4LZOA

Crystal structure of human prs1 a87t mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
304
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTTVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 304
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lzoA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lzoA02
4RACA 1I14A 5ESWA 5BQPA 1D6NA 1P19A 4IJQA 1O57A 5IAOA 1HMPA 1GPH1 4PFQA 2P1ZA 5KAMA 1ECGA 4RADA 1GRVA 1A4XA 4P83A 1A95A 1QB7A 1IBSA 1UPUA 1OPRA 3EFHA 2JI4A 2E55A 3OZFA 2H08A 1J7JA 2C4KA 5BRNA 1ECBA 5HIAA 1P17A 4OHCA 1JLRA 3ACCA 3HVUA 4JITA 4M0PA 4P84A 3LRTA 3KB8A 1QK5A 4P80A 4LYYA 4WN3A 5HKLA 1DKUA 4FYMA 1P18A 1FSGA 4RV4A 1PZMA 2PRZA 3OZGA 1ZN7A 2WNSA 1A97A 4P3KA 5ESXA 5KAPA 4F8EA 4LZNA 1Z7GA 1OROA 1I5EA 3ACDA 3M3HA 4P86A 1U9YA 4X44A 3S5JA 4RAQA 4JLSA 1DKRA 3N2LA 4P82A 2JKZA 1OREA 3NAGA 4RHXA 4RQBA 3H83A 3DEZA 1AO0A 1XTVA 1STOA 1I0LA 2PS1A 3LPNA 1QCCA 1BZYA 1A98A 1XTTA 3G6WA 4MB6A 1DBRA 1YFZA 1ZN9A 2GEBA 4S2UA 1WD5A 1QB8A 1U9ZA 4RHTA 1NONA 4RHYA 1UPFA 1UFRA 4TWBA 1TC2A 5BQOA 1P4AA 2JBHA 5IPFA 2VFAA 3DMPA 2JKYA 1LH0A 1QK3A 2XBUA 4M0UA 4WMLA 4RQAA 1QCDA 5JSQA 1G9TA 1A96A 5E38A 4P81A 1ECCA 1XZNA 3ACBA 3QW4B 3GEPA 2IGBA 3MBIA 4RHUA 2AEEA 3DAHA 1ZN8A 1R3UA 1VSTA 4QYIA 1MZVA 1XTUA 1XZ8A 1HGXA 2H06A 4ZFNA 1BD3A 1A3CA 1ECFA 4RAOA 1VDMA 1W30A 1O5OA 2HCRA 1V9SA 5JV5A 1QK4A 1NULA 1TC1A 3OHPA 1CJBA 4LYGA 3GGJA 4PAWA 4LZOA 1L1RA 4QRIA 4RANA 5EUCA 1DQPA 4X45A 3MJDA 1G9SA 1DQNA 1VCHA 1ECJA 1BD4A 1G2PA 1G2QA 4LZAA 2H07A 2PRYA 4M0KA 1L1QA 4KN6A 4Z1OA 1JLSA 5K51A 1Y0BA 3GGCA 4QYIB 3O7MA 5BSKA 2YZKA 2FXVA 1I13A 4RABA 2EHJA 2DY0A 1I0IA
chains in the Genus database with same CATH superfamily
5BN1A 1HORA 1OR8A 4OQLA 3DWIA 3WYGA 4BO4A 2YIVX 5LR6A 3IP6A 5EWMB 4MKRA 2OCIA 4LBZA 2E89A 1T8SA 5ICMA 3IXMA 2SCUA 1ZQ9A 4CE6A 4DZZA 1FVXA 1NW8A 5EI5A 1FMCA 5EN4A 3TUJC 3ZZMA 1E6KA 1OGIA 2AOVA 2RGBA 2YRFA 3LUJA 4J75A 3B8EA 5HIJA 1RRMA 3D5EA 2AIRA 4DR4B 1YZVA 4RFLA 2FJ0A 4HNVA 3T7DA 3GNQA 3HADA 2Q4RA 3GGOA 2OAGA 1E7QA 3I8SA 5BVGA 3HO1A 3E8SA 1QFZA 4L15A 1SO8A 4BNVA 4EP1A 3K5PA 4KO3S 4LOJA 2BFNA 3RUDA 5E6SB 4R9UC 5JDIA 1EP1B 3FUVA 3WOHA 3OTQA 5DHAA 4G0OA 3FCAA 5IZ4A 3BIXA 3M9WA 2HU2A 4NWIA 1MIOA 1CRQA 4Q1EA 4JLKA 1UAAA 2QEQA 3O82A 3EFEA 4A0GA 4K46A 4X3CA 3LVFO 2C7PA 2NO4A 4CUZA 2K7ZA 5CDSA 4CM8B 3JPWA 5K0FA 4BO8A 1YACA 3WMGA 4FQ7A 3DYBA 4KRYA 3VC3A 3Q8XB 2YZ7A 4KXQA 2PX3A 1MIHA 4O2RA 2CVHA 2VP6A 3GFPA 3UV3A 1YOBA 3BFVA 4LCEA 1KJ8A 1GGEA 4UM7A 4CKCA 4DYVA 3WWYA 4HB0A 3WK9A 3FHJA 3EVZA 5MFZA 1JQ5A 2XUKA 4KUGA 4MUFA 2QYTA 1OIVA 1J20A 1UPCA 1QNLA 2R66A 4IIDA 3UB2A 1JSXA 3TFOA 4PXYA 5JS6A 1XQ6A 2F6RA 1C1XA 4ESEA 4EQ6B 3CRZA 5KTYA 3C16C 1JTVA 2AUNA 1RHKA 1UJ2A 3NBUA 1M2EA 3EE6A 5IRCD 4BTVA 4PZ0A 4TV8F 5GOZA 3MBOA 4KLCA 1E2DA 2QLNA 2V4ZA 1KJJA 2HX1A 3O84A 4O25A 4EJMA 4UFPA 1QYVA 2RHDA 5JY6A 1AQNA 3RAFC 2B6NA 2HLDA 1QHXA 2EGUA 2H1SA 2LRHA 2JGMA 3CEJA 4N40A 3TTTA 2IYYA 4P81A 1W4CA 4DNPA 2QG9A 4R8LA 5BR4A 1P5FA 2VXOA 3R3VA 4Z1MD 2OAP1 4PLFA 3C39A 3FPAA 4MV1A 4I3HA 5ICEA 4DR3B 1R3UA 2JJMA 2HSZA 2P9EA 4NCXA 4BNJA 3DFUA 4J8PA 5IUNC 2ZQYA 1LSJA 2A5FA 2H52A 1HR0B 5LD2B 4DIMA 2KQUA 4TLAA 3KSDO 5BW6B 3V8MA 5DOVA 2XZOA 3TPCA 3DFKA 4L57A 4XGRA 1GL9B 4BEJA 3TH5A 2H1OA 3SC4A 3TTYA 5KYXB 1U0GA 2H65A 3EH1A 3LP6A 3UZUA 5AWFC 2A35A 1GA6A 2PZLA 2HEIA 1GQ2A 1Y37A 4C21A 1B0ZA 4Q4LA 4P35A 2H07A 1L6IA 4P36A 4ZHQF 3H1BA 4C5AA 2VNJA 4RF2A 2ZTSA 1WHTA 1KH3A 2IHUA 2D0PB 4P8RA 1Z5UA 3TX6A 4C6HA 1GNTA 4MMZB 2N42A 4RKWA 4R1LA 1KYYA 2I22A 5EFOA 3K6KA 2VQDA 2OHXA 2QM0A 1MJFA 1Z5VA 4MPJA 2Q9AA 3QM1A 1RJEA 4ZT6A 4LNUA 5T4HA 2XH8A 1L7VC 2V0NA 3S1AA 3AR4A 3AIIA 2EWVA 3IEIA 5G4KA 2GZRA 3LX8A 3BGDA 1N8SA 1OLUA 1YL5A 5BMVF 4O0LA 2E4YA 2OFWA 4YROA 1ECGA 5ITWA 5H4HA 3UEOA 4JIGA 1KAQA 4A6DA 2VSQA 2JJ8A 3VHRA 4BCDA 1K0UA 4J3NA 3BORA 3A1DA 4N54A 1E6MA 5F3RA 4BY9E 3K70B 4NICA 4QU5A 4US1R 3GUHA 4R9RA 4E07A 3B1KA 2V7QD 1FC0A 2WBLC 2YX1A 3TJZA 3OKCA 4EJSB 3A6HA 2ZCJA 1I3CA 4P0PB 4RETA 1QTNA 2GN2A 4D9MA 4DSZA 4A27A 5E8JA 1RPAA 2GPJA 2NYVA 2PLNA 3I04M 1T5SA 3FSRA 4TMXA 4KO8A 5IULC 4D96A 5FWNA 2C4TA 3DZHA 3VVCA 4K9KA 3TIIA 1RWWA 2JA1A 4CCAA 1QE5A 1JJ7A 2WHYA 3KVRA 3NDIA 4TWAA 2HBYA 4ZOBA 2MHCA 4IQ0A 4OMDA 2HQ1A 4RSRA 4ZCMA 3R7SA 2PXHA 2EX4A 3N59A 2ZAGA 1XCPA 3QQPA 1GY8A 1OX5A 5CMLA 5JVDB 3P5BA 1N1DA 1DL5A 4MR9A 1UKYA 4GLJA 4JEIA 4IIYA 4OXXA 3D8BA 1ENYA 1ZINA 3MYRA 4HAVA 4W8HA 4YONB 3TIXB 2XZLA 3NAZA 4E11A 5DWQA 1GSIA 5E9AA 4HT3B 2BCJQ 3MINA 2HRQA 4WV3A 2IZOA 2W48A 4TQ9A 4WCFC 1A98A 5DN6A 1FVHA 2OCXA 3SHTA 2F8SA 3VU3A 1ETUA 3W78A 5BW8A 1L7OA 4MYUA 3PQ4A 2Z9BA 1SKBA 3CKMA 1CFZA 3C87A 2GHQA 3QVUA 2C00A 4EELA 3R6TA 4DSUA 2UXCB 1ZOPA 2XKAA 4G0WA 3MJVA 1O6ZA 2PA0A 3STHA 3JQ9C 3JQAD 3U81A 1YDMA 1O0SA 1JHYA 2B3TA 3L01A 3TQRA 1TJYA 2BKAA 1RHRA 1YC2A 2NN3C 2CXXA 1C7FA 3C3YA 3OEYA 5DE3A 1B15A 2IOHA 4DV3B 2VDLB 3RH0A 5HX7A 3KJHA 1E5QA 3G2JA 4L75A 1AC5A 1COWD 1VZ3A 2BJVA 3D3KA 2HO5A 4IV5A 1XRMA 4ZA2A 5C7IO 3OD1A 3CKLA 4O0MA 4O4LA 5COAA 2J08A 2W2PA 4CTJA 4JLWA 2QIPA 3IBGA 3QKTA 4LNHA 4RH0A 3VPSA 10MHA 4G5FA 1UMCA 4WKBA 2XMSA 3N86A 3N7AA 1I2DA 4NESA 3DMHA 3CO5A 4RNDB 4FW9A 4ZAFA 3F6RA 1QWSA 3L79A 4AP9A 3BHMA 3H19A 2W2KB 4ER0A 4MK4A 3M1YA 3QXXA 5ALYA 5DX8A 1H2AS 3TZCA 2IY7A 4ER5A 2HQOA 4CM9A 1JR3E 3ODGA 1RLUA 1GV0A 1XEAA 4R6WA 2VYFA 1ZIYA 3LDGA 1NP3A 3R9IA 3RD5A 5HMLA 4CLXA 5IZCA 5CB4B 3HB4X 2OBNA 2LDXA 2GCGA 4M88A 2GK3A 4ND5A 1SA0B 1VMDA 3ZDDA 4MJLA 4IUDS 3HXPA 1FUYB 4RTPA 1K5DA 3HHEA 3IT0A 4ARCA 3RAPR 4GI5A 1RBZA 1J39A 4HN9A 5CX1B 5IT4A 1PJSA 4IHQA 3EMDA 5ICFA 4DJJA 3P9SA 3RS3A 1QVAA 3H8SA 4YCLA 1NJGA 3FAKA 1FQOA 4GYYA 1JIKA 5G3ZA 4ZHSA 1MHPA 4ZOQI 2BKUA 3REQB 4BIMA 2X86A 4GP6A 4OXRA 3OLXA 3WHIA 5AKZA 3KUDA 4NBKA 2XCOA 1W4ZA 3AUXA 1ABEA 2HQBA 1V3TA 2GYYA 4PPQA 1GNPA 3B8HA 5EL0A 1CQZA 3W05A 2H1VA 1VJ0A 5HIIA 3ZCPA 2C0QA 4ND6A 4AUNA 4HZUA 4JBXA 4MR8A 4FYVA 1HC7A 4AZWA 2C03A 5BWLA 1GQYA 1NP6A 2GI4A 3IT2A 3MMZA 4P7GA 5F3DA 1B6RA 1YQXA 3BDVA 4TT8A 2GVDC 4J4HA 2FWPA 4Y9SA 4EB3A 1Z6QA 3UN1A 1VLQA 2QRHA 3AOEC 4L85A 4ND3A 3ZE2B 1EXMA 1R27A 4MKHA 1GDTA 4MO9A 3NHAA 2ZXFA 3IDAA 3AMVA 2EP5A 1F06A 2GXQA 5KU1A 4IS2A 4I1RA 4AZTA 2DH6A 4YJKA 1DZ3A 3IDOA 4JHLA 3LGAA 2CMDA 1LRLA 2R1TB 4PE5B 3BE5A 4XVHA 1PQ4A 3WGOA 3OQMA 4K6HA 2GERA 2I87A 2Q2OA 2ZJOA 4WZBE 1ZI8A 2EQAA 1PK9A 3EULA 1T5BA 1WZUA 2FRVA 1MNAA 5EWLA 1QF9A 3SG0A 3UK1A 3M9LA 1QPZA 2JLVA 2MTBA 1P4HA 2X9GA 4YS6A 1O96A 1PUIA 4EATA 4DMGA 3IJRA 5HJ5A 1F3OA 2VXYA 4UVDA 1J2RA 5L95A 1BA2A 4OFZA 5T4FA 1QB8A 3PNPA 4IVNA 2OSVA 4NIMA 4L72A 2XODA 1VECA 1U94A 2AOTB 3DVLA 3N5KA 4DR6B 2RGWA 3H75A 3RUEA 4DMUB 1DXYA 3UHAA 1SUEA 4MKGA 1RJ9A 2PUTA 1X7XA 2QB5A 3GUYA 4ZI7F 3NBZC 1DIBA 3K0FA 3ITKA 1SCKA 2WU4A 2ZB2A 3MTEA 4ZKEA 2BEKA 2D2FA 2UZ3A 2FP4A 4EHIA 2ZSKA 2Q5EA 1E8DA 3FTEA 1VIYA 4WRRA 1JDSA 5ALUA 1YBFA 2V7EA 1RNLA 1XDUA 3D6TB 1PWYE 4PZLA 2I2CA 5JVDF 2ZJ3A 2O7NA 1G42A 2QTTA 4D56A 1J5EB 1T5HX 2JD1A 1BFUA 2PSEA 4TQUS 4O3MA 4DNOA 4CEHB 2G1UA 3OEEA 3ELDA 1OFGA 2GTHA 2RK3A 5TLSA 2FN4A 2HF9A 3FPLA 4P3XA 4D2IA 5IVPA 1XZQA 3ECCA 1UDBA 3WLEA 1XZ8A 2FN8A 4G0MA 4EG0A 1QHHB 2P2LA 4F3NA 2WTUA 4A36A 3D2LA 3GP3A 2VC2B 4D3FA 3Q8KA 5IWCA 2H5JA 3SNHA 1IQRA 2AQKA 2HCRA 4KGVA 2QN3A 2FZGA 3DTYA 1VMAA 3ZWWA 1QVVA 1HE5A 2II6A 2ZGVA 2MOKA 4CUKA 1OKKD 3LA6A 3P4UA 1F4PA 2BW0A 3DEIA 4S2EA 5CT4A 2IP1A 3PB3A 1FNMA 3GEBA 1G9XA 4UULA 2VHVA 5CT6A 3SDZA 3SIWA 1QE3A 2AXPA 4F0JA 2QTMA 1YE8A 3IHLA 2QTZA 2VRNA 2JLRA 2WK1A 1PFVA 2ZSDA 1P60A 3DVAA 3X1MA 4BPRA 1SUWA 4YUXA 2XNDA 1V2HE 2UVQA 3EXFA 2XB6A 2VWHA 3EIOA 1R9NA 3EVCA 3K9HA 4HDQB 4KXUA 4RACA 3LT0A 3G02A 3MTGA 3TLEA 1FDIA 4ZZ3A 4D97A 1F9AA 1O57A 1O94A 2IXEA 5E3JA 4F2DA 2ZZNA 3AKZA 3PUHA 4NCHA 5KTSA 1P91A 1A4XA 1Y1LA 3C45A 4O29A 2CW5A 3RU3A 1D4AA 3ECAA 5BW4A 4IDQA 5I45A 2JI4A 5L4LA 2P78A 3TO5A 4UE2A 3DBLB 4JUDX 1NLYA 1T2FA 4HADA 1G5QA 1Q0ZA 2PAAA 3PUVA 5KYVA 4ARUA 4BC1A 5ER6A 5LMUB 4YRNA 3U44B 4HMQA 2YWRA 3AR3A 2MSDB 2V7XA 4YRLA 5CB4F 5DW3A 2C92A 2ZAYA 3WFJA 4QDJA 4ZQGA 1WUKS 1NDHA 1U8TA 5KWEA 3ZBPA 4HFMA 2QKYA 4ZCIA 1BWSA 4KDFA 2XWPA 2ZVPX 5FBVB 4BMPB 4QQKA 2QRGA 1N36B 4A73A 4CTOA 4UUAA 3HKBB 5K3EA 4HRAA 4MWOA 3V42A 1GPKA 4I5EA 3ROEA 4Q1AA 3DTVA 1U5CA 3V55A 4ENTA 3Q1KA 3WLMA 4B6QA 4JLSA 2YICA 1WB9A 3BQNB 3ZDBA 2D1TA 3AJ9A 3O75A 4QDZA 3A3PA 2E4XA 1SUPA 4TTVA 3RBVA 5JYBA 3C6XA 1ONNA 4YT5A 4YALA 4JT2A 5LKRA 2ZT5A 2P9BA 3G6WA 2ZJ4A 5EYPB 2AHOA 5AKGA 5IAJA 1ZOOA 3IBYA 4WXPA 2PUVA 3EVAA 3COWA 2BLLA 1H66A 2ZOSA 3HCAA 4O4IA 2FMTA 5H3LA 1CRZA 1JLLB 4R31A 3ZW7A 4HB4A 1TYDE 4G5XA 1TQ4A 5DLEA 5HDQA 1G7TA 1A88A 2F9MA 1O5TA 4JBHA 4QDUA 1Q19A 2WM9B 3FCOA 1KDTA 2XCIA 1NV8A 1HTBA 2X1VA 2ZTMA 5T4BA 1T35A 1THTA 1ZNXA 1HETA 5T5QA 3NHBA 2PO5A 1BOFA 2GDJA 3LKZA 3L7KA 1DO2A 4LV6A 1N32B 1QS0A 1EUDB 5E0OA 2GM5A 2PT6A 3R3JA 4XGQA 1XEWX 4Y2TA 5F4BA 4EO7A 3OIUA 1N5KA 3GAZA 3QVJA 3SKXA 2HUPA 4Q3EA 2M6RA 2DWOA 5A1JA 3HJTA 3G8CA 4FHFA 1VKOA 5KO2A 3AY3A 3GT3A 1S2GA 2A94A 5A06A 1CUIA 2N47A 3PA6A 4EBBA 3EDQA 1WA5A 2NT3A 1P2UA 4U5XA 5K20A 3NEYA 5JD6A 2B25A 4JOBA 1XO1A 4HRYA 3MS4A 3EZNA 2H54A 2DPLA 2HXSA 3Q2OA 3ZE1B 1G8SA 1QU2A 2ZYSA 1P2SA 1VHWA 2Z5GA 4MKXA 5B6PA 4UC0A 2BH2A 2FW9A 2NV6A 1N92A 1WIWA 3IDQA 1ZD2P 4AYWA 3ESXA 1MC4A 5JH7B 3OUUA 2WAYA 1OH5A 3HXMA 4YHBA 1IHXA 1VMEA 1Y6FA 4HB2A 4J29A 5CHEA 3MGCA 4KQCA 4TS3A 1YRHA 2JAWA 4CIYA 1A4UA 1DXQA 1A8PA 1S5PA 1EK5A 1XELA 1Y7HA 1D6NA 4XQEA 3VNBA 5LU8A 1WY5A 4LW8A 3LP5A 2OGSA 4Y2QA 1PT6A 4O4JA 4G0UA 3QF4A 5BP7A 1IZ7A 4N8EA 1PEAA 2FZ5A 3GXBA 1XZJA 2RIRA 3L6OO 2AE1A 4E2XA 1UOQA 3VA7A 2CVFA 1FIUA 1GKYA 1XKLA 2W8BA 1L8QA 4L6CA 4BGVA 2JAHA 2V8BA 3RJ9A 2I3BA 1PO7A 5LD2C 1W36D 1HQYE 1RQLA 1G5FA 1ZMXA 4DR1B 4Z0NA 1FTGA 5TRTA 5JNWA 1D6JA 5MGNA 3D3NA 1DADA 5JNRA 3G8AA 1UWLA 3U1TA 4MS1A 2VP2A 4RLQA 1E8MA 1ZRMA 1ZUNB 4QQNA 4HNGA 2XT9A 2Q2NA 1FDUA 3EXIB 2MDTA 2GZ1A 2OB2A 3MJFA 1M1UA 3TLGB 5CFNA 5HQ3B 2XA2A 3HY6A 2RBGA 2PY6A 5ER9A 4AJNA 1IN5A 5I4IA 4NG4A 3VPGA 4J07A 4DKXA 5A6SB 5I7SA 3I0MA 3CLUC 5M7EA 3O3MB 4U6QA 3USCS 3CLRD 5I7AA 3PWZA 2B2CA 3UMJA 4QODA 3SS9X 3TR6A 2AFIA 1NG1A 1RWKA 1F0PA 1UP7A 4ZAYA 2Q6IA 3E22A 5FUYA 3OTHA 2LUOA 1JUDA 1T8WA 9GPBA 3JZIA 1OXVA 5CVUA 3ZZTA 4M38A 3WGNA 3HN6A 4YMGA 3KLBA 2QMOA 1XPJA 2OBLA 4HWRA 2O2SA 3EXEB 4EOGA 2A1TR 4KIGA 4WLUA 1S3FA 1SRRA 1GRRA 3EEQA 1RMYA 3K70C 1U9JA 2RI6A 3BL5A 4NPHA 4H9GA 2V6FA 3E9YA 4D9EA 4RHEA 3HB1A 2O3RA 4GBMA 4EJSC 3TSAA 2V96A 4HLQB 1T24A 4K6CA 4ONEA 4JC5A 1EX7A 1T6BY 1QV6A 5CLQA 1G59A 4W6ZA 1IQPA 1ZNQO 2QVBA 1YF3A 4FS8A 3JALB 5DPMA 3WXBA 5KYYA 4GUAA 4HDRA 4IFEA 4BFXA 5LBUA 4GWKA 3ECSA 3S81A 1T4CA 4LJRA 2YWFA 4EFLA 1WVGA 1T25A 3FBGA 3R6GA 3WLRA 1GKKA 1CVRA 1MVOA 1PYOA 4DXAA 4G65A 5HILA 1C0IA 2H9YA 5EMKA 1T2UA 3OETA 4R2JA 5ARCA 5G0UA 1KVRA 2HL6A 1I7SB 4M7OA 1KAGA 3Q0TA 3MCUA 4JUBA 1PG5A 4RZQA 5KDLA 1U2DA 3HZRA 4HNSA 4X92A 2Q1SA 3JCZA 1VBKA 3ICQB 5FBQB 1O5OA 3D7MA 2ON6A 4D6YA 3NPMA 4Z2AA 1EG2A 1ELOA 2GZSA 1YQQA 1ZNZA 2AX3A 1KPGA 2WUWE 3BWDD 4JODA 1Q7TA 1M8FA 5TC4A 1TT5B 1Z33A 3H2SA 3OWHA 5L8VA 5F3WB 1KDPA 1WNFA 1E61A 3A2LA 3PR3A 4R83A 1AUQA 2JIZD 3U7QB 1CCWA 5FTJA 1YVRA 1IY1A 2UYHA 4CMHA 4CMAA 1EDDA 3WGKA 2LCIA 2UXDB 4C4RA 2YYYA 2ZR7A 1IBRA 1Z17A 3KB6A 5AKLA 3L6CA 1J49A 2DWQA 3HE3A 3L04A 4YJDA 5CPFA 1RYZA 2YNMA 4WCVA 5CDUA 1XSEA 4NBTA 1E6CA 3CJRA 3PQCA 1D2HA 4EMTA 1ZI6A 2JARA 3FNFA 4I7EA 5DHTA 4NOKA 2YBEA 2AJCA 2V03A 5J4HA 2A9RA 1YBVA 3GMSA 1SU6A 3B9BA 3WLQA 4B7CA 4J43A 1B26A 3GZNA 1D1SA 1OLSA 2I3DA 5AH0A 2AN3A 5D87A 4JQZA 4MEBA 5HKBA 4NI5A 1EJBA 3TFQA 2ZW9A 2PKQP 3KB8A 3ABIA 1V4NA 5DNAA 1LF5A 3AVYA 5GY7A 2JZNA 4WBNA 3TAXA 3NW9A 4I5DA 1DEXA 2OP0A 4CF4A 3MUEA 3RSQA 4G9GA 4YAUA 1VJCA 3JQRA 3NUGA 3FWNA 6GPBA 4L4ZA 4DR2B 3DOFA 2EFEB 1PNQA 3TL2A 2E4UA 4TMVA 2AOUB 4X54A 3HLTA 4MV4A 1Z0JA 1JH8A 2CNBA 2EJUA 1WCYA 4IIVA 2VHCA 2WFAA 3QK7A 1NBMA 1ZUIA 4G36A 3SAJA 4ALJA 4F2WA 1TUGA 1Z6ZA 4UAGA 2FQ1A 4B3DA 1ZD8A 2DPHA 1JKIA 2QE7D 4QOSA 1GUDA 2DYKA 2TMKA 2X2OA 4BNFA 3ZIAA 3K30A 3O8BA 4M9SA 1WXGA 3EPPA 5DCUA 4DPMA 4EFMA 1YFZA 2LKDA 2QSYA 5MN6A 4AJIA 4F84A 2BFEA 4MEJA 4JP3A 3F9IA 1M1ZA 1Y1RA 4MVJG 3ZHQA 4JBIA 1HDYA 4C0AC 1L5WA 5BN3A 5LUBA 2FFAA 3N05A 2VT7A 2GS9A 2WHRA 3OQHA 1D0VA 1HURA 1OMOA 3F3MA 2EV9A 2J0UB 3FETA 3MTIA 4ZCRA 1Z8DA 1KWGA 2O5EA 4MJ7A 4MYDA 1VRWA 4IF6A 1QM5A 4UBOA 2BMAA 3PKIA 4P3YA 3CVUA 4IXTA 1XU7A 4PGGA 5I9SA 3N2YA 2HDWA 4IIXA 3CZ9A 3N2ZB 4DCVA 5CA0A 5ALSA 2HSGA 4Q9KA 1V1MB 3O8OA 3B13B 3W6PA 3MEQA 2VNAA 1IG3A 1CR4A 2EW1A 5DXFA 1ISIA 1QQTA 4B47A 2J4DA 2OC9A 1JNYA 3JQPA 1H3NA 1Z4OA 4QULA 1NJ5A 4U1RA 3STYA 1L5RA 2G7ZA 3UFBA 2BP7A 3LKVA 1L4FA 1OV4A 2VRCA 1C0EA 1MB4A 3N7UA 4OKSA 4QPZA 3AXTA 4CM4B 2ZRDA 4O5OA 4F1WA 4RIHA 5HZMA 1AV6A 1QG2A 5B6IA 5FEMA 1OLXB 3ND5A 4URUR 2GN4A 2A8YA 3F3KA 3S2EA 2J7KA 1XZEA 1NASA 1ESNA 4CI0B 2CJFA 4GVPA 3C4QA 5F33A 1DAGA 2XZTA 4N12A 1TTPB 1PRYA 5LQRA 2X1HA 5G1OA 1Y3HA 4DLSA 4C1NA 5I4CA 2WA1A 5L3QA 2EFHB 2IXGA 5U9CA 5HA5A 4BZPA 3Q41A 2DH5A 2XXBA 2I1LA 4GE3A 2VWPA 3MWKA 1AGPA 2ODBA 3JW8A 4UUNA 3TRHA 5JMOA 2VBCA 3S29A 5J2UF 1Y3BE 1R0ZA 2DY0A 2IIVA 3AZPA 4RCYA 2IRWA 1BQ4A 5CTJA 3CE6A 2CCJA 4A0RA 1ML3A 3MWYW 3ZK9A 1A2KC 2HA6A 3SZOA 3A4MA 3F7MA 1J0XO 4P33A 3EGIA 1EB9A 1T3ZA 4D4LA 1KNXA 4I8XA 4Y6GB 4IIEA 2D1SA 3IRVA 1KI3A 4L4XA 3TLCA 1GJRA 1G8GA 5EMLA 3WGMA 2DTDA 4GL2A 4FXOA 3A1SA 4O1MA 4WZAA 2HLDD 5FORA 3I01M 3B6JA 2PBRA 3EPRA 3LC7O 1LLFA 3PHIA 2B34A 5LB4A 2I9PA 4L9AA 3TG8A 1W47A 4HSEA 1X9HA 1RKXA 3P5SA 3ZLBA 2J3IA 1NYTA 4Z7NB 3TM5A 1Y81A 3DOJA 3O74A 2RGUA 3EAFA 3GJ3A 1V16B 1K8RA 3IEPA 2H59A 3A1VA 5H3HA 1UC8A 2HDHA 1FDWA 3W1EA 3WI7A 1XIVA 3W8RA 2DERA 2PYZA 4UFOA 1KS9A 2AOXA 2VHZA 4OQXA 4QQFA 1E5DA 2FEKA 3PK0A 4QOHA 4E31A 5MN5A 4R8SA 2WYWA 5ALWA 4JI8B 3CN7A 3I9V6 3E82A 4CKEB 1NU6A 3SJ7A 3QMVA 2QZZA 1Z5OA 2A78A 2IF2A 1HNNA 1VPTA 3DHNA 3OZVA 2R6AA 3AP3A 5EAIA 3U4HA 4DUYB 5FFMA 4BB5A 2OOSA 5TQJA 3VR5A 2PUDA 1X7GA 3K53A 3A4LA 1JYSA 4S2UA 2BGNA 2IXFA 2OZVA 1BHJA 3IQZA 4ZANA 4BN0A 4G07A 5LNK6 3B9QA 2BFFB 1GCIA 4M3NA 2P6OA 2FPKA 4TL9A 4Z7OB 5FR2A 1E3MA 4QUKA 4TKVB 1AF4A 1YGYA 3BULA 2D4AA 3KELA 3JQ8B 3R5XA 4I1VA 4UCFA 4P7FA 1X8KA 4QDXA 5FBKA 2C9BA 1QZTA 3EZ9A 3NDPA 4ZOLA 4XE5A 3SR3A 4G1EB 1TL7C 1A2OA 4RZSA 1QH1B 3T38A 4IX1A 1ZUD1 4DA0A 2JLSA 1Z15A 2QRMA 3AVTA 4NVRA 4UTZA 2I65A 5FNVF 1JPUA 2PQ0A 3EC1A 4HGRA 4OYRA 1RWMA 2ZR9A 3BF7A 1H4VB 3ACBA 4IVQA 4XQCA 2QRJA 2X19A 4K81B 4B84A 3NDRA 3FB4A 1Q0TA 4KI7A 1M5TA 1IZ9A 1JU4A 1TE2A 3KLPX 4LJYA 1WZ2A 4A0HA 2OV4A 4X9XA 4YRQA 2YVLA 2FRDC 1RW4A 4J1TC 4ZFNA 1JJIA 3U4CA 5JZ9A 2I7TA 2LXNA 3A3NA 5DBFA 4C22A 2F2TA 4FFBB 4MQFA 1SEVA 2HT6A 3E4CA 1U9CA 4Z54A 2NX2A 4X44A 3CF6R 2GPWA 4B8ZA 3ZXSA 5E6UB 2CF6A 2EIHA 5CG2A 2Q62A 3B5EA 3QPBA 5SZJA 3S2IA 2J0SA 3TKAA 1N7HA 4EGSA 5H8WA 3IXLA 2FMUA 2HA2A 2V4UA 2ZJBA 4PLCA 3QA3E 5DN6D 2PSFA 1XZPA 3ZS9A 3THWA 3HFSA 4LGVA 2Q8NA 2DR0A 4NJEB 3TI9A 3T5AA 1AX9A 5C1PA 4X90A 3KWMA 2CGEA 3H5RA 5B1IA 5TQ0A 4TS4A 4EKGA 4LF7B 2FUKA 4XYEA 2JW5A 1L8LA 1EFKA 3PUWA 3AKCA 2IEZA 2G0NA 2IOYA 4B3IA 1JDNA 3BWVA 4PGMA 3NHMA 5JE8A 5LB2A 1VHTA 5B55A 5JNLA 5M3BA 2Y93A 4D74A 4NFYA 3RS7A 3S1LA 3NLLA 4IHJB 4K9PA 5TB5A 1QOZA 4YMSA 1XLTA 4H1UA 3ZWQA 3V5NA 1GZ7A 1W5TA 2VUHB 4PLHA 2FEWB 3NFYA 1YO6A 1R8XA 1K98A 1KR5A 3OZIA 5EUMA 1R5BA 3M4ZA 2PUWA 4ARVA 2N3ZA 2C3UA 3RS4A 5A5EA 4BGIA 4J6EA 1DB3A 2R4TA 1M7BA 1KXJA 2G4VA 4R2XA 3V8NA 3GBVA 1RSZA 2CL6X 3TQSA 1W88A 2NNWB 4MV3A 1X1EA 5BSGA 1IU9A 3QXJA 3G8DA 4L27A 3SYNA 2O3QA 2HMTA 2CVZA 2AG0A 4I08A 5B7QA 4A23A 2GTPA 3D43A 2ZT6A 2ZIEA 1E1DA 1RYDA 3LBAA 4FQ5A 4P4NA 3LCCA 5C34B 4DRZA 2VCEA 3Q12A 4JUAA 4XLZA 3UK6A 3W2GA 3VR6H 5AUQA 3PXXA 2VJAA 1H2EA 3GUVA 1O89A 3L43A 4DLUA 3O2SB 5INTA 2J5BA 3NWBA 2EJTA 1IOZA 4YPVA 1KOFA 4TMKA 3WICA 2XGGA 1ZXXA 3LYAA 3EWSA 4NF2A 2B1QA 5LLSA 2ZE6A 3KEFA 4MGYR 3QKUA 1FDTA 3UY4A 1UZAA 3C1TA 3W3ZB 4D3SA 4WI1A 5C9ZA 3L7BA 5K09A 1QRRA 3QV1A 1XC7A 4OI4A 5TPWA 2XGJA 2JH3A 4ENUA 1YCHA 4PG6A 5FJIA 3E7XA 3GI1A 4EHFA 1UFKA 2J59A 1A5AB 5U4QA 1FFGA 3KQUA 3VZBA 4FYHA 4N7BA 2VYVD 5IPFA 3HYRA 3RREA 4EUKA 1E32A 2OV3A 4LUCA 2AL7A 3VPDA 4Q1FA 4KR6A 1EQUA 1X1DA 1MXHA 4QJ4A 2BEJA 1QYRA 4MITA 2FOIA 1GT6A 3K3PA 2QT1A 1QCDA 3TNJA 1DVRA 4M9CA 2GJAA 1MC8A 2YVAA 3H5WA 4JJ8A 2F00A 1T2VA 2J33A 2M1ZA 3C1UA 1E7SA 1BFKA 3NBMA 2VHWA 2YJGA 1G6OA 1G98A 2A0WA 3DDUA 1QHSA 5AVKA 4KOEC 2G25A 4TMFA 4BEVA 5JS8A 2XRYA 3EMBA 3FOWA 4LXGA 3EWAA 2H4WA 1HDGO 1SCUA 3RF7A 3FN4A 5E4FA 5C7OO 1PE0A 1F2UB 4H2DA 5CCEA 5JASA 1C81A 4XJTA 3QWBA 2GYVA 2RK4A 4TV8A 1S7CA 3WTCA 4ZEWA 2AWNA 2WUEA 4YJFA 4MGEA 4L5JA 1ZKMA 1P1KA 2GTIA 4H08A 4RUKA 3C8HA 2R8PA 4PV7A 3M7IA 4FFSA 1IJBA 3AONB 4XOUA 5IVKA 3IBCA 1C9EA 3NIFB 5BXQC 3OJ0A 4JB2A 4EHNA 1DV1A 4DWJA 5DFAA 4RF3A 3BXHA 5KVVA 4DUZB 1CK4A 1E2KA 2EKLA 4IJ5A 1IZ8A 3K9QO 1DEAA 4OF4A 1QXSA 5K6AA 2P9ZA 4EPVA 5K0CA 4LFBB 1D8TA 4MS4B 1ONPA 1JQKA 1G60A 4RJTA 1I9CA 3O4IA 1BKSB 1QFSA 4LV8B 2Z1NA 1PD1A 5LLTA 3B3FA 3M1AA 4AKHA 4CLEA 2POCA 3Q2KA 4GRIA 1G21B 2PANA 4JB3A 4RYLA 4ZHQA 3H5NA 3O0TA 2IOQA 3IUYA 3OZFA 3FYUA 2D0IA 2QG6A 1A27A 3QFHA 4DSNA 5IT5A 3EEOA 2QL7A 3CX8A 1W0CA 1YQDA 1DOZA 2C0PA 4LXXA 2R65A 1WCIA 4X20A 3KOWA 4WACA 1IUPA 5DIFA 5EHNA 1JFTA 4K3VA 1JQDA 1CUAA 3P97A 1IULA 1N2GA 4GF5A 2VPYA 4D4HA 2I03A 2CJPA 2ZS7A 2R3SA 5BMVA 3BGIA 3NXSA 1FP1D 4YCCA 4JU9A 4KRXA 3Q10A 2D7DA 1JT2A 4EB6A 5A0FA 2XTJA 5EP3A 1I5EA 1RKBA 1C9YA 3UPTA 3NHKA 3DLIA 2BI4A 3J81A 4DIKA 1NWHA 1A9SA 3NGMA 5BUZA 2CHQA 2IX3A 3R9WA 2FR8C 4YGYA 4GOXA 3ZD9A 3OWOA 5KHOC 2FEPA 4X6UA 4A9AA 4OQ4A 2E82A 4NMMA 1JIUA 1PQUA 3C74A 3DHEA 1NQAO 5EZQA 1UOPA 1QGUB 3GMDA 2QW0X 2ZAOA 4DZRA 3G2KA 1LS1A 4UNPA 5U4XA 3EGDB 1Q0QA 1Q7BA 1VA4A 2HU7A 3EW9A 4YJGB 1CUDA 3VH2A 1M34E 2NM0A 4I1OA 4CG2A 2R7AA 3F7OA 3OKFA 4IHJF 3UYLA 1ISMA 3HI6A 4K2HA 3X3HA 2WP0A 5F7ZA 2PS9A 4Z4CA 1UBGA 2WPNA 1I4TD 2NUPA 2GK7A 3NHRA 3DONA 5LCXA 1XXHB 2A5GA 3ADOA 2V7PA 4PZAA 4UU8A 1OIWA 2QBYB 2FG7C 5IT9A 2VFAA 3QFFA 2RJ3A 5EE3A 3BH6A 5CT8A 2A67A 1WSAA 1E3EA 1XG5A 5GONF 1KVTA 4LHXA 1E94E 1NN0A 3ZV3A 2CN1A 1RXVA 2B8EA 1YIDA 1KYVA 4G9EA 4JT4A 1XCOA 4WVLA 1LDNA 1T15A 3LHKA 4BB0A 2V0GA 3ROGA 1F8FA 1RLJA 4O2AB 5KNDH 1Z2CA 2OVBA 2C78A 5CT9A 1D4OA 2AS0A 4Z3DA 2IE8A 4BKPA 1C1DB 4EY8A 1N4DA 4KACA 3KQSA 1CIVA 2IE0A 4IR7A 4YGXB 5G3YA 1ODKA 4IL5A 3L8MA 3TQHA 5EVJA 1K0FA 4TRMA 2R7NA 2HO4A 1BVYF 1UFVA 2WTNA 4HBZA 1JFSA 3H5LA 2M98A 4GMFA 2DEUA 3MQ4A 1F8YA 3MWEA 4X45A 2DBZA 3KUCA 4LXTA 4D99A 4CM8A 2PA3A 2J5RA 2B3DA 3GLHE 5A3SA 4RZUA 3M2TA 1GPMA 3ZK7A 2OAEA 1OT3A 2C7QA 1KHTA 1RVV1 5F7OA 2WD7A 5F76A 2MSLA 5I48A 1QPGA 4Z0HO 1TVCA 1R0WA 1LDMA 4YACA 1AQ6A 3KUUA 2PGNA 4N6NA 1D0SA 1ISGA 3LHSA 3ISJA 2ORED 4KR9A 1JR4A 2IYQA 3JWIA 3PYMA 1SCIA 2UZIR 3OOSA 4MQLA 2C9ZA 4JP8A 1C1YA 3ZLVA 4UEQA 5KNBA 3CUEF 1Z4QA 3TOXA 4OYHA 5BSVA 3DT6A 3JD0A 5EPEA 2AVDA 5DTRA 5KSYA 2CKDA 2ZUSA 3EDCA 2FWBA 2ZJ2A 2A86A 5T41A 1I5RA 3WMEA 4WJKB 3OD5A 4EF6A 1W76A 2BGUA 1K2VN 2EDCA 2HZBA 3TWOA 4CQLB 1DT5A 3A6LA 4BVGA 3PWTA 1E3DA 1JE1A 2Q5CA 2W6OA 1Q1QA 4G5GA 4JXXA 2Q29A 2VJYA 5JAOA 5ELXA 4DFDA 4IUYA 2FUG1 2AW5A 3A6JA 4A82A 2BGGA 1P74A 3CF4A 1IXZA 1CV2A 4PCLA 4RM2A 4ZTUB 5HJ2A 4B45A 2H1FA 3D6NB 2IHTA 4WX2B 2VYCA 3WQRA 2VCHA 1KF0A 5DASA 4KSYA 2X4GA 2IW3A 3NIGB 3GRKA 1AHIA 1MG5A 3EOBI 3O8QA 1ODCA 2W8ZA 4Y2HA 4QT0A 3E84A 1NVGA 4D9GA 3NG1A 5LIRA 4QICA 1HDZA 4AK9A 3HSSA 3V4SA 4ZQEA 3L3BA 3LQRA 1C0PA 2GESA 2JGEA 1CC1S 3KXIA 4G5SA 5DMXA 4RVGA 3GRZA 4REQA 5JNSA 1HL7A 3GN1A 4UD2A 1FUIA 1OWOA 4UMEA 3I3SR 4NR0A 4ARIA 4HGQA 4QVIA 4LDPA 3UK2A 5KCMA 2PKRA 4EPWA 3FCCA 3BAZA 3GC6A 4X65B 1NBWB 2P3QA 4FKZA 4FKMA 2I2XB 3WJ2A 1O9HA 1BAPA 3FF4A 3K2QA 4EPYA 1GEGA 1GKLA 4UD6A 5JU6A 4YJ3F 4CN9A 1WP4A 5H82A 3UXEA 1PHRA 1TAUA 3GRAA 1UDAA 2P6PA 3Q88A 4RLSA 5JZSA 3DKPA 2P7IA 1TJNA 3K0BA 3AUAA 3FCYA 3UKOA 4GAEA 4K9SA 1QP4A 3CINA 1R5NA 1VA5A 1ZVMA 3UWDA 2JRLA 1Y3IA 1OZ0A 1SC4A 3IJ5A 4E7PA 3EQ9A 3RTEA 3HXLA 4XM1A 1E9BA 4YP5A 3ZWKA 4ZYLA 4CIAA 1AE1A 2CUTA 2O0MA 4FDTA 2AQIA 2NT4A 3INYA 4YIKA 3U3ZA 2OO3A 2ZIFA 3R8CA 7YASA 1A96A 8AT1A 3P52A 3IKTA 1R4NA 1SURA 2V45A 4Z9FA 3LQKA 1R9JA 1DBVO 3SF8B 4MRMA 2BBSA 3LBFA 2VDVE 3O3CA 4E33A 1BQ3A 1JQJC 4MROA 3S6JA 4ZI7A 5MF6A 4Q3KA 3QVOA 1N0IA 4UCQA 2Z6AA 2H7YA 3JR3A 4N4AA 1Y7IA 4BCBA 4GPIB 2B2NA 5JCXA 1XGKA 1CUYA 2FPPA 2P1RA 1YJ5A 2CLIB 2H8GA 3MWJA 3EZFA 1FF9A 4AQ7A 1E64A 2NZYA 2QG4A 2CNNA 2ADFA 2O0JA 5ERXA 1C4OA 1HBJA 2BM9A 3CNLA 3OU7A 5JVDA 3IE0A 5EIWA 3IUPA 1FRFS 1S2LA 4FHCA 4WASA 1JYFA 1TJPB 2ECOA 1V8FA 3NJ4A 3MW8A 5CK5A 1ZM3A 4ZT7A 3TB4A 3T9CA 9MHTA 3HWWA 5FUXA 2XB9A 3NNDA 3Q87B 1ZD3A 4I4TA 1FP7A 3VO8A 4S05A 1T6NA 1T5TA 3QTBA 1E0JA 1ZVJA 4GBGA 5DTEA 1F2VA 1HRDA 3GJRA 4BEWA 4KE9A 4AY3A 4U0KA 2FSPA 2MR6A 4OD0A 3VNUA 4LZPA 3A36A 2DKOA 4QVGA 1H2BA 3FTQA 5ALMA 3BXPA 1GVHA 2FW7A 4QYMA 4F21A 4B35A 1QIMA 1G8HA 1C8LA 2WIDA 4F72A 3HDVA 1GRVA 1YHNA 2ZXEA 4N7MA 2HA0A 1XQ9A 2GBLA 1AGXA 3W3AA 3QLEA 3EGXA 1J5XA 1FDRA 2A9VA 3OC0A 1D2CA 2J6IA 1TZCA 2Q7XA 2X58A 2R62A 3T35A 1T4MA 2DCUA 3TE6A 5KVCA 4LQDA 5EHXA 5HUQA 3SOZA 1WM1A 1W29A 2Z5LA 2YR0A 2DCMA 1J0EA 1VJ5A 2ZRAA 1U65A 4R1TA 3TPZA 4ZI5A 3NO4A 2W2KA 2G77B 5IDXA 4F3TA 3ILHA 3BXOA 4HDNA 4MMXB 5GMOA 5JS7A 4A16A 4BP9A 5CB4A 1FSZA 2JGKA 1GZSA 3H5OA 4M6WB 1T43A 3FKSA 4TUYF 3VAZA 4C3UA 4BZQA 5JYDA 3ZCSA 3CU5A 4I4IA 2C4NA 3DEZA 4BLPA 3DMNA 4MQ6A 4XWWA 3P94A 2ZRPA 1Z28A 1DIRA 2SECE 5KKAA 3NP9A 1USKA 4FYIA 4DDKA 2FW1A 2AHRA 2C58A 1JKXA 1MRZA 1N0UA 3BA6A 3N0VA 5ILQA 3VPCA 6CHYA 2QMZA 5KHLB 2IK8A 2QJFA 5JRJA 1WXDA 3DV0A 3DGEC 4TXJA 4EHBA 5KDDA 1XMQB 1SHKA 3QEMB 1C9KA 3ROZA 1FL9A 1A04A 3F73A 3LK7A 3C41J 1NQOA 4R9VA 4FFDA 4GD3Q 5HKAA 2PUFA 3DTTA 1EUZA 1CKEA 3VAYA 3AZQA 4CT5A 3GUUA 4X91A 1U3CA 1NGSA 1CEXA 1TPZA 3Q2IA 2FFQA 3T1YB 3HKEA 4JLMA 5ALIA 2EHDA 4RWZA 1N77A 4G09A 1WV0A 2IUEA 2R84A 2ZBVA 3DVRX 3FCXA 1I7NA 2BEVB 2IBTA 2QUAA 2C20A 2QA5A 4X5OA 1ISFA 1P1IA 3DE1X 1QX3A 2TRSB 1CUSA 5ECWA 1KVUA 1Q2XA 4AD8A 5IKEA 5JANA 4NE9A 3RBAA 1SC3A 4AF7A 1P1BA 3KUKA 2E3JA 1HYEA 2I99A 1ORIA 1MZVA 3JD4A 4LXUA 3KQVA 3TMAA 3D0RA 3PD7A 4KN5A 4ICIA 5FBHA 4FMDB 1GA1A 4H1TA 4IPTA 3ZHTA 4ZAWA 1AKUA 1D5WA 1N9GB 1UC4B 3PCTA 1OBVA 1TVMA 2R1TA 2P2GA 2W4IA 4KH1A 4FZJA 2NU7A 3G88A 3PGKA 4GVLA 2WWYA 3AETB 3TBHA 2DUWA 4QWWA 1G9SA 3PNSA 4CYMA 2FOLA 4ZO4A 3U7IA 1KYWA 3USZA 1UBRS 4YA6A 3D4BA 3ZZNA 1KAMA 2XUGA 4GW3A 1IC6A 1RJDA 2F4NA 2OUIA 4MUEA 1C8KA 4TXHA 3TKLA 3YASA 4LBYA 3O6VA 4WXRA 4QQRA 2IU3A 1VE3A 3CVYA 3W79A 1HEUA 4C7MA 1GG8A 3K1AB 3V7YA 3K0AA 4NS1A 3JQ7A 2E7ZA 2Q0XA 2IH4A 4P53A 2RGCA 1IPHA 3FM9A 2OXFA 2O0LA 3IVRA 3QWIA 3OMLA 3D3JA 4KFRA 5A1TA 1YIAA 2J9RA 3N0RA 1IZ0A 4D9HA 4JOQA 5CFRA 3B2NA 2JGIA 2Y1EA 2XW6A 4QJ3A 1NN3A 3N0TA 3PCXA 4FDVA 3V1KA 1INLA 1SCJA 1WSBA 4LOAA 4PZCA 4IDPA 5BV7A 4E12A 3LDHA 5BURA 1IOLA 4ZVQA 1W5FA 3OIFA 1E60A 1XNQB 4PZUA 4UAJA 1WQ3A 4KQJA 3G49A 2NSJA 3CMMA 3MWFA 3C3DA 1G66A 2Z2XA 4NPAA 3W2HA 2J48A 4ZYTA 3S1SA 2ECFA 1NQUA 3H4MA 5EE9A 4M8KA 3E9MA 4I1IA 3VDMA 2QP9X 5K7SA 2JFXA 3E4DA 2WLSA 4J3FA 4W7SA 5K03A 3U3JA 3VPBA 4OB8A 4FB5A 1QORA 2VH5R 4FJ2A 1QHHA 2VRCD 3W7AA 4WPGA 3KQKA 5A0TA 3UANA 2QJOA 2XUFA 3P4YA 4Y6QA 2O2HA 2P77A 2XMQA 3T7AA 4ER6A 3EUWA 3DR3A 3F4BA 3M33A 3TRKA 5JBNA 1E99A 1E6EA 1UBHS 1OV6A 1DBIA 3C8ZA 3DDOA 1ZEJA 2LGJA 4U9UA 1AOXA 1JDUA 4DXHA 5BW5A 2JEYA 4E5NA 3UTCA 1D9ZA 1H0HA 4UM9D 2C95A 1B74A 3RUIA 3GLGA 1EHYA 1UDRA 4GLBA 3KZ1E 2W83A 1XWWA 3VOAA 1Y5IA 5LQUA 2GEVA 1MDBA 1SBZA 3FOAA 1AGNA 3LZDA 1BS9A 1FE8A 4LI0A 1I51A 2BHTA 2J3DA 2JGNA 2Q3FA 2Q3DA 2IEIA 1CP3A 1JU3A 2ZRGA 4UJ3A 3T3HA 3EA4A 4HF7A 4DGSA 1X1TA 3L84A 4RA9B 4EHDA 4F1KA 5C5DA 4MWDA 4N82A 4UZSA 2CMKA 3A9VA 3IKMB 3C5HA 3LCVB 2SBTA 2H7VA 4QEDA 3DNMA 2X3UA 3N8HA 1JSLA 1TO1E 1KY4A 1YBMA 1HZZA 5FWDA 1Z5WA 1SOAA 1K75A 2IPOA 3PJFA 3QPWA 3O8RA 3TDNA 4OL9A 3U44A 3UMGA 1KZ1A 4L16A 3HDYA 2JBAB 3FVRA 1A72A 4KBFA 2DM6A 4DDVA 3O8CA 3E3NA 4IFBA 3E9ZA 1Z45A 5DYNA 1ESCA 3WB0A 5KWJA 3M6LA 3NU1A 2REXB 4CWAA 1YTUA 4CTMA 1A3CA 1YQEA 1YDWA 2XUOA 3KLNA 3B3AA 4CXMA 4BXOA 1L4YA 1W0KA 2P4EA 2DAPA 4LMAA 1PJRA 1MABB 2W90A 3GXOA 4DT1A 2AEMA 2XSZA 2QVXX 1U6KA 1VL8A 5IF3A 2I6FA 4AKIA 4ZQIA 4PSAA 4ZV4A 3NS7A 2HFJA 4KAFA 2BGJA 4MVYA 4DG5A 4B74A 2EFGA 1J9ZA 2W5UA 3WMXA 1I9GA 4RW0A 1GUAA 2Q07A 5SZKB 4D5GA 5C5IA 1MGOA 4Q15A 4L22A 4MDYA 1EHIA 2ZSUA 2ZJ6A 1IHPA 4M53A 2HM7A 3R7AA 4G4SP 2JB9A 2SHKA 3ICCA 1ENPA 1XA0A 2FE1A 1JLLA 4BNHA 2RKOA 4EBFA 4F5EA 1EXDA 4BPBA 5KNCD 4DHWA 3ZXYA 3HEAA 5K3BA 1G6KA 2ZE7A 3M82A 1DRJA 3OE4A 2H2GA 4UHCA 3G5TA 1U7XA 3HSYA 4YJHA 4W5QA 2ZG6A 3RUCA 4FGLA 4FMDF 4XIIA 4B7XA 3ZBQA 4YY3B 4NARA 1H2ZA 4JBWA 5CJJA 1LDGA 2Q28A 4Y8VA 2CLHB 5FOXA 3SHOA 1ZESA 5IARA 4CEJB 3NDJA 1RLTA 4JZYA 1LY1A 2XD9A 5B3LA 1YUNA 4X62B 2B0JA 2F4VB 5FWAA 1FW8A 2AN5A 2R00C 3HJUA 1RKUA 2M6SA 3AUFA 3P8ZA 4DEVA 5JJIA 3CR3C 1BDHA 1G4AE 1NXQA 2OV1A 2PWAA 1CJKC 4L08A 1JSCA 2Q6VA 3W8DA 4F1JA 1SOVA 3PS9A 2JLCA 4OLHA 3OTOB 3HB9A 1JPNA 2F3QA 2H9AA 4Z99A 3RQSA 1W34A 3IOYA 4XPIB 1JZTA 4G0YA 5HCIA 2J9GA 2X8LA 2XVMA 2FI1A 3RJMA 4BVFA 5BYJA 5K2OA 1G4UR 2YJZA 4RVUA 1ZU5A 3TAHA 3O38A 4DBZA 1W5EA 4CDMA 4IHAA 2XDQA 1YE5A 3F5FA 3FHCB 1K2WA 1IQUA 2NV0A 1VIDA 2OGZA 4TL6A 1OXMA 5EJ7A 1CZRA 1RWXA 3TZ6A 1E79A 4M54A 3I5XA 1KDZA 1JHXA 3GDWA 1UJ5A 4TPKA 5DWVA 3WKCA 2AMVA 4PHFA 1XWFA 4F4JA 1A1SA 1X7ZB 2OLKA 3GFTA 4PC7A 5I5EA 2QS9A 3UVEA 4DCCA 3WKAA 1IBLB 5IJ0B 3U7HB 5BVHB 1XU4A 2IYFA 1PTJA 1OFHA 4YI3A 3UHPA 3W06A 4OH7A 5L7WA 3NBQA 2CUNA 5FUMA 2C8LA 1S89A 1QYWA 4JP5A 4G8JA 3U4QB 1J33A 4BTLA 1X1AA 2FW8A 1R8YA 1PNTA 2D74A 3L41A 1TAGA 4B44A 4GDFA 4L8WB 2WAMA 4J2HA 1EEHA 3AI1A 5F2NA 4RQUA 1QVRA 2GASA 5C4IA 2BMDA 1O95C 1ORTA 3NIWA 2CSUA 5AXAA 2YHBA 7MDHA 5LN1A 2IODA 3PGLA 2OPBA 5K0ZA 2NXEA 2YYAA 3ML1A 3JRXA 4IVPA 1RCTE 1ZUNA 4G8BA 5FL7A 3HY3A 4PTYA 1CUVA 1HE3A 1ZMRA 2M32A 2MIIA 3EXIA 4Q19A 4U8HA 4DC1A 4B3MB 2VHQA 3EDRA 3CZRA 3ADDA 1J9EA 5TEVA 4LWOA 1GYRA 4LJLA 1BW9B 2HAEA 3L0IB 2R68A 1SQ0A 5DLPA 5DTMA 3U7GA 2C8KA 3FWYA 3ITNA 2AZDA 2COEA 2ZRJA 3MGGA 4B6FA 2A0UA 4J0FA 1S3GA 2CYCA 4B3BA 1WVIA 2QVLA 1GGHA 3L02A 1HXHA 4CETA 4MPDA 3ZE6A 4KFCA 1YB7A 1VP9A 4IIUA 4KXMA 4D80A 4AICA 1IJKA 5A4JA 5GV7A 5JWRA 1JXMA 2A9FA 3A6ZA 1GTJ1 1P9LA 1PT5A 4I4CA 4X97A 1H0RA 1HQKA 2AFHB 3EDMA 4XSHA 5AFSA 1IN4A 2O19A 4JH0A 4MJXA 1OTHA 2FWAA 4HDOB 4FT2A 1RI4A 4Q03A 3E9EA 4LK3A 5JYEA 3HYLA 4AG6A 2ILVA 2D54A 3HUFA 2JGLA 4CCSA 1ZHOA 1C8BA 2C07A 2R6ZA 4CG1A 4DA9A 3KP1A 1P5JA 1M1YE 2ERXA 3LO5A 3ET4A 1WW2A 4MI1A 4UNIA 4BAGA 1FOEB 2BIFA 2HC9A 2I6XA 4OUDB 3NV9A 2IVZA 2VQ6A 1Q15A 3HHPA 1B42A 5I7UA 4AQYB 4B4DA 2VDPB 4KO2S 4W5WA 4BNKA 1SVKA 1JQLB 2Z98A 3UGTA 3RFCA 4LYYA 2V9PA 5J2UA 2VSNA 3GFRA 4J76A 3T4UA 4MEAA 2LPMA 2YRXA 1B73A 2VKQA 3DXFA 3ZH2A 1GNLA 2QXTA 5LP6B 1LDBA 1T13A 4EGJA 2GSDA 3EIHA 3H1EA 5FHQA 2PBFA 3R0XA 4WGGA 5B4TA 2QRLA 2EBHX 2B4QA 3U5ZB 2Z8ZA 4JT9A 4UNSA 1K92A 1ZIDA 1J25A 3GMTA 3R44A 4O5AA 3CSDA 3MJTA 3SU8A 4Q66C 4KV7A 4UDOA 4WTOA 2WLTA 2RG7A 2X9VA 2Z09A 4QJ5A 1QRSA 3GJSA 5DP2A 5EXXA 2ZROA 1YZHA 2HRCA 2ILTA 3I6ZA 4OJQA 4RS3A 3G5MA 2PR7A 5B1HA 4ALLA 1NRJB 5AM1A 5JAUA 1OB2A 4EHLA 3EVBA 2Q2VA 2JD0A 4KN9S 3U80A 1FA9A 4HEHA 1Z4IA 4JOCA 4QBKA 4G8CA 5AHXA 4BAZA 1REQB 2HLHA 3SSMA 4DM3A 5DK6A 3AX6A 3HCCA 3GB9A 4PAMA 2G9UA 3FOBA 1EFRD 2GEJA 3VO2A 2AH5A 1IRXA 3ND7A 3Q8WA 1OAOC 2QVYX 1CQJA 3PEEA 3DL7A 3QVLA 4IICA 3IP7A 1CE8B 2LCFA 3GFQA 4G5RA 4ZVRA 4YCMA 2YOFA 2QXYA 4M9RA 1ZL0A 3I58A 3MXOA 3GZJA 2QW8A 1US8B 2C77A 4IDOA 4OXYA 4DIDA 1SBTA 1K7XB 1SHLA 1K8ZB 2J0VA 2DX7A 2ZP1A 3I30X 4EMBA 3GRYA 1H22A 5I7HA 1F7VA 1JF8A 4FFLA 4HOYA 1ZJYA 3OZXA 4CU5A 1Z0SA 2AKEA 4M1ZA 3DOOA 4CL3A 1ACMA 1DUIA 4A8JA 1M2KA 2QRNA 3FCEA 4TX1A 3EQZA 4I55B 4JELA 4TN1A 1WXEA 2GO7A 3BOSA 1UBEA 4GZ6A 4LVOA 1Y34E 3DL4A 1VE9A 1HLDA 3N2GB 2BRUA 1KEWA 1FZQA 1E1YA 1QGOA 4FYJA 4Z7JA 2FWMX 2W6JD 2ZAMA 2V3VA 4IOLA 4PW0A 2Z4TA 5ALEA 4EZBA 2G08A 1TIBA 2R4UA 3F74A 3FHLA 4DQ0A 4YRGA 4I50B 1P9OA 1OE0A 4KXFB 5FNVA 3VUEA 1GUBA 3N8GA 1RJGA 1E3TA 3LLMA 5B37A 1OTXA 2WTXA 1UBJS 5GJVC 1ZRSA 1E1KA 3KTAA 1D2RA 3JX9A 1TKRA 2C4VA 3KR0A 4DBLC 4DR5B 1AK9A 1JEOA 2RGNC 3B53X 3NASA 3QOXA 4P4LA 4RMIA 5CT5A 3GRUA 2LIPA 5ALRA 3ZZ1A 1JVNA 5TF0A 3DYIA 5KX5B 4PLVA 5K01A 4EF5A 1JXOA 1Q95A 1D9XA 1LUAA 3FVTA 5B7NA 2H63A 4LBVA 5CVDA 4EY3A 4QIHA 1E5TA 3ZHZA 3AV3A 3LQ2A 3BHNA 5IANA 2GH1A 1MJHA 3BE4A 5D01A 2HLNA 1R5JA 3A27A 3TDMA 4D92A 1N6LA 1EFVB 1KORA 1U8YA 2WG1A 3KKEA 4XQ9A 1N8KA 4CI9A 2P9TA 1LJLA 3C7TA 4PNHA 1VE6A 3C6ZA 1Y82A 4IXMA 3O7WA 4ZVUA 2O8FA 5F9FA 4O4HB 5AM5A 1E77A 1GKUB 2G04A 2CL0X 4MYRA 1LVGA 2QQFA 4JLBA 2WOJA 2IYPA 2I67A 5ALZA 4YXWA 3FOEC 5CH5A 4IOKA 1CUCA 3GAAA 5T57A 4OHZA 3WLKX 2QAGB 2VP9A 2QJWA 1Z2PX 3H2ZA 2OK7A 2Q1WA 1M6YA 4H3KB 4ZAGA 4CLOB 1N2CE 5REQB 1UXGA 2A9PA 3O73A 3E05A 1CFJA 4WOKA 1SMKA 4XKJA 4JZKA 3T4EA 5A4FS 2AOWA 4KFSA 4ZKDA 3VH4A 3BIFA 3FE2A 1P31A 3WYEA 2FQXA 2H2WA 4WUTA 1EE1A 1PIWA 3QV2A 4UUOA 1PT7A 4ZIRA 4K8OA 4BBZA 1PWZA 5SICE 3FWKA 2YINC 1VP3A 4UKDA 3T4PA 3LHDA 3GA0A 5AUNB 1J2EA 2HFKA 1Z4PX 4CKWB 3NWOA 4TMZA 3VMMA 3CG4A 4P7KA 4HVAA 5CCXA 2G71A 2A1TS 1I4LD 3F5MA 3ELBA 4H17A 1DAPA 1F2DA 1AZSC 2ZIWB 4URVR 5LOVF 4AN0A 3L5KA 1TW2A 3FX2A 3R7WB 2AUTA 2GBFA 4GZ5A 3H2IA 4L51A 1ADCA 3IR7A 4M87A 5ALXA 4J2TA 1GZ6A 3AF2A 4DBLE 2JATA 2J3MA 5JFOA 2YS6A 4M1TA 4B17A 2QX7A 3JYQA 4KE6A 3TLBA 3W7VA 4E5YA 4RD3A 2GXSA 5LP6F 1OH8A 2MT9A 3Q6NA 2VVTA 4BJ5A 2PX6A 5DM0A 1RU3A 3KPYA 1Z9BA 4Y2GA 1FP4B 5K8LA 2IS1A 3FFAA 1LPNA 4NEGA 2AXNA 1GAJA 3RFTA 3ANNA 1P81A 3S4YA 4D0GA 4QZVA 4E2FA 4KMRA 3GOQA 2VTKA 1YKSA 2R8ZA 5BQXA 2G4CA 3BILA 1L9XA 1MX1A 2W71A 3IODA 3NPAA 1V16A 5DBEX 2Z08A 2IYSA 5D7NA 4BE9A 3B5JA 1ANKA 4JXKA 4DL9A 3DULA 2ACEA 1MAHA 4XX0B 1E3LA 1EM6A 2YVUA 3X43A 1G3IA 4N0DA 1EB8A 4HN2A 1H2FA 1UM8A 4LZOA 1PJAA 3IP8A 3D8RA 1EM8B 3O26A 2EP8A 3QFSA 3S28A 1VLJA 1W96A 1IJEA 2ROQA 4Q7JB 4KR7A 3R40A 3ANTA 4KYVA 1KJNA 2WMOB 1FPMA 2Q1TA 3RAGA 4C14A 1KEKA 2HK8A 4V0SA 2EJWA 5KEIA 2ZYVX 4HBGA 5CFZA 3KAJA 4FOOA 2WR8A 1HUQA 3AZOA 3O90A 1WULS 2FZEA 4N9WA 4PRYA 1N34B 4NS4A 1CTQA 4ENQA 4IH1A 2JAQA 221PA 4B2YA 1H23A 3H2KA 1NUTA 4MS3B 5E1BA 3HYSA 4TT3A 3KSRA 5ES3A 3QYJA 3M6AA 1T8UA 1TM7E 2ZSHA 2AJBA 5ULLA 4E6PA 2NO1A 1TQ2A 3QNWA 5BN5A 2NUAA 5HQJA 2H6EA 3BXFA 3CUWA 3FSGA 4E1AA 1GZDA 3GEMA 4KEAA 2OYRA 5B36A 5ITVA 2ZDQA 5KYWB 5FRDA 2H1RA 2IYOA 1KFJB 1KAEA 1X7DA 3A4NA 2WKSA 3MFYA 3GFOA 4REMA 5EIBC 1JB1A 1JHMA 3PR2B 3SVZA 3K70D 4L0DA 4LVUA 1I33A 1K7YA 1E1LA 4WXHA 3SVLA 3WSTA 1ID8A 4JI1B 3AVQA 3QENA 4D9JA 5FOVA 4JDUA 1NLUA 4DIOA 4HWTA 8ATCA 3GJ0A 3WO1A 1Z7EA 5A6VA 4EUHA 2FSSA 5EKXA 3O47A 3KCNA 3UWMA 2PL3A 4BMXA 4PFSA 3SIRA 5CJ2A 2BSQA 2VWQA 3O9VA 3A0UA 3EIXA 5B7GA 1KYZA 4BUZA 2VN8A 3KX2A 3W6UA 1OUMA 2AZ4A 2QD3A 4Q93A 3UHFA 2O5CA 4WE3A 5H0IA 2C31A 3C6MA 1LBEA 3HGMA 1RXCA 4FFBA 4DV7B 5CNIA 3AEYA 1EGHA 1VB3A 3SE7A 2I8CA 2N46A 3RVJA 3STUA 2C4MA 4R81A 1JXAA 1G0NA 2P5TB 2YXLA 3CLSD 4MGIR 4WA8A 5LQDA 2G9RA 4OBEA 5J47A 5EXEA 1WZEA 1OILA 4QOIA 1M2NA 2GEBA 2QYHA 3TQOA 2KB0A 3PC2A 4Q9AA 4O4HF 5FFFA 1POXA 4HYEA 3SEZA 4Y0NA 4V1CA 3MF4A 2R8BA 1HK7A 1KFEB 4HH1A 5I5GA 5LQKA 3ETJA 5DI9A 3L7NA 4CIWA 5IXSA 4IQ4A 2PGXA 5BUSA 3B6KA 1CUZA 1TQ6A 2OXIA 2PT9A 4RA6B 1NLFA 4KX3A 3AR6A 3F6EX 2Q41A 1BE0A 2R47A 2Z4RA 4UW9A 5EHQA 2CJWA 3UJ6A 1TZJA 1XHFA 3OM8A 1ENZA 1M1NB 4K8RB 4JJAA 2EG5A 4JI0B 2ZU0C 2PUGA 2REQA 2CWWA 1CY4A 1U9IA 3GG2A 5ERGB 5LBIA 3TOSA 3GEPA 3C8DA 2XVAA 3LBYA 5E7IA 2C9DA 3SC2A 5J3JA 2CV0A 1VKJA 2AG1A 3AM4A 4PINA 2PJRA 1YDHA 2LCQA 1FFDA 1TQ8A 1K7CA 2QT0A 1V3UA 3O1IC 4WOPA 4M2LA 2Q2QA 5ALQA 1TUBB 3KT3A 3SNKA 4M83A 5GONA 4U2FA 3ICWA 5DLQC 1NUQA 3EK2A 3ICEA 5EJ6A 1Z2DA 1FBTA 5E1MA 1OBOA 1W5AA 2P9YA 4UQLA 1KPHA 2VXCA 3SXPA 1Q20A 3FPBA 3MJHA 1HDOA 2OQIA 4CL8A 2BHSA 3ZBUA 5NLLA 1WLYA 3MXTA 3QY0A 3FKSD 4LZAA 3VV2A 5JD5A 4B6SA 4A15A 1VPWA 1L1QA 1CF4A 1M6HA 2YV5A 3U9LA 1Y6JA 2RONA 1DTWB 3ZUPA 3LTNC 4AKSA 4MTCA 1GL7A 3A05A 4LDZA 2YZKA 1NF9A 4JSTA 3K1ZA 4LS3A 1E4EB 1GTRA 1PI3A 1PJQA 3EB9A 3OQPA 1XJ0A 5JS2A 4DIBA 3SHWA 5JTTA 3VYUB 4FOPA 4JI4B 5CEJA 3LOUA 3T15A 1NN5A 1QIFA 1VYUA 2AMYA 4F6RA 3DZ8A 3NT4A 5FUWA 1DCKA 4JNCA 5IAGA 4OJTA 3O31A 3UWSA 2XKJE 2WT8A 3F6SA 4TVBA 2P8JA 2E55A 2GHIA 2BE7A 4OM7A 3IAS1 4IEIA 1DRUA 1NV9A 1TVKB 4PO1A 4U9HS 3HCBA 1GFZA 1C3XA 1FRNA 3C3CA 1EP9A 3LRTA 3H86A 1UXKA 1NI4B 4GC9A 4IRUB 2FX2A 4BX9A 1AO3A 3IRUA 1FUEA 4TKLA 2A88A 3D4OA 1SIBE 4I9FA 3DLCA 5DM4A 2EJVA 2XAAA 4FEAA 2W2LD 2G1AA 1GQRA 2DHCA 2A92A 3K2EA 3EH2A 4LC0A 5IKPA 4A5SA 1E6LA 5CFMA 2G9ZA 5KSPA 2FPGB 2GF9A 3DT8A 1TM2A 1PQPA 3RLFA 2JFHA 1E1QD 4WN9B 2H2IA 3C5VA 3BFXA 3ELUA 1SC9A 1RZVA 3RBXA 2J31A 5IM5A 4HFNA 2RKWA 3NNSA 2ZB3A 2E4VA 1CHNA 4EVQA 4NCIA 2I7DA 2QRVB 1ODSA 3QKRA 1S4QA 5AIAA 1OJLA 3H11A 1ADGA 4IGIA 4NZYA 4RM3A 5B57C 4M36A 2GRUA 5D7BA 3BKWA 4H59A 1EE2A 1R3DA 1ZEMA 2O5RA 1UR5A 3LT2A 3HU3A 1BH6A 1ZX1A 2DUMA 3T9BA 4ARAA 4GGPA 2W42A 3CCBA 1QGZA 1QO0A 2EBUA 3JZAA 3LPLA 4I6GA 4M8IA 1ZIPA 2F48A 5K0JA 4W1RA 4EF4A 3L1HA 4OXKA 4CMGA 1C7JA 1PLKA 4Q34A 3FNQA 3EPHA 2Q5OA 3D02A 2XT0A 4ZVKA 1YSCA 2BMVA 3UXMA 3PHGA 4AUEA 4AMUA 1B3BA 3KLOA 4ZQHA 4DMKA 1EVQA 3BMNB 3AIKA 3ETGA 4RQAA 2VTBA 5GTDA 2H2AA 4AJOA 4QRHA 4BBJA 3QUQA 4KVAA 3TSOA 5EZYB 1IFXA 4YJ3A 3H2GA 3SIPA 5EJEA 5TJ9A 4DY6A 5DM2A 2IGBA 2QPOA 1V11B 4QD3A 1L3CA 3G9QA 1MRNA 4L76A 1LC0A 1IL0A 1XUOA 1TLLA 2GD1O 2JLAA 2YJ6A 4CMKA 5CLLA 2GAIA 1HGXA 3CTMA 4CW7A 2GZHA 5FOWA 1II0A 3HU2A 3N5CA 3STTA 4RMHA 2HD4A 1GSOA 1ORVA 3C70A 2GEDA 3DE7X 4XPZA 4EG6A 1H9CA 2PCJA 4ESOA 3KPWA 4G23A 1SVIA 3MHPA 4DXDA 2GAAA 2ZJZA 2X23A 4M1QA 8OHMA 4K9QA 3TN7A 4GEGA 1YFLA 3DCIA 3GJYA 3B89A 1UFQA 2W2TA 3NEJA 4OK6A 4DLPA 3CEAA 4QOJA 2AMJA 3AEXA 4HH0A 3H0KA 1RHUA 3CZQA 4RVDA 4MRNA 1QKJA 5IG2A 4S0ZA 2PJZA 3EGDA 3JQDA 5L3SB 1G20B 1JEYA 3L1VA 5IJ9A 2ATEA 1MEEA 121PA 2NQ2C 3BL6A 3CF2A 2FPRA 5BNZA 1H1DA 1FRVA 4FI3C 1NNLA 4GBJA 2FWNA 4LGYA 1T1RA 2WKQA 4QX6A 4CRWB 4I1UA 2HHAA 4MRAA 5FBWB 4R8KA 4Z0TA 2ZYIA 1DIGA 5TPZA 1RDFA 1O5IA 5BSRA 1DAMA 4MTLA 4OGWA 4WKPA 4OIMA 1G8KA 4RVSA 1L7RA 1DQRA 3JWGA 5L7YA 2XTAA 3ILXA 5A3RA 1VSBA 2VF5X 1TNDA 1P0MA 1W87A 1QK5A 2BEUA 2GGSA 3N3BC 5M34A 5BOSA 4D0RA 1SXJA 2QR5A 1K4KA 3CJTA 1ULSA 4Y2SA 1I01A 3TFWA 3H8JA 1C1DA 3ZS8A 2W2MA 5A05A 3RU9A 5DHUA 1IN1A 2QTCA 5HEKA 3THOA 1XU9A 1F48A 3HV2A 3A4IA 3NRCA 2O59A 3EC2A 5FFNA 2K6GA 3AJ8A 1R4ZA 4LY9A 1MMFB 3ZI7A 2IXBA 3KJZA 5K3DA 2PKYX 4DLYA 3GUCA 1OTYA 2XZPA 1BE8A 2X5NA 3PFGA 3ESRA 5T6MA 3TLXA 3BB3A 2JZOA 4FOSA 3PDCA 3NAGA 5F2KA 1U8EA 4FWBA 1X8JA 2VSFA 3WNZA 1XRNA 3DSRA 4MULA 2XSZD 4XYBA 4WXYB 1MGPA 2DFVA 3BERA 1E7RA 2KM1A 1YJXA 2Z83A 3PYLA 4XR9A 3IVAA 5DBGA 2PIAA 1VL5A 3AF3A 5DF1A 4Y2YA 4F38A 4FONA 1ORRA 4HNQA 5LBTA 5C18A 1PV4A 2R5NA 1EA7A 1E4VA 4CMCA 3SYRA 1SIWA 2GDZA 1KO4A 4NAHA 4F3KA 3HI4A 3D3WA 4LN1A 3AKYA 3AYXB 5GGYA 4BNYA 5AKHA 3D2CA 2IU0A 3DMTC 2BTQA 1HYGA 5BSMA 4M8NE 3IDZA 2D0OB 4TUYA 5J58A 4MW4A 3I1YA 2QAGC 3VHXA 3T3NA 2O7VA 1FYWA 3OTIA 3KSAC 3M5WA 2IZ7A 3FDZA 3MLAA 5G4LA 3WGTA 5HS4A 3HK2A 1U3DA 1P62B 5DWDA 2XPCA 1XXLA 4Q6BA 3AP1A 3ED1A 3PXGA 1B8PA 4ABYA 3FPKA 4PC2A 1EK0A 2R8EA 4GG1A 5TMEA 2Y76A 3RKRA 4FFWA 1RQXA 2DT5A 4B6PA 3C7DB 3UM9A 1SXIA 2W6ZA 1U7DA 2ZYHA 1USWA 2CHUA 4BNUA 5ILOA 2IYZA 4NNPA 3WNDA 1S8AA 4QYIA 5FLEX 1IONA 2WD8A 1NMSA 3O3OB 4M0MA 2IZ5A 5TNXA 2Z2KA 5BPFA 3TLZA 1VKHA 5HBGA 1UDCA 5AESA 3CLKA 1IUNA 1X80B 2FSFA 3FJYA 3OU2A 4DY4A 1V9SA 2JIPA 1DTEA 1QIJA 2D2XA 4QAQA 4W82A 3ZGZA 4HXFB 3RRFA 1L1RA 2ZITA 2DBQA 3HM2A 5JBQA 3BWCA 1DG3A 2O8VA 5EQDA 3RYIA 4BJ3A 4QEKA 1HI9A 1D4FA 4OL0A 4Q7EA 1QP0A 1WSWA 1NX9A 4CV2A 3K0CC 1XKXA 2C1EA 3X1ZA 1F1BA 4FCWA 4UHDA 2J67A 4J4BA 1XTQA 2OM6A 1EGMB 3H5AA 5EERA 4KODA 3ER6A 4JJ7A 3WGHA 4BLTA 1XB2A 3IH5A 1UM9A 2R8XA 4Q4JA 3GAMA 1RFGE 1E1CB 3D6FA 1FRQA 1NMQA 3I61A 2ODWA 2VJMB 2EAUA 2H5LA 3FDJA 3NR2A 1DO0A 5FUVA 3MA0A 2YBDA 4TZ6A 2B7BA 3G9UA 1T0HB 5F73A 3H8WA 5CM2Z 4K03A 2QZPA 5ICCA 1A50B 3G82C 3QX9A 2CYAA 2HIGA 4OSOA 2BZSA 2WSBA 4RKQA 2NYUA 1JEJA 1WO8A 3H1TA 3N8KA 3GJTA 4YO7A 5D3ZA 5FTNA 5TX7A 1APBA 3KFXA 4IY1A 1ZBDA 4U9IS 2VDMB 2KHZA 4Q3LA 3LJKA 4X1YB 1Z5NA 4XA8A 4P6VF 4GPTA 1IIRA 3SF8A 2BTEA 1U7UA 2ZI6A 1X1SA 2GLXA 4TKMA 3I2YX 2YRWA 1H2RS 4XWOA 5G02A 1MA0A 2SCUB 4L8GA 5FL7D 3W6OA 1GRNA 5LZ7A 4AURA 2CLDX 2HN9A 4ZK6A 4OBBA 1UXIA 4G0XA 4NZOA 3DKIA 2FMHA 2N1MA 3DZCA 3V7WA 2CHFA 1ZJWA 1PVDA 1NVVQ 2Q6KA 4R2LA 5LA6F 4X1IB 1U4OA 1XDGA 1EK6A 2JC3A 1D2EA 3LPAA 4B6EA 9LDBA 1J1UA 4LPSA 2VJOA 5I7FA 2BN4A 4IDEA 1YB5A 2QTBA 1KARA 2ZJ7A 1JEEA 3H9EO 3TZHA 2HSDA 4MLDA 1Y1KE 1MC1A 2G0AA 4OMFG 2FOXA 1TF5A 4DB4A 1EGVB 1MIOB 2XIJA 1KRXA 4CL0A 1PWEA 4EAAA 1NZFA 2ISQA 4D8XA 3C2QA 1MCZA 2CZGA 2QZSA 1LK0A 3WOVA 2JJ1A 1ZWKA 3NALA 3WYDA 5DYGA 2JI7A 5COQA 5BN4B 2YQ5A 5J59A 3TKYA 1VZ2A 1VIVA 1Z7WA 3TECE 5TS2A 4YFVA 4TLEA 2DJIA 3OWXA 2O2JA 1U0SY 2UVPA 3SQWA 2I4OA 4YAFA 2HZ7A 3O4VA 4UDXX 2QNIA 3KC2A 4ASUA 6ABPA 2IZZA 3DLAA 4CKCB 5J5AA 4X85A 1B8VA 4DCOA 4N5MA 3PUIA 4YJ2F 5JSUA 5FT9A 1ZUWA 1S01A 1IZZA 1GT91 4EPXA 1MJGM 4F4UA 1QIHA 1XJCA 3ESCA 2C98A 4HL6A 1PZFA 4Q3NA 1H1LA 4P7JA 5BQ3A 2R6DA 1WBBA 4YQZA 3V8RA 3PNOA 2D13A 4WBXC 2ZWVA 4QECA 4V3BA 3RHTA 1KBOA 1RAFA 4OTZA 4KRFA 2E85A 1FB5A 5TQ2A 1ZDMA 2IYUA 2CDNA 4MCJA 4YMIA 2GCIA 4B3SB 3R75A 3HP7A 3Q9SA 3S5UA 3WC4A 1BWPA 2Q5LA 5EUQB 1DX4A 2J32A 1Z8NA 4E0BA 3W5JA 3V2HA 5ALVA 2XNJA 1ZPDA 3OQ1A 4E03A 1N7IA 1V37A 3ENWA 3FPCA 3GPLA 4FDAA 2JCYA 2VJPA 1XJQA 3DM9B 4NU8X 3C3XA 3OHSX 4UQPA 3G1WA 4PQFA 4UBKA 1XCBA 1XTIA 3KJQA 1J7KA 4OHMA 3K0SA 2YWGA 3KEOA 1XRSB 3UXYA 3QEMA 5FLXA 1V8BA 1TW3A 4Q9JA 2FW6A 2PMDA 4UJ5A 1WABA 2CLOB 3NONA 4FM9A 2C2WA 4JNKA 4DB2A 3EFHA 4ETMA 3TLYA 3IHWA 1O7JA 2FUG6 3VU1A 5CB6A 4IO1A 4OHCA 1WHTB 5TT1A 2NZXA 4KXXA 4M0PA 3T3MB 4BO0A 4C4SA 5JNTA 2UXBB 4G84A 4DSTA 1VG0B 1ZG3A 3QJ5A 1GEEA 3MC1A 4IFIA 5EXPA 4LWPA 3VPHA 5KBYA 3KQWA 4M99A 4J0CA 5FWXA 3RABA 4C29A 5DNYB 4UBNA 4GMKA 3TLKA 4UUMA 4QXPA 1FFXA 2O0HA 2I80A 4J0DA 2CLSA 3PC6A 4HFRA 1XMPA 4G26A 4LNUB 1JIIA 1JWBB 2PZAA 1ATZA 4PIVA 3W1VA 3B6EA 3S1AB 1AQIA 3QVMA 2R9VA 1KEVA 3K09C 4HAZA 1KI6B 5G4KB 3BD8A 1OLUB 4DWWA 4M49A 3DMYA 1IWPB 3KEMA 1K08A 4MW5A 3ZE8A 5KU7A 2Y0PA 5JIBA 5HHTA 5J4KA 1MOZA 1W0JA 2ONCA 4EVSA 1LSUA 4FHGA 4LA4A 3U4DA 1N9GA 4RPJA 2Q6OA 1HYHA 2RK6A 1MX5A 1OWMA 4MCAA 1GGVA 2Z8YM 4PO3X 4B75A 2ZTHA 5HJ7A 2X76A 3AETA 4O2LA 2OZLA 4JC8A 1MBZA 1JAZA 3K4HA 4TVSA 3WDMA 3CPJB 4RKFA 5THXA 1KZGB 1GUYA 3GLTA 3NYWA 1BO6A 1PGJA 2Q5IA 4DLLA 1AZLA 2DFLA 1C30A 1YR1A 2DLNA 2JJ2A 3KXKA 3SBEA 3TZBA 1O1YA 1YTLA 3IOMA 3P4XA 3PKZA 3MRTA 4Z7QB 3AV0B 1O77A 1EZ4A 1UADA 4CMIB 3K1AA 3VKVA 4F04A 3GHYA 2ZPUA 3LAWA 4KMOA 5JLJA 4GOMD 1KOJA 2OD2A 1ODTC 2D3WA 3E1SA 1JKMA 5EMMA 1CY8A 1CQIB 1QFYA 2PEZA 1ARZA 1FMTA 3OZRA 2JKYA 2C7BA 2X41A 4XASA 3FGNA 5A7GA 3R9KA 3WB2A 5DNUA 1E7WA 4Q6WA 1QLHA 3I3OA 2OLEA 2O1SA 2XUPA 2BI8A 4TLMB 4CN8A 1E6WA 1XE3A 4R0NA 5JSQA 2Y0EA 3ZW8A 3K9NA 5KTKA 3AI7A 1IOVA 3FPEA 3S2ZA 3TS1A 2WSSA 3I53A 3WLOA 2BE9A 3HA7A 3NWPA 1OX6A 3ZJ4A 3ERCA 5A7FA 2PWPA 2WU3A 1GKIA 4GOKA 4PYMA 4Q4CA 3L6RA 3LGXA 1Z8HA 6AT1A 1XA3A 2VHXA 4EKEA 2FSUA 3B3JA 2DWUA 4ROTA 3B38A 1J2UA 2HNBA 3GLUA 4OJMX 2AXQA 1NHWA 1CLEA 5KJ1A 3IA7A 2O05A 4F5ZA 1CJBA 1ZQ1A 2CL7X 1XRLA 4YQEA 4BGUA 1EFAA 4AB1A 4JOSA 4QGAA 1CUFA 3MS7A 5JAQA 5CURA 3T3OA 2WQ6A 4O4LB 3CLHA 4HPWA 2IPAB 5HSGA 1M0TA 1XMIA 1YI1A 2GN1A 1DHTA 4E5VA 2J9XB 3DOEA 4ESVA 5AW6A 2L19A 3PIDA 1JLKA 2VBGA 16PKA 3EZGA 4ZGWA 1VE7A 2HWUA 3H2BA 2WWWA 4IILA 4MKFA 3DC2A 4ES6A 4N41A 4BFWA 3IQDB 4H27A 3LZ6A 1Q6YA 2C29D 1PEYA 1J8DA 3IKLA 4YQFA 5LM3A 4C4OA 3HG7A 4JSRA 3H04A 1HY3A 5CVJA 2IH2A 2GWHA 2VRWA 4IZOA 4ZZ0A 4Z5XA 5JECA 4OYYA 4WOJA 4EUEA 1H9AA 3FIUA 3KFLA 1DBWA 4RA9A 5HPYB 1NUSA 4BAUA 3HVKA 4B81A 2AI2A 3GV0A 3SZMA 5KQLA 1ML4A 5EQJB 3BMCB 3IURA 4ZEXA 5EHZA 4W9MC 1KGSA 4PYJA 5E3IA 2RKBA 2J5QA 3EPKA 2AZTA 2IPLA 2VUIB 3NYIA 3HSKA 1XWIA 3OEHD 1MB9A 3RBZA 2BTOA 4Q7LA 4E4TA 3RFXA 3L7LA 3NBKA 3G1TA 2JK1A 1QJCA 2PM8A 3B70A 4N7JA 4HK4A 4NG5A 5AJVB 5AK0A 1Z3CA 5AKJA 2I54A 2V54A 2HF8A 3HJHA 2DHQA 3CWZA 3D7LA 3ADCA 2N75A 2G40A 5K4GA 2YV1A 4HWPA 3JQCA 4P3KA 2XJ4A 1AMOA 4Y2PA 2BT4A 3E03A 2C88A 4HZUB 4MR8B 1V7ZA 5TR9A 3DUFB 3Q72A 3OT5A 1MH9A 4NZZA 5J1SB 2E6UX 4NCNA 4OI2A 3F71A 3FMOB 4V39A 4C0SA 1GUFA 3TUZC 4UTNA 4R8MA 1X70A 3QLVA 1R88A 2BC9A 2DUJA 3EQ7A 3O4JA 1O3YA 2WYHA 5AI8A 1H8EA 1QIGA 3BTSA 3H83A 4RTSA 4PQEA 1VL6A 4ND1A 3CLRC 4XLTA 3DDNA 3DL0A 1T0PA 2G17A 2JDID 5DTQA 3FGZA 1VPLA 2J9ZB 1HE1C 3WIBA 1OCEA 4LRYA 2CE7A 1UWCA 3CTPA 4MGZR 3TMYA 2OQRA 5C81A 3K2BA 4GMDA 4V0LA 3U48A 1TC2A 2XBMA 5A0VA 3ZHCA 3SHQA 5ELLA 1ZGBA 3DMPA 5EWLB 5IN5A 4PANA 1UQUA 2OA0A 1U0BB 1FQKA 1GO2A 3FSGD 4N76A 1LRKA 4UTOA 4D3DA 3HR4A 1QFMA 3UQZA 1MFZA 3NTUA 4B2LA 3PFHA 1O96B 3I39X 2CLLB 2FYTA 2V98A 2WWVD 2ETVA 4NQRA 1JIVA 2WM3A 1Q1AA 4AKEA 1CUXA 2Z3ZA