3QV2A

Structure analysis of entamoeba histolytica methyltransferase ehmeth
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
320
structure length
320
Chain Sequence
QKQVNVIEFFSGIGGLRSSYERSSININATFIPFDINEIANKIYSKNFKEEVQVKNLDSISIKQIESLNCNTWFMSPPCQPYNNSIMSKHKDINDPRAKSVLHLYRDILPYLINKPKHIFIENVPLFKESLVFKEIYNILIKNQYYIKDIICSPIDIGIPNSRTRYYVMARLTPFKNEIQLHQEKESMISNYLDNNVNESYSIPSDLILKKGMLFDIVGKDDKRTCCFTKSYTKIVEGTGSIYCPIEPHFIPVKKAEDLLNKNLRYFTPNEIKKIHGFSSNFTTQIDGLTDKQQYQCLGNSVSCFVIAQLMEYLFDDLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-cytosine DNA methyltransferase
publication title Crystal Structure Analysis of Entamoeba histolytica Methyltransferase
rcsb
source organism Entamoeba histolytica
molecule tags Transferase
total genus 98
structure length 320
sequence length 320
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00145 DNA_methylase C-5 cytosine-specific DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qv2A01
3.90.120.10 Alpha Beta Alpha-Beta Complex DNA Methylase; Chain A, domain 2 DNA Methylase, subunit A, domain 2 3qv2A02
3BGVA 4RVHA 5EMKA 4DCGA 5KYGA 4RVDA 4RTPA 4YMGA 3M70A 3ELWA 1I1NA 3KPJA 4C07A 1NKVA 2VDVE 3P71T 4DM3A 4XCXA 2YXDA 4AZWA 4AX8A 2AOXA 5T67A 4RVFA 3MTEA 5DM1A 2AVDA 4HRAA 3VC1A 5EMJA 4BLWA 2IBTA 2B78A 2AVNA 3LKZA 2PV0A 1MHTA 2FPOA 4P7FA 1B42A 1L3CA 2IP2A 3HNRA 3PFHA 3TPZA 5B1SA 3OU2A 2I7CA 2BR3A 3JWHA 5K0NA 4YUYA 1JSZA 4CTKA 3G2QA 1XVAA 5DSXA 4QTUB 1XCLA 3TLJA 3UZUA 4ER7A 4PYJA 3GU3A 3PX3A 4C03A 4PIMA 4X63A 1EQAA 2ZBQA 5BW5A 5HILA 2AOTA 2G71A 2OB2A 3GRRA 3MHTA 1YFJA 2JHCA 2ZBPA 5HFJA 3RIEA 2IDKA 4Y2HA 4OA5A 3FPEA 3ELYA 4R05A 2HNKA 4RVGA 5BW4A 1L1EA 3LCCA 1VP9A 5K0GA 4OQDA 1RI3A 1RI1A 2P3OA 3NWBA 1EJ0A 4ISCA 2VDWA 1R8YA 4FGZA 4CXMA 3UBTA 4AZVA 1P91A 3EVGA 3M6VA 5GOZA 3BWCA 1WZNA 3SSMA 5K01A 3E05A 1Z3CA 3BZBA 5DM4A 5FQNA 5LQKA 3OU7A 4E30A 3KQSA 4DZRA 3KQOA 4PYNA 4JXJA 1QAOA 2FK8A 3KQMA 5C1IA 5LQUA 2V74B 5DX8A 5K03A 2OPBA 1X1DA 3MB5A 3O7WA 5EIWA 1FPQA 1KP9A 5EOVA 3TM5A 1VQ1A 5K0FA 3DXXA 3M6WA 1JQDA 3FPHA 3FPJA 3AXTA 2GH1A 2EX4A 4R8SA 1XTPA 4P7KA 4QTTB 3C6KA 1PJZA 1VLMA 2XYQA 3LCUA 4YUVA 5H02A 2OXTA 4E2ZA 3BKWA 4RTJA 2Z6QA 2FK7A 3A26A 2YVLA 3GRVA 5P8WA 3KPWA 1DCTA 2AOVA 1RJEA 2BM8A 3HVKA 5CD1A 3O31A 2PX5A 3ER8A 4PGGA 4R6WA 1UWVA 4CWAA 5EPEA 3CVOA 1G38A 1FP2A 2ZULA 5EIFA 2G1PA 3G89A 3BT7A 2C7QA 5DPMA 3KR0A 3BGDA 3CBGA 3FTFA 4GOLD 3EVAA 5DM0A 3A4TA 3THRA 1QYRA 3I5UA 5DWQA 5HOQA 3A27A 3D2LA 3DXYA 3GDHA 2AOUA 2OY0A 3FRIA 1EAMA 3GRYA 3UJ6A 2P3LA 5FA5A 1OR8A 2HV9A 3BWYA 5CUQA 2B25A 5E2BA 3E7PA 1SKMA 3JWGA 5ERGB 3MAGA 3QV2A 5CCXA 3P9CA 3R3HA 2UZ4A 5CCBA 4DQ0A 2VDUE 4E2WA 2EJUA 5K09A 2BR4A 4PYOA 3P9NA 1PRYA 1NBHA 2UYOA 1JTFA 1XJ5A 2AR0A 2UYCA 1NW5A 1NBIA 3HP7A 2ZWVA 1HMYA 3NDIA 1JG1A 3KR2A 2P7IA 1FP1D 1XXLA 1VE3A 2QE6A 3UJ9A 3NVMB 4RTKA 4GUAA 3DP7A 3G2OA 2YQZA 1JSXA 2PBFA 3OE4A 4KDCA 4BLUA 4BP1A 5E1BA 4F85A 1INLA 1KYWA 2YXLA 1N7IA 3F4KA 3I53A 3DTNA 3KQQA 4P7GA 3G8AA 5E1MA 2PVCA 5BP7A 2P8JA 2B9EA 2ZLBA 4OBWA 2CWWA 3LPMA 2IH5A 3DXZA 2NP6A 4RTMA 5FHRA 2QY6A 2GPYA 2Y1WA 3HA5A 3UJCA 3G88A 3T7SA 5IH3A 4ER6A 1X1BA 3KQTA 4YV2A 2NYUA 1EG2A 2R6ZA 1ZHFA 4KIFA 4RWZA 1O54A 5LQNA 3TOSA 4GOOD 1JG2A 4YUZA 5F2KA 4PINA 3MERA 2OYRA 2ZZMA 4KDRA 1QAMA 3MQ2A 3EGEA 2PKWA 4DMGA 3CJQA 4FSDA 2PXCA 1SVUA 3KPUA 5DXAA 2PWYA 4R8RA 3OCJA 4M36A 3T7RA 1QANA 3A25A 4PYLA 5EHIA 2YTZA 2JG3A 1FJXA 3GIWA 3VSEA 1M6YA 2JHPA 2PX4A 5CVDA 3KU1A 5HIJA 1R8XA 4YUXA 3FRHA 3HCEA 3NW9A 4XUCA 3LCVB 4RTQA 3SVZA 1H1DA 5LQCA 9MHTA 2GS9A 5FWAA 3DMFA 4A6DA 2PGXA 1RJFA 3B3FA 2BM9A 2HMYB 1UFKA 2BH2A 1KR5A 2VZ9A 2ZIEA 3AXSA 3MCTA 4QPPA 4DF3A 5EEHA 3BGIA 2NNWB 4FSXA 4HSGA 2G72A 3E8SA 3EGIA 5FULA 5HIKA 3CJRA 2PT9A 1P1BA 4UOEA 5KVAA 3DMGA 3H2BA 2KW5A 1R6AA 2I6GA 2ZBRA 1TPYA 2CMHA 3UJ8A 4ER0A 3Q87B 1TW3A 1XDZA 4GC9A 4F84A 3LBFA 4WXHA 5GM1A 4C06A 4RX1A 4LECA 2QRVB 3NDJA 2B2CA 2HR1A 2Q41A 1AQIA 2ERCA 1NW7A 3LECA 2PX2A 5DRYA 1QAQA 3DLIA 4C04A 3BXOA 4RTLA 1NE2A 3TFWA 2P41A 2H1RA 2WA1A 1AF7A 3BUSA 3DOUA 2NXJA 2UYHA 3C3PA 2ZSUA 4P7JA 1MJFA 4PONA 2P7HA 1L3BA 4PIPA 2XBMA 3PB3A 3OZSA 2G70A 4Y30A 4E32A 3G7UA 5K0EA 3UJ7A 3NMUF 3KQVA 3K6RA 3UJAA 4CKBA 1YZHA 3MGGA 4YV1A 3O4FA 2FRXA 5GWXA 4BLVA 4E31A 4FR0A 2PT6A 4POOA 5FTWA 4A6EA 1Q0SA 2AN5A 4MQ4A 5EC8A 3HVJA 1VBFA 3HCDA 4PWYA 5EHGA 3BWBA 3X0DA 1V39A 1IXKA 2IGTA 2PSSA 5EMMA 5HZMA 3CCFA 2C7PA 2P40A 1ZG3A 3P9IA 4GOND 4FP9A 5K0JA 1P1CA 3HCBA 1JR4A 3EEYA 4KVZA 5ICEA 3LGAA 5EG5A 5D1HA 4B17A 3FYDA 3LDUA 3LSTA 3NJRA 5DX0A 4OX9Y 4RTOA 4EQZA 3GCZA 4EK9A 1VIDA 2O07A 1D2HA 2F8LA 3L8DA 4MTLA 5F2OA 5GIOE 2P1DA 5U4XA 1WXWA 4X60A 1ZGJA 5FUBA 3CKKA 5E1OA 4BY9E 1I9GA 3BWMA 3HCCA 1YFLA 2ONZA 5E2AA 1EIZA 1T43A 5DRTA 1P39A 2QM3A 2OB1A 4M7RA 1O9HA 2IIPA 3BKXA 2VS1A 5EZSA 4U7PB 3OFJA 3R0QA 1NV8A 2YR0A 5KQSA 3G5LA 5GIPE 3MCZA 3EVEA 3EVZA 1ORHA 4MWZA 2K4MA 3IHTA 4AZTA 1SQGA 2AOTB 3PT9A 3R6TA 3EVCA 3SSOA 2ZZKA 5CVEA 4EKGA 5FHQA 3V8VA 3ANXA 1KPIA 3M33A 5DTRA 5IKMA 2EJTA 5FCDA 2HWKA 1R00A 4EVIA 1TW2A 5M5BA 4YMHA 3FUTA 3FYCA 3OZTA 1RJGA 1XCJA 2O05A 5K0CA 1Q0TA 4FZVA 3TM4A 4GQBA 2ADMA 3OFKA 1R74A 3LL7A 4V0RA 1L9KA 4U7TB 1SQFA 3ELUA 4FT2A 4G56A 5E8RA 5K0LA 2YXEA 3OU6A 3Q7EA 1RI2A 2H00A 2YUIA 2XYRA 3SM3A 3P2EA 3HM2A 1ZGAA 3B3GA 1L3IA 2OO3A 2PY6A 3B89A 5GM2A 4HC4A 4PYKA 2NXCA 2O57A 4EMSA 2N47A 5K8VA 2Z6AA 4PYIA 4Z2YA 1YUBA 2AOWA 5FA8A 1SG9A 3UJBA 2I62A 2ZCJA 1FBNA 2O06A 1X19A 2R3SA 5JUWA 1VPTA 2ORED 2ZIGA 5CIYA 5FADA 4IV0A 2QRVA 3M4XA 2ZW9A 1U2ZA 2VP3A 2NXEA 2Z6UA 4AUKA 2V7EA 4P58A 5FWDA 1WG8A 3KKZA 5JR3A 2GLUA 2XYVA 3DR5A 4YUWA 3KQWA 4O29A 1KPHA 4X61A 3TR6A 4QQNA 3TQSA 10MHA 3LDFA 4L7VA 5CVJA 3TKAA 4HGZA 2P3QA 4R6XA 4E2YA 2C7OA 3R9XB 1G55A 2DULA 3CC8A 3GRZA 2I9KA 2IH2A 5DM2A 3SR4A 4GC5A 1RJDA 2ZTHA 5K0BA 1KIAA 2AOUB 4KRGA 4WVLA 4LWPA 4XUEA 4FS8A 3R24A 2NP7A 5E9JA 3CGGA 1JTEA 3IYLW 4GOMD 4MHTA 3DUWA 3KPVA 3ER9A 4GBED 5C0OE 3VYWA 2OZVA 3KR9A 5EMLA 3REOA 2IPXA 2JHAA 4E70A 1DL5A 3UA3A 3MTIA 3V97A 3UJDA 3AJDA 1SUSA 2BR5A 3I64A 4RV9A 4V0QA 3LDGA 3DLCA 5CVVA 5LQRA 3DH0A 4RYLA 1JQEA 3K0BA 2GAFA 3OE5A 3T0IA 4YV0A 1X1AA 1KXZA 5LQAA 2G8NA 4LG1A 2CKDA 2PX8A 4HG2A 5DLYA 3SMQA 5ICCA 3B3JA 4X1OA 3P2IA 2AN4A 3C3YA 4CKCA 1JG4A 2IBSA 2DPMA 2HTEA 3AY0A 3HCAA 3T7TA 5LR6A 2PXAA 3FTEA 2ZFUA 3KHKA 3E23A 4QDKA 3AWIA 3C6MA 4PYMA 4CTJA 1UIRA 2FHPA 1F3LA 5HIIA 3B5IA 4C4AA 1NW3A 3NTVA 1NW8A 2EG5A 5E9QA 3I58A 5BXYA 5EZQA 5LSAA 1YF3A 3THSA 2LD4A 2XVMA 4KIGA 3M6UA 4DCMA 2NXNA 3ELDA 4M37A 5ICFA 3PTAA 3HCFA 3A7EA 5F2NA 1AQJA 5EGSA 2BZGA 2OBFA 3KQPA 2O0LA 3GGDA 2ZIFA 5CM2Z 2JJQA 3PVCA 1IY9A 3GWZA 5G02A 8MHTA 1BOOA 3G5TA 1BHJA 4DA4A 3FTDA 4HTFB 3PFGA 4QVGA 5CVUA 3B7PA 3DMHA 3FUXA 5EQJB 2IDJA 2B3TA 1I4WA 5E1DA 3M6XA 2WK1A 3TRKA 3EPPA 3P97A 4RTRA 4PGHA 4E2XA 5DTMA 3KPYA 4OQEA 1WY7A 4ER3A 4AZSA 3SGLA 1M6EX 3GO4A 4M38A 2P35A 4KWCA 1N7JA 2AN3A 5C9ZA 4RTNA 3LX6A 3U81A 2E5WA 1RI5A 3UFBA 1R18A 2AS0A 2PLWA 3ID6C 4QVKA 3JWJA 3ORHA 1EJ6A 4PCLA 1WXXA 3GNLA 3LKDA 5DXJA 4NECA 5LQJA 1G60A 3HVHA 2XVAA 3VC2A 5T6BA 1VP3A 1BKYA 3EMBA 3HA3A 2H11A 3KR1A 4MIKA 3SXJA 1DUSA 3FZGA 3IEIA 2PWPA 2JH9A 2ONYA 3G2PA 3RW9A 1AV6A 3FUUA 4CKEA 1N2XA 2IFTA 4IV8A 2EFJA 4QQKA 3WSTA 4PNEA 5DSTA 1D2GA 4FT4A 5FQOA 3RODA 3PLAE 3HEMA 1G8SA 3TMAA 1IM8A 2QYOA 2UYQA 1F38A 2OKCA 3LHDA 3OPNA 3A7DA 4IWNA 4QDJA 4C08A 4GEKA 1G8AA 1RI4A 2GA9A 3PS9A 4X41A 3EVBA 2FYTA 3LBYA 4PCAA 1BC5A 3ERCA 3C0KA 5HIMA 5ICGA 4BP3A 1KHHA 3G2MA 2CMGA 4LWOA 2FCAA 5T64A 3EMDA 1Y8CA 5HEKA 3FPFA 2IH4A 5EKUA 5K05A 3P2KA 3SX0A 1M0EA 3UWPA 1JQ3A 3JWIA 3EVDA 4XUDA 4ER5A 2CL5A 3HTXA 2C7RA 1NV9A 4C05A 1JG3A 5E9WA 3FTCA 1ZKDA 3DULA 3PX2A 3NVKI 5DX1A 3ME5A 3FUVA 3GRUA 3CJTA 5GP1A 2JH8A 2PXXA 3GXOA 1YB2A 4HH4A 4K6MA 5EVJA 4OBXA 2ESRA 3EGVA 3SSNA 2A14A 3KQYA 4DKJA 4GF5A 2ZVJA 4ATNA 1XDUA 4PYQA 4QPNA 5KS2A 5KQRA 2PJDA 3NWEA 3GJYA 3FPGA 4IKPA 3S68A 1G6Q1 2AZTA 3QOXA 4RTSA 3EEOA 1NT2A 4ZTBA 1ZQ9A 3G8BA 5E8JA 1VL5A 3QOWA 1NW6A 1KPGA 1XDSA 1SUIA 2ZWAA 4RSRA 5DTQA 5MHTA 4HGYA 4F86A 1ORIA 1QZZA 1O9GA 1D2CA 1X1CA 5GINE 3IV6A 3HA7A 3I9FA 4H0NA 4KW7A 4OA8A 5EKXA 3TKYA 5D1NA 2ZZNA 4EKIA 1WS6A 5DT2A 3HVIA 7MHTA 4E33A 2WA2A 3UA4A 3EVFA 3P8ZA 3OZRA 3P9KA 1YZ3A 2GB4A 1KYZA 2Y1XA 3FUWA 2YX1A 1HNNA 4HTFA 5EEGA
chains in the Genus database with same CATH superfamily
3UB4A 2ENUA 1Q0HA 4FR2A 5FBHA 3ZK9A 1JL3A 4AJPA 3O93A 3TR5A 2HIAA 4E7PA 2WPDA 4LJ4A 3L7MA 1E1KA 5EYPB 4Z1MD 1NM5A 4XM1A 3WJ1A 2FN7A 2YMQA 3NCHA 4DM3A 3L0YA 4EI2A 2CYBA 3KSMA 2BMWA 4EYEA 3GOQA 1TCUA 1G3RA 4B4KA 1H0RA 4L9SA 2IBTA 5T3YA 5H8WA 1IPHA 3A06A 3W4KA 1KYYA 1EX7A 4P7FA 2CXNA 4PGMA 4TSFA 4UBOA 5AJVB 4BV2A 4Z3DA 2XRZA 2H4FA 1EFDN 2N9UA 3C1TA 3JZFA 1DAGA 2CLSA 4RA9A 1T5OA 4R8VA 4RS3A 2PX6A 2H51A 1NNUA 4PZEA 1EFVA 4LXIA 4Y0AA 3TJZA 2FSFA 2QX4A 4K6HA 2PT7A 3VUFA 1H3FA 3H65A 4I1OA 4X63A 3ZWWA 3H13A 2GKOA 2BIFA 1ZSYA 3ZDZB 4CKBA 3M1IA 5KTPA 1JWLA 1HT0A 1QZUA 4ZZIA 4TUYA 3SDZA 3G9QA 3N7UA 3TD9A 4FGLA 1NF2A 1LS1A 3WE7A 1CX9B 2BZ0A 4CDGA 1IHUA 3RYTC 1FFWA 4R2LA 3SHOA 2QMOA 4X71A 4PHTA 2QE7A 1PHRA 4OH7A 1EHYA 1U8YA 2JKYA 4MV4A 2R5FA 4AO7A 1R0LA 5FYDA 5KPDA 2QV0A 1A7UA 3DTVD 3CZAA 1VI2A 2JIRA 4B7CA 4P3NA 3QFRA 3SSMA 2CV2A 3V6MA 3L07A 4TXMA 1PWEA 4IJKA 3CG0A 1KY4A 3KQMA 1U8UA 1WDKA 3SQOA 2HKIA 3PGXA 3ZG6A 4GZ6A 3NAQA 5K0FA 1Z08A 3TFOA 5DIFA 4RZ3A 4S12A 4X7MA 3UUFA 4EZIA 2DBQA 1I0IA 1II0A 2W2OA 4WOCA 5ALMA 4F2DA 4QTTB 5LXTF 2PNJA 1SIWA 1IOVA 2GF0A 5KC9A 5ENDA 1UC5B 1BXKA 2PDAA 2P1ZA 3WZLA 4L78A 1CJUC 3DV9A 2G04A 2IUYA 2VXCA 2I03A 4O2AA 1EXDA 5AM5A 1PP4A 2YASA 4QUDA 3OTOB 4HN4B 2ZAGA 1YR9A 1XZAA 3ZC3A 3LKBA 3EG9B 3OLZA 1RP7A 3TN7A 1VCMA 2IK8A 2YNMA 3CVOA 3RLIA 1I8TA 2RHDA 2NW6A 3EWSA 3EWAA 3NUGA 1ESZA 1FCJA 3AO0B 4DLWA 3M1AA 4NYMR 3R9XA 3HUFA 4ZO8A 2GCOA 4BNVA 1QH8A 4M99A 3EULA 3SF0A 4JQYA 4GGOA 3QF4A 4L4YA 5BR4A 2NXWA 2YRWA 3L7BA 3T34A 2XRMA 4NMHA 5DLQC 4ND6A 3W2IA 5HOQA 5IX8A 4YACA 2J41A 3DL4A 1XHEA 5HRAA 2F8MA 1OR8A 1E1DA 1TU4A 4P81A 3ZBTA 3T4UA 4DM4A 1GQQA 1Q1NA 2RAPA 1H2EA 1L1RA 1VJGA 2Z08A 3AIMA 2APJA 3IP5A 5IXJA 3R3HA 3HWSA 3H75A 4WLUA 3M9WA 4RMHA 2YW9A 2IE0A 4LF8B 3IBCA 4KV9A 3IIJA 1PRYA 3DKIA 3KUXA 5TE9A 3DVRX 5TGTA 1TVEA 4CIXA 3IR6A 1NW5A 4XEHA 3IFSA 2IZ0A 3NDIA 4W6QA 3SC2A 3DV0B 2P7IA 1XEXA 1V2GA 4BWYA 2WAYA 4OIFA 3P4XA 4NC9A 2B1QA 1Q7GA 4J7XA 2PBFA 4G0YA 2CLLB 2ZUCA 1YL6A 4BLUA 4F85A 3VHXB 3IEMA 2IH5A 1PD1A 3OX4A 2C58A 3ECSA 3G8AA 3M34A 2P8JA 3NGXA 1D4AA 5FORA 4CL3A 1OPRA 3OC6A 5AVXA 1A4UA 3ENQA 2GN8A 5F3DA 2Q7DA 2ZRJA 3VR6A 3TOCA 3OOSA 1CUFA 2IRWA 4BMNA 3OCXA 1LBIA 5T8KA 1IHPA 5BSVA 1ODJA 5AVTA 4K6FA 3MJCA 5AI6A 3ZLUA 4U2BA 1XSEA 1A76A 3LUPA 3ONWA 1XMXA 3ANNA 4KQCA 1YJXA 1ZL0A 3EC1A 2OAEA 3H05A 2QBYB 2Q1WA 3CSDA 5FUXA 3N2LA 4LPKA 3UYLA 1X7YB 1TZMA 3EASA 2JH3A 2PVSA 2JD0A 2O1WA 1C8BA 3CR8A 1X80B 1LS6A 2A57A 3GRCA 4LJLA 5FV7A 4LHWA 2H2GA 3MWFA 5B2ZA 4YP7A 3TPFA 1NVGA 4UNIA 4BNIA 4C7MA 1AN0A 4DMGA 1PJLA 3PJEA 1QANA 1RJ9B 3T95A 3PUXA 1CE8A 3E84A 2JHPA 2OK7A 4ZODA 2VCEA 1PV4A 3FRHA 3HO6A 2DF8A 4WBXC 4WXPA 2C3UA 2GS9A 3PUJA 2H5EA 2PGXA 3B20A 4JB8A 3UPDA 1RVV1 4ZT4A 3FDXA 5IVIA 3ZWXA 3PQCA 2QVYX 2VJAA 4FUQA 2NTYC 3MCTA 4MLDA 5EEHA 3NC1C 2A1UB 5D3MB 2Z8YM 3IA2A 2O5EA 3EGIA 1YQQA 3IQZA 4HDOB 1VHQA 1R6AA 3QQ5A 5ECDA 1NVAA 1KU0A 1UXJA 2HLDA 3LBNA 3A0RB 4RADA 3DMNA 4WXHA 5ALVA 1HE4A 4ZTZB 3UWDA 2VP2A 1NXWA 4RU1A 5FL7D 1E94E 3NAMA 4BCBA 1HDOA 1KAMA 4L2IA 5CCEA 5HKBA 1JMYA 3RVQA 3PITA 2BFEA 1LSOA 4WKNA 3EDYA 3PD1A 3LUKA 1JFVA 1UT8A 5JASA 4EECA 2FEKA 1ZWLA 4RTLA 3PHCA 3RAFC 4CQLA 1LWOA 5LOVF 2AEEA 1JAIA 2GR9A 4MV1A 1I4LD 4F2GA 4PONA 1US8A 2HU7A 2VH1A 2F55A 1N2CE 3LI2A 1XMQB 3NRBA 3RS4A 2JW5A 3OZSA 5C3UA 4ALMA 2JFXA 4AKIA 3OM8A 3W9YA 2WLTA 1PZNA 1U2SA 2I8CA 2QL6A 3MGGA 4PO9A 5JMOA 1UK6A 3U0BA 3R0ZA 1AK1A 5A9SA 5BYKA 3AIOA 1CDDA 4OI0A 1KYQA 4AKTA 3FVTA 3MOIA 4HFMA 4M60A 4J4HA 1A4RA 1OE0A 4S2EA 4HX9A 4XQGA 3TL2A 1XZKA 4IH9A 1UR5A 1DRUA 2JJYA 4P1ZA 3BWBA 4Z49A 3OHPA 2F3PA 3RKUA 3CCFA 5B3JC 4AD8A 2C7PA 3M1YA 5EE3A 1P1CA 3HCBA 4RH3A 3EXFB 2ZJZA 2MU1A 2PUWA 3BK2A 2JIOA 1CXZA 4U8HA 4WCVA 3CF0A 1HDZA 3VYSB 3QHAA 4NVRA 5JIBA 3NJRA 3HBAA 2WBLC 4G6ZA 2O07A 4K86A 3LV8A 3NTLA 1Y7LA 1SK8A 3TW6A 2GMWA 4DIMA 5I9LA 3RSCA 1PTJA 5E1OA 4YRZA 1AKUA 1C9NA 1HDEA 2YS6A 1LD3A 4NMLA 2HQBA 4XYGA 3HCPA 3FJ1A 4F6LA 1TZCA 1DO0A 2QLLA 3SLRA 4CF7A 5F98A 3DEYX 2VS1A 2ZPUA 4CQMA 3DFZA 1TUIA 1N9GB 5IYZB 2J9ZB 2Z2XA 2CJFA 2V8BA 5HJ2A 4R68A 1SEVA 3EVZA 1YMUA 3A9UA 1N4AA 2GWRA 5BN4A 2H1CA 4DR2B 1KRHA 2O59A 3RVSA 1KPIA 2W00A 1A9ZA 4JOCA 4YRFA 5IKMA 4QJIA 2RB5A 1YBAA 1E4EB 1R00A 4URWR 3FPAA 4P08A 1CRPA 3CTPA 2IUFA 3V8BA 1YB7A 3D6UA 1ZXBA 2Q0QA 5E8RA 4IQGA 2R47A 1FTSA 1UMCB 4LX8A 5E7IA 4WBNF 5C4GB 2AUMA 3RADC 5IC5A 1ZGAA 2OO3A 3FCAA 3II6X 4O4IB 4D45A 1A96A 3A9SA 2DX7A 5AHWA 1MEOA 3E7DA 1MAWA 4ROTA 4BB6A 2Q27A 4NK4A 2NO5A 5DK4A 1QQBA 1YHZA 1BEZA 5FBWB 4DIKA 1SA0A 1FBNA 3WWZA 1V11B 3QIVA 5REQB 1QVRA 3TDMA 1M34B 4OU5A 3IMCA 5KU1A 1ODIA 3PF9A 3QE2A 4IV0A 2Z9BA 2O8EB 4HVAA 3A2KA 1BWPA 2XMSA 4XQEA 3KNZA 1FVHA 2DC1A 2VH2A 4ZJYA 2GLUA 4WW0A 4N5NA 4WXMA 4KE7A 3HSSA 2BL4A 4DXAA 5CVJA 1HKHA 2YZ7A 4UDXX 2HF2A 4ZQCB 4B81A 1CUGA 5LP6C 3KV3O 1E3QA 4IJ5A 1FYVA 1TK2A 5CLLA 3TMKA 2BF7A 4U6SA 5EIXA 3GYBA 1YBMA 3I6QA 4GYJA 5EUBA 1CR6A 4BKUA 1W4RA 4OI2A 4KBYA 1W0CA 3KSZO 2IHZA 2NZXA 3SR4A 2GVDC 5HUQA 3FOFC 4CM8A 4E1AA 3C85A 2AOUB 5IJ0B 1QGUA 2Y76A 3DNFA 4GBGA 1J9EA 4XR4A 4QEKA 2NP7A 2QAGC 4PQGA 1IPEA 3DW3X 1TEVA 2XB4A 4LVOA 5DO9A 3TD6A 1M2HA 2AWOA 1IUOA 3U7QA 4FNOA 3PNVA 1DBSA 1ATZA 5J4YA 4G81A 1GUBA 1NJFA 4RJIA 3REOA 3TCNA 3U4GA 5D5PA 3H8JA 3PGMA 3KWMA 1RFGE 4MVJA 2ACEA 3MTIA 1SXJB 1XXHA 3D8TA 3LIPA 1F8GA 1MT0A 5AM4A 4HNRA 3IEKA 4CT0A 4Q6BA 4OYLA 4KR0A 1C3VA 1W85B 3KSDO 4YV0A 2V7GA 3W3AD 3D7RA 4ZYUA 5EGNA 1RPAA 1Q19A 4FGUA 3E1SA 1F0NA 3TOVA 5B7GA 4IXDA 5EHZA 1JEAA 1GZ5A 1XKTA 1JLMA 3DDCA 1DSSG 3P5SA 3ZPXA 1W36C 5JAQA 1IZ0A 2XZTA 2P2YA 1TK3A 4ZN6A 1W4LA 1N5DA 3GJXC 1PNRA 1F06A 4EX7A 1GZSA 3R5XA 5E4TA 1GPDG 1ZRSA 4TWZA 1KI6A 4S05A 1J06A 3ADCA 3NTVA 3CZRA 1ZH6A 2MTBA 4W4TA 2C1EA 1FDWA 4G0XA 5B7QA 3AUSA 2I76A 1KDRA 4URUR 5JXGA 1M1YE 3D4OA 1SC1A 3D8HA 3ELDA 4NARA 5CA0A 4E7OA 5A5GA 2GF9A 3WBKA 1R7RA 3N59A 2PLNA 4MUYA 2QZZA 1K2VN 3GGDA 4KE6A 1BA2A 2WV9A 1YK0A 3HN7A 3Q9UA 3RFUA 2GM9A 2C9BA 1QVZA 3FUXA 4F3KA 1V47A 2E4UA 4LIPD 3KELA 2PPVA 3M4NA 3PP8A 3KPYA 4L4XA 3JRWA 4TTQA 1G5TA 4F12A 1CD5A 3AI1A 2G09A 5C9ZA 4OUDB 4R9NA 5H7XA 3LX6A 4LQ4A 2F3QA 2DT5A 2E5WA 1TT5B 2PANA 4QNNA 1K2WA 4UM9B 2B8JA 3PFWO 1T4DA 4OHXA 4HLCA 1W30A 3LG2A 3LCRA 1UPBA 5G4KA 2OG1A 2TSYB 2VT3A 2EP5A 5DXJA 1SCUA 4YQEA 4XRGA 2X8JA 4DMHA 1B00A 4KOAA 1EFPA 1JJAA 1E3EA 1Q5PA 1T0PA 3T5AA 3BILA 1V1RB 4II7A 4HAUA 2PWPA 4C1NA 2AB0A 3L93A 1R2QA 4MS3A 1NUSA 2BFBA 4RPIA 3OCWA 1KNXA 1R64A 1V5WA 2QRJA 4U9IS 5EIBD 4AJ4A 4CKEA 3VJKA 3OZVA 1N2XA 4GHWA 2FA9A 1AD2A 3JASB 4JYBA 3HEMA 4IPTA 4AKHA 1TYBE 3DO8A 2WFLB 4Z9XA 3TG8A 1TTQB 4FB5A 2W0SA 4LRQA 3DA8A 4EY4A 3WLSA 4A3SA 1KEUA 1EI9A 1NF3A 4ID3A 1U5BA 1FTYA 1GUYA 1YMVA 1N1GA 2OV6A 3ENVA 3KXKA 4LDQA 4H1UA 5KX5B 1BDIA 5CT6A 4J0HA 2FY8A 4YMTA 1E1YA 4AJIA 1ECGA 2Z3WA 2DWPA 3MTDA 3HKEA 4IFIA 5JQGF 3P2KA 1UAGA 5KKCA 1OTHA 2NADA 1TU3A 3AL3A 2JFHA 4EHAA 2CL5A 4MTCA 2Y67A 3O9ZA 3H2JA 2FXVA 1QIJA 1LLCA 1ZVQA 2GZ3A 4ZI5A 1LDYA 3SZGA 4ARAA 4PG8A 3LYLA 2CFIA 1FXUA 3QE3A 2Q4RA 2FH5B 1ZK4A 3NPAA 1OFHA 1U2GA 5ENZA 3CEAA 1BU8A 5FTJA 2A14A 4DKJA 1TMYA 4NAHA 4FB4A 2ZYVX 1T2FA 2FW9A 1NVMB 2NV6A 3NWEA 4P32A 4F9FA 3SHQA 1KYVA 2ZYIA 3AHGA 4M86A 2PJZA 4L22A 2IHKA 1Y33E 1QHSA 3G7SA 1DEOA 1R0ZA 1DAMA 1V35A 1P1HA 4IX9A 1AQUA 3WG9A 1T36A 2EGUA 3RU2A 5HCUA 4KRFA 3E22A 5FA6A 3PU6A 1OX4A 3FMIA 1MLDA 2WWIA 3QKUA 1NXQA 4RPGA 1WZ2A 4Q4AA 1ODSA 3MRVA 2EARA 5ES3A 4AJOA 1NQTA 3KKPA 3PD0A 1QHIA 2RDMA 1PR1A 5IANA 1QFMA 3D8NA 1YIDA 1E5XA 2BBOA 2OK8A 3OX1A 2BTEA 1OH5A 3TJMA 5HMMA 2IEGA 1MC5A 1FSGA 1NZJA 1EM8B 2D8MA 2G0TA 2YYSA 3A3YA 3ORYA 4HTFA 4DCGA 1H2BA 4XR9A 3SC6A 4TQ9A 3KDSE 4OO3A 5H70A 4YMGA 5KOHB 3ELWA 3FYTA 5J9FA 1ESCA 3LM8A 1AKVA 1EUCA 2DWCA 2IYEA 3U7FB 2J8ZA 1W48A 4GYWA 3OZWA 5T67A 4TKUA 3LQRA 1LSSA 1OGYA 4RGVA 4KMOA 3I8XA 3N2EA 2LKDA 2PV0A 1XTIA 1MHTA 2QMYA 2O3JA 1A7KA 3HNRA 3QYFA 4WCFB 1HI9A 3TPZA 1AK2A 3K9FC 2ZQYA 4JL8A 3HB9A 3FF4A 4EUNA 2V03A 1JJ7A 1G3IA 2WYOA 4Y2RA 4ER7A 1SUAA 4C03A 2WYIA 4IDPA 2AMYA 1B26A 2D0IA 3DYBA 4B3SB 5BW5A 3T9CA 2QG6A 5KSYA 2FGKA 3MUEA 3OT1A 3U7RA 2CNKA 2MSWA 1IQUA 2W6ID 4D9MA 4EHHA 1K7SN 5JMPA 5CFQA 4CIAA 1ISFA 3THXA 3L3BA 4YJ3B 5IN5A 3QY9A 1E2EA 2ZIVB 1VL0A 3I2IA 5JSYA 5HPYB 1L1EA 3TRDA 4P31A 1NXSA 4JLOA 4PRKA 4WINA 3X1YA 8OHMA 4PPQA 4Z7NB 3DDOA 3V46A 3SJBA 4K46A 1E1CA 1OZGA 2Z4SA 5EVCA 5CHYA 1J6UA 3ICEA 4IS2A 4ZALA 1G21E 2BDEA 4HKTA 2IUEA 4PRYA 1VIAA 2OSVA 3BZBA 2EQAA 4NE9A 1MC4A 4JKYA 2O2YA 1I3MA 3N0XA 4MPJA 5K0TA 4G26A 1YTUA 3IEVA 1EZ4A 1VDMA 4KN9S 1GU7A 1FPQA 1K6EA 1N57A 2HLPA 2X4DA 2ZRDA 2GPWA 4YIHA 1XPUA 5BOVA 1H1TA 2VAPA 2ONKA 3EEBA 1P2DA 1E3WA 2BEWB 1A97A 1QB7A 1XTPA 3RIYA 1XCGB 2A2ZA 3UY4A 4D92A 1EFUA 3AZQA 3H1AA 2OXTA 1U81A 2C5BA 4HWGA 1BDBA 1NE7A 1NJ2A 1KQPA 3A26A 3PDWA 4DG9A 1MVOA 2IVFA 2R7NA 3ZXUB 3X1WA 1WF3A 1T6XA 2XVYA 2AI3A 1RKVA 4IHQA 4L9RA 5JATA 2PX5A 2Y99A 2A8YA 4C7VA 3QJGA 2WOOA 2IYNA 4B6JA 3A9VA 3AW9A 2ZULA 2NV0A 3L4KA 1W9HA 1M74A 2DWOA 3K1AB 3BT7A 3STTA 1YS1X 4Y2QA 4AW9A 1UC8A 5DNWA 3V4RA 4B2YA 2BEUA 3HMQA 1E5DA 4ZXPA 1TKAA 4B6FA 4CLOA 4HN2A 5HQ3B 2R4TA 4OMFG 1C30B 2QN7A 3FRIA 5GJWC 1SWVA 4TYPA 1VDZA 4JVSB 5KIAA 1CUSA 4ND2A 1SC9A 4MIOA 4B73A 4F8YA 3B53X 1RRMA 2JHGA 2QQ0A 4TPKA 2BY4A 2LUOA 3KVYA 1NF9A 3Q0IA 2I3DA 1TO6A 2E6KA 2VYVA 1Y42X 3B9QA 4MQLA 2OWEA 3DAPA 3IHWA 3Q7IA 3ZXSA 1SMKA 4ZQIA 4C5AA 1GYPA 2OAGA 1NBIA 1PKXA 1HMYA 1QV7A 4HPXB 5EZYB 1T5BA 4GU5A 3WI7A 2WM2A 3C5EA 4HEA1 2CKMA 6ABPA 1CG6A 2FLVA 4G0UA 2GN1A 2IIBA 4ITRC 3PWSA 3TW4A 1IWBB 1YDWA 1EESA 1E64A 1Z45A 2YJGA 2GNAA 3OT5A 2XGSA 4J43A 3RRYA 2XTAA 5I4IA 4ZT3A 2JGKA 2R6R1 2YZMA 2VZLA 2X77A 4JYCA 1A77A 2W58A 2UZAA 4RDIA 3BSSA 1KDVA 4RHXA 3PYMA 3KQTA 4IXWA 3UGKA 2NYUA 4N3GA 4I1YA 4I9NA 4YV7A 4EAAA 4YP5A 4RVSA 1QTQA 1T0JB 4LY6A 4NCNA 5ADWA 2E87A 2I33A 5ER6A 3TOSA 5B1IA 4RD1A 4MS1B 2QLMA 5EJMA 4IGAA 1ZM2A 3O0TA 4AXXA 2OMKA 2TMGA 3WGGA 2OYRA 1H2HA 4M7WA 5AMXA 1G3QA 3EGEA 3VTFA 4GLJA 9LDBA 1ZMRA 2DQ4A 4QWMA 4M9XA 4MEBA 2XADA 4Y9SA 4BP9A 1JJVA 2JLAA 4EQ6B 3DOIA 5CYFA 1XZLA 2YN0A 2YTZA 2ZIWB 1HYEA 3GCWA 3UCFA 1DRJA 1JEEA 1UOQA 2FZWA 2ECOA 2QLJA 4W7IA 4FX5A 3K0CC 4JMPA 3S2ZA 3VVBA 2IS6A 2X13A 3HY6A 2NO4A 4PC7A 4RAQA 5TF4A 3IPCA 3SVZA 3U3XA 5BNZA 4HXFB 1GTSA 1NY6A 1L5OA 1IOWA 2CMDA 4OGGA 2HMYB 3CFYA 3W8EA 1EJ2A 1UFKA 3VR3A 3HPRA 4LCEA 5E3IA 5A62A 2RMKA 2O2DA 3FBGA 3PQ8A 3AFIA 4MAFA 4QO8A 4YS6A 4M0CA 4BKRA 3JAMA 1VJ1A 5JWRA 4TVSA 4K6CA 3Q8LA 5HIKA 3THYB 4M0DA 2GEBA 5JEDA 5LZ7A 3VKHA 4DA0A 1OHHD 4ER0A 5C5EA 1TW3A 2GN9A 3LPLA 4AIRA 3K1JA 4C06A 3IPYA 2E3JA 1H8ED 2C04A 1U7ZA 2PD6A 2BHSA 3WLMA 3A9CA 3F5DA 1MB3A 2W0MA 5IBRA 1OZFA 2X2PA 1BYIA 3AUAA 1V8DA 5D87A 2AMFA 3VTKA 4OHYA 4CCYB 3U9SA 5A4JA 5B64A 4IFTA 2OCAA 2VRWA 1XMIA 4INZA 1RWNA 1VA4A 3FJYA 1JEQB 1YQGA 2OECA 2Q1SA 4ZCTA 3L0OA 1K6IA 3LMKA 1YZHA 1FSSA 2C4KA 1V45E 1Q77A 3R23A 4HH0A 4L16A 4BL5A 2R84A 2V7TA 3CLTD 4TV9F 4BMVA 1VB5A 1SXJD 2QD2A 1VL2A 3CRQA 5DI9A 3L02A 1E63A 1A3CA 4MZDA 3O9MA 2AMJA 4PZ9A 2ZTMA 3TLKA 4C0JA 3UATA 3U7GA 1NMEA 4BO0A 1WB9A 4FDTA 3RG8A 4YXWA 2G76A 2JI7A 5GJCA 3ZHYA 3ZQ4A 2YJZA 3JARA 4ENVA 3ST7A 3KYDB 5IJXA 1TJ5A 4BXOB 1FRZA 4RW0A 1JR4A 5DBFA 4M7OA 1JE0A 4JVNA 4DJDC 1C4OA 4ECAA 2D4HA 1Q11A 3LDUA 2OBNA 3KTAA 2OVBA 2RHGB 5TJ9A 3SWWA 4DR5B 3AL2A 2QN2A 2R7KA 5IEBA 1YASA 3OJOA 4ESVA 1J8FA 1Z0SA 2EL7A 1P0FA 3H1EA 3TZQA 2DWUA 1WXWA 2R2AA 4O5OA 4OTZA 4WVFA 1L8QA 1UBFA 4XWGA 3HCCA 2HYIC 4NBRA 1G16A 2OCLA 5KNCH 2XA2A 1EWQA 4QBHA 1AX9A 1GPKA 4R54A 3V4ZA 4BHTA 2EL9A 4FU0A 1A9QA 3R0QA 4CG3A 3O92A 3GVPA 4JJEA 4E03A 1BX1A 1QB8A 3Q1KA 1JHZA 1BS1A 2ODWA 3EARA 3D7MA 2X6TA 3VSAA 1RZ3A 2XBLA 4EZBA 2QK4A 1ZA1A 4GR9A 1XTKA 2H0RA 2PMKA 3ZZMA 1TMGE 2YL2A 3DNPA 3JY6A 4ZT5A 1XAGA 1ZN9A 3O8OB 4RZ2A 4J6FA 2FOLA 3W6PA 3C48A 4X20B 4NOMA 4ITUA 3ZBPA 4FN5A 2ZBGA 2GF2A 3B2NA 2FPRA 4HWOA 4OREX 3ZV6A 5COAA 1JVNA 1DC4A 2Z5GA 3WLTA 2PKEA 4A6PA 3BIFA 2YXEA 3B36A 2ID7A 1UPCA 3SE7A 1U9IC 1Z28A 4UM9D 2LV8A 1ZESA 1DBQA 3LPDA 4PQEA 2BMJA 6PFKA 4J03A 4K3UA 4UHDA 1UBUS 5GM2A 3IL2A 1QP7A 2IIVA 2HQOA 4HC4A 3P9ZA 4NZ9A 2P5UA 4NH4A 3DHEA 4DB4A 1XL1A 2PSDA 4DDWA 4A16A 2A92A 3HDVA 1B73A 1DZ3A 1OX6A 1TFRA 1FX1A 3CLRC 4OY3A 4LXUA 3C6XA 2I62A 1PX2A 3RTAA 1RLOA 4OGLA 3HU3A 3QW4B 1XQ1A 1Z6PA 2WICA 1AF4A 2YFYA 2VAVA 4YHBA 4ZOEA 2Z1DA 1XYYA 4IQ4A 2QD1A 1KQFA 3T5PA 1HO3A 2WT4A 2VPPA 2I2AA 3BL8A 1HDIA 4NMXB 4FMDB 2Q07A 4NBVA 1KPHA 3UGTA 4O4HA 5CFRA 4OMUA 5FBVB 4HWRA 2ROQA 4G5OA 1C1HA 1C7QA 2VF7A 4Q3AA 1V5EA 1RWBA 1LSUA 3FWHA 4YQFA 5CEEA 3WMGA 1T8YA 4JKIA 4Y1EA 3PQ6A 2SHKA 2JAXA 5ESXA 1NQUA 3M82A 2AC4A 1U90A 3ZHQA 1OH8A 3PJDA 1I0LA 2JGMA 2JAWA 3JVEA 3MPOA 3LXMA 3MUNA 1JTEA 1ZIYA 4QRHA 3DJYA 3AR8A 3KWFA 1EDDA 5HS6A 5FOQA 5C0OE 4KUHA 3MF4A 2FSGA 4GZ3A 4ZYZA 4QPDA 3ENKA 2CFOA 3QFTA 1R5NA 4B9AA 4E70A 2XOEA 1IRXA 2JAQA 1KMIY 2ZYSA 3AHIA 5HVNA 2C31A 1C4WA 2GQ0A 4JOQA 1U99A 3IVXA 3DBRA 4H15A 1GAWA 2ZAOA 5LQAA 2CKDA 2JGEA 4OHCA 1GL3A 2O2EA 1OREA 3MSCA 4QGAA 1HNWB 1LFAA 5LM3A 1NWCA 4W7HA 3SMQA 3M5PA 4XWOA 1RADA 1DKRA 4NU6A 4B31A 3UCEA 3UN1A 1ZI9A 3RTDA 4KQJA 3T7TA 3TZEA 5LR6A 3FTEA 1QOZA 1UM8A 4QFDA 1H0KA 5ICMA 3BMCB 1SD5A 3IUSA 2OM2A 2E4AA 2NU6B 5HIIA 2X3YA 4L75A 1NQAO 3QPUA 2A9OA 4Q1VA 4JHLA 5E9QA 5KPJA 3M6UA 2FPGA 1EM6A 4PPGA 1WQ4A 3D7LA 3BEDA 1XEWY 1VSTA 5SY9A 1S9HA 2FPWA 1GTG1 4LYJA 3QE4A 5B1EA 1Y8ZA 3TNDA 3IDAA 1EVKA 3ZY6A 1APBA 1STOA 3NEJA 3G9XA 1XJ0A 1YK1A 3LRPA 4O63O 1DDIA 4CHTA 3Q0EA 3WJ2A 3FY4A 4WKBA 2M9MA 2WK1A 3JVDA 4QASA 2AX3A 3EPPA 3TL3A 4BVFA 1S4MA 3MYRA 4YRKA 4ZJZA 6GPBA 4RTRA 3GLGA 1YACA 5I9MA 3N1UA 4DY4A 3CF2A 5GPBA 2JCBA 5EXSA 2CD9A 3ICCA 2QD3A 3QBVA 2OXIA 5JVDF 1OX5A 3U0VA 1SG0A 5IWCA 4RTNA 1OAOA 4NYMQ 1MIHA 1TVKA 3ULKA 5IULC 1M8JA 4E14A 1M1YB 5K3CA 1P4SA 2PLWA 4DA7A 5AKEA 3QELB 1U3UA 3PGLA 4PCLA 3EYAA 3O90A 3TSYA 1HQKA 2AJDA 3UQYS 5LQJA 3F71A 4GKJB 5KYUB 4KITB 2D74A 2HJ9A 3IT3A 3W9UA 3K9QO 2BJHA 3QU4A 4TWRA 3QKRB 5KJFA 3A6JA 1U02A 3MWEB 5FD8A 3BH6A 4INAA 1QZTA 5CK4A 3EQ8A 2ONYA 3OCVA 3ABSB 4NENA 3DAOA 1DG3A 1M2VB 2EJBA 5E6RA 3FUUA 3SNHA 2B7CA 3H2GA 2J7PD 2H4YA 1G5IA 4I3GA 4YLEA 5EJGA 1A1SA 1N2ZA 1NYLA 5FOUA 4MGZR 1TEZA 8AT1A 2ZSFA 3OPNA 3GUVA 1R3UA 3H18A 3DEHA 4OOFA 4EY7A 3AWDA 3HPQA 1YR7A 3PS9A 1Y3BE 4RMJA 4ZOLA 3WICA 1B8OA 5F33A 3TVTA 2CXXA 4BDSA 3LVQE 1SCAA 3EUEA 4PG6A 3PHLA 1T2NA 4AK9A 2R6GA 2LNDA 2G28A 3UC9A 1R66A 4Q21A 2QU8A 1MG0A 1U5CA 1XA3A 4REOA 2Q2OA 3UWPA 5KTTA 4EW6A 1XQWA 3T5GA 1Y63A 4ER5A 2VNJA 3AG5A 1U0FA 5TS3A 5J4KA 1SULA 4TLMB 1E6UA 4C05A 3PX2A 1G8MA 2ZB2A 1NL3A 1WUKS 1RYMA 4KXXA 3GXOA 4WZBA 3H99A 4MCJA 4B2IA 4DNFA 2FAXA 4J6EA 3PHJA 3TXAA 2JJ8A 4HNGA 4FYPA 4K9DA 4LMAA 4QQFA 4DSOA 1PFUA 3JV7A 3H4MA 5KMGA 1XKQA 4D7AA 3UMGA 2DXIA 2QX6A 3M2PA 1OI2A 3DGFC 5IH7A 3WV5A 4WNAA 1BH6A 1OJ7A 3FPGA 4LFCB 2P5SA 4KQGA 1X77A 3AFGA 4XEUA 2WTNA 2SECE 3GPBA 4IOLA 2PD3A 1XZPA 1ZQ9A 2DFLA 3DL7A 1NF8A 4WACA 1JAXA 2Y1FA 4QREA 5GONA 2BDUA 3RB8A 2PKRA 1LF5A 5FKJA 1D2CA 3URKA 4FOOA 5LWHA 1M6VB 1TM5E 3IV6A 3D2BA 1PIWA 4NU0A 4EKIA 1EFKA 4OJYA 5FNZA 3W2GA 2JEYA 1P7YA 3SJ7A 4BVHA 2D62A 3L8MA 4OBBA 3A4MA 1JFSA 1QHXA 2F1HA 1OKKA 1YKFA 3INRA 3OZRA 3U80A 1CY0A 5D8DA 2B2XA 1TB4A 1NSFA 2YJ4A 1RHUA 1W88B 1MD9A 1XQ9A 3A6GA 3IHLA 1LLFA 3BTUA 4B3TB 2C4WA 3HO1A 3NHRA 3CW2A 1NSTA 4FFLA 2XDAA 4HFNA 4P93A 1QTRA 2BFDA 2L69A 3I1JA 3JQAB 1H1LA 3CW9A 1VKZA 3E4DA 1TMOA 4UM8B 5LA6B 3W79A 5LP6A 1MEEA 3P0IA 2P4UA 3L0ZA 4KX3A 2DFTA 4RVFA 1DO8A 4NFYA 2IXBA 2JLVA 2O8BB 2QR2A 5AICA 1LVGA 3ESRA 3B7WA 1GCUA 1CF4A 2IP2A 1JH8A 4MKRA 1F6WA 4JVMA 4XD7A 3ZCQA 1HETA 2IHVA 2I7CA 3NP9A 1LDGA 1B15A 1E61A 1HZZA 2DLDA 3EDRA 3STWA 4DBLC 4YUYA 2HSEA 4EB6A 4J0CA 4QTZA 1RLIA 4P84A 4HMOA 2VDLB 4TV8B 3E0QA 3BWEA 1UMKA 4YDSA 1ISHA 3H5WA 4EDFA 3FX2A 3DTTA 1Y3IA 4C6SA 2JHCA 4FLFA 4I2VA 5A4KA 3DDNA 3AV0B 3FPEA 3LVBA 5FBZA 2GN4A 4KNVA 2OV8A 5L4NA 1VP9A 3SIWA 3VGJA 4OQDA 1RD4A 4OP1A 4CI9A 1KY5A 1PR0A 1RAEA 1XXHE 3SXUB 3MGCA 3WGKA 2VDWA 2ZSIA 4BS9A 3Q9LA 4YCLA 3FHTA 2JEOA 2Y0EA 4O2BF 1U0JA 2P79A 1GV0A 1MGOA 5B3KA 3K70C 4BO2A 2XMBA 2B8EA 5F9MA 2P9EA 3I3SR 1QRTA 1TM3E 1JVBA 2OZLA 4DZRA 1ZOLA 4JXJA 2C54A 4GLLA 3R0JA 1DG9A 2Y1CA 4LRWA 4OPMA 5KOJB 3LWDA 1BW9B 1VQ1A 4IY1A 1TVMA 4E3ZA 3ED5A 4WK6A 3K8ZA 4FFNA 2BKAA 2HUNA 5FXMA 4AWAA 5L53A 1S8OA 1W75A 5B58C 5HZKA 2Y92A 3BWXA 2O7VA 1XN4A 3CW8X 1Q22A 3L79A 1M72A 4MR8B 4CFYA 2VTBB 3C6BA 4UZFA 4HSEA 1DCTA 2AOVA 2BEVA 2LIVA 5C2JB 3S1LA 3CF4A 3GT4A 3O75A 4F6RA 1G21B 1L7MA 3JQGA 2QTRA 1OTXA 2UVQA 3PR2B 5F12A 5F9FA 5TT0A 1KK0A 2PQMA 3X2EA 2HMVA 3AI3A 3WGUA 2E18A 1J70A 2II6A 1Q1AA 1I1HA 5ARDA 2DP4E 4JP3A 4PNPA 4D42A 2EX1A 1DPGA 1KGSA 2O2CA 4FNMA 4X62B 5EHXA 2H3EA 4D9NA 5DP1A 1V4NA 4MQEA 1EX1A 1GPUA 4QX6A 5BPFA 1B6TA 4AX8A 2OY0A 2ODPA 4B5KA 4P7BA 3PC4A 1J33A 2HV9A 3BWYA 4PY2A 1S0UA 4ZVTA 2LIPA 3SDBA 4N54A 4HXEB 3NR2A 3MAGA 4X90A 1J0CA 2XIQA 1PO7A 4Q1EA 4OP3A 3PENA 5HKKA 3C8MA 3OPYI 5I7FA 4QRDA 1IRIA 2VHYA 3KOZA 3QX3A 1PF7E 3QLVC 2CCJA 3WNDA 4F2HA 5BSTA 4JP5A 5JAOA 1U9JA 5ULLA 4J75A 1AJEA 3MMNA 1FP1D 1C5KA 3RVRA 1VE7A 4JIMA 4DJTA 4HDNB 1WUJS 4BP1A 2NU9A 4LOAA 1X39A 3GUUA 2QTGA 3F5QA 1CVLA 2R7MA 2I6SA 1QQ6A 2VPWA 3CZ5A 3EZ2A 1J07A 2H4WA 5CW2A 4OI1A 3ZDXB 4B4VA 4DPMA 4EI9A 3PSAA 1Z8HA 3HKDA 4ND8A 1HNXB 3QYAA 2PGIA 1L2TA 2QTLA 2XDYA 2PO5A 3AFNA 3MM4A 4MSUA 3WADA 3NTUA 1P2BA 4CQNA 3PFNA 1LPPA 1R37A 2B2NA 2PS1A 1MV8A 1G0OA 5IAEA 3JW8A 4FZ3A 2Y1WA 3B2QA 3GBPA 5WRFA 1RQ2A 2QRKA 3TINA 1HEYA 5CXQA 4E51A 3MYYA 4LSZA 1WBBA 4RZIA 1P6UA 4MRRA 1IAVA 4X85A 4YFVA 4WHMA 1S2LA 1MB2A 4UXHA 3AM1A 4B71A 5HHTA 2H0AA 4JDUA 3OQOA 3V3KA 4DW8A 3QNUA 2WMOB 2EAUA 4MR9B 1H9AA 1LXCA 2QVLA 2UZ1B 4JQSA 2HHHB 4NJOA 2PXCA 4RPKA 4CCWA 3KPUA 4BQPA 4O4JF 3OCJA 1MQSA 3A25A 4Q18A 4AZ0A 1COZA 3OZXA 1Z6XA 2PX4A 2IGBA 1CR0A 3REGA 1IEXA 3I45A 5JWOA 3OZIA 4UQPA 3LWNA 5THKA 1UK8A 3DDWA 4Q3LA 5CBPA 3UAXA 4MVJM 2BH2A 1D2RA 1DPFA 5SV2A 4YP9A 2CE2X 5CYGA 3U7JA 1S2NA 3RROA 3GPIA 4AY3A 5K3SA 4KXWA 1XTVA 1I1QB 4TS1A 2QVXX 4UUAA 1O95A 1OUMA 3ZW7A 5KVAA 3OH8A 1RBMA 4WTOA 3MELA 4KQ1A 3ZJYA 4ZJPA 4JROA 2WJ4A 3D3KA 4EKYA 4M83A 4EHNA 1KO8A 4ESEA 1T1IA 4YMSA 2FZ4A 3LECA 5K8CA 1Q0PA 1G5PA 1L4FA 2AFHE 3DZCA 4RY9A 4WNYA 4XFJA 5CDSA 3R6WA 4RORA 1PS0A 5AK3A 5EJ6A 1XWIA 3IUMA 3NGLA 2D06A 3CZPA 2NXJA 2PGAA 2WOJA 2NU8A 1E79D 3ROQA 4C6TB 2PFSA 3E61A 3JATA 2KJQA 1LTHR 2JIQA 4PIPA 3RKRA 2I7VA 1CJKC 3HNPA 2G1UA 2QTBA 1B8PA 2YZNA 1N4DA 5AK0A 3SCZA 1V3UA 4FFDA 3NBMA 3FZEA 4MWCA 3RYFA 2W37A 2CNOA 3RH0A 1O3YA 3C5WP 1DWPA 3H2SA 4J0KA 1WCXA 5CLIA 2VSQA 4GLOA 2OGUA 3RFVA 4E31A 1G6OA 4UDNA 1EWYA 1ZVJA 1DHTA 3D81A 1SFRA 2PKYX 1IU9A 1SHKA 2IHNA 1SU4A 1N8TA 3UK1A 1QXSA 3R20A 3JD2A 4LK3A 3EXHB 4HWSA 3UXYA 5K7SA 3DVAB 3HWX1 3EIEA 1J5PA 1JEYA 3G2JA 1N78A 3STUA 1Y1TA 4I5IA 1FFGA 4DDMA 5A3JA 2CZGA 5LJLA 1ABBA 1ZP6A 3PQ2A 3TLXA 4R1TA 1OT5A 4KLCA 3HJAA 1BHQ1 4V0OA 2WR8A 4Q3NA 4Y7CA 3F0TA 1XTBA 1HE2A 3PCXA 2PL5A 4IYRA 4LRYA 2GZHA 4EQZA 1W5AA 5F2OA 3N5CA 4J91A 4ZAWA 4IH4A 5IVDA 3E7WA 721PA 4C7OB 1K3UB 4KODA 3VKFA 2DR2A 3NQ41 4HXYA 5J4VA 1I9GA 1VXOA 4ID9A 1SGWA 1OWOA 5EQFA 5DRTA 4LCBA 1KEKA 2X23A 5CT4A 2P5TB 1MABB 5BSKA 4H3VA 5HF5A 1R12A 3RK4A 1ZBQA 1EFVB 3NHWA 5F3WB 2YR0A 5JZBA 5KQSA 5GIPE 4DPKA 1XZEA 1ZNXA 4LTDA 2YCBA 2HT1A 3FCXA 1CUZA 2AX4A 1J0XO 1DKOA 3V8VA 2HGZA 3Q15C 4FFSA 4EYGA 1JR3A 2ZETA 3RUIA 3ZLVA 5EHNA 3ZTTA 4DT1A 1XVIA 4HGPA 4HDRA 3BA6A 1LC3A 4U02A 4OLBA 4E5UA 1XK7A 3JQFA 2DFNA 1YL7A 4UNPA 3TM4A 1HRKA 2ZUVA 4EBFA 1FYFA 1JHAA 1WPQA 5DBOA 3FFTA 2H00A 4GDMA 4RZQA 4O8ZA 1FU4A 1LU9A 4LCJA 2PWZA 1U7DA 3O8BA 2HA0A 4Y0NA 4FGKA 3HBLA 3NYIA 2R96A 4AVYA 1NFRA 2O57A 2B1JA 2YYYA 3I0ZA 2RGEA 4Q4DA 2VNAA 4DMLA 1YUBA 3IT2A 3P0FA 5EKDA 4YJ2B 2GFHA 1BXRB 4RGBA 2FJ0A 1QG2A 2I34A 5JUWA 4CI0B 1OD6A 3G1UA 4FGJA 2IYXA 2ZW9A 5FTMA 4O2AB 2QB5A 3GUCA 3ZI7A 5JR3A 1N8KA 4HNAA 4ZREA 1JU4A 3KHUA 3Q1LA 1DV2A 3LWZA 4IGEA 3HY3A 1G7SA 1WULS 4D9EA 3I01A 3KT6A 4WMLA 1XHFA 4NWIA 3LDFA 1G9XA 4KCGA 5CB4F 5ITZA 4ABYA 4E2YA 1XD8A 3AW8A 3OM0A 3R9XB 1QOPB 4PFKA 1ORRA 1CDOA 2GCOB 4OJMX 1P17A 1QH8B 4DCUA 4IIHA 4AF7A 1XNRB 4AAYA 2QNIA 5B1YA 4UHEA 1ZQ1A 1QPZA 5AKZA 4CM9A 1I4OA 4N6NA 5BN3A 3LQYA 2ZTHA 2NQTA 3TI9A 4K40A 4EY5A 1IQPA 3D8BA 5IXSA 3GJ3A 2XDQB 5E9JA 1T2AA 1XRLA 4BJ5A 1G8PA 2VWGA 3ROXA 1SB9A 4Q7LA 1JLRA 1TK9A 5FWYB 2OAQ1 2R1VB 1NULA 2OENG 3WRVA 1MX1A 2QT0A 4G4GA 5JCOC 1X8KA 4D43A 2GN2A 1P4GA 1ODCA 5ALUA 1WUIS 2Q9UA 4CM3A 5ILQA 4ZYXA 1NNSA 5HIAA 3KEQA 4FZJA 1ZO8A 3UG6A 4JR1A 3WNQA 2PX8A 5I3ZA 2ZWOA 3ZOKA 3K5IA 5HMLA 3SZ3A 3UV6A 1YRYE 4EUSA 1CUYA 3G1TA 4DSUA 3DW1X 1GDHA 1G63A 1GL7A 2XR1A 3CX7A 1TEXA 2B61A 3K0CA 4DMMA 4ZV4A 5MFZA 2IBSA 4I5GA 1RAIA 4ZDKA 2SBTA 3O8DA 1CK4A 1OBHA 1KMHA 3FI9A 3RU9A 4NMMA 3E23A 1EA5A 3VR0A 3AINA 1GQFA 4JELA 1V6CA 3RJZA 2DFPA 3B5IA 5KI6A 1QGED 2C97A 2NO9A 2O3QA 3HACA 4H77A 1CF9A 4RD2A 2IPOA 3VJRA 3AEUB 3ZHCA 5G4LA 2J45A 4HAVA 4I50B 4XVQA 4KIGA 3NLLA 1JN0A 5AK4A 1F8UA 4NHOA 6AT1A 3UKOA 3A1NA 3HCFA 5F2NA 1DJMA 2OBFA 1FMCA 3HABA 2HIHA 1DWQA 4LHXA 2Z2JA 2BKUA 4WN9A 4XIJA 3JQAD 1ADYA 2FMIA 2YWGA 3CINA 1R4ZA 1VG9B 3K7EA 4CUZA 1N6RA 3Q9SA 3AJAA 5ENVA 2GHRA 1KYXA 1V3TA 3C3JA 4KQ6A 4YO7A 3KEFA 4IHAA 5C8YA 1SHUX 1U1GA 1LZKA 4PGHA 1GNVA 2N0SA 4ZOBA 2OXRA 1RXCA 1D7OA 2FQXA 3ML1A 4AZSA 2GNPA 4NONA 2ZYAA 4YREA 2YHIB 1A5TA 1AXRA 5E9AA 5FFFA 3KAKA 2C95A 4PEVA 1QGZA 1YZKA 3K9LA 1PG0A 2FX3A 2Q5FA 3QLTA 2YIVX 1XPRA 1L8OA 3T12A 2BWJA 2WMDA 2PYDA 3WMEA 4D9HA 1PGOA 2NZ2A 2Q9CA 2PA0A 4KK3A 1UP4A 4C4SA 1NJ8A 4M46A 1M2KA 2EDCA 3HVHA 2EZ4A 3BCSA 3HDJA 2DPXA 4ZCSA 3K8YA 2BCGY 5T6BA 2UUPA 3PLNA 1YZVA 3BSYA 1V7ZA 2IYUA 3R5FA 3GLTA 2VJNA 1EFTA 2JAOA 3FLAA 7REQA 4WI1A 1CYEA 3G2PA 1HNZB 1A8UA 2RC6A 4MV8A 3L5KA 4IRMA 3I0NA 1SOAA 2C0CA 3CUKA 4MULA 3KUKA 3MS7A 3WOHA 2E4YA 1FQJA 2HQSA 5K8IA 2GAIA 1ISGA 1V9LA 1W2GA 2O7NA 2HRQA 4FE4A 4PTYA 2QP4A 4EABA 4IWNA 3COYA 1Q95A 3A7DA 5JFTA 4QDJA 1VJ0A 2I7XA 4YAOA 2LKCA 1Q3TA 5IBPA 4F5ZA 4G4SO 2A1TR 4QKQA 3C3KA 4H7EA 2DM6A 3T3DA 4BUCA 4GD3Q 4LWOA 4BMZA 1ZVVA 2IJGX 4YMLA 3PQ4A 1YC2A 1TQ4A 1XZHA 2I6TA 4IZOA 3ABZA 3M6MD 3WP0A 2WVGA 5A9SB 4QQ8A 1KHTA 1KI2A 1H0SA 1XP8A 2ATXA 2C7BA 1RYEA 2F59A 3HCWA 2OXCA 2YXPX 2W2LA 1QCYA 1SOUA 4RCVA 5J2UB 3U3ZA 2XH8A 4NIMA 2DBRA 2G4LA 4HDKA 5DXFA 3V9PA 4L3OA 2AJTA 1NV9A 3NHUA 2HA3A 4LMBA 5AHRA 5ALJA 121PA 3SIRA 2EZUA 3RM3A 1UJ2A 2R4UA 1WUHS 2JH8A 4UVHA 3HK2A 5J5AA 4G86A 4JI5B 1I14A 3FM9A 1J39A 1HTBA 2EC5A 3MRTA 4ATNA 4PCUA 4EVRA 4X44A 1IATA 1OWPA 2XUOA 3MT9A 3FROA 3QWIA 4PLZA 4K7JA 2ZR9A 1NVKA 2H2AA 5TMEA 4I1RA 3ZVRA 1LTKA 4PC1A 2GHQA 3IUQA 1B0ZA 1VZ3A 3S55A 4YT2A 3FGZA 5C7OO 3QU5A 3T35A 1X1CA 5TPZA 3BWVA 3ZU3A 4J4BA 4PRZA 1RCUA 2P9HA 2ZI4A 3COVA 1CLUA 2ET6A 1CNEA 3C39A 4QBTA 4UJ5A 4Z3KA 3IH5A 5JW6A 5BV1A 3UMRA 4XWAA 1USIA 2HWUA 4OYHA 1SIBE 2AR9A 2RD2A 3CF4G 4UHFA 2W6QA 2YQ5A 5AVYA 2HBQA 2FW1A 1G8HA 1MX9A 1ZJJA 2OFXA 3QPCA 4S1WA 5IAJA 1RXWA 2QDXA 3N2ZB 3WBBA 1DEXA 3PHBE 4MJ7A 2ASEA 2IZ7A 5IYZF 4WEQA 3C3XA 4B2LA 3G3EA 4XQCA 4JI4B 3F5MA 4DA6A 4XSHA 3FHOA 8LDHA 1SU7A 3VZQA 3ICOA 1CPYA 1FFSA 1PDVA 1OH6A 1U0RA 2ZPAA 2ETXA 2O4CA 2MSKA 4IDEA 4MAMA 5DTJA 1CSEE 1WDTA 3PKJA 3ROTA 3EXIB 4JEMA 3HJHA 1G2PA 4WQMA 2V54A 4PIMA 2FWNA 1UZLA 4FD3A 4LGVA 4XQ0A 2B1RA 3VSBA 3SQNA 4AG3A 2WWGA 3MHTA 3E81A 2WD9A 3ET5A 5KOIA 2NTVA 1YULA 4HNTA 4X0EA 5A7HA 1YQXA 2EBHX 2W48A 4PX3A 1GSHA 2AG0A 2QD4A 4G1UC 3A1SA 1VYTA 4GSKA 4P5PA 4UEOA 1YHYA 2F00A 1JFFB 3OA2A 2FWPA 4KFSA 4AICA 1DS6A 1P9NA 3NHJA 3DAYA 4IZHA 1XWFA 4M98A 4OQQA 5LQSA 1ZS9A 2GEJA 1S2MA 4R9UC 3SX4A 3ROZA 2BGMA 2ERYA 3HGQA 5D3ZA 4LVUA 2VNIA 1E2KA 5ALHA 4CIVA 3SYMA 5HZGA 2FK8A 4R01A 1WCIA 1WZUA 2QLFA 5DX8A 1X1DA 3O7WA 3C16C 3FBWA 4G1FA 1KDZA 4F38A 4TLBA 1EK1A 2H1LA 1Q2UA 4WK4B 1JIKA 5F73A 1OA1A 3BGOS 1GWNA 3OZUA 3U7QB 4ZI7F 2PRIA 3C6KA 1QG6A 4KMRA 4MXDA 4EG7A 2PZGA 3QA3E 4ZHQF 1VGVA 4IJ6A 3ACBA 3Q11A 3R75A 3RK0A 1FEZA 1SHLA 1XXHB 2L82A 4K3VA 1T5SA 3WL3A 4EUHA 2FW7A 5TSDA 2WVJA 3DBLB 1X92A 4JY7A 3K0KA 4OMCA 1PEKE 1UCFA 3S99A 3TDNA 4PGGA 1GVHA 2ZAMA 3NV7A 4TZTA 3RUEA 2I4MA 2X6RA 2AJBA 5KJ1A 2G1PA 4LSMA 1B16A 3D59A 1JFRA 3EVNA 4R1OA 3MUFA 3ZK8A 3R76A 1KA9H 3LYAA 2R87A 4J0JA 4ZVQA 2ZJ3A 4D96A 2A94A 3I9MA 3PNMA 2ADFA 3RRNA 4PAGA 1YE3A 2MYUA 3F3MA 2FP3A 4E5PA 2VSXA 1PX0A 4ZT7A 2DTEA 5FO1A 5FPPA 1LRJA 1KI6B 2RBKA 5FA5A 3QBTA 2ZSBA 3MD0A 4OAQA 5KREA 4GMGA 4GQIA 4I6EA 1BZYA 2RGRA 2ZXFA 5CCXA 4MS4B 2VK4A 4PLCA 3KYCA 4FEYA 4NBLA 4XYMA 2PUTA 3WB0A 4KPFC 3X44A 3HBNA 4D4GA 1PQUA 1DJPA 2IPNA 3NTRA 4GQAA 2W6ZA 3CWQA 4JCCA 4KDEA 4BBZA 1PR4A 3HJUA 1TJNA 1FTQA 2V58A 5K45A 4G25A 1W1IA 3LT4A 2NAPA 3VKUA 3AVUA 4GMKA 4KSBA 1T5TA 4KPYA 3G2OA 3C3EA 2VHTA 4KDCA 2ERXA 4L15A 3T9DA 2GD1O 1INLA 1ICEA 3A9WA 3Q2OA 2PVCA 3PDUA 4TSFD 4WASA 4TTVA 5E1MA 1FRNA 1N5IA 1ECCA 4FK8A 4AMVA 3TNYA 2FWJA 5ARBA 2VAWA 1QX3A 1Y8AA 2W7TA 1TL7C 4JLPA 2CB0A 2QROA 1E0KA 3FHLA 4PHCA 3KE9A 1YOVA 4QDUA 6REQA 4YV2A 4JI0B 5G4KB 3DZBA 3TZLA 3LL4A 3A2LA 1SCUB 2X8JB 3WDMA 2BM1A 2UVDA 4BBAA 3IKMB 3VVCA 1FXWF 4RMNA 4WT7A 4UDOA 1JSRA 1YDFA 4ZMBA 5LMUB 4MS3B 3GDGA 1JFLA 5HR5A 2QE7D 2OCIA 3ILSA 2NVUB 1SUEA 1J8DA 3PGJA 4OJTA 4EOGA 4CKEB 1YU6A 4RKQA 3KZ1E 4OXIA 1LPNA 3OPXA 1PJAA 4QPJC 1WHSB 3GJ0A 3FOEC 3M5WA 3OHMA 4F96A 1KK3A 3QEMB 1FJGB 3T7RA 3C41J 1Q6ZA 4Q9KA 3TTYA 2IPAB 1X0VA 2IEBA 5G3ZA 4ZV7A 3DV2A 3U7EB 1FJXA 1I2ZA 4WZBE 3VSEA 1BIFA 1EXNA 3P0EA 3E70C 1QO0D 1YE8A 1PJCA 1KK1A 5T6MA 4FKBA 1DBRA 1U94A 2ILTA 3Q0TA 4EB8A 2OSBA 1PI3A 2WILA 4LNHA 4ETNA 5MDHA 4E07A 1CEEA 3IELA 3VKGA 4TX1A 4HB0A 1IFXA 1MO3A 4Z0TA 5JXIA 3O8LA 3D7NA 4LQDA 4AS2A 3UG7A 3HKEB 3T5BA 4EH1A 2P9QA 5C37A 1E89A 1MN6A 1UKYA 2QRUA 3TZCA 3UK6A 3E27A 2IYQA 3CLSC 3OJCA 5TVGA 5CW1A 5A6SB 3RWOA 3QTTA 4EB0A 4YAIA 3B70A 5KX5F 5D51S 1PZEA 4DFDA 2AFRA 2YWRA 2XLBA 2YNMD 2RJOA 3B8EA 2Q6TA 4GE3A 4U00A 4XIGS 5I5GA 3ZH9B 2PUAA 3BREA 1RWQA 3COZA 1UPTA 5FI1B 2FFRA 3WLHA 2B34A 2XOKA 4LF6B 5DRYA 5NULA 5KNDH 4DEXA 1BWRA 4C5BA 5MFPA 3W7BA 3NOXA 4HATA 4F46A 5A03A 1NE2A 4CDRA 1O89A 1S8FA 3DWFA 1HV8A 1M1ZA 4C3ZA 3WWYA 1AQNA 1L3BA 2I9PA 3O21A 5AIAA 3D6VA 2I6QA 4DABA 2W2TA 3FXAA 4O3FA 1CJBA 1YQEA 1T36B 2X2OA 3DOCA 4MW5A 3K6RA 5IDWA 1UXHA 4W9RA 2Z98A 5GWXA 4L8GA 4MUIA 1CUVA 3H5LA 4Q4AB 3FNIA 4LE0A 3W2EA 3TAUA 4BFZA 3WFZA 3I39X 5JPCA 1T4CA 5KBYA 4A0GA 3WHKA 1KTVA 2B8WA 3N0TA 5EHGA 1JMKC 1K89A 4NCXA 2B83A 1HH4A 2X9GA 4PAMA 5CDYA 3PJRA 2AFHB 2XUGA 4XSGA 5AVJA 4HV4A 5IC6A 1QIHA 1ANKA 5KNDA 3KAPA 1J8VA 3P2YA 1E92A 2IQ5A 4X93A 3TYXA 3NTOA 3RRZA 3LGAA 1NRWA 3CCBA 5IAOA 1KXJA 1S8AA 2CFTA 4EARA 1QUFA 1ZVKA 2A58A 3AIIA 4U7WA 4ZT6A 2BKVA 3RNOA 4RVNA 3VR6D 4LYGA 2PUHA 5J5VA 2YYAA 3W04A 4LJKA 2MDTA 4P0QB 4ZCIA 3R6DA 3EUAA 4JBWA 4QLAA 4Z3OA 3C87A 3L8CA 3MG9A 2HRRA 3L84A 3EODA 3OE1A 4X5OA 1B43A 4E94A 1NJGA 3FBTA 3H11B 3KG2A 1IHDA 2FKNA 3IX7A 1K06A 2W90A 3W77A 3PYXA 5KWIA 1UEJA 2X7HA 1BFDA 4FYHA 1OU0A 4LQCA 4EF4A 4MRSA 1G7CA 5ADVA 1HUQA 1Q0LA 3EVEA 1QYXA 2PQ6A 3IHTA 3OJXA 1WV1A 2P5YA 2ENWA 3U40A 3PT9A 1Z4PX 3I92A 1WCYA 3DMPA 3NHPA 4JGGA 3PSHA 2YH2A 3QBDA 5FCDA 3OIFA 3WLOA 3E3LA 3FUTA 5A3SA 5J23A 4N8EA 1DJNA 1G3UA 3HS3A 3OZTA 3AB8A 3IPAA 4RS4A 3H0CA 1PNTA 2A7QA 1E1CB 4N9WA 3H9BA 5ERXA 4DN6A 4YRGA 4JL6A 2BT4A 4U7TB 1YB4A 4FT2A 4JT8A 4BE4A 2J67A 4YJ3F 4L9AA 2Q1TA 1VLVA 3ICPA 4GVPA 4XUGB 3LY7A 4N47A 2RK4A 4BNNA 2X4LA 2WSYB 3WMWA 4ZOQI 1N6PA 4RKFA 1I4EB 1E3WB 1ZH4A 1HFKA 5FA8A 4BLOA 4IL5A 2CUNA 2PSHA 3KT3A 2HLDD 2D7CA 1XE3A 2XBUA 5AP9A 4JU8A 2O06A 3ZR4B 3W7AA 1FW8A 2OFPA 4UC0A 5JAMA 2V6GA 2X9NA 4MGKR 4LC9A 3VPFA 4I2NA 1NG9A 4KAXA 2ZK7A 2VUHB 5CJPA 1MTOA 3UFXA 4ZYYA 2FPXA 1XF1A 4BQQA 1MO2A 1PLLA 2FOXA 4LJYA 4CMIA 4O29A 1DAHA 5M04A 4QQNA 2EJWA 3QP9A 3B38A 4Q3CA 1ISMA 5HSGA 1IM2A 5DWVA 5YASA 4ARIA 2P3QA 1GPJA 1RTTA 2OOKA 4UD2A 2W71A 3FOBA 4KFUA 1GFWA 1P2FA 1U2QA 3DBIA 1ETUA 1JLKA 3I09A 3L2OB 4XGIA 4IDHA 5L3ZA 5DHRA 3VYRB 3GAZA 1C9JA 1PSWA 5A2QA 5T4FA 4CF5A 1EWTA 1RRVA 3UICA 3ORSA 4XTRA 3ZY4A 1P5HA 5KOYA 4D25A 4FWTA 4L5JA 4FYVA 2C00A 1XDBA 3KR9A 5AD1A 2C8KA 3PHIA 3OQNA 1RMQA 1UBMS 1RSZA 4DC0A 1DL5A 3R3SA 2R85A 5T4BA 5I6DA 1MHPA 2V59A 1U4OA 3MBIA 1A8QA 4KWHA 1U1DA 4WE3A 1QDLB 5CVCA 1HORA 2BGLA 1PL0A 2RAVA 3DH0A 2OEPA 1B0AA 1PWHA 3WAJA 1R3DA 2O6HA 4MYDA 1PJ3A 2FDXA 4HG2A 2Q2VA 2A9KA 3DHWC 4FBLA 4HWKA 3V4SA 4CNQA 1TPZA 4TXJA 4GICA 1T0HB 4Q4JB 4FJ2A 3T0GA 1JG4A 4CCAA 3AKDA 5AM1A 5FTKA 5JAHA 3DZ8A 4UEWA 2VBFA 4IVQA 4GKVA 4M9ZA 4UTRA 2VJMA 4CQMD 2RCNA 1G7TA 1WXDA 1J25A 3HUDA 3BE5A 5A1TA 3N75A 2DOKA 4TMFA 4R0VA 1L4BA 1V1JA 1I24A 4P80A 3A3NA 4RY2A 3F6RA 4YCMA 1U7PA 1L5WA 2Q6LA 1GTJ1 1FDTA 3HR4A 4WLNA 4HGOA 4ZAYA 5BXYA 5B3AA 1OYVA 3SBDA 1HYQA 2NXNA 2ZJ8A 5B3JA 3THOA 2HXYA 3ZGOA 1N6IA 4R9RA 1BHO1 1XNGA 5LBTA 1P6XA 3UO8B 1L4YA 3GWZA 1NVTA 1TLLA 1BOOA 3G5TA 4I81A 4K9QA 2A3RA 3GEBA 1XAJA 2OZEA 2D5LA 4JHXA 3VH3A 4C0KA 2I1WA 1LNSA 3PWTA 4I8DA 3A3OA 4QFMA 5LD2C 3KTDA 1P5RA 1PJ2A 4Y1RB 2BMAA 5K99A 2BN4A 1LEHA 5DTMA 3PDIB 4C7KA 4CV3A 4MITA 1HT2E 3PEVA 3NFYA 1Z73A 1CIPA 3NETA 2WKWA 1LV8A 4DRYA 4S04A 1TIKA 1UBLS 4RKYA 2YOGA 5DHUA 3L4BA 3M81A 4JFAA 4JGBA 1GNQA 5E7JA 1WO8A 3TTSA 1J09A 4R0MA 4FQ5A 3PTLA 3UMMA 4OG2A 2QN8A 3JYLA 1V8BA 3BXFA 4UEKA 3P1JA 5BRAA 1YQDA 1JA0A 3ID6C 1FNDA 1XZFA 3A9RA 1ORWA 3MNFA 5C7IO 3GNLA 3VSCA 4R1LA 1GPWB 1KFJB 1BN7A 1I2AA 4NV3A 2WJAA 2MSEB 3IDQA 5DEIA 2VDKB 2R6FA 3CR3C 1K0FA 2RI6A 2XMCA 3AOGA 4TTPA 5CXXA 3MIZA 4I55A 4QODA 5C46F 1Z3IX 1QRUA 2YWJA 4XM2A 4F4UA 4Q82A 4DQVA 4PNEA 2YV1A 3C1UA 2IEZA 3S2SA 3FZNA 1D2GA 4GPD1 4NOLA 2O2HA 3WSTA 5KYYB 3PLAE 4M9UA 3OT4A 4YAGA 1VSBA 1A5BB 1Z26A 4L4SA 3PDHA 5HKLA 4B80A 1QV9A 3EVBA 1EEXB 1U65A 2JFZA 5HUJA 4OJNA 5GADl 3U5ZB 2Q3CA 2V5UA 4GGPA 3FTQA 3R5JA 4KIWA 2CXQA 4PPNA 4TZKA 4ZU6X 1UL1X 4IZ6A 1KHHA 3AKYA 1RQGA 3RBZA 1QQAA 2XZDA 4MW2A 5FF9A 1J5EB 3R7SA 4YPVA 4M9QA 5ED4A 5A3QA 3ROKA 2ASVA 1H65A 1YZUA 3DMYA 3HC7A 3UHFA 1TX4B 2QRNA 3CPSA 2IH4A 3QPDA 4MVJD 4P5EA 4K1XA 4UJ3A 3N2GA 2VF5X 1DT3A 3KVVA 1JPJA 4NP6A 4RGYA 3GA5A 2M6RA 3DEKA 3Q10A 5JCJD 5CB6A 1TT7A 4FFVA 1JI3A 1YBFA 3DE5X 4RJKA 4TRMA 4HBZA 3PUZA 4Q4LA 1C81A 3GK3A 1BJRE 2X4GA 2J07A 1TJYA 3ZI0A 1WV0A 3GQBB 2H48A 4CMCA 4UU8A 3BMOA 1PDOA 1ETHA 2H06A 2PUCA 1X9IA 1S1MA 2WUWE 1HRDA 2UV8A 1JR3E 2SCUA 3G02A 5E4JA 3C7CB 4A8TA 1U98A 1NJ5A 1ZJ6A 4ONEA 5DCWA 4TQAA 4EGSA 2WIJA 1R10A 1JWAB 3EF0A 5E8JA 3VV2A 2QZSA 2TYSB 4R7ZA 3QVGB 1SC4A 3GVIA 3H83A 2RBGA 1NPTO 1BS2A 1K3FA 3W7VA 1LRKA 1MB9A 4CUJA 1O6GA 1NOJA 2WA2A 3PUKA 4D9FA 4ENSA 1T6ZA 4BLPA 3DVAA 1IOLA 4JT9A 4MJ3A 2O1EA 4Z0PA 1Z75A 1TCBA 3BSWA 1QH9A 1I32A 1X1RA 5JS7A 1D1PA 4ZYLA 3H8WA 4KQMA 3ZDBA 1W0JA 2XE7A 3TF5A 3GDFA 2WFZA 5JXJA 1M6NA 2XGGA 1H3EA 4MDFA 4JBNA 4BLSA 1F5NA 1PK8A 1UWCA 1YQWA 1WDMA 1U0HC 4I6GA 5J4HA 2UZ0A 4EUKA 1Z4OA 1JAYA 4M8SA 2QT1A 4MA0A 3DYVA 3M6IA 1GR1A 5ICSA 3CLVA 3HR7A 4BLWA 2WYUA 4BTVA 1ZKMA 4G4JA 4EKEA 3NUQA 1P75A 3IT0A 3SHTA 1UT5A 2AZ4A 3IJEB 2B5OA 5CU7A 4GNRA 1MNQA 1M2OA 1ZH8A 2W2NA 1XPOA 4HXGA 3D5EA 3GEMA 3E6AA 3KQLA 2RJNA 4JBYA 4PAQA 4CODB 4LHVA 1NXPA 4C7BA 4WLVA 1LLDA 5AVUA 1ZPDA 2VDJA 1BDMA 4I1IA 3NFRA 1O97D 2HHCA 5IUJC 1CUHA 2KB0A 4UD6A 2RH5A 3MEQA 4QFCA 1IYZA 3RIEA 5JDCA 4CGZA 1Y80A 1GGJA 3PCRB 1OVMA 4F56A 5ALNA 1HDYA 1TI7A 4WUTA 5C5IA 2P3OA 4GMFA 4I4TB 1KYIA 4MYCA 5BN5B 3SEFA 2JA2A 4CLXA 3ZU5A 5L3SA 3U4MA 3ES9A 3M6VA 1ZU5A 3SQXA 3OIUA 2R7AA 3IQDB 2ISCA 1JZTA 4MB2A 5FWXA 4J3NA 1H05A 2IHYA 3L9WA 5TLSA 4D6PA 1IN5A 3H0EA 2KM1A 1U7XA 2IS4A 2CMFA 4PC3A 1KP9A 1N3BA 4KPEC 1P6QA 2HHAA 1TZKA 3MJSA 1ITZA 1WR8A 3QWBA 3VX3A 4AC9A 1IEVA 3Q3GE 1MU0A 2VJQA 1Z4NA 1JHVA 2FPUA 2P9ZA 2VTEA 3L6CA 4LC0A 3WKCA 3KYJB 2A86A 1EK5A 4FWIB 4HB3A 1HYBA 4DAOA 4S1NA 1I6LA 4JJ4A 1L5HB 1RJEA 3LGXA 5BMOA 4B3BA 5DCLA 3CH6A 1SCBA 2DAPA 3EA5A 3HVKA 4IYJA 4LN1A 5K8JB 4JFRA 1O94A 5A4MS 1WSWA 5AUOB 2QRQA 3GN1A 4O4LA 3W3AA 4HLNA 2K2WA 1FP2A 2O9JA 3D7KA 3EZ6A 3I9V1 3LLMA 4XRRA 2WABA 2H63A 1Z37A 4QATA 1UK9A 3NKVA 4OM7A 2I1QA 3OKFA 4KUGA 4YALA 2D7DA 2OM6A 4OHWA 4GOLD 4AUNA 3THRA 3NV9A 4ZO7A 1LW7A 5JAZA 2F1RA 4FYIA 5IKPA 1AKNA 1XRPA 3D2LA 3EUFA 1QOQB 3BB4A 3HNOA 3NWJA 1A8IA 4B3MB 4G3XA 3WO1A 2B25A 2RGBA 3ADKA 1NRJB 3PQ7A 1KH1A 2ZBEA 3EVTA 3QKSA 2IKQA 1PJSA 3U60B 4IP0A 3HWWA 1OMOA 1X15A 4KJXA 4WESA 2XIJA 1GG9A 1Y4AE 2IU6A 4CLRA 3TNFA 1Q3KA 1CR4A 2Q1YA 5FUQA 3FLEA 4B4DA 3ZEAA 2ZU6A 4MV3A 5AW4A 5U9CA 1FJ2A 5A5DA 3N28A 3B78A 3V8NA 5JCPA 4CLEA 1U8XX 4L5BA 4OV6B 1AZWA 3FDIA 2H92A 4B34A 5LU8A 3FCEA 1UBSB 3D02A 2J0EA 3OETA 1QONA 1XL0A 1Z7YA 3BYZA 3GJ6A 2G63A 1RQNA 4JC0A 4C14A 4TMYA 3X1ZA 3ZIAA 2ZB4A 4GX0A 4N3NA 4M0FA 5CLHA 3TJRA 3DXZA 4OSEA 3KYBA 1L7EA 4U2CA 3RHZA 5FHRA 2GPYA 4JSTA 2O3TA 4PLFA 3B6MA 5HQTA 3OESA 4QGSA 4RDXA 1EG2A 5DHFA 1O54A 1WMFA 1YRHA 3L9XA 2QTVA 3ODGA 1U3FA 1KY2A 1Y1RA 3I01M 1D5WA 4QYXA 1FF9A 1R4MB 1SNYA 2AJCA 2W4QA 2YS7A 3P19A 2ZZMA 1KC1A 2CYAA 4DCVA 4Q02A 2H9AA 2F90A 3SEZA 4JVLA 5HG0A 3LS2A 4NAUA 4QUEA 3VRHA 1MW9X 4R3WA 5DXAA 3EBPA 4M36A 2A9JA 4BFCA 4EITA 3KFLA 4UNNA 1FFYA 3AR9A 3HJRA 4LYEA 5K6AC 2GPSA 3BCUA 5LZ2A 4ZOLB 2IYWA 3DZKA 5LQCA 1BNCA 1Y9DA 2Q9AA 3BRQA 3CPEA 1H2YA 2NYRA 4YBZA 3PV0A 4N82A 4YPOA 1EBUA 3WQRA 2X6QA 5DP2A 3W5SA 3JQQA 1GT91 1KR5A 4DVGA 4RJ2A 4ZZ1A 2J9YB 3E1KA 1MKYA 4AJHA 4DF3A 2J0QA 3TMYA 4CM4A 5DU2A 2HK9A 1MF7A 2IYTA 1T9DA 3CH4B 1TJ4A 1V95A 1YIOA 3TRIA