4H7DA

Crystal structure of haloalkane dehalogenase linb t81a mutant from sphingobium sp. mi1205
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
molecule tags Hydrolase
total genus 113
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7dA00
2YXPX 4EY4A 5BV7A 1R1DA 5LP1A 4HVTA 1DX4A 4B0PA 2VJCA 3MVEA 2DSNA 2QJWA 1BE0A 4KAFA 2WQZA 3FVTA 4WDQA 2DCMA 3G9XA 4G8BA 4LKOA 5AKJA 5LZ8A 1UK9A 3OG9A 5AK3A 3STXA 2V98A 5HKAA 1UKAA 1BN6A 2GZSA 1SC9A 2WHRA 4GHWA 3ZPXA 4B6GA 5AKYA 1RYYA 4W1RA 3ZLUA 2O7RA 1LPBB 4RE5A 3WL6A 1W4LA 1ORWA 4G4IA 4CCYA 3EBLA 4AX4A 5T4HA 4G8DA 4EY8A 1UOOA 4JEIA 5CMLA 2WFMA 4DNQA 4OPMA 1ACJA 5T4EA 1E5TA 1YB6A 1CUFA 1F6WA 3D2BA 3EQ7A 5I8PA 1JKMA 4BYMA 5ALRA 1AKNA 2XUHA 4J0IA 1QIKA 4AN1A 1EX9A 1OCEA 4UHFA 3G9ZA 4H7HA 1XRRA 3W06A 4BZWA 4AB1A 3ANSA 3VKFA 4J03A 4GXNA 3PI6A 4BAUA 5AKXA 5EI5A 3ESBA 4N5HX 4FDMA 5CT8A 4ZREA 2GZRA 5JARA 1VJ5A 3VJKA 5HCUA 2FUKA 1EDBA 3D4LA 4GECA 1AGYA 2O2IA 4RGYA 1XZAA 3RARA 3KXPA 2XMBA 3DQZA 1DQZA 1EDEA 5HQ3B 3G7NA 1H2XA 3AINA 2XLBA 1LBSA 4TVKA 5DYTA 3IURA 4C6HA 3PDCA 2WJ3A 4ZXFA 2WG1A 4FWBA 3WKCA 1XRLA 5AO9A 4DLNA 2X5XA 4HTAA 4J0CA 4OYYA 3RKSA 2VTVA 1WOMA 2VJDA 5E4TA 5LIPA 5ALHA 4W1QA 1A8QA 3A2NA 1ZD4A 5HF8A 4XIIA 5EIHA 4G4JA 4D9JA 3GZJA 2PUJA 2WTMA 2PM8A 1ZOIA 4Y2RA 1JMKC 1LPPA 4ZWNA 2XQKA 3M82A 3O95A 5ALUA 3FBWA 2DR0A 4JNCA 1R9NA 4UHHA 1VA4A 4MXDA 1AURA 2H7YA 4UHBA 1Y7HA 1MU0A 2YYSA 3IUMA 1O6FA 3WZMA 5ALGA 2BAGA 5K3FB 1WB5A 2AXEA 2H7CA 1K6EA 4BDSA 1G42A 1ETHA 1DQYA 5EHQA 1EINA 2AJ8A 3O9MA 2R11A 5ALQA 3IUJA 1E3QA 4BTVA 5HK9A 3WLAA 5JANA 3R3YA 4IH1A 3AZPA 4KRXA 4DSZA 1YSCA 4W1PA 2IX9A 2V97A 1N5MA 3NWOA 4FHZA 1QIGA 5DWDA 2XMSA 3OC0A 5HF5A 1DT5A 1CUVA 4J0JA 2CJPA 2VT6A 3HABA 4ZRDA 2HFJA 5EFZA 5JAOA 3RM3A 2Z8XA 3FYUB 4MQMA 3GA7A 3BF8A 4EUSA 5IKXA 4J0DA 3STYA 1C4XA 2J4FA 4DMKA 2VSQA 4LYDA 2XUIA 2ZJ7A 5LZ2A 1ZIYA 1M33A 3PUIA 2FJPA 4F0JA 2XMRA 1IMJA 3YASA 5LZ7A 2C4HA 3N2ZB 5BWBA 4Y2SA 1ORVA 4X90A 3WK8A 3A6ZA 2QRUA 3WWCA 1A8UA 2XUGA 2OPHA 4Q82A 4FFVA 2XUJA 4KAAA 1QIJA 1TCBA 3E3AA 2QMQA 5DTJA 4KRYA 4X97A 1CUZA 5AM1A 2RIPA 2WIGA 4JUIA 5I9IA 3VISA 4QWWA 3S8YA 2WILA 3H18A 4EA6A 4CG3A 5HK8A 3O4JA 4KE9A 5A6VA 2WU3A 5CBKA 5T4FA 3M83A 2XE4A 2QJRA 4YK7A 3OOSA 5A7HA 2FX5A 1CUDA 4OYLA 1CIJA 3ZLTA 4HXGA 3WWEA 1DWPA 3C70A 3WI7A 5AKEA 4UBOA 1G66A 3U0VA 2OQVA 4AZ3A 5KWJA 4OSEA 1W52X 3AZOA 4CG2A 1EDDA 2G5PA 1THTA 1Y7IA 2WKWA 2JGIA 1JJIA 5CT9A 1WPRA 3IIIA 5AI5A 4BVJA 3KWJA 3M3DA 1XZIA 4M0FA 5DYWA 2WIKA 4HRXA 3T52A 1TCCA 1MX9A 4UBLA 4J0HA 3Q8WA 4H7EA 4RNCA 3WQHA 1CQZA 3DKKA 5K3EA 4BP8A 4H7JA 3V1KA 4CIAA 2C5FA 1LNSA 1Q84A 1OXMA 2XMGA 3R0VA 2WFLB 2BKLA 5EHNA 1UK6A 3ICWA 5IVHA 2GBFA 2HIHA 2WHQA 2JGKA 1CUHA 4BCDA 5AI9A 1XLUA 5AOAA 5FP0A 1UOQA 3BIXA 3F8SA 1WHSA 2ONCA 3KOOA 4ROTA 1MT3A 2J3DA 4X94A 3I6MA 1QTIA 1W75A 4FLMA 5ALTA 3HLKA 3WK9A 1DT3A 4DIUA 4ZV9A 3R40A 3HXKA 3QPDA 3GFFA 5IVDA 2CEKA 1XZFA 1EA5A 5CW2A 5E2IA 2DFPA 3V1MA 3HSSA 4UPDA 1XRNA 1QIMA 1AQLA 3WJ2A 5AKZA 1U65A 1ODTC 3C6XA 3I2JA 4X7BA 3M81A 5AOBA 1CFJA 1P0PA 4A16A 3BF7A 2JGEA 4DMCA 3ESDA 2H1IA 4A5SA 5DNUA 2GYUA 1P0IA 1CEXA 1ZI9A 5AM5A 1XRMA 3L1IA 5AKKA 1AMNA 4NZZA 4E11A 4FBMA 4OCZA 5K3FA 3IDAA 3HACA 1ZD5A 1LPSA 3E1GA 3LS2A 4U2DA 5K3AA 5SYMA 4U2EA 1XZEA 1UWCA 1T2NA 1EK1A 5CRIA 1C7JA 3K9BA 5AI4A 1J2EA 1EB9A 3G02A 4OU4A 1ZJ5A 4B82A 5DNVA 4F21A 2UZ0A 4QDXA 5AM3A 2AJBA 4PV7A 1CRLA 1YS2X 1N8SA 1N1MA 3STUA 4N8SA 1YAHA 3ESAA 3HYSA 4Q05A 3HEAA 2ZYHA 3QMVA 3UUEA 2G4LA 4P93A 4PQEA 3AFIA 4I4CA 4EY5A 4DYHA 4N8DA 4UHCA 2HDWA 3UUFA 3DS8A 2Y2VA 1ZGBA 5LKRA 2WLSA 2WUEA 2VQ6A 2QTBA 1QIDA 3BL8A 5ALYA 1GZ7A 2JGJA 3I6ZA 3BJMA 3G0DA 1L7RA 3CCBA 4WCVA 1FJ2A 3CCCA 3WL8A 3QM1A 1ISPA 1XLWA 5JD4A 3RLIA 3G0BA 3BJRA 5JZBA 1QO9A 4AXBA 1XZKA 1JJBA 3BIWA 3HI4A 5ALKA 1XFDA 2YH2A 1XZLA 3AJAA 1HPLA 3ANTA 1CV2A 3OM8A 4PW0A 5CT4A 1X2EA 4AMYA 2B61A 4XX1A 4JYPA 1EI9A 2RONA 3SWWA 3LCRA 2EEPA 2WUFA 3FYUC 2XQIA 1R88A 1HKHA 1F8UA 5CT6A 5FRDA 4BC1A 1ZIXA 3F98A 3QH4A 2VJAA 3IUQA 4WY8A 1CLEA 1EXWA 2OCIA 5SYNA 2Z3ZA 1ZD2P 2O2GA 2EDCA 3C8DA 5DTIA 1CUWA 1J06A 2RGUA 2QUBA 2WTNA 4PSDA 1XQYA 2OAGA 1T4MA 5IVIA 1YCDA 5ALDA 5C8XA 4ZI5A 2ROQA 3EQ9A 4DSAA 5KREA 5CT5A 4DNFA 1VLQA 3WZLA 2FJ0A 3V1NA 4EY7A 4BBZA 3LP5A 1VE6A 4AZ0A 4G9GA 1CUAA 1R9MA 2Y6UA 1CPYA 1SCQA 5AH0A 3U1TA 4ITVA 1Z68A 2JEZA 2HU8A 4AN0A 3C43A 3GUUA 1ZI8A 5AKIA 1DWOA 4IQ4A 5ALXA 3G0CA 1FFBA 4QWMA 4CFSA 1K8QA 2XQGA 1BEZA 3IA2A 1S8OA 2WFLA 2WM2A 1QFMA 3DL7A 2QXUA 5EGNA 4YX9A 3B3QA 1JJFA 4OD0A 3V48A 4FLFA 1U2EA 2D0DA 5AK5A 2GBGA 1L7AA 4GBGA 4KEAA 2OG1A 1JT2A 1MX1A 1QIFA 4X6UA 1UKBA 3WK7A 3G9TA 3QPAA 4BB0A 5E4JA 1MO2A 2QZPA 2GYWA 4HRYA 5ALZA 5A62A 1GPNA 4WDRA 4LXIA 5LLSA 2XI4A 3N0TA 3F96A 5EHXA 3DD5A 4Q3OA 1H2YA 1QIIA 4W63A 2QKYA 2XUPA 3H0CA 2OCKA 2C5GA 3QBJA 3I2FA 5JAPA 2JGLA 2HRQA 4OB8A 1JFRA 2OCGA 1IUNA 3ESCA 3H1AA 5LZ9A 5K3DA 3X3HA 2IITA 2LIPA 4TGLA 5HF9A 1AZWA 1TQHA 4Y2VA 2C7BA 4OB7A 4J0GA 4KACA 4DTCA 1EVQA 1MN6A 3I1IA 5JD6A 4G8CA 4DGQA 2HA3A 3GROA 1X70A 4Y2YA 4HXEB 4FBLA 1JI3A 3WYNA 1XZHA 1ODCA 3I2KA 2WJ4A 4X3CA 4AO6A 4K6GA 1LPOA 1YS1X 3DEAA 4QDTA 1Q0ZA 3WIOA 3WKDA 2JBWA 3BWXA 2DQYA 2QOEA 5AI8A 1GGVA 2H7XA 3W04A 3WK6A 6YASA 2GYVA 1MTZA 4DMFA 1QLWA 2PSDA 2WG0A 1FFAA 3PF8A 2PSFA 5AKGA 1Y37A 1XQWA 3R3UA 1B6GA 1TIBA 5JZ9A 5EHZA 4NMWA 2HFKA 2JGFA 1PFQA 1GXSA 5HF6A 2XUKA 4BCBA 4PSCA 4QDZA 3WIBA 3VJMA 2I78A 4Y2JA 4FOLA 4RPCA 4S0XA 3FSGD 2IIVA 4QLOA 5BOVA 1QONA 1P0QA 1JU3A 1GQSA 1CUGA 4H18A 2WHPB 3WKEA 4KE7A 4E15A 4J0KA 4E46A 3F9CA 4JYMA 3C45A 3C6ZA 3EF3A 3OTQA 1ACLA 3QZUA 4FFWA 2HA4A 2HA5A 4P08A 4L0CA 4AO7A 4QLAA 2VAVA 3KD2A 1USWA 3MUNA 3A2MA 3QMWA 1NU8A 4KR0A 4BE9A 3OURA 3ZI7A 2ZVDA 4XVCA 2E3JA 5FPQA 1VA5A 4B0OA 3AIKA 1SCKA 2DHCA 2AJDA 4H35A 5AOCA 4C87A 4C01A 4EHBA 3KSRA 4UHDA 3SX4A 4W1SA 1TRHA 1N5RA 1DINA 4QNNA 5K5EA 5FXMA 4W9RA 3L1HA 3F97A 3F67A 4L72A 4U2BA 1BCRA 1CR6A 2OCLA 3E0XA 4TPKA 1XZMA 1ZJ4A 1UOPA 1GT6A 5JAUA 2BUBA 2J4CA 1UFOA 3BE8A 3K6KA 1FFDA 2G63A 4FMPA 2XUAA 2JIDA 5A2GA 4C4YA 2C0PA 1IUOA 3FNBA 4FTWA 1LPAB 3KDAA 4ETWA 1FFEA 2WJ6A 3I28A 5FOQA 5ALFA 3H2JA 5AP9A 4Z49A 2PSHA 2XMQA 1GKLA 1VOTA 5HQ3A 2XB6A 2HA2A 3C6YA 1XROA 2PUHA 1HLGA 3A70A 4M0MA 2XUFA 1YAJA 2WUGA 2WUDA 3D59A 1LLFA 5ALWA 3H2HA 1I6WA 1XRQA 3C5WP 5CH5A 2QM0A 2Z8ZA 1UZAA 1VE7A 2WIJA 2Y1KA 3G9UA 3D2AA 2WIDA 2RHTA 4BVLA 3DL4A 2QVBA 1PJAA 3STWA 4H7FA 4H0CA 1XKLA 3Q0TA 1OILA 4MWSA 2PVSA 4U2CA 4QE3A 4BZZA 1VZ2A 1ZICA 2X8BA 1CUUA 1MAHA 1LPNA 2ECFA 3H2GA 4ARAA 2VEOA 5A71A 2VA9A 4AO8A 3LIPA 4K6KA 1HBJA 3HC7A 2HHAA 4K2AA 3UMJA 2JGMA 4BVKA 3B5EA 2OLEA 4HZGA 1THGA 2OGTA 1CUCA 4OB6A 3EIOA 3RK4A 3H17A 1XQVA 3TRDA 5A7GA 5HFNA 2PL5A 3JWEA 4ARBA 3IB3A 4EBBA 2XQFA 1QGED 4H7IA 5CURA 1CUEA 4Y2TA 4EY6A 3WKAA 2HRRA 5AKLA 2X76A 3I6YA 3R3WA 4MJ3A 1XQXA 5DJ5A 4MYDA 2CZQA 1X2BA 5ALOA 1BROA 1ODSA 2WU4A 3C8HA 4HS9A 2W6CX 3W9BA 2HU5A 3BDIA 2BUAA 5CTAA 3R3ZA 2ACKA 3PUHA 2D5LA 3WWDA 1XZCA 2Q0XA 3FYUA 2XDWA 4E14A 4YASA 2XUOA 3PF9A 3WA7A 2I03A 4WFJA 3WWPA 4KE6A 1YA4A 2WHPA 1GPLA 2EDAA 2C58A 4G4GA 5JALA 3H04A 4K6HA 1QIEA 1XZJA 1TCAA 2PU7A 2V9ZA 3JW8A 1Q83A 4KYVA 3PICA 4Q3LA 2XQJA 3D0KA 5AK6A 4WFIA 4AQDA 5JYCA 3LLCA 1PV1A 2BJHA 2ZJ6A 4B80A 4DNPA 1XRPA 5AIAA 3WK4A 2HL6A 5JASA 1CUIA 5JZSA 4Y2UA 1RWQA 5AI0A 3H2IA 3D3NA 5J3JA 4QDUA 2ZYRA 1E8MA 1R50A 3ILSA 3WK5A 2OQIA 5HFAA 4ZGBA 1H2ZA 5ALSA 1DX6A 1JMYA 3R3XA 3DYVA 1H22A 4G1FA 2OGSA 1UK7A 5JD5A 2R8BA 1MX5A 1BS9A 3R41A 2GBIA 2O2HA 1VKHA 1IZ7A 1XZGA 2WIFA 3BDVA 3O4GA 5CXXA 3DNMA 3WMRA 4Q3KA 5JATA 1SFRA 2JEYA 3FLBA 2HU7A 2B9VA 2HADA 5DLPA 4OU5A 3MUOA 2YASA 2V96A 4H77A 3I2IA 3W05A 4NS4A 4FNMA 5I7UA 4MYSA 3AZQA 5E4YA 1E8NA 3D5EA 3QPCA 3DCNA 4V2IA 3KWFA 4HXFB 2GBCA 1W6RA 2ES4A 1EVEA 4U2GA 3ED1A 1EB8A 1U4NA 1K63A 5AJHA 2DQZA 2RHWA 4MQLA 4BCCA 3K2IA 3DLTA 1XLVA 1R3DA 4B83A 4UFNA 2O7VA 3C87A 1QO7A 4LHEA 1A8SA 5JADA 4QZVA 2CKMA 1E89A 1SOMA 1YR2A 2PPLA 3GBSA 4MWTA 2JF0A 2Y2UA 3VJLA 5IVKA 4FKBA 2NW6A 5FDFA 2BGRA 4Y2QA 3WJ1A 4EB0A 5LZ4A 2G5TA 1O6GA 3DOIA 3GELA 4FNGA 4WFKA 1TK3A 2VF2A 3QITA 4B81A 3WL7A 1ZGCA 1HDEA 1XZBA 5H3HA 1LZKA 3A2LA 2Y6VA 1QFSA 2H9YA 1FFCA 1ZD3A 3FCYA 5ALMA 1CQWA 5LKAA 1D07A 2QXTA 1QZ3A 4MEAA 3VDXA 1G5FA 1CUXA 3TGLA 3D7RA 1YASA 2DHEA 3H2KA 1DWQA 1A7UA 4DMHA 2PU5A 4IHAA 4QDOA 4X6YA 5LYYA 4LYEA 4F60A 2W22A 3ZV7A 2C0QA 1BCSA 4C89A 3NOXA 1TAHA 2VATA 4J3JA 3TEJA 1W1IA 4Y2XA 2PX6A 1MJ5A 2PKYX 1YA8A 3ICVA 3O9VA 1E8DA 1HQDA 3I2HA 5C8VA 1AX9A 4DNOA 1LPMA 2P8SA 5AHXA 4U2FA 1VZ3A 3CN7A 5FV4A 4BDTA 4KAJA 1E66A 1JU4A 3IBTA 4XWGA 2HA0A 3SC2A 3WL5A 4MEBA 2VJBA 2PSEA 4KE8A 1WCYA 4P92A 5CXUA 4LXGA 5EIAA 1CUSA 2OAEA 4BE4A 1MAAA 4N5IX 1QTRA 2QS9A 1XKTA 4J7AA 3FLAA 3DOHA 3IVMA 4BP9A 4P9NA 5K3BA 4UBJA 4X6XA 3NUZA 1BRTA 4UFOA 5JAHA 3JYHA 3VVMA 1CUBA 5D6OA 4C88A 2HM7A 4ZV7A 1BN7A 3WA6A 4OUKX 5ALPA 3WYDA 4CCWA 3HRHA 5CH3A 1TKRA 1K4YA 4Y9SA 1WB6A 3I1YA 4X95A 4BTLA 1EH5A 3ZWQA 4UBKA 2ZSIA 2ZJFA 4B7ZA 2CBGA 2QR5A 1WM1A 1KU0A 3FLEA 3I2GA 5D3ZA 3W2TA 1EK2A 4XJVA 3V9AA 5LZ5A 4B9AA 7YASA 5ESRA 1EHYA 4BRSA 5FLKA 1BEEA 5D7BA 4CG1A 3VVLA 3IUNA 1H23A 2CB9A 2WFZA 3PE6A 1WPXA 3G0IA 2I3DA 2B20A 5C81A 4BRZA 2QT9A 4L3WA 4UBMA 2Z3WA 3HJUA 4BATA 3FCXA 1VXOA 4UBIA 3CN9A 1CVLA 3PFCA 4WY5A 5AICA 5DNWA 3OPMA 4C4ZA 3WWOA 2XUQA 1MNQA 3IULA 4QA9A 3G0GA 5ALLA 1W76A 5T4BA 4PF1A 4UFPA 2ZSHA 4X93A 3S2ZA 3TJMA 4BAZA 4UBNA 1C7IA 1HL7A 2RI6A 4X00A 4O08A 1RP1A 2BGNA 3P2MA 2J3QA 1NU6A 2AJLI 3AILA 2XLCA 3O4HA 3QVMA 4CIBA 1GQRA 4CCYB 3LIIA 5YASA 4Q1VA 2XMCA 3SK0A 2QUAA 2VAXA 3HZOA 5ISMA 1UXOA 3AIOA 5AM0A 4B85A 2RAUA 3DDUA 3NGMA 4RE6A 3WKBA 5C7YA 4N8EA 2HA7A 1YB7A 1KU6A 5ALNA 3QMMA 3FVRA 3G8YA 4GI1A 3B12A 1KEZA 1ZI6A 4KJXA 5K3CA 3W9UA 3T4UA 1L7QA 4GW3A 1DU4A 1GPKA 3FOBA 4GLBA 5AM2A 4A23A 1UKCA 4H7KA 2XUDA 3O0DA 3D2CA 4X92A 3DYIA 3BXPA 1DTEA 1AC5A 2BCEA 4Y7DA 4WJLA 1NX9A 1BU8A 1QOZA 2I3ZA 4G5XA 4B9EA 4X91A 1CUYA 1IUPA 2AJCA 5FUMA 1XZDA 2WG2A 3PFBA 1A88A 1LBTA 3L1JA 2ORYA 2PBLA 4PSUA 3DJYA 1QE3A 4Q34A 4IO0A 5ALJA 3STTA 3MGAA 4M0EA 2HA6A 1R4ZA 1WHTA 4PO3X 4YPVA 4INZA 4K5QA 2OGZA 2CMFA 3FWHA 4C4XA 1IVYA 5HKBA 4FLEA 1UK8A 3H19A 3ZLVA 4IH9A 1U8EA 4IH4A 5AK4A 2VT7A 1J07A 5C8ZA 3STVA 5BWCA 4GEGA 1P0MA 1CUJA 5AKHA 3R3VA 5A7FA 4QEKA 4LXHA 3FSGA 5ALIA 4H7DA 1GKKA 1G4HA 1LZLA 2ZYSA 4UUQA 3FYTA 1MNAA 1FSSA 4F5ZA 1QIHA 1VXRA 5AM4A 5CH8A 5DYYA 2K2QB 4X71A 2XMZA 3VXKA 1WB4A 5FPPA 4I3FA 1K5PA 3EQ8A 5ALVA 4GDMA 5F4ZA 2ACEA 5AI6A 2BUCA 1J1IA 5KWIA 3V1LA 2XT0A 3FAKA 4DM7A 4PNZA 3C6BA 4GWLA 5AIBA 2DHDA 1QJ4A 1LGYA 2OXEA 4B84A 1F0PA 3DKRA 4CI9A 4JH0A 1B41A 3AIMA 4X85A 1IZ8A 5JIBA 1SCIA 2WSLA 4BC0A 5ALEA 4EZIA 4L9AA 4NVRA 1MPXA 5KBYA 2B4KA 4BAGA 5EIEA 4LIPD 4Y2PA 5IH7A 5FKJA 1UT6A 3AUKA 4AMZA 1Q0RA 1F0NA 3CXUA 3O4IA 1H2WA 3C5VA 2Z5GA 2CUTA 4G9EA 3E4DA 2BFNA 4UHEA 3H1BA 4I19A 3QYJA 1AUOA 2PSJA 2XMDA 2ZYIA 5HZGA 5D3KA 4HAIA
chains in the Genus database with same CATH superfamily
3B6JA 4O4JB 1OMOA 2Y9PB 2HI0A 2YXPX 1ZVMA 4CKYA 4EY4A 2VTEA 3M6WA 3FJOA 5BV7A 4X62B 5HHTA 1DX4A 1JH9A 1WU8A 1Z34A 2VJCA 3MVEA 2DUWA 3TMKA 1DZ3A 1QMGA 3TSZA 4HB3A 5H9VA 2GD6A 3KXKA 3ZHVA 4B8ZA 1IY0A 1HURA 1OJ7A 4FN4A 4M1MA 5LXTF 1X7YA 3U56A 2QNRA 5AKJA 4KI0A 4L9WA 5H80A 3NOQA 1RQXA 4LPKA 2IUTA 1ZN7A 4KWTA 2F9FA 4N03A 4JBLA 1Y1KE 4TKUB 3KFXA 3JSAA 4DMLA 2M6RA 2POCA 2ZXUA 3CVVA 4WKGA 3BIOA 1DJOA 1GTL1 2A86A 3HU3A 3NASA 4UC0A 2I1VB 1LCIA 4UNRA 3B1KA 3LCMA 1QRDA 1FY2A 1BWSA 1AXRA 3WP1B 3U19A 4K6CA 2SKDA 4QXAA 3W4KA 2P9FA 1JR4A 4MRMB 1S4MA 1OFVA 1V8OA 3UIEA 1F2TB 1RYYA 3ZPXA 3ZWXA 3G23A 1U9JA 4W1RA 2EX4A 2G8LA 3WFZA 3ZLUA 4EEKA 2WQ6A 2O7RA 3CNOA 2H92A 3MOSA 4RE5A 4J43A 4LZOA 5TGZA 3O6VA 3CX6A 4YQEA 4BJ1A 4F7DA 5BMVA 2EGUA 2HXGA 4I55A 3VMFA 1E4EB 3ABOB 3WB0A 3I5AA 3ZD8A 2DPLA 2XTJA 4Q9JA 1DRUA 5LBIA 5C8DA 5CA1A 3T7EA 2B83A 3VPFA 2OHVA 3ZE1B 4NV3A 3REFA 5I8WA 2ZBQA 3N5CA 3M5PA 4MCIA 4G8DA 1L7EA 4XEUA 1EGHA 1GTG1 4QO8A 1GTZA 1OWLA 2YVKA 3D81A 4NEQA 4FHGA 4H1TA 4M0LA 4PG4A 5CMLA 4L5IA 4EW2A 4CM1A 3KOZA 2OP0A 4QT0A 1OBFO 3UF0A 2CDAA 1RQPA 2GK3A 5CBPB 5GONA 4Q3BA 2Q0HA 1L5VA 1MV5A 3FF1A 1B15A 1JAHA 4I9NA 5JLAA 3HVJA 2AWOA 3KAQA 2IYNA 4YJGA 4WPGA 3EQ7A 4IRUB 1QG2A 1IXZA 2ZB3A 3MT7A 1JKMA 1U0FA 2G4CA 4CDRA 3AXTA 2ARKA 3TTYA 3I9NA 4PNEA 3F2IA 2WSSA 2BWJA 4K6OA 4RFLA 1U7HA 2H9IA 5ICCA 1HQKA 3WHKA 5EA2A 4DMUB 2A9JA 3G13A 1PKEA 4W5JA 4ZVVA 1V25A 2AOXA 4J7CA 1TYAE 2QE6A 4PPYA 4PSKA 3ZXXA 1KI6A 2VF7A 4WXHA 1EAMA 3VZPA 3D6MA 3L02A 3THSA 2QMZA 1Q3HA 3C39A 3SEQA 4IY1A 2YFYA 3RYCB 5KOIA 2OILA 4HHEA 2VDWB 3DFIA 4OHCA 1U2PA 2VSYA 1NNI1 4RTSA 2VFAA 1QQ6A 4GKVA 2VPZA 2IV7A 1MBZA 1PZEA 4GXNA 3MYYA 2BONA 4TRRA 1Y6GA 3O4VA 3U7IA 3G5UA 2QBYB 3HB5X 2LCFA 4GPEA 5CJ2A 4JOBA 2ZU6A 3GJ8A 3DMFA 3ESBA 5EI5A 4YRNA 3MC1A 4EYOA 3QOXA 1EUCB 1N2HA 1KS9A 2GZRA 3BWVA 1NPYA 4H08A 5JARA 1OROA 3FTNA 3EDYA 1VJ5A 3SHQA 2F6RA 2OHGA 4R5HA 4ZQFA 2FUKA 1ZOSA 4TLAA 2VDNB 1OGJA 2FNAA 3L6DA 4BMYA 1T1SA 1BMFA 3EN0A 4E5SA 5K20A 5CAEB 4ZEWA 1JI0A 4PIVA 4RCVA 5JI2E 2Z9CA 1AGYA 4RGYA 4AUNA 1TTQB 2AH5A 1KMQA 1QVWA 1UFKA 2AFVA 3DFFA 4R6WA 4WN9B 1JHQA 4JI5B 2B1JA 3OZBA 1Y5MA 3OTIA 3VRHA 4M4SA 1DQZA 2EGGA 3M6LA 3PEEA 4XUDA 3ZK9A 4DMMA 4BNDA 3CLSC 1QHHA 4ACAA 4BN5A 4MP3A 1L4LA 4R41A 3DOEA 6ABPA 3AINA 1FDTA 4IW3B 1XYYA 5DHFA 2ZDQA 2WJPA 1EUYA 5DYTA 3D3KA 4TS1A 2BMDA 2BBSA 4DR1B 1MZVA 1TUGA 2POQX 3LCVB 4LDAA 1TCVA 1UBOS 4RIFA 4HZUB 3KTAA 3JALA 4UUMA 2ZB7A 5CCXA 2ZIAA 1KO4A 2RI0A 1ESNA 3GP5A 4QL3A 4ZXFA 4EB3A 4EMTA 3O3NB 1DAMA 4XIJA 2QVCA 4FFSA 1HF3A 4FWBA 4BU0A 4BNWA 1XRLA 1NULA 4DT1B 1MGPA 3JQ6A 2FE4A 3TZEA 4OJNA 1PG2A 5JY1A 1J0EA 3A9TA 3MJSA 3CH6A 5CJPA 2ZUUA 4HTAA 1PK7A 1WL8A 4KO3S 1ZD1A 3DV2A 4HEHA 4J0CA 4JZYA 3IR6A 5CIQA 3TI9A 5TNXA 1WOMA 1KMHA 3LBHA 4LRWA 5LXTB 5CG2A 4AG6A 2HCBA 3H2BA 1DTWA 4RFSA 2RB4A 3BH0A 3I62A 5KPJA 5E0OA 1H69A 3TW0A 3TOZA 4IAOA 3U81A 1ZPDA 3VR4A 1A8QA 1HFJA 3A2NA 1WSWA 1Q12A 3OCCA 4MR9B 1OAOA 1ZD4A 4NU0A 1SR8A 3QYPA 3ZWKA 4DR7B 1N0WA 3E7XA 4G4JA 2XNJA 1HMYA 1VI6A 1L4NA 1GPMA 4RYDA 2CJFA 3R8XA 2IHVA 3N8GA 3TNLA 3EYAA 2JLQA 1ZOIA 1P60A 2ZIFA 3DT8A 3ENWA 3HMQA 1S01A 2FSVC 3HPRA 4MLCA 4Y2RA 4LMBA 3TDMA 2YZ2A 4AW9A 2EU8A 5LQJA 3BXEA 3QNMA 1SO8A 1FMTA 3RUAA 3W5DA 1I2BA 1FSFA 2X8JA 5K99A 1ZJWA 4JC0A 1UBUS 1I6LA 4PC2A 3V7WA 1X1RA 3PNPA 3I6BA 2CNDA 1ZK0A 2NNLD 2I1WA 2QRJA 4RF3A 5ALUA 5FWYB 3STHA 1QFJA 3QRWA 2VNAA 1M1NA 1KWGA 2I7VA 3IR5A 4Z3KA 1R9NA 4UHHA 2BTOA 3HKDA 4L4ZA 2YV1A 1SQ6A 1XWFA 3C3EA 2JRCA 1AURA 1OYYA 2D5IA 2H7YA 2X2FA 5D51S 4BMZA 4E5VA 2GWRA 1MU0A 2YYSA 1L5NA 5KTOA 4XDHA 4BNXA 1L8XA 1K89A 1Z0UA 3MT8A 5FLEX 4F1JA 3PG5A 4H15A 1HL3A 3QUAA 1V1MB 3R24A 3R5TA 4M0DA 5ALGA 4E2FA 4ESHA 5KEIA 3FVVA 4IIJA 4G81A 4ND5A 4BZXA 3IV6A 4QFCA 1ESDA 4L76A 4W9NA 2ZPUA 3PGKA 4N0PA 5D7NA 1Y6RA 3AM4A 5HCIA 3RNOA 5A0TA 1K6EA 2V59A 3LFTA 1PQUA 4IXDA 1AHNA 1DSSG 1JFSA 1BZYA 1Q22A 3AR8A 1GG5A 1MEEA 4JELA 4F6RB 1AV6A 5EHQA 1OZHA 1BX3A 3ZHRA 2IOFK 4UOEA 3O9MA 2Y1FA 2A33A 4JGIA 4C20A 2R11A 3GQVA 2GXUA 2LW7A 3WQSB 1CEYA 3LT4A 1DRVA 2JVKA 3R5SA 1A4IA 1E3QA 5IJXA 3OP4A 1BGXT 2QQ0A 1FNSA 1ZCJA 2IY7A 1QBKC 5F5NA 5BW8A 4CKXA 1R5NA 5ADHA 3SXPA 3R3YA 4IH1A 1GTJ1 3OQ1A 1YSCA 3DZHA 3X2SA 2IX9A 1GCOA 3UCEA 3PR1A 2WIAA 3LUBA 4ADSG 1YVUA 1I1NA 2TSYB 2V97A 1MKYA 3MK31 4LOJA 5BSKA 1XVLA 1VHWA 2L19A 3Q7EA 3ZW9A 2OBMA 1W581 3FHOA 3PUXA 2A57A 2OXIA 1KQGA 1OE0A 3QJYA 3R9IA 3DKIA 3O91A 4P54A 1LUAA 1LXCA 3RF7A 3RTEA 2IXAA 2Y27A 3UMRA 5IUNC 4XYLA 3HABA 2EWVA 2OBNA 4ZRDA 3LUDA 5J2TB 2HFJA 3EWSA 5K0CA 3V4RA 1KMMA 2HOQA 4ZCQA 2PE5A 2AFHA 5JAOA 4JUFA 3SIWA 3BJIC 3RE1A 2IY9A 1IHYA 4J0DA 2PAAA 2ZG6A 1C4XA 2B82A 1VJRA 1E2PA 2J4FA 4GF5A 2WQ7A 3T5CA 2R84A 4OK5A 1MQ9A 1B73A 3BAFA 4Q1DA 1XEXB 1ZIYA 3IVCA 2DYKA 3ZY5A 4YAGA 1E0DA 3I0NA 3NOOA 1W36B 2XMRA 4LVUA 5EMNA 2CLKB 2M1XA 3EA4A 3FB4A 2EFYA 4WA8A 4D80A 2HHJA 3HNRA 1IK4A 2P9ZA 2R48A 1Q1EA 2V7QA 4CUKA 5A4AA 1ZD8A 3GUHA 2RGGA 3QE3A 4X84A 5HIMA 4BU1A 3A1DA 3WK8A 1UF9A 2C04A 4KXMA 4FGJA 4OXIA 3RBVA 5GPBA 3TIVA 4E09A 4LOKA 1LF5A 1EX7A 3HWX1 3OIWA 3PQFA 3A6JA 5J43A 2XUGA 4LY3A 4OAPA 5JSFA 1ZSNA 5EUCA 2D0PB 1OH7A 4GX0A 5A4IS 4CR8A 2FG6C 3SD7A 5KQGA 3DC2A 3L7OA 1KE2A 5LQRA 3IQZA 5LJIA 2XUJA 2NACA 2PMDA 1QIJA 1HT1E 2ILTA 1JDVA 3HDTA 2EBWA 2XBUA 3K09A 4KXVA 3ZYCA 3EC1A 1CB0A 3PTLA 2NPFA 2I4IA 2XGMA 1AKUA 5K0GA 3L04A 3D1JA 4ER7A 1TCBA 2OTCA 3OESA 1TQDA 1NVWQ 2ODBA 5GV8A 5F7JA 3VPAA 4YDQA 5TLSA 3FGPA 1N5LA 5DX8A 1LLUA 4KRYA 3I5MA 1TOAA 1QQTA 5F5LA 4JOQA 3ZK7A 2ECOA 2P3LA 3OM1A 1W36D 3HXLA 4WEOA 3OEYA 4CG3A 5HIAA 5B6PA 3IDSA 4MRPA 1NVEA 2QW8A 1H9BA 2CNWA 2Q6KA 4TQGA 2HSJA 1G21A 1DBSA 3EVTA 3M83A 1FUIA 3M49A 1WUHS 1PWXA 1P2DA 3KSZO 3P71T 4TL8A 5DEIA 4L8VA 4F3NA 1DDGA 3LW7A 3D31A 2PT5A 2GD0A 2FPIA 4UZEA 3ZLTA 4A8HA 2NZ2A 3BD8A 1UZMA 4V3BA 5A5EA 2FP4A 4L8FA 1DO2A 5IZCC 3DDCA 1JQAA 3OMLA 1UEIA 3RI3A 3G89A 2ZBUA 5E7MA 1O9GA 2ZCVA 4E7PA 1X7ZA 1ORDA 2WOJA 3TLGA 1TM1E 3KR9A 4FFNA 4ND3A 3UYKA 5EG5A 1U2DA 1X8LA 5JCJA 4LF8B 2IK8A 2CDBA 5KWJA 3ZGOA 1CJKC 3W5JA 2YWHA 1W52X 1L5KA 5IM4A 3BMNB 3L1VA 5FYDA 1TCUA 3DTVB 3FUUA 2HSWA 4DFDA 1CXZA 2YW2A 2CVHA 1DKLA 3JYPA 2ZSEA 3EFHA 2OMKA 3ULKA 2XBMA 2QTVA 1S2GA 4MRAA 4YT2A 3FE2A 4GYYA 1KKMA 4NBRA 3PKJA 5EOVA 3ETDA 4ZU1X 3WWYA 3AFOA 4AJNA 4AZ0B 2I9PA 3QEJA 1X1TA 1HKUA 1XNGA 3E1SA 3KRTA 4M0FA 1E5DA 4KLRA 4L22A 2Y9MB 2PKQP 2QAGC 2R6R1 3G2KA 4IGKA 4P0PB 1NBHA 1XALA 3UH0A 4UBLA 3SEZA 5KVAA 3LT0A 3UJHA 3I23A 4OHVA 1LX6A 1U2RA 2HLHA 3A1NA 1HG0A 3BZUA 4ITRC 4PM4A 4ZCMA 1X1QA 1IONA 1HRDA 1N6NA 1CTQA 3WQHA 4Q12A 4M7WA 3IOYA 1CQZA 1QVAA 1ONOA 4B76A 4PRKA 4H7JA 4BP8A 1GSIA 2O3RA 3V1KA 3WYFA 3C7CB 1RRMA 4R16A 1LNSA 2A5YB 3SDSA 2AD1A 2XMGA 2Q4DA 5GP1A 5LP6F 1AK1A 1ORHA 4KQ6A 1V48A 1PP4A 3HV0A 3ZE6A 1RHQA 5IYZF 2JGNA 2FF7A 2RBKA 4OFXA 1P31A 3BWDD 3DTVD 4EFNA 3FCCA 5EHNA 3ONWA 4FYXA 5B53A 2JLYA 2C59A 4TTSA 1F4VA 1KP2A 4OUDA 4I1RA 5ICSA 4KSYA 2HIHA 1ZH2A 3K5PA 2Y0DA 4WNCA 3U44A 2GN1A 2ZJAA 4BCDA 3O83A 1M6NA 3VU1A 1XFAA 4AZWA 2VH2A 1QYXA 3OLYA 1GO2A 1CY1A 4QRIA 3A9RA 5AOAA 2R5FA 2H0AA 2FW9A 5I51A 3SVTA 4A0SA 4QYMA 4I3HA 5FP0A 4A8TA 3EIXA 1UC5B 3WB1A 3ZY4A 1PL0A 2ONCA 5KTKA 3VGPA 4ETIA 1FIUA 4JB8A 1AGRA 2HRZA 3I6MA 1WV0A 1WIWA 5G0VA 3RSHA 3AH8A 1V45E 1D5WA 1SPXA 4GOXA 4LZZA 3WRXA 5IUKC 1QF7A 1W9HA 1M1YE 4OXRA 2ODTX 4ITUA 2J3MA 3SXUB 4ZMBA 2XZDA 4ZV9A 5K4AA 3A6HA 4RIGA 3RBZA 4C3ZA 1M5RA 5IVDA 5FAKA 4AICA 1N2XA 2GJSA 1XZFA 2YVAA 3UGQA 2DXIA 4IXTA 4YP0A 3ITNA 5T8KA 3GLFB 1Z5OA 3QI2A 4EMSA 1ADGA 1M34B 5CW2A 5EL0A 1MH9A 1C9EA 3LWBA 5BR7A 5DNCA 1QFZA 2QG4A 2OHOA 4E0BA 4DDUA 4IEIA 3MCTA 3H5LA 3M6FA 2DFVA 2I4RA 2GAJA 3KJZA 3DH0A 3KHKA 4A15A 3NVMB 2IEAA 5DNAA 3PXAA 1HDOA 1A9XB 2R2GA 4N0EA 4CKEB 2O3UA 1ZJYA 3OCVA 2FOIA 2CFIA 2HUNA 2NO4A 1DUVG 2I71A 4TYNA 3P2EA 4BASA 1GCAA 4JKYA 2O2YA 4U0JA 1QTQA 3Q7PA 1XPJA 1A7JA 2A9PA 3GFQA 2NZ8A 4MV9A 4ZN6A 1W4BA 1AM4D 1P0PA 2GEFA 2C3PA 4X7RA 4X20B 4A16A 4YV0A 1PDOA 1ZL0A 3BF7A 3PE3A 4HNUA 3UZUA 4XGKA 3AUYA 3LDUA 1EP9A 5EE5B 2I2WA 1P0IA 2XITA 5HMMA 1CEXA 1E2NA 5BV8A 1P6QA 1NM5A 1WDMA 2Q4RA 3THWA 4JP5A 1RQ7A 1ZI9A 1RJDA 4NJMA 1XRMA 3L1IA 3PQ3A 4F04A 2Y8EA 4FGSA 1CZLA 1PJTA 4NZZA 3WYGA 4Z4EA 4YP9A 4O4IA 1QMPA 3HACA 4GXRA 4J9UE 4DIFA 4ZZ0A 4CDGA 1IDN1 4DS3A 4WXYB 2PX0A 4BWGA 1UWCA 1G2IA 3GJ3A 4KWIA 1J24A 3ZDRA 3MWEB 3UANA 2B1RA 3SNKA 1J1ZA 1N2SA 2NG1A 1U4SA 2OHFA 3BE4A 3GRKA 2KB0A 4MARA 4QICA 3FDFA 4RL4A 5AI4A 3M1IA 4I4NA 4L27A 2BPOA 3G02A 5KNBD 4QUGA 3GEHA 2XNHA 3DFUA 4B82A 1H2FA 4O25A 3HYRA 1O94D 2HIAA 1KYQA 1T2EA 2WKRA 4HB0A 2VYND 2WF5A 3H1TA 4P4UA 4QDJA 2YFKA 4PX3A 3ETLA 1Y6FA 3WNDA 2UZ0A 4QDXA 3VSDA 2W37A 4ER3A 3Q85A 4U9HS 2DUNA 4IILA 5F77A 3DE6X 4N40A 3ZTYA 4JS0A 1CRLA 1LV7A 2GEDA 3OU2A 4R8LA 3KYDA 3ROZA 3VM6A 4BVHA 1NNUA 1YJ8A 3X1YA 4CF3A 3LL4A 3VR3A 2DUUA 1N8SA 3UBTA 1SB8A 1N1MA 3C48A 4JLUA 4YRPA 3ZHBA 3KXDA 2QV7A 1O58A 1TYEB 3FPHA 4QGSA 5DGIA 3QEAZ 1KDVA 1YAHA 3M4ZA 4KP7A 5I7VA 1G6OA 2ESRA 2GM5A 3DNPA 2WWWA 3CUUA 5DU2A 1CF4A 3HEAA 1Y6QA 5G1OA 3S1AB 4V3CA 4LC0A 3HEBA 5IF3A 4PTYA 4UM5A 2OLJA 4U7HA 1OYWA 5CXSA 1SQ0A 2YFQA 3ML1A 2VTBB 4P93A 4L57A 4U7DA 1P39A 2XB2A 3UATA 3LOQA 1Z75A 4DYHA 3WDSA 4EY5A 4YR7A 3KZCA 4OHPA 3A0UA 3UUFA 4MMZB 5LP6B 2AXNA 3FCSB 4YY3B 4L4XA 3WXMA 1N3BA 4AXXA 5IYZB 4ZO6A 3FSJX 3U4DA 1MG0A 4XM2A 5CCEA 1XDWA 2VQ6A 2QTBA 2AF3C 1QYVA 2RGEA 2W71A 3EF1A 3PI7A 4RORA 4ZKEA 1PJ8A 1GTRA 4UE3S 4WKNA 2JGJA 3U31A 1LRKA 2OR3A 4MVJF 1G4UR 5AVJA 3SF8B 3BFXA 1CE8A 3OFSA 4ZIRA 4HEA1 3A7EA 3GVPA 4J2TA 2CL0X 5G1NA 4US0R 2JIBA 3BZWA 1NF9A 3HG7A 3EY9A 4FXOA 1T0HB 1T1EA 3CF0A 4F2GA 4PN3A 1L7RA 3AEXA 1QHFA 4Q3CA 1JP7A 3GMSA 4ND7A 4CM8A 4DA7A 3K6SA 5D8DA 3PQEA 3VHQA 1XLWA 1G38A 2RK4A 1VCOA 2IYWA 4LRXA 3G0BA 4P98A 1NUSA 3LPNA 4G0VA 1ORRA 3BDAA 3KT3A 1NXWA 4ECAA 1QO9A 5BRJA 1GNLA 3UPUA 2C5BA 1RXSA 2BLNA 3DG9A 4K9NA 5REQA 3BIWA 3DEKA 4GX2A 1PJBA 3KZVA 5BP7A 4HGNA 1Z7BA 3DZBA 3OMWA 2QD4A 3OM8A 1DJLA 1IAVA 4JLDA 2AQKA 4MPRA 4XD7D 3UBMA 5J2UB 1TUBA 1CWUA 2ZM6B 4Q1EA 3JWGA 2B61A 4XX1A 1MV8A 4JYPA 2NTYC 1EI9A 2QT0A 4XAQA 1MXFA 2RONA 3EUWA 1IBCA 4R6XA 2DX7A 1FLNA 1YMUA 1QCDA 1F8YA 1ZR4A 4L6IA 1PQPA 3SI7A 2LP4Y 3NATA 3TNFA 4DPKA 1F8UA 2CFCA 1SC1A 5FRDA 3RFFA 3RS3A 3NHLA 3OLCX 1GQYA 1ZIXA 3EGOA 3KC2A 1G5IA 1NVFA 3QH4A 1LFDB 4UTXA 3ETCA 4TQAA 4WY8A 1CLEA 2X5KO 1J8MF 2H0QA 3NC0C 3K16A 1WW8A 1IEWA 2P9HA 1IQRA 2QUJA 1BVRA 2Z3ZA 1ZD2P 3JQ8B 4B8YA 1YQXA 4LW8A 1W36C 3HKEA 3VVBA 4OKIA 3C8DA 4FHCA 2G80A 3RK1A 3MWDB 4PIMA 4ES6A 4G5GA 1U3UA 4NOKA 3GDOA 4F8JA 3EG5A 3KHSA 4OJKA 1M1ZA 1RXWA 2FVYA 2F9LA 2JI7A 2VS1A 3N76A 3TLCA 3KP1A 4DPLA 4CF7A 2CT8A 4AP6A 3EASA 1CQXA 3M6VA 4LK2A 4D43A 3QVWA 1JDNA 3KHTA 3PC2A 3CGWA 4J94A 3U3JA 5C8XA 4X1OA 5EWMB 2ROQA 3EQ9A 4E4YA 3MLEA 1QK4A 1KY5A 4ZQGA 3HA2A 4EG6A 1C5KA 1LRLA 4LDQA 4RW0A 2VAWA 5C2JB 3WZLA 4C0AC 4CU5A 2FJ0A 5IM5A 2BI8A 3FKSA 4F86A 5JC1A 4G36A 4KPYA 421PA 1EGVB 3F6RA 2H1VA 3QFFA 4BX3A 2I65A 1VE6A 4WBSA 1OZAA 1MJFA 3I2YX 4ND2A 2PAFA 2Y93A 2X0FA 2Y6UA 2PZBA 1CPYA 2WF7A 3D7SA 5AH0A 1JSXA 4N54A 2ZUFA 1L8LA 2FDXA 4KDRA 3QU7A 5JVDB 3VOAA 1Z68A 1VI2A 2H48A 1AB6A 5HFJA 4X1IB 1JTFA 1QHEA 2EIXA 4RANA 4DMGA 1BVHA 4YQFA 3PITA 2QYTA 3B6KA 4CR7A 3MTIA 3DM5A 1D03A 1GGHA 2JAXA 4MLDA 3RBXA 1XNRB 1NRXA 3S44A 3EA5A 1C3OB 2R47A 4OQEA 4RH3A 1NKSA 2C5LA 4G0PA 1DWOA 1HT3A 5BSHA 1RFLA 3ZGVA 5IT4A 1RYFA 5K8VA 5EIXA 1FPMA 4RGBA 1YQEA 1XU4A 2AK3A 1NXXA 3MW8A 1UBHS 1TZCA 3H5AA 4XUGB 4BX0A 4F8YA 1QFYA 4YMGA 1F20A 2I7XA 2VHZA 2X2OA 3E22B 4BV2A 4Z2AA 3BQMB 4K9LA 1STOA 3N70A 5AW0A 4WK0B 4ZVMA 4F4UA 1TF7A 3ZY2A 2WKSA 3GNSA 2QM7A 3CYFA 4O6VA 4OK6A 4R01A 4QU0A 1EBFA 2IELA 2XVXA 1RRKA 2BISA 1I5EA 2BGUA 4OXQA 2HN9A 4AYTA 2AEEA 2SHKA 4MUAA 5KDDA 5JXJA 5K8JB 1MABA 4TVBA 1PJ4A 4KBFA 1O0BA 5CHYA 1AZSC 2V6GA 4PLGA 2G5CA 3BB4A 3GJRA 1B6TA 4CEJB 1KJQA 4HQNA 1TEXA 1UAYA 3EPRA 3QPAA 1UJ5A 5J47A 1E2DA 2P9QA 4J4TA 5DW3A 1MO2A 2X40A 2AA3A 2ZTSA 3AQIA 5EGSA 1LLDA 1W2GA 4CFZA 3BB3A 1QQBA 2NZXA 3U3RA 2LXNA 1RADA 1U0GA 4TL7A 1QAMA 5C9ZA 5T7BA 4BY9E 3R0QA 3VYVA 3A32A 1FE8A 1EX6A 2VHUA 5ESWA 3NBQA 4Q3OA 3HJHA 2FSVA 1FS5A 4IJWA 2XMPA 2FWJA 4ZOBA 3MAJA 4IYRA 5BWOA 5A9SB 1R8YA 2RJ3A 4WOKA 3V1TC 3WLHA 3U3DA 4OL0A 2QKYA 4KK3A 3NANA 1MW8X 4UEJA 2B0JA 4CI0B 4YR9A 3N75A 3LFUA 3CW9A 3T9DA 1J0DA 4F96A 1HX7A 3H5IA 1GPUA 3E15A 3P96A 2JFFA 2QVZX 4M8KA 1IY2A 3VBEA 4DR4B 1ADYA 1H1LB 4KB5A 3RUFA 1V8PA 3I92A 4ONEA 2GTPA 1QG6A 3C3CA 4G67A 1GOTA 1NOJA 3EG9B 3Q5DA 5LZ9A 4PY2A 5I7SA 4EHHA 1J2RA 1JR3E 1L4BA 2ODNA 3U3MA 4M1KA 3X3HA 3NAGA 2B0CA 2PVPA 3COZA 3G3EA 4JR1A 1Y82A 3I32A 1TZJA 1DQSA 3TJRA 2IP1A 3EZ9A 3MMSA 1M73E 3Q6NA 4IV0A 4X45A 2QP9X 2BFCB 1XCMA 3A9VA 4B7XA 1B3RA 3B1YA 1TQHA 1ZGGA 3NRBA 5KYUA 3DTNA 3AM3A 3CF6R 3HN7A 4R1TA 5TSDA 1MRSA 1PZGA 2ZE5A 4A0GA 4G0UA 4MROA 4U9IS 4BNKA 3QKSB 2WPDA 2Q1WA 4AJ2A 1KZ9A 5FWDA 3ZLJA 4DV4B 1YVDA 1THZA 1YZVA 2NQTA 3EFOA 4HGRA 4WLVA 1BOOA 4QU9A 4Z51A 4ZYUA 2P2NA 2ECKA 3QKWA 2IYXA 4WT7A 2O3QA 3IDFA 2IYAA 4MJ7A 3D4NA 4POAA 2J48A 5DXAA 1RW4A 2MOKA 4HX9A 4AKIA 1I13A 1ICEA 1O03A 1Y5LA 4UNQA 1DC5A 1ZUHA 2QVYX 4CKWB 1JZSA 5A0FA 4BO7A 1M7HA 3O47A 4DGQA 3DYBA 2JIPA 1X70A 5BN4B 4FCTA 2R8EA 5H70A 4GPTA 2GKOA 4QXPA 5FUYA 4W5QA 1VMIA 2Z43A 5E1DA 1LRJA 1JI3A 3GEMA 4PICA 4OP2A 4QATA 3COWA 5HQJA 1GRRA 3B13B 4BMXA 3T1TA 4G2NA 2EW2A 5BOSA 3W2IA 4MKIA 2JPDA 3IVGA 1GQFA 1U02A 1XZHA 2HD4A 2BFDB 4MV0A 5EWLB 1JDPA 4K6GA 4WBNA 2LTAA 1X8XA 5F64A 4FGLA 1Q74A 1VL2A 2I0FA 1PW5A 3HCEA 4I1SA 1II9A 4JJZA 2ENWA 4LGCA 1Q3TA 4QDTA 5EQTA 1XMQB 1XQ6A 1NQOA 3DEYX 4R05A 4S12A 2VRNA 3LXMA 2DWOA 3PJEA 2D3WA 1SPBS 3HDJA 3RSFA 4Q39A 3CZRA 1GNRA 1KEEB 2SECE 3MCZA 1UAAA 4FILA 1J9GA 2Q7DA 2P2LA 3UUGA 1KIFA 5BV2P 2OUKA 2PKQO 1XWIA 3TRHA 3J81k 1W4CA 3NBUA 4AZTA 2ZBRA 3KZKA 3R0IA 4GKBA 5D1NA 3SSMA 2QTZA 1VSTA 4MI6A 2LUOA 2ZRIA 4D8VA 4ZZ3A 1RZVA 3LF1A 4MV6A 1UPCA 3C3MA 3ZBQA 4EQ6B 2WG0A 5C3MA 1HTWA 3PDHA 3Q2IA 4U02A 1D2HA 3UJDA 1JILA 1EIZA 2PSFA 2R6GA 1QDLB 4XI9A 5KTNA 3IEVA 3AJ9A 3OCUA 2JA1A 3E35A 3IQWA 1Y37A 1PN3A 5E6SA 3GRPA 1B6GA 4DQXA 1CERA 1ZBQA 5TQ2A 5JZ9A 2Q2VA 3D6TB 5C34B 2V7VA 4NMWA 1YQUA 2WTEA 1MAUA 2HFKA 4UUAA 3Q9UA 4JJ7A 5ICEA 2ATXA 2XB8A 1AY0A 1GXSA 2YHAA 4R1OA 1EE2A 2XUKA 2AI2A 2PZJA 4CKCB 1IZ0A 1BW9B 1M0EA 1UPTA 4KR3A 2RC5A 3VR4H 5BNIA 4HR7A 2XECA 2RBGA 5IJWA 2DKNA 1TE2A 5D5PA 3VJMA 3ABZA 5HE9A 3L06A 1O4VA 5JMWA 1WMFA 1DS6A 1KS2A 3NTRA 4N5MA 4RV5A 2OK7A 5JS2A 2FXIA 5MN4A 5L6LB 3VTZA 2ZZNA 2IHKA 3IPAA 3PHHA 3HVHA 2P9CA 1D1QA 4GBMA 1IXRC 1X94A 1QONA 2CWDA 4H3VA 4IIDA 2VP5A 4Y7CA 1NW3A 4J90A 2OZEA 2JS7A 3GCDA 3JQFC 4ABTA 1GQSA 2H08A 2QJFA 4MA5A 4OQ4A 1U8CB 3KPYA 3FOEC 2E4VA 4YEDA 1PNOA 3RVSA 3ABQB 1DTSA 3WKEA 1Z08A 4KE7A 4AKEA 4DBLC 1BFDA 4ARZA 1YBAA 4J0KA 4BFSA 2J5BA 3E8MA 3ESZA 4FX5A 4JYMA 4D44A 5IZCA 4BNNA 4IF6A 1T15A 4R2HA 2HMAA 3LE8A 2CC2A 5I7WA 3KFVA 2JLAA 1A95A 3O38A 2X8WA 4LYHA 1JHMA 3CRQA 5C32A 5CEEA 3QZUA 5L3RA 2XHZA 1GUYA 1GYQA 1Y8CA 4FFWA 4TKMA 4LVOA 1C1DB 4TKUA 1YDHA 1Z5GA 2YJGA 3P2KA 4XASA 4DLTA 4YRCA 4RLHA 5LP6C 2HA5A 3OBBA 4EFMA 3ETHA 4QJ4A 4ZVOA 3K8OE 1XTZA 2IUSA 2O7QA 3GDWA 1JG2A 1DFIA 1I1OA 4L0CA 1T34A 1XWWA 4OA8A 4QQKA 1AQJA 4AO7A 3ZGXA 1A5TA 4QLAA 3GGJA 5IS2A 1ZONA 1OLXA 4MWEA 4JA0A 3LX6A 1BMQA 1Z13A 3OM9A 2Z1DA 1A8PA 3BA6A 3THOA 3N2YA 1E9DA 2B7BA 4GSLA 1N0VC 4MV3A 4R51A 3Q3CA 2QAGA 1USWA 4EKYA 1BOFA 1PQ4A 1X7XB 2EERA 2WZQA 1NVUQ 3DOOA 3VKUA 3SQWA 1AKYA 5B57C 3VSEA 1E5LA 4KR0A 1JLRA 1LSJA 2ZUDA 4ZFNA 2B2XA 3MA0A 1E4EA 4GMKA 4AT1A 5KJCA 4N48A 3TZQA 1SHKA 5K0JA 1QR2A 1DKQA 1IBRA 2FRDC 3GX1A 1C9KA 2NO0A 1SOVA 3LC0A 1NN3A 2IUEA 5EC8A 4C0QC 3PTAA 4RKQA 3V33A 4JLSA 5EMKA 4URXR 3RF6A 3D4IA 2CYCA 1SURA 5E6UB 5DT2A 4C01A 3EZ7A 4MS3A 1E1YA 2RDMA 4C87A 4EHBA 5BW5A 1D4ZA 1T6BY 2Z56A 2QYOA 5CBPA 1ADJA 5C5IA 4Q3AA 2DMRA 4GVLA 5EJIA 4F72A 2PVCA 3GAMA 2H1OA 3C1OA 5ERYA 4W1SA 3RSZA 3T0GA 5DE3A 1MPTA 4XLZA 1U0HC 3R5HA 1DINA 3ZW7A 4BFCA 4OI0A 2HTFA 3RH0A 3GG9A 1M2EA 3PDIB 1SU6A 1YVEI 4F4HA 4W9RA 2JLBA 2I2CA 3IP5A 4HBZA 5EZ5A 3ZV5A 1ABEA 1B8UA 2FPPB 4C7OA 2P3OA 2O4UX 4UM9B 4KFCA 2VWQA 1FLDA 3EC7A 3LBFA 4JB3A 4L72A 4G1EB 3AV3A 4PC3A 1UPXA 1WKBA 2GD1O 3BC1A 1JG3A 2V7GA 1AKMA 3HJGA 2XCLA 4GEKA 4ETNA 3QVXA 4O8CA 1C41A 3EMVA 3QU4A 3TCNA 3CW8X 2DLNA 4L7QA 1A5BB 1EHCA 2MSNA 2X42A 3B1XA 2VDWA 4GE3A 4WKCA 5FTNA 4II7A 2R3SA 1UMKA 5JAUA 3SIRA 5DI9A 1W0JD 2M98A 1C9MA 1Z73A 2I1QA 4Q7KA 4Q4JB 2W2VA 5D86A 3OE1A 3SU8A 1FFDA 2G1AA 2ZSJA 3I42A 3UW1A 2KHZA 3ZG6A 5I7RA 3T3GA 2HREA 3W2EA 2G63A 3R3SA 2PMWB 3A8TA 1N36B 4ND1A 1Z74A 3C6KA 5A2GA 1RYHA 3LQFA 3RSSA 4D6YA 3GEEA 3HU2A 1IUOA 1VRCA 5BR4A 1C9YA 1VMDA 2Q45A 3HU1A 3AONB 3QJ5A 4BNZA 1L5ZA 3COJA 3L43A 1FNCA 3DDWA 5JSZA 3TUZC 2KBEA 4KWHA 1FFEA 4MI9A 1E2MA 1PR3A 3M1LA 4MUHA 4RHUA 4UMDA 2FZ5A 2GCIA 2WMYA 3GWZA 4PLTA 3EPPA 3CEJA 3EK2A 3D8TA 4QG7A 3ECCA 2PA3A 3SJBA 1OZGA 1UJCA 2EVWX 5JMOA 1TMKA 2A0KA 3JSXA 2V54A 2XMQA 4HGOA 1I4LD 4UM9D 1GKLA 1C30B 1OD6A 1NKVA 2REQA 4BLPA 6CHYA 2WWRA 2XCRB 4EFKA 1TX4B 2WAMA 1ZCAA 4BFUA 4CQLA 3QU9A 3LT5A 2GX6A 2I6GA 4HNAA 1QE0A 5CW1A 5G2OA 4L1KA 4DV7B 5CGZA 3L8CA 3C6YA 3BMOB 2F62A 1FQWA 3DMPA 1HLGA 5L3QA 4A03A 1UAGA 2Q6OA 4TTJA 1O7JA 1TO1E 1H66A 2AOUB 3BJEA 3E53A 5DWVA 5FUQA 2JBHA 2WUWE 2WUGA 1JR6A 2ZT6A 1TA9A 3FD8A 2WUDA 2KQUA 4MAAA 4PNPA 2BH2A 3C8MA 3P97A 4FDAA 3QY9A 4PZDA 1YD7A 2EJBA 3NO4A 3PRKE 4RK0A 1WULS 3W90A 1RLJA 2BC9A 3DBOB 3WBFA 4MIYA 2VPIA 5J9FA 1T3ZA 3TIFA 4HAZA 3RSOA 3UA3A 4AWBA 4ZARA 4HI0E 3HUEA 1NRWA 3FI0A 4U7JA 3KUDA 4RK5A 4MUMA 4D45A 1A3CA 4U8HA 1XRQA 2WVGA 5CH5A 5E1BA 3MLBA 3E58A 1UBGA 3H8SA 1AXGA 1TAGA 2QM0A 2Z5FA 4YRJA 1UZAA 5MN6A 1B1AA 1OV6A 1VE7A 2FOLA 5JE8A 5KYVA 5LXTA 4DANA 2VDLB 2I67A 4TQUS 3TFQA 1XPRA 5DSTA 5B1SA 4HQFA 1R0LA 5JJCA 5KDLA 3QGMA 3ENNA 3CNEA 4G25A 2R00C 4REQA 2ID4A 5IASA 3KQVA 4NR0A 5ES3A 1NQXA 3STWA 1NJ6A 4PHGA 3HBJA 1RC8A 1DG3A 3NJRA 3PS9A 5HBGA 1P9WA 3ZJYA 4G24A 3MJTA 4RZHA 5G4LA 2JZCA 4R84A 2REXB 1D2GA 4XVHA 1F2UA 2WWTA 1GAQA 5F1OA 1U8TA 3Q7RA 5FH9A 4BUCA 2ZS8A 1G20B 1O4WA 1WCXA 3OJWA 2VQFB 1T2AA 1U0TA 5JT1A 1X77A 4PYOA 1ZICA 2AOTA 4BQFA 4EECA 4JI4B 2FN3A 3HJBA 1JIXA 1JTEA 5C0OE 1U3DA 4LNUB 4M37A 2O1WA 2JJ8A 5FI1B 2LCIA 3H2GA 4P4NA 4ARAA 2VEOA 1HM5A 2NAFA 4K6KA 4B6RA 4QBKA 3ZXUB 2WDZA 3HC7A 2O2EA 4A10A 1KFKB 3GNLA 1QG4A 3AUJB 3RHFA 2LNDA 1V1MA 5ITWA 3M6AA 2B5WA 4KQMA 2K4MA 5TJHA 2CXRA 3B5EA 3QELA 4U6NA 1THGA 1CUCA 3P0IA 1U1DA 4MVJH 3DXXA 1N1DA 3W4JA 3H17A 4IJQA 1ZIDA 4MQBA 3QTBA 5TQ0B 3JWEA 4RD6A 3DLBA 4F6RA 1F6DA 4KR2A 5DW0A 3SQXA 3CEPB 3DBVO 3KPWA 4YJ3A 5TS2A 2CK3A 3X0DA 1D1PA 1UBKS 2XQFA 3PPWA 5CURA 4DVGA 1JPJA 1AUPA 1U2GC 1CJSA 1YZTA 1CUEA 4Y2TA 4BJHB 2W6JD 5LLDA 1TYZA 1ND6A 2YYZA 3A1FA 4HG2A 1B8OA 3CMMA 4HSEA 3VNBA 1HEYA 3HKBB 4YRZA 3OJOA 2ZVJA 2ASEA 2G36A 1R3UA 5ECYA 5AKLA 4XR9A 1AUXA 1G60A 4L8YA 3I5XA 3I6YA 1M1YB 5A6SB 2XTAA 3TLYA 3NNDA 4D7AA 3R3WA 3SZMA 2OV3A 1RABA 2Y68A 5DJ5A 4BWVA 1AK9A 2B7LA 4ZOAA 5DF1A 3SS8A 2Q6IA 2PMBA 4Z0NA 4ARIA 1BROA 1DOZA 4JVMA 1MOPA 2Q4OA 2JH3A 1Y4AE 3FB1A 4HS9A 3SIXA 3SNHA 3SICE 4B3JA 3JZAA 1NPDA 1WD5A 1CY0A 4X61A 3T9CA 3ADCA 3PJRA 2O5CA 3FYCA 2AWNA 4DTIA 1FNMA 2IIQA 1NQUA 4D42A 1CHDA 1PKXA 1R5OA 4DLRA 4RJKA 1KWKA 2D5LA 1E9AA 1K88A 1CW2B 2D1SA 2E4ZA 3AXSA 5LBUA 3AEUA 4MSUA 1E20A 3SXJA 1Z29A 1OFTA 3EE6A 4LNHA 4OA5A 4EYKA 2XXAB 2Q0XA 3HB4X 3AUAA 2UV8A 1KGSA 1XCLA 3P9PA 2G07A 3A14A 3OM0A 3K9HA 2PZKA 3JAMA 4RTMA 1T8TA 2Y67A 5I9LA 1NJ2A 3HH8A 3UH1A 1R6XA 5K03A 2F43B 4NRDA 1ATZA 1XJCA 3DOCA 1HOTA 3SQDA 5I4BA 3SX0A 5L6MB 4EABA 1G2OA 3IAS1 5HE8A 2GPNA 3JYOA 5CNKA 1QGZA 1ISJA 2WHPA 5JNLA 2P41A 3HXTA 2KSQA 2C58A 3QX7A 5IBQA 3W4IA 1ZESA 1U4OA 2JIOA 1TAQA 4QT4A 1IG3A 1X3SA 3BEOA 1A9YA 1G8KA 1CYDA 3H04A 4IVNA 5EJAA 3F73A 2X5OA 3LECA 2WHXA 1XZJA 3NNNA 2PWZA 1TCAA 1W25A 5K6TA 4GQIA 2O0HA 3JW8A 1Q83A 2DAPA 1OVGA 1JDTA 1PIWA 5GGXA 1QKKA 2ZQYA 4GYJA 6PFKA 3CVYA 3EX7C 3OUUA 3NBZC 1SVLA 5AK6A 1R74A 4V1CA 4J2OA 2HMUA 1HI9A 5B3JC 3CZPA 3VC7A 3LRXA 1I33A 2HRCA 2UDPA 1K8ZB 5FYQA 3CB2A 3EEQA 5HQTA 1ULZA 5D3MB 3MRVA 4MCAA 5AIAA 3MQ2A 3L01A 4F3CA 3WK4A 3QQ5A 3G49A 2YJTD 2HL6A 4J6EA 2BSQA 5JZSA 1OBHA 2VL7A 4KGXA 4H16A 1RWQA 1KI2A 1M2OA 4Z6KA 4C0BA 2H2DA 1EFRA 2Q7XA 4BGEA 4F12A 1YDFA 4M87A 3H2IA 3D3NA 5AI0A 5FLXA 1X1DA 3FUVA 1EZ1A 3RS2A 4C07A 2VPPA 4LYFA 5L45A 3A1TA 2AYXA 2ZYRA 1E8MA 3EXFB 3LQKA 3ILSA 3UTCA 3DVLA 2WBLC 1KFEB 3FPLA 1GA1A 4YCSA 2QRLA 3OICA 4CM6A 4ZI3A 2O19A 4N0MA 5HFAA 3PWZA 2UYHA 1Y8QA 3DV0B 1VJDA 1WZUA 3A7DA 2OYRA 3ZZTA 1H8HD 1AMOA 1L7MA 2ZTVA 1YHZA 4MPTA 2AF4C 3DYVA 4D02A 2R97A 2WYHA 2FTKE 4G1FA 4Y6OA 1BVYF 3UFXA 3KQKA 2B4RO 1V7CA 5JD5A 2R8BA 4EHIA 3PT5A 3E03A 4FT4A 1MX5A 1DUIA 1GP2A 4TWRA 2Z95A 2ZRQA 2FN8A 3T7TA 3WHPA 2AMYA 2O2HA 2V7EA 1S6YA 2FW0A 1MVLA 3ZZ1A 4QDKA 1FUEA 1PFWA 4LHWA 1Q44A 3QXCA 4QPCA 1ZEMA 3OTGA 1LK5A 3BDVA 3SN6A 3QUBA 3F7NA 4X3PA 4EA7A 3TQQA 5CEFA 5IDWA 4OGFA 4GX1A 5CXXA 2NO5A 4CMIB 4PGHA 3ZNNA 1YJAA 1LW6E 2OOSA 4LVNA 1TT7A 1BSVA 2UUBB 4ZAWA 1DXYA 2B9VA 1XMPA 4A1FA 5LB2A 3JPWA 3KXLA 2HADA 2QLLA 3QIVA 1GJRA 3GFGA 1JA0A 2E4AA 4HC4A 5DGTA 1AH2A 1XVIA 2XHEA 2YASA 5EJMA 3TVYA 2WKQA 4H77A 4MULA 1Z83A 4QM6A 4S3MA 2QN9A 2FMXA 3IFSA 4ZPJA 1XT6A 2I6TA 3CY6A 1PSDA 5JZMA 4ZAFA 2FEOA 1H65A 2EJVA 2W2LD 4DLKA 1PX0A 4GM4A 4LECA 5KBYA 3MEQA 4IUYA 2IEZA 1NBAA 2PS0A 3DCNA 3KKNA 3QEOA 3EXAA 4MKGA 4TRJA 4YGXB 4MUEA 5C1IA 3LRPA 2DB3A 1UFRA 2O54A 3OWXA 5AVXA 3VX4A 4IJVA 3RPEA 2FI1A 4AUKA 4BKOA 4KVFA 3IBFA 2WABA 4QBHA 2OCDA 4KUGA 1J21A 5ITZB 3ESRA 3CXRA 4M9CA 1IIRA 1C7EA 2G17A 3C1UA 5AVVA 1EB8A 1N3IA 3Q9LA 1PSZA 2VDOB 2QRZA 3I30X 4JQCA 2DQSA 4ALNA 1QHYA 2AIRA 5AJHA 8ABPA 4B3MB 3EEFA 1VE5A 2PUWA 1NLZA 2JGDA 3DE7X 3KE9A 4OKNA 2QL5A 3RJ9A 4CCSA 4ESEA 4FFBB 1ZXXA 2J3HA 5LYJA 5I7HA 4RKRA 4YT4A 3GEPA 3OX4A 1TQ4A 2ZIZA 3I37X 3DAHA 1M2HA 2CCGA 5EXEA 4ID9A 5DHSA 1XLVA 1OKKA 1U6JA 1VG9B 1Z12A 3QW2A 4O5AA 2I6XA 1RAGA 1V5WA 3CUYA 1MOQA 1QO7A 3F6BX 4LHEA 4P4SA 4PSVA 4S35A 3JZMA 3UK0A 1NUUA 1CP3A 1YJXA 3SLRA 5A4KA 4DSNA 3BXXA 1AB5A 2FUG6 2VOEA 4RXUA 2PPLA 1MW9X 4UJ3A 5U1PA 1YQDA 1RC1A 1GGKA 3URMA 3T9BA 3NBKA 1J2UA 3SXUA 1OW3B 4K9QA 1JG4A 1JJ7A 2Y2UA 4MUFA 4RC9A 4MHOA 3N6RA 5KMGA 3QPUA 1F5NA 1Z7GA 3ICCA 2XVZA 5IVKA 2HJ9A 2J07A 1TVCA 4Y2QA 2VP4A 3Q5EA 4ISCA 3WJ1A 4EB0A 5IC4A 3CPEA 1W5SA 1O6GA 3D3WB 3K4PA 4ZKDA 3GELA 2HK9A 1ZMTA 3EHEA 1PL8A 1XZNA 2JASA 3MILA 2ZWMA 4FNGA 4P22A 4WFKA 4QSHA 3AWDA 5SY4A 4D8UA 1FS4A 2VF2A 5J4LA 3O2NA 3K20A 4JBNA 5KNDD 3L4BC 5HRCA 4HRAA 1E3JA 2O8DB 1EP2B 1JPUA 4EA8A 2ZB8A 1FNBA 1ZGCA 3RUDA 2E87A 5KNBA 2Z6VA 4CKEA 4G1BA 1NVGA 4C03A 1LZKA 1HDYA 3TIIA 1X80A 4UTRA 4G9BA 2WWGA 2RD2A 3Q5GA 1XIVA 1XEWY 1CRQA 1Z6GA 3AVQA 1QFSA 1XA4A 2VYNA 3G0OA 1E3IA 3IDQA 5EQDA 4C9BA 1TM3E 1XEFA 3BWBA 1X9HA 2MU1A 2NZWA 5LKAA 4QTUB 3CVJA 4X20A 4MEAA 3GLRA 4PS0A 4UJ5A 5K09A 1VRVA 3L0YA 1CUXA 3CSUA 4KQXA 2MMCA 3CT4A 1Y1TA 2A5DA 4B6QA 3RQSA 4EL5A 3ZVKA 1YASA 4XSGA 3K53A 3H2KA 1GLNA 1KSJA 2ZJ3A 5FOUA 2OBXA 1P2SA 4NU6A 3RWOA 2QTLA 4DAOA 2VXCA 4WIAA 3SR4A 4YAKA 3HL0A 1AA9A 1EXMA 1K7CA 1KFCB 2CE2X 3GP8A 2X23A 4DMHA 4YV1A 2Z6AA 2A94A 4IDQA 1QO0D 4DJFC 3H2ZA 1WEHA 1JAZA 3BQ9A 3TLZA 2VDMB 4BVGA 4CM3A 4X6YA 4JUBA 2ZAOA 5AJXA 2HWKA 3GBPA 2ID7A 2R5NA 2GEJA 2W22A 1YR8A 3HGQA 3FYDA 4QYXA 2X9QA 2C0QA 1P4HA 5GVSA 1WXDA 1II8B 4D6XA 1LQ2A 3NT4A 1UDAA 2VG8A 3A3YA 4C89A 4C4SA 2CLFB 4FR5A 3IOBA 4TUYF 1OX4B 4JMLA 2VATA 4MW2A 4BFYA 3KT6A 4B73A 4ZYLA 2AX3A 1PR9A 4D9FA 3I83A 2A9KA 4J4BA 5B1IA 4MAMA 4MYRA 1RZRA 3ESXA 5EP3A 4FZ5A 3S27A 3TEJA 4M1OA 4DIMA 3TD2A 1MJ5A 4H59A 5L7WA 1Z5ZA 2MT9A 3QEKA 4F4CA 3ELBA 1IJKA 3JQFA 3L18A 4EP1A 5CYGA 1FPQA 3FTFA 2I7CA 3K0AB 3A6GA 4I81A 1V6CA 5JFOA 2X8LA 4DNOA 4IJ6A 4MPDA 5JTUA 2I91A 1FYXA 1LPMA 1UBNA 3L4EA 4B43A 2SCUB 4D0NA 1ZA1A 3LVFO 5AHXA 2N3ZA 3HFJA 3PQ2A 3UT5B 2BMFA 3MTAA 2DH5A 5JSYA 2M1ZA 3S1AA 1Z35A 1WVGA 3RSQA 1GA6A 3CE9A 1AJEA 2D5AA 5JAMA 2VSOA 4LY9A 1FQJA 4BLOA 3ZU4A 1PCXA 3VZBA 3ZJTA 3DMRA 1IM5A 3IL2A 2BGLA 1NIJA 3MRSA 2R6AA 1M6VA 4WK2B 1FRFS 4XD7A 5JQGB 3NBXX 1JQKA 1FVHA 2CLHB 3H5VA 3Q41A 1WKVA 3WL5A 4C2BA 4RTQA 2HV8A 4DIBA 5ELXA 1HEIA 5DWQA 2II6A 5LP6A 4NG4A 3PK0A 5DTEA 3ZS9A 2C5AA 4BMCA 4CJXA 5KU7A 4DDMA 4TV9F 3KWLA 4RS4A 1NFQA 5EIAA 1US8B 1GADO 1T8PA 4W7IA 5CM8B 3K3PA 4MZXA 5K2MA 3HFSA 3K31A 3N1UA 1MAAA 3U7EB 3HVRA 3SF8A 4N6OA 1QZUA 2CHEA 2E85A 4UM8B 3ROXA 1Z0FA 2ZR8A 3DOHA 3IVMA 1UT5A 3LV8A 4J7AA 3OZVA 4OQQA 4RA6A 4BP9A 4MO2A 2XKJE 3VO1A 3MMPA 1CS0B 4XGRA 2ZRAA 4QNMA 1JLKA 2CN1A 3V2GA 4I14A 4BX8A 2BT4A 2FRDA 4FC6A 4ZICA 5IDXA 1KO7A 4OM8A 1CUBA 1JXOA 4MEJA 3VVMA 5EIOA 3QX8A 3AEKB 4DXDA 1BN7A 2G06A 4QEDA 1UXKA 3WYDA 4CCWA 3HRHA 4A6XA 1R12A 3E9ZA 4HQRA 2G77B 4PC1A 2JHGA 3FMVA 2Y1DA 3WMXA 1K4YA 3IIMA 5M5BA 4PZCA 5JEDA 1S7CA 1WCWA 1J23A 1EH5A 3DQQA 3FHLA 5CPBA 3R7BA 5J2UA 4Z4IA 1EVYA 3UQYS 3ZWQA 2ZSIA 3HN6A 1PFYA 2ZJFA 1SXHA 3QPBA 4EI9A 2IPNA 5L3SB 4OBBA 3WOVA 1KDTA 4P6VF 4BWFB 2HJVA 4ENUA 3ZQKA 4YTEA 1Z6XA 3FVQA 2CBGA 4HJXA 3LBYA 3H8WA 4F9GA 5ED4A 1OA0A 4KIWA 3GZTB 2WJIA 4R5MA 1IY9A 1EEXB 3I39X 2IP2A 2VJNA 4YJ2F 3BA1A 3ND7A 1EK2A 1MB3A 2GPAA 3ZNQA 4URUR 3MAGA 3W2HA 5IG2A 1P4JA 1WZNA 1MXHA 3CQ9A 3GQBA 4IV8A 4HDRA 1Y4ZA 5ESRA 1F14A 3TDNA 2HPVA 4F6CA 7YASA 1QP0A 3P9CA 2IOHA 1BEEA 5GV7A 3MWDA 1LWNA 1ZR2A 3QLVC 4B3CA 3HN2A 3SOZA 2J59A 4R54A 1DRWA 5TMPA 3IUNA 1XVVA 5BYJA 5CDFA 3SLKA 4ZEVA 2B21A 4DBZA 4NTZA 4REOA 2YV3A 3N2LA 1HE8B 1IPHA 4EI2A 1S1MA 4OEHA 1NYTA 4EJSB 2DPMA 1WPXA 3ZZ0A 2XBLA 3WB9A 1HDXA 1WSDA 5EWMA 3BM5A 2NMVA 2QJTA 4P84A 4PX2A 4CF6A 3DJFA 3I9V1 4L0DA 1TU3A 2E0IA 2ANCA 4AJEA 4BRZA 1ZK3A 1Z6PA 2QT9A 4XQ0A 4XGNA 2VK8A 3PC8C 1NBEA 5C1BA 3HJUA 4QOIA 2IYOA 3KQUA 1FFXA 3F78A 3IAM1 4F4IA 3SPXA 1DJMA 1E3WB 1X0XA 3PFCA 1L4FA 2Q9BA 4H2DA 1E2GA 1ZIOA 2D8MA 2FLWA 4IXWA 1FP4B 4IR7A 5AVZA 3CKLA 2R4TA 3LY9A 4YECA 3DHNA 3QE9Y 2NUBA 3BK2A 3OPMA 1CNFA 4EG1A 4C4ZA 1YB1A 4GRDA 4JQZA 3SC6A 4NCHA 2XUQA 4AY2A 1KI9A 1MNQA 1DBIA 1WDTA 1XYGA 4NAUA 4X1IA 3VV3A 4LEIA 2K5UA 2PJUA 4P7JA 1I1HA 5ALLA 1KI8A 1QVZA 5T4BA 4DHEA 4JQYA 4R1NA 4X93A 3RAJA 4BN4A 1JKFA 3W34A 4YV7A 3FOWA 2O0JA 3LC7O 4S1NA 1HL7A 4TUYB 4L2IB 3G1TA 3N8KA 1ZUNB 3QX3A 3EUFA 3NHYA 1I10A 2A58A 4JB0A 1UQTA 1W2WB 3JV7A 3TFOA 4C3VA 1KIMA 4LV6A 1A0OA 2PEYA 4Y0NA 2JAOA 4ZEOA 3W8NA 3R9XA 4OOFA 3NXSA 5EKDA 2FW1A 4M6WB 3K1YA 1Z8NA 1EK0A 2NVOA 3JAWA 3RJ5A 1Q0UA 2D5CA 2OZVA 1BDMA 3O4HA 3BORA 5EIBD 3U4GA 5JW6A 3ROEA 3QVMA 2Y66A 3JQAB 4LC1A 3SEFA 1LK7A 1V7PC 4BRWA 4DE5A 4QQ8A 4QLBA 2VKQA 4DY4A 1YMVA 3GPBA 3JRXA 3LIIA 3OJLA 2HHHB 2F67A 1Y4DE 2P68A 1NHGA 2A0WA 3NDRA 4Z4HA 3PC3A 3SK0A 1EVZA 2VAXA 5EZ6B 4QGGA 1CQJB 3DOJA 3GOHA 3LUGA 3WMWA 5LMUB 1SG6A 2VDJA 5BQPA 4AJ9A 4CEJA 3LVRE 3VPBA 2R00A 1SH7A 4MVJM 3TQTA 4BO3A 4BNLA 3ESQA 4AVYA 1Y80A 1IBKB 2DGDA 3EVAA 1MMFB 2NU7A 4N8EA 4F85A 1PJLA 2ONYA 1G7SA 1BXGA 4N3BA 1JECA 3QE0A 1DFGA 1ICIA 2IL1A 2XVAA 3FVRA 3QMMA 5AUNB 4MB0A 4MW1A 4FMCF 4TV9B 5BN1A 1KPIA 3PFWO 3I6QA 1N75A 1KEZA 1YI0A 3ZDBA 5SZKB 1LW7A 3RRYA 3W9UA 5KAMA 4JKOA 1OI2A 3PCRB 3IALA 4PR3A 4E2XA 5BPFA 1ENZA 2AOVA 5A9SA 3U7QB 4D4GA 3SHOA 2IXTA 4P3NA 4ENTA 4OQDA 2HSDA 3L8MA 4CLOB 1TZMA 2BIFA 3JQAD 3D02A 3KKOA 4G89A 4JVSB 3RD5A 5GM1A 3DYIA 1F8FA 3DZGA 1AC5A 2DP4E 3IEPA 4D8TA 2RAPA 1VDZA 2DFLA 1G7RA 3G2QA 4EAQA 3DL2A 4JSTA 1NY5A 2EQBA 3LK6A 3FPGA 3AJ8A 1NLUA 3N07A 1NX9A 2GF9A 1JIIA 1FTQA 3FDZB 1T36A 3EG9A 1MAWA 3U61B 1MT0A 2V1XA 2H6EA 1VCHA 3IQGX 4OFBA 4WNYA 5FV7A 3UG7A 1KSHA 3UICA 3IPLA 5DDIP 3IVXA 1CUYA 3C7AA 3FI9A 2NP6A 3BTVA 2AFIE 3C3DA 4OXKA 3M3DA 1MFPA 1WCV1 3D4OA 5FPSA 5FUMA 3FNGA 2NT3A 3S0JA 3AU8A 1SHLA 1H2AS 3SYNA 5JYEA 4LDRA 1IEXA 1DAGA 3EQ6A 3K94A 3SKXA 4M0CA 5EE1A 3UMMA 3A4NA 2JCBA 2QLFA 3PFBA 1U2GA 4LJ7A 4D98A 2J6BA 2WY2D 2EHJA 3IEUA 1XAIA 3M4NA 2A5JA 1A88A 4IXNA 2I66A 2IC5A 3QKSA 3NOVA 4X60A 3NBYC 4G0YA 5EJ9A 1Z6AA 4YJ2B 1QE3A 3EXEA 2W48A 3IKVA 1E59A 1CY7A 4IO0A 4C29A 5JNWA 1ZGJA 3NBFA 3CZAA 3OT4A 3IKMB 3V4LA 2YXDA 4CLRB 4BQEA 2IBSA 3HDQA 4INZA 1QGAA 4MR8A 4DG9A 4MR7B 3DBLB 5KSWB 3L7AA 3HWSA 3X43A 2EV9A 3FWHA 1WUIS 3MQFA 4XDZA 3OJ0A 5HXAA 4LF7B 3R7WA 3KKLA 3Q0EA 3JASB 2GWHA 4B7AA 4F3YA 4X44A 3W5UA 4D9KA 3LFHA 5JFGA 4PQYA 2CVZA 2J45A 2SBTA 4ZOCA 3TSOA 2P67A 1P6XA 2EG5A 4R8KA 3KEGA 3A3PA 1XDZA 1ZH6A 1ZOPA 3E9RA 4IH4A 4CEHA 4HQLA 2PMKA 3H5TA 1UP4A 4MDEA 3T3PB 3KQHA 2XNDD 3PGLA 4RH1A 5TV2A 2VRBA 1IM2A 4UEQA 5EWLA 3KQOA 1DEXA 1NOKA 1PS0A 2P5TB 2QZ9A 4IMIB 1QF9A 1BNCA 2PYDA 3I52A 2A4KA 4TWJA 4KNYA 2H1FA 4ZVQA 4BE7B 3ASVA 1CY6A 3G68A 4GEGA 2Z4TA 1OOEA 4XEHA 1P3JA 1E3SA 1U3WA 5FOVA 1NJ1A 4ZQEA 1CUJA 4G0NA 5TVKA 1WZCA 2NVUB 4ZYWA 2FWRA 1EK5A 2XDAA 5AJWA 4I1OA 2BCJQ 4LXHA 1WUKS 5BQFA 5CD9A 3D8SA 3HWWA 2VNKA 3RSGA 1YJBA 1MA0A 3HUTA 2JVIA 4LTNA 2RGRA 1Q7TA 2C84A 5CEJA 2G6TA 1WSAA 4LRUA 4UEOA 3WS7A 5DCYA 1VJ1A 1P5JA 1TA0A 2YV5A 4X1KB 4EQ6A 3CJQA 2ZB2A 4WLOA 2IP4A 1PSWA 3E2IA 1T8WA 1QIHA 1RKXA 1VXRA 2OB1A 4I5DA 1M9NA 2NAPA 3P8ZA 2BHLA 2HMSA 3NIGB 4D3ZA 3L8DA 2K2QB 1G17A 2UZ1B 4UKDA 3DDNA 3O8NA 2XMZA 3CF2A 4EW1A 1SZDA 5B3JA 3RYIB 5FEUA 1V6SA 5FPPA 2CHGA 3ODPA 4NP6A 2BEVA 2D5BA 3IBCA 5BV1A 4LJLA 4AD8A 4CT0A 3GPIA 3PD1A 2XE8A 2E89A 4Q03A 4R2MA 5AVUA 4NMXB 1KSGA 1F8XA 1JJAA 1WBJB 1SRRA 1CDZA 2OO7A 1DXHA 3PDWA 4WXEA 5ALVA 5EESA 5D6NA 4CKCA 1DDIA 1BW9A 1PZNA 2X4GA 3UJ7A 4BNJA 3HB7A 5AI6A 4BVEA 1HYEA 2BUCA 4TSFD 4ZZIA 3I61A 5I9NA 5KWIA 4NSNA 4HQ0A 4EUHA 2ONKA 3T7DA 2M6SA 1H4SA 1LC0A 2IHUA 3KD3A 3IQXA 5KCMA 3K92A 4KH0A 2P6MA 4RD4A 3G7UA 4AP9A 4OLAA 5AIBA 2I4NA 3WLEA 1R6AA 3FNFA 3JWJA 4EFLA 4KN5A 1VYHA 2CSXA 5E95A 4NZYA 2J1LA 2I87A 3IE2A 4QAQA 1KYTA 1J2TA 4Q0MA 2W70A 4YCDA 4HP8A 5JO9A 2R8YA 4LQDA 1NW4A 2A67A 4RD0A 5FFNA 3T7JA 4FMCB 4JD5A 1M10A 2Q5JA 5ALEA 3BMXA 4EZIA 4PLPA 3W1WA 1REQA 3NHPA 1CF2O 4Q16A 3MB5A 1MPXA 1KI1A 3C7KA 4HDOB 1WWKA 4S2UA 4BLTA 3DE5X 1TW3A 3B89A 3FJ1A 4B2PA 4Q00A 2DWPA