CVXA 4KXFB 3MRTA 3N7TA 4OQEA 1GA4A 4RLSA 1B2RA 2NUPB 5IVKA 1YQTA 2R8OA 3PWZA 3BILA 4Z54A 3C41J 3HXLA 4YLEA 3RJZA 1VJTA 1EFPA 2IX9A 3PBKA 4LDPA 4L72A 4Q1BA 3A0RB 1RPZA 4WBNB 2BHTA 4NBSA 4YX9A 5CG2A 4QDZA 4KGDA 2QLBA 3TQSA 5BUQA 1LPSA 3N5KA 2NVUB 5KMGA 3R6LA 3BXOA 4BFUA 1SKUA 3AM5A 4DA9A 2PUHA 3VZBA 3T5GA 2GSDA 3CUYA 2JATA 1F8UA 2YOFA 4Q9NA 2Y1DA 4DJFC 2ZYDA 1R66A 2AOUA 5TVKA 5EPUA 4C87A 1FX0A 3FUUA 2IVZA 4B73A 2WKRA 2HXGA 2NXNA 3U81A 2A30A 1JYSA 1XTRA 4GYKA 1GLGA 4EJ6A 2ZUTA 5JXWA 2Q5FA 2FPKA 3KOMA 4PLGA 4BX2A 4RAOA 3NDIA 3G5TA 4QOJA 2J31A 3THRA 3HUFA 2REQA 2KE5A 4CI9A 3A2KA 1QUFA 3HBFA 3I1IA 5T57A 2BCEA 3PNSA 5F2OA 3T7JA 1KRXA 1BN7A 4WXHA 4KE7A 4DNFA 3DL0A 4PN7A 1SA0A 4B84A 3S1AA 3GFGA 1QO0A 1J20A 1YD7A 1L4MA 1QKJA 2EFJA 4D02A 3GRRA 4QXQA 1GQOA 4EMUA 3INYA 3R44A 1M76A 4LRTB 2KBFA 3FHTA 1KI8A 2EIHA 3ESQA 3I61A 3NHPA 5ER6A 1CY4A 5EVCA 4XLLA 3ZS9A 4DCOA 2PZFA 3SK0A 1JR3E 3H6KA 1Z36A 2HK8A 5JD3A 2EERA 3B2NA 3DCIA 4G9EA 4EUKA 1A76A 2I54A 2O2EA 2PH7A 1N1DA 1K27A 1KI3A 1NMXA 4G0PA 1S9HA 3PA6A 4H7HA 4CM9D 3B53X 5CVCA 5ALKA 3CZAA 4IJVA 1SOVA 2XNJA 2F1OA 5B55A 3U60B 4NMLA 3FYDA 2PDAA 2ZETA 4J4HA 3ENZA 3G6WA 4K6HA 5DASA 3O7WA 4I2VA 1KJQA 2HRQA 1PL0A 3CU5A 1K68A 4ZQFA 4I8XA 1VZ3A 3USCS 2O5EA 1M6VA 1X70A 2GSWA 4YUVA 1AUVA 1GG9A 4E32A 1YL5A 4XWTA 4Z4QA 1IPFA 4CHGA 3OLWA 3QELB 4NZNA 2R2AA 5EE5B 3LV8A 4HNUA 3TMAA 5JAIA 4N3AA 1IN7A 1QX4A 3LT5A 4TLMB 3KG2A 1VB3A 3DQPA 4TMYA 3LU1A 4PLZA 4N18A 3C8ZA 1QFXA 1OBFO 1WDTA 2YV3A 3FB1A 4YMGA 4ES6A 5HUHA 2DY1A 3KUDA 3O1LA 3R7FA 3RUCA 2JGIA 3B1FA 4DLLA 2Z1NA 2IIBA 4NBLA 3T52A 5JQGB 5HJEA 4P3OA 5KTKA 3PGXA 1AA6A 1KMHA 4CXMA 2XA1A 1JBEA 1QBKC 1ZU5A 2H2HA 4G8DA 3KTAB 4PNHA 1J06A 3KFLA 3NHBA 4LN1A 5EYPA 2DR2A 1JFFB 1QB8A 1U8ZA 3M81A 4KQ6A 1OLSA 5KNDH 2H5IA 2IY7A 1V9CA 4P4NA 2O2GA 2ZATA 4RD6A 3ZE9A 4E4TA 5GTDA 1K86A 5C5CA 4K9QA 2OXEA 3VKWA 1G1MA 1NKTA 4O2LA 3WQBA 4DS3A 2GFIA 4TWRA 1HT2E 2A86A 3KYIB 4Y2TA 1Z4QA 4L6IA 3ZWAA 2ZJ2A 1EMDA 1LX6A 1KJJA 3AQ4A 3FZGA 5FTWA 5CBKA 2WV9A 1T36B 3O91A 4JC0A 3TINA 4CEJA 2EX0A 4UPEA 2VQ3A 1OLUA 1WSBA 1G55A 1L7AA 1QUEA 1SVMA 2O7RA 2ZB4A 3OZWA 3QI2A 3QWFA 2GZSA 3JQAD 5FO1A 4MEAA 5C35A 2GLXA 5FIUA 3K8QA 2OHOA 1EDBA 4MW4A 1W4ZA 1E1QD 1WHSA 4RYDA 4RYLA 3G89A 4Y0NA 3EZNA 3GGCA 1OBVA 1KMCA 1FUIA 1LX7A 3OPVA 4E3WA 2V55B 5AVTA 4YUXA 5D3QA 4KUEA 5KREA 3SY8A 2GA9A 1P4GA 2QDKA 3HXPA 4XPZA 3R5TA 1FXWF 3DDNA 4KV7A 3M34A 2E5FA 3WGLA 4OHPA 1DI0A 4N3CA 4YRZA 1GOTA 1XRSB 4B3JA 2GNPA 3IAUA 4W9RA 2D06A 2JANA 2GQ0A 3QVWA 3K96A 5AM0A 4F5EA 2VDPB 2FFHA 3L6RA 1ESZA 3ICQB 1M0TA 4NKRA 4FOTA 3TLXA 3TTYA 4OIFA 1W46A 3UJCA 4RKEA 4RE6A 5GY7A 2NUTA 1TK2A 4FSXA 4CQMA 2JLCA 4D9JA 2QRKA 2GYVA 2OHGA 2PZBA 3I4LA 1L7EA 1NW4A 2CJWA 2AN1A 3O94A 3OJCA 4FR0A 3GT3A 4PZYA 4P3NA 4TXMA 4OX9Y 1ZG3A 3AVUA 4OL9A 1RWVA 3PC8C 5EJ2A 4AJ4A 2HREA 4NBKA 1YS1X 3SF8A 3FVRA 1GNPA 2GK7A 3HWWA 5DX0A 3RKUA 3F9CA 5AIAA 1N4DA 1YU9A 2FZEA 3GRYA 3MTEA 3OOYA 4ZCPA 1C50A 4DT1B 1VLZA 2FMHA 3VFDA 4DN6A 4W9NA 1Y7LA 2PGDA 5DO9A 1FMJA 4K88A 2AG5A 1ZOIA 4YCDA 1Z5ZA 2PKQO 3OOWA 1QF7A 4LRQA 4WXEA 5FKJA 5IK2A 5BO5A 3P9PA 4LMRA 4MV7A 4UU7A 5DYTA 5TF4A 4EUHA 5K99A 1NBHA 1XALA 4M0EA 4TM8A 3TW8A 2Z98A 3WISA 4ZGBA 5C8VA 1ADFA 3TSYA 3E81A 5IBPA 1AQUA 1KHHA 3A1NA 2BH2A 3R41A 4YI3A 4ENQA 3IIKA 1U5CA 1MIOA 2VS1A 4HH0A 5T8KC 2C5HA 1I2BA 2JHPA 1JHRA 5A71A 3NNNA 4PGMA 2WFZA 3NEAA 1PS8A 4Y9RA 1MB9A 2RJOA 1DTWB 3NYIA 1JDZA 2E4YA 3D6VA 4JJGA 4WA7A 3RYIB 5A5VA 5C3MA 2NTNA 1ONSA 5E9JA 5KQLA 1TUBB 2B83A 3GBSA 4H4EA 1DZ3A 4J94A 5KVCA 2YNMD 3D3KA 5GQSA 3EJWA 3O90A 2XSZA 4Y6LA 5H82A 1V25A 3C6ZA 2GARA 4RKQA 3FCAA 5EP4A 5H5JA 4B8WA 4LQDA 4G0NA 1SRQA 2CFSA 4BNGA 3N3BC 2XIQA 2JCSA 3G5AA 1OH7A 1LDYA 1XO1A 3LUGA 1DQRA 3VPGA 5G1OA 2QAGB 3OECA 1T4CA 4Z9AA 2HRDA 3BDIA 3K70D 5JARA 2RGXA 3QLUA 4Y2JA 4DPLA 1VGQA 2NYRA 1BOOA 2EJTA 3JD1A 3PX2A 4IFBA 4L4SA 4Q7QA 3V2IA 3F5MA 4XIJA 5HF5A 5I3ZA 3FGNA 4IKEA 2YMQA 4NK4A 1V1RB 2ODAA 1QU2A 5AVSA 3OWXA 3KSRA 4P08A 3ZGOA 4EDFA 3JSAA 4DDTA 3RC8A 4KOAA 1PZNA 3W4JA 3DTVB 3FDJA 3OZRA 3KQNA 2Y67A 1C7JA 3GK3A 2PBLA 1Z8NA 3LX5A 4FC7A 3LW7A 4G37A 1UINA 2KJQA 1ZLXA 2OM2A 3E5HA 4O4LA 4CDGA 4E14A 5KTMA 2JFXA 1U0EA 2FSGA 3GROA 5F2KA 3REGA 4ZU6X 3MT8A 2ZRPA 4I0WB 1KWKA 1N77A 4JX8A 4EFKA 4EF6A 1M2NA 5L51A 1CYEA 4O0LA 3HBJA 2NVUA 3GP3A 2FR0A 5CA1B 1EUYA 3QWBA 4JEIA 4JXKA 1KPHA 2OSBA 2D7JA 5AJXA 1U3CA 2CEAA 3AB8A 4DIDA 1PVVA 1MJNA 4LY0A 4OGWA 3UY4A 2EW1A 3A6GA 3QZUA 3V4ZA 3EDQA 5A02A 2ZUVA 2OHVA 5FWXB 1YZ3A 3DEAA 1ZVQA 3KQVA 3CFYA 4CYMA 4YMLA 1ORTA 2DMRA 1W36D 2OOKA 4KBFA 5E9WA 1ADGA 1K66A 1VP9A 3BSFA 4YREA 1EUDB 2IXTA 3AR8A 3FGZA 5CYOA 2OUKA 1VKZA 2OOSA 2VA8A 4D8XA 4JYZA 2NZYA 4DR5B 3WLTA 2O2DA 2VHQA 4GFDA 3CX4A 3R20A 1TQ6A 2H9IA 4WJZA 4HAIA 2NTEA 3P2EA 4MYHA 4PCVA 2VDWB 1EP1B 3G8YA 4MUGA 4OU4A 1MO4A 2DLNA 3KSZO 3KT3A 3PGLA 2HMUA 1W96A 2QLJA 2PKXA 2YXPX 2IKSA 3K30A 5BT8A 1G2IA 1BDIA 2PUDA 3OCYA 1ZXBA 5CA0F 2BGKA 3DKVA 2PS9A 3KTFA 5SV2A 4I4IA 1SHZA 3M6WA 1QDEA 1SHTX 1FJXA 4K28A 3TIVA 5BWLA 1TECE 3QSYA 3JAWA 4YWHA 3EGIA 2OR3A 3FG9A 4R1QA 3COJA 1UJ6A 1QIMA 1YNOA 5BVGA 3ZR4B 2LIVA 2XT0A 2ZLBA 3V80A 3WWPA 2Q5OA 3AJ8A 2QQEA 4DUYB 4GXRA 2FWRA 3K4HA 4Y2VA 1JLSA 2O48X 2D4HA 4GZ6A 3S2IA 1BEEA 2WU0A 5B1DA 2J0EA 1SIOA 4RKFA 5AT1A 4ZYXA 1M8JA 3TRJA 3GLFE 1TJNA 4QPDA 4M8KA 1G9XA 1B6TA 1IK6A 4AG3A 5L9AA 3OCUA 1IZYA 1TKBA 2VDKB 1Q6ZA 5HFAA 1T6BY 4JLPA 2PX8A 3KUUA 3SX2A 1D4ZA 1F1JA 1FFBA 1ZI9A 3PEVA 3F4BA 1GPH1 2DEUA 1JH8A 1U5BA 3C3DA 1CJTC 3L41A 4AJLA 2JASA 4NEQA 1V6CA 1R64A 2PH3A 2YTZA 4XYBA 1ULTA 4B3GA 4M49A 3A6HA 1B3BA 1ZD1A 5KKAA 3QE9Y 1Q2XA 5FORA 3GRPA 4KACA 2V7WA 1QRRA 4I1OA 1EAMA 3E9CA 3PX3A 4G41A 2P1ZA 3OEHD 1IXYA 4CCWA 1WOMA 2NXWA 4YRKA 2PEZA 1V3QE 1G5HA 1KP3A 1BWQA 3M4XA 2GCGA 2A6PA 1JFFA 3CLRD 4FKMA 1O2DA 1CNFA 1EFCA 1P3JA 4PAWA 3LE8A 1DIHA 5A0FA 2IGBA 1KVQA 3ROKA 5LQKA 2Y2VA 2I67A 2GBLC 3RI3A 3HLYA 4O6VA 1QX3A 4LCEA 4AZ0A 1JEYA 5AK4A 2BKEA 2VQ6A 5AR1A 3TLKA 1N2IA 1X1DA 2FE1A 3SZUA 4ME6A 1G21B 4O02B 3BL8A 4DYVA 4CLRA 3DBLB 2I62A 4BJ1A 3I5UA 4L2IB 4XD7A 2GNOA 1JQLB 1AT1A 1KOFA 2FUEA 3MJCA 3QMMA 3FOCA 3VR3A 2XMBA 3PFFA 1KP9A 3FMFA 4O63O 3UT6A 4YMVA 2WD9A 2YWCA 1SKMA 2YCBA 5ANRB 4A2WA 1JR4A 2QE7D 5DHFA 1WP9A 3O75A 4HQOA 2QMEA 3OZCA 4FYXA 3V4FA 4JB0A 4RADA 4NF2A 1TMYA 1OQAA 1UR5A 1P4AA 2VRNA 1NPTO 1PUXA 3C1AA 4Q1CA 3D31A 2R6AA 2XWBF 2PKWA 3DB2A 5TXGA 1KS2A 2O5VA 1EU1A 4MLPA 4K87A 5ENDA 5U1PA 1Z5GA 1ISGA 4ZU3A 4D98A 3SNHA 4RSMA 1JR6A 4MARA 4MUKA 4AUKA 4INAA 4OQXA 4ZMBA 1R4NB 2C4TA 4URZR 4DLNA 2PX2A 3IVGA 1YIOA 2BTOA 4MZDA 1IPHA 1MTZA 1JW9B 3CTMA 4UU0A 5HIJA 3RS9A 3B3QA 4WCFC 1Z06A 4FB4A 2QL7A 1BYIA 3ZZ1A 3R2JA 3QBTA 3IQEA 2VPXA 4YS6A 3D02A 3GV0A 4B7ZA 3Q3GE 2UUCB 4IYRA 4BKRA 1J2YA 1Q0ZA 4CL0A 1J22A 2ZDHA 2XE4A 4F8EA 4QVIA 1OVMA 1PLLA 5DYNA 2XZDA 2ZREA 1S6YA 3UQZA 3H2JA 3WKAA 1Z4LA 4RK6A 1HE1C 5CDHA 3SLGA 2P9FA 2YWRA 1XDWA 4JYCA 2G70A 5L8VA 5C8XA 3CVUA 1K5PA 3O1JC 4NCHA 3PRJA 5A3JA 1B8OA 4QOIA 3UH1A 1TUEA 1UJNA 1G6OA 2QTVA 4RE5A 3R9KA 1JFVA 2GHRA 1VHDA 2JGRA 1XNJA 3I01M 2I80A 3VZPA 4MW7A 1E2KA 4MLZA 3MUOA 1NVTA 2DFDA 2C20A 4Z1MD 4UCXA 3TJMA 4AC9A 2I78A 3MN1A 3QVUA 2HWXA 1LLQA 2A94A 1KJ9A 4BEVA 2IOQA 3FPHA 3OQBA 4CF5A 1ND5A 4BKQA 4XQEA 3H1TA 1K08A 1M8PA 1GDHA 1OI2A 3AVPA 1RP7A 1ZA2A 3PQEA 4XCXA 4EGFA 4M38A 1FQWA 1SMKA 2JLZA 2NSHA 4OG2A 1LS1A 2O1XA 2PMEA 1ACJA 3G0IA 5JIBA 3C97A 2BTQA 4QBHA 4R9NA 1ZU4A 4GNKA 2AK2A 5K09A 1QRDA 2ATEA 1Z2AA 3DO5A 3L18A 4LZNA 3W2FA 5CDYA 1WB6A 1G9TA 5TT0A 1UCFA 1USUA 2ICAA 4PYKA 2RH4A 2ON6A 1Q7GA 1UEJA 2OE2A 4XX0A 4GMHA 1JH9A 1XL1A 1JU9A 1TO2E 3F67A 1ZM2A 1M0SA 4IXTA 4JC8A 2OECA 3BMOA 1PZGA 4TL6A 1MXHA 2AOTA 5HFJA 1N34B 1IZZA 2YWEA 4B40A 1SG0A 3IP5A 3ZCPA 2V9PA 2Z6QA 1T8TA 4I5FA 1V8DA 2G5CA 3UENA 3U56A 2QRZA 2IPXA 4UNIA 1QAQA 1EIWA 1N7JA 3NNSA 3DTVA 3WGHA 2COUA 2P7HA 3F5DA 1UOQA 3IP9A 3QPUA 3VVBA 1W94A 1OI7A 4ZDKA 5KWVA 2A1TS 1M6HA 1YR8A 2OBFA 3HCRA 2V98A 5FAKA 3FMPB 1RYFA 1V4VA 2FFRA 2XI4A 3EZ7A 4BB6A 3DL7A 2G1UA 4EPRA 5JI2E 2XF2A 4H6PA 1Z68A 3M6IA 3MGAA 4FYYA 4UBKA 4O2BF 1LI7A 1SB9A 4GG1A 1C81A 4QDTA 2BISA 4EX7A 3RJTA 4B8ZA 3VNVA 3JAKA 5KHAA 3WWZA 1CUIA 4DQDA 1EVJA 3TE6A 5HKKA 5FWXA 5M7EA 3ZGYA 2HSWA 5BWCA 2YJ5A 3IEPA 2WFLB 3P9NA 3DWIA 2XCIA 5CLJA 3JQ6A 1A2QA 1XRMA 1ZQ1A 2P3SA 3MT9A 3D3QA 2GPJA 4AF6A 2PEYA 3UT5A 3T54A 4MQEB 1G1AA 5CTAA 2J32A 3L8DA 3R6WA 3RIHA 4EVIA 4A5SA 2QQFA 5FUMA 4YJFB 2G0NA 1T2DA 1C7QA 1ZHFA 3QPCA 4JA0A 2P41A 1QLWA 4GOJA 2XD9A 1LF5A 5A9SB 1P74A 1C4KA 2V8OA 4FILA 2C83A 2HSZA 3AEUA 2E4ZA 4UM7A 5JO9A 4HNSA 1PS9A 2DX7A 2XCQA 3C3XA 4L8YA 4BFXA 3PXGA 1MOQA 4JKOA 3NTQA 4Z2YA 1P0MA 2B25A 5TGZA 4DHWA 4US1R 1HURA 3AIOA 2Y27A 5B3JA 1XGKA 3ESCA 4LSMA 2AG0A 2GXSA 4MV4A 1DV1A 3EASA 1NXSA 3OD5A 4CDMA 1TE2A 5FDFA 4DVJA 3HKBB 1B93A 4UUQA 4X44A 1XX6A 4C22A 3SYTA 3VDNB 4X95A 4UOZA 1JHOA 2CDAA 2YV5A 3GAAA 3ZIUA 2RH5A 2XVMA 1WDMA 5AI4A 1GD1O 4ILKA 4WVLA 3TRIA 4ZHQA 2P35A 3I5XA 4Y67A 1CRWG 3VGJA 5JAZA 4LYHA 3RVBA 4AK9A 1LU9A 3PHGA 2PKEA 2HGZA 4FZ3A 2O8EB 1U7PA 1J0EA 1NBMA 3DW1X 1JTFA 2IS6A 2V7TA 3A25A 2W6CX 3HCOA 4TMWA 4IIBA 4RK1A 1CY8A 1Q0QA 3D6MA 3O9MA 4JQSA 3RSFA 3NXSA 1DT3A 2PT9A 4DDWA 2WINI 3PYLA 3BDAA 3LCRA 4L5IA 4GPEA 1SC4A 1XEXA 4GOND 2LV8A 2ZANA 2Z3WA 3ETLA 4IDGA 5A5GA 5L95A 5CHEA 1LF0A 1NFQA 3DMFA 3SOZA 4HC4A 1F06A 3MB8A 3T1QA 2OEPA 1KVRA 4LBVA 4C06A 5KDDA 3PEWA 3T7AA 3KQSA 1X6VA 2PMCA 2XUHA 2DM6A 3SFTA 2YBDA 4AMGA 4B83A 2HMSA 4DR2B 2B3DA 4N0DA 3H8SA 3UGKA 5ED0A 3FUXA 4EG1A 4D0SA 3TEFA 4ZI7B 5D6NA 1JHQA 3H4TA 5B4UA 5BV8A 3D6JA 4UHDA 5D3KA 1DRWA 2O1EA 5EWJA 1Y63A 5BSUA 5KOJB 2FW1A 1LSSA 4GEKA 1FRVA 4L2IA 3A9VA 4NJMA 1WPQA 1P72A 2D00A 2VKQA 4OLAA 3KP1A 1JP7A 1W8IA 2IIQA 3KV3O 3ZH9B 7REQB 3JQPA 4OAPA 5D8DA 1IFXA 3HA3A 3SQLA 1DOHA 4FTWA 1PRYA 1ZJJA 4WKOA 5EWMB 4IOJA 1PFGA 4WBNF 3FI0A 2Q3JA 3D4NA 3FAZA 1O3YA 3BRWD 4IY1A 4QL3A 2ZUBA 3BAZA 2BRUC 3V9PA 1Q0UA 2BE7A 2QRNA 4HGQA 4YCSA 5K5EA 2E0IA 4L9WA 4IWXA 2PR2A 1QP8A 1S7GA 1EFDN 3G23A 4Q19A 2J85A 1EDZA 1N0WA 1QHSA 2V6GA 2QVBA 2GVZC 4L95C 1IUPA 3PUHA 4YO7A 4D43A 1UJ4A 4Z53A 1FYVA 5IDYA 3WRXA 4Y6PA 5EGSA 2X42A 1RYMA 3WNDA 2AC4A 5KI6A 4IWNA 3L7DA 3HR4A 1J42A 2TECE 4UFNA 4NOJA 1NUQA 3HJTA 1XL0A 2DAPA 4RZXA 4E21A 4AL4A 3K71B 5EOVA 1VRCA 4OHRA 4QYWA 4B46A 4UNPA 4W8HA 1FBNA 1F8YA 4IIJB 4IZHA 3RW9A 121PA 2P4UA 1VL5A 2F59A 5T4EA 3D8NA 3CVWA 2C00A 1VE9A 2HBYA 4U02A 4UPDA 1XVLA 4L74A 3DDWA 1WO8A 2V54A 2WYWA 1VFPA 4A10A 1XZGA 2JEOA 5EMNA 4V0OA 3B1JA 1G63A 2HEGA 1Y1TA 1X39A 3H9QA 3HJNA 4HDNB 3PXXA 3VRHA 4Z4HA 3N1UA 1GTMA 3RU7A 2HJRA 1BHO1 4L85A 1N2HA 1W25A 3VC3A 1QIJA 4UTVA 2W2MA 5LNK1 1QANA 2QRMA 3DWEX 1ID1A 4PO9A 4PO3X 4FWBA 3A0UA 1WQ3A 3CYFA 1E9BA 4XB2A 1XHLA 4IZIA 4KO3S 2C96A 4KAAA 4PZ9A 4TMVA 1EE2A 5D1NA 1EX6A 3EK2A 4EA6A 1W73A 3LBYA 3A31A 5EZSA 2GCEA 2VNSA 1M1XB 1QH8B 2CMFA 3B20A 4Z9FA 3PCTA 2ZJZA 4WGGA 1XXLA 4X20A 2R1VA 3CCBA 4A6XA 3QNMA 3HM2A 3T5PA 1CQPA 16PKA 3O73A 4L76A 3NV7A 1GFWA 4YCMA 2NGRA 4HRVA 2Y1KA 4IPTA 3R3ZA 2QA5A 3WTCA 4US2R 1TVKA 4G0MA 3DE4X 1SD1A 3V8EA 5I47A 4G0YA 1W9HA 2Z58A 3Q8MA 4YDQA 1WZIA 2Q6TA 2DKFA 1WW3A 1EFRA 1C1HA 2DQYA 2CGEA 2JI8A 4C3VA 5B7QA 1ZK1A 1G8AA 1SRRA 2ECFA 2HAEA 3GOQA 4R01A 3DE0X 4HYYA 1WY7A 4XGKA 4Y9SA 5JQGF 4W99A 4RIGA 3IDSA 3BE4A 4OXQA 4W1RA 2IUSA 2UZ0A 3IDZA 1TK3A 2VPZA 3JW8A 4ZQHA 3RE1A 3MRXA 4FFVA 3UAXA 1KDVA 4FOLA 1DLJA 3OM8A 2JLYA 4HX9A 4E3ZA 4RPGA 2WJIA 3DKKA 3E9NA 4NMMA 1CUCA 2FSHA 1QIHA 3GP5A 5BWNA 2Q1XA 1B8VA 1QHGA 5CNMA 4GLFA 3VGPA 1X0XA 4REMA 3UN1A 2RHLA 3OQHA 4YT8A 4PQRA 2Q2WA 2RK4A 3B12A 2IV7A 2VUTA 3NHRA 4IVRA 1NW7A 2AS0A 1X7GA 4DLWA 1X86B 3QX9A 4L5YA 1K7FB 4BNKA 2JH8A 4E5MA 5KWEA 3F3YA 3HKDB 1XCBA 4H4DA 3WDMA 1NXXA 3SQDA 5BQOA 1J99A 5DWQA 2R4TA 2YUIA 3TQRA 1PSZA 5CLQA 1TJ4A 2PBRA 4R7GA 5BN3A 3Q8LA 2QNIA 5DM1A 3UHOA 1PS0A 2IPNA 5EXTA 2VZ9A 1L4UA 1PGQA 5HWSA 4MUNA 3P20A 1HE2A 1NDQA 4GR9A 3SVLA 1V3VA 3OF3A 4KBYA 4LYAA 2QUKA 3DZBA 3DD1A 4NBUA 4YQYA 5ALRA 2WMDA 1MW9X 1XZFA 3AC0A 4ARAA 4EYEA 2UVPA 1Y7IA 2FQYA 2PZAA 1IIBA 4YAIA 3K1AB 3BH7A 5FNVF 3ZGNA 4K40A 1JSXA 2X0FA 1G3UA 1H2WA 5GM1A 2C8KA 2VDMB 4B3BA 5CIYA 2NZXA 2QHXA 1YC2A 5F78A 3T99A 2JHGA 1E5VA 2PUGA 1Z75A 3BWDD 2VJPA 3T4XA 4C76A 1KE2A 4GOMD 1PR2A 3RSCA 3DXFA 1E4VA 1XTUA 2NUAB 3FCOA 1DSSG 4KTVE 4MLDA 4DCGA 3A1WA 4NMXB 1T13A 4MGEA 2VDRB 3FGOA 4QXAA 4PLPA 1V1MB 2IW1A 2B30A 4C1BA 2FCRA 2VATA 2L82A 4QGFA 4NOLA 4EB0A 2WDPA 4F5YA 3TGPA 1VMEA 1ZD3A 1Z25A 2J4CA 1Q16A 3KSDO 3RBXA 5M2QA 3RJMA 3Q72A 3AESA 3A9UA 4GP7A 3FDIA 1C1DB 1RWKA 1ZPDA 3LGAA 3EY9A 1GN9A 2EL7A 3L77A 1NIJA 1O8BA 3W8DA 3ASYA 4OIMA 2Y0PA 2WG2A 3RG2A 3SBOA 4Z4CA 2WSMA 3QEAZ 1LLUA 2PRZA 1OXKB 4IINA 2QTMA 4XYGA 5B2FA 3JQ8A 1BDBA 3LCVB 2G04A 3BRSA 1P18A 4WOCA 4Z9YA 5FI3A 4PQEA 2B4KA 5ARDA 1NV9A 2B37A 3ID6C 1V26A 4LE2A 5BPFA 1JR3A 1CKEA 1KH3A 4RELA 1NC1A 1C3VA 2PU5A 4LXIA 5UKDA 3LCUA 1KGSA 1TNDA 3EMBA 4PS0A 4GI7A 4TLBA 2I34A 4XGRA 3EPKA 3F6PA 2IC5A 2UUBB 3RUIA 3WKDA 3S5UA 3JYHA 1JEQB 4RD3A 2BEUB 2HK7A 2V8BA 4OP2A 3B7WA 1R50A 2ZYUX 4CQLB 2WILA 3O9ZA 2V97A 4F9GA 4MW5A 2WICA 4U2EA 3M1YA 4RUKA 4HXFB 4D3YA 5CFRA 3ZEIA 1RNLA 4XRRA 2QG9A 3WNQA 4ANFA 1T2EA 1Z0IA 5LUAA 5BSVA 4G85A 2PZ8A 1E2UA 3MIZA 4HJXA 1U2PA 2FJUA 2VYFA 3R5SA 1LLCA 1TIKA 2AEFA 1Z22A 2WTNA 4MKHA 1RZRD 3VXKA 1J09A 1DCMA 1MAWA 1IQPA 3EXIA 2EC5A 3A1DA 5EXXA 3SOPA 5KC9A 4S35A 2CKMA 4BNZA 4B74A 3AUYA 4GKAA 3U3XA 3GFFA 1KI6A 2CXQA 3G9QA 3DNFA 4DCPA 4QAQA 4IVPA 1AKVA 1VCNA 3TCKA 2BFEA 2FA9A 1EJ2A 2MINB 2J0UB 2VJCA 2VZLA 3PUVA 3SS8A 1PP4A 1H6AA 4RFSB 5JZBA 3PXBA 2EFHB 4B6QA 3D0RA 1IBRA 3TW6A 4BOYA 1C2YA 5CA1F 5IXSA 1DBQA 4RK5A 1QRTA 3LXUX 1EVEA 4WE3A 5EQTA 1CWUA 4ALIA 2JIDA 2RB5A 1NPYA 1T0PA 1NHWA 2XWJI 3DJFA 1K8XB 2H4JA 4A0SA 3EVGA 1Q50A 1NKSA 1SO8A 2O05A 2WJGA 4Q7LA 4DQVA 2VRBA 5CVUA 2MMCA 2B0CA 4H1TA 3R7AA 1WU7A 3GGGA 4RSGA 2KPOA 3VU8A 2GDZA 4RFLA 5E1OA 4YRBA 2BHRA 4LOIA 3F7MA 4P58A 2CL0X 4JJAA 4MHOA 4WRRA 4N5HX 4Q9DA 4YJ3B 3PHHA 4GICA 1P60A 3Q7SA 4IXMA 3J7AC 2M6KA 4FNMA 2GR9A 3AB3A 2JHFA 4K1LA 1H65A 4RENA 2RH8A 1WLYA 3L7BA 2XQVA 5GJBA 1RYBA 2JGJA 4TYQA 5L45A 2QTBA 3RM3A 4UEJA 3IIJA 3IMGA 4DV1B 1H2RS 1OX4A 1PDVA 4UKDA 2HIAA 3UWOA 4WXPA 2B8NA 2F3UA 2ZB8A 2CYCA 2CN1A 1TM4E 3H13A 1GPLA 3B9QA 3OLYA 1AE1A 2Y71A 5EXPA 4W5OA 1VTKA 3LOPA 4RIIA 4MVJG 4MGZR 2PHZA 3B1YA 1TIPA 4ADSG 4IVNA 2DPXA 1KTIA 3IUPA 4HEA6 3CNQS 5F7XA 3C1OA 4W8OA 4L5JA 4KKVA 1SUIA 2G06A 1KBQA 3G0DA 4UASA 4DANA 3L9XA 3KR2A 4E0BA 3UTCA 5FCDA 1BJKA 3AR6A 3D8RA 5IYZB 3OFVA 5IVDA 3HGMA 1MZPA 4TSKA 2FEKA 3LBNA 5A05A 2QJRA 4XWOA 4BEJA 2L18A 2D1SA 2X1VA 5G0SA 4RTLA 4TTAA 4JBLA 3UK2A 3MCAA 5FH9A 5A04A 5J2UA 1VHLA 3JQRA 2BBOA 2HZBA 3LK6A 3UAOA 1C5KA 5DBGA 3V4LA 2D59A 4BBZA 1LJ8A 3PDCA 3WQQA 1IOVA 2R6FA 1ULAA 4UCQA 1Y1PA 1KQPA 4ASUD 3TYXA 4W7HA 4QU0A 3TMKA 2KSQA 1VL2A 3ZV7A 4QPNA 5KCZA 1W30A 4YP7A 3OLVA 2AKYA 3QPAA 3JWEA 4JJ7A 3MZ0A 3IA7A 1QGUB 3HSKA 2GK6A 3IBYA 4UNQA 1IOWA 4OSOA 2OYRA 4H1HA 2C42A 3G8DA 4JI1B 1NP7A 2CUKA 3RVKA 3TL6A 4RTNA 1R9GA 2AFHB 4I14A 3RS3A 4W1SA 2NO4A 3GO4A 5IXJA 2NZ8A 4HPXB 1CP2A 1XEWY 2M9MA 2OA0A 2POQX 2X1HA 5JTTA 4L4XA 2WKSA 2VQFB 3EIWA 1Q0TA 2VP6A 1V8PA 1PTKA 3T3IA 4IILA 5BURA 1R6BX 1CEQA 1XR3A 1TZ2A 2ZJ3A 2UV8A 1YONA 3LQFA 3MMPA 4MZXA 1PDWA 2F17A 3OLXA 2YY5A 3TD9A 5HR5A 2O07A 3CISA 3CRW1 3WA6A 2ZUUA 2O7SA 5DJ5A 2J3MA 3LOQA 3N2KA 1BWPA 5CNJA 3H9UA 1A0OA 3VR1A 2P4EA 4JASB 5B1HA 3VAAA 3UOAB 1O9BA 2HEIA 4U0KA 5K8CA 4B7AA 1PNOA 1G9SA 4FR5A 1U4OA 3CF2A 1EK1A 3C3BA 4V1CA 4LXTA 1PYGA 1H2HA 1E5XA 1M34A 3EVEA 3UG7A 1JQ3A 3R7NA 4D3ZA 1A9XA 4A8JC 3MOIA 3OM0A 1F6WA 5L7WA 1EHYA 2FN8A 1OB5A 2RIRA 4FGKA 4NC9A 1R8QA 4LDQA 2ZJYA 2OAEA 1X1EA 3FPLA 3Q40A 4R41A 1YSCA 3D64A 2EQBA 2HXYA 3M4ZA 1GIAA 1GL9B 1K98A 1RQNA 1WMEA 2H2DA 2BJWA 2VNHA 2OAGA 4Y6GB 1XFAA 2PJZA 5ALTA 2YVUA 4TVSA 1E1KA 2YVKA 3IDFA 4GX2A