4H7DA

Crystal structure of haloalkane dehalogenase linb t81a mutant from sphingobium sp. mi1205
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 113
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7dA00
4UHDA 1YB7A 1T4MA 1G42A 2WKWA 5BWBA 5CBKA 1DWPA 1YCDA 3G9UA 3UMJA 1UOQA 3C87A 3CN9A 1XZKA 3IDAA 4D9JA 4P08A 4EY5A 1TCBA 2WSLA 3WIOA 2XUPA 4OYYA 3HACA 4TPKA 3KDAA 4GLBA 1AKNA 4FDMA 4NVRA 1QIKA 2WIDA 3FCYA 1DX4A 4FNGA 4W1QA 4IO0A 4FNMA 2XUJA 3FVTA 5AOBA 1MX9A 2CUTA 1AURA 1LPAB 5AI0A 5AM5A 1CUIA 3ESAA 5A7GA 3WWPA 4QZVA 4C88A 3SK0A 1CUBA 3ESBA 3D0KA 5EIHA 1LNSA 2WHQA 4OSEA 5K3FB 5AKJA 2V9ZA 5ALYA 5DLPA 2QZPA 2G4LA 4ARAA 3G0GA 4BAZA 4Y2JA 3G8YA 5JADA 5JAPA 4RNCA 1AZWA 2PUHA 1MTZA 1ODSA 2VTVA 3AIKA 4BVLA 4GI1A 4DGQA 2OLEA 3I2KA 4HAIA 1EDDA 1E89A 3NOXA 3R0VA 2PKYX 5AM4A 2JGIA 3AILA 2VAVA 5ALEA 5KBYA 1CR6A 3G9TA 1IVYA 4UBOA 1VKHA 3TEJA 5JYCA 4MWTA 3QMVA 2WQZA 1K6EA 3FVRA 5DWDA 4LYEA 1BRTA 2C5GA 2VT7A 1GPKA 2XQJA 2OQIA 1A7UA 4JNCA 5JIBA 3DLTA 1VOTA 4CIBA 1WB4A 1A8QA 3G7NA 3DYVA 3A2NA 1AC5A 5ALUA 3T52A 1A88A 3V1KA 4DLNA 1BROA 5CT8A 4MJ3A 3WLAA 4IH9A 4Y7DA 4KR0A 3QM1A 4H7DA 2DR0A 4EY4A 4PO3X 4QDOA 1P0MA 2GBGA 2Z8XA 4QNNA 3NUZA 4X00A 1AGYA 2XQGA 5HK9A 4J0JA 1UFOA 5CH5A 3R40A 1CVLA 5LP1A 4EHBA 5K5EA 2RHTA 4CG1A 4A23A 4W63A 4YK7A 1CUAA 1WB6A 3VJLA 1IMJA 1DT5A 5SYMA 5I8PA 5AKGA 2XI4A 4KAAA 3STYA 5AK3A 4K6HA 2WU4A 1CRLA 3GZJA 4KAJA 1CUGA 1L7QA 3I1IA 1GXSA 2OCGA 2OCIA 4B7ZA 5ALJA 1JJFA 3FAKA 4G9GA 4WCVA 1XQXA 3FLAA 4BVJA 5FDFA 3H2JA 1N5RA 3FCXA 1QO7A 2HL6A 4OB8A 4U2FA 2HA7A 2XUAA 1MU0A 5ALZA 2HFJA 4UBJA 4OB6A 1VE7A 5FUMA 1CUZA 3FLEA 4CI9A 3C70A 3C45A 4G8CA 3PF9A 2XQIA 2B9VA 2ZVDA 3LLCA 4BBZA 5CW2A 5LYYA 4AO7A 1Q0ZA 1UK9A 2HFKA 3PICA 5CTAA 2QT9A 5AI6A 3CXUA 3HZOA 3DOIA 3CCCA 3W05A 1Y37A 2QUAA 3RARA 5LZ5A 5C8XA 3KOOA 4B82A 5AM3A 2PU5A 2JGFA 1WCYA 2H7YA 2WUEA 2JGLA 3PI6A 3TGLA 2HA0A 3SX4A 4CFSA 3WKAA 7YASA 4RE6A 3O9VA 1EX9A 5AKEA 3O9MA 2HM7A 4X93A 1I6WA 2H7XA 5HF5A 1QGED 1GGVA 2WG0A 4BTLA 2WG1A 4J0IA 5DYTA 5EI5A 4KACA 4X6UA 2QS9A 1CUDA 4HRYA 4KRXA 5AKXA 5AHXA 1N5MA 1U2EA 3H1AA 2YASA 1AQLA 4LXGA 4AN1A 4G4GA 5DYYA 4JUIA 1QIHA 3K9BA 2XUQA 1L7RA 3HSSA 2XMDA 1D07A 1DQYA 2C0PA 3B3QA 4FLFA 4M0FA 3DL7A 4OU5A 1G4HA 3PF8A 1K63A 3OPMA 5ALXA 2GZSA 5EHNA 5AH0A 4LXHA 3AZPA 3GUUA 2ZSHA 5AP9A 4AZ0A 4UBKA 4UBMA 4MEBA 1SCIA 3O4JA 3O95A 2PSEA 1UT6A 3PUIA 5EHQA 1E5TA 3IUJA 1ZIXA 4QDXA 3D59A 3DL4A 4AB1A 4G8BA 5CT9A 3WKCA 4K6GA 3A70A 1H2ZA 1WPXA 5T4EA 3EF3A 4KE7A 1JMYA 2O2GA 4JH0A 4KAFA 3E0XA 4C6HA 1CUVA 3QPCA 3HYSA 5FPPA 2PSHA 4DNQA 3BF7A 3WA6A 3BJMA 4XIIA 5FLKA 1P0QA 2QVBA 3VVLA 3QMMA 2Q0XA 3HJUA 4J0DA 3WL8A 1QFSA 5AKLA 2WU3A 3YASA 3PDCA 4H7IA 1MN6A 3C6ZA 1QFMA 1E8MA 5F4ZA 5AKIA 5IKXA 2JIDA 2XMSA 5EFZA 4PSUA 1EB9A 1SCQA 1J1IA 1X70A 4KRYA 5YASA 2DQZA 3ZLTA 3L1HA 4J03A 2PUJA 3ESCA 1SC9A 2XUGA 2PL5A 1UKBA 2VSQA 4OPMA 1QIDA 3FYUA 4YASA 4ITVA 3AIOA 3H17A 1VA5A 4W1PA 5AK5A 1XRQA 1UZAA 2I3ZA 4MXDA 5K3FA 4AQDA 4P9NA 3MGAA 1XRMA 4X95A 1LBTA 4Y2PA 5JAUA 1BU8A 2DFPA 2ORYA 4QDUA 2ZJFA 2CB9A 3FOBA 5AK4A 5AOAA 4EA6A 3WYNA 4ZV7A 5D7BA 4RPCA 4UHHA 4MYDA 3W06A 4P92A 4BVKA 2C7BA 3LCRA 3L1IA 1ZD4A 1EDEA 3QBJA 3TRDA 2P8SA 2CMFA 3V1NA 5CXXA 3TJMA 2AJBA 4UFPA 4HXFB 3WWEA 2HHAA 1MO2A 3D5EA 5ALRA 5EHZA 5AI8A 1CQZA 3V48A 2XUOA 2ZYSA 1YS1X 5HCUA 1WM1A 4AMYA 3U1TA 1QIGA 3OTQA 5AM2A 4HZGA 5HF9A 4PV7A 1YB6A 4Q3LA 1A8UA 1CQWA 4HS9A 4IQ4A 3EQ9A 1CPYA 2CKMA 1XZCA 4L0CA 4Q34A 2WUDA 3PFBA 2OGZA 5HF6A 3DKRA 3FYUC 5HFAA 4EY6A 3GA7A 4EBBA 4C89A 2PPLA 2VA9A 3ZLUA 3C6XA 4B85A 4X97A 4GECA 5JD6A 5T4FA 1XRNA 1XZFA 2QM0A 4PW0A 3WWOA 1W4LA 1CUUA 1ZOIA 1N1MA 4BDSA 3E3AA 5ALPA 4BTVA 3G0IA 4KJXA 2BUAA 4BRZA 1JKMA 1DX6A 1XZGA 1FFBA 4BB0A 2BJHA 3F8SA 3VKFA 2GYWA 4BAGA 2V98A 3OM8A 3IIIA 3I6ZA 4HXEB 4XWGA 3F97A 3OG9A 4UBIA 5LZ7A 5HFNA 5HF8A 1Z68A 2PBLA 1QJ4A 4FLEA 4DIUA 4WFJA 2J4FA 1VJ5A 4XX1A 4GEGA 4U2EA 4QA9A 5ALKA 3Q8WA 2XUFA 5JALA 1YS2X 4HXGA 1MAHA 1R1DA 5K3EA 3W9UA 2QKYA 5DNVA 5ALDA 4W1SA 3AFIA 4UFOA 2D5LA 2J4CA 2PM8A 3C6YA 3WK6A 5EIEA 3O4HA 3C8HA 5IVKA 3H2KA 3FSGD 5ALFA 1HDEA 3BDVA 5K3AA 5HK8A 5DNWA 2H1IA 2ONCA 1QOZA 4BDTA 4C4YA 3G0CA 1SCKA 4CCYA 1AUOA 5T4HA 4Y2RA 1TRHA 2PU7A 3ZV7A 4B0OA 2DSNA 1MT3A 4AN0A 2WUFA 4JYPA 5ALTA 5D6OA 4QWWA 4BC1A 5FV4A 4WFIA 4X6XA 4AZ3A 2HA6A 2Y2VA 1ORVA 1FSSA 2DCMA 1LPNA 1BN7A 2EEPA 1XLUA 1UK8A 1QE3A 3PFCA 2WIGA 3H2HA 3WA7A 3WL6A 4H35A 4B80A 4QWMA 4Y2TA 2AJLI 4AXBA 3G0BA 3EBLA 3R3XA 3O0DA 3MUNA 1EHYA 1JFRA 1KEZA 1HPLA 5AIBA 3DD5A 4WY8A 3EQ8A 2VF2A 4CG2A 3S2ZA 2JGEA 2VJAA 1BS9A 2C5FA 3WZMA 4QE3A 4FHZA 4N8EA 1LZLA 1QTRA 3DS8A 1XROA 3BL8A 4IHAA 3I2JA 4FOLA 2BFNA 3WMRA 2Y1KA 3N2ZB 2GBCA 1J07A 3WQHA 4U2DA 2HIHA 1FFCA 3LS2A 3I6MA 1YAJA 4U2GA 3LIIA 4H7KA 4V2IA 3KD2A 5LIPA 4A16A 2HA5A 4LHEA 4HRXA 2QMQA 2CEKA 3Q0TA 4W9RA 2WJ6A 4X94A 2OCLA 5K3DA 2OAEA 2I78A 5HQ3A 2O2HA 4GDMA 4EY7A 4I19A 4BZWA 3D2BA 1W1IA 1ZIYA 5I9IA 3SC2A 1TIBA 2HA2A 4F5ZA 1XLWA 1A8SA 5CT4A 3I2HA 3H04A 5EIAA 1K4YA 1CUSA 1YAHA 3DYIA 3M81A 5E2IA 1H2XA 4H77A 4MQLA 1EA5A 3QITA 3W9BA 4JYMA 1MNAA 4L72A 1DQZA 2ECFA 3QVMA 5JARA 1THTA 1E66A 2ACEA 4Y9SA 2XMCA 1LGYA 1LPSA 3IVMA 4BCCA 1XZLA 1BCRA 3AUKA 4BCBA 1HL7A 2X5XA 4XVCA 2IITA 1ZJ5A 2XMRA 1FJ2A 4QDTA 5BV7A 1ACJA 2Y2UA 5FOQA 1VE6A 3WZLA 3DOHA 3IURA 1UKCA 3ZLVA 2WFMA 3L1JA 4Y2SA 1H2YA 2X76A 2XMQA 2W22A 4BCDA 1WPRA 5E4TA 1JJBA 3RM3A 4MEAA 2DHCA 4FKBA 3STWA 5JZBA 4TGLA 2XDWA 4Q1VA 3V1MA 1VXOA 3AJAA 4Z49A 4BE4A 2XLBA 1ZD5A 4E14A 2WFLB 2VQ6A 1PJAA 1YA8A 4F21A 5DYWA 2XMZA 3QPDA 5LKAA 2XLCA 3R3ZA 1EXWA 1IZ8A 2HU7A 5A62A 4BZZA 1EVQA 1HQDA 2Z5GA 4GWLA 4H7FA 4C4ZA 5H3HA 2GZRA 3G0DA 1NU8A 3D3NA 1NU6A 5JATA 1OCEA 2VJBA 4UUQA 4BC0A 1RYYA 2I3DA 1ZICA 3AZQA 3OC0A 1EVEA 4FFWA 5JD5A 3F96A 2XQKA 3QMWA 1S8OA 5JZ9A 1QIIA 3G9ZA 2C4HA 1XQWA 3W04A 3QPAA 3S8YA 1BN6A 1JU3A 3WK7A 4GW3A 2B20A 3FWHA 1JJIA 4X91A 4G5XA 1TQHA 1DT3A 5KWIA 1HBJA 1THGA 2XUKA 1ETHA 2VT6A 3HABA 4C87A 2WTMA 1RWQA 3WKDA 5I7UA 4HVTA 4AO6A 2JGJA 3MUOA 1VZ2A 4J3JA 3QH4A 3LIPA 3BIXA 2JBWA 1X2EA 3AZOA 3A2LA 4OCZA 1JI3A 2DHDA 4PSDA 3VVMA 2G5TA 3KWFA 2ZYHA 1R88A 1DTEA 2VATA 3BE8A 3JWEA 3BDIA 2JEZA 3VISA 5AKYA 1MPXA 4N8SA 1EB8A 3NWOA 4DMCA 5JZSA 5HZGA 1GKKA 3ICWA 4A5SA 5DTIA 1DINA 4BYMA 5BOVA 4OD0A 2HA3A 3OOSA 1IZ7A 4Y2YA 2QXUA 2OG1A 2PSDA 2QUBA 1RP1A 3IA2A 4UHFA 3R3WA 1TKRA 3FBWA 4H0CA 2PX6A 3BIWA 1UK7A 3R3YA 4FTWA 1YA4A 4KE6A 1VXRA 4KE9A 3X3HA 1F0NA 5ALWA 2JGMA 5DNUA 5D3ZA 5AKKA 2QR5A 4Y2XA 1CUWA 4QEKA 1XRLA 3WKEA 3DNMA 1R9MA 3WJ2A 1WOMA 4U2BA 2O7VA 4UBLA 5LZ2A 3R3VA 1QO9A 3KXPA 2RGUA 2XQFA 5E4YA 4NMWA 2OAGA 2WHPA 3WKBA 3C5WP 1USWA 2XT0A 1WHSA 5CURA 1E8NA 4CG3A 4AX4A 2B61A 2C58A 3C6BA 2IIVA 4EUSA 5AO9A 1LPPA 4N5IX 3A6ZA 1H22A 2BKLA 2OCKA 4NZZA 3VJKA 4DMKA 1FFAA 4Y2QA 3ED1A 2DHEA 5KWJA 1W6RA 4CIAA 4X85A 3T4UA 1CUHA 2WUGA 4DMFA 5CRIA 1CUYA 3D2CA 2B4KA 4DSZA 4ETWA 1EINA 1DWOA 1Y7IA 2HADA 1WHTA 4FMPA 3N0TA 3O4GA 1MX1A 3F98A 1J06A 5LLSA 3HI4A 5E4JA 1XQYA 5IH7A 2JEYA 3H2GA 2HU8A 2V97A 3M83A 3B12A 2BUBA 1BEZA 2ES4A 5CXUA 4I3FA 1BEEA 4B9EA 2Y6VA 4DNFA 3STXA 4MQMA 1N8SA 4UBNA 1P0IA 1W75A 1UK6A 5KREA 4HTAA 5AI5A 4EB0A 2AXEA 5AKHA 3M82A 4CCWA 3IBTA 5AICA 2Z3WA 4FWBA 2NW6A 1C4XA 1LLFA 4ARBA 3PE6A 4BP8A 3VJMA 4IH1A 4L3WA 3GFFA 2CZQA 1C7JA 2V96A 4PSCA 1O6GA 3STUA 3DEAA 2EDCA 2ZJ7A 1MAAA 3WI7A 1EH5A 5ISMA 1CUXA 4PNZA 4ROTA 2R8BA 1YR2A 3CCBA 1Y7HA 1JU4A 1XLVA 2FX5A 4B6GA 3WK5A 4X71A 4BAUA 3DQZA 5JASA 4LKOA 2RI6A 1LBSA 2EDAA 2HU5A 4DTCA 5A2GA 2HDWA 2I03A 4RE5A 3FSGA 1XKLA 5HKBA 4ZREA 3M3DA 1GT6A 1G66A 2W6CX 2OXEA 2FJPA 2WHPB 4XJVA 4CCYB 1XZHA 3IULA 3NGMA 5CMLA 3P2MA 3LP5A 5LKRA 3ZPXA 1LPOA 5ALVA 3RLIA 4J0GA 4K6KA 3B5EA 1CFJA 5IVHA 2J3QA 3I6YA 1FFEA 1CUEA 2XB6A 4QLOA 4WDRA 1ZI6A 1MX5A 3MVEA 4FLMA 4DNPA 4QDZA 2XE4A 5AK6A 1CUJA 3WWCA 4W1RA 3R41A 2HRRA 1ODTC 4TVKA 1ZGCA 4L9AA 1ZI9A 4GBGA 2OQVA 5IVIA 2XUIA 5T4BA 2AJDA 4B84A 2BAGA 4Q82A 2WILA 2WFLA 4MWSA 4FBLA 1U65A 4RGYA 1CIJA 2LIPA 2RAUA 3WL5A 1KU6A 3C5VA 1HKHA 4G8DA 4IH4A 1E3QA 1UOPA 3ZWQA 2YXPX 3IUMA 4B81A 2WIFA 4PF1A 1UWCA 5AM0A 3PUHA 3K2IA 5ALMA 4DYHA 1TAHA 4I4CA 5JANA 2QRUA 5CH3A 3E1GA 2VJCA 1LZKA 1ODCA 3CN7A 4E11A 2WLSA 3D2AA 3GBSA 4AMZA 4DSAA 4OUKX 5DJ5A 1BE0A 4X3CA 5ALQA 1CUCA 1F8UA 2CBGA 3WWDA 1WB5A 1H2WA 1TCCA 3ANTA 2GYUA 1KU0A 1L7AA 1LPMA 4F0JA 4J7AA 4B0PA 1P0PA 4NS4A 3AINA 4LIPD 2WIKA 3C8DA 4B9AA 1QIMA 4ZRDA 4DM7A 2J3DA 2ZSIA 2BGNA 2RIPA 3STVA 1PV1A 4MYSA 3BWXA 3ILSA 4Q3KA 4DMHA 5ALHA 4X7BA 3QYJA 3H1BA 2XUDA 4YPVA 5CT5A 5ALNA 3W2TA 1R4ZA 5FXMA 3WIBA 2Z3ZA 5HQ3B 4F60A 4OB7A 1ZJ4A 5CH8A 4O08A 4OU4A 3AIMA 5A7FA 5BWCA 4BE9A 5LZ9A 4EZIA 4DNOA 3I1YA 1HLGA 1VA4A 1U4NA 4Q05A 2DQYA 3I28A 3R3UA 1GPNA 2JGKA 4UPDA 2OPHA 3IUQA 1QIFA 3IB3A 1DU4A 4KEAA 5A71A 4FBMA 4ZI5A 4C4XA 1EK1A 1G5FA 3H19A 1W76A 1T2NA 1IUOA 1XZBA 3QZUA 3WK9A 4N5HX 1XKTA 2WFZA 2GYVA 4Y2UA 2Z8ZA 4OYLA 5JAHA 1SFRA 3U0VA 1OXMA 3H0CA 3VXKA 1IUNA 3GROA 3WL7A 5ALIA 4Y2VA 4H7HA 4J0KA 1XZJA 4BRSA 3HC7A 4N8DA 1GKLA 4AO8A 1W52X 1K8QA 1R9NA 4ZGBA 5EHXA 4H7JA 1AX9A 5C8ZA 4G1FA 3STTA 4P93A 1DWQA 1UKAA 2Y6UA 4H7EA 3I2GA 2XMGA 1CUFA 4GHWA 3JW8A 5DTJA 2QJWA 1XZMA 2WIJA 1M33A 1XZEA 3UUEA 5K3CA 1TK3A 2WJ4A 2WTNA 1CEXA 4G4JA 3O4IA 2AJCA 4U2CA 4G4IA 4E15A 2OGSA 2XMBA 1E8DA 3BXPA 1EDBA 4QLAA 3G02A 2OGTA 4UFNA 4PQEA 3WYDA 4H18A 4K5QA 5ALGA 4FFVA 1R3DA 3DJYA 1B41A 2HA4A 1JT2A 2GBIA 2PSFA 3V1LA 1EI9A 5AI4A 5ALSA 1QTIA 3FLBA 1GZ7A 4E46A 2E3JA 1IUPA 1FFDA 2D0DA 1UOOA 5FPQA 4KYVA 1ZI8A 5HKAA 3UUFA 1QLWA 2FJ0A 3GELA 1AMNA 2RHWA 2GBFA 1PFQA 3WJ1A 2C0QA 3ZI7A 1QONA 1Q83A 3RKSA 3HEAA 1ISPA 5FKJA 2CJPA 4X6YA 4G9EA 4BATA 1LPBB 3KSRA 4WDQA 1H23A 2ROQA 3VDXA 3C43A 3H18A 5D3KA 4LYDA 1EK2A 1U8EA 5AKZA 3ICVA 2G5PA 3DDUA 1ZD2P 4J0CA 5AJHA 2VEOA 1R50A 4UHBA 2PSJA 4EY8A 2H7CA 5J3JA 2WM2A 2R11A 5AIAA 2JF0A 4J0HA 3H2IA 1QZ3A 3KWJA 4ZWNA 2YH2A 1XZAA 3HLKA 5JD4A 3HRHA 5ESRA 5C8VA 1GQRA 1CLEA 5CT6A 4ZV9A 1VLQA 5FP0A 1UXOA 2PVSA 5AI9A 2YYSA 4WY5A 3DKKA 1VZ3A 4YX9A 3F67A 1QIJA 2ZJ6A 2RONA 1ZD3A 2BUCA 2WJ3A 3JYHA 3ESDA 2VAXA 5EGNA 5A7HA 1J2EA 1XRRA 4Q3OA 1GQSA 3F9CA 3WK4A 1XRPA 3A2MA 3BJRA 1XQVA 1Q0RA 4K2AA 2O2IA 3HXKA 1YSCA 5ALLA 2O7RA 2ACKA 1ORWA 3EQ7A 5A6VA 2QJRA 2K2QB 3EIOA 1X2BA 2G63A 5SYNA 2FUKA 2WG2A 5C81A 3I2FA 4UHEA 3E4DA 2HRQA 1K5PA 1MNQA 1O6FA 1JMKC 2ZYIA 5AM1A 1XZIA 2QOEA 2BCEA 3DCNA 4ZXFA 1B6GA 4WJLA 1TCAA 2IX9A 3FNBA 4BP9A 4X90A 2QXTA 3WK8A 1CV2A 5LZ4A 2H9YA 4KE8A 1XFDA 4LXIA 4GXNA 3FYUB 1F6WA 2ZYRA 4JEIA 1MJ5A 6YASA 1F0PA 5LZ8A 1BCSA 1XZDA 2QTBA 5K3BA 2AJ8A 5C7YA 3V9AA 4WFKA 3FYTA 4B83A 4S0XA 4X92A 4M0EA 3D4LA 2X8BA 3ANSA 4M0MA 3D7RA 3SWWA 1SOMA 1ACLA 3IUNA 1QIEA 3BF8A 5ALOA 2WHRA 5JAOA 2XUHA 5IVDA 1OILA 1ZGBA 4INZA 2BGRA 3K6KA 5FRDA 1GPLA 3OURA 1YASA 5AOCA 1NX9A 3RK4A 4UHCA 3G9XA 4C01A 3I2IA 1Q84A 2UZ0A 1C7IA 2VJDA
chains in the Genus database with same CATH superfamily
4JT2A 2IBTA 4PX9A 1S5PA 2R66A 2C3YA 3C4QA 1YB7A 1T4MA 4NBWA 1FLNA 4GP6A 4RD1A 1OMOA 3IP1A 2JHAA 4NARA 5BWBA 2F3PA 3E9CA 1SPXA 2X40A 3OUUA 3PEYA 3SNHA 4YR9A 2C2BA 5BVGB 1A5SB 3G2PA 3RIHA 4F2HA 4B3MB 3SEFA 1U63A 1YCDA 1ONSA 2GHQA 1LF0A 4C7BA 1EWKA 3ITKA 2HJRA 4JLMA 4IIJF 1Y5RA 3OJWA 3ZK7A 3UMJA 3CN9A 4IIYA 4MIYA 3RUDA 1IBMB 3IDAA 2K2WA 4J16A 3OIDA 3THRA 2PYZA 1EVKA 1VCHA 1BZYA 2YBEA 4YACA 1TCBA 3H4TA 2PYIA 4N54A 5B1DA 3WRWA 2XUPA 3MFYA 1PJ2A 1WZNA 3BMQA 1CY0A 1H6AA 2A14A 2PJUA 4YJHB 5F9HA 5DCLA 4CI0B 4G0VA 4M98A 4Q9JA 3TTUA 3DHNA 3KDAA 3T0GA 1R6BX 1YS6A 3WB9A 5ITSA 3H2ZA 3WP0A 4OKSA 3PPVA 2DPXA 3FTNA 1F6DA 4UTVA 2AMVA 3NC4A 1LDBA 1OIVA 4RU1A 4TSFA 5FUWA 3V8BA 1I3CA 4HAUA 3VTZA 1ABBA 2NU6A 2QTAA 3ZW8A 5DM70 3OEED 3MXTA 4FNGA 3MC1A 1IPHA 2XCQA 1PL6A 2XJ4A 3R77A 2XUJA 2FE4A 4XRGA 1F20A 4WESB 1IVSA 5TJ9A 3RUPA 4ENSA 5HMLA 2ZCJA 4C3ZA 1AURA 1LPAB 1ZH8A 1G5TA 2F3RA 4Q1CA 5DCUA 2HHLA 3DR3A 3P2OA 1CUIA 1JQ3A 2O50A 3PYXA 2IKSA 5AI0A 1XTBA 5AM5A 4ZCSA 5KJ1A 1CY6A 4QZVA 2V7QA 3M4JA 5KTMA 4TLEA 1NW7A 2VAPA 9GPBA 2WYUA 3I62A 3TDMA 1EG2A 3IUYA 4BHTA 5B3LA 3L77A 1PI3A 2O5EA 1RJDA 3D0KA 3ESBA 4XQ9A 5BQFA 1W7AA 1OC2A 2WHQA 1Q1ZA 1BE8A 3G2IA 1V5FA 4TQGA 5AKJA 5K3FB 1BJRE 1T3TA 1N32B 2O19A 2IU4A 3R2JA 4BB9A 2VQFB 2YMQA 3B82A 5ALYA 1VJRA 4M54A 4H7PA 3DHYA 4Q24A 4KGZA 1WX1A 4B09A 4RFSA 2CV1A 4ARAA 2AEEA 3M3HA 4LRWA 3G0GA 3PP8A 4LOHA 3G8YA 1UJMA 4PG5A 4BAZA 3LC7O 4RNCA 4RO0A 5JNVA 1QCCA 4ZRNA 1TNDA 2H0QA 1TVKA 2C59A 3FOFC 2D4HA 3ADDA 4CM3A 1ODSA 3OOEA 3D6UA 2ON6A 1XA3A 2VHUA 3NP7A 2QE7D 2W90A 4DCGA 4DA8A 1ZN2A 4TL7A 2YIDA 3PNPA 3ZE7A 1GNPA 1NJ6A 1X92A 2OLEA 1HNNA 1JKFA 2NYUA 2ZDHA 4FOPA 4HAIA 4AY2A 1EFHA 2PTGA 1OH6A 1DELA 3VZCA 4J29A 4E2WA 5IU6A 2BKXA 2GFQA 4FYJA 1JKIA 2YQZA 2WD7A 1X14A 4N82A 5DHUA 1L1EA 4BZPA 5I47A 3CLHA 5EE1A 4JKYA 1CR6A 1NOKA 4KPUB 1DG1G 2JI8A 3U7HB 4G0WA 3SPXA 2REXB 3TEJA 1M1NB 5HDBB 1IMOA 1G21A 3OKPA 3AP2A 4HD8A 3FIJA 4NBRA 2IA5A 3RIYA 3ELWA 4OQ4A 4YV2A 4HTFB 4W5QA 1XLTA 4L16A 1JTFA 2C5GA 2VWQA 3NHLA 3H9CA 1UANA 2HWUA 3AP1A 4OP3A 2HY7A 3RS7A 1E20A 4JSTA 1PDVA 4TL8A 3DLTA 3WXMA 4CIBA 1U7XA 4HNSA 2WTBA 2EHDA 2XOKD 4X45A 4B4WA 3SIWA 1ISMA 3CH5A 2FVYA 1A8QA 3DVRX 3DYVA 2I3AA 1UBLS 2XEXA 3VBEA 3J81A 4ITRC 1FXWF 2EFHB 1JNYA 1JPJA 1NF8A 2EW2A 3FZGA 5ALUA 1SXJA 2VDRB 3VHXB 4D9GA 1A88A 3WZ2A 3ITEA 2RGNA 3IAM1 4RQUA 3TM5A 4CPDA 1BROA 1WD7A 2ZI6A 3HO6A 4D6XA 4US0R 1NURA 4XQ0A 1CJBA 3U9LA 4R6WA 5B6JA 3A1TA 4DR2B 1Q0PA 2CZCA 1ZAYA 1OFVA 5KVAA 4BBAA 3E7PA 2XGOA 4ZYTA 5FUYA 4YA6A 4RQTA 4Q9KA 2QAIA 2GAJA 1B8VA 3VX3A 1SBHA 3A1CA 1RI1A 1WKBA 4YRZA 1WR8A 3CZPA 4QDOA 3B6JA 3H75A 1SCNE 3HUTA 2Z8XA 3V2HA 3FPCA 3LT5A 3O4RA 2PE5A 1ZRSA 1XMOB 3FPGA 1AGYA 1K88A 5CPBA 4DYVA 2QX8A 2R60A 5HK9A 3U7GA 4WN9B 2ZI3A 5JJKA 1UFOA 1MFZA 4XVQA 3RRYA 2GK7A 3DMGA 3OF2A 6REQB 4PNHA 4AJKA 3COSA 2VDLB 1V5WA 1DAPA 1PFVA 1T43A 4ZVKA 2OXFA 4UEQA 1KYZA 2W70A 4BIMA 4ZI3A 3W5SA 4EHBA 1JH9A 3SYMA 1NULA 3BULA 3I8OA 2PZFA 3JWHA 3Q3VA 1JLLB 1NR1A 4FQ7A 4HRVA 4MYHA 3VJLA 1DT5A 4M83A 3ROPA 4CN8A 2YV2A 3I64A 1DXHA 1QPGA 7REQB 5AKGA 4BKMA 1VE5A 4OSPA 3T35A 1NJSA 1NL3A 4ZAVA 2ILVA 4ZT4A 1C29B 5FFMA 5LP6F 5KNLA 7MHTA 1F38A 2BIFA 3IEPA 4MS1B 1CRLA 2HCBA 2ZE6A 4IWYA 3OTOB 1CUGA 4RZ3A 3SJ7A 1TLLA 1UUFA 2EYUA 2XIJA 3S5UA 3BTUA 3D3QA 2GPAA 3P2JA 1K86A 2J6HA 3L46A 4PYOA 4R83A 2DPHA 4MVJF 5EPUA 3WQRA 3I1FA 4YP7A 3V4LA 5DGCA 4NDZA 4ZHQF 2DR2A 2GLUA 3TIGA 2J7PD 4B7ZA 1OHHD 5LLTA 3NEAA 1KI2A 4G65A 4DQDA 3GEMA 1OI4A 4EGSA 1U99A 1IZZA 4NFLA 4PZ0A 4DMRA 5C7LO 4FR2A 5KSPA 4WCVA 2JFFA 4W6ZA 4UVIA 4YMSA 4YJGA 2OILA 4E5MA 5JFTA 3OEEA 2I8AA 4NS1A 3AHCA 4E1VA 3W5VA 1TYZA 2LD4A 2YUIA 4P32A 3UT5B 4YV7A 1BS1A 3VPHA 4MINA 1YA6A 5FAXA 3OETA 5FWNA 1XIVA 3S6JA 1O95A 1P62B 1WQ4A 3MLBA 3GJ8A 4FCCA 3AR6A 1Z08A 3KU1A 2LVBA 3OT4A 4PLFA 3LLUA 4QXPA 1FRQA 2ZQ5A 2O6HA 1XDBA 2R6FA 4L7VA 4BRUA 3MWEB 1C0EA 3AG6A 1RM0A 2HEIA 4UCXA 5H3LA 1AB6A 2OUKA 5LQSA 4UBJA 5BVHA 4WEOA 4E22A 4BJ3A 3UAOA 3WLOA 3FKSD 3W7BA 4CI9A 4OHRA 3PF9A 5EZ6B 1NMSA 1U7DA 1MO6A 1UZMA 2GARA 2I80A 4NU8X 1EPUA 3IVAA 1O0BA 1W5EA 2OTCA 2P68A 2ONZA 5LMCA 1MRNA 4LYJA 1OI7A 2CN1A 1SA0A 4MW0A 4A6EA 2B7LA 3VO2A 1O0CA 3JQGB 2QV7A 1WF3A 2Q4TA 4QOJA 1J6UA 3HBAA 2P0EA 4QJ5A 1US8A 3SBEA 1PFUA 4X8MA 5HQTA 4ECEA 1MP0A 4REQA 2YWJA 5H81A 4EM6A 1I1OA 2RAFA 3CXUA 3I5UA 2WICA 1MAUA 3CCCA 4G2TA 3VV2A 3W05A 5F3DA 3HGQA 4JVLA 2G07A 1W5BA 3KOYA 2OGWA 3BTOA 5LZ5A 1N7GA 4D9IA 2DPMA 1QHIA 2AV6A 4ZVSA 4DY6A 4B82A 5AM3A 2EJBA 1U6KA 3CS3A 5I01A 2JGFA 2ZZKA 1FUIA 3V8QA 5FWYA 1NHGA 4HQ0A 4G36A 1DKPA 1G8SA 3ZE2B 2EJTA 2HA0A 2NQ2C 1T15A 2AF4C 3A3OA 3B3JA 7YASA 1PR9A 4CGYA 3RS9A 3FWYA 1UFKA 4G84A 1EX9A 5AKEA 5BN4A 1EXVA 1PS9A 2HBQA 4Q3DA 4AP6A 4Z4CA 4A7PA 3KR2A 4AMGA 2H7XA 2JVKA 1QGED 4ZK2A 5E2BA 1J24A 1MOQA 1Q3KA 4G1UC 4JKIA 1ZXLA 4RV4A 1CJVC 5DYTA 4KACA 4QDKA 1XJQA 1ZNXA 2YKGA 3AVWA 2ZK7A 3KBBA 4IEFB 4KQ6A 2VJPA 5AHXA 1JPNA 3QMPA 4RKQA 1GPBA 1E1NA 5TC4A 3VU1A 2C7QA 4HF7A 1DCKA 4U6QA 1HEYA 3ETJA 3UO8B 2W2MA 2OHIA 3ZE9A 3Q8KA 3GN1A 4LXGA 4UATA 5JJLA 1E5VA 3KTAB 1TTTA 4IJVA 5T3UA 1KSGA 1U1EA 3U44A 2JHFA 4KZKA 3GFOA 1OH5A 1KXJA 1FLVA 3GMDA 3Q6IA 3OX4A 4IHJA 2RD2A 5KNBA 4B33A 3P9KA 4O2BA 4B8ZA 3AF1A 3DM5A 1P6UA 1V7ZA 3OP4A 2WWIA 4H6PA 3RFXA 1L7RA 3UK1A 1GPJA 2WHYA 2XMDA 3PEUA 2X1LA 5F9MA 3KVNA 1D4OA 4IRUB 4HBZA 1DQYA 2AX4A 1SBIA 4U63A 1YDEA 4FLFA 4HLNA 2RGDA 1GEGA 3HYRA 3JQFA 5LMUB 3RVJA 3PZBA 3JS5A 2QBYA 1E7RA 1DHTA 2AHOA 2PRJA 2XV1A 5EUCA 4DV6B 1WZCA 4OU5A 4EJ0A 2IYRA 4LVCA 3V34A 4IGFA 4MHOA 4YUAA 2QP4A 3PF8A 3ORQA 1POWA 3VR2A 1CEEA 3DF9A 1K63A 4RS3A 2WTUA 2G36A 2GZSA 1UBSB 5EHNA 1EUQA 5AH0A 3SEZA 3ROFA 5HILA 2CXTA 5HRUA 1JKJB 4I6EA 1PQWA 2RAPA 2O23A 1L5HA 1E7MA 1QGDA 2X15A 3M1YA 5F7JA 3NAQA 4G5RA 3ABQB 4ZCMA 3UIEA 3I9V6 1VE9A 2BV3A 2C98A 2I1WA 1BX3A 3LECA 3Q8XB 4MEBA 1HYQA 4PZCA 3PNBA 1OFIA 3ZGXA 5IS2A 5TY0A 3HR4A 2BGLA 3CO5A 3O95A 1ZM2A 2ASEA 2F8TA 2PSEA 1GSHA 4BLOA 1X42A 5C3UA 4PZUA 3ZIAD 1VIAA 1DS6A 5LBIA 3SSMA 2B35A 4L8FA 3IAAA 1JMVA 2V7XA 5B6IA 4LJYA 3T1OA 1XVVA 1ZIXA 4QDXA 5EXPA 2H54A 3FCCA 4AB1A 2W7TA 6ADHA 1G64A 2MSCB 3CRQA 2J59A 3H83A 5C8DA 4D41A 2LUOA 4D0SA 4G56A 1HY3A 4KR9A 1W73A 4K6GA 1RKQA 4Q01A 4QUAA 3WNVA 4OREX 4LF9B 1CRPA 3OQJA 2R6ZA 5GONF 3HCWA 3LDUA 4DLAA 3Q7SA 1R0RE 3C3KA 3IUPA 1Z0UA 2YVAA 4TSRA 5K99A 2ONKA 1DXQA 2FCAA 3EF3A 4GT1A 2ZIXA 4NMXB 5J40A 2CW5A 1JFFA 1JX6A 1W29A 5E0OA 4WXHA 5FWYB 4GMKA 3UMMA 4JI8B 1KAOA 1QCZA 2A1UA 2NYVA 3QPCA 2C20A 2PX3A 2VI5A 4KN6A 4DNQA 1TVEA 3BF7A 5AR1A 3ZIUA 3TZLA 3TTSA 1CE8A 1FNCA 3C3AA 3MGKA 3UWPA 5KYUA 2QN8A 4D4LA 4XGRA 4FYKA 5AVJA 4XUGB 4Y67A 5EJ2A 2NGRA 3EBOA 3HJUA 1EESA 2G17A 4GLOA 4J0DA 4FX5A 4NOLA 1QFSA 3EGWA 2AEMA 2WU3A 2WBLC 3BXOA 2DTDA 3UAZA 1STOA 3AB7A 2JH9A 4CKZA 4MUXA 2GXSA 3U3JA 3DR5A 3WLTA 2PGJA 2QD4A 3C6ZA 1ZCBA 1I4TD 2FQYA 4S2EA 1IIBA 1IK6A 2KX7A 4GPEA 4QXAA 5BNWA 2OK7A 1RQNA 4RLSA 4KOEC 4C0WA 4PRLA 1EB9A 4PSUA 5A4MS 1J7JA 4M53A 2I7VA 2P4QA 3RS2A 5YASA 1VHTA 5KYYA 1X7YA 5U9CA 2DQZA 3F7NA 4HWRA 2RGCA 4CKCA 1V16B 8LDHA 2PKXA 1C4OA 2Z0MA 2AOTB 3ZLTA 5CTJA 4B5LA 1Y9JA 1TW2A 2EG5A 2PUJA 4UVEA 2Q1WA 3SZGA 3NHAA 4PGHA 3A3YA 4LHSA 4ZTZB 3IESA 2XUGA 4X20B 5KWEA 4P0TA 3U80A 4YASA 4YIHA 5F1YA 1CNMA 3KU4A 1GGFA 1II8A 4HPWA 4AXXA 2VK2A 4ZEWA 1VA5A 1KPIA 5AK5A 5E1BA 5CFMA 4AQDA 2SCUB 2ZBGA 3BBPA 4YJGB 2VJYA 3Q1LA 2HYIC 1Q3HA 5H70A 3H8JA 2M2IA 3LRTA 5EAIA 3EJWA 2BGMA 2FWAA 3PA8A 5JAUA 1BU8A 4LTNA 3T7TA 4RK6A 3INNA 3TLBA 5KTRA 1YB5A 3A4NA 3GAMA 3SE0A 1GUAA 3TM4A 3ZWWA 3H1EA 4C4TA 5IWCA 1KSHA 2WK1A 1VYUA 4Z2AA 5KQLA 3FOBA 1NXVA 5AOAA 1E92A 1RPJA 2JLSA 3L7YA 5F3RA 4PINA 5AJYA 4DSOA 1A2BA 3WYNA 1LV8A 4KG7A 3ASUA 4CM9D 1VJGA 1XXHE 1EFTA 5BWMA 1QGZA 1OAOA 3W9SA 3UTCA 2WAAA 4D81A 5DFAA 5KDOA 4TKMA 4E0BA 1XU4A 5D7BA 3QIAA 4RPCA 1S8AA 4Z9YA 3F5DA 4P4LA 1ULSA 4MYDA 3HXTA 1L4EA 4YFYA 3W06A 1W36D 1GPYA 2FHPA 2Y05A 1T0UA 3HBMA 3N7AA 2EZ8A 4KB5A 1U0LA 2OY0A 2C7BA 3OQVA 2I7TA 2SNIE 3GLIA 5GJBA 3V6LA 1SVWA 2ZYWX 4KO2S 3Q5EA 3FSEA 2GJ9A 3QBJA 4MW6A 2W6ZA 2I4IA 4JL6A 2C0CA 4K03A 3TRDA 1SVUA 2RC6A 2WKSA 3MWDA 1NMXA 2V9CA 2R68A 4CQLA 5CFPA 4DEXA 2MMGA 5JSUA 4DA7A 1JIUA 5CLIA 4DABA 1VL1A 4DFDA 1QBKC 1SUWA 5IT5A 2XB2A 5CXXA 1QH8A 4JJ8A 3MJSA 1BE1A 4HXFB 1B74A 1K5GA 3MHTA 2HHAA 1BIFA 1DRUA 1TYCA 4B6OA 5J2TF 3WMEA 4KV9A 5FADA 4L76A 1EFLA 1HDRA 2QG6A 1T9AA 2PMWB 2BM0A 2XUOA 2D2VA 3PPXA 4II3A 4LGCA 5C1IA 1YS1X 3P9PA 4L6AA 3ZIAA 1ZBQA 4N9QA 4OMCA 1VE1A 3RABA 1M9NA 3NCTA 2W00A 3ND9A 4IIUA 3KOUA 4U7WA 4AMYA 3ZD6A 4F84A 3NHRA 4DLUA 1XDUA 3TPCA 4WK6A 2Z8YA 1OY1A 4ZVQA 1EX6A 2E7ZA 1BVUA 2W6QA 1ZH0A 3F3SA 3OZEA 4HZGA 4MAAA 3IAS1 1YB6A 3NU1A 4XUEA 1OWOA 4Q3LA 4R8KA 1SPBS 5DYNA 2XECA 4EY3A 1CQWA 2I6GA 3ZUGA 4HWSA 2NUBA 3EQ9A 5F2KA 2PMCA 5ADVA 2UXDB 3A6JA 2Z57A 1H0SA 5C3MA 4ZQFA 2R87A 2OZLB 4Q34A 3T95A 1DOHA 4IMIB 1OSNA 2ZVPX 3MXOA 3PFBA 4IQFA 4M89A 4CHTA 1K7XB 3CR3C 3GJ4A 4R8VA 3WOVA 4C4RA 3DKRA 3FYUC 1B15A 4PICA 4XXHA 3GA7A 2A7XA 3STHA 1IBKB 4WCFA 2FX3A 4EBBA 5FLXA 1JA9A 2VA9A 3DE4X 3ZLUA 4B85A 1D03A 2CNDA 1SQSA 2Q28A 5KOHB 1Y6ZA 2NOAA 4WBNB 1DDIA 2AMYA 4GZ3A 1R74A 1H9BA 4P3YA 3TFWA 1JA0A 1NVTA 1X7HA 1W4LA 1Y1RA 2IUYA 4FX2A 1ISFA 1DKOA 3P9YA 1Y7PA 4MVJE 3M49A 4TKLA 3S2EA 2V7QD 1XD2A 4Q4LA 2COKA 8ADHA 3JAWB 3UOGA 5ALPA 3IQDB 4DDUA 3WLQA 3ZC3A 4FYXA 3KUXA 1D5WA 1YS9A 1TVKB 4HYQA 4ESOA 1DX6A 1XZGA 1FFBA 3AWDA 1NI5A 1RVDA 2AWNA 3PXXA 3UICA 4DOMA 1S8NA 4INJA 3VKFA 3PNSA 2IV2X 2GYWA 4TLLB 3AKDA 1JEYB 1E2UA 5MF6A 1D6NA 4LZAA 4P81A 2Y71A 5AHKA 4YMUA 4OP2A 3IIIA 1LQ2A 2P2GA 2EC5A 2NUTA 3I6ZA 5IAOA 2AFVA 2FTKE 3L7NA 4OHWA 2AC4A 1LTQA 5HGXA 2PL3A 4HXEB 4N65A 4NAVA 3SJCA 3SU8A 8MHTA 4IEEA 3UMVA 1ADFA 3H9JA 1SC3A 2IEAA 5DM60 4C03A 4FUQA 1TUBB 5K0GA 1PVVA 3I3SR 4MQUA 4GLJA 4MVJD 3GZ4A 4J4TA 2O2ZA 4L95C 5J5AA 3VNUA 4RQBA 3MJFA 2IYOA 2D3TA 4KHZA 4UXJA 1MXFA 4GEGA 5G0UA 3L84A 4IQGA 2BDEA 1T2CA 2CT8A 2BTQA 3G3EA 2VP3A 3QELB 4Y1GA 2WJIA 2XUFA 3M4XA 2C2KA 5AJVB 3FIUA 4Y6GB 1X8LA 3WE7A 3K5HA 5LQJA 2V4MA 3GBVA 3TBFA 1CBUA 4ZPJA 1QRSA 4OLFA 5EJMA 3T7JA 4R41A 3VPDA 5H83A 4ES6A 3SZ3A 1MAHA 3DZIA 3R7SA 4EX7A 1N2EA 3M6XA 5DHQA 1P19A 3DE6X 5DNVA 3MOSA 2QRKA 1V8PA 3FYCA 3ND8A 2X1VA 4FOSA 4G81A 4F4HA 1A69A 1W44A 2JG3A 3QXCA 5H82A 3OEWA 3KKEA 4ZHSA 2ASVA 3JYQA 4EHJA 2J4CA 4ZAYA 3ILYA 2H4WA 2CK3D 3QU7A 2FPRA 2Q3FA 4L57A 4LNAA 5AJZA 1AK2A 1E9CA 5F5XA 5IC6A 4TV8A 1YS7A 3IEVA 1HUQA 1JHDA 3BDVA 5K3AA 3V8NA 5HK8A 5DNWA 3CUUA 3HPRA 1QOZA 4BDTA 4UNQA 3VFDA 2E55A 5FO1A 2PT7A 3KQNA 1GDDA 4C4YA 1HLPA 4PYRA 3M1AA 4KQXA 1QFZA 2H5EA 3FOWA 4KTTE 3T06B 3UHPA 4DLVA 2G06A 2Q5IA 1R6VA 3AFOA 2KSQA 4WI1A 1XAIA 1A9ZA 2WZDA 3IOBA 4HKTA 4Y2RA 1VKOA 4IMJB 4OQQA 5EJGA 1NUSA 1TRHA 4QBIA 3H5WA 2XGMA 3W5UA 4B0OA 2DECA 2Z58A 4C6RA 3ML1A 4A1FA 5HIJA 3EHDA 3TQFA 1MT3A 2WTAA 4J7UA 3TH5A 2YVLA 3DV0B 4TT3D 4UAUA 5HG0A 1DBVO 2C77A 3TIFA 3ZQJA 4ZTUB 1DX9A 2P9BA 5L3VA 3AUAA 5AVYA 3SY8A 2O1SA 2IBSA 4WBNF 1QC5A 3GYBA 4WXPA 2BBTA 4WKBA 1F14A 3RVNA 4D26A 4DMUB 1Z6XA 5KINB 4BC1A 5FV4A 3HLTA 4DJTA 4F5WA 1XTPA 1C3VA 4KX3A 3TXXA 4DC0A 2CV2A 4OHKA 2JCYA 4QRDA 4Z9FA 2VO1A 3I9OA 1ZJYA 3GD5A 4BP3A 1N2IA 3LUKA 1KBQA 4YJ2F 1U7WA 4Q7JB 4ABTA 1AXRA 2GCIA 2DCMA 3FVWA 5JROA 4EARA 3EVAA 1VGRA 5L3RA 1BN7A 4CT5A 4DJ5X 4ZI2A 1SQFA 3I4CA 1SHLA 3LCMA 1TZCA 3K0FB 1V39A 3LO5A 4H08A 5FR2A 5FTJA 5F5LA 3U0BA 2OK8A 3V46A 4DSNA 5JQWA 2HRZA 3X2EA 3HL0A 2ETVA 1K7EB 3CF2A 1NW8A 2WIGA 4U8HA 4EPTA 1E64A 2I33A 4JVOA 4RVNA 4ND2A 1FXWA 4M22A 3K70D 2VYNA 1PFYA 3N75A 3SHOA 1HZZC 1W25A 2ZT7A 3U60B 4QWMA 4CT0A 1OKKD 1WDTA 1YDFA 4ALLA 4IG9A 1IL0A 1W46A 1V95A 3ZWXA 2JD2A 4OVKA 3OT1A 2WWXA 3S44A 1YHZA 3G0BA 4BMSA 2VYVA 2ID8A 4LZPA 3K73O 1Y9AA 4G9BA 3LPDA 4RMIA 5IJAA 1IXRC 2C9DA 4LRTB 3TCNA 5H4HA 3DD5A 4NV3A 3W1EA 4QAQA 3CYFA 1TIPA 4WY8A 2R62A 5FBWB 3ZHQA 2AKEA 1CDEA 1N6KA 3CH4B 4BFYA 1KH3A 4UOEA 3BRWA 1PJQA 2SKDA 3ETDA 1Z2DA 2VUIB 2C5FA 3UMFA 1FDOA 4QE3A 1LSOA 3HSKA 4RCYA 5A2QA 3MTQA 4BB6A 5M2QA 1PQ4A 3RH0A 1XROA 3ZU6A 4HQFA 1IIRA 2KW5A 2QQ0A 4MNTA 1M0SA 1X1QA 4IHAA 3ZJUA 2FR8C 4DIKA 2VS1A 2YY5A 2ZJ3A 6LDHA 4ZT7A 2GD2A 1EJ2A 3EY4A 2PKQO 2QV0A 3F74A 4ND7A 4YRJA 1CRZA 5JV5A 3EXEA 1S8FA 2GBCA 3FMPB 1W47A 3BG5A 3PQ7A 4GICA 4ZU1X 2PGIA 4PHCA 1QF7A 4R2MA 1CY1A 1GTL1 3IKVA 5D5PA 1MTOA 3GCGA 3TZBA 1USKA 3GLFA 2QX6A 2HIHA 4D9FA 3ZW7A 1FFCA 2H2FA 3BAZA 3GD7A 3PG5A 4UE3S 1Q44A 5L40A 1XZ8A 2QORA 3QOYA 5JLAA 5LIPA 5H68A 5KO2A 2VJNA 5CVUA 5HJEA 3AVTA 1T3GA 3HA2A 3KLBA 3ZY3A 4LZZA 2R47A 2V4UA 4RD6A 4UVHA 4DXHA 1CHDA 1W0JD 1GKUB 1XE3A 2CEKA 3Q0TA 3PNQA 1L9KA 2RH5A 4PBTA 2G7MC 4ER6A 1W0CA 2J6BA 1OIXA 4XRRA 4LYAA 3UKOA 3WAGA 2I6XA 1ZIYA 4E4YA 3NBFA 2YHBA 3TE7A 3FTFA 1LSSA 2OXRA 3I8SA 2HA2A 3GBPA 4RJ2A 3OICA 3MW8A 3EWNA 3UAYA 3CUKA 2WTXA 3EH1A 3OFND 3IIKA 3FMFA 4Q9LA 1A8SA 3L7DA 3TZHA 3EAGA 2XTNA 4M4SA 1PUIA 1TMKA 2DTEA 4R9SA 2R0QC 2Z43A 4R9UC 1ZIOA 2YHSA 4LCBA 4I0WB 2ZUVA 1KL7A 3EGVA 5B3AA 2BW0A 3F2IA 3GUYA 1KNQA 4X6LA 2J5QA 1ND6A 5J2UF 2QW1A 1QX4A 3N8DA 3OKAA 4KMRA 1DO8A 2OFPA 3W9BA 2PKEA 4M9QA 4JYMA 4ZAXA 1WD5A 1V8ZA 4O2LA 4CNQA 1O94A 1I4LD 5BSUA 3HJNA 1L4KA 3PLAE 3Q3GE 5FBRB 2NO7A 4TUYB 5KEIA 2B4QA 3OJLA 3FDXA 3D1JA 4GMFA 1LGYA 2FETA 3DDZX 3HKDB 3WRYA 1RXEA 4D3SA 5KYWB 1CCWA 3A0RB 3OHMA 5KWSA 5TARA 3OKCA 1FMLA 1XZLA 2AXPA 5EESA 3R0JA 1C0IA 1FUYB 4K8RB 4WNAB 3WMWA 3MPOA 1HURA 4BCBA 4G4SO 3PWKA 1HL7A 1KGDA 3I6QA 2L82A 4UU7A 3H7AA 3THXA 5HBGA 3RVDA 1MDFA 2XMRA 4QDTA 2H51A 1U3TA 2R84A 1ACJA 3K8ZA 4RFLA 1C3OB 4JZKA 1KI7A 3CVWA 1IXYA 5BSGA 4AIRA 3U3XA 1P7CA 1N3IA 3IURA 2P7HA 4CQJA 4FQ8A 2WPDD 4YRGA 1ZG3A 3O6VA 3RYIA 2X0RA 5EZSA 3F7OA 4WEQA 4PYMA 3ZLVA 2WFMA 4PBSA 2RHJA 3GIWA 3VA7A 3L1JA 5TE9A 4M1SA 2ZIFA 3E0QA 1UINA 2F1OA 2GX6A 2X76A 4F7WA 2W22A 4HX9A 2AG5A 4MRPA 1FUEA 1ZOOA 5CB4B 3RM3A 3EE6A 1V1MB 1NT2A 2OG2A 4LYGA 2FFHA 3HKCA 4IO1A 2DHCA 3OE1A 4Q7KA 3IMGA 2D3WA 4K9LA 3DCYA 2DOKA 1E2GA 4I9GA 1Q1BA 1MORA 4LZNA 5DEOA 4XZ3A 2A4KA 2Q99A 3H1GA 1WXGA 4Q1VA 4PYLA 5A5VA 1VXOA 4WK2B 1H5UA 1XVTA 3OQHA 1U2TA 4ZYWA 1SUCA 5I7OA 2GMWA 2WFLB 2PG3A 3CW2A 1A9PA 1T6YA 4EQ6A 1YA8A 4DG5A 5EIBD 3ROTA 2QWXA 2JJMA 1HC7A 5BW6B 2X3YA 2PH7A 3SC3A 3UHFA 3UMGA 5LKAA 2XLCA 2JW5A 3OKFA 1QQBA 3DGEC 1Q50A 4B7AA 3PV0A 3SS8A 4DV2B 4MDFA 4JOCA 1UKVY 5TDHA 5C2JB 1OF1A 2RGNC 3GEBA 1FZQA 4XLZA 4JQZA 1GZVA 5C9ZA 3KQPA 3TOZA 4QXRA 1MV5A 5EGSA 3ZDAA 1IBCA 2J0VA 4LAFA 1Z7BA 2Y0DA 2ZRMA 3IO3A 4HWOA 1ONBA 2W93A 3GJRA 5J58A 2Z5GA 3KZKA 1ZK1A 1T9CA 2FN3A 5AW6A 1B1AA 2QX9A 3KVOA 3BQ9A 3TF5A 5CDTA 5H3HA 2EKBA 3F5QA 1YNSA 2V8BA 1K0FA 2IXBA 2ZR9A 3H5TA 1OUMA 2LRHA 3L0ZA 4OO3A 3MYRA 1CS0B 2GZRA 3TI7A 2VKQA 4UNSA 1SB9A 2HJWA 2HZ7A 4HL6A 3EIQA 4NICA 5LXTF 4CTMA 1XELA 2GCOB 1N36B 3CVJA 4HWGA 1CR2A 3DAHA 1F8YA 3E9QA 3NIGB 4KVFA 3ZE0B 3QTLA 4JUBA 4R2WA 4ZO8A 5ECGC 4MCAA 2MDTA 3UBTA 3HBJA 4BC0A 2V7TA 4R1OA 3AZQA 4LDJA 4QJ4A 1D7OA 2CJYA 2HF9A 2PRIA 2A5FA 5JD5A 2QTRA 2Q3CA 1Z29A 4P3XA 4XIYA 4UCWA 5JZ9A 1MENA 1FP4A 4LBYA 4JQCA 2BMDA 1P1JA 3VMMA 1D9ZA 3X1XA 1UEXC 2C4HA 4QD3A 4R1SA 1JXAA 4UEOA 5FB3A 3EVNA 3W04A 3S8YA 3BD6A 4C6TA 4IL5A 4J75A 4K6CA 1BN6A 1NF2A 1Y8QA 2BR4A 3U31A 1J8VA 1NQOA 5C53B 2RHDA 1JJIA 4TXLA 1A8PA 3AY0A 3WC4A 4HVLA 3ZG6A 4C4AA 4R2IA 3KKPA 1ZH4A 4KSCA 3ENNA 2F2TA 1QK3A 4P4UA 1KNXA 1X94A 4U7GA 5KWIA 2JLUA 1S02A 1KVUA 4CLHA 2XUKA 1V3VA 3K09C 1U5BB 3GGDA 4URHA 4ZEVA 2DFTA 2VT6A 4RTKA 1GAXA 3IQEA 5BN5B 4B3BA 2NSDA 5C0OE 4DBVO 3NBMA 1PVDA 1QU2A 1U5BA 1R37A 4PM4A 4PSVA 1RJ9A 4JD5A 1KA9H 4HAZA 3CEPB 2DBVO 1JLMA 1O8CA 1VSUA 5ECDA 4I8IA 1IN5A 1WBDA 5EG5A 3CFYA 1TDJA 1SZJG 4M9ZA 1TYDE 3NDBB 2EBFX 4D43A 3MUOA 2I55A 1Y3BE 4GP7A 1C1XB 3KEGA 3DZCA 1JJVA 1XTRA 4GG1A 2P2DA 1KFKB 2PVCA 3B89A 4K6OA 1OROA 1N3YA 5A1JA 1DGQA 1J8QA 4BVEA 2X0NA 1DEHA 3BIXA 2MYUA 1QK4A 4GM4A 2YMLA 4K9MA 2Q8QA 2YTZA 5LUBA 2JK0A 4QBFA 4JA0A 3KR1A 2PQMA 1NVGA 3MERA 1F17A 1KI9A 2OSVA 2REQB 4TWJA 4EJ2A 4Y6OA 1YFLA 1GCOA 5WRFA 4OL9A 2VRNA 1J8YF 1PJSA 2HWKA 3KOWA 4IVRA 2G5TA 3PR2B 1NN0A 4FNOA 3LUGA 1T1EA 3ETGA 3KWFA 3CTPA 2ORVA 1N7JA 1U11A 7ADHA 1RRCA 2X58A 1ZM4A 4IJ5A 4UEWA 2I87A 2FMUA 3GUCA 4JWKA 2EAUA 3HK2A 4XKJA 2ATXA 2BKAA 2VXBA 5K0BA 5KU7A 3DXYA 2L0XA 1M2KA 1NQXA 1TTQB 1AZTA 2X5OA 1J2TA 3OJXA 3VPAA 5CDFE 4YJFB 5AKYA 1F4VA 4UZFA 4DL9A 3AHJA 4YUXA 2BEKA 5JXGA 4HEHA 4DMCA 2WY2D 1JU9A 1JDVA 2R5FA 4XA8A 3N59A 5DGHA 1RWPA 1EQAA 5L7WA 2VH5R 3KJHA 4ENUA 5DTIA 3P2EA 2HF8A 4YMTA 4BS9A 4YMGA 3OEHA 4K0RA 4OD0A 5JNLA 2H1OA 3BGSA 1FFHA 2NG1A 2P79A 3OOSA 1V2HE 5F3WB 3U4QA 4QSHA 3AGQA 4CMJA 1IZ7A 2JJ8A 1KJZA 2GCEA 4JP3A 5AWFC 3R6DA 4X1IA 4F96A 3IV6A 5L53A 1C8KA 1SRRA 2QTLA 2YC4C 5E8JA 2Q41A 3UM9A 4E2FA 1NE2A 5F1KA 2ZRKA 4S35A 3BICA 4W5TA 3DF7A 4C3UA 4U8GA 3A1UA 2UXCB 1V6CA 4Z1MA 3FBWA 3ONDA 4JXKA 4H27A 4RK0A 1ZRMA 4AD8A 3GQBB 3K0CA 2VDOB 3RS0A 3T3DA 4G37A 3D4NA 3U6KA 2P9JA 4JC4A 2Q21A 2ZS9A 2X0DA 4C7MA 1ZXXA 1W35A 3RTBA 4KE6A 2ODQA 1QFYA 2JCXA 2CL5A 3BXXA 3N0VA 4RZQA 1CX9B 3OJ0A 2I6TA 3ZVKA 1L4UA 3L6RA 5KNCA 1AS0A 2ANBA 2ZJ1A 2NADA 2F67A 4CMEA 2XD9A 5DNUA 5CXQA 2O2EA 3I8XA 5D3ZA 3N74A 1C30B 1T5IA 2NACA 4FINA 2VRCD 3DMHA 4TRNA 5BMVA 2QR5A 1RWBA 4RIEA 5AVWA 2Q1UA 1NSFA 2GILA 2D0IA 2JIOA 3LUBA 1R8JA 4Y2XA 3K9HA 2ZJ8A 1V41E 2ZUUA 1ZLXA 3HDVA 5KTSA 3JD3A 4NECA 4P5EA 3K71B 3PLRA 4QUBA 3H6GA 1I51A 2IEGA 1MKYA 4DQUA 1RFGE 1FF9A 3WLRA 3RC9A 5LXTB 2BGKA 4TS4A 2ZJ5A 3WJ2A 1NN5A 1JHAA 5E6RB 5I8ZA 3K9NA 2QROA 2Q6KA 4FXOA 4RK7A 1AVTA 1C1DB 5FBKA 5LZ2A 3OOYA 3C16C 1NE7A 5JMPA 5D84A 4ZCLA 2XQFA 5BWLA 1F4PA 5CHEA 2YHAA 3RYIB 3K09A 4NMWA 3U1BA 4L5CA 3OE7D 1RRMA 1ZGAA 4LBWA 3WGNA 1AUQA 3DLPX 2RJ3A 4LRSB 2EP8A 3C5WP 2KB0A 4H1UA 1I3LA 5DU2A 3GPIA 1T3HA 1WRBA 5FHQA 2X3UA 1U2DA 4OH1A 3UUGA 3I04M 4AS1A 2VZLA 2KQUA 4BPBA 1UDBA 4DPKA 1I7PA 2IUFA 1DRVA 1UPTA 3WXBA 1JDSA 2Q5LA 4AJLA 4IIJA 2G6BA 1B0ZA 2FQQA 1Q0QA 2A9RA 2CDRA 1XNJA 3G1TA 1J21A 3QPVA 3R1IA 4N5IX 3E70C 4XE5A 1IBSA 4RJKA 4ON9A 2RGRA 1Z0IA 3M1IA 2OCKA 5G3ZA 4CF7A 2QE6A 1Y3AA 3EQ2A 4RTPA 1EVIA 3SDZA 4D3ZA 1Z0ZA 2XA9A 2BHNA 3BD9A 3R5JA 4RZXA 2A1TS 2WWTA 5KHLB 4Y2QA 5EXXA 4COOA 3FMVA 1O4VA 1KTVA 3QGMA 3U49A 1W1UA 1U4SA 1L3BA 4KSYA 3BGOS 1WHSB 2DHEA 3ROMA 4TTVA 2AFIB 1OREA 3DVQX 3FCAA 3K0AA 4IV5A 2NX2A 2VWPA 4I1PA 3DE0X 4PX2A 1N5KA 4X3OA 3CLSC 4W6QA 1MVNA 1GU1A 3V4OA 3FWZA 3HFRA 3AKZA 3T4UA 1RAEA 2H59A 1E7YA 3NAGA 3K9LA 5KHAA 4LDQA 1L8AA 3CGGA 4H1WA 3U6BA 1JG3A 1CUYA 2K4MA 4G23A 4CMIB 2WI8A 4V0KA 2FK7A 3BXHA 2PZMA 4AECA 1PGJA 2CHQA 3OOJA 4Z9XA 4QUEA 3FPLA 1IQPA 4S1VA 2V1XA 1U8AA 4FUTA 5B4TA 4LJLA 1Y7IA 5ILQA 4E08A 3BWVA 2EW8A 3A26A 2F7SA 2HADA 4OXRA 2ISSD 3OAAA 1HTBA 2PZKA 3KAKA 1J06A 2F9MA 1X8XA 2VZ9A 2F17A 1DTSA 4QEZA 3TOCA 1P81A 2ZTMA 3PQ8A 4RLFA 2BFMA 4QOEA 4C4OA 3VDNB 1C3JA 2HCJB 5IH7A 3G8DA 4LJSA 5EKTA 1W85A 5LOVB 1T5SA 2C5LA 2HU8A 3K5PA 1PL8A 3HA7A 4Q1EA 4EELA 5EEHA 2YYYA 3VAAA 3N2KB 3M1LA 2GN0A 4ZYXA 4CMGA 4GGPA 2BUBA 1LLDA 4KDFA 1R2QA 1GRNA 1TYAE 2J45A 3K1AA 4RWEA 4F9FA 3P45A 5CXUA 4DV5B 2UXBB 5F2EA 3EIUA 4L5BA 4B9EA 4HWTA 4LNUA 2QTNA 5TMDA 2ZM6B 1ZD8A 3U3KA 4RTMA 1R64A 1V6SA 4IEIA 1N8SA 3HJHA 3K7EA 1ZU4A 3O8DA 2GJSA 4IUYA 5IH3A 1U8TA 1NBEA 2JHPA 5E9WA 1BHJA 4ZAFA 1EGMB 4X1IB 2IPOA 4FJ1A 4JLWA 3K5IA 1WBBA 4OQZA 4IDDA 1RCUA 1SQ6A 4FYYA 4OI1A 2FKNA 2Q9CA 4LRQA 4HTAA 5AI5A 1ELOA 4Z9BA 4W9MC 1HFEL 2D2IA 3DV9A 4KWEA 4MR7A 3A2KA 3VTFA 1UBNA 1FC0A 2BE9A 1D2EA 2YJ4A 1V1RA 3W1WA 1ZMOA 3AEXA 1TEZA 1P29A 1ZESA 3GRZA 1C4XA 1YZ3A 4JB0A 1L1QA 3SR4A 1ZMXA 3R6LA 1KFJB 3PXBA 4ARBA 1VHLA 5JAMA 1ULUA 4BP8A 3DDWA 5IEBA 4B8WA 3KJGA 4L3WA 4MP6A 1KMIY 1NLUA 5CDUA 3PWSA 3NHPA 3DZ8A 4DEYA 1X86B 2IH4A 3WO1A 4DQKA 1C9DB 2QTVA 4YMLA 1TJ5A 5EJ4A 4DJAA 3DEAA 4QUHA 2QJFA 1FYFA 1BXRA 1NV8A 1TMOA 4FT4A 4QPJC 4ZOBA 5ARDA 4YUVA 3WMFA 1ZNQO 5DBEX 4C2BA 3FI0A 1Q2UA 1T13A 3AYXB 4OATA 3SZUA 1WMBA 1XP5A 5CLJA 3B85A 1MAAA 1PZFA 5J4VA 3F2VA 3GJSA 2GKGA 4RD3A 4LF5B 5FQOA 1EH5A 1YVRA 4S1TA 5F98A 1BWRA 4ACAA 3GARA 1NJ2A 4Q15A 4PLCA 1KE2A 1OAOC 3G5MA 4B7CA 1MOPA 1NBAA 1WULS 1JU4A 4PRYA 2HZBA 2HWWA 3SZMA 1BX0A 1JTEA 1YCFA 4BNTA 3K0AB 4CCSA 3QKRA 4CNBA 2PUVA 3WLPA 4F7DA 5CDYA 3DT8A 3LF1A 4PZLA 4X71A 5JO9A 3CEAA 3H4MA 3OTHA 3VNRA 5JASA 3K70B 2EX0A 2GAIA 5GZ1A 5L51A 1PR6A 5K01A 4V1CA 3QA3E 3FUTA 2A0XA 4D56A 2XF2A 2HU5A 1NKTA 3DUWA 5A2GA 1C3XA 4RE5A 3IHWA 1JQAA 5FL7A 2QT0A 1M8KA 1A9QA 3EDRA 1NAIA 3C3PA 5BURA 1FX0B 1G7TA 3ZVLA 5FR1A 3PNVA 4F3CA 4A0HA 4U7PB 4ZREA 1G20B 3M3DA 4BKOA 4XPIA 5AVSA 1KETA 1RE0A 1D09A 1T8TA 1GL9B 1N92A 4J16C 3MCVA 3UA4A 4QOSA 1NDHA 1Q6ZA 2WHPB 1KDPA 4KVGA 4OFZA 4YCNA 4C04A 2IOFA 4JENA 2BP7B 4MKZA 3VC2A 5FUVA 1H05A 2GAOA 3EPPA 4YRTA 4MCJA 2AUMA 4RKFA 1YRYE 5HM6A 2X6RA 1Y42X 1UBCA 3PA6A 3VRHA 5LKRA 1LPOA 4LFBB 2VOEA 4YRQA 1XTQA 4EITA 2BFEB 5JS7A 2RE8A 4I6JA 1CJCA 2VK1A 3DULA 3IT3A 4MCHA 1G5PA 3NJRA 3PUKA 1CFJA 4XCVA 5SV2A 1Y9EA 3J7AC 5A04A 4LPSA 2VHXA 4JT4A 4XGIA 3V55A 4RTSA 1N33B 3Q0IA 2IH2A 1B6TA 2A9FA 3GRAA 3ZCTA 1UEJA 4PN7A 5IANA 3EA4A 3ES9A 4M8IA 5A9TA 3ZS9A 1UR5A 1V96A 5FOWA 3FWNA 3E2MA 3R3JA 3UCFA 1V3UA 1LX7A 1Z5WA 3PD0A 4RZUA 1ETUA 2D2FA 4G5FA 1G63A 5IJ9B 1CUJA 3R41A 1XMVA 4HGQA 4WGGA 3RKRA 3UT6A 1A95A 4PPGA 4DEVA 5DULA 3PQ4A 4NSNA 3FNHA 5EVCA 3O4FA 1L4MA 4R68A 3RHFA 3AF4A 4KIGA 4TYMA 1TM1E 2C4WA 2FE1A 5LC1A 1QLHA 1ZN8A 3C74A 4LZOA 3V1TC 2WAOA 1YQQA 3EB9A 1QQ5A 3B8EA 2Q1YA 1KAMA 4YWHA 1XT6A 1GTG1 4Q47A 4G86A 5CDHA 4RH3A 2GJAA 2ZQYA 1FB5A 4FD3A 3FUXA 1G60A 1OXTA 4WGFA 3RU9A 4U3JB 3KKLA 4AZVA 4CU2A 2IYAA 4PN3A 1FDRA 5CB8A 3ENKA 1RP7A 1Y4UA 1QHXA 3BFKA 4F6LA 1XDSA 1AQ6A 1ABFA 3EXEB 2O0JA 3N2KA 4GMDA 4KWTA 1KH2A 2WFLA 1ADJA 2DWQA 4FBLA 4X3PA 5COAA 5HCNA 4BNWA 3MMPA 5C31A 2E6UX 3PENA 3WL5A 1KU6A 1NFFA 3KLNA 4D80A 5TS3A 2A78A 4LHZA 4LZJA 3SZOA 1XCPA 1TZMA 4Z7OB 1O5OA 2WOOA 3QX7A 1PD1A 1UMCA 4MPRA 1EE2A 1AGPA 4TV9F 1B3BA 4LG1A 4B81A 2PAFA 4AJ9A 3D54D 2BM9A 2I71A 1NVAA 1SXJD 5E8RA 2HGZA 5ALMA 1PGPA 1TAHA 3IAFA 4A6XA 4OX9Y 3O2QB 1XMPA 4ZDJA 2ETXA 2EZ9A 2NYAA 3ECSA 3ZHTA 3KAPA 3OPYI 3BK7A 3HB1A 1YZYA 3ZV3A 3HO1A 4QFBA 4AY3A 2VJCA 1NNLA 1J5XA 1ESZA 1KARA 2C3MA 2VP5A 2QMYA 4QODA 2VIIA 2N3ZA 1W5SA 3UB3A 5G1NA 1V11A 3QG5A 2ZCUA 4DRZA 3I9KA 4DQXA 4UUPA 5KVSA 3A9WA 2Y0PA 1BA2A 1C3OA 2CE7A 4ILKA 4PS0A 3V2IA 4BV2A 1XL0A 5JZMA 3KYDA 1A9TA 4XI9A 1KY3A 3AUTA 5D3QA 4PYIA 4TVSA 3GBSA 5AJXA 1G38A 1A1VA 2CUNA 3ZQ4A 2C54A 4DR6B 1NKSA 2C3OA 4X3CA 3SBXA 1CUCA 3VZDA 3URKA 5AVUA 3CW9A 2ZRCA 4GOOD 1H3NA 5ESDA 1WB5A 1Z5UA 3WWDA 1RLMA 1OLOA 1UCFA 3DM9B 5CM2Z 3AM1A 3L18A 1SXPA 5D87A 1E4YA 5KYWA 4DZZA 1LPMA 3ZY6A 2XUZA 3EIFA 2AZ4A 4ZVVA 4F0JA 4NS4A 1ZQ9A 2W4MA 3SFTA 1E6CA 4CM8B 3ETLA 4FDUA 4HQ6A 3QXXA 4LIPD 1LJUA 2ZGVA 4ARIA 3FI9A 2ERCA 3TRIA 1G21B 3IMCA 4B9AA 3BRSA 5B7GA 3HCFA 3IIMA 3SZRA 1F7VA 3HDQA 4ZRDA 2J3DA 4KPUA 4I55F 2R1ZA 1ZGJA 1SU4A 1Z6YA 2ZRHA 4UTRA 3KJEA 3BWYA 4IYJA 1RM3A 3JRXA 3S1AA 3IO5A 1YB2A 4F5EA 1XPRA 5MGNA 4FFOA 1M54A 3ILSA 4WINA 3RHZA 4HNHA 2ZULA 3QKIA 2JCGA 2JI7A 2QX4A 4Q3KA 1T5HX 4DBLC 4HQOA 4RAOA 1KEEB 1S3GA 2IP4A 1OVMA 2Q50A 4Q66C 3WSVA 4F6RA 1UPFA 2V55B 2ZBPA 3AJDA 2XUDA 3A9CA 4XW2A 4G26A 5CDSA 3G5AA 2DLDA 4MAFA 1XEFA 4MRVA 4BNVA 2Q5HA 5JFOA 2UKDA 3TW6A 1P73A 3NPMA 3RBVA 1OH7A 2PX8A 5GOTA 2XX3A 3Q9LA 1A2QA 3B9RA 3H3FA 4DIEA 2PZLA 4KH0A 4UD2A 1Z12A 4LV6A 3OE4A 1LQTA 2ZE5A 4Y9UA 4B3XA 3ROEA 3ROGA 1REQA 1FTNA 2RARA 2VBCA 2ZJOA 4Q16A 4Q93A 4XDHA 1OZGA 5CH8A 5EEGA 3T3NA 1F7UA 3V80A 1N57A 5LVAA 1LB1B 3O1LA 1W8IA 4OU4A 5K09A 2FPUA 2C00A 3ESXA 4NYMR 3ZCPA 1W30A 1Y3CE 4IM7A 5A7FA 1Z8FA 3AWIA 4E7PA 4F5DA 1EFUA 3KT3A 4HNGA 3T5BA 3OFKA 5LZ9A 1RAGA 3JALA 3K72B 2DBRA 4KAXA 4ENWA 3F7TA 2ONJA 1KFBB 3CM0A 4RKRA 4CUJA 3H5AA 1NBWB 3IAM6 5DBFA 1QFXA 2VSXA 1F8XA 2XNDD 3A28A 3KOXA 2PUDA 1H8ED 4PCVA 2DQYA 5KU1A 2FR1A 4JBWA 3VM6A 5HOEA 5FX2A 3A6GA 2YN4A 4D9CA 1QBGA 1B8PA 3BMNB 4QIHA 2QPAA 3IUQA 1QIFA 3MS7A 3ZV5A 2QDKA 4JVMA 2CSXA 1QCYA 3K16A 3T38A 1RT9A 5TQ2A 4KEAA 4NZPA 1X8KA 1AO3A 3EHEA 4FBMA 3ZZTA 1E7WA 5L4NA 1VIMA 2PLFA 1VE3A 2XVAA 1M1YE 1Y7TA 4JI5B 2JA2A 3EEIA 4N5NA 4C4XA 1VFPA 2ZROA 3P9CA 2AMJA 1JDUA 1EK1A 1G5FA 2OZEA 1HT0A 2ZETA 4IG4A 1TF2A 3PU6A 2ADFA 1T2NA 1IUOA 3LC0A 1WXIA 2XWQA 1LNQA 3PGMA 4N5HX 3QNMA 4FHCA 3RVMA 1VMIA 3SHVA 4G0XA 1YNOA 4L8YA 2FDXA 3PXCX 5K9ZA 1TZBA 2AE1A 1WWKA 3OZRA 4DLLA 4EYKA 1U9IA 5H9VA 2VJMA 3VAZA 2X4LA 4UD6A 4NEGA 3SMQA 4E4RA 4UQOA 2XVZA 1ONPA 1NVKA 3DEYX 3LZ6A 3WHPA 4CM9A 5JISA 2VQEB 1KP3A 1Z2NX 1T6ZA 3LPNA 3SVZA 4DUPA 3RUIA 3JTEA 3ZGVA 1WS6A 4K0KB 2FW0A 4AWBA 4FHGA 4WKNA 1XZJA 2HF2A 4RTNA 3OZFA 2OKCA 4F4DA 1AY0A 2JBAA 3RUCA 3WLMA 2IF0A 1DFIA 4D92A 4ALNA 1JT9A 3I52A 4G2NA 2Y4OA 4KQWA 3TNLA 3G2JA 1HDXA 3U40A 1EDOA 2GF2A 4WV3A 4D79A 4G1FA 2BISA 3H1TA 1JEQA 2Y6UA 4P0QB 4MA5A 4GM1A 4GHWA 3V7WA 5KVVA 2I3GA 1WDLA 1KC3A 5DTJA 4R1PA 3RRXA 1P3DA 3I1JA 4BNFA 2A35A 2WIJA 3IQXA 3Q85A 2WJYA 3UUEA 3GGGA 2ZCVA 3GXBA 1R0LA 1CJKC 4BN4A 5CITA 5C32A 4NFSA 2HTFA 2BTEA 1F60A 2RHBA 2B1RA 3H5LA 4RHTA 1CEXA 3KB1A 2Q3LA 3DT9A 3K70C 3O4IA 1OV4A 2AJCA 1VYHA 4LW8A 3VAYA 4O4LA 3CEMA 2EFCB 3EZNA 4G4IA 3HL4A 3V2GA 2UUBB 5JI2E 4JUCA 1ZNZA 3MRXA 4MWCA 1E8DA 3VZSA 2H3EA 3LC1O 1U5CA 3G02A 5DI3A 4MWZA 4QTZA 3C8MA 3ULKA 3GR6A 1ZR4A 2PUAA 3DBOB 1FTGA 3O3MB 1YE3A 5TT0A 3VU3A 3WYDA 3U56A 3INRA 1YR7A 1EFRD 1LU9A 2VQSA 4KXXA 1R3DA 1FP4B 2AK2A 2BEWB 2KPOA 3DJYA 3P9RA 2F8SA 1O58A 1LRJA 3NUQA 5IBQA 5KS2A 4UU8A 2OM2A 2OVBA 3IHLA 4EUHA 1E6EA 3HVKA 1M1UA 1EI9A 1SKYE 3BFVA 2J0EA 1J2YA 1FPMA 1QTIA 1SMKA 4NIMA 5TF4A 2B2XA 4P80A 3GFGA 1PZHA 1WY5A 1VHWA 1WUTA 3I9MA 2O07A 4UXIA 1E3LA 1VI2A 3FJ1A 3OZAA 1XN4A 2JD0A 2XYPA 2X41A 3D3WA 1OR8A 5BO5A 1A5AB 1WJGA 1LDMA 2H07A 3OLZA 2E3JA 2FRDC 1X9GA 2VHEA 4JIGA 2GGSA 4ZHQA 4BLUA 2V58A 3TR5A 2OB2A 3AI3A 2RK6A 3BMOB 5KYGA 1PLKA 4I1YA 2BRUA 1TTHA 2ZPAA 4PLVA 1ARZA 5DISB 3UT5A 2O8FA 2QG9A 1GSIA 1QLWA 3Q2IA 3V4FA 1VI5A 4Y8VA 2KJQA 3RC8A 2QTGA 4Q19A 2P9FA 3WJ1A 4W5RA 4DB4A 1HDCA 2F64A 3W2EA 1Q83A 2ONYA 2GKSA 1FQJA 3NM6B 2JA1A 3HEAA 3RIMA 3W5BA 1PQPA 4ZEOA 4X6YA 3WP1B 1PZNA 2FSFA 3UWMA 4CEJB 1HSOA 4JP1A 2Q29A 4ADSG 1QCDA 1IHPA 2ROQA 1P8JA 3BIOA 3N2IA 4LJ7A 3QLVC 1NZFA 1KS9A 3MJHA 3R0XA 3LQKA 1Z2AA 3H18A 4KIWA 3L0CA 5GV7A 4RJLA 4EB3A 4BWFB 4FGZA 4K1XA 4J3NA 4EQ6B 4GBED 2IYNA 5GJCA 2P40A 2P4HX 2Z83A 3T9CA 1KRWA 3IILA 2YDYA 5BYJA 5GGXA 4OGWA 1TQ6A 4MUYA 4QQKA 2PCJA 2JJ2A 3R23A 5DK4A 3B7PA 4OQMA 3MJEA 5E2AA 1NBMD 4J0CA 4WUVA 4BQFA 1ZD9A 2OL4A 4M0DA 3B6EA 1E3DA 3V2UA 4QDJA 1MQAA 1R50A 4DCCA 4EW2A 2YXLA 3KQSA 4A8HA 1DAHA 4P4NA 1T3ZA 5LNK6 1CRQA 5EUQB 2JHGA 3WRXA 5C8YF 4I50A 2AQHA 3F8TA 1N1EA 2WDZA 2WM2A 1W1WA 5EY5B 1DZIA 3LOPA 5DGXA 2JF0A 3ZBTA 1E2IA 1MOZA 2B2CA 1NW4A 1M8PA 2DULA 3HJTA 5CPFA 5J5VA 3K8YA 1XZAA 3CGWA 2XGGA 3CZ9A 1LTKA 3IUSA 1DE0A 4GZ6A 2Q5OA 3EJ6A 1E1QD 3DC7A 3MPUA 3ILHA 3V6MA 4D02A 3AB3A 4M76B 4R3NA 4UUNA 1R8QA 5L3ZA 3GP8A 1A7JA 1UC4B 5ESRA 1EJ6A 5C8VA 5CA0B 1M0TA 1V16A 3KQMA 3MS2A 2NU9B 3AUUA 5DASA 4HX2A 2FZ5A 1VLQA 2VP6A 1L8XA 1WCXA 2ZVJA 1T6XA 2C5AA 5FP0A 1C7RA 1UXOA 4J6FA 5CM9C 2GI4A 2PVSA 2XAUA 1YGPA 3B20A 3CLSD 4P22A 3R9XB 4HX5A 1IQ0A 1PE0A 2FEOA 2AIRA 3KQYA 2FG7C 2W2OA 2ZRJA 4WY5A 1XL1A 3PDIA 4BFXA 4ER5A 4L74A 2EATA 4TRJA 4PFSA 1VZ3A 5IARA 1PR1A 5LIRA 4ARCA 3GVIA 1JR3D 1C9JA 1R4AA 4JLSA 1WP9A 3IBGA 3VNVA 1P4AA 3MCTA 3TZCA 4WVLA 5CYGA 4N41A 3O9ZA 5KYXB 2OYSA 4M7WA 2J6IA 1LS6A 3EF0A 3G7SA 4M1ZA 5I4CA 2ZJ6A 2RONA 4KMOA 1ZD3A 2BUCA 4Y7CA 3UWOA 1Y6QA 3ESDA 3K0BA 2R751 3U13A 5KYXA 4WAUA 2XXAB 4N48A 4L0MA 2NV2B 4D8WA 2IWHA 2NN3C 1SVNA 2I54A 2EFYA 3QVSA 4EX6A 2CMDA 5GJWC 3NQ41 2ZT6A 3QWAA 1GQSA 4RVCA 5EERA 1AJEA 3ZJYA 1ULZA 5BSMA 1P7WA 1YBAA 1TJPB 2CLOB 4X24A 2NTVA 2ZIXB 3MWJA 3H0EA 4P2BA 1WL8A 2ZSAA 4BQOA 4IIXA 1T1RA 3FMIA 3LUFA 1U9YA 1G6OA 4K2AA 1YHYA 2O2IA 1IY8A 1GIAA 1SKAA 3DFMA 5TPZA 1YSCA 4ZI7F 1MJGA 3AU9A 3LQ4A 3TKAA 3QOXA 1EUDB 3AR7A 5DE3A 5ALLA 4BXOB 2QHXA 3FETA 2AG8A 1LRKA 4US1R 1UJ2A 2UZ3A 2H9IA 1ORWA 4KJZA 3GLGE 3EIEA 3GO4A 2QJRA 1A76A 3ME5A 1NASA 4FC6A 4ZI7A 4O4HA 1X2BA 3UVEA 3KHUA 4GEKA 4AUKA 5DHAA 4B75A 5H9WA 1DBSA 1HFKA 1YIOA 2NZYA 5JSKA 1IB0A 1OBVA 2HCRA 2VJQA 3SICE 3W5HA 3A9TA 5C81A 3ON5A 5DN9A 3ZU4A 1BS2A 1NT4A 2C4MA 4Y6SA 3D0QA 2HRQA 1K5PA 2JIMA 3TUJC 4EJSB 3H2YA 4L02A 4PQGA 4WLFA 4ERNA 1NVVQ 1AQYA 2DH6A 2PS3A 3EFOB 1UXJA 4IAOA 2TS1A 3RFUA 3X1MA 1UMBB 1NN1A 3I45A 3O47A 4YGYA 4HDSA 4LQDA 2Q3EA 3RVPA 2A9VA 1XZIA 4A6PA 3F5FA 1KI1A 3O91A 1Z8NA 1EG7A 3GH3A 2AA3A 3JQFC 4JC5A 1XNGA 4GWKA 3U4GA 3ZWBA 3CB2A 2QAGA 3LT1A 3AH8A 3MF4A 4JB8A 2VPYA 3R76A 2FP4B 3CTMA 2CL0X 1B6GA 2AFIE 5BN1A 2IX9A 4LXXA 3NCHA 3IQIX 2HJHA 1CD5A 2O06A 1XWIA 2D7CA 5CYPA 5K45A 4E51A 1HT2E 5IF9A 4IFBA 4RVSA 1I4WA 1U0HC 1UP7A 2NU6B 4X90A 4YROA 5C7OO 3BREA 1E2KA 3ELUA 1AOXA 5A5DA 2ZLBA 4K40A 4LVNA 3SS7X 4AP9A 4ITUA 5LZ4A 5K6RA 4L27A 3JWJA 4UBMA 3GF4A 2Z1MA 2HR1A 5IP5A 1FVOA 2QMZA 4M55A 4KE8A 2GN9A 2PZJA 3AF2A 4NQZA 4LXIA 4D4IA 1GPDG 3BKWA 4IWNA 3W8RA 3U2QA 1GDTA 1EFAA 3JZAA 1NP3A 1ZJ6A 1V25A 2I7DA 4TVBA 5A3SA 3ZZUA 1CEQA 4GXQA 2Q27A 4MDEA 3I4LA 3REQA 4ZCIA 1EP2B 2HSWA 2OHFA 4Q1AA 3L07A 5JSYA 4RM3A 2ORIA 2RI1A 3MD9A 1SUAA 5K0TA 3GJ6A 1QH0A 1O89A 5F73A 3KZMA 3GNQA 3TEFA 1A5BB 6YASA 1Q77A 1FUUA 5LZ8A 4BNLA 3DVAB 4PO8A 3GRKA 2MSNA 5JCPA 1RI4A 4HUTA 1XKQA 2QYSA 2YXDA 2JFNA 4FGLA 3MG9A 4WFKA 5EUMA 1BMFA 3ZWDA 5AVXA 2EJCA 9ABPA 3FYTA 1KH1A 1JYEA 2WU8A 3KP1A 4N5MA 2IOHA 2JCVA 2VF5X 3Q5DA 3HGTA 3D4LA 5BPHA 1JEDA 4ZT3A 1SUEA 2A4MA 3SWWA 1SOMA 1NUUA 2VZ0A 2Z09A 2PR7A 2Q7OE 1H4QA 1UJ4A 2IP2A 1QIEA 3BF8A 3RHTA 3DW1X 4BWYA 4AM8A 2Y66A 4KP7A 4Z86A 5HBRA 3TQOA 3UJNA 2XUHA 1U0BB 1OILA 5IVDA 1N0HA 1N2CB 2IIQA 2E1RA 2TECE 4EO7A 1ZP6A 1B6SA 1H4TA 3K6KA 1GPLA 3MCUA 1K3TA 1QHSA 5BSTA 3DEKA 3EMBA 1VQ1A 4D3FA 5BY2A 4Z4EA 2X5KO 5C1PA 4XIGS 1Z6GA 3EISA 3ZDZB 2EVWX 1X15A 3ONWA 3UA3A 4RANA 1L5WA 4Y1RA 2YIVX 4XD7A 5AUQA 3PEWA 4ZIRA 1J49A 3LBFA 4WZBE 5LWQA 3IDOA 1MW9X 1PR5A