4LZOA

Crystal structure of human prs1 a87t mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
304
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTTVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ribose-phosphate pyrophosphokinase 1
total genus 90
structure length 304
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lzoA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lzoA02
3ACCA 2H06A 1JLRA 2FXVA 2GEBA 3MJDA 1DKRA 1W30A 1XTTA 2DY0A 1P4AA 5K51A 3OZGA 2E55A 3DEZA 1O57A 3H83A 3G6WA 1DKUA 5E38A 5JSQA 4X44A 5ESWA 1G2PA 3OZFA 1L1RA 1XZNA 5HKLA 1GPH1 4P80A 1BD4A 4X45A 2JI4A 2JKYA 1TC1A 1BZYA 1OROA 1VCHA 3O7MA 4P83A 4RAOA 4RQBA 2VFAA 1ECJA 5BQPA 5IAOA 4RAQA 1VSTA 5KAPA 4PFQA 4ZFNA 1FSGA 4RABA 2H07A 1OREA 2JBHA 1DQPA 4P81A 1QK3A 3OHPA 1AO0A 1PZMA 1V9SA 1YFZA 1VDMA 1D6NA 4QYIA 4WMLA 1XTVA 4P86A 4M0UA 1J7JA 4RHUA 1BD3A 1G9SA 1DBRA 1XZ8A 3MBIA 4P84A 4P82A 4PAWA 1STOA 3S5JA 2PRYA 1HGXA 4Z1OA 5HIAA 1ECCA 4P3KA 4RHXA 1QK4A 4MB6A 5EUCA 4QRIA 1TC2A 2P1ZA 1QCCA 1UFRA 1ZN7A 1I13A 1P17A 2JKZA 1IBSA 3EFHA 1UPUA 1I0IA 1NULA 1ZN8A 4RHTA 4WN3A 4RACA 1CJBA 2PS1A 4RANA 4RV4A 1A4XA 3NAGA 4S2UA 1A95A 1QCDA 1UPFA 3LRTA 4LZAA 4IJQA 4RQAA 1L1QA 4LZOA 1R3UA 1A96A 1A98A 1I0LA 2EHJA 3DAHA 1Z7GA 1ZN9A 5IPFA 1ECFA 1ECBA 1QK5A 3ACDA 5BRNA 5BQOA 1I14A 3ACBA 3KB8A 4M0PA 2XBUA 3GEPA 3QW4B 1MZVA 1HMPA 5KAMA 1U9YA 3HVUA 5ESXA 1OPRA 3M3HA 4TWBA 1QB8A 1P19A 1GRVA 2C4KA 4OHCA 2AEEA 4FYMA 4JITA 4KN6A 4LZNA 5JV5A 1U9ZA 4RHYA 4JLSA 1I5EA 2IGBA 2YZKA 4LYYA 1Y0BA 1JLSA 4LYGA 1WD5A 3LPNA 1O5OA 4F8EA 2WNSA 1ECGA 1NONA 3GGJA 1DQNA 3GGCA 1QB7A 1A3CA 2PRZA 1XTUA 3N2LA 1A97A 2H08A 1G9TA 4M0KA 4RADA 5BSKA 1P18A 1G2QA 2HCRA 4QYIB 3DMPA 1LH0A
chains in the Genus database with same CATH superfamily
3SHFA 4I50B 3ZQUA 2CWWA 4BQRA 4TL8A 1XRSB 1EXWA 4MVJP 1NLFA 3ZZ0A 5K3OA 3VRHA 5CXUA 4WHMA 5CBPA 2E55A 3JQ8A 5CPBA 4AKIA 1HUQA 1DIBA 3PNSA 3SFTA 2XB2A 1PV2A 4QBTA 1HH4A 3IDFA 5CUQA 3RROA 4WN9B 4AKSA 4LI3X 4OVKA 3G2LA 2XNHA 4JT9A 3C3XA 4IDAA 1M8GA 4JXKA 4M1YA 3HEMA 3EIXA 4NEHB 4BGVA 3U6KA 4EZIA 4KXXA 4U7GA 3QWAA 1MH9A 2WFLA 5H81A 2FMHA 4IDHA 1RJ9B 4FJ1A 3BK1A 4WSOA 4JLVA 2CCKA 1B0UA 1V71A 2DTDA 3TZHA 5HRCA 2GVNA 4EHFA 3Q3VA 4LVUA 3UMRA 3PQEA 3V8VA 4EAQA 1II0A 3ABQB 5ES3A 2FPLA 2PRIA 4L22A 4OU4A 1IHYA 3LLUA 4WKCA 5CURA 4D9BA 3R3VA 1ESDA 4HB3A 3OZIA 2PE5A 4V2IA 1J9ZA 3WLIA 2EQ5A 4C7MA 4OQMA 5TV2A 1FFDA 1PLKA 5KCZA 1T8UA 2VYNA 3ELUA 4RVDA 3W5HA 1AU9A 1THGA 3HZZA 1TDJA 4OPMA 4ENQA 4H08A 4BNVA 2RG1A 2ZE8A 3SKVA 2P27A 1Z83A 5DP1A 4CIDA 3EZNA 5F1KA 4FFBB 4IWXA 3I4CA 1NLMA 1KR2A 1Y98A 4G01B 1BDIA 3HCEA 1WZCA 4PFJA 2B4TO 3SYMA 1I2CA 2VPTA 4R0MA 2P9YA 1LJ8A 1AD2A 3NHPA 4Z4QA 1WBDA 1TD1A 1N1DA 2LIPA 3N2GA 4CFYA 3ZLJA 4JLOA 4OA8A 4EFDA 4IFBA 4QPCA 2GS9A 1NYTA 4DNQA 2B4AA 5HDQA 1K92A 3ZV7A 1AX9A 3CINA 1FDOA 3A25A 1KARA 2QL7A 5H3CA 2JDIA 2OZVA 3H11A 3BD6A 4QDZA 3OCCA 2QY6A 1V4VA 1EWRA 4C0AC 1K4MA 1M75A 4MVJI 2IPMA 3EZ9A 4RQAA 4UZFA 1IY1A 1KS9A 1Y8AA 1YVEI 1YQTA 2R7LA 3AV0B 3QX7A 4G84A 4P53A 1II9A 4KLRA 1UXHA 5U1PA 1MG0A 1Z7GA 3HY4A 2IIPA 1OT3A 4DWOA 3CCFA 2F55A 3GF4A 4MQEB 2GZAA 1DRUA 1I14A 3LVFO 5ALZA 2AKAB 3OMLA 3TLXA 5KAMA 3NU1A 3LIIA 3X1YA 3O4RA 1NVVR 1IWPB 3EMBA 1U9YA 2I1VB 4GZ3A 3ZJYA 1PW5A 3EDYA 3EBPA 5DNCA 4DXDA 4L5JA 4B8YA 4D45A 3FJYA 2V6JA 3FKSD 3QPDA 4XWWA 1U28A 1T1RA 1IQRA 1VLQA 1KGDA 1BN7A 1I6KA 2DPXA 2ZBGA 3NVMB 4R16A 5AI5A 3OOJA 2XUDA 1XMIA 4J0DA 4V0NA 1Q83A 2PBFA 3LTEA 4ND8B 1ZL0A 2CXXA 3E70C 4GDMA 3I01A 2KHZA 2E7ZA 3N2KA 5DSTA 4QA9A 3AF5A 3SIWA 3ZG6A 2OORC 2PZAA 3TL6A 3UMFA 4Z3KA 4ZI7A 4BJ5A 1PK9A 3H1BA 3NBUA 3R0JA 1KYQA 4KQHA 1I51A 2IOHA 2FPWA 1XD2A 1XMPA 3CJTA 3VM6A 2XRYA 4AI6A 3PUHA 4LJKA 4EPTA 2G9ZA 3R3XA 1SRQA 2QZZA 3F4KA 1W2GA 1G9XA 1XZPA 4XTCS 1A5AB 4JX8A 1PT5A 1ZOLA 4DEVA 1PR2A 1ZSYA 2M6KA 3I9OA 3O4IA 3OPYA 4RLFA 5JS6A 1T3ZA 2CZCA 4IXWA 5LZ8A 2C9MA 4BBPA 4EHAA 3W2TA 4GAEA 4ZQCB 1P9LA 3UMGA 1C1DA 2WDPA 4KX5A 4Y6GB 4IV5A 2ZIAA 1ZNQO 3HRHA 4WY8A 3Q8LA 5DRTA 1E6CA 3LUGA 3LD9A 2F9FA 3FRJA 4TQUS 3KQHA 3AEZA 1XZGA 3RS3A 1L5MA 2GPWA 4R2IA 3W78A 1M6WA 1TZMA 2Q5HA 4KQWA 3RC2A 2BE7A 5FWAA 1XKLA 4LRSB 3UB3A 3AHFA 4EFMA 2C9CA 5LKAA 2FPUA 3IEXA 3O7MA 2GK3A 3AXTA 4L0QA 3AUAA 3MAGA 1AQ6A 2IK8A 4ZZ0A 1FMTA 4GWLA 1ILEA 3R3JA 1NAIA 4FTWA 4YJFB 1WB5A 3RYCA 1IEWA 4AJNA 5A5FA 4GHWA 5DI3A 4BO3A 1GL9B 1K8ZB 1HTTA 2A5DA 2F6RA 3C4QA 4BB9A 5L3SA 2JCGA 1P9OA 4G67A 1HEIA 1ZLXA 3KT6A 1D7OA 2CKDA 1D6NA 2H2GA 4U6NA 1T1IA 1O6CA 3U6BA 2ZETA 3I6MA 4TSFA 3R8FA 3D02A 3WOVA 2ZJ0A 1ID8A 3OX1A 2Q3MA 2CBXA 3TG8A 2EL9A 2VDLB 1GDHA 4ZEMA 4Q19A 4NU8X 3RJ5A 3BD9A 3BFJA 1SKMA 4HFJA 1MA3A 3HKDA 1KDTA 3B12A 3GZNA 1N9ZA 1PRYA 2B92A 2QEQA 5CLQA 1U1DA 1UBSB 4MRMB 3OAAA 3TKYA 3LECA 1F4VA 1FRZA 2A0XA 3E9YA 1FNNA 5L4NA 2DETA 3RG2A 4LYAA 4BU0A 4E11A 3GDWA 3I9V6 1QFXA 4X64B 2X0IA 3T5MA 3V8MA 1TVEA 1WHSA 4O5AA 2I4LA 2ZBVA 3ZWQA 4P5EA 4OM7A 1RXVA 1N4DA 1BXKA 3LBNA 4UUAA 2GTPA 2WEKA 2VJYA 4OIMA 4ED9A 4BQFA 2GETA 4F8JA 3N2EA 2GM4A 3HWRA 2CJPA 2RH4A 5BPFA 2AN3A 2O9JA 4O4IB 4YRZA 1FUYB 1OSNA 1FB5A 1QE3A 2DSTA 4FEEA 2AFHA 3GELA 4BX2A 2VHCA 4B44A 1NOJA 4XQCA 2G9VA 2QMHA 3AY0A 4EK9A 4AKTA 3ERCA 4PGFA 2H6EA 4IOKA 1O97C 5IZCA 4AXXA 3W4JA 1VJCA 3IUMA 1I3OA 3AHHA 4P4GA 4QYSA 1NDQA 2WKWA 4BCDA 5F1PA 1TTQB 1WV0A 2HV8A 4P32A 5HYVA 2NMVA 4B83A 4EO9A 1G8SA 1CZHA 1GADO 3H6HA 4FS3A 3TW8B 4CJXA 3HVRA 5AJZA 3I83A 4JMLA 4QOSA 1PX2A 2JFUA 3KUUA 4MHOA 3JZAA 4ZDWA 3RYHA 5EPEA 4JJGA 1MIOA 1PJAA 3DULA 5H02A 4IDNA 5AVUA 1F0KA 1BQEA 2J3MA 3N7AA 3GCXA 4B4VA 1WEHA 1Y3CE 1O0BA 4E12A 2ZTSA 1XVAA 1GPYA 1GNVA 3R9WA 5BQ5A 5JY6A 4Y9RA 5JQWA 3GLFB 3SMVA 1TVKB 3JD0A 4N0DA 4PAOA 1EVEA 3DYIA 4OJNA 4P4SB 2AG1A 1JALA 1CY6A 1L4BA 2I3DA 3UHJA 3FZEA 3IVXA 2XZOA 1N8KA 2C00A 2WUDA 1ULSA 5D00A 5LB4A 4HAIA 2G80A 1G5FA 5DGDA 3SS8A 4HVTA 4MQFA 4NJMB 2NU8B 3WLLA 2J4DA 2O0KA 2QQFA 1IY0A 3DT6A 1JLRA 4RF3A 3RYTC 4P98A 3UV6A 2ZWPA 1S2IA 4HRVA 4MKGA 5F2EA 3FGNA 3F5QA 5J2TA 3FDXA 4LCEA 1UK6A 1NF3A 5L3RA 4B6JA 3U5ZB 1C14A 1A9QA 3CLUC 1QRUA 1S8FA 2LBPA 1R9GA 1SOUA 2N3ZA 3FWKA 4RK4A 5FJIA 1KQGA 3WWOA 5DHRA 4B3BA 5A3SA 1MC8A 2AOTA 3MLEA 2Y0EA 1H8HA 3UJDA 4AL4A 4X1KB 1CUZA 2F8LA 1H69A 4BE9A 3MJEA 3EY9A 4YMTA 1U3CA 4B34A 2X19A 5G02A 4PFQA 3WL4A 1PT7A 3OIDA 4KMRA 4RK6A 1E6KA 1U2SA 2QM8A 4Z7OB 4US2R 3IURA 4D79A 4FZVA 5FI5A 1OGYA 4CBVA 1NMYA 1ZJWA 3U40A 3SAJA 2PMBA 4K9RA 4YR9A 2CNDA 4KLZA 4NZ9A 2PNFA 3ADPA 3KKNA 2ZQYA 5KC9A 5EC8A 3UM9A 5I4BA 3IJEB 3LVQE 3DL0A 3UMCA 4XUCA 2BFEA 2R1TB 3UK1A 1P72A 1ZICA 4FW8A 4LTMA 4DNFA 1KH3A 2HWXA 4RD1A 2DB3A 3MBIA 4IGAA 1PR9A 2EU8A 4QGHA 5JS2A 2QJFA 1PL8A 1WUYA 3SYRA 5BWBA 5HIAA 1L7AA 4KIGA 1GA4A 3P9CA 4V03A 3UMMA 3EUFA 4CMEA 4UBKA 4QOHA 1UQTA 4QPDA 5FNVA 5AHWA 1RZVA 4O4HA 2IH4A 3HI4A 2M9MA 1RP7A 4PONA 4MI9A 5JNSA 3T7KA 1COWA 3KQYA 4MRVA 1GP2A 1W8DA 4B87A 4PLYA 2JIDA 1FTSA 3HY6A 3IKMB 3EASA 2DBYA 2VAMA 1AMNA 2CL6X 5KOIA 4LG1A 1NXXA 2C7OA 5HF8A 1G98A 2ZLBA 1YR9A 5IAKA 1BW9A 2A35A 2AI1A 3KLPX 4L3OA 1RJEA 4NENB 3TXXA 4R41A 1JR2A 4D8YA 1L8LA 4NH0A 1U04A 1A5TA 1JDTA 4G5YA 1C3OB 3IQEA 3RSFA 3VU9A 1WW3A 4N7RA 3WWYA 3CE9A 5JIBA 4NZPA 1MGOA 3UJPA 3HXMA 3OPQA 4XASA 4ZVPA 1O95C 4GM4A 4J3FA 4KAAA 4M9SA 2QKYA 2ZSUA 3K6KA 3QFTA 3ZJ4A 1W4RA 4MVCA 4FFWA 2ECQA 3ONFA 5AK3A 3UB2A 4FI3C 1B4DA 1DO0A 2UYGA 1RAEA 3C97A 2F1RA 3K1JA 5IT5A 5JVDA 4JLPA 1FUIA 1O8CA 1WKBA 2H54A 3K0AA 5T7BA 1O4WA 3ZHZA 2MSCB 3I1IA 3T7RA 1DBQA 3WIDA 1PKXA 2QORA 4TVOA 3UGJA 2OBLA 2MHCA 5T8KC 1SHUX 1JHQA 2K4MA 4R9NA 3I2KA 1RQGA 2XT0A 4PS0A 4X6UA 5IAJA 5AKKA 3K71B 5T4FA 4QGFA 1KPIA 1A3CA 4KR0A 2KB0A 3TCXB 2MSLA 5JXIA 2CMFA 4PSCA 4PEVA 1J4AA 4G81A 3UWMA 4BJ3A 1YU6A 3DZBA 1JU9A 1EJ2A 4PC3A 1INLA 2IU3A 4TRMA 4EGAA 4F2PA 2HLPA 3STYA 1JHOA 3PEFA 3SX0A 3W7BA 4EX6A 4L8LA 4WADA 2HBRA 3MJDA 4G5OA 4XLLA 1SJ9A 4H18A 4E1VA 2D1TA 2FSIA 2ZRCA 3A10A 3U16A 2J4CA 2YCBA 5CLGA 4N7BA 3Q8WA 5KVSA 4BHTA 2F3TA 3BEDA 3DBHB 1WWKA 3O75A 5EIOA 5T6MA 4LWZA 1MNAA 3LDGA 2NO4A 2WZCA 4C4TA 1XZNA 1MCZA 2QVXX 2PQ6A 3QUQA 5G0TA 4HYQA 3WYFA 2PFKA 2IPNA 5HOQA 2BGNA 1CR4A 4G8CA 1CY1A 2ZRNA 4PWYA 5ELLA 2IUSA 1TECE 4Q9NA 4RF5A 2MDTA 5C35A 5E4TA 3LQ4A 4C0XA 2QR5A 5CLJA 1FVXA 1HE1C 5IN5A 4DSUA 4EUKA 1VHWA 1I2ZA 1T4GA 5A03A 3GJ5A 1UC4B 2EHDA 4I4IA 4IQFA 1PEAA 3FBTA 3WLTA 1RXWA 1L5ZA 3CZRA 5AIBA 3RKUA 1U0FA 4D3YA 3NEPX 2HWYA 3SLKA 4CU2A 5IULC 1MT0A 2YWHA 3G8AA 4YDQA 1JYSA 2P2CA 1MB9A 3SM9A 4GLLA 4AZWA 4B2PA 5T3UA 2ODQA 2V58A 2X8BA 3KOYA 5CIYA 4I66A 2GCGA 4IM7A 4M89A 3LYAA 3QXHA 1GZ6A 3OKPA 4H4CA 2JGDA 3WB2A 3CNOA 3K16A 1ULUA 2Q3BA 3NASA 1OX4A 4LCJA 2RJNA 4QU9A 5ALQA 5ALDA 4EW2A 3B5IA 4HEHA 3TTXA 2H4HA 2YV4A 5HCUA 3IVAA 1P17A 3ADBA 3GO4A 1VCIA 2R87A 3GAMA 5EXXA 5HDBB 3FZYA 1F12A 4EITA 1D03A 3I0MA 3AYXB 2WHPA 3PNLA 4WINA 5BQFA 3ORHA 4HJRA 3TLCA 2R6JA 4FZ3A 3NAZA 4CIVA 4WOBA 2BMFA 2UUAB 2IYTA 1L8XA 2OBNA 1Y3IA 1R0KA 3NZEA 5BYJA 4Q7EA 2XNDA 1UFOA 2WWXA 5F12A 4BO9A 2CW5A 1GNTA 2F00A 4RE5A 3TIXB 4CL3A 1X1EA 4RH3A 5AKHA 2HUNA 3CF4G 3OCVA 1MZVA 5JXGA 2AHRA 1GGMA 3THWA 1P0MA 3H9BA 1KIAA 3W2HA 1HLGA 2PMWB 1LX6A 2G8NA 2GOYA 2D5BA 1GFIA 1MXHA 2OYRA 4QUBA 3WLAA 3RRZA 4J9VA 4NESA 3AB8A 3KUDA 1P1BA 1RLJA 1VL2A 2XMSA 3IT2A 3KJQA 5J4YA 5JAPA 3V3TA 4R31A 1NATA 3EGXA 3I72A 3ZN2A 221PA 3I6QA 5BYKA 3BB3A 2ZI7A 4PZAA 1D4ZA 4PQFA 4BX8A 4BUZA 1GGEA 4X61A 1O8BA 2RGEA 2OBMA 1JILA 2UVPA 3ANTA 3QWIA 5B36A 2WNSA 4BNHA 2XQFA 3N87A 3UCXA 4FDAA 1E62A 4CM4A 5KJFA 1EB8A 3PNVA 2VQFB 5FQOA 5TC4A 5TQJA 1RHRA 3TLBA 3OBBA 4DNPA 1XZKA 1MTZA 1OILA 1UMDA 2V9CA 3DE2X 4R83A 1TM3E 2YJTD 1T25A 1Z8DA 2NZVG 4D42A 5BWCA 3S6JA 2EP8A 1GARA 1O9HA 4NRDA 5IT0A 2CJWA 3WLKX 3DBOB 1OF1A 4TWAA 3OBIA 4LGVA 4QXQA 1USVA 5I9IA 3AESA 3EQ8A 3M5PA 1Q84A 5DEIA 4L8VA 4ZAWA 2AXEA 3T3HA 1TMYA 2E4UA 2G71A 3JVUA 3NHMA 4E94A 1UINA 1S2DA 2L2QA 4KQJA 4WXHA 2FMKA 1Z4JA 2FRVA 2GBFA 3G2OA 1JGTA 3TS1A 1ZQ9A 1JIIA 3GMSA 4W1SA 3PI7A 2UV8A 1XZFA 4ZZ3A 2Z8XA 4MMYB 3CIOA 4WD3A 5KYWB 3T1YB 3RVOA 1HT3A 1AK9A 1R6AA 2A5LA 2IHJA 2V03A 4HXYA 2RHMA 5TQ2B 4ENWA 1FXWA 3GQBA 2XOKA 2XE7A 3SKXA 5KHLB 3M5CA 1D04A 4KQGA 3M6AA 5BRJA 3ZU2A 2ZT6A 2ZAYA 2ODWA 1NN5A 3I76A 3NH9A 4GMDA 4R2MA 5F1OA 4EHKA 2XVXA 4QTTB 4DLWA 2ZBPA 3WL7A 1MDBA 1Z47A 1I3CA 1PLJA 2PXXA 1YRQA 4CEJB 1JFRA 5GM1A 1T9CA 4R71A 1T1EA 3IQZA 2FVYA 7REQB 1DC7A 4H3VA 3GHHA 3Q10A 5ENVA 3O92A 2IX3A 4KJZA 1L5YA 4D9KA 1V7ZA 1XZ8A 3QPVA 1P7ZA 4QX6A 2DKNA 3NDIA 3S5JA 2IUFA 4IIVA 4K9LA 3FPHA 2CLMB 1UXGA 2X6QA 4R8VA 3ZKWA 2G09A 3OIGA 3WYBA 3BFPA 1EVIA 2EARA 2QTNA 4HWKA 1CJCA 1E1CB 2IHNA 1HBJA 4ZKDA 1XLWA 1YKSA 4DVJA 3NPAA 4GR9A 4X3CA 2OHHA 3DQQA 2YOHA 4IIHA 3ILVA 2WM2A 2QRVB 1EWQA 5K3AA 4QEDA 2FUEA 1LW6E 2GRJA 5LA6B 3D7NA 2AH5A 4MUIA 2VH2A 2QSYA 4EUFA 2GAFA 4IINA 4PN3A 1ZNXA 4G56A 4FGZA 4FFRA 3WAKA 1GZ7A 2G1PA 4O4LA 4C87A 3LC7O 5AVQA 5MFPA 4PLGA 2P2GA 4O2AA 4EY5A 1XQ1A 2QQGA 4ZGGA 2WU1A 1M0TA 1PNOA 1G21A 1KI4A 4ANFA 3G02A 1DOZA 2EWWA 2ZKIA 4Y6LA 2X8AA 2AVDA 4J0IA 3MIIA 3KV1A 4TRRA 2BFFA 5DGXA 2BBSA 1MENA 4HDQB 1E64A 1QHYA 2FW1A 1GUFA 4XB1A 2AOXA 1ZZGA 3R7FA 4JI2B 3VC1A 4HP8A 3LWBA 1LPBB 4CCAA 1TT5A 2WV7A 3T9AA 1M1YA 3GVHA 5KYKA 1UPCA 1Y4SA 3BSSA 3L5OA 3QA9A 4HAXA 4KN6A 5AI4A 5EZ5A 2JLRA 4Z2YA 3RM3A 3U61B 5IHXA 2O54A 5FTMA 1GRRA 1DADA 1GFZA 3F5FA 3OLXA 3GA7A 4RK7A 4WFQA 5THXA 3I5MA 2OXIA 1ZK0A 4PO1A 1NVEA 1EHYA 1RWWA 4MI1A 1WOYA 4FOSA 5IDWA 3KKEA 2XIJA 4OEHA 5F9HA 4XB6B 2HTEA 3NIFB 3R6GA 5HE9A 1P6UA 3DVAB 1Q6YA 3KK0A 2GJ8A 3RG8A 5BNIA 5C5DA 1N7HA 1JG4A 3NHFA 4NS4A 3D4IA 1CRPA 1HPLA 4CQMD 4TZ6A 2YVLA 3CBQA 3RIYA 4BMVA 5GQSA 1MAUA 3G9UA 1OHHD 4FEYA 2D3TA 3LOPA 2BTEA 2N1MA 3HTXA 5DT2A 2O2XA 1H2RS 3DBLA 4C08A 1OC2A 2SHKA 5LP6C 1OA1A 4Y1RB 4O33A 4OMFG 2H17A 2WSYB 3EFOB 4JOBA 4S1TA 4CF6A 3N75A 2L18A 2OEPA 2VKQA 4U2GA 2SKEA 5EHNA 4CZ2A 4DJ5X 1A9XA 1Q95A 3VJLA 1PCXA 2N46A 1P91A 3C5HA 1OT5A 4J4BA 4JP8A 1KY2A 3OP1A 1PTJA 4JJ7A 1WDTA 1H5NA 2GPAA 4L4RA 1GPKA 3IV9A 3H19A 1YZUA 4YAUA 2EGHA 4DV6B 5E4YA 3B6ZA 1DQPA 2Q0SA 3L40A 3DMYA 3L6OO 3STXA 3RWOA 3ZQKA 3GLGA 1EEXB 3H97A 3NVDA 4TLDA 1WY7A 3LGAA 2IH2A 1E2EA 1TO1E 3PXXA 4QAQA 1K6JA 2QP3A 1M1NB 1Z5PA 4DMFA 3DXXA 2R62A 3C8HA 4LRYA 4CEHA 5C37A 3DB1A 4QHSA 4W4TA 4IF6A 4HNAA 4JUIA 1A8PA 1M34B 3JAWA 3JPWA 4PCAA 4B6FA 3UCEA 1KK3A 1LWNA 3KUKA 2I3GA 2PX6A 4MWDA 4RPKA 3EJWA 2GNAA 3AZPA 5KYYB 2HRZA 1IRXA 3PC3A 3HZHA 2GBGA 2KSQA 1DX6A 1HC7A 2M6LA 1NVVQ 3W0LB 3CW8X 3ZHBA 1AN9A 1TIBA 3V5NA 2RG7A 1NQTA 2EERA 2BR3A 3FH0A 3QU2A 4M0CA 3W3AH 4B3FX 2BHNA 3PF9A 1WY5A 2X0JA 1SBQA 4GSLA 3QKSA 1KRWA 4G2TA 1RTKA 1FZTA 1VGRA 3BZBA 2XNKA 1FCJA 1T26A 3O3OB 3GLIE 1R27A 4H1HA 2Y1CA 3FPJA 2WINI 3BK7A 3TLJA 1OV6A 3FYUB 3GJQA 3LOUA 3QLVA 1FP4B 1CETA 1ZMBA 3V1YA 1NP3A 5KSWB 4I5IA 2EYQA 3NNDA 4L5YA 2ZYTX 1G0NA 2PGLA 3NCHA 4UNRA 3FHTA 2NN3C 2WIAA 3D3KA 2X6RA 3MWYW 2L82A 1CS4C 1QK5A 3FPFA 4RULA 1EX9A 3I32A 5FTJA 1UOEA 2MINB 4NF2A 4LQCA 4RSGA 3C3KA 3MOGA 1D4FA 1ULZA 4RZIA 4GE3A 4Y9DA 2C8VA 4LRTB 3W6ZA 2NVOA 2ATXA 3TYXA 2OO3A 3CS3A 3TB6A 1FK8A 2H7VA 4DRXB 1YACA 2HT6A 1VXRA 2XMZA 1P39A 2HF7A 1UPXA 5ALUA 4ZHQA 1U0BB 3U09A 1RWMA 3K6RA 5DTEA 4DV2B 2JANA 2ZUWA 4HRYA 4LWQA 3MINA 4J1SA 5FUVA 5FOVA 1HT1E 3VDRA 1UJBA 3EF3A 2IDZA 3AZOA 1N5RA 5CM2Z 3RKRA 2V7UA 4OQ4A 4WVFA 3ROTA 3KQNA 1XTBA 4UZSA 4FMCF 3RIGA 3D31A 1G38A 3QKUA 5HJ2A 4C3UA 1SVKA 2EEZA 3E82A 5FR2A 1K7YA 4OB7A 2FUCA 4DUPA 2A1IA 3MBKA 4YAJA 4DUGD 3TRKA 3DAOA 2Y71A 3JYNA 4HMOA 4BN4A 3MZ0A 1BFUA 4KV9A 4BN5A 4ZN6A 1KOFA 3TEFA 1RYBA 3U39A 2PSJA 2P35A 2X9GA 4BP8A 1RYFA 1EQUA 1HK7A 3NYQA 3WNZA 3EPRA 3KTAB 4ZQGA 3TRFA 4DJAA 3BILA 2G6BA 1NW9B 2GZRA 1NXPA 3PJGA 5C8YF 2XEDA 1GZ3A 4IIBA 3V6MA 4DLAA 1ZK2A 3MJCA 2VDWA 3GD5A 4IFIA 3P2JA 3P4UA 5DH9A 4A91A 3F5MA 4PS1A 3UATA 3TAUA 2BSXA 5F2OA 4GPEA 2Z1MA 4BNUA 1L4FA 3C7CB 3PWSA 3VTFA 3HXOA 3LX5A 3Q3JB 3NS7A 4LJ9A 1EVKA 2P4UA 3L5KA 2H07A 3V9AA 3ZCPA 5K0EA 3D8SA 1IATA 4DIBA 1JA0A 1E5QA 4EVRA 1P1IA 3LM8A 4AMUA 4CIBA 3JD2A 5JDIA 2ZUEA 2QSJA 3GC6A 3IE2A 3MSXA 3QYAA 2ZBEA 3O21A 4HV4A 5D7NA 4LS3A 5LXTA 4BC0A 3EVDA 4QYIA 5FPSA 3PHLA 4P86A 1E3JA 4X20A 5D7BA 1CV2A 2I3AA 2ZBFA 5M04A 5BSTA 2VQEB 1T8YA 1SR8A 4E33A 2OZLB 3M3PA 1JLMA 1PJBA 5FH9A 2BGWA 1G9SA 5A5VA 4UBOA 1UM9B 4YI5A 3KQPA 3CVUA 2VNAA 3N1UA 4WT7A 4P58A 1ORIA 2NZUG 3DDSA 2AQ8A 2E0IA 1A77A 4K2HA 3Q6NA 4K9NA 3B85A 4NS1A 3QJYA 4B8WA 4BKMA 1V2HE 1RLMA 4O4JB 4UHCA 3GRUA 5FPKA 4TZ0A 5HILA 1TJ3A 4IG4A 4JUDX 4TV9F 3RV3A 3IVCA 4ZOLB 1N6KA 3GBVA 2EFYA 3L6UA 2ADFA 1TYCA 3VX3A 1T6ZA 5L53A 3HCBA 3IBCA 3G5TA 5AQ1A 3T9CA 1VE6A 3TE7A 1SBIA 2I9PA 3CU5A 5A2QA 2K7FA 4A4DA 3ZCXA 3RNLA 2GO1A 4WXPA 3ZE8A 2CFTA 3F2VA 3LCMA 2VTDA 1RHUA 3FD8A 1A98A 1GKUB 2W2PA 2REQA 2ZR9A 4ISCA 3WDLA 1URPA 3IO5A 4DLPA 2Q3FA 4EPVA 1M0EA 4J3JA 1TUGA 2YNMA 4MAFA 5C46F 1T9GR 4LKOA 3DOEA 4HB4A 5CXXA 4ETNA 2FK7A 2Q0QA 2W6OA 4FOLA 3AF6A 2XAAA 5BURA 3ZY6A 3SJ7A 1H2ZA 2JJQA 2P90A 4A36A 5FBVB 1RWOA 2R65A 4KE8A 4WV3A 5DGTA 2DWPA 2QTWB 4LYJA 1BDBA 1ZGAA 3T34A 2V5VA 3VTKA 1N5OX 5JRJA 1IFXA 4M21A 4BECA 4A23A 4HDKB 5CYFA 3RIXA 4RTJA 3HR4A 3OF2A 4AD8A 4GYJA 4W8GA 1JIQA 1U81A 2WBLC 5CEEA 1GNRA 3RU2A 1TUEA 2BTQB 2JGFA 1L1FA 4AZ0A 4AQYB 1LQ2A 4HQRA 3GEHA 2YVAA 3Q72A 1R8JA 2O0HA 3LT2A 3SPXA 3LH5A 5JS8A 4IDCA 3DWEX 4PC1A 1D3AA 4ZK6A 3N2LA 1ADGA 3L06A 5THKA 3NOVA 2IV2X 2ZZNA 4E5DA 4BKRA 3IAFA 1IEXA 2DT5A 3EXEB 5AUQA 4N5DA 1OE0A 1P2SA 2ZG6A 4ZO4A 2G7ZA 4MRPA 3UOWA 4IDBA 5K0FA 3IQWA 4PCVA 2R8YA 4ZWNA 4RDIA 2UZ3A 2DLNA 5E9QA 2CE2X 1WXGA 5JT1A 2FWJA 1E4EA 4Y2TA 4ALKA 1NMEA 4BVJA 2Y9MB 2FPIA 1NFFA 1N2EA 2PXAA 3HDHA 3M4JA 1KEEA 1IMJA 3GJ7A 5IDQA 4WXRA 1DDIA 3K2QA 2FSVA 4JCCA 4DIKA 3EGDB 4EF6A 1P6QA 4MZDA 2GZDA 2HU8A 5D3QA 3JRXA 2BEWA 3ROGA 3O4GA 3WMRA 2EKLA 3RC8A 1MJNA 1NW6A 1K6IA 3NJRA 1PFYA 2QN3A 4HTFB 2XW6A 2BGTA 3HB7A 3UT0A 4G36A 4XX0A 3D3JA 2LCFA 2D2XA 4QBGB 4PIPA 4B84A 2AK3A 1ZOOA 1NMSA 2PH7A 3LZ6A 4L4XA 1DAGA 3KZNA 3FOWA 4E46A 2OSVA 1LTKA 4DEXA 2NT3A 3LO5A 2FP4A 3CX4A 3TUJC 4Q4AA 5AJHA 2CYCA 1K89A 4FYHA 2YRWA 4EA8A 2FWPA 4L27A 1N6IA 5PNTA 3SJZA 3GROA 1Q91A 2V7GA 3Q0TA 4N5NA 5LYJA 1VPLA 4H2DA 5KYUA 1W6UA 5EJ5A 2GJSA 2PR7A 5K6TA 4WNIA 2I2XB 4WQMA 5A6SB 2CT8A 3VO1A 3HKCA 1ZUNB 1VYUA 1N1MA 2BE9A 4Z4CA 1UF9A 1Q22A 4WLEA 1K8QA 1WUTA 2O8FB 1NULA 1U0SY 4PSDA 3ZNPA 2HNAA 4ENRA 5CA1F 3KSMA 4NDAA 4Y9UA 2Q1WA 2DTEA 2J48A 4BYGA 1YZHA 2OUIA 2X3UA 3BH7A 4DKXA 4WH0A 1H6CA 3WL6A 2RI0A 3T4EA 1D9XA 1FL9A 3DL2A 2GF9A 1UWLA 3HU2A 4K1LA 4DZRA 4R2XA 2V5AA 5LYYA 3BMOB 4A8HA 1XJ0A 2X4DA 3FWHA 2QTGA 3DAHA 3UGQA 5CDFE 4QDTA 2A58A 5D01A 4KQ1A 3FMFA 4M8IA 5LD2B 4LPSA 2Z4SA 3ZIDA 1L5FA 2VDQB 3ZWDA 5IG2A 2LD4A 3R5XA 3URKA 1EEHA 2DZDA 2VDRB 3I9JA 4N3BA 4MO2A 3H04A 3BIFA 1X7XB 3UC9A 3FKJA 4AP9A 3LKZA 3V4SA 4F06A 1L8OA 2ETXA 3BC1A 3U56A 2XLCA 3QIAA 3JQFC 4J0HA 2JAQA 2C7RA 2A84A 2QVCA 1PIWA 2QVGA 4UNNA 3UWSA 1FFYA 1B6RA 2E4VA 3UY4A 5DK4A 1N2ZA 1RFLA 1IEQA 3OM1A 2A9QA 3OJXA 2HU2A 4FEAA 3U5TA 3N76A 4CGYA 1EBFA 4DHEA 1JVBA 2DCUA 4CR7A 4TN1A 3R5KA 1MORA 2AE2A 3KXPA 5BSEA 2I76A 3OO0A 2OAQ1 2MR5A 3ZX5A 3H5AA 2Q9BA 3H2BA 4YCBA 3HVHA 2QLBA 3AQIA 4IYJA 3UFXB 1G9TA 2PZ8A 1KH1A 4QFCA 2XYRA 2HCRA 3CT4A 5DBHX 6ADHA 2P67A 4QYIB 3CTMA 2X1HA 3KT0A 2Y05A 1W8IA 2QWXA 1Q7GA 4HQKA 3SK0A 1LRKA 1W75A 3O94A 3QELA 4HN9A 1R6DA 3OZGA 4LHXA 3HWWA 4PCLA 4YJ2B 1EXVA 3H83A 5B1EA 5JROA 4OHYA 3IRVA 3O4FA 3LV8A 4DHWA 1U6JA 3ZGXA 4CUKA 4PHHA 4PAMA 4DLLA 1YR2A 1GZHB 4J2TA 4AKHA 5FTNA 1H2FA 2AX3A 5A7FA 3RUAA 4MPDA 3BHMA 4K40A 3BL6A 1E4VA 2IODA 1D5WA 3BFVA 3P5BA 5T6BA 2QD3A 1WXXA 4BS9A 2C03A 3QI2A 1JEOA 3JQDA 3SCZA 4A1OA 4CM4B 1ZSVA 1QGUA 3A6ZA 4CM9D 1L4KA 5KYVA 3U7QB 4ZYVA 4OH7A 3QQ5A 1BS2A 3AP1A 2EJVA 3O9VA 5HR5A 3UJNA 4V0OA 4AYXA 1B14A 4HSGA 3PD7A 1XO1A 3CUSA 4L0CA 2YS7A 3D0OA 4ZTZB 3E5HA 5BV7A 1VG9B 3BHJA 3DMTA 3NBZC 4BZXA 4F72A 5JQGB 3ZJ5A 1FQJA 3JQBC 2FG5A 4XDGA 5EFOA 2I8CA 3UT5B 1V3UA 4HL6A 3D6VA 4FYWA 3PF8A 2VL7A 3LI2A 3ZKAA 4RNCA 1P4GA 3GFRA 3FYCA 3N2KB 3T5DA 4BNJA 1OXSC 1Z26A 4Z1OA 2FVXA 3N59A 4FYXA 1OLSA 1QDEA 1FS4A 2IYQA 3SF0A 4V3CA 5C7LO 2X5NA 3IO3A 1QRDA 2WSSA 2H3HA 5ALHA 2XMDA 1I7NA 3E8SA 5AFSA 5IM4A 4ESVA 1X2BA 4G5HA 1Q50A 1Z22A 1BGWA 4M22A 3J80A 2PYDA 4ES6A 3WIOA 2PVCA 4PTZA 1VECA 3MT9A 4ZV7A 4DRYA 2PL3A 3UAXA 3HB1A 3RH0A 2YASA 2G1UA 2E3JA 1F48A 5FKJA 4MVXA 4Y0AA 2EKPA 4Z4IA 4JEHA 4BNXA 2E48A 4HZUB 3HDYA 3L4EA 5TVGA 4KFUA 4A8JC 3RYFA 3K5PA 4DYHA 3PJEA 3O83A 4YJGA 4MVJH 2HMVA 3GZ4A 2GJKA 1O2DA 4I3HA 4BNGA 2J3IA 1CUGA 4E0BA 4YLYA 4DCJA 2DQ4A 4KR9A 1YR7A 4CRWB 1FRVA 1FP2A 3EXEA 1Q1AA 1QFYA 3UT6A 3QXJA 4B3DA 2VEOA 2I4RA 2QMYA 4QXMA 3R3YA 3T5PA 1JSCA 3WTCA 2XCRB 5LQMA 3ZBPA 2FK8A 1LD3A 1WCIB 1EB9A 3K53A 2ZIUB 2A14A 1GRVA 2P2SA 4HPXB 5JZMA 1J6UA 3G2HA 3O38A 4FYMA 1DUIA 4WKOA 3G2PA 3E9QA 3TIVA 4TWRA 3WIBA 4HDRA 3BORA 1U9JA 2XZPA 2FUG1 4IIEA 1E6UA 4CL0A 2ZBUA 1P7WA 1WD5A 1ZH0A 4MUJA 3V7UA 4YMIA 1BE6A 3I2YX 1YV9A 2QU7A 4V0ME 4WFJA 4ZC1A 6REQB 3CXRA 5B7QA 3RSCA 4E14A 2RHTA 3K1TA 4LXTA 2GTIA 3WIVA 1SVWA 3O2JA 1E9EA 4YS6A 2Q0HA 2C5BA 2OG1A 2FPPA 2ID9A 4O2AB 1KFJB 5KNCH 4R01A 5CT6A 2NSYA 2O06A 2C5FA 3VYRB 2QVLA 3B3AA 2IWRA 4B7CA 4BRWA 4X7BA 1FJXA 4NCKA 3WK8A 4IJKA 5KS2A 4OHOA 1GL6A 3L1VA 4MWEA 3NHZA 2WNHA 3TQCA 3Q3HA 3UVEA 1Z37A 5JFGA 3DJFA 5KDOA 4FM9A 2ZU0C 2J33A 3G8BA 1SCUA 13PKA 4Y0VA 3U7RA 4GL2A 1HO3A 1XJ5A 2ON6A 2WJVA 5JECA 4L6IA 4NV3A 4TROA 1RADA 2BVNA 3H6KA 4MW2A 4X7MA 3WA6A 5A4FS 3BXHA 4L72A 4NMWA 3S1LA 1PV1A 4QJ4A 4D43A 2IY7A 2Y0DA 3W6NA 1V16B 1VLMA 3E4CA 1RLUA 2RHHA 1LC0A 3IP7A 3WXMA 2ZUSA 4NIMA 3KYBA 5GOZA 2OHJA 2QUJA 4R1TA 3X0DA 1AO0A 1US8A 3UK2A 3V55A 4LRWA 4MYRA 1LJLA 1M1UA 2W0SA 3TH5A 3DV2A 4IXTA 4P8RA 4R2JA 3MCAA 1OBOA 2C2MA 4NNJA 5J43A 1JQEA 1TJPB 1LC3A 2QP9X 1RBZA 3UUEA 3EMKA 4JI6B 2CNNA 1J8VA 4ASUD 3RYHB 1QH0A 3MCTA 4CW7A 3PLAE 1J2EA 1P77A 1RIIA 2HMTA 5A1JA 1NKTA 3ROFA 1ORWA 3D5EA 1JNXX 1JBKA 5GPBA 1IHOA 4NBTA 5FQNA 4PNHA 3MSCA 3NWJA 4AY4A 3T7TA 3EUEA 4TMWA 4MDEA 3MT8A 4MUKA 3V48A 1GGKA 4YQZA 3FUXA 3MILA 2FWAA 2V4MA 4KO2S 3MUOA 1YHNA 3ANLA 4O1IA 3RBVA 3UGKA 4DSTA 1QMPA 2OFPA 2ZWMA 2ZJFA 4AW9A 4YMUA 3OC6A 3E2IA 2ZIFA 5EL0A 2CVFA 2JGEA 3SYNA 3HP4A 5ITZA 3AVWA 4B75A 3DEHA 2QPLA 4NE9A 1K08A 2NO0A 1IDOA 5FCDA 2G3YA 4HADA 5HQTA 1V6AA 3PJRA 1ISMA 3MJFA 4G4IA 1MC4A 1XDDA 4F9FA 5JD5A 1SXQA 5DGCA 2H5LA 3O0DA 4HN4B 4HNHA 3GDHA 5TR9A 4YCLA 1EDOA 1J2YA 4MYDA 2FJPA 2JFZA 4ZPJA 2VRBA 4PZLA 1U2RA 2B3TA 3OQPA 4D0LB 5C52B 3ESXA 4TTQA 1TMKA 3H8VA 2XA1A 3AINA 3BQ9A 3QKRA 4HNRA 1QB8A 2B1IA 3HYRA 621PA 2GCIA 2GI4A 4CV1A 3M9XA 3QXSA 3AM4A 4HEQA 1U7WA 4TV8F 2R8BA 3OCYA 3GOQA 1Z3CA 3NEAA 3PUJA 4D9GA 3HI6A 1AKNA 3RSHA 4B7ZA 4E09A 5CEFA 3GAFA 5KINB 4UQPA 3OEYA 1KQ3A 5L7YA 5TJHA 2FJ0A 1G4UR 1G5RA 1AUOA 3RS5A 4CM6A 5ITSA 4O02B 3G59A 3E0XA 1B93A 2CK3D 2I1LA 3EISA 3KDPA 2CYAA 3V2UA 3N3BC 5CR9A 4ZQEA 2WC1A 4LF8B 4RM3A 4GRAA 3I5YA 4X3OA 4OFWA 4JJ8A 3A9SA 3OPMA 3U17A 1HV8A 2HI0A 3VNSA 2WICA 1DIAA 3B5EA 4KHPB 3EHEA 3UO8B 3HVIA 1RAFA 1UJMA 4YT2A 4D99A 4HZIA 1XYYA 2G0TA 2BZ1A 4W9NA 2A5YB 4IUYA 5A3QA 1SUBA 3SHTA 2H85A 4M54A 3V7FA 1SXJC 2HF2A 1TCUA 2VRCA 2ZJ1A 3ITKA 4FMDB 1VJDA 3SZUA 4UDNA 2HXGA 1TCBA 1BH2A 3CRRA 4LBYA 1LI4A 1WSDA 3TDNA 2W22A 5G4KB 1SBZA 1JJVA 2NZWA 4EPXA 1WO8A 3DZGA 3E3LA 1QP0A 1NBMA 1T0UA 2GZ2A 3A4IA 4MH0R 1JPNA 2YX1A 5D5HA 4YV1A 5CA0B 2QX8A 3H5WA 3IIKA 1T34A 4DGSA 4XIYA 2XNDD 3MIZA 3ADCA 3L4BC 3L92A 3NUGA 3K1YA 1CUXA 5REQA 2F17A 3A1WA 3F4LA 4OTZA 2ESRA 1V25A 2AC2A 4HZUA 1RSZA 3LBIA 3IOMA 4QFDA 3MGBA 4KWEA 2ZRBA 3RVKA 4BO4A 3LDAA 5JNWA 1RCFA 1BNCA 1KBOA 4X6YA 1NASA 2GK6A 2QLJA 3A26A 3B9BA 2C5GA 4EGJA 3MW8A 3SFZA 1JKJA 1NIJA 2Q1TA 1L4GA 3HNRA 4O0MA 5DX1A 4EELA 4EEXA 5CNMA 3SQWA 2BUAA 1KQNA 4DA7A 3JATB 2ODAA 3NLLA 4ZCTA 1X7ZB 1ZUD1 1X8LA 3ZHCA 2C1XA 2GNOA 3SLRA 3L41A 1TAHA 3C41J 1VBKA 1ZNZA 1RTTA 3FSJX 4OQYA 3T54A 3SICE 1MPXA 3EWNA 3MN1A 4YO8A 2GJ4A 3IIIA 1ZC4A 4MO9A 2AMVA 1EHIA 1P45A 4AJOA 1CUSA 1T5HX 3DPIA 3LSYA 4U7WA 2QA5A 2C3MA 4ECAA 1BCSB 1Z4OA 1KI6A 4EMSA 3QPBA 1BG6A 3VGPA 3MM4A 4DLRA 4K0RA 1ARZA 4FCTA 3OZBA 1Q7BA 1TAGA 5FLYA 4BFXA 2VHZA 5KZMB 3VAZA 1JMVA 2OZLA 3DFUA 3K09A 3SBOA 3N58A 2R4UA 2ZSJA 1HDXA 3PNPA 4YK7A 4BVLA 1L5HA 1XRNA 4GICA 3EGOA 2QR3A 1OTXA 1EK5A 1UADA 1NWCA 1Q16A 2AG0A 4O3MA 1O54A 4RZSA 5I9BA 2OK7A 5F98A 2VQ6A 2Z43A 3P9NA 2H5JA 3GJ6A 4GO1A 1T0BA 1JSLA 4MVJF 5IW8A 1HYGA 3UQYS 3VR6H 1A8IA 4OP3A 3E05A 2HA4A 4ZOLA 3JYPA 3HK2A 4MLDA 1ZWKA 1JSZA 4HQ0A 1UBUS 4JLNA 4HAUA 1LS1A 1QO9A 3EODA 1OQAA 3PQ8A 3ZDRA 2AXQA 1DAMA 1NT4A 2XDWA 4F2HA 3VOSA 2DKOA 2ZSFA 5DSZA 3BHIA 1SPBS 5DTQA 3KQOA 3QMVA 4RYLA 5TXGA 3FOBA 5JD6A 2RK6A 4I6JA 4ERNA 2JCYA 2P9JA 2ONCA 5I9SA 5JNRA 2AJDA 2F48A 3W8NA 1JH8A 1XCGB 4RHUA 3WRYC 3P9KA 1R15A 1SXJA 1OTYA 3PQFA 3QUAA 5E0KB 3A1DA 3A9TA 5L4SA 5K51A 4B8ZA 4F2WA 3P8ZA 1ZDMA 1CY0A 5CJPA 1KSGA 4P5DA 3WQSB 1OU0A 3MVEA 3KVOA 4NMXB 2W4MA 1EFUA 2HHJA 1M33A 3MCVA 1XHFA 2CFSA 3OPVA 4KPGA 4QICA 1MO4A 1N2SA 3R7WA 1F0YA 2WUVA 2JZCA 1WG8A 4FPXA 4H1UA 1V0JA 5HM8A 1MLDA 2IFTA 5F9MA 5HKAA 3OY2A 3ZK9A 1ONNA 3D9QX 1KC3A 2VNSA 2YVQA 1C1XB 1U3FA 1YJQA 3IMKA 3JD3A 1F8XA 2HJGA 5B5SA 4HTAA 5GMOA 1Q0TA 4OLBA 2WG1A 2FEMA 1IZYA 1EDEA 3LBYA 4EG3A 2PFGA 4OQNA 1E6MA 1DNPA 4LYEA 5D2CA 4CKBA 3P94A 4AS3A 1ZO8A 2ZBRA 1G1AA 3AEQB 3O73A 5JC8A 2VAXA 1RQ7A 2Z8YM 3W05A 1SC3A 4EJ0A 3P7MA 1ODCA 1P7PA 5T4EA 2NQ2C 3PPYA 1LPMA 2BYTA 2CK3A 3PXEA 1PZGA 2HRRA 3HBJA 4YJKA 1VL8A 1EYZA 2AG8A 3O2SB 1SMKA 1Y1QA 2EJTA 1QIKA 1PR1A 2EX4A 1KQPA 3CWZA 4CLRA 4YRTA 4BUJA 1DUVG 1SUIA 3IR5A 3GT3A 1MP0A 2V3VA 4HDSA 4K9QA 4FBLA 3FDJA 3OE4A 4HUJA 1IBSA 2GZMA 2YJ4A 3INRA 2EW2A 1GLGA 1CIJA 1UMDB 1K8RA 4FYJA 5EXDA 2JRLA 2BMWA 1OR8A 2HXYA 1KJYA 1DEOA 5EIEA 1JEYA 2JG3A 3LXRA 3UKJA 1UZAA 1YVRA 3TI9A 4QEZA 3K9LA 4F12A 2B4RO 2P62A 1D2MA 4MYCA 2Y92A 3K9WA 3U3KA 1UOQA 1R0LA 3VVBA 1EUCA 1PT9A 2ZSAA 3DE3X 3STVA 5FBKA 1RT9A 3RSQA 2O2JA 3DCYA 5LIPA 1EU1A 3ESBA 5IBRA 3BWYA 2YDYA 4II2A 4LISA 1ODFA 4Q1BA 2MR6A 2H7YA 4RTOA 3K6JA 1N0IA 1N2IA 2IU4A 4HDNA 4XQ9A 1E3TA 5DCLA 5CK4A 4AM8A 5KYUB 1HE4A 1Q7EA 4MV6A 5CG1A 1C4XA 2ZJZA 4CF4A 3TMAA 4KWTA 4M36A 3PKZA 1JEQA 1SIWA 3R3WA 4M46A 4OFXA 1TU0A 1BEUB 1YBMA 2H2HA 3E3MA 3EG9A 4IV0A 4MA4A 1BGXT 2YKGA 3E8MA 3KYIB 5FIUA 2O2SA 4GWKA 5EJ6A 4L02A 3AY3A 4NABA 3LPMA 3TWOA 3QWHA 1KH2A 3VHXA 3QSYA 3HKDB 3RU7A 4BO8A 3KZKA 2H5EA 3TX6A 5ICMA 3CUYA 1Q92A 4RL6A 1KP9A 3WL3A 3AEKA 1MRZA 1H1LA 3DE6X 4XEUA 4D98A 4KXNA 1YVUA 4J7CA 3MD0A 2FEPA 2WIGA 2XX3A 2IQ5A 5DLPA 1ACLA 2YRFA 3VR5D 4A6XA 3J81A 1XTUA 3ZKWB 1U0GA 3JSXA 4QD3A 1VHTA 1X6VA 4CEIA 3IOBA 2YVUA 1CEQA 1N6OA 1MDFA 3OA2A 3ZNNA 3TUIC 3FNHA 3CX3A 4ZGWA 2VHWA 1PNQA 2J5BA 4GSKA 3VXKA 1GEGA 4BVHA 2WTUA 1GHTA 1GVNB 2LGJA 2Q4EA 1IY9A 3A36A 3VR5H 2J67A 5JSQA 5GIOE 1PQWA 4AJ1A 3F67A 5JADA 1T8RA 1IBKB 1Y48E 1GSHA 4LC9A 5AHRA 5HZMA 4L9SA 4MQ5A 4Y2RA 3CT6A 3KR2A 1UBKS 5LUBA 3AM1A 4KHZA 2A94A 2J0UB 3VKVA 1ZZEA 3FTPA 1BRTA 2X40A 3HEBA 3OU7A 4LBZA 4RFVA 3CLTC 2Q4OA 3O8QB 3UZUA 4DMKA 4TVSA 4B6OA 5JH7F 1UWCA 2B69A 2NYUA 3N2IA 4L2IB 3GY0A 4D6YA 1F2DA 2O8BA 3AZQA 2ZJYA 2WU8A 1QIFA 2DWUA 3CA8A 5DLDA 4LZZA 2Q45A 3D0KA 3EZ2A 4QULA 2QMZA 4K0KB 1DL5A 3ESAA 2WQ7A 3VC7A 1GQFA 2OWEA 3H9GA 5DYYA 4B3SB 2FSHA 1UIMA 1HQYE 4TKVB 4RTMA 3EBLA 1P31A 1DEKA 3JTEA 5BUSA 3U1TA 3TG2A 1G41A 2YYZA 1HG1A 3IDOA 2WT9A 1XMOB 4OU5A 2PR2A 3O6VA 4MARA 9LDBA 3IODA 4XYEA 2JJ2D 4CKWB 2GHTA 2WFMA 3ZBQA 4KRXA 2FLVA 5MGNA 5SZKB 5HE8A 4UDXX 1L4YA 2FWIA 3BVPA 3L7KA 4EMBA 4EQ6A 1HDYA 1SXJD 5KWJA 1ADBA 4JI7B 3VKHA 1LLUA 1Z12A 1U31A 3QLEA 1THMA 3A6PC 2ZJ4A 1XE3A 5JSZB 2G36A 3E7FA 4NX2A 3RUHA 3JR7A 3NOOA 5B2ZA 3R9IA 1U98A 2IYXA 3CZPA 3EDOA 4MW9A 4D82A 3BTOA 4XD7D 5K0NA 4B5LA 3V8RA 5U4XA 3ZDQA 1B0AA 3OTQA 3E84A 2VZLA 4E2FA 2BGKA 1Y7HA 2ODBA 2Q4RA 4KREA 1YO6A 2OM2A 4FX2A 4KJXA 1FDIA 3ROXA 2XYGA 1EAYA 3AR9A 3FJOA 4MIYA 2INGX 3AW9A 4Q4CA 1SUPA 2P91A 3FHLA 4HD8A 5AVXA 5KX5F 2HJ9A 2H2FA 2R9VA 2VF4X 3WFZA 2J85A 1RKUA 4IH4A 1HDGO 3ASUA 5HZKA 4IOJA 5EVCA 2JFQA 2FSSA 1G0OA 4BMOB 3CVVA 2Y93A 3KS9A 3J7AC 3LFUA 3QKTA 1P4JA 4ZVUA 1P3DA 5EHQA 2BFEB 2ACKA 2R1TA 1ZEMA 3EVEA 2FQWA 5HEKA 1K86A 1LK0A 3P2MA 3TXAA 1YHYA 4AU1A 1LTHR 1U5BB 3CEJA 1Z4MA 3A1UA 1E18A 1Q0SA 1TJNA 4QTXA 1GZSA 5EP1A 3TTYA 2RBGA 3IE0A 4MS1B 3ZHUA 3RV4A 2AFIA 4QBFA 5JY1A 4NR0A 2XTJA 3VZPA 2ZJ8A 3FTNA 3CUWA 3PFGA 1ZU5A 4H1VA 1E99A 4FMBB 4NATA 4B45A 1HG0A 4LX0A 2IYLD 3JVDA 4TMYA 4HGNA 1ZH2A 4RHEA 5FHQA 2XTNA 3LDUA 4M0LA 3GLUA 1LLDA 1GUYA 3GA0A 4H1TA 1BXGA 1PJZA 1XOIA 3USZA 4UMDA 2Y99A 3OEED 1BHO1 4EKYA 1P18A 1B6SA 2AG6A 2Q4TA 4Y8VA 3RRBA 4BMSA 5I3ZA 3UW1A 1UJCA 4PN7A 4XA8A 5DSXA 3RFFA 1YZVA 4IDEA 3AF0A 1XTTA 1MIOB 4ADSG 4RPHA 5LQKA 4ZCMA 1C30B 2LNDA 1J39A 2J5XA 3DEZA 4YAFA 3OTIA 4MUGA 2CB0A 3KG2A 1RABA 5EI5A 5BYAA 3THXB 4KR2A 4LY0A 1JFFB 1AIPA 3EULA 1VYHA 3ZWVA 1H0SA 2YH2A 1M8JA 2B7CA 2XCLA 3ZCRA 4UOZA 4O63O 4A73A 4IGEA 2OL4A 2DJ5A 1OGJA 3TD9A 1JLHA 1TRHA 4Z8XA 1U0HC 1J90A 2J9ZB 3IQFA 4F7DA 2MWMA 4ER6A 1UPBA 3TZQA 4TSFD 3C8MA 1U2EA 3G5UA 5BQ3A 1W581 4J1TC 4LRXA 1AQJA 4X5OA 7YASA 4DQVA 1P8AA 1Q3HA 3C48A 4CKZA 1Z06A 2ACWA 3EQZA 4UATA 2R85A 2NXCA 3JVEA 4DKJA 2CHVA 5AK0A 1WCWA 1HWYA 4IPTA 1L5RA 2PGIA 1EPUA 3KVRA 4GPIB 3WWCA 1FYVA 3W5DA 1XMSA 4F97A 2IS2A 4MUHA 5EMJA 5I8ZA 2QIOA 4UQLA 5CDGA 2RHRA 1E2KA 1F14A 4N76A 2Q3EA 1ZRHA 3OEWA 2NO1A 1XJQA 1F4LA 1GA1A 1NVUQ 2VHTA 1E4OA 3DP7A 5DBOA 1DXOA 1K63A 4AJJA 4RA6A 2OK8A 4ZRNA 3QG5A 3CW2A 3M82A 2VJPA 3DVRX 4G86A 5JCJA 2I6QA 1CB0A 1ECCA 2FPMA 2Q21A 3Q2OA 3ZOZA 3AIOA 4OQFA 1NF9A 4RHXA 2V6BA 3CZCA 3DE7X 2B9EA 3C1AA 3IULA 4WLFA 3K31A 2EFHB 3EFEA 1NJ8A 1T6BY 1W48A 3IB3A 4IIDA 4KP7A 4TXHA 4ITVA 4FQ5A 2RIPA 1TADA 2GA8A 3Q2KA 4RACA 2C9BA 4QWWA 3QENA 1CJVC 1MJHA 3D7MA 4S1WA 5H82A 3DLIA 4WNYA 3CGGA 5KU7A 5JOQA 3PQDA 3R20A 5I5EA 3ER9A 1BFKA 2Q99A 3U13A 2IBTA 2RJOA 3AFGA 5AM5A 3IMGA 2B94A 1DAHA 4OK5A 4Q1VA 3COSA 4NJEA 3VR4D 4JU9A 4QPZA 721PA 3W2FA 5G0WA 5U9CA 1AQIA 2FRXA 1GFSA 1W1UA 1SQGA 1O89A 3FCAA 3GEEA 3R74A 1B74A 4EVIA 1P33A 5DXFA 3GLRA 4NLLA 3O95A 1E2JA 2GMWA 3EMDA 4EKIA 5CDSA 4Q3BA 2WFLB 3NBAA 3VPAA 2QD5A 3PNBA 1KZYC 1XFDA 4Q5IA 3DAPA 4YIKA 2AYYA 4YDSA 4N0QA 2XQKA 5JNLA 1BQ4A 3RAPR 3U4QB 4AF6A 4L85A 4P93A 1XTQA 3A0UA 3FMVA 2FRDA 5K4AA 4EG0A 1QYWA 4A7PA 2IP4A 2GBLC 3IP9A 4ME6A 5AK6A 5KVAA 1T2VA 3UH1A 1S3SA 2D2VA 2BSQA 1Z6ZA 3CF6R 1NUTA 1M72A 1O7JA 2GAAA 1FMCA 2WY2D 2JAWA 2VNHA 1Z5GA 2O3RA 4DLVA 2JHAA 1L7QA 4JI5B 1GIAA 5I9LA 3K92A 2BMJA 2H4FA 5FOQA 1NVWQ 5A4AA 3K0CC 2XMGA 4LF6B 3HFSA 3HBAA 3ZUPA 4GQAA 2XNCA 1W9HA 3DW3X 4I8DA 4JS0A 4DMMA 4I8IA 3ZZNA 5J63A 2DKFA 2A0KA 1EXMA 4MYHA 5IAEA 3U3ZA 3FHJA 3GRKA 1H1DA 1EFRD 1WEKA 2W7TA 1FS5A 1G20A 4NCHA 5IJXA 2OGSA 5AUNB 3DDWA 1NVMB 4O2AF 5MFZA 2V8BA 5LXTB 4J16A 4DGQA 4KXFB 3G2JA 1X80A 1L1RA 1RHQA 2Z3WA 1RPTA 4PRKA 1KAMA 3FPAA 3MWFA 3OY7A 2JLYA 4CU5A 1R6BX 4EQ6B 5KWSA 3FCCA 2ZRQA 3G9TA 2SICE 1ITZA 1YDFA 3KIPA 2DPYA 1Q14A 4CMIA 1A71A 5JSZA 4JVNA 3IHKA 4KO3S 3BSYA 1WR8A 2QLLA 1YKFA 1RI2A 2VPYA 3RVBA 3TD2A 1C2YA 2BIFA 4FU0A 4PPYA 3VBCA 3DHVA 3HUUA 2G9RA 3AG6A 3HZRA 3UXYA 3ZTWA 2CVHA 1IB0A 4QG3A 2FWBA 4WLOA 4BX9A 2J9FA 3DXFA 3AHDA 2QAIA 2VK2A 1RI1A 3I2HA 4UVDA 3ZZTA 4IIUA 1X86B 2BI4A 2PM8A 1JQ3A 3G9QA 3DD1A 3GLHE 1SXGA 2Q3CA 3TL3A 2HHHB 3PRKE 3Q9UA 4FCVA 2JCBA 3ONVA 5IJ0A 1KZ1A 1SQ0A 2ANBA 3RT9A 1TOAA 2WMNB 2XI4A 4LXQA 4NDZA 2Y1FA 1PSWA 3WGLA 4BWYA 1QFJA 3H3JA 4GP6A 4XJTA 1UBMS 2QRQA 1Q0RA 5BORA 5BUQA 1Y7IA 2AMFA 2FAXA 3CRVA 1HOXA 4NH4A 3FMPB 3WL8A 5ITWA 4R1PA 4YRNA 3L1UA 1UK8A 2WE8A 1NW3A 3H5NA 4ISBA 3DQZA 3H9CA 4D4HA 3VO8A 3TSOA 5E6UB 5C2JB 1QQ6A 1CZNA 4Q24A 4P0PB 2PWYA 1C9EA 4FWTA 1AZWA 2AF3C 2EZ4A 3C8ZA 4RMJA 1KOJA 4CKCB 4ATNA 1OD6A 4K9DA 4UCFA 2DOKA 4MCIA 1NDUA 1P6XA 4GPD1 5FNZA 4BGDA 2QVYX 3K8ZA 3T3OA 1JN0A 3K4PA 4K88A 3AQ4A 2ISQA 1LF0A 2I62A 2WTNA 5EJAA 5CK5A 3P9SA 4I9UA 1C30A 5E3HA 4KO4S 4MV0A 5JMWA 3IOEA 3ETLA 4QGGA 4ASUA 2C4KA 3PD0A 3BT7A 1QZ3A 3BIXA 5L7TA 2DHDA 4G9EA 4GP9A 3C8UA 2Q6LA 3GEIA 4C89A 2QSZA 3EDCA 3O4JA 4EOGA 4G5RA 3ZV5A 2IGBA 1A2QA 3E9CA 3OLCX 2F9MA 4KYTA 5ESDA 4QZVA 5C3UA 4C5BA 1KSJA 1DGQA 1HDRA 5BMOA 4R1LA 3RRNA 3G0BA 1SUAA 3PQ6A 3M6XA 2H1HA 4HGZA 4EM6A 1NM5C 1L4UA 1E1CA 4YBZA 2FX3A 4C30A 4BMNA 4D4LA 4PNPA 2YZNA 5KPDA 3DOCA 4YP7A 2O07A 3VSDA 4C03A 5BSKA 1WDKA 3W9YA 4TQAA 3D6AA 3P5SA 1RRCA 3ICWA 4ROTA 5B3AA 3B9PA 3X1ZA 2G4VA 4INPA 4PHTA 2C61A 2OC9A 2C7BA 2PRSA 1O77A 2B4YA 3DVSX 3E81A 3FNRA 4EG8A 2D6FA 3MNFA 5EQTA 9ABPA 1V3QE 3A2KA 4XUDA 2D2FA 2O7NA 3O8LA 3HCRA 5ESWA 5EERA 3WVNA 3VSEA 3N53A 1QG4A 4CQLB 4KR6A 4NCAA 5IKEA 3GR6A 3OF3A 4HYTA 1JB9A 1U8XX 2I8LA 1Q15A 2WPNA 2H1RA 1RJGA 5E8JA 3QPWA 5FAXA 1DQZA 3QE2A 1W36C 4BNKA 2AXPA 1VGVA 1IBCA 3DLHA 3QEKA 3M3DA 2J7PA 2PGAA 4D0SA 4JLUA 1PZMA 1GNQA 5IDVA 2IYZA 4HNSA 2Y68A 3T9BA 3ICPA 8MHTA 5EUMA 4YR7A 4FT4A 5D51S 1RWVA 4DG5A 2YV2A 2GN4A 4PTYA 4M9XA 1I1QB 5EXSA 4L9AA 3A9UA 4UASA 4YYZA 1CLUA 2YWEA 3AF4A 3GDGA 4MAAA 4Y9TA 4B73A 1DC4A 1QHFA 2OBFA 2WJAA 3QYPA 3L93A 4LQLA 5ADHA 5GGYA 4PYIA 4ZYYA 4NFSA 2FMIA 2JGIA 5B55A 1ZA1A 3L79A 3EZ6A 4HWPA 4MB6A 5A3VA 3FMIA 3P97A 3PEEA 5K0LA 4TSRA 1RM0A 1WMBA 3PQ2A 1CY7A 2VXOA 1PG0A 1YB7A 4L5IA 3PQ7A 1QU3A 2GBCA 5EXPA 4UM7A 2IPOA 4XOUA 1OYYA 3GI1A 1ANKA 3AXSA 2X14A 5ERXA 3WADA 2IXGA 2IYWA 2ZPTX 1DHRA 4YC7A 3T3IA 3G5MA 3C4JA 4FDUA 1CUJA 3WISA 2ZPUA 1E2LA 3HFGA 1L1QA 2XDQB 3K8QA 2ZIWB 3KFXA 4OHXA 1VGQA 2J3DA 1VPDA 1F2TB 3LHDA 4BIMA 3WA7A 3HCNA 3TI7A 2DVMA 4QJIA 3G5AA 3LKDA 3PJFA 1AY0A 2QRNA 2HZBA 3ACDA 3MXTA 3G2NA 3SFVA 1H9AA 1KZ6A 3PTAA 2I65A 3E48A 2FZWA 4DDUA 1GTMA 3ZI4A 3K2IA 1HMPA 4CIYA 3QNMA 4HRXA 4HPWA 1M6VB 4NFYA 1LTQA 1GNPA 1NC3A 4W5HA 1LQTA 2CJYA 1DT5A 1VMIA 1X87A 4PSVA 2JIOA 3OWOA 1VXOA 1R66A 1XCLA 1R4ZA 1QO7A 2OHXA 3V8PA 1FF9A 4GL4A 2OCYC 4FI3F 4X90A 5EMKA 4B7AA 1X92A 1NXOA 2ERCA 2EAUA 1W76A 1TZJA 4I4NA 1VHLA 1NNUA 3HBFA 1IEVA 3MPOA 1K7FB 4Y7DA 4BP3A 1WW8A 3GGPA 4GI5A 4MGKR 2CD9A 3KAQA 4GI3A 3KWJA 5EESA 3HC7A 3JRNA 4WPGA 3EA4A 2RGWA 4LA4A 4J1TA 1L9KA 3I8SA 2Q8PA 1M83A 2EW8A 2C54A 2OR3A 1SKBA 5E7IA 3MHTA 4XZ3A 1M2HA 2KQUA 2UVDA 5ALMA 3CJQA 3T7AA 1RACA 4QTYA 4RJJA 3DTTA 2H08A 3EXFB 4D8UA 3C8DA 1UFQA 3NGXA 3RVSA 3IA2A 3LPDA 4HY3A 1P2VA 3W3AA 3TR6A 3CLRC 1OW3B 3PNYA 4EA7A 1NRXA 4C22A 1PN3A 1QX3A 2G1KA 2J7KA 5FNVB 1DKRA 4HJXA 4QQ8A 1X7WB 2H4WA 5EHXA 5IU6A 1M2VB 1HE5A 2B0CA 2X9VA 4Q66C 5B7PA 4JNCA 1YJAA 3VVCA 2RAFA 1Y5RA 3PIIA 1YCGA 1Z45A 4C2UA 1DX4A 2EP7A 1JR3A 1XEFA 2BKVA 2JA1A 1SC1A 2C20A 2HO4A 2NV0A 2QL6A 5DCUA 1E0DA 2VOJA 5FFMA 4B3CA 3DQPA 1O1YA 1JJ7A 3KEOA 1ZHOA 4E5PA 1XA4A 3C3MA 4HYEA 3LRPA 4LTDA 2OFWA 1EM8A 3DBVO 3O1HB 3HVJA 4DS3A 1EZ4A 1MEOA 5KKAA 1U0OC 1AKEA 2BD0A 2HR1A 4QYXA 5EIBD 4BKOA 5FR1A 4ZARA 1XTPA 4GZ6A 1J0EA 1P61B 1USWA 1ZCBA 2D7DA 5KTKA 5G1OA 5LZ4A 2H57A 2DQYA 1ZP6A 4F3YA 3RAEC 2M2IA 5BPHA 1IOLA 2HLHA 3A7EA 1VJRA 5I01A 4EL0A 5H4HA 4CEIB 4JYAB 3KLBA 1GL7A 4FX5A 4Q3DA 4FHCA 4Q4JB 1E4YA 1GUAA 1YQEA 2XXBA 3HCFA 3LSTA 4P35A 4UVGA 4B3IA 8ADHA 4YPVA 2AS0A 4YRIA 1YR6A 3PR2B 7ABPA 5HKKD 1WUJS 3WO1A 1PT8A 3ZDBA 2QUKA 1QYIA 4NBVA 2IOQA 3GFOA 3LQYA 4NY1A 5DHPA 3SZLA 3W6OA 3N6XA 4OYYA 1N36B 4F8YA 5MN6A 2E89A 3DG9A 4WBXC 4A03A 2IXAA 4UTZA 1NQAO 2IXBA 3ZU5A 1EZ1A 1Z08A 2C84A 2ZSIA 3FUWA 4D8XA 4DFDA 1EG7A 2XE6A 3LRXA 4KNVA 4R1NA 2CUKA 1LSUA 2D74A 3GGOA 3RVDA 1KJNA 1VMKA 4B76A 5BN3A 1LBQA 1RQNA 2W37A 4RGVA 2H0QA 4RKFA 3B1JA 1LSSA 3LA6A 3Q9NA 3LUPA 3ZXUB 4D9EA 4HDAA 3IQDB 2EWMA 3N0XA 3E7XA 3HU1A 1IBMB 4G0ZA 2ZSBA 3C5VA 4X94A 2GEDA 2BJVA 1V9CA 1RKXA 1W46A 2BOVA 1KDZA 4LCBA 2H1FA 1OZHA 1CUWA 4DQDA 5AJXA 2RJ3A 4MEAA 2FQQA 4F1JA 3GJ8A 1ICIA 4Q3AA 1R12A 3IR6A 1NPDA 3SZRA 1XZMA 1ZOSA 3E9MA 4R9VA 4MDYA 2VTBB 4JGIA 5CLFA 4I6GA 4TTRA 1VBMA 2EQBA 3STUA 5BSGA 2DPHA 2YIJA 1W5AA 1SUWA 4NYMQ 1FX1A 4DSNA 1GTL1 1RYDA 3ZVMA 5IBQA 2OXFA 3RD5A 4EG1A 5H80A 2W8ZA 1F8YA 3PL1A 1U8CB 1UMCA 1LA2A 3KUXA 3OFKA 4N0PA 4HNUA 4OD0A 4YV2A 4QDOA 4ZYLA 9MHTA 2PN1A 1HY3A 2EJWA 2MINA 3LCVB 4WY5A 5BW4A 5J2UA 1YKGA 1O94C 3IB6A 4TV8A 3NT5A 2GEVA 3GGCA 3KQQA 2PZBA 3Q2IA 3GT4A 3KP1A 4XYBA 4ZYWA 1W25A 3OWXA 2IDJA 5JEEA 3DHWC 3H17A 1OX4B 3FOCA 3NXSA 3X1WA 3KSZO 2PLNA 4I36A 3VHLB 4YUYA 2AGVA 2YMMA 3MTJA 3OFSA 4LDQA 4U8GA 3ZE1B 4CMAA 2EX0A 4URVR 4D3ZA 2FUG6 1Z2OX 1PSZA 3D2LA 4DDVA 2CLHB 3WBJA 4C6TB 2HYDA 4TVBA 2GUWA 1ZR2A 1Y3FE 2C7VA 3Q98A 1VCNA 2IX9A 1QDLB 3CRW1 4LRUA 1QSGA 4HEA6 3ZVKA 1C9MA 4MR9A 4A9AA 5LFAA 3NIDB 3FNQA 1E63A 2D62A 3VDQA 2QAGB 1MAHA 1Y80A 2X23A 4RY9A 4X45A 1TYBE 5GV8A 4TX1A 1Q5PA 3NBYC 3NM6B 3FZQA 2R4TA 1HYQA 1D8AA 2I99A 4KSCA 3OQJA 3UPTA 4P0TA 2A5JA 3ANXA 5KKNB 1OVGA 2VRNA 2VNIA 4S3MA 2Y1EA 5EIXA 4MB2A 1TPZA 4KU4A 5AKYA 3THWB 2DH6A 4FWIB 1WV1A 2WYOA 3BF8A 2X2EA 4RPCA 4DW8A 1ENOA 3DF9A 1N75A 3BS4A 3QQPA 5KJCA 5FD8A 4JA2A 1J1ZA 3F49S 3RSOA 3EG5A 5FUXA 2B3DA 5KNBH 2WAAA 1XZAA 1Z0UA 3L1KA 1WU7A 3BMCB 4J9UE 4BEWA 3PE3A 4NYIR 1A7JA 2AKEA 1GXSB 1GQYA 1T5LA 5JZBA 1WNFA 3L0PA 5EWLA 4PYRA 2O8EB 1D6MA 1V5WA 4JN6B 4N5LA 4TKZA 4OBBA 5AR1A 5I4KA 1LQUA 1U8UA 1X8KA 1ZRNA 4BX3A 4YA6A 1Y5NA 2JFYA 3VOBA 3OQMA 4F4JA 3BULA 3QU9A 1V48A 1PGNA 1VCMA 4FR5A 3NHBA 1VMAA 5JLAA 1QHIA 1BWRA 1IIBA 1U4OA 2PZFA 2XCOA 1RKQA 2Z9DA 2ZEJA 1DXHA 2ZULA 3AU9A 3D5TA 3LUCA 3LUJA 4HLNA 5K09A 1XDWA 2G9QA 2VJNA 5ECDA 3EF0A 1JV2B 1M1YE 2ZI5A 4EEZA 3ROMA 1E4EB 3DYBA 1OAKA 4WY2A 1ZGZA 4HQFA 3ZWWA 5TF0A 4MS4A 3IEKA 5SYAA 2QG6A 3DNPA 3PQ4A 1RPNA 3WQBA 1EP1B 2CCGA 3II6X 4UAVA 2WF6A 4X6XA 1EIWA 3BB4A 1DEHA 1Z4PX 1IOWA 1ONPA 1ZM2A 3CKLA 3HM2A 3MJHA 4QYMA 5EZ6B 3AR3A 2RDMA 3K0CA 4P1ZA 5CBKA 3WWPA 1XDSA 4ZVTA 2FKAA 2AG5A 3KU4A 1P8JA 2ZYSA 1T24A 3GBPA 3N8KA 2XUHA 1K8YB 4I19A 5DTRA 4UMFA 5JI2E 2RGCA 3HVKA 3CPEA 4P4UA 2ADMA 5DXJA 3DMTC 3D1VA 3UHFA 4AZ3B 4AULA 5JSFA 3ZV4A 4JLSA 3KJHA 4O5OA 4DCOA 3PCXA 4JVMA 3ZX4A 4BLUA 3JWPA 2JJ2A 2NVBA 2OSBA 3WMGA 2GYWA 4RD0A 4GU5A 3I34X 2R25B 5T67A 3WHIA 4A0QA 2Z4RA 4HUQA 1E5DA 1W6RA 2AN1A 1O96B 3SEFA 4EJSB 4KE6A 2QRKA 2ZM5A 3ZD6A 3NBMA 1YT5A 3DR5A 4CFSA 4MRMA 1WZEA 4TT3A 3HUTA 1FUUA 2VHQA 3JQFA 3H0CA 2R66A 3WGJA 4WOKA 1V8FA 1DXYA 3EZ7A 4N5IX 2IWHA 3L7LA 5BR7A 1SURA 2FY8A 3IQGX 3N9IA 4LXGA 4ZJPA 5K9ZA 2HLDA 3ESZA 3H4MA 2C98A 2ACEA 2EEPA 5IZCC 2O1WA 2VA8A 3OMWA 2QRVA 1XUOA 4IMIB 3FY4A 4FOOA 4YNBA 3SF8A 1E2PA 3W7AA 2XDYA 4JZYA 4E2WA 4IDOA 4JFAA 3DOIA 3P26A 2QDXA 3EQ7A 1G2OA 5BV1A 2O3JA 2AFHB 1SIOA 3EDMA 5EXEA 5KTSA 1YAJA 3L4SO 2OV6A 1T43A 1DZIA 3Q9LA 1EUQA 3NEJA 4BVFA 3ZDZB 1SD5A 4MKZA 4CDRA 1JR3D 3Q5DA 4PYQA 1FPQA 4LN1A 4HLUC 4Z9XA 2A8YA 2WF9A 1BX1A 1BX3A 4DB4A 1X1BA 2I22A 3ENKA 3JWIA 2DE0X 3WV4A 2ZB7A 3ANMA 3DHYA 1KRHA 5CFZA 3UMJA 2D1RA 5FBRB 2DFVA 4HXGA 4WNCA 2GAJA 4PX3A 4QOIA 1T8SA 3TTTA 5CCXA 2R2AA 1PQUA 1Q57A 2JKVA 5F23A 2A86A 4GR5A 3CX7A 2BM1A 4WACA 3TLEA 1QLJA 4ZDKA 3QX9A 1KE2A 1XTVA 4M0UA 3BZUA 1VE3A 4D2IA 2O1SA 4BB6A 1FSSA 2M6RA 3IMFA 1OFGA 3F98A 3PRHA 2QZPA 4I5DA 1ETUA 2Y1LA 1G20B 1IAQA 2OCLA 2W4QA 3LK6A 4BU1A 2AJ8A 4DV5B 1SEPA 4UHEA 2ZKLA 2D0IA 4UXIA 3H1GA 3SJBA 1QYXA 3EZLA 5FI3A 1CNFA 3SN6A 3PTLA 3M0EA 2FSUA 5L3SB 1G8MA 1RQLA 3U62A 3BERA 1XQXA 1WMAA 2B4KA 2DBQA 2NAFA 3QELB 1TX4B 3JYLA 4JSTA 3A3PA 4MQLA 3RJZA 4DM3A 1FX0B 1TMOA 4HLQB 4G4GA 4HXEB 1BDHA 3T38A 3B89A 4Q00A 5TQ0A 2X7XA 4TSKA 2Z08A 4PC7A 2H65A 3KLMX 2XWQA 1RJFA 3TLGB 1SVMA 1TKBA 3RUIA 4RFSB 2DF8A 2J9FB 1PGPA 3V8BA 4AO7A 1UDCA 2FW8A 4DR1B 4M8NE 3ONDA 1R16A 3KOUA 5E4JA 1QLHA 5L51A 2GK7A 5EKXA 3RREA 1QFZA 1S3GA 4OF4A 2ZTLA 2DFNA 2X9QA 3P0JA 4M49A 1I4DD 1Z4IA 2VP9A 4RIEA 4C0BA 2VDKB 3C39A 3GPCA 4YRLA 5ALGA 1CUFA 4ZRMA 3B8HA 4LF4B 2CXOA 1TAUA 3U81A 4GKVA 5JAMA 2YDXA 1QOPB 1U1CA 3P2EA 1E79A 1GPBA 2RI1A 2FMTA 1M2NA 3DKIA 4CEHB 1XG5A 1FSFA 4QM7A 3HUFA 2PJDA 1O6GA 3EVAA 3QVJA 2ZE7A 3QW2A 4PFSA 4JGBA 3GAAA 1XKTA 3JQGB 2ZS9A 4RPGA 3SHVA 1BOOA 1PJQA 2D4AA 2XUPA 2P6NA 3SGLA 5EJ8A 3ZHXA 1M2OB 2XKKA 4UCWA 1T1JA 3RAFC 2PKYX 4JT8A 3QEOA 1KI9A 1AGXA 2J9YB 3B1VA 4AMZA 4B3RB 3G5LA 3BE6A 2Q5JA 4BQPA 4IW3B 3VR3D 5ALOA 2RHCA 2R7AA 2WWIA 4ZAZA 3N7UA 4H6PA 4Q7MB 2ZITA 3ZTYA 1K2WA 1EBUA 4OGGA 4A26A 2RGRA 1I9GA 2VPWA 2JAHA 3M1YA 1N5JA 3RYFB 3W8EA 3ZCQA 2AMJA 4C4AA 3C6QA 1YZYA 2QNIA 3S2EA 2JJ1D 5JJIA 4DIMA 1HE8B 2BJHA 2PZKA 3MTEA 5HKLA 1FU4A 4J2HA 2ZR0A 2OZPA 3DLPX 1XCJA 3JVVA 4GKAA 4Y2QA 4QXPA 2ONJA 2Z1DA 1OROA 3S29A 3AUYA 1JRLA 3UFXA 1G66A 4FMDF 4H1WA 3SI7A 5GZ1A 4GXRA 2XXAB 2Z3VA 4KGZA 2AR0A 3QBEA 3GEDA 2V7QD 1E2IA 3KL2A 1NBOA 1TTTA 1K9SA 4P36A 3U2QA 1HFEL 1KA9H 1WZ2A 3TAXA 2EZ8A 3L77A 1VE7A 2C82A 3PNQA 4FJ2A 3VNAA 3OE7D 3WC4A 4U0JA 1E3LA 2P78A 2NUAA 1T8PA 1G55A 2YN2A 1DWOA 4PG5A 1NZDA 4AJ4A 4RGQA 2BW0A 2NGRA 3T61A 3IT3A 3CH4B 4UOQA 3WJAA 2WJJA 3L7YA 4A15A 5H1YA 4W9RA 2O0LA 4E22A 1JIVA 2CXUA 1ZUWA 2MJLA 1DQYA 2C4MA 3EDQA 1R0CA 5DXAA 4A3SA 4RFLA 1QQAA 1XPUA 2C96A 2GBLA 2YFKA 3QE0A 4C6HA 3MS2A 3AI7A 3UG6A 3A6LA 3F2IA 4NPHA 1JIJA 1OAAA 1WS6A 5J1SB 3RRFA 2PUBA 4ENSA 4MYSA 5FBQB 3QFHA 1JFVA 4QOGA 2Q1UA 4BLWA 2P6RA 1UEJA 3AKZA 1CW2B 4YIHA 1KYTA 4GLJA 4J16C 3KWMA 4D3FA 1JLLB 3UJ3X 6PFKA 3BJRA 1TTPB 5HZHA 2AJCA 2HU5A 2ZJ3A 1A76A 1RHJA 3JX9A 2B4QA 2P8SA 3CN7A 3QBTA 3KPVA 4HH3C 2CVQA 4ALIA 4BIIA 5HX7A 3L9XA 3PFCA 4GQIA 1KOLA 5HIIA 2GTHA 4JB8A 3KCNA 3RSLA 4AF8A 3UYKA 2WD7A 2JZNA 2IHYA 3FOAA 1KJWA 2QSUA 4GQBA 1LVGA 2ZJAA 3MCZA 5DWDA 9LDTA 3IFSA 4OUKX 3PRYA 1FMLA 1XCMA 5AP9A 3ZGVA 4V0LA 2WA1A 4PLPA 4AWAA 2BDUA 1ODKA 2CKMA 2OGUA 3QH4A 5TF4A 1LBIA 3C15C 1G3UA 5CVCA 1EHCA 4M1QA 1P1HA 1XEWY 2BEUB 2XMPA 2JI7A 3QBDA 1Q2XA 2Y1WA 4Q34A 2CV1A 5KQPA 1ORDA 1YMUA 2GKGA 2WHRA 3BSWA 4WCFC 4XIGS 1AKMA 1A2KC 5IXJA 2YHIA 1EX1A 1NJGA 2RHLA 1R0WA 1WVIA 2JVIA 2V59A 1B6TA 4URHA 4C07A 4OYRA 3T7DA 1KMNA 1TGVA 4HVAA 2WIFA 3EOBI 1OX5A 5LQUA 5AT1A 5M34A 3ZK8A 3CEMA 5JYCA 1ORHA 4WIAA 1X7GA 1JG2A 1CZRA 2YIMA 1TYEB 1WIWA 2QD1A 1YNSA 2VLBA 3DWGA 3O8DA 2YJ3A 4PRLA 4R8MA 4XH9B 5D3ZA 3AOEA 3NTUA 3OCUA 3QK7A 3WDMA 3ZLUA 3NFYA 4LFBB 3AIMA 2ADOA 4DEYA 3BXOA 4UNQA 4HWOA 2B7BA 3TMKA 1YONA 3WLSA 1LB1B 3MBOA 1C7RA 1O97D 3VVMA 2ORVA 3ZWNA 1DKUA 1PDVA 3IAS1 3NIGB 5AXBA 3VZRA 4DLXA 5CVEA 2FA9A 3BAFA 4M1EA 1W85B 3FI0A 2PJUA 3TLMA 1RXSA 3ZE2B 5HCIA 2Q9UA 4ZYUA 2FPXA 4V3BA 2GM3A 3BWDD 3KJEA 4JY7A 1SIUA 2RIRA 4I1SA 1AHIA 3EYWA 6YASA 4W9NC 5JNUA 2IIQA 4WZBA 1JPUA 2ZOSA 2ERYA 1U7ZA 3HNPA 2BZGA 3TBFA 1UIRA 2A9FA 1HR0B 4XDYA 3STHA 4YEDA 1P9RA 1QYVA 3PWKA 1H4TA 4CPDA 4FINA 5IMBA 2EDCA 1E79D 1QF7A 2VAVA 3G9XA 2XAUA 4GW3A 4A10A 3IILA 4DV3B 2QX7A 1DTWA 4B6PA 3ZGOA 2RHJA 4EJ2A 3AKEA 4JBWA 3TZLA 5F5NA 3OURA 3E53A 1NQVA 4EPYA 1VP9A 2PJZA 4QJ5A 1NG9A 4W63A 1ADCA 2G76A 3Q6IA 1EX7A 4G25A 4KO1S 5EE5B 5CDFA 1DAKA 2TECE 4HDKA 4QNNA 5AOAA 2W2KB 2FI1A 3R0VA 3BE4A 1E7WA 3KEQA 4EVQA 1P4SA 1B7GO 3H86A 2JK0A 4BEJA 1J22A 2H11A 2NSDA 3ELBA 2VO1A 1C4OA 2TYSB 3CRZA 1PTJC 3GJ3A 3KYJB 5C7YA 1TXGA 1X7YA 3EFHA 4H16A 1Z8NA 4WLUA 1DAPA 3AR4A 1VL6A 3VNUA 2GGSA 2ICAA 1H22A 3R23A 1DO8A 5FB3A 3WG9A 2B1JA 2WWFA 4AFNA 4W5RA 4B2YA 2WB2A 4C7JA 1PD1A 3FSGD 4OM8A 3TLKA 1M5RA 4YQEA 1FDSA<