4H7DA

Crystal structure of haloalkane dehalogenase linb t81a mutant from sphingobium sp. mi1205
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
total genus 113
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7dA00
4DSAA 5HF8A 2YXPX 5ALUA 2HA6A 3EQ9A 4BP9A 1DQYA 1WM1A 3JW8A 2JGJA 3WL8A 1EDBA 4Y2PA 5LLSA 1PFQA 2XQIA 5JADA 5AM4A 3EIOA 2O7RA 1VZ2A 4KACA 1X70A 5AKKA 1UKCA 4M0EA 4C4ZA 4RPCA 1FSSA 4B84A 4QDZA 5ALQA 2D5LA 1GXSA 4NMWA 1BE0A 1CUYA 2FJPA 2DHCA 4TPKA 2HIHA 4CIBA 5ALLA 1VJ5A 2FJ0A 3W9UA 1LPNA 3VKFA 4UBOA 3IVMA 3T52A 2WFZA 4JH0A 2EDAA 4FTWA 5EHXA 1VOTA 2QTBA 4JYMA 1U4NA 3HACA 1S8OA 4Y2QA 2XB6A 3WQHA 2RIPA 1UK7A 4BAUA 2PUHA 4OUKX 2OQIA 1GKKA 1ZD4A 1Y7IA 1ETHA 3I2GA 1F6WA 4J03A 2OCIA 2C4HA 4KE6A 1BN6A 2EEPA 4N5HX 1CUJA 4U2EA 4IO0A 1XRPA 1R9NA 3O95A 5I7UA 4PF1A 5AM1A 4K6HA 4X91A 3O4JA 3W05A 1Q0RA 1FFAA 5HF6A 4AXBA 1DT3A 5A62A 1EDDA 3WJ2A 1ZI6A 4YX9A 5BWBA 5T4BA 3PI6A 3WKBA 3FYUB 4TVKA 2GBIA 2NW6A 1F8UA 3STUA 3L1JA 4W1SA 1GT6A 5AM2A 3W9BA 4XWGA 1A8QA 3U0VA 5ALJA 3S2ZA 1XRNA 4EY5A 3IIIA 5SYMA 2ZSIA 4MYDA 1AQLA 1J1IA 4YK7A 3WWOA 5EIEA 1Y7HA 3H1BA 5FKJA 1GPNA 1ODCA 1QIIA 4OU4A 5E4TA 4WDRA 3A2LA 5K3AA 4X95A 2WUGA 4Q3OA 3BXPA 4BVLA 5LZ5A 1CUDA 3VJMA 5IKXA 1ISPA 3WZMA 1EVQA 1IZ8A 2VQ6A 4W63A 5JAPA 2C0QA 2VJAA 1XRRA 4OB7A 4WFIA 2DR0A 5K3DA 4WDQA 4GXNA 3IUMA 2JIDA 4A16A 4PSDA 3V48A 2HADA 3KOOA 3I28A 3LIIA 1QIJA 4G4GA 1L7AA 3FLEA 1WB4A 1UWCA 4P93A 4BCDA 2RHWA 1ZI9A 2HA5A 5AKZA 3FSGA 4LHEA 1N5MA 1XKTA 1DU4A 5JD6A 1QLWA 1TCCA 5HQ3B 2J4CA 1R88A 4BE4A 3LCRA 2OGSA 1DQZA 2QMQA 3PFBA 2B61A 2XUAA 4ARBA 1XQYA 3ILSA 5LIPA 3ANTA 4UHHA 5AM0A 4CG2A 1QIEA 2AJ8A 3KXPA 3QM1A 3V1LA 2OAEA 2VSQA 1XQVA 1J2EA 1VXRA 1DINA 3G9UA 4RNCA 2WJ3A 3IULA 3ZLUA 4E14A 3CXUA 3OC0A 4HZGA 3PICA 3G0CA 2JBWA 1L7RA 5CBKA 1CV2A 2WU3A 4BTLA 4JEIA 2J3DA 3DDUA 5CH8A 3WJ1A 5ALIA 4UHFA 3RLIA 3IB3A 3GUUA 1KEZA 3G9ZA 3WWEA 2HA0A 4QDXA 3FWHA 4L0CA 1CUFA 1QGED 4G1FA 4QZVA 5CT9A 1W76A 4WCVA 5ALOA 2ZYIA 1GQSA 5EHQA 1M33A 2GBGA 3YASA 2WIKA 5CH5A 4UHDA 3MGAA 3AZQA 1VA5A 4H7FA 4J0HA 1ACJA 3H2KA 1W75A 4X85A 2K2QB 3M3DA 5AI8A 5CURA 5DNUA 2JGMA 3DCNA 4S0XA 1EA5A 4BATA 3ESAA 4BVJA 2V98A 2VJDA 4L9AA 2Y2VA 3WYDA 1BRTA 1ZIYA 4QLOA 2CMFA 1ZD3A 4DSZA 4DNOA 1MNQA 4MWTA 2VAVA 5ALHA 1THTA 3ZWQA 1TCAA 3AILA 2XLCA 4U2CA 2AJLI 2UZ0A 3F67A 4WFKA 2XUFA 3KD2A 3D59A 2WTMA 2G63A 3STYA 2C5GA 1N5RA 3PUIA 2QOEA 2WJ4A 3B5EA 3V1NA 5D3KA 3K2IA 3V1MA 4BYMA 4J0GA 4JYPA 2PSHA 1O6FA 4B6GA 1UZAA 3NWOA 4AO6A 1JT2A 4OSEA 4F0JA 3O9MA 2WHPA 1LPPA 5KWJA 4OYLA 4CCYB 5IVDA 4DGQA 2E3JA 1DX6A 4XX1A 2YH2A 5FRDA 1EHYA 1BEZA 2J4FA 1E3QA 1YS2X 3D3NA 3SWWA 3R3YA 1NX9A 3DJYA 2AJCA 4PO3X 1SOMA 1CUVA 4I19A 4M0FA 4B9AA 4OCZA 5DWDA 3FCYA 3AINA 5C8ZA 3ZV7A 1BEEA 1MT3A 2CUTA 4LXIA 4BBZA 3QPCA 2RHTA 2DHDA 3D2CA 3DYVA 1XRMA 1SC9A 5AKYA 1UK8A 3T4UA 4J0JA 1MX5A 1XZFA 4IH1A 3TGLA 1XZLA 2WUEA 1G42A 4HXFB 2WM2A 3ICVA 2PPLA 1MX9A 3BDIA 2JF0A 1QIDA 5FOQA 3AUKA 3C8HA 1X2BA 2YYSA 4OYYA 1F0PA 5LZ2A 5E2IA 2HA7A 3R0VA 1RP1A 4DMFA 1JI3A 4LIPD 5HCUA 4G4JA 4Y9SA 1GGVA 1X2EA 1P0MA 4W1QA 4UFPA 2XMRA 1QIFA 4LYEA 1CPYA 1CUEA 4OPMA 5ALDA 1BN7A 2OCGA 4I4CA 1Q83A 5C7YA 2DFPA 3CCCA 2AJBA 2FUKA 2OGZA 2Z5GA 2DCMA 4DTCA 4FKBA 3ZLVA 5FPPA 1HQDA 2ACEA 4RE5A 2JEYA 2XUJA 4KAJA 2WG1A 4X93A 1CUHA 4UHCA 3V9AA 4AN1A 4N8SA 3HI4A 1WCYA 1H2YA 3NUZA 2BCEA 4ARAA 3KDAA 2JGKA 2V96A 4EY7A 5AI5A 3QPAA 3I2FA 1IUOA 3WWCA 1USWA 2HA3A 4BCCA 4CIAA 3O4HA 4K6GA 5FPQA 5HKBA 1IMJA 1XFDA 1JMYA 1CUAA 2Y1KA 1QZ3A 5AOAA 5FDFA 1EI9A 3R3UA 4DIUA 1VLQA 3GELA 1YASA 2WUDA 1BS9A 1MU0A 1N1MA 2W6CX 5YASA 3LP5A 4H35A 4WY5A 4HAIA 5AJHA 5JATA 1HBJA 2ZJFA 4DNPA 1MPXA 3QBJA 3WK6A 1XLVA 5AI0A 4Y2YA 1LPSA 2PM8A 4U2GA 5EHNA 4X7BA 4DNQA 3PDCA 3P2MA 2CJPA 2GBCA 2WHQA 5JAHA 1DTEA 5DYWA 6YASA 1SCKA 4Q82A 3BF7A 4H7JA 2C7BA 5LKRA 4G9GA 1W6RA 5A6VA 5ALKA 3R41A 1O6GA 5CT8A 2XMDA 4X94A 1T4MA 4BZZA 2BGNA 4EB0A 4BRZA 3OG9A 4BRSA 4QA9A 4XVCA 1LPBB 3FOBA 3IUJA 2QR5A 5JZSA 2ROQA 1XROA 4B80A 4J0CA 4MYSA 3UMJA 1K6EA 5KBYA 2WTNA 2ES4A 4BCBA 1MAHA 1IVYA 1EK2A 4MWSA 5EFZA 5AI6A 3L1IA 1H2WA 5T4HA 1AC5A 5JAOA 2X5XA 2QJRA 2V9ZA 1G4HA 3C5WP 3HXKA 4KRYA 4KR0A 4X00A 1JU3A 1ZD5A 4C4YA 3GZJA 3MUNA 4LXHA 4TGLA 5HK8A 5LZ9A 4UBIA 2I3ZA 1EX9A 4ZGBA 4AZ0A 4WFJA 4N5IX 1Y37A 4G5XA 2ZYSA 1EVEA 3EBLA 5AOCA 1SCIA 5FLKA 3H19A 3I2JA 1HKHA 1FFDA 5A7GA 3STTA 3QMMA 5ALEA 5AIBA 5FXMA 3PE6A 4W1PA 5DLPA 2PKYX 3ESDA 2QVBA 2AJDA 3KWJA 3WK7A 2H7CA 2H7YA 4EHBA 5CT6A 4K6KA 3G9TA 2ZJ7A 1FFBA 3GBSA 3OTQA 2QUBA 1CRLA 3A70A 5AKHA 5JIBA 4EY6A 3G0IA 4GDMA 1E66A 4AN0A 5D7BA 1MAAA 5EIAA 3JYHA 1DWPA 3G0BA 2OPHA 3H0CA 4CI9A 3WZLA 1ORWA 1QIGA 4PQEA 1LBSA 1FFCA 2XT0A 3G8YA 4XJVA 2HRRA 3BE8A 2GYUA 3FYTA 1JU4A 1VKHA 5JASA 2ZJ6A 2BAGA 5HF9A 1CUWA 2JEZA 3AIMA 5HFNA 2QRUA 2DQYA 4UPDA 5DJ5A 2JGEA 4J0DA 1EXWA 1XZCA 3M83A 3CN7A 2XE4A 3DL4A 5DNVA 2WFLA 1ZD2P 3HJUA 2XUHA 1C7JA 1XZBA 2QZPA 1DWQA 2C58A 3HLKA 3VXKA 3H2IA 1AGYA 1UOQA 4ZI5A 4G9EA 5DNWA 4KAAA 4BAGA 5A71A 5JZ9A 4J0KA 4HXEB 4A5SA 4EA6A 1R1DA 2C0PA 2XQFA 4UBNA 4ITVA 4H7KA 1R50A 5AO9A 4W9RA 5J3JA 3BF8A 2HA4A 4C87A 4D9JA 3ZPXA 1XLWA 1ZI8A 2I3DA 1LNSA 2XQKA 2VA9A 3ICWA 5AKJA 3I6MA 4IHAA 4B81A 4J0IA 2VAXA 1TIBA 3VVMA 5FUMA 1UT6A 2CKMA 5A7FA 1YB6A 1F0NA 4H7DA 3JWEA 4AX4A 3N2ZB 1THGA 4Y2VA 1EDEA 5A2GA 2XMCA 3C87A 2H1IA 4NS4A 3TRDA 2YASA 3WK9A 1TQHA 5K3EA 3TJMA 2OLEA 4JUIA 4LYDA 2PX6A 1ZOIA 2PSDA 5K3FA 4PW0A 2QM0A 2XDWA 4E46A 1YA4A 3IURA 4PNZA 2VEOA 2WSLA 1R4ZA 3W06A 2HDWA 2EDCA 5K3CA 4GECA 1UOPA 4UFOA 3WK5A 2O2IA 3HC7A 5ALPA 4X6YA 3TEJA 1YAHA 2B20A 2G4LA 1QTIA 3RARA 3WKEA 3WKAA 1K4YA 2G5PA 2DQZA 3QMVA 3BWXA 4QLAA 4C88A 4O08A 1YCDA 2VTVA 3HEAA 2V97A 4EZIA 5EHZA 1LPOA 3FLBA 2GYVA 4GW3A 1XZEA 3MVEA 5AM5A 4EY4A 3PF9A 4ETWA 4U2BA 5AI9A 5AK4A 5JANA 3HRHA 1TAHA 1K8QA 1XQXA 1QO7A 5CRIA 1AZWA 3G9XA 4Y7DA 1JMKC 4QDTA 2CZQA 2OGTA 5LKAA 1JJIA 3GROA 1Q84A 5JZBA 2Y2UA 1K63A 4H7EA 3N0TA 4J7AA 3BL8A 3FVRA 4DYHA 3ZI7A 4AB1A 4ZWNA 3D5EA 2H9YA 4LKOA 3DNMA 4QDUA 5CXXA 1FJ2A 5JYCA 1J07A 5AKEA 3R3WA 4IH9A 1KU6A 2QUAA 2Y6UA 2XUGA 1OILA 5ALVA 3WIBA 2R11A 2W22A 3SK0A 2VF2A 5HK9A 5IH7A 3C43A 4Q3LA 4FMPA 4H7IA 3DOHA 3STVA 3DLTA 7YASA 5K3BA 4HXGA 3WKDA 2OCLA 2H7XA 1QONA 4X6UA 3RK4A 3G02A 2HFKA 2Q0XA 1J06A 3FVTA 1WB5A 4C4XA 2I78A 5LZ4A 1B41A 1BROA 3D2AA 4NVRA 2HHAA 3DL7A 2XUOA 1MNAA 3IUQA 2XI4A 1G5FA 5ALWA 1YA8A 4MQLA 3A6ZA 2O2GA 5HKAA 3BIXA 4B0OA 3C6XA 4MEBA 3E0XA 2WILA 3AZPA 2VT7A 5BWCA 4DLNA 1JJFA 4E11A 5JALA 3ESCA 4BVKA 5LYYA 3DS8A 4DNFA 5AKGA 5JD5A 2G5TA 5AK3A 3ZLTA 4QEKA 1XLUA 3KSRA 4AMZA 1ZJ5A 3S8YA 1T2NA 2XMBA 2LIPA 3WA6A 5FV4A 3H18A 3HZOA 1DT5A 3PUHA 1ZGCA 5CT5A 2BUCA 3GFFA 3H2JA 1YAJA 3DEAA 5KREA 2BUBA 4FLEA 3E1GA 2BJHA 2XMQA 4CFSA 5ALRA 4HTAA 2XLBA 5FP0A 5SYNA 4U2DA 3I6YA 3QVMA 5T4EA 1RWQA 3B3QA 3C5VA 4K5QA 3AIOA 5AH0A 4F5ZA 2QJWA 4YASA 5K5EA 1TCBA 2WHPB 1XZJA 4X97A 1UKAA 2WIGA 4X90A 3I1YA 3G7NA 4L72A 3OPMA 4Q1VA 3RKSA 1W4LA 3B12A 2CBGA 2PSFA 1XRLA 2R8BA 1YB7A 2JGLA 4FFVA 5C8VA 1IUNA 4Y2UA 5CXUA 1QIHA 1CEXA 4EY8A 2WHRA 1Z68A 2WLSA 4G4IA 4KJXA 2OCKA 3BJMA 1A8UA 2J3QA 1UKBA 4U2FA 5AKIA 2O7VA 1QIMA 4Q34A 3LS2A 3X3HA 1H22A 1LBTA 5ALSA 3F98A 3O4GA 5LZ7A 2AXEA 2RAUA 4X3CA 5HZGA 2VJBA 2HU7A 3FNBA 5ALGA 3QMWA 4FNMA 4GWLA 1OCEA 3WK8A 3DKRA 5EGNA 5AICA 4KE9A 3Q8WA 1VE6A 1P0PA 4ZXFA 1GZ7A 2OAGA 4V2IA 4WJLA 3F9CA 3R3ZA 3C8DA 1JKMA 4FBLA 1JFRA 2CB9A 2ZYRA 1ZJ4A 2IX9A 2PVSA 1RYYA 3LIPA 3A2MA 3WK4A 4RE6A 4HS9A 1R3DA 4LXGA 4Y2TA 5CH3A 4UBJA 3D7RA 1ODTC 1P0QA 2QXUA 4IH4A 1QJ4A 1CVLA 2RI6A 1JJBA 1TKRA 2WQZA 1MJ5A 3AJAA 3E3AA 2ECFA 5C81A 1MTZA 5AKLA 4QNNA 3WL5A 3D4LA 5ALZA 1XZDA 1WOMA 5HQ3A 1HLGA 1QFMA 2PBLA 1TK3A 4G8CA 4BDSA 1QTRA 4GEGA 2HL6A 3DOIA 1XRQA 1VE7A 3BJRA 1UFOA 2ZYHA 4FLFA 5BOVA 2FX5A 3W04A 1SCQA 4Y2RA 1FFEA 3M82A 4UBLA 1TRHA 4BDTA 3WIOA 4XIIA 1E8MA 1K5PA 5AM3A 3WI7A 2B4KA 2HU8A 2Z3WA 5H3HA 3R3XA 3UUFA 2HM7A 1BCSA 2IIVA 2Z3ZA 2HU5A 2WG0A 4G8DA 3NOXA 3H2GA 5ESRA 4AO8A 1XZIA 2BKLA 2ZSHA 5D3ZA 4BZWA 2HFJA 1UOOA 1CQZA 3G0GA 4YPVA 2XQJA 1QFSA 5IVHA 3D2BA 1EB9A 1QOZA 5AK5A 2PSEA 4BB0A 1AURA 2IITA 3G0DA 3SX4A 3WLAA 2X76A 2PU5A 5E4JA 5ALXA 1CUGA 1A7UA 5AI4A 1ORVA 1XZAA 5CW2A 2WJ6A 4PV7A 4UFNA 1E89A 4OB6A 5IVIA 5KWIA 1EH5A 1NU6A 4ZV7A 1HDEA 2CEKA 4KEAA 3ESBA 1QO9A 1OXMA 4J3JA 1KU0A 3A2NA 1EK1A 4X6XA 4UBMA 5ALMA 1GPKA 2BGRA 3IUNA 3R3VA 5ALYA 4Z49A 2XMGA 4QWMA 4ROTA 1EB8A 2XUIA 4EUSA 1MX1A 3AZOA 4G8BA 1QE3A 4GLBA 3PFCA 4GI1A 1VZ3A 3CN9A 2XMSA 1CUZA 2XUQA 1XZMA 3VJLA 1LPAB 3AFIA 4IQ4A 1WPRA 4M0MA 3WMRA 3VISA 1UK9A 2GZSA 3H17A 3STXA 3M81A 2XUKA 3F97A 4OU5A 2QKYA 4BC1A 1CUBA 4I3FA 5DYYA 4OD0A 4FFWA 4Q05A 4C6HA 2QT9A 4RGYA 2GBFA 3DQZA 2WIJA 5CTAA 1AUOA 1XZHA 4N8EA 3DYIA 1GQRA 3FYUC 2D0DA 3K6KA 3QPDA 1WHTA 1SFRA 1CLEA 5LP1A 4KRXA 3O4IA 4CCYA 1BCRA 3EQ7A 3STWA 1EINA 5I8PA 4F21A 1PJAA 1YS1X 4Y2JA 4P92A 3RM3A 5HF5A 4MQMA 3AIKA 4FNGA 1CQWA 5I9IA 1LZLA 2XMZA 3WL7A 1VA4A 3QYJA 3E4DA 5DYTA 4C01A 2RGUA 2C5FA 5D6OA 2WKWA 2PU7A 2Z8ZA 3WWDA 5ISMA 3IBTA 2WIFA 4H18A 1UXOA 4UHBA 1CUIA 1ZICA 2HRQA 1G66A 3HSSA 4C89A 4A23A 4KYVA 3V1KA 1NU8A 1E8DA 2GZRA 5EIHA 3DKKA 1CUCA 1C7IA 4QDOA 1R9MA 4MEAA 1LLFA 4L3WA 4CG1A 3OURA 5ALNA 4FHZA 2WFLB 3IDAA 1U2EA 1C4XA 3WWPA 4EBBA 4DMHA 3OOSA 5JARA 3VJKA 3K9BA 4KAFA 4QE3A 2XUDA 1P0IA 1W1IA 3LLCA 4H0CA 3FLAA 3I2IA 1DX4A 2RONA 2ACKA 1WHSA 4KE8A 4B7ZA 2OXEA 3ANSA 4HRYA 1XZGA 4H7HA 4GBGA 3D0KA 3OM8A 1MN6A 3BIWA 2P8SA 5HFAA 2XQGA 4DMCA 1B6GA 1H23A 5F4ZA 4KE7A 5JD4A 1CUXA 3NGMA 4MXDA 2QS9A 3C6BA 4BP8A 1LGYA 3EQ8A 1GPLA 3H1AA 3IA2A 3SC2A 5EI5A 3WKCA 4CCWA 2HA2A 4AMYA 3O0DA 3UUEA 5LZ8A 5ALTA 5AIAA 3VVLA 3QZUA 4INZA 1ZIXA 4UUQA 3WYNA 5C8XA 2PUJA 3ED1A 2WUFA 1HL7A 2WU4A 4CG3A 4BC0A 3I6ZA 2Y6VA 1PV1A 4AO7A 4BE9A 4ZREA 5ALFA 3I1IA 4AQDA 3FCXA 4E15A 1XQWA 2BUAA 1UK6A 4QWWA 2QXTA 1H2ZA 4B82A 3U1TA 3H04A 5A7HA 3GA7A 4NZZA 4B85A 3L1HA 3C6ZA 1CR6A 1WPXA 4AZ3A 4H77A 3CCBA 3BDVA 2JGIA 2I03A 4PSCA 1ODSA 2ONCA 1U8EA 5K3FB 2O2HA 3EF3A 3C45A 5AOBA 4ZRDA 2B9VA 5AP9A 1HPLA 1LPMA 2X8BA 4FLMA 1QIKA 3KWFA 1CFJA 3WL6A 4P08A 2ZVDA 4DMKA 1A8SA 2DHEA 4JNCA 1AKNA 1XZKA 4BTVA 2PL5A 3QITA 1YSCA 2VATA 1L7QA 1IZ7A 4DM7A 3QH4A 4X71A 1A88A 1CIJA 4FWBA 3I2HA 2WFMA 5T4FA 1IUPA 1XKLA 2VJCA 4ZV9A 3VDXA 5AHXA 2WIDA 1U65A 4Q3KA 5AK6A 2BFNA 3DD5A 5CT4A 4PSUA 3HYSA 1D07A 3W2TA 3HABA 4UHEA 2PSJA 1WB6A 2ORYA 4W1RA 4FBMA 1H2XA 3F8SA 3WA7A 4FOLA 4Y2XA 1MO2A 3F96A 1AMNA 5IVKA 3R40A 2DSNA 1N8SA 2XUPA 4HVTA 1Q0ZA 3MUOA 4F60A 4B9EA 4OB8A 1ACLA 3H2HA 3I2KA 1AX9A 1LZKA 3Q0TA 4N8DA 1E8NA 2Z8XA 5JAUA 1BU8A 5BV7A 1CUUA 3FBWA 1GKLA 5DTIA 5AKXA 5DTJA 1YR2A 1W52X 4HRXA 4P9NA 4B83A 2JGFA 3FAKA 1E5TA 2OQVA 4BAZA 4UBKA 1ZGBA 1DWOA 3O9VA 3FYUA 4FDMA 4X92A 3C6YA 4Y2SA 2WG2A 2VT6A 5E4YA 1VXOA 4WY8A 2GYWA 4MJ3A 1CUSA 1I6WA 3C70A 4K2AA 5CMLA 2OG1A 3PF8A 4GHWA 3FSGD 4B0PA
chains in the Genus database with same CATH superfamily
4CKEA 3A3KA 2V7EA 3IO3A 4DSAA 5AVUA 3ZD8A 3WGYA 2AMYA 2A2ZA 3NATA 5IYZB 3I5UA 4XSGA 1UMBB 3PXBA 2R1TA 2BFDA 4P7JA 3K70C 4HPWA 2BTQA 2GNOA 2QX8A 4K9LA 1CJTC 3N0WA 1KC3A 4PQYA 4PAMA 4PPNA 4R8RA 4UCWA 5C1IA 1V0JA 2I80A 3ZQ6A 5LB4A 4KN8A 3I58A 2ZYTX 5K8CA 3A58B 3D4NA 3W3AA 3W8NA 2QTNA 1YBVA 4GP6A 3JU3A 4EW2A 4V1CB 3H2SA 1PLJA 4PCLA 3K0BA 5U1PA 1HZJA 2GPNA 3OD1A 2GXAA 4X54A 1KQ3A 3LDGA 1XIVA 3UJAA 1DIAA 1OXTA 3NH9A 1G16A 3N58A 3PLRA 4U6QA 1NW5A 5LA6B 1CRWG 1MIHA 2YY5A 3RS0A 1KYYA 2BISA 3PQCA 2IS2A 3SVZA 5AM4A 5JRDS 4NCBA 3OOHA 4OUDB 4KACA 4ZCLA 1L5ZA 4UZSA 8GPBA 3D5TA 3ETJA 2H29A 4LYGA 5HQJA 1C9EA 5B7PA 5CJ2A 3U62A 3RYHB 2F3SA 2ZRLA 5AUQA 2WBLC 3U3KA 4WE3A 5M2QA 1V7PC 2R6CA 4M0EA 1BAPA 1R0XA 1RLMA 3D31A 3WRYA 5K4GA 5AVWA 1SBQA 2D00A 5K0LA 3F6PA 1YR6A 3CLHA 2O8NA 3HBLA 3CLTC 3A06A 2ZSDA 3LXXA 3N0XA 1GIAA 4D5EA 6GPBA 5FBZA 3PKIA 4NS1A 1KY4A 2EKZA 2RGEA 1IDN1 1TK2A 2WMOB 3TFWA 2IQIA 5KOJB 4O59O 1CUYA 2FJPA 4TPKA 2JLBA 3G23A 4HADA 2Y0BA 3WLOA 4CF5A 5C5CA 1RWNA 4P98A 4MSUA 1KFEB 1XD8A 1XLTA 2P62A 5H4GA 4FINA 2NO0A 3AERA 1G0NA 4Y1RA 4F2GA 2DQ4A 1J23A 1LPNA 2D2XA 2J9FA 2NTEA 1JYEA 5GONB 1RC0A 4RF5A 2F64A 1ULAA 2YVQA 2LXNA 4TL8A 3R1IA 4R98A 1U63A 4UBOA 2VK2A 4MJLA 2WFZA 4REQB 2JAXA 2ZIVB 2P6MA 2SNIE 4TL6A 2NSHA 3FUCA 5J4HA 1IHXA 1ZGAA 2X9NA 4FTWA 4AXXA 1VOTA 2ZJYA 3PC3A 4WW0A 5EP1A 3LC0A 1U4NA 3JVVA 1GKYA 4RVHA 5MN5A 3WNZA 4XJTA 4KIUA 4Z2YA 4AF8A 2JLXA 2PKWA 3EQ2A 2RIPA 3T1NA 4YIHA 3HCDA 1AUPA 1VCIA 2YWJA 3VPHA 2CMGA 2NPOA 4XX0B 5KQSA 3R7DA 2OQIA 1JMVA 3E5HA 1JEOA 3HDYA 3LVQE 4HRAA 1N6LA 1QYIA 1V9LA 2NU9B 4FYWA 3TW8A 3VPDA 1W19A 4YGYA 1T6YA 4KG7A 4YRAA 1YQEA 3DTYA 5P21A 1ZA2A 1Z5GA 5A3JA 3SEQA 2EG5A 2C42A 1I4LD 4KE6A 4KFUA 4N5HX 4Y6RA 1QDUA 4ED9A 2ADMA 2C5EA 2QZZA 2EQBA 1ZUD1 3FKSA 5FAXA 2OBBA 1ZU4A 2R2AA 1NBAA 1OXXK 2NU6A 2AF3C 3WO1A 2HEIA 3BRQA 4X91A 1KOGA 3W05A 2HRZA 3HR4A 2JFYA 1Y8ZA 4M7PA 1M7GA 4H3HB 3SE7A 4R3NA 1XT6A 3NIBA 1I3CA 3O8OB 2R5NA 1UFRA 3MPOA 4GLFA 1M2OB 5F3RA 5HF6A 2IU0A 5I7HA 1DT3A 1QVRA 1U3DA 3U1BA 1OJLA 2VWQA 2GTPA 2J08A 4RK0A 1ANKA 2HBRA 1ONNA 5EJ2A 4JLOA 2EGUA 4X60A 3EVBA 5T4BA 5JFGA 4XXHA 3S0JA 3SIRA 1E0DA 1S89A 3WKBA 1RQRA 3FYUB 2WPDA 2GPJA 3EODA 4L8GA 4FDTA 1IM8A 4OMUA 4X8LA 3VOAA 2IY9A 5KAPA 4L8VA 1ISFA 4QGAA 1F8UA 5F5LA 4ZDKA 3RJ9A 3UA3A 2VDVE 4CTMA 1O87A 3ZHRA 2QTCA 3L1JA 3M1AA 2E87A 4W1SA 3WAJA 1TTPB 4O4JF 1GT6A 2R6FA 5L53A 4HYQA 5B4UA 2MSDB 1PX2A 1A8QA 4BBJA 5BSFA 2WMNB 1Y6GA 3VU1A 2H1WA 1I1OA 3U0VA 2WU1A 4ZO8A 4BL5A 3DMTC 1RJ9A 3IIIA 3KJFA 4AI6A 5L4SA 2IVFA 2WJHA 2XCUA 2VIIA 3W4JA 5L3VA 2VP6A 1SCJA 3N2GB 5F77A 3SOZA 1ZNZA 1N2EA 3LT1A 1DPFA 2YJNA 2PGLA 4MYDA 2IBMA 1QUFA 1SOAA 1E0SA 3A4YA 4QYWA 3ES9A 3QUQA 3SNKA 4EPYA 3C3PA 3K2QA 5DCUA 4LF4B 4NNPA 2CJXA 2C7OA 2FPPA 5KJEA 3TKAA 1K7FB 1R8QA 1Y8CA 4QO8A 2HK8A 2PXCA 3WWOA 2FR1A 2QAIA 2UKDA 4B44A 4OP2A 4WXPA 5EJAA 5EIEA 1IAVA 3N5KA 4HMQA 2CFOA 5G1PA 1DUSA 1OI3A 4E7OA 1Y7HA 1E6CA 3EXHC 2G25A 2I54A 2B2CA 2NZWA 2HD4A 4D6XA 4K6FA 5FKJA 1GPNA 4BHTA 1P91A 2VCYA 1U4SA 5LWQA 4OU4A 4YROA 1JEEA 2A30A 4UOQA 2FVXA 1U2PA 5BPFA 5M34A 4EKDA 2HDOA 3DYBA 3TM4A 2XCRB 4GBED 4Q3OA 1J21A 1UDCA 3BXPA 4BVLA 4KR2A 3PR2B 3VJMA 2NUBA 4NH0A 4M1ZA 2Z4RA 2ZB3A 1FA9A 3PFKA 4B8WA 3N76A 1TPYA 2X8WA 4B3TB 1YO6A 2H65A 2V1XA 4OREX 4OQQA 2YVAA 3R0QA 1EVQA 1IZ8A 3HA2A 2F8MA 2GPSA 2BFBB 3LUPA 3QJYA 4G5SA 2D2VA 3MM4A 4MCIA 4MW4A 5GGYA 3SXUB 1J5EB 2TSYB 1NONA 1PS0A 5J47A 2ZT6A 3HXOA 3K0HA 2APJA 4WFIA 5DIFA 1Y4UA 3A1EA 2W93A 1PLKA 3R6LA 2QVZX 4OJQA 3W2IA 1JGTA 2OBNA 1Y4SA 2V7WA 1E2HA 4WDQA 1TMYA 1L7VC 4RKRA 1YL6A 1XMPA 3CURA 4Q9KA 4Z4CA 3MW8A 4MUJA 3UKJA 2WSYB 2G0AA 1OPXA 4RV4A 3N2IA 5JJBA 4PSDA 3V48A 3P9QA 2C5HA 3RRNA 3ABQB 1FFWA 2V58A 4EYQA 5JVDB 1Z83A 5LC1A 1R7RA 5U4QA 3EW7A 3NUQA 5DHPA 1N36B 3DMFA 5B37A 1NMSA 2R84A 3OICA 4KPUA 5AW1A 4RU1A 2I6SA 1KC1A 1A9OA 3O31A 4EFNA 1ZOLA 4OJMX 4FJ2A 4Z1OA 1XTQA 1MAVA 4YJHA 3ROXA 3PHJA 1ZI9A 1XG5A 5I7RA 2XBLA 4QBTA 1HEUA 4HB3A 2O59A 2BF7A 2AEEA 3U17A 4ZAGA 4L1KA 1WPQA 2HA5A 1DDIA 4AS2A 4BMZA 3KTDA 4L6IA 2JFBA 3UHPA 4C1BA 1DRWA 2GDZA 1PUIA 4MW6A 4Z51A 1YR7A 5KYWB 2VUSA 2VDPB 4G6ZA 3SY8A 3V4FA 5BUZA 1U2RA 4HG2A 2WA1A 3KYBA 5JHGB 3ED5A 3AW8A 3W5HA 3MFQA 1DPGA 1YJ8A 1Y4AE 2F55A 4MKFA 5AJZA 1ZS9A 1TCCA 1TM1E 3OM9A 2UXCB 1XVUA 4PRZA 4ESHA 2JKZA 5HQ3B 4HNTA 4LYFA 2J4CA 2W6OA 4KW7A 4DV5B 1SXJE 1N1EA 3CVYA 4BE4A 1U81A 1NDHA 2X0FA 4CHTA 3UAYA 1BYUA 3LCRA 1RHJA 3H4IA 3DMGA 1M1UA 2ZR8A 5AT1A 4XOIA 1TZCA 3EA0A 4MV8A 2F3UA 1PNQA 4FMCB 2WHXA 2HJVA 1NY5A 2HCFA 1XUOA 4D0RA 1EXNA 3B3FA 2DM6A 2ON6A 4XSHA 4DLKA 4EX6A 4EL5A 2GAFA 3K96A 2RCNA 1SKMA 1E79D 4E33A 2P91A 2PIAA 2YRFA 3R44A 1C7RA 3IQGX 1R64A 2X3FA 1FJGB 1H3EA 2X77A 2VSQA 4EJSA 1M67A 5AK0A 5HFJA 2CV1A 4HGNA 5EXXA 1XQVA 4UOEA 1NW8A 2COKA 5B36A 3L7CA 2JJYA 3G9UA 1C1DA 4K9QA 4TQUS 3MT7A 2QYTA 1BEUB 4ZAXA 3IULA 1H2BA 4RSMA 5HS6A 4E14A 3CXUA 5JI3E 1U8ZA 3IDSA 1TPZA 4D9EA 1UT8A 3G0CA 4CM5A 4RKWA 1CV2A 4I1YA 6AT1A 3AL3A 1H6CA 3RU2A 1YJCA 2J0EA 2I0FA 3DDUA 4GC9A 4IHQA 1ODKA 5FFFA 1SHJA 1XFAA 2WP0A 121PA 3SMVA 3E5RA 3K4HA 3I12A 3ZVRA 4TMTA 3DONA 3IB3A 5ICFA 3UFXB 1K6IA 1BW9A 3BXGA 1MG0A 2AFHA 2X7XA 4J1TC 3WWEA 4QM6A 1GWNA 3M7IA 4NFLA 2GX6A 2UAGA 3FWHA 4L4RA 5JBNA 3PQ8A 4B6FA 3G59A 1V5EA 1RQLA 1J9EA 3KP1A 4G1FA 1D4ZA 5CT9A 3X0DA 1MC1A 3J80A 2ADOA 1M8KA 3D64A 2JGDA 3LRTA 4WPGA 1UPTA 2K7FA 1WZNA 1N0UA 2ZYIA 2Y9MB 4LDJA 3Q8MA 4GRDA 3EIEA 2XGMA 5DIZA 4YCCA 1CEQA 2HTEA 1HQYE 2NMVA 2JFGA 5H81A 3HN6A 4LZPA 5C5IA 3QLEA 4CIYA 2GBLC 2H1VA 5AR1A 2R8YA 1G59A 2ZIXA 2ZBFA 4ZYXA 1DXQA 4JJIA 4PGMA 1ACJA 3V8BA 1CZKA 4B3HA 5JDCC 3BIFA 3WLSA 4KI0A 2OORA 4KXQA 4N4AA 4RA9B 1QKIA 1X1TA 3FNIA 3H2KA 1IBLB 1POWA 3S3TA 2BI8A 2PIDA 3TTYA 4HQKA 5KHLB 5HWSA 4CMKA 1JKXA 2AUTA 2K2QB 2C1ZA 2OY0A 3UAOA 3V00A 5KOYA 2V4ZA 3A10A 2FH5B 3OUUA 2JGMA 5EUCA 3AF1A 3GCXA 4RBNA 2VTBB 4EKIA 1OVGA 1GGNA 3SQNA 3ZGXA 3U7QB 4HLCA 2YWGA 4L28A 2QD5A 1GUAA 1OX4A 1SIUA 4A8PA 1SBCA 1Z7EA 3MRVA 3NONA 2OSBA 2VZ0A 1SHZA 2EWWA 2Z95A 4TYYA 3F74A 3QBTA 2DU8A 4G36A 2VJDA 4OXRA 3LXRA 3IC5A 3T0GA 5BR4A 2FG6C 2GI4A 4M1OA 1WBDA 3MMXA 2RB5A 3CLKA 1BRTA 1E2QA 3RT9A 4OATA 2NYAA 5JVDF 1D0SA 3LFTA 4RPLA 4QEZA 3OIGA 2CMFA 1ZD3A 4EHKA 1MNQA 4MWTA 4KOAA 2VAVA 3UK6A 2YYAA 3JD4A 1XL1A 1Y1SA 3KYDA 1TCAA 2RK6A 2XLCA 1P73A 3AILA 4WZAA 3ZWQA 5KYYB 3UJ9A 2W8BA 4O3MA 3L8MA 4HATA 3KD2A 4HNAB 5IT4A 1I7SB 1Z0DA 3D59A 3F46A 3DFUA 5TB5A 2ZSEA 4URXR 4OGLA 2C5GA 5BWMA 5G3ZA 4GE0A 3FFTA 4FHDA 4DA0A 3BWCA 2P41A 5JY6A 4Q4AB 4LBZA 2F1OA 3A6DA 1YQDA 3CZMA 2CNLA 2ZR0A 4GF5A 1E6EA 4IKPA 3V1NA 3WNDA 3ZLBA 3V1MA 2QDKA 1NXSA 1X6VA 2NO7A 3DCJA 4RH1A 1UXJA 4LVOA 3K8OE 5I8ZA 2VF4X 5EVJA 5CFPA 2FUEA 2ZR7A 3DT6A 2IXTA 5GJCA 2O8CA 4M83A 1YWGO 3K9HA 3GPCA 3UJ8A 3S40A 3WSTA 1O6FA 1IVNA 4BWYA 1CEEA 3ESZA 4ALJA 4B6GA 5DI9A 2VYQA 4FNAA 1OX6A 1FW8A 1LF5A 4ZAYA 3ZS8A 1XTPA 3OQPA 2RJNA 3QKUA 1GNQA 4FMCF 4MTLA 1JT2A 4OSEA 1II0A 5SY4A 2PFGA 5TJHA 2L0XA 2A9KA 4B87A 2I4LA 3FYSA 3T1VA 4JQSA 2R4TA 2ZJBA 1J9GA 3KJZA 1RQGA 1XKXA 4F45A 3CH5A 3BFXA 3AI7A 2HK9A 2IEZA 1OW3B 4JSYA 1WEKA 5FCDA 1ULSA 5GAJA 1BJTA 5IVDA 4DGQA 4ZARA 4GUDA 1ENYA 2O50A 2BMFA 3R09A 2O14A 3PVZA 4M98A 1BEZA 3PL5A 4TYWA 1PFGA 3ZD7A 1SULA 2C3MA 1YS2X 3H9CA 5JDIC 5B2ZA 1JPNA 1R4MA 4ZICA 1P0CA 1QHGA 4A2WA 4ER7A 5E38A 3V55A 3LUJA 3DJYA 2AJCA 3EDOA 1VE9A 2P77A 3RAGA 4DA6A 1GPH1 3PEYA 5CYPA 3QVGB 3LPAA 4PO3X 5FWAA 2MYUA 4NPAA 1I2ZA 3C1TA 4YGXB 3KEOA 3MWYW 1MZPA 3JQGB 3CYFA 2DUUA 1XZPA 1CUVA 4WASA 1MV5A 3B2QA 4B9AA 5ADVA 3PHHA 3KJIA 3BMXA 4QIHA 4NYMR 2R6ZA 5A03A 4ABYA 1W96A 5KJCA 4YJDA 1S01A 4P82A 3FTQA 3QYPA 4MR7A 2J59A 4X9XA 2QF7A 2W2NA 3EY4A 1FPMA 1BEEA 3GLSA 1F2TA 3KL4A 3OCJA 4MQ5A 4EOGA 1D3AA 1GQQA 1RZ3A 4ENTA 3QPCA 4XEUA 4ARSA 3JTMA 2CJYA 4ZHQB 3ADCA 4HX2A 3D2CA 2WNHA 2YFKA 5JY1A 4YUXA 1P0FA 1WU8A 3DYVA 4N7BA 1XRMA 1R10A 2Q50A 5AKYA 3T4UA 2KSQA 2JZNA 3GG9A 1HO3A 1JN0A 3K09C 2RH8A 3C1OA 1XGKA 1XZFA 5EPOA 3UPTA 1Y98A 2PMCA 4MWZA 2X23A 2G88A 3EEIA 3N7UA 4UM8B 5EE3A 4MITA 3CVUA 4IGFA 1N6OA 4FFBA 1W5EA 4HN4B 3LXUX 2WM2A 1P9NA 2PPLA 1OLXA 1MX9A 5EWJA 4TZ6A 5CEEA 2Y1LA 2AOWA 2HMUA 2ZVPX 3BDIA 4OHKA 4BNWA 4EVRA 5BSVA 3HM2A 1K4MA 2G17A 3AETB 3IV9A 4K6CA 4AP6A 2R1UA 3PD7A 4RZQA 1VLZA 5FOQA 4L6AA 1THMA 1E2UA 4QG3A 3DHVA 4O3FA 1LNQA 5F5XA 2CLLB 2KBFA 2YYSA 3KHUA 1OWNA 2GD2A 4PXYA 4NR0A 1PVDA 2V74B 1HH4A 4YMIA 4YPFA 5EJ7A 1PSWA 1LDBA 1QK3A 5LZ2A 2VLIA 2ANCA 3BD9A 4RM3A 4US1R 4WKPA 1HDZA 2RGDA 2OZPA 1T4BA 3BMQB 1ZL2A 5TQ0A 2O7SA 2HA7A 1P29A 3R0VA 5ARCA 5MGNA 1KDOA 3G5TA 1CK4A 1JIXA 1E7QA 1GP2A 1U2SA 4HL6A 4M1EA 4FX2A 1KVSA 4DMFA 1JI3A 2ZFUA 1RABA 3CS3A 4DEVA 4G4JA 2Q6IA 1QGAA 3ND9A 3R7WA 4QDJA 5KNBH 4EZEA 1GGVA 1U9IC 4JJZA 3EBOA 1LRKA 4LCJA 1GCUA 1RLTA 4P58A 4OI2A 2Z5VA 4W1QA 3HM9A 3GAMA 4A36A 3TDNA 2KS6A 2OXFA 4MIOA 5IN5A 4WKGA 4B2LA 5E6RB 4QFDA 3UMBA 1AZLA 1YR3A 4AJ1A 2IXEA 5L3QB 2IYAA 3DMNA 3UWPA 2AN4A 2Y0DA 4I2VA 3AL0C 1WZUA 2VBCA 3ZZMA 2E4AA 3HB4X 4LZOA 1SB8A 5DCWA 3JD3A 1EWKA 2BBTA 2C3YA 2HAEA 2HKIA 5E7QA 4I4CA 1H4TA 4LY9A 4TL9A 5DXFA 2DFPA 2G5CA 1ICIA 4TM7A 3HE3A 2JD2A 4B40A 5B12A 5CVTA 1OAAA 4O33A 2JBAB 4MW9A 3TSAA 1EFAA 4EGJA 2DCMA 4DTCA 3Q8LA 1V41E 1LK0A 1V1RB 4FKBA 2X1HA 3RWMB 3EPHA 2HNBA 2KQUA 2X5OA 4HLQB 5FPPA 2Q1TA 4HWGA 1Q3HA 1F6DA 4I9UA 2X14A 1G5RA 3BGDA 3K5WA 3QW4B 1TUIA 5KMGA 3SC2B 2FOXA 5F1KA 2G9VA 1V11B 1SK9A 2JVJA 1G7SA 3IA7A 1N0WA 5EE5B 1JHDA 2HMYB 3KT3A 1QDEA 1FXWA 2JEYA 2XUJA 5DMHA 4MS4B 7MDHA 1X7HA 2WG1A 1Z2OX 4RW0A 1CUHA 3R7FA 2G70A 4N82A 4WWHA 3SSAA 4B4KA 4E6EA 4XD7A 5KNLA 2ZQYA 1W36B 4Z3DA 4ZTUB 1WCYA 1Q92A 1WUKS 1H2YA 2BCEA 3KDAA 5A4JA 2Y1EA 4LV6A 2J0UB 2C8VA 2ZWPA 3MINB 4WNCA 1AHPA 3QHQA 3Q9NA 3MCUA 3AJEA 2G09A 5PNTA 5G0UA 2WEKA 3RROA 4BS9A 3WXBA 5K8VA 1Z33A 4YJGB 2ACVA 1QG6A 2FSSA 3QX9A 4PLCA 1VG9B 3JQFC 3WWCA 2YS6A 5IBCA 5AW7A 1EVLA 1XQ1A 2WWRA 2IIBA 4FR2A 1MQ8B 2WWIA 1PJ4A 4QHYA 3VOTA 3VH4A 2O1SA 1W4BA 3PPWA 1Y1LA 4M38A 4Q3NA 2QX6A 5B1HA 5J4KA 1WB9A 4BCCA 4CIAA 2PUDA 2FUG1 4ZCQA 4L5AA 2P30A 3R9WA 5JMOA 3SGLA 5E8RA 4GC5A 2GM5A 5ER9A 3ZV5A 4RJLA 1PJZA 1WXWA 4ENQA 2DPGA 2ZTSA 5H5JA 2GXUA 3FFAA 1P2UA 4WEOA 1AZTA 2A67A 4AJ2A 1V6AA 1F06A 2VDWA 2J1LA 4TXNA 4FYKA 2X4LA 5BOSB 4EW6A 4V24A 4RADA 3OQMA 4KMOA 5AOAA 2IPXA 3A28A 5FL7D 2G82A 1EVIA 4N0PA 5K0GA 3C74A 1I3MA 4BNYA 1VLQA 3LHDA 4J4HA 3FUXA 2A0UA 4YRLA 4FFOA 1NPTO 4C2AA 4JROA 3LLSA 3PC2A 4WOCA 2Q5LA 4IM7A 3H5AA 2PLFA 1HQKA 3H86A 1GG5A 3RUFA 3CH7A 2HNKA 2YIDA 3RTDA 2P8JA 1FPQA 3GUZA 4AK9A 5AJHA 4UTNA 4GUAA 2AFIB 2PMDA 2ZJFA 2Q3MA 3I9JA 1T9GR 2R7MA 1JIVA 2QP9X 2W2XA 4H2DA 4M21A 3REOA 2AOTB 5IUNC 3GY0A 4RTNA 3TMAA 2WI8A 3TOZA 1TM2A 4ZVMA 4GIBA 3OLYA 2GFIA 1NJGA 1DBSA 1L7OA 1ORIA 2AZTA 2Q1SA 2Q3HA 2QLTA 2ZVJA 3B85A 3FMFA 5A5VA 2CNKA 4Z4EA 1K4KA 3HVJA 2G6BA 5EHNA 1LQUA 3SR0A 4KUEA 1W88B 2VPTA 2ZWOA 3T1QA 1G9XA 1ID8A 2EKQA 3C3MA 3P2MA 4FYMA 3V4PB 3PDIB 4D7AA 3UTCA 1ZM9A 4R1UA 1C3XA 2ECOA 5JOQA 3GEHA 3I32A 4JP3A 5BQ3A 2AKEA 3N1UA 3NWPA 4X62B 2PV0A 1MH9A 4JLPA 5JZVA 2PLAA 5DP2A 3QF7A 3WOVA 1DX9A 4C4TA 2B3TA 5KTSA 2XF8A 2XKBA 2C7BA 1XE3A 3KYIB 2V8BA 3OX2A 4JB8A 4LRXA 5ARBA 4XCVA 5TIIA 2QR2A 4OHOA 4WCFA 2ZJAA 1U0SY 5CT8A 4ID9A 2QPOA 1MA0A 3TQCA 5HPYB 2NSJA 3C3DA 1T4MA 4RPGA 2ZXEA 5IM4A 1E32A 1U5AA 2BCGY 2JFPA 3WHKA 3OG9A 1PNVA 1CIVA 5KPDA 4RV9A 4H1HA 5JSKA 1LPBB 2AMFA 3I6IA 3MN1A 1E18A 4IZOA 4NBRA 1A8PA 5G40A 1XROA 2FN4A 1QP0A 1WF3A 1MB2A 1XDUA 3AF0A 2JI7A 4WXEA 1E69A 3PXEA 1K6EA 1JEAA 4KIFA 5BRNA 5KX5A 2Q7DA 3JZFA 3QNMA 3N2NA 4WTOA 4YHHB 4ND8B 2UUBB 5H83A 4W5JA 4JLUA 4Q5IA 3T1OA 5HQTA 3KELA 1KS2A 1LI5A 2P9EA 3QVJA 4GVXA 1QRUA 4A73A 1D09A 1TEVA 2D62A 1DXHA 4OQMA 5EFZA 4JYAB 4FFPA 1T2UA 4LJ6A 5CDGA 4CLRA 1OH7A 2NADA 3RWOA 1GLVA 3D8HA 3JXEA 3HJGA 4Q19A 1C0KA 1H2WA 4KQ6A 4WA7A 3CVXA 2FHSA 5K7SA 4MRPA 3PX3A 2Q27A 4PAGA 2VH2A 3D8BA 1RCTE 3ORFA 5G0VA 4RTLA 8ADHA 5LD2B 3DA8A 4KRYA 3ZDAA 2HWWA 3KLPX 1YONA 2MOKA 2Z2IA 1JU3A 2WD8A 1PJ3A 3TPZA 4UEWA 5FFNA 1ZW6A 2B82A 3VI4B 3ZJTA 3HKDB 3PFNA 3GRCA 1FTNA 1XYVA 2R8PA 3HVHA 5TX7A 4W9NA 3U48A 1X8LA 4M7RA 4LXHA 1SVMA 4LFBB 1YA6A 5DX0A 2K6GA 2I2BA 1ZK1A 3QOXA 1YH3A 1HR0B 1FVXA 4UBIA 5JXGA 3FWNA 2JLWA 3SYRA 3ROQA 4WV3A 2B94A 1TA9A 2RAVA 3LUFA 1Y7TA 1L1QA 3CHYA 3KDSE 3N59A 3NM4A 4G85A 1FL9A 4R51A 5DGCA 4LYHA 2CWDA 3UXMA 2D3TA 4W7HA 2I2XB 3E23A 2FZVA 1GUBA 2YOGA 2ORVA 5H02A 3KYCA 3HNOA 2CV0A 2HHHB 4E5KA 5C53B 1FQWA 1E9DA 3ROGA 1SQ6A 4MV6A 1UPUA 3CVJA 4I2NA 1NRXA 2Q62A 4BJ1A 4P35A 4RJJA 3KWLA 4ND3A 1WVGA 5ALEA 3FMOB 3SFTA 2O6LA 3HSYA 3ZHSA 3GF4A 3GLTA 1ZM2A 1VLVA 4YRMA 2F43A 5EUBA 5HX7A 1ORTA 2C5BA 1KAHA 1SC6A 2GHRA 2HQSA 5JRZA 4EB6A 2HRDA 3GR6A 4ROSA 2H7CA 2A1UB 1VJCA 4IJ5A 3AR3A 5FHQA 2JIOA 2PZFA 3D3WB 3QKRA 4J0EA 4F84A 1OXUA 2DAPA 2W00A 4UNQA 2ZUTA 4KQJA 3IOEA 4HEHA 2R1TB 2BFDB 4I6EA 2B0JA 2BTQB 2DJ5A 2NNLD 3ND7A 1KSHA 4FHFA 3A1SA 3R0XA 1QF9A 1L5LA 2GCPA 1FVOA 1K97A 2FPIA 4KIGA 2P9CA 4X7RA 1P2DA 2WDPA 3LVBA 4H60A 3S68A 4AN0A 3M5WA 5D7BA 3JYHA 2VDUE 1DWPA 1KAGA 2C92A 3A6JA 3U4GA 1P7ZA 3SSMA 1E1QD 4D0NA 4ENSA 4LAFA 5HHTA 5LSAA 1E9AA 3HWWA 3EUEA 3DTVD 3GLFE 1P1BA 1QIGA 1B00A 2JJ2D 2BF4A 2O6HA 1KQFA 3CWCA 3IT0A 4YAFA 4XJVA 2FWJA 2PHZA 2WWFA 4KI7A 5DM4A 2PUBA 3JYPA 3BE8A 4N3NA 2ENUA 1C8VB 1CG6A 1JYFA 4FDVA 3THWB 2BGJA 5JASA 4EQ6B 3LW7A 3IP9A 1GD1O 2KLHA 4R7ZA 1F8YA 1OREA 5HF9A 1QMGA 1CNEA 2JEZA 3RVBA 1FLAA 3IQIX 5E7IA 4C30A 3ZDCA 5EXTA 3PV0A 1QYWA 5ITVA 5JSUA 3P0JA 3LTEA 1SUSA 1P1CA 4HUQA 2QRHA 2JHGA 3D6FA 3NDBB 3VHLB 3SDBA 2IH2A 1XZCA 5EZYA 1KJ8A 3Q85A 4MAFA 3VR1A 2VO1A 1SZDA 3JWPA 3WRXC 1J7KA 1VE5A 1JR3D 2GJ4A 5IAGA 1O0BA 4CUZA 1T6NA 1PDVA 2RG7A 4FWIB 4F93B 3IVAA 5LJLA 1E1MA 1T5SA 1O77A 3AERB 5JU6A 4L9RA 2AMVA 4UJ5A 3R6GA 4DIEA 4D43A 1E9BA 5KTOA 4AQ7A 2RD2A 3HJUA 1P2VA 1JLMA 2IOHA 3CLSD 4C0LA 2BTOA 1C7JA 1XZBA 2QAGC 1M34A 4OI0A 4ZOLB 1OFGA 1XMOB 2C58A 2Y1CA 3OIWA 4R1TA 5ARDA 3HLKA 3U3MA 1ENPA 2FHPA 2IEIA 2HMVA 5E1DA 3KPWA 2WNSA 4INAA 1JZSA 3I45A 4LDZA 3UN1A 3UVEA 5K0CA 2GPBA 2PD3A 3IR7A 4WBSA 1WE2A 3HGTA 5DBIA 1K9VF 2HW8A 1GU7A 1N5JA 2XD4A 3RJ5A 3EDRA 4KAAA 2W6NA 4XZ3A 1GFZA 5BYJA 1E2KA 4KGZA 1ZINA 3ZIUA 2XTMA 1WXDA 3N3AC 4J0KA 4ZQEA 5A71A 2B8EA 1JA0A 3NJRA 2BR4A 3CBQA 3EVZA 5JE8A 4AY5A 4ZYWA 1THZA 3H9BA 4B5LA 4BFLA 3A6PC 1DHTA 1RHUA 1P4HA 4UTPA 2FGKA 5FL7A 1SUBA 4TMKA 3DMYA 4A5SA 4GL2A 3NDIA 3LSTA 2AHRA 2C0PA 1RNLA 2WYUA 4PU0A 3WRVA 1WBBA 2O8FA 2QPLA 1GAEO 2A94A 2J9RA 4I14A 3DUWA 2W2MA 1NF8A 3JAKA 1C3JA 2ZWMA 4TKUB 4DEXA 3W5BA 3NJ8A 3FF4A 3I8XA 1AHHA 3TFOA 4S2UA 4CM8A 3IQDB 5B2FA 1UBHS 1A9QA 2XD9A 2WYOA 1R50A 4EFKA 2NG1A 4LGYA 4MUAA 3RNOA 2J5BA 3CE9A 1BGXT 3W04A 3NAQA 3X1DA 4AY3A 4C87A 3E9NA 4TTIA 1YCHA 1ZI8A 2AGVA 3OZVA 4UU0A 2X0JA 3KOYA 4K2HA 3D3QA 2VOJA 4Q7KA 1G64A 5AKJA 3BIJA 1TJ4A 2KX7A 2VF5X 1PG0A 1VKNA 5KQMA 3NFYA 3IS3A 3B8EA 3HVKA 3OWHA 1E61A 1EDOA 2VAXA 1XU9A 4NOLA 3ZW9A 2AD5A 1SQFA 4WBXC 1D8TA 4NG4A 5EP4A 1JNYA 3KEMA 3DFIA 2HRBA 1TAQA 1H8ED 3W34A 3ZHVA 3TLGA 3FRIA 3COSA 3JWEA 1SBNE 3PFFA 5F7JA 4TMWA 1T2CA 1JR2A 2EF0A 1Y5IA 2ST1A 2V03A 4N65A 4NSNA 1YFJA 2VP0A 1NUPA 2B4YA 4HZIA 4HDRA 3MD9A 5A2GA 3DXZA 5HSGA 2XMCA 4KPGA 4LDNA 4U4AA 3C87A 3VC3A 3MB5A 1J0XO 2VXOA 4QOFA 3IMEA 1WDMA 5B64A 2E9SA 4RTSA 3DB2A 3WQRA 4WBNA 2ZANA 3H84A 2FPPB 2HQ1A 2C03A 2HXSA 3R6TA 4N03A 3ZGZA 2OLEA 1U0TA 1V39A 1NHGA 1N9GA 1Z4QA 3K2EA 1Q3TA 5JYEA 2QL7A 1FX0A 1T34A 5I9SA 1YJBA 2Q5CA 5K3FA 1XK6A 1QMPA 3WSVA 4QO7A 4C0HA 4E46A 1VMIA 3HK2A 5DHAA 4DR3B 4G86A 1X8JA 5F3DA 5LIRA 3UXEA 1ZJZA 2WSLA 4ZT3A 5EHGA 1IQRA 1XDDA 4CKYA 1KAOA 1ODJA 3UB2A 3GL9A 2VQEB 3TW4A 3AM3A 1EXVA 3A32A 3KX2A 1HY3A 2CFSA 3O8QB 4UFOA 5K9ZA 5BN5B 7GPBA 1XHLA 1TLFA 4UPVA 2EWMA 2O2IA 1NM5C 3WK5A 3HC7A 2FW6A 4IAOA 1Z15A 4R9UC 3UA4A 4X6YA 3WGMA 3NIFB 5MHTA 2IYUA 4Y9UA 4BV3A 4ER6A 1R8JA 1LU9A 1PLLA 1Q0LA 1FTQA 3DC7A 2X22A 1DO2A 1HDGO 3ZBQA 5JCOC 3FPJA 1QTIA 3RARA 4P3KA 4ZYTA 4UE3S 2XX3A 4AW9A 3K5PA 2DQSA 4V0KA 2G5PA 2DQZA 3QMVA 4KMMA 1Q16A 3HYNA 3NASA 2IYQA 4UTOA 4A6EA 4YRIA 4C88A 2FPUA 4II7A 4DQLA 4IIJA 1L4LA 3TIIA 4G0PA 1F0YA 1DAKA 2DFTA 3RAPR 3SZMA 2O3SA 1YF3A 3FLBA 1WZIA 4Q9NA 4GW3A 1XZEA 3K0CC 1NBHA 4EY4A 2E48A 3EVTA 1T4GA 4ETWA 2VAWA 2G1AA 4QREA 4KLZA 3M6MD 2W48A 1YFZA 3HKBA 2QD4A 1U0RA 1YNOA 3B1FA 3NP9A 4UM5A 4JLKA 5AI9A 1DARA 4DBLE 5AK4A 1RW4A 3NT4A 4TXMA 1RQ2A 1IU9A 1N3IA 2B34A 1JR4A 2V6IA 4Q93A 1YI1A 4UEQA 4BO6A 2A9OA 4GX0A 4RVGA 1MBZA 3KOZA 1TA4A 2CVPA 3EC2A 3ZGVA 4LOJA 1TVKA 2HWUA 4ES6A 4GU5A 1KMCA 2QEQA 4NBUA 1CD5A 3V4LA 1H3FA 1B8UA 3C8MA 3GJXC 1YE3A 3H8JA 3W5VA 1O94C 1Q14A 4B48A 3BXOA 2MSKA 4G5OA 1FNMA 1JMKC 1JI0A 3W8FA 4A15A 3M1YA 4NPCA 4MA4A 2XRYA 2Y66A 1CY0A 4NCAA 2OGTA 4JLVA 1E1CA 5FH9A 5JS7A 1P3DA 5IT9A 1SUAA 3GIWA 3GROA 1E2BA 1WSBA 3IP7A 1P6XA 2DP4E 4L5CA 2YW2A 1TL7C 1K63A 2Y2UA 3PIDA 4IQFA 3AB8A 4JL6A 4K26A 1GYPA 1XI2A 1KS9A 3FVRA 2UYGA 1U28A 3PWTA 1NJFA 1Z0AA 2HXGA 2C2XA 5CXXA 1LVUA 1D4OA 3L02A 3VR5H 4CKWB 2H1RA 3H05A 3OOWA 1V2GA 4HJRA 4BEWA 1DC3A 3WICA 3HTXA 2WZQA 1UEJA 5FLYA 2H4FA 1ND6A 3DTVA 5SY6A 1MH1A 2IBTA 2VJKA 3RO7A 5KOHA 2PRIA 3HJAA 4IH9A 5B3AA 2AVNA 3ZDQA 1XEWY 4K81B 3WR5A 1QCDA 3WMGA 2Q7OE 1OILA 1Z4KA 3G2JA 3MD0A 5GJVC 3SK0A 1H3NA 2CL0X 4HLNA 2VF2A 1AGRA 4LPSA 3PUVA 4WVLA 5TF4A 1CW2B 5JMTA 5K2OA 2I2AA 3I9V6 4XA8A 3TQOA 5H68A 2DKOA 2V8OA 1J25A 3STVA 4HNRA 1L5MA 1C1YA 3EB9A 3EYAA 2N0SA 4I9FA 4MYRA 4DRYA 5H80A 2JNWA 5DOZA 5CYGA 4E3WA 2QRPA 4PZEA 5KU7A 4BEVA 3JAMA 3FE2A 1JQAA 1E1YA 3KUCA 4IDQA 3BMNA 3VI3B 1IOLA 2XIQA 3U37A 2D0PB 2FV8A 3VYTB 5I48A 4EFLA 2XNDD 1YVRA 3T35A 1E99A 4PX5A 4D2IA 2HFKA 1NNLA 4E1AA 2ORED 3PP8A 3ZOZA 3FVTA 4NAHA 2GO7A 4S1NA 3S2UA 4C4XA 4W99A 1YCGA 4BNHA 4MQBA 1AKWA 5EJIA 1BW9B 1RPJA 2AFHB 4U8HA 1T2DA 2P9TA 3E27A 4FD3A 3EHDA 1DNPA 3JVDA 2WAAA 3OQNA 5DLEA 5EC8A 1PFKA 2JLAA 1KKUA 2KLBA 4V3CA 4BQEA 4KR6A 5M7EA 1R0KA 3UANA 1MNAA 2VYFA 3IUQA 2JFZA 4EAQA 2ZJ4A 4A8JA 3RSCA 5A4AA 2ID7A 5BN4A 2VQDA 4UUMA 1O1YA 4RTJA 1CU1A 1KBZA 3IT1A 1RACA 1RQNA 3FHLA 2ZRFA 3T3GA 2X2OA 2BMJA 3HDTA 3GWGA 2B4TO 2EZ9A 3A6ZA 4FHEA 2O2GA 4DNXA 5HKAA 2O4CA 4IHJA 3HUDA 2V0GA 1MUUA 4B4DA 3ENKA 5K0TA 4P3XA 3CH4B 3TE7A 3AVVA 4TX1A 2P2ZA 3ICCA 3L84A 2QTWB 5F21A 1D2MA 5BWCA 3H1FA 3ZY6A 1JJFA 4K0RA 4E11A 1FS5A 1OLUA 4GM4A 1NZDA 2QD1A 4FDUA 1A7AA 2D5BA 1T3TA 4MV5A 3AF6A 5KS2A 1UEIA 3DS8A 1T9AA 2X15A 2CF5A 4F72A 4EYGA 2EC5A 1SXJA 2G5TA 3VR5D 3ABZA 4G3XA 1EGAA 1GEEA 1OX4B 4X8MA 3QEKA 4F3KA 4EKYA 1ADYA 2ILTA 1PR5A 3GRFA 3NFRA 4HQRA 1IY1A 2WWWA 4ZO9A 3S8YA 1T2NA 2R1ZA 2Z30A 2ONZA 2R25B 4WXRA 3RIMA 1I7NA 1AQ6A 5KNCD 3G2OA 2EYUA 3B70A 3DAGA 4KDRA 3PPXA 1JHXA 1U3CA 2EV9A 3IVGA 3NG1A 3OM0A 3PD1A 4R2JA 4BKUA 4H08A 3C24A 1SKYE 4GSLA 3PUHA 1DEOA 4RORA 4DSNA 4TVSA 1YZ3A 4XB2A 5F2KA 3PWKA 1BE6A 4KLRA 2YMMA 3QVOA 1GTJ1 2HCBA 1SU4A 3L3BA 5ERXA 2PS1A 3KYDB 4GQBA 4WZAB 2F67A 3V2GA 1VCMA 4MROA 3A3NA 1ZRHA 3MT0A 5KYNA 1I24A 1Z3IX 1LSSA 3DDOA 3DEAA 2PWZA 4FQ7A 3IBYA 4KHPB 1Z6AA 2DFLA 3FPKA 4UVDA 4JI1B 4DLRA 2K87A 5C8DA 2A92A 2BUBA 1WY7A 3QV1A 4OOFA 2BJHA 2C99A 3ZH2A 5ABPA 1P33A 1VKOA 3ZYZA 4DV3B 3KEFA 2CC2A 2FMTA 2FMUA 3IO5A 4CFSA 3K9GA 2VT3A 4TSFD 5ALRA 4QUGA 4KBYA 3SEAA 5NULA 4YT4A 2IHTA 4EVIA 5L7WA 3AI2A 1GSHA 1S1CA 2ODPA 4N9WA 4W82A 2ZULA 1QHHA 3GJYA 4AD8A 4C5BA 1WETA 2FN8A 1X86B 2FXVA 3Q11A 1E9VA 2G7ZA 4G63A 2PZLA 5B1IA 2PA0A 4U2DA 1VPWA 3RG8A 4R9NA 4G5GA 4HVAA 3OCVA 4OIFA 3WLQA 4BLUA 2CMDA 2Z83A 2ZZMA 1NLMA 2QX9A 3FBGA 2CUNA 3V97A 2VPPA 1G18A 3B3QA 3C5VA 3PXGA 1FNBA 3RS2A 1KK0A 2UZ1A 3AIOA 1RI5A 3EGXA 2CNNA 5AH0A 1QP7A 4IKEA 4P5EA 1JJVA 4I1PA 4C6RA 4QVGA 3VX3A 1V1MB 1CWUA 5DISB 3TB6A 4Q12A 1WWKA 1R5JA 2CDNA 4YMWA 2QMOA 3R5SA 1X1QA 3L79A 4X97A 4WK2B 4X90A 5JAQA 1NFQA 2XAUA 3I1YA 1UC4B 4XYBA 5D7NA 4ZK6A 3HFRA 2G28A 3HGQA 3TLAA 2ZI3A 1U3TA 3V1UA 4L72A 1DXYA 1WMAA 3NC1C 3Q6MA 1MGPA 3AEQB 2HQRA 2P1DA 3BSYA 3M9XA 4IJMA 3CUWA 3E1SA 3RKSA 2Z09A 3NHPA 4WESB 2F6RA 3ST7A 4NC9A 2Q6LA 3KQLA 2NUPA 4J1QA 2OUKA 3EWIA 4I5DA 1FP2A 2H5LA 4FM9A 4CMEA 1XRLA 3K30A 1Z4NA 3QY9A 4LXTA 4L78A 3LGXA 2M6KA 1LI7A 4BWVA 2V9PA 1YB7A 4JQCA 4FFVA 1FQJA 2ZTVA 1QKKA 1IUNA 4Y1FA 5C8VA 4UOZA 5CB8A 2ZJOA 1ECFA 3SHQA 3SX0A 4CHGA 2AK2A 1CEXA 5BQOA 3THRA 2WHRA 2CK3A 2XKJE 1Z68A 4RENA 2X2EA 2WLTA 4FIZA 4NZOA 1ADCA 3F7NA 2ZJ2A 2XGOA 3QX3A 1ECLA 3E9EA 1T9DA 3HZZA 2X3YA 3A04A 4IIHA 1O5TA 1WDWB 3SICE 2WAXA 1A8UA 2Q07A 5D5HA 2Q0QA 1VJ1A 1JF8A 4OK5A 4IVRA 3B5IA 5HOEA 3FOWA 2O7VA 3LZDA 4OHWA 4N41A 1U31A 3RRMA 3M6LA 5DTRA 1O8BA 1E6MA 2ZAIA 3D02A 2UZAA 3A25A 3RAFC 2CY0A 2FEKA 3LX5A 421PA 3QKWA 1Z5UA 4E13A 4YJFA 2ZUEA 5ALSA 2H11A 3BKXA 5DBHX 5HIMA 2Q8PA 2RAUA 5LZ7A 1EBBA 1V37A 2JIPA 3I30X 3QBEA 4X3CA 5T3UA 3VNVA 1JSXA 1PF7E 4FFBB 2NWQA 3II6X 4LX8A 4ZT7A 2H1HA 2GHQA 1DMSA 1OLXB 3UPDA 3C6MA 5IKPA 1AKTA 2FYTA 2XZPA 2ZAMA 1UBGA 3SCZA 4MP6A 5B7QA 1LSOA 1UUFA 3CSUA 4YN3A 3ZGNA 3ACBA 4QBKA 1P7WA 4CF4A 3ZN2A 3P20A 1MTOA 1IVSA 1NOJA 1EESA 3DKRA 5CPBA 3CX8A 3SZGA 1X0VA 3C3CA 1GDDA 2VRWA 1JLRA 3KTAA 1IEWA 3B20A 3TLMA 4ZVSA 3P4UA 1IB6A 3H4MA 1ADFA 4JCOA 3HB0A 4JD5A 3I37X 4U3JA 4E5PA 1ODLA 1ZYUA 2IKQA 2K4MA 3L1VA 4O4LA 3WB0A 5TQ0B 3T94A 4J0QA 4ZXFA 1GZ7A 1X39A 3KAQA 2F17A 1BOOA 2R66A 4PO9A 4NK4A 4PN3A 1YVPA 3VBCA 2P2CA 5D85A 3ZCSA 4WJLA 3X2FA 3F9CA 3JWIA 1NW9B 1XZNA 3LUDA 3Q5EA 3JQAB 1KK3A 3BQ9A 2MSCB 1LBIA 3HJCA 1JDTA 1J39A 3AONB 3SZLA 1JQ5A 3UWKA 1JFRA 2PH5A 2ZKIA 1Z0KA 1X8KA 1BC5A 4OJKA 5C7IO 3VNUA 1I36A 2QVCA 2ZYRA 3ZDRA 3ROKA 1H8HD 3AKYA 2CCGA 4QSHA 1I0ZA 1TK9A 2EZUA 1UC8A 3MMNA 1RYYA 2A9QA 5CD9A 2FF7A 1P62B 2JS7A 3WK4A 4RE6A 3PGA1 3UMFA 2YBDA 4DB4A 2C97A 5EXDA 4HS9A 3IEKA 5EIFA 4BB9A 4NTZA 4PG7A 4LXGA 4MI1A 1XAJA 3ZIAD 4UBJA 5BUSA 3TLBA 3ZNPA 2XNDA 2LD4A 1NG9A 3NIDB 4GWGA 1KSGA 4RSHA 3VO8A 2GHIA 3JD1A 1YRQA 1LKZA 4DA7A 4GPBA 1KK2A 3NHSA 4BUCA 4NAUA 3B3AA 4X1YA 4D8WA 5BVGA 3E61A 1CVLA 3MS4A 4FSHA 5CJPA 5CB0A 1DFIA 2MWMA 1DV1A 1T13A 5E2BA 1H1TA 2GA9A 4HBZA 2EX1A 2ZJ1A 2R7NA 2WQZA 3N8HA 1OZAA 4OKIA 1MJ5A 3DW1X 3AJAA 3F49S 4L0QA 3QBVA 3L6UA 1HT3A 1PYGA 2ECFA 2VOEA 1BWQA 2CE7A 4QSMA 4A0RA 3BTVA 1TUGA 4YDSA 1VYHA 1H93A 3ASVA 2W6JD 4ZOBA 2ZU0C 2O5RA 5IEBA 4WLVA 5CCBA 1DO8A 3GZNB 1YZHA 1FX1A 3H6HA 4RWZA 2ENWA 2AOVA 3AIIA 1K5GA 5CEFA 3U4QA 4PZLA 5L9AA 1YULA 1ZEMA 2E1PA 3EW9A 1QZZA 2WIBA 4DV6B 3JRWA 4JJ8A 1BDJA 3ANMA 1XRJA 2FB9A 3NALA 3R9IA 2FZGA 3SYKA 2FDCA 1MW9X 4GEGA 3RBAA 2HL6A 4ZRMA 2YJ6A 4FYIA 2PY6A 2W43A 4KX3A 4MUNA 4EM6A 4CLOA 3CE6A 1UODA 1LTKA 3DMDA 3IPCA 1FMLA 3JQCA 1GAJA 1JSRA 2J48A 3RUDA 1ML3A 2WV9A 3AHJA 5AW3A 1E63A 4XFJA 1VE7A 4I36A 4KWCA 3CEJA 4CIXA 1IK4A 2DVMA 4MLCA 1J8FA 5AXBA 2OFPA 5BOVA 2GXSA 3IUBA 3V3TA 4EJ6A 1OHHD 4D9CA 1CS0B 5F73A 2DPHA 4ZCTA 2XZTA 1SZCA 1ZXXA 5JQGB 1EXDA 2WAOA 3TINA 3UATA 4URHA 5HP4A 3VR5A 3X2SA 1M3SA 3N87A 3NOOA 1NKSA 3WIOA 5E6UA 4IVNA 1K6JA 4XIIA 5M5BA 4NNJA 5JPDA 3VC1A 2VDWB 5EJGA 4EG6A 4KL8S 4M7OA 4ZU3A 2PZEA 3WI7A 2B4KA 2CLOB 3F6EX 3GEPA 3PWZA 2IWRA 4V0NA 4WKNA 1CJSA 1DFHA 1UP6A 3ZZUA 2AZDA 3HL4A 4TUYA 1N6RA 4U02A 1AKMA 1D7AA 5H3HA 3S29A 3OAAD 3Q5DA 3THOA 5D87A 1ZONA 3TOCA 4KXNA 4M76B 4ZGGA 4Y6SA 1Q5PA 2VHEA 4WVFA 2BE7A 2EWVA 3E8MA 2RHDA 3T7CA 4QDKA 4L4SA 3QPBA 1Y6RA 2YUTA 1JG4A 3ITKA 4IFIA 2BKLA 1ZITA 2Q2OA 3DFMA 2CDRA 4PLWA 4BZWA 2TECE 4RD3A 4DA9A 2Z6AA 3PEUA 1RIFA 3G0GA 3HCFA 1MOZA 1J0BA 2R8EA 4YRKA 5LQAA 2XQJA 4DC0A 1QFSA 4Q66C 4QT0A 2H00A 1IK6A 1W4AA 4RLSA 3RVLA 3Q3CA 1KR2A 2Q5FA 5AHKA 5BSTA 4DIMA 2F4VB 5A0TA 2GJAA 3EFOA 3KM0A 3P4YA 4UUBA 4MLDA 4BB0A 4DLVA 1DJMA 4TN5A 1DEAA 2IITA 2IOFA 2V7QA 5EJEA 2ANBA 1RAFA 2DFVA 3LVFO 4Z0TA 1ZCAA 3SX4A 1CJVC 3AHEA 1R0RE 2Q99A 3OWXA 3GCZA 4YRJA 3WLAA 2H07A 3MTJA 4MCAA 4NF2A 3RYFA 1N2XA 3T99A 1F7UA 4UPEA 4BMDA 3V1YA 5ALXA 3BTUA 1YNSA 2X7JA 5AI4A 1ORVA 4HQ6A 1XZAA 2B4QA 2FWIA 4PINA 5FQOA 3VAZA 1BGWA 3VFDA 3K32A 3UT0A 2JIZD 4JJ7A 4GYKA 4JA0A 3TW6A 3HDVA 5TPWA 3NC0C 3R9KA 5KWIA 4V0RA 3KSMA 2NUAB 1QP8A 3RJMA 3MGCA 4PIVA 3WZ2A 5AXCA 1NU6A 4ZV7A 1HDEA 2CEKA 4GZ5A 3TTUA 1C0LA 1XNRB 2P9JA 3LHKA 5TPZD 1QO9A 1OXMA 2FSHA 5A2QA 4J3JA 1P31A 1YZFA 1UDXA 4OI1A 1FQKA 3J81k 4FYYA 4LI3X 3NCTA 4RGBA 2HIAA 2WVGA 3OQ1A 3P94A 3JQRA 1C4KA 3MK31 4RACA 4CQMA 3C0KA 4Q4HA 5KX5B 1JHRA 1K3UB 3IUNA 4H1VA 3WK8A 4Z49A 2D5CA 4MVJE 4NDZA 3T3PB 1X7ZA 3LUGA 4MB2A 2QVYX 1ZSVA 1GRCA 4KQ1A 4M9ZA 1NVDA 2GLTA 2BEWA 4EUSA 2WJPA 2JJMA 2ZIAA 2YXNA 3QEMA 5ANRB 3AEKA 1QRDA 4EB8A 1MX1A 3VZRA 4E5MA 1DRJA 4P38A 5CB4B 3LECA 4W9MC 4F4IA 1E1KA 3CU5A 3KSZO 5KHAA 5A3VA 1NE7A 4D8XA 4F12A 4GI1A 4XGRA 4YT5A 4V39A 3RVSA 3WDMA 1YDHA 1OQAA 1W4CA 1P4JA 1EBFA 1G8KA 1UBKS 2PAAA 4A8HA 4E0BA 4DBVO 3RD5A 2PE5A 2RGNA 2QENA 4M0MA 5KHOC 3Q3EA 2W2TA 4GM0A 3UAGA 2FG7C 1FXWF 2EBWA 3LCVB 4HDCA 1VBNA 4TV8F 4BVFA 1U1EA 3STXA 4G0ZA 4RMIA 4A7PA 2FPRA 3NHRA 2SICE 4EBFA 2O3RA 4MVJM 2AW5A 1PL6A 2XAAA 4MVJI 4N12A 4KQXA 1JIQA 2IHJA 4OD0A 5CVJA 1YZTA 4FFWA 1YBFA 5DYYA 4RPKA 3HU1A 4QL3A 4FKZA 4D41A 1UINA 1T5OA 2O52A 3EISA 5HKLA 2QTMA 3SIPA 3TD6A 4Y98A 1TZ2A 3FKQA 5F98A 2F00A 3B38A 1AUOA 1XZHA 3WDKA 4AZ0B 2WJJA 4N8EA 4MS3A 4UQPA 1CF4A 2FLWA 3KPVA 3ET4A 1R16A 3PXDA 1ZWKA 4GGPA 1KZYC 1AN0A 3FYUC 5JJ5A 3HV2A 3KALA 3PCRB 5T57A 2CDBA 3EG9A 5B55A 1FNCA 1TXGA 4KRXA 3GNTA 5AXDA 3KYCB 3GRUA 4CCYA 2PJRA 3EQ7A 3W4IA 3TTSA 1RZUA 4OYHA 4RY0A 3W7BA 2ZREA 1R6BX 2MTBA 3EIWA 4B46A 2A9FA 4NRDA 4EHIA 2F43B 1X0XA 3Q87B 4HAXA 4D1YA 3LT0A 4CV0A 2H1CA 4RV5A 3AIKA 3CNEA 1UJ5A 4EB6B 1PEDA 4WLFA 3W5IA 4LDQA 3RRYA 4ETMA 1KA9H 2XMZA 2Y9PB 4TQAA 3V2HA 5G41A 1LLQA 4CCSA 3RTEA 4ABTA 5E1BA 3E4DA 3QKRB 1P60A 1XZQA 3COZA 1FDVA 1S96A 2AS0A 2C5FA 2CLCX 2RGUA 3OQHA 4PZ0A 5D6OA 3G8DA 4DHEA 3VZCA 1ZRSA 5LR6A 3ONFA 4OQDA 3VPGA 1H8HA 4RMGA 3ZKWA 2XNKA 4HPJB 5JNSA 1FLNA 1FW6A 2P68A 3GLGB 2BE9A 1P5RA 4MGZR 2FPIB 4ALKA 4CM6A 5IP5A 3EPJA 1H5QA 1UXOA 1VGRA 1Z16A 2A4MA 1JQEA 2BEKA 3DPSA 3LVRE 4FE3A 5J5VA 4GX1A 5CW1A 3LW8A 1I7QB 2V55B 1G66A 2IFTA 3EC1A 3HSSA 3Q0EA 4JP8A 1XTSA 4AVYA 4AUKA 2YMPA 5FBLB 3FUTA 1NE2A 1Q0UA 4JQZA 2OHVA 1DJLA 2OV6A 3V4SA 1N5IA 4UTVA 4MRSA 3HB1A 3L07A 1ZMOA 3UAZA 2O19A 5KKAA 3CEMA 3WLKX 4A0FA 3EZ7A 4K8RB 1KH2A 3ITNA 5AVKA 2P69A 3E7FA 3F4LA 4G2TA 3VRHA 1LDYA 2W2QA 1Z25A 4N5NA 1NYQA 4J9UE 4MGHA 5CK4A 3PLNA 4YRCA 5DBOA 2H9AA 1Q7TA 3U81A 5HRAA 4DABA 1C7IA 5IH3A 2EJVA 4M1WA 1UM8A 4J76A 4EHLA 4ID3A 3GT7A 1GRQA 3DFZA 1LLFA 3FCAA 3OX4A 4NYIQ 1K6XA 1V9SA 5HGJA 1IHUA 1S2NA 2H5EA 3GLRA 3OURA 3PFIA 1Y7PA 4QYIA 1S7GA 3E18A 3I0ZA 2CYCA 2J9ZB 1ZN8A 2AYXA 1U2EA 3VTFA 1X9HA 3CX7A 2V6MA 1SM4A 1H94A 3P96A 4FGUA 4F2PA 5JR3A 1NI4A 2VRNA 1CY6A 2W0SA 4OO3A 4CGYA 1IEXA 4U2KA 3UW1A 3H87A 1M0WA 1NXVA 1R0YA 4NARA 1B6SA 1F5SA 3E9RA 5I7SA 4DCTA 4NYMQ 3O8RA 1M34B 1S3SA 2VI5A 2X3UA 2QG4A 3EZXA 4M22A 4PFSA 1YDMA 1EP9A 3CNNA 4CN8A 4Z4FA 3LLCA 1OHHA 3FW1A 2F9FA 4RVNA 1A9YA 2JFUA 3I2IA 3OKPA 3HY3A 3QWAA 2A14A 1QCYA 5EMNA 1E2PA 6Q21A 4DCSA 5KIAA 4MARA 3BEOA 4HRVA 2GEKA 2FQYA 1XJ5A 1QE5A 1T29A 3KZKA 3N8DA 2EHDA 3M6FA 1XDGA 5AWFC 4GXRA 3CVVA 1UFVA 3D0KA 1G20E 3GCGA 1WQ3A 4MKXA 3BD6A 3ZWVA 1NYRA 1JDBB 2ORWA 3EFEA 3HGMA 3MSCA 3OAAA 2P8SA 3VO1A 4QYTA 4BO4A 4K9KA 4M9QA 4NZ9A 4RQUA 1WA5A 3S1AA 3SKXA 3MC1A 4L8WB 5BSWA 2VBGA 3ROZA 1HTBA 2HJGA 4NZNA 2IS4A 3SBDA 4AROA 3UKDA 2EQAA 3O8DA 4I9HA 4BO2A 4BQIA 1H23A 3KTOA 4QX6A 5KYUB 1NAIA 1QRTA 1VL5A 2C4TA 2W2LA 1OGJA 4Q4JA 3IUYA 4MXDA 2QS9A 2Q21A 5HGXA 3KKLA 3RS8A 1IPFA 5BRAA 5LLTA 1LGYA 2WTAA 3A3PA 3EQ8A 2PWBA 3CPSA 3NLLA 3ANNA 4UE2A 4W8HA 3STHA 3CW8X 4BO1A 3IA2A 3WKCA 4CCWA 5EI5A 5KNDH 3BZUA 3B9RA 1CY8A 1F48A 3C3WA 4GOOD 3GLFA 3ORQA 4LTNA 5JBQA 5JSZA 5BNIA 2QMUA 1M2NA 2C4NA 4HF7A 5AIAA 3WLFA 2JGAA 2NV6A 1CIPA 3WGUA 4HUTA 4GMGA 5JUWA 3OCCA 5E6SA 1ZIXA 3TGWA 1TGYA 4RAOA 4UUQA 5DM2A 1GTVA 2NACA 1XWFA 3GP8A 1X7YA 4FDAA 3DKPA 3ED1A 4YFVA 2PUCA 2OWDA 5BR1A 1IBCA 1WHTB 2QTAA 5K8JB 1XHEA 3NP7A 5DULA 4Q24A 4NBWA 1BCRB 1KO8A 4F9TA 3PIRA 4CVNA 8LDHA 1N5LA 1GRNA 4B74A 1D6NA 4UDXX 3I83A 3GWZA 2LRHA 5AVOA 1T43A 2JIZA 3PC8A 4N7JA 4D3ZA 2W71A 4AO7A 1C9YA 4PVDA 3TLGB 5FORA 4ZREA 4QEDA 2AOUB 2HT6A 2M98A 5ALFA 3I1IA 3H9QA 2EOAA 2XR1A 1XTJA 3FCXA 4EA9A 1XQWA 3DO8A 3PK0A 2BUAA 2PV7A 4HDRB 5FPYA 4JCCA 2VQSA 4JJAA 1UK6A 4H31A 4UU7A 2GBPA 1EWYA 4EGQA 2UXBB 2YZMA 5TPZA 4CU2A 4AKIA 1N6PA 5A7HA 1W59A 1E4EB 4P32A 1G38A 4NZZA 4UVIA 4W5OA 1PE0A 4MCHA 3KU4A 3UQYS 1FUKA 3I3OA 1KP9A 1WPXA 2VC2B 1EVZA 1NN5A 1Z6ZA 2FUG6 2QA5A 3NTOA 4IS3A 4C5AA 3ER6A 3THSA 2GF2A 1N9GB 2R0QC 3PU6A 4PSCA 3ZS9A 2EBUA 3LFHA 4QUKA 4B76A 2BGTA 5DP1A 5K3FB 1VBKA 3LBNA 4B6PA 2BDUA 1L5YA 1J2TA 1MO6A 4G0OA 5ECWA 3GLIE 2G7MC 1DDGA 4HAVA 2GK4A 1BE1A 3QUTA 4O2AB 4M1YA 1WIWA 4M0UA 4R16A 4RH3A 2OKGA 3SF0A 3C45A 1O2DA 2B9VA 2A9VA 3D8RA 3DHWC 4XGKA 1NUAA 3VKVA 4W5QA 3RT1A 4E12A 2VZ8A 1G8FA 4P08A 2ZVDA 2YMQA 4TS3A 3FMIA 1UPFA 5KC9A 2FSUA 4BNDA 5KSPA 4NCNA 2OGWA 4BTVA 1XVTA 4I8DA 3FX2A 4BMSA 5AUPB 2RI0A 3WB2A 4AJHA 4G5FA 3L8FA 1WVMA 3PB3A 4GR9A 4EB3A 2J3HA 3NS7A 4C76A 2WVHA 1WO8A 5EZYF 2HXYA 3TLCA 3ZDFA 4PFKA 2I34A 3I05A 1H1LB 4ZODA 3FSRA 1CIJA 5JZOA 3ZU5A 4CMGA 3IPLA 4FS3A 3K8YA 5EERA 3BORA 1KRXA 5FUBA 2Z1DA 1F3OA 4TTTS 2VP4A 5T4FA 5TVGA 1B8OA 4Y3UA 3WBKA 2PK3A 3P5SA 4Q9IA 1MG5A 3DGFC 2VJCA 4PY2A 4RANA 3RUIA 4ZV9A 1ISHA 1YOVA 2AV6A 2IYVA 2C5SA 3LCCA 3ZW7A 3VDXA 4NU0A 4P4GA 2PQ2A 4C7VA 1EE2A 2Z58A 4MPDA 3OC6A 4DY4A 4X66B 2REQA 3HKBB 2DEUA 1EFCA 2XEDA 4K6OA 1L2TA 4EKEA 4JYBA 4RYLA 2AG5A 3KSUA 2RBGA 4GPAA 4DV4B 3A1WA 3OJLA 4H3VA 4HFJA 1TVKB 1DOHA 4W7SA 4W4TA 2V1UA 2CUKA 1GY8A 1W46A 4QOGA 5BY2A 5H3LA 4UDYX 1QWSA 2Q41A 2X4DA 2GZ3A 4Z3OA 2PSJA 4M8IA 2Q3JA 4WCDA 4I1IA 4LJ7A 1VB5A 4I81A 3W6ZA 3AWDA 4XRGA 1PR2A 4W8OA 4MDFA 1LFDB 2ASEA 4W1RA 5HMMA 1H2XA 4JJEA 3UJCA 3F8SA 1UCFA 4RJ2A 1NYLA 5FULA 5L7TA 2IVZA 4QUBA 5JRJA 1RDFA 3EZ9A 4Y2XA 4Y2GA 3MAJA 3KKZA 4PYRA 2GPAA 1MO2A 1NQOA 3ID6C 1AMNA 2V7GA 1AVTA 3ONVA 4C78A 3MQFA 3DLCA 1N8SA 3B1XA 4Q1AA 3HV0A 1L5HA 4E32A 1LV7A 1Q0ZA