4LZOA

Crystal structure of human prs1 a87t mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
304
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTTVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 304
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lzoA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lzoA02
2C4KA 2FXVA 3GGCA 4LYYA 4RABA 1QB8A 1QK5A 2XBUA 5ESWA 3S5JA 2DY0A 2YZKA 4F8EA 2WNSA 1JLSA 5IAOA 4KN6A 1I0IA 5EUCA 4QYIA 1I14A 4WN3A 5KAMA 1CJBA 1J7JA 1A4XA 4QYIB 1P17A 4LZAA 1O57A 5HKLA 1UFRA 1A95A 1LH0A 3LPNA 1ECJA 2IGBA 1HMPA 2JKYA 4RAOA 4IJQA 4WMLA 1I5EA 5E38A 1BD3A 1XZ8A 1D6NA 4RQAA 4LYGA 1ZN8A 1A3CA 1Z7GA 5K51A 4Z1OA 4P80A 1DBRA 2PS1A 4RAQA 4FYMA 4RQBA 4P84A 1QCCA 1TC2A 4P81A 2PRZA 1VSTA 1AO0A 1IBSA 2JBHA 2E55A 3M3HA 3N2LA 3OZGA 1P19A 1R3UA 4P83A 4JITA 1NONA 3LRTA 1W30A 5KAPA 1I0LA 1PZMA 1L1QA 1QK3A 2JKZA 1QCDA 5ESXA 1BD4A 1Y0BA 1A96A 3MJDA 3DAHA 4P86A 4MB6A 4P82A 4X44A 4LZOA 1P18A 1A97A 4M0KA 3HVUA 1JLRA 3MBIA 4PFQA 4RHUA 3H83A 3QW4B 1ZN7A 5BQPA 1L1RA 3KB8A 1YFZA 4RV4A 2HCRA 1XZNA 1ECGA 1OPRA 3OHPA 1XTVA 3OZFA 1XTTA 3O7MA 4RANA 4RADA 5BSKA 1TC1A 1GPH1 2GEBA 3GEPA 1U9ZA 4LZNA 3G6WA 1P4AA 4P3KA 3DMPA 4M0PA 1I13A 1G2QA 4RHXA 1FSGA 4M0UA 1VDMA 4RHTA 3GGJA 1ECBA 3EFHA 1G9TA 5HIAA 2EHJA 4QRIA 3NAGA 4JLSA 4ZFNA 1G9SA 1STOA 1U9YA 5IPFA 5JSQA 3ACBA 5JV5A 1V9SA 1MZVA 2H07A 2H06A 5BRNA 1UPFA 3ACDA 1ECCA 1QK4A 1HGXA 4OHCA 4RACA 1DQNA 1UPUA 1DKUA 4RHYA 1ZN9A 1QB7A 2JI4A 1O5OA 2P1ZA 4X45A 2PRYA 2AEEA 1DKRA 1XTUA 1BZYA 1VCHA 3DEZA 4PAWA 1GRVA 2VFAA 1ECFA 1DQPA 1OREA 1A98A 5BQOA 1OROA 4S2UA 4TWBA 3ACCA 2H08A 1WD5A 1NULA 1G2PA
chains in the Genus database with same CATH superfamily
2D1FA 1OV4A 3NI2A 3K31A 1DQYA 3ZVMA 5IDVA 1ZLYA 4UFOA 2G76A 4G1UC 4KGZA 4AG6A 1Q1NA 2W2MA 3FUXA 1HURA 2ECFA 3K30A 4NOMA 4X84A 2CZCA 3H16A 3P2KA 4N47A 3UY4A 2XE4A 2H4JA 1CQJB 3PYMA 5D2CA 3GHYA 1T24A 4IL5A 4KFTA 2VF8A 1V7ZA 2ILVA 3BZWA 2B37A 3BN3A 1SBNE 5H16A 1W34A 4LJ5A 2NTJA 2RGYA 3GOQA 4KMSA 4CR6A 1NU6A 4MPJA 1UFOA 3OOSA 5ICEA 2IZ1A 3OE5A 4CCSA 4E2YA 5K45A 4V0SA 1NOJA 4NF2A 5FV4A 1EUQA 1B43A 1F5NA 4YT5A 1V7QA 3QVGB 4GI1A 1JKFA 3ECCA 4YC7A 2EW8A 3JD3A 1MX9A 3TQRA 5FEUA 1CY0A 1PZNA 3EGEA 1ZNYA 1TB4A 3IBGA 3O3OB 4G1EB 4N9QA 1NAHA 4V0MA 4B6PA 5BWOA 4ARAA 5KAPA 1IOZA 1Q22A 1NNEA 5F98A 2F2TA 5U4XA 5KYKA 2GETA 5BYAA 4JGBA 4UULA 4P3NA 1DAIA 4LC0A 2P35A 4TLBA 4EPXA 3T35A 2DH5A 3HCDA 1AKNA 2IUYA 1W2GA 2QGFA 1UC4B 2H54A 1USWA 3LT2A 2E1RA 3IR7A 4YLEA 4ZMRA 3DE4X 3GXOA 2BM0A 3H3FA 1PR6A 1TA0A 1SCIA 2DSNA 2HK6A 3NT4A 1O6FA 4TS4A 3A0RB 4OQNA 5CXSA 4C6HA 2Q50A 4JBGA 4US2R 5HJ5A 1KRXA 3EIWA 3G02A 1NOIA 4XEUA 4F2WA 2IS2A 1CV2A 1FYWA 3FGNA 3NKVA 4WKCA 3EFBA 1ECGA 1VKOA 2N42A 4YMUA 3MN1A 3HP7A 4H2DA 3ROTA 4LNHA 1JSCA 2IZOA 5B5SA 2CFCA 2ZKLA 5DBHX 4AZTA 4ZI7B 2AFIA 2IYLD 3CG0A 1ZM4A 1QGZA 5FL7A 4HGOA 2HDHA 5LYJB 3WHLA 5HUQA 2XWJI 2JIQA 4KYIB 4I9GA 5FD8A 3V8BA 3EFHA 3FPGA 2DQYA 3NEPX 1VA5A 4G37A 5FO0A 2BH9A 3ZI0A 1RKBA 1KDZA 2GZMA 2GRAA 2OB1A 4MRRA 4CL3A 1VECA 4NFSA 2WE7A 2XOKD 4G0XA 1GGMA 4UE2A 2QTBA 2F3UA 4MTCA 3K70D 4FYJA 2GBIA 5A2QA 2BM1A 3AIMA 4FUQA 1R6UA 1G8JA 3E8XA 3NR2A 1KO5A 4NENA 5EIOA 1QJCA 3B2QA 5LQUA 1CRQA 1G42A 5LJIA 1ZITA 1BJRE 2GBGA 4P34A 4BEJA 5DYNA 4WRRA 2P1ZA 1C1DB 1JVSA 3LE8A 3JSAA 4A6XA 3KU1A 1I5RA 4B8ZA 4HLCA 1CIPA 2V7PA 1CY1A 1YJXA 5E8RA 3GP3A 3RC2A 1D2AA 4EOGA 3AM5A 5C81A 2BFOA 2H1HA 3I28A 1H2AS 1WMSA 1PT9A 3ZCPA 2D1QA 3UICA 1M34B 1MTZA 3B3FA 1JKJA 3AQ4A 5KHOC 1UXKA 2ZAMA 1A5AB 1ID1A 4PPFA 3F49S 5AUQA 5TT0A 4GPEA 3S2SA 3T12A 2QTZA 1HDRA 4QFCA 4R3UC 4K81B 3BUSA 3FVWA 4X93A 1H2WA 4BN4A 4F3RA 2YZKA 3L7JA 4UM7A 721PA 1W36B 1ZVJA 3JY6A 2XCRB 5B1EA 4K0RA 5ETJA 1SCJA 1SUDA 1X94A 2OKCA 2P90A 2V7VA 3GA7A 3O2QB 3IPAA 4A16A 2NUAB 2VBIA 2ZUWA 4N8DA 5J5CA 4DQUA 1XTBA 1N0UA 3ELBA 3IP9A 1ZOPA 3KQSA 1DKOA 1S1CA 2ICAA 1NBMA 1QTIA 4AM8A 3LC2O 3QF7A 3TINA 2PNJA 2ZVDA 4FQ7A 4E2WA 2ZAGA 3BXZA 3CLTC 1M5RA 4DJ5X 2FWNA 4HAUA 1YZGA 3A1CA 1GCAA 1Y89A 2WTEA 4PYIA 5FNVF 4CE6A 5B58C 1GOTA 2NZVG 2FDRA 3H1FA 3H65A 3O83A 3ZGXA 1O2DA 3AIKA 4TV8F 4UE3S 5H5JA 2ZT6A 1JIXA 3GJXC 2RHLA 3PXXA 2MSWA 2GR9A 4OHBA 3U4AA 3H2IA 1JSZA 2X0KA 5BMVB 3VU9A 5HIIA 3O8RA 3UJBA 2Q9CA 3DQPA 1VI6A 1Y0BA 1CUSA 4HNQA 5EJAA 2RGAA 4B73A 5CAEA 5T4HA 2IOFA 1KYZA 5C18A 1Y6FA 2QQ5A 3E3LA 3EXHC 1JB9A 3EQ9A 1SXJE 1W8DA 4CL8A 3OVMA 2IY9A 4OQDA 1SA0A 4OQYA 1EFAA 3I72A 4JENA 1QG6A 1JYSA 1RVV1 5JCJA 2PY6A 3VR2D 4AP5A 3RB8A 1XEFA 2P9HA 2VJQA 4CQLB 1EVZA 4ZK2A 2OSVA 4ZREA 3UC5A 2PS3A 4I9FA 1MT0A 4YV2A 3RK4A 3ND6A 1F5SA 1LF5A 3GFVA 4C4YA 1DOHA 1G5RA 2ZGVA 1YI0A 1GITA 2ZWPA 5CYGA 2I6GA 4RD6A 3L7IA 3AW9A 4GGOA 2XD9A 5G53C 4PX2A 1KZ4A 1SOMA 3UB2A 4DABA 4LHSA 2C2HA 4OFWA 3HUTA 4HDSB 4IIJB 2ZIVB 4ZWNA 2ZREA 4WNAB 1PQUA 3EUWA 4OLFA 3RT7A 1RWVA 2KM1A 1MOPA 3BRSA 2IIPA 4M9ZA 4YAGA 2G36A 3LV8A 1LPBB 1V8FA 4GZMA 3UW1A 3O3CA 3FCXA 2YXNA 4HYYA 2CZQA 1WVGA 2XVYA 2IP4A 4WFKA 4Y6LA 2FK7A 2Q21A 4HNAA 4JJGA 1Y8RA 1QRSA 1SVLA 1QIHA 2DQ4A 2CVQA 1GCOA 3LXXA 2F1HA 2I7DA 2ZFUA 5AD1A 3X1XA 1UBCA 1QNFA 2QJTA 2QV7A 4DDMA 3SYMA 4E5KA 1U7HA 4HBGA 2RSLA 4YAFA 3F5MA 4CNBA 5KPDA 1B0UA 5MF6A 4CM8A 1S4QA 1DUSA 5TQJA 4UU1A 4PHFA 1GQ2A 4K9OA 3LHSA 2ZUVA 4FWIB 4YCSA 4MI1A 5J4YA 5C51B 2C95A 4YP7A 5CBPA 2WP0A 2CV2A 3TTUA 3ZWVA 3AVQA 4E33A 3P2YA 5DHFA 1CR6A 3WADA 1E1MA 2WNSA 1JMYA 2RH4A 2WF9A 1K97A 1YR1A 4AO7A 4V02A 5HS4A 1XMXA 2XB4A 3BHIA 3CR3C 3KUKA 2W6JA 2XOXA 1PYDA 2ZI5A 3FJ1A 5JQGF 1J99A 2RMKA 4N5IX 3B48A 1CJVC 1BGWA 2I3BA 4F84A 2HO4A 1CF2O 3A9TA 4URXR 1LLDA 2OO7A 2BFFB 5K0SA 1Q0HA 2PA3A 3BIOA 1FFXA 4NQZA 4PBRA 2V3WA 4F45A 4GSLA 1H6DA 5JJBA 4HNVA 3LWBA 1BQ4A 1ESCA 1OJ7A 5CCBA 5DULA 4RZHA 4QATA 5JS2A 2FZVA 4C2UA 2EX0A 3EZ7A 1GPUA 2OQRA 3R44A 1HEUA 3ZVNA 3KAKA 5ITZA 3DE7X 4S1NA 4YP5A 1HE8B 5IKOA 2AE1A 1PN3A 1USGA 2CUTA 2G08A 1GKUB 4Q03A 4ZQEA 1C29B 2P62A 2YXPX 4YUWA 3D7RA 1FRQA 1L4YA 3EUAA 3LPCA 2OXIA 2G17A 2I2FA 4JBLA 2FZKA 3G2JA 4Q9JA 1XIVA 2Q1TA 2D4HA 1M3SA 3OBIA 5DHUA 4E70A 5IYZA 4UUNA 4XGIA 1EWVA 2B6HA 3DAPA 4FMPA 2MSKA 3SF0A 5C8VA 1HDGO 2K7FA 3IUQA 1VJDA 1KYIA 2BHNA 3MVEA 2QVCA 1E0AA 4DLRA 2WHEA 5I3CA 1VL2A 1F9AA 1N3YA 1OXBB 4OTZA 2C8KA 4TM8A 3RJTA 2Q5JA 4QA9A 5FFFA 4V1CB 3LL4A 1RJWA 4CR7A 5IHXA 2TMKA 1QQBA 1IQUA 1X8JA 4NULA 4YGYA 1LV7A 3T41A 4JL5A 2VF7A 3H5IA 3TZHA 3VHRA 2AD1A 5ELMA 4E88A 4F3CA 1SOVA 2CHVA 3DMDA 4IF6A 4INZA 4DIUA 1JG4A 2CXUA 4H3KB 4KBFA 2IS6A 3INRA 1PG2A 4FB5A 1ISMA 4HDKA 1JXQA 4NDZA 3GCDA 2R6AA 3QE4A 4LPSA 4YJKA 3IMEA 4IXDA 1DSSG 1CIJA 5J2TB 3OM1A 4H4DA 4O63O 3SC2A 3R23A 3M83A 2X2EA 1F0PA 4FI3C 2EQ5A 1NYRA 4JHLA 4Q1CA 1RHUA 3HDQA 4D4HA 3G7SA 1DG1G 2F62A 4KIUA 3H1TA 1I3MA 1EGMB 3T0FA 1P0FA 1E2QA 3C1TA 4RHCA 1HC7A 2QN2A 3W5BA 3PU6A 1EU1A 4TRJA 3O84A 3AVTA 3RFTA 3WLLA 4Y98A 2VHCA 3BREA 1EXWA 1RWKA 3L0CA 3EGVA 4OGWA 5ALXA 1ACLA 2GKGA 3QVWA 3OQJA 5EIBC 1O0CA 2HB6A 2PVCA 2C0PA 3II6X 4PFKA 5B64A 1E5DA 1DKRA 2EFCB 2GHQA 2HHLA 3ONFA 2WU8A 4K46A 1J97A 4ZO7A 2Q0HA 4FGWA 4KRGA 1OREA 3DXZA 4GF5A 1FRFS 3AM1A 2R4TA 4UAUA 1CUXA 1EM8B 3OU7A 1ZGZA 3QVGA 1UM8A 5AT1A 3G1UA 1JE1A 3RVLA 3T3DA 2GKSA 1E1LA 5CITA 1NZJA 4KC0A 1X14A 3A8TA 4QHSA 1AN0A 5LUBA 1YR7A 2PYIA 2PQ2A 4EDHA 4NXNB 5DK4A 4C9BA 5COQA 4LF6B 5AVQA 2XNHA 4G0YA 1DOZA 4G24A 3CY6A 2JW5A 4YJHA 2WTBA 5JI3E 2AOWA 2P3SA 3G1TA 3QG5A 4GDFA 2ISCA 4TTTS 1NLYA 4IP0A 1I1HA 5CNKA 5DK6A 1Y7PA 1IY8A 3IIKA 4ZU3A 2R60A 1JW9B 1GUDA 3FAZA 4C30A 1RRPA 3SJ7A 3DFZA 4XVQA 4N48A 1ZIPA 5K0BA 1V4VA 3MHPA 4US0R 1D03A 4YRDA 3GD7A 3HA2A 1ZOSA 1GTSA 5ER6A 3H2GA 1U7ZA 1Y48E 2WUEA 2O1XA 5A4JA 1GO2A 2HJ9A 4ZOLF 2BI7A 2JZCA 3FLEA 4ESVA 4UVHA 3ZXXA 3E23A 1N9GB 2XUDA 1N2IA 2AVDA 3HJRA 4MV4A 4BQFA 3Q7EA 1Y7LA 4BL5A 1ZM7A 3DT8A 3CXRA 3GELA 4CZ2A 4MO9A 4NAHA 4R2LA 1ZMBA 3V2HA 1W0KA 1Q1QA 2QM8A 3LQKA 3ZWDA 5C8ZA 2AG0A 3R7FA 4D7AA 5JJLA 4KEAA 4XQ9A 4ZHQF 1AUVA 1BJKA 5IZ4A 3RSOA 3UT0A 5ILOA 3B60A 1UQTA 1W87A 2VEDA 4UNQA 3RLIA 1CERA 4PZAA 3WP0A 1HXHA 2IEGA 2JDID 2ZB4A 3GRAA 4MW5A 2O5VA 5CFMA 3U3DA 3RJ9A 1ZG3A 1K08A 1VKHA 4NCBA 1Y1LA 2C3PA 3EF1A 1II0A 5KQLA 4PSDA 1YI8A 2WKWA 3K6SA 4LZPA 1U98A 5BUQA 5C5DA 1Y8CA 5JXGA 4TVOA 1E2DA 3RREA 2MINB 5A3JA 1BHSA 1SOWA 4KV9A 2DQSA 2VUHB 2DP4E 4IO1A 1N34B 3T7KA 4AVYA 4U6NA 4HH4A 1Q7EA 1XDDA 1XCMA 3CPEA 5LP6B 5F9MA 1HRDA 1M2GA 2D62A 2CMHA 2E1PA 2P9GA 3IQFA 3TSWA 4AZ0A 3A0UA 1T25A 1YCFA 3IAS1 3EBOA 3O9VA 4GBED 2RI0A 3HCBA 4URHA 1KHHA 5JAMA 2FPGB 1EP2B 2O0HA 4ZVQA 1VTKA 2QPOA 4QUBA 4MW7A 4S04A 1M34A 1NXWA 1Z0DA 3CUUA 4BX8A 3ZDBA 1SXJD 3CEHA 3GGDA 3A9WA 2EXXA 3FUUA 4NMWA 3EXIB 4XLTA 1ZGAA 3EC1A 5IARA 4AY6A 4RY9A 3JD1A 3TRIA 4ARIA 3PTLA 3L0BA 2F17A 5JFGA 3T3PB 4RVNA 1QIMA 3CZMA 1NVMB 4MI3A 4AMGA 2AUTA 4OU5A 2WHPB 4QUAA 1O0SA 5D5HA 1W1WA 2WA2A 3AEQA 3ECSA 3M6UA 3TLGA 2A9JA 1U8TA 2DMRA 3V32A 2NUTB 1KH2A 1USIA 4R81A 3JR7A 6CHYA 2DUWA 3CZ5A 3INTA 4IHJB 1HKUA 3QI2A 4DLVA 5L53A 5LQAA 5U9CA 1P77A 4BP3A 3SJZA 2AN5A 2R66A 2VA8A 4UHBA 1P4SA 2VOJA 3AI7A 3WGVA 2WSIA 4ENTA 1YB6A 1RWOA 1ZKDA 5L6LB 4R69A 3STYA 4D4GA 1NF2A 3O4FA 1OTYA 4MB2A 1NUSA 4RD3A 2J3LA 4HGYA 2A9OA 1A8QA 2F4NA 1JFRA 2JATA 2NG1A 3CVXA 1WZ2A 4BQRA 2ZBEA 1TUBB 1Z0KA 2VXBA 2JI7A 3SX2A 3T06B 3ZEIA 1BFKA 3OP1A 5AWFC 1A9TA 1J9EA 2IE8A 5DW0A 5H68A 1GPLA 1XEXB 4DTCA 4M83A 1F2TB 1OGJA 1FLAA 1ZFNA 2IHYA 3DOCA 1QPBA 1WOYA 3DV2A 4LDPA 4D97A 4DBZA 3C16C 4FFRA 2W90A 3VAZA 4MYSA 4HI0E 3VYWA 2G0AA 1TQ8A 2VUIB 3DMFA 3HN6A 2GOYA 4B76A 1KJ8A 1WB5A 4ZAXA 5KNCH 3SXJA 3ZZ0A 2A0YA 1RI3A 4I0WB 2OEPA 3LW8A 3LQ1A 2OV8A 3V46A 1YE8A 3VJMA 4X7MA 5E3JA 4KYVA 4NV3A 4BB0A 1OTHA 5DXJA 3V9PA 4YJ2A 1X80A 3QY9A 2FCAA 3KRTA 1HDEA 4OB7A 3M3DA 2ADOA 2QUAA 1RRMA 2VPYA 3IB3A 1IM2A 1UPXA 1JKMA 1AHHA 3BAFA 2YS6A 3ICCA 3N7AA 4GNKA 5FHQA 3RG8A 2ZB8A 3ZNOA 3LQ2A 5K8VA 5DDIP 2IE0A 2JJ8A 4YQZA 1H2ZA 1ES9A 4KIGA 4DLLA 4QM6A 4O5AA 5DLEA 1YZYA 1AA9A 1TYEB 4FDVA 3U7IA 1E1KA 1QK3A 3VFDA 2VJYA 2H57A 3TE6A 2DFTA 1FYVA 4L4ZA 4KJXA 4C21A 3O90A 2ZU6A 3T7RA 4P4NA 1SKQA 1ZGCA 2VPTA 5A9TA 1ZPDA 1AV6A 3IR6A 5A0TA 1DIOB 1XAIA 4RVCA 1QHEA 4HDSA 3WJ7A 5HS6A 1Q95A 4IIJA 3ZY2A 4QQKA 2OMEA 5BN3B 4WNAA 5EIAA 3VMFA 1KY3A 1KFKB 3DTVB 4CN8A 2Y1DA 2YJ3A 1AXRA 1NXXA 1R88A 2A4KA 3G5LA 3LGSA 4BQNA 5CT8A 2H1OA 2YRXA 2SCUA 4CI0B 4GO1A 1Z8HA 4X3PA 3WY9A 1B6RA 1TU4A 2E49A 4CMBA 1XTVA 3D2CA 1T3SA 2PU5A 1GSAA 5CCEA 1SRRA 5K3FB 3I2FA 3VX4A 2ET6A 4RMJA 1XN1A 1Y7HA 1G2QA 3M33A 1B14A 4KLCA 3ABQB 5FBRB 3HJTA 4YCAA 2W83A 2WT9A 1I33A 1VSVA 1YBVA 3HZOA 2AA3A 5K6TA 1PNRA 3PRKE 2DCUA 1VSQA 4FKZA 3U4IA 3ZWNA 1BMDA 1S2LA 8OHMA 4U7DA 4K8RB 3WLIA 5AW6A 1CFJA 2ZDHA 3ZHRA 3DAYA 4CLHA 4ZFNA 2ZG6A 1U3CA 1QVAA 3FNEA 3WYAA 4EHBA 4HEQA 2CLFB 4C0BA 4QPPA 1U7TA 2R44A 1AGNA 1Q0QA 3FF1A 5FPTA 3TKLA 2QUIA 3WYFA 2W6NA 3GEDA 4BLOA 4YUXA 5JAPA 2FMHA 4BWFB 3UGJA 3U31A 4DIBA 1MAAA 3GNQA 4DC1A 3KBBA 1HX7A 4BUJA 1G291 4RM2A 4ILKA 5EXSA 1L4BA 3EY9A 4EJ6A 2O2CA 4ZC8A 3I5UA 2LCQA 4CG3A 1C7EA 1QRUA 5JUWA 1HDCA 2ON6A 3L02A 3NWOA 4LXGA 1CUYA 3ZHTA 1TJPB 1H4QA 4LJ4A 1U7OA 1XZEA 2FJUA 2HSDA 1RJFA 2BFFA 2INGX 2R5WA 1YWGO 2UKDA 3RARA 1M8FA 3F6YA 5TGZA 5KREA 4RLSA 3MUFA 4Z7QB 1EUYA 3PI6A 1XPUA 3CVUA 4WGGA 4AN0A 5FWYA 1G2PA 2ZATA 1U31A 4S1OA 1ZC4A 5FIUA 2XY4A 1JR2A 1AB6A 2NOAA 4FVTA 2QMHA 2DPMA 4Q7KA 5AI6A 4XIGS 4C4TA 1COWA 1E0JA 2FPMA 4M1OA 2RE8A 1BDIA 4YMTA 1S3GA 5L3RA 5KWVA 3EFOB 3DA8A 2VJOA 2AZTA 2BGMA 1LSUA 3R8CA 5CA1B 2P40A 1M1NB 1UXHA 1Z7BA 2WKQA 2V7WA 4BNGA 4B3GA 2QY9A 1GYQA 1CJBA 1WUHS 1UBFA 1M54A 1J6UA 5D1HA 1G38A 3U0VA 3ZWXA 4QNNA 4MS3B 1B8VA 1WXDA 5IKXA 4WMLA 3AR2A 4RK5A 4TXHA 4HGNA 1I7QB 4YI5A 4GUAA 3IQIX 2C7VA 4J9VA 4IIHA 2HT6A 4CF4A 2NQTA 1XEWX 1U9IA 4TYYA 5AI8A 3DLIA 3LPLA 1P7CA 1INLA 4MV9A 4EX6A 7MDHA 5NLLA 3BL5A 1E3WA 3FIUA 4QTTB 5IH7A 3ONWA 3H9UA 4BBZA 1JRLA 1ICEA 4AJHA 4F2PA 1XC7A 4XDYA 1NXQA 1CJUC 3MCUA 2IIQA 3K4PA 4OJKA 2V1XA 5KWIA 5MHTA 5IVHA 2ZANA 221PA 1PS9A 1QCDA 3RGGA 3SWWA 4YBRA 2DLNA 3EYAA 5EWLA 1PS8A 1LQ2A 2PMCA 5I8PA 3KSBC 5J2TA 2D3TA 1JTVA 3L1JA 1XDZA 2QD3A 4EY7A 4E4RA 1L5YA 3FTPA 4L9WA 2JGRA 1L4NA 1TCBA 2JFUA 3FTCA 3VR0A 4BLWA 4MQUA 4RS3A 2HC9A 1AURA 3LHDA 2CEKA 7GPBA 2JBAB 3NLLA 1J0XO 2WB4A 1C1XB 1YVEI 4DRZA 3HMKA 3K5WA 2GESA 3AR9A 1KEEB 5DCWA 4MDHA 3UJHA 1PD0A 3B9BA 5KNLA 2Q5OA 3AKYA 2BTOA 3NTXA 4CR8A 4JIMA 3WOHA 4KFRA 4PLVA 2I2DA 3K8ZA 3BQ9A 4O8ZA 1XRSB 3CR8A 1E32A 3FLBA 4LY6A 4TRRA 1I2DA 4HNUA 2UUOA 3H5RA 4AYXA 3WHPA 1CR0A 2CKMA 4NS1A 1DX6A 1EM8A 2JGLA 2V7QA 4QIHA 4JX8A 4JLJA 1U0OC 1NM5C 4NV0A 1KPHA 1K7SN 3AEUB 3PPWA 5SZHB 2WW8A 2QRVA 2XA2A 3IA2A 2ZIXA 2XMPA 4QJBA 5KINB 2GILA 3JAWB 4I1UA 3DB2A 3KXDA 1D9XA 1UUFA 2I6SA 1ECCA 1KGSA 1TAGA 2VT2A 4OQPA 3TQCA 3UMVA 4NPAA 1DWUA 1QFJA 1CY6A 1R5OA 2CE7A 2E0IA 2JEOA 1J25A 3AJEA 2FZGA 3CGGA 3FCEA 3HJBA 4RZ2A 3B7PA 3PV0A 4D8XA 4LXIA 2NM0A 1PL7A 3IV6A 4RK6A 3PX2A 1YULA 3SJAA 3V5NA 3NO4A 2QNBA 3AY3A 3QEMA 5F7XA 3KC2A 1R5BA 4G84A 4NR0A 2X8WA 2NZ2A 3DMTC 4RGBA 4TKVB 4URZR 3ZS8A 3TFOA 3E7XA 3F5QA 3Q7PA 1C0KA 4EW6A 2H4HA 1MPXA 3DBIA 4WGFA 1XYVA 3EF0A 2KBFA 4QPDA 3UXYA 3OEEA 4AY5A 4J8PA 1M0WA 2O57A 1CJSA 2W48A 3GFTA 1V16A 2A7QA 3IJRA 4R8KA 4ZU1X 1JEYA 5FTJA 1QHIA 4DG5A 2WMDA 1HE5A 4PEVA 4B34A 4D96A 3QOWA 3J81k 4EB6B 3K9QO 4OH1A 1YA8A 2O8NA 4FOTA 3RS2A 1EEXB 2OAQ1 5FUVA 3OCJA 1EVYA 1FQWA 3UUEA 5JPDA 2YWXA 4K6GA 4WEOA 4HDMA 5E6SB 4DG9A 1XWIA 3E3MA 1GFSA 4PE5B 3RTCA 2C7QA 1G66A 2IODA 3UJDA 4TQAA 3RTAA 4CKWA 3IMCA 3N0XA 3A4IA 1MAHA 3OI7A 5E4FA 1YB2A 4W7SA 1UFRA 2HOQA 3HK2A 2I4MA 4RTLA 4HGPA 3TB4A 1DKQA 1IEQA 1WHTB 1RTKA 3TNFA 4PCUA 1OFIA 2JAXA 2NVOA 2VC2B 4C04A 4E5YA 2OVFA 4A26A 4IXNA 1PKEA 2PL1A 2DFKB 4NTZA 5FOSA 5KOJA 2MINA 3KQMA 2YFYA 4C2BA 1L5FA 1EE1A 4HATA 2CNBA 3GLHE 1GRNA 2HHAA 2WJ6A 4GX0A 5CT4A 4KZPA 5DLQC 1CHNA 1IY9A 3VDQA 4RTSA 4OB6A 1JT2A 1KTVA 2J3JA 3JWEA 3P9NA 4OHMA 5JPCA 1VPLA 2IZ5A 1OILA 2OVBA 2Y1WA 4LJ7A 3TRFA 3TQHA 2PXXA 1MABA 2ESRA 4FYHA 3LG2A 5EJFA 1N1EA 5DNEA 1O08A 3VX3A 4YMHA 5LU8A 1ENOA 1KZYC 3R4CA 1Z22A 1D5WA 3EN0A 4DLNA 1DPFA 5DWVA 4UHFA 2VPPA 1WDTA 5DXFA 3IUYA 4IGAA 5GJWC 4D4KA 5BT8A 2PBZA 2JCXA 3HU5A 4QPZA 3O03A 1Q92A 2WHPA 3M9WA 1RWXA 4K3VA 4NBVA 1KWKA 1EWKA 4DLKA 1QGED 1ZISA 2NUTA 4PQGA 1UZUA 4QEKA 2B36A 4E1AA 1ISHA 4JLPA 4KU4A 3LY5A 3EA4A 1VHTA 1DVRA 2I6XA 3KNZA 1QYWA 5E7JA 1KPIA 3CX6A 4EJ0A 1TEXA 2O8DA 1ISIA 1E4EB 2SKCA 1IHYA 3FNQA 4IZIA 3IOCA 2XDQB 3WK5A 1KR2A 5KMGB 1XYYA 3DWEX 4O2AF 5GPBA 4UOEA 1QTNA 2C92A 5K0LA 2RHJA 5C4MA 2I1LA 2VUTA 3HABA 1DRUA 2BEUB 4LK2A 4PTYA 5CHEA 3UYLA 4D0SA 2WB2A 3HN2A 1TUBA 3RV4A 5IULC 5DW3A 4ZVLA 1NF8A 4E03A 4F46A 3SC4A 1XEXA 1TLFA 3IIJA 1F2TA 2JCVA 5EJGA 4BX0A 3W5CA 1S02A 2ZIEA 3I4LA 1E7MA 4WY5A 2C7PA 4LRWA 2HYIC 2GYWA 3CN9A 5AW4A 2HLPA 2J4CA 2R7NA 3EULA 2IK8A 3ZQKA 1KARA 5JHGB 2PL5A 3PP8A 1NFQA 2JK1A 3PWKA 4RMGA 1EZZA 1HEYA 3WRYA 1H1LA 4I5DA 2JS7A 3RVNA 4FS8A 3DLTA 2X0DA 1AE1A 3H9QA 5L3VA 1Z4OA 3NAQA 4XASA 5JFOA 1XCGB 1T8YA 5A4MS 3FKSA 2XXJA 3WLAA 3AB8A 2QLNA 3EIXA 3JQGB 2ZWAA 2Q45A 5KYGA 1LBQA 1X74A 5ALPA 1Y1QA 3EZYA 3SHTA 5C7OO 1AS0A 1C9KA 3QU7A 4OIMA 3SYRA 1SG6A 1F1JA 1U0JA 2D5LA 2O7QA 1B6GA 2BY4A 2I71A 2NVUA 4GOLD 1E7SA 5JNRA 5GOTA 2F1RA 1T2AA 1VHJA 5AK0A 5KHAA 5LOVB 2JA1A 2FW6A 3TIVA 2HR1A 3GJ5A 2PUCA 1E2HA 1RHRA 1P7PA 2ZJ8A 4QPNA 4XR9A 4CW7A 4ER5A 4TV9B 3KJIA 1NJGA 4ZVRA 3OIYA 2QX7A 4FFWA 1RXSA 3NVMB 2XIJA 1PI3A 3CCFA 5E4YA 3RS3A 1R4NB 4W5NA 4NK5A 4D3ZA 4BLQA 1M2KA 5KTSA 1T43A 3TQFA 4MJ3A 1XTJA 2D54A 4G5FA 3EY4A 4Z0HO 1GGKA 2ERCA 2VDWB 2YWBA 4TKUA 5BSUA 2GN2A 1R8XA 3MT9A 3C3PA 4GRIA 3IT1A 3GDFA 4BNMA 5JS1A 2FMKA 1RQRA 4R9NA 3G8YA 1OAAA 3LTNC 3D8TA 4Z3KA 1X1RA 3DBHB 3DZGA 3N2KB 3PQ5A 3EPJA 4KN5A 1F14A 1GZ3A 4FU0A 5EINA 2CLEB 3EQZA 4HWPA 4KNYA 4P82A 4OGFA 1AO3A 1T5DX 3AF4A 3LO8A 1K8YB 4U7WA 3F5SA 5KYWA 2RHOA 1NUAA 1EXVA 4BO0A 1R2QA 3GEEA 2PZKA 3M3PA 5EOVA 4IXTA 1MFZA 3WLFA 2FY8A 4QOEA 3JSXA 4KR2A 2FN4A 3IQHX 4EPVA 3BWMA 1JSXA 4KH1A 5HW0A 3DEFA 2ZE7A 4CMHA 4LXQA 2W93A 2A7XA 1EX6A 4LSZA 3GFOA 2CNNA 2AUMA 3INGA 3PT5A 4Y18A 4BMXA 1PJ4A 4E2XA 2O5RA 2OCKA 1X0VA 5F21A 5I5EA 4RY0A 1Z9BA 4CIVA 4BQOA 4ZGBA 3GFPA 4ID9A 2DR0A 1E96A 4RZXA 5H3CA 3RK0A 3EGXB 1OGIA 1VI2A 5CX1B 3JTMA 2VDVE 3EEQA 1D04A 1PTKA 4W8GA 4C88A 1JNXX 3UXEA 4RFVA 1C7ZA 2HHJA 5HBGA 4CT4B 2W2PA 4ND8A 2X15A 3KQVA 2O52A 2KQUA 3U7QB 3IHLA 3K9CA 4Q39A 5JNLA 1MB4A 1BU8A 1U4NA 1U0HC 2R1TB 2OV6A 3C3YA 3FR7A 2I4IA 3NKLA 3W4JA 3ZWKA 1H2EA 3QWAA 4JKIA 4ZA2A 3KT0A 3U0BA 6ABPA 4XKJA 2J3MA 1WETA 3TOCA 1M1NA 2ONJA 4RCYA 1ZBQA 3SC3A 3T7JA 1ZIXA 2QSUA 1JJBA 1D8TA 2QTMA 1C8LA 1SGWA 2Z2JA 3BYZA 3C3JA 3IKJA 1CUJA 2FMXA 3QYFA 3T5BA 1PYOA 4MS3A 4HLNA 3ROQA 5I01A 3GQBA 2DR3A 3PGXA 4OU4A 3CTMA 4NZOA 5EZQA 5IC4A 3HN7A 4N0MA 4MRVA 3ULKA 4F4UA 3BXFA 3D3JA 1UDRA 2HQBA 3L2OB 3OZUA 4JUCA 4I5GA 2X58A 5I9IA 5KYNA 4PHGA 4B84A 3ASUA 4N7RA 1QWSA 1AUXA 3PQDA 1GZUA 2G8LA 2GEVA 3G2LA 1CLUA 1V4BA 2XQFA 3GARA 2X7HA 3A37A 3STVA 3PTAA 1BU5A 4DLZA 2CFOA 1GDDA 4FZJA 1W59A 4R9RA 3NU1A 4QDXA 3C43A 4HPJB 4PGFA 4LF7B 3KPVA 4B47A 4JL6A 1SZCA 1YIDA 2B5WA 2AT1A 2CMDA 5IKMA 2ZPTX 4B3TB 4IIVA 3TLZA 3K15A 1ULUA 1ULAA 1VHQA 1VLVA 1R9MA 2I6QA 4BYMA 4MWEA 1GYRA 5KX5A 3DL4A 2AG5A 3PWZA 1LH0A 4IMPA 1ZEMA 1PW5A 4EG8A 5BY2A 2FN3A 2ZJ0A 1RQ7A 4G41A 3LW7A 3IT3A 3JQ7B 4I8DA 4NU0A 3W2HA 1ODIA 4IGEA 5E4JA 2Q2NA 4NJMA 3GRFA 1FQOA 1EQUA 2QP3A 3ZE6A 2AEFA 2YFKA 3DOOA 5FBVB 2IBMA 3IT2A 4A15A 3PXEA 2ZE5A 3F2VA 1KEEA 2MWMA 4OJQA 5FA8A 3WK9A 1WZUA 4MKGA 1JFSA 4Z3DA 1MHTA 5ILGA 3RVQA 1FMFA 2Y0DA 1FC0A 2UVPB 4O2LA 5DP1A 3I04M 1Q6YA 3V8PA 2P2GA 4M88A 4BZZA 2QT9A 4WLEA 2J46A 2J0VA 3JZDA 3K53A 4CJXA 3RAGA 1H6AA 1U80A 2QR5A 5D5QA 3CH5A 1RQGA 4W8OA 3VBCA 4NCAA 1YRQA 3FIJA 3W5DA 1EFKA 2PKQP 1HQKA 3EJWA 3L6OO 4TMKA 2OHOA 4BNHA 1X8XA 3C6XA 3JAWA 2PSJA 5BN5B 4IJMA 4KQ9A 2FF5A 2VT6A 4G97A 3BE5A 4JBWA 4QG7A 3AUJB 3IAEA 3KPUA 3WAKA 4PM4A 2VYND 3OT5A 2HWYA 2UVQA 5AK3A 1KI1A 2JANA 4OGGA 3ER9A 1GR1A 3I2IA 2GUWA 3R6GA 4HDOB 3AHHA 4B0PA 2H65A 1AK9A 2B5VA 1YC2A 3QMMA 3RASA 4KLNA 2GMWA 2XYVA 3K16A 3DE5X 4TKVA 3KB6A 1O03A 4CDRA 3LWNA 3I05A 2O8CB 1G8GA 1T2UA 3R6DA 3EXG1 4PAQA 1P8JA 1XLWA 5B2ZA 4JLUA 1NBIA 3BERA 4Q3BA 1IZ8A 3KWJA 3FTEA 2XEDA 4EG1A 1ELOA 1GKKA 4KRYA 2C3UA 1E6WA 4PG6A 4BMPB 4G5GA 3I1JA 4M2LA 1XZLA 5TPZD 4H3VA 5KEIA 1MG5A 1GCUA 3E7WA 4CVNA 3TZEA 4EGJA 1O7JA 2IY7A 3SR3A 3O26A 3U6BA 3N6VA 2C00A 4U63A 5ALEA 2OQVA 2UYGA 1Z07A 3C1OA 1FVHA 3IS3A 4WI1A 2J3HA 4YWHA 2A1UB 2AOUB 1XCBA 3LOQA 3SSNA 3WSTA 2RD2A 1JSRA 2G25A 2LP4Y 3OZWA 4IS2A 1TO1E 1A9XA 4PO8A 3GN1A 1U1EA 4MV3A 2WV7A 3FWZA 1C9YA 4MJXA 4NL4H 2QGNA 4UU7A 4DMCA 4ECEA 1W85B 5BQOA 5LMCA 3NONA 4GLFA 1D2RA 2OTCA 1XEAA 3ABOB 4AJ1A 2JHAA 3ZHSA 2UUBB 4BEWA 4GPZA 4ME6A 1NSFA 1OLXB 2G77B 4OPMA 1XZAA 1RHJA 3NT5A 2X9QA 3RYHB 1TEHA 1PUXA 4ALMA 4DR4B 1P5HA 1Z0AA 5ALOA 1KVSA 3THOA 2RGNA 5J2UA 3BJMA 5EQJB 2HIGA 3I5XA 2Y0EA 3T5AA 1QV9A 3D6HA 3N07A 1KFCB 4A1OA 2A5DA 1EFLA 1LZLA 3ZCTA 3RLFA 4JLNA 1ZESA 2XXBA 5LUAA 3K0SA 1YJ8A 1V2HE 3X1MA 3BGWA 2MSCB 4GPD1 5EIXA 3QI7A 4UBLA 2IDMA 4OQQA 3MEQA 4RMHA 3RANA 3RC1A 4ND2A 2UDPA 4X90A 4LF8B 3KT6A 3V1MA 4M7OA 3E9CA 3L07A 2B2NA 4KLRA 4NZYA 3IESA 4J07A 1AQYA 1GZHB 2G82A 2AJDA 5CH8A 4M7PA 3FA2A 4IIEA 3SZUA 3CJQA 4E4YA 3U5TA 2P8JA 3TPZA 1RHKA 1V3QE 3DHYA 4ROSA 5HEKA 2YNMD 2GZSA 3P4YA 4P08A 2F55A 4FKMA 4XGRA 1EXDA 1KK2A 2BZ0A 3R20A 3HFGA 4EW1A 5KMGA 1ZU5A 1NVKA 4KQFA 2OCPA 2KHZA 2ZIWB 3FI9A 2IOQA 4J76A 4KQMA 1QFXA 4LSWA 4F9EA 3KWFA 5HK8A 4OK6A 3D6AA 1GTJ1 1HNNA 3ENWA 3A6KA 2FFQA 4D9HA 4QTYA 4BY9E 2WM3A 5IDYA 3VDRA 1E94E 1XLUA 3O9ZA 4LTDA 1YA6A 1FPMA 3GJ0A 2HCRA 1XDGA 4EHFA 3B85A 1J5XA 2R7MA 5LB2A 1LDBA 2GF9A 4RADA 1J2TA 2MCFA 3JQFA 2LUOA 4JQSA 4IGIA 4BCBA 1TQ6A 3MJRA 4BIIA 9GPBA 2QXUA 2VKTA 4QUIA 3TLMA 2QU7A 4Z5XA 1CR4A 3D4PA 1E2NA 2C8VA 1NR5A 3O4VA 2GAIA 4NESA 2CBGA 1RKVA 2VKQA 4L8WB 4BGUA 5A3QA 2R00C 3K1ZA 5JXWA 3L7MA 3H8VA 3GLRA 1WPQA 3CW8X 1P4JA 1P2VA 3KE8A 3WWYA 5DMXA 4YONB 3I0ZA 2FEMA 4KI7A 2WMNB 4QBGB 1UM9B 3L18A 3NPMA 4LVOA 5EP3A 4UUBA 3G9UA 4D1YA 2DOKA 1QH1B 2BGIA 5JSQA 3ER8A 1F60A 4AS3A 2JCYA 2WJYA 2R4QA 1GILA 2LD4A 121PA 4JA2A 5IN5A 3DMGA 3OEHA 2R6CA 4FZ3A 4PICA 4XQCA 3RWOA 5LOVA 2OB2A 1JPJA 2VYVD 2UU9B 4MDEA 3OJ0A 1UBOS 1Z4NA 2ZTVA 4GOOD 5K8CA 2IYQA 3AEYA 3L6BA 2M1XA 2NO6A 2RHBA 4MEBA 4KQIA 4QAJA 2VP5A 1HM5A 2RJ3A 4JT4A 2H8KA 4V0RA 1VFNA 4OFBA 4MCHA 4Z54A 4CG1A 1V8ZA 4CT0A 1VLLA 3P9SA 4ZYXA 5CFOA 1R4NA 4R4JA 3DQQA 5LMNB 4TL6A 2E5LB 2I7VA 4J1QA 4B6JA 2ZB7A 3ECAA 5AJVB 1Q1EA 2Q3CA 2H4YA 2VSXA 4JVNA 3H11B 5D6OA 3STUA 3TD2A 2WSSA 4CF3A 1AKWA 1K7EB 2GF2A 1UK6A 3Q3JB 2PZ8A 1QVWA 1FFGA 1LTQA 3IP1A 2ZUBA 3MSXA 3ZQUA 5ESWA 4E31A 1Q77A 3EXHB 4YLYA 3IP6A 3MF4A 4X1KB 5CXXA 2P7IA 1Q1AA 2VYCA 4MQ6A 1YKGA 1WKVA 3VU8A 4AZVA 3FTFA 5GWXA 5G02A 3VMMA 1RMTA 4GNRA 1ZZGA 4MUHA 4I4TF 4IDNA 4AMZA 2V7GA 4ND4A 1DQRA 4HNTA 5GGXA 2D0OB 4P36A 2GA8A 3ESBA 1H3NA 4FINA 1NX9A 3RSQA 1ZD9A 1RACA 4GI2A 1RM0A 4L4RA 3FNBA 5EHQA 3RR2A 4M0LA 5DNYB 1ECJA 2JKYA 2P68A 1TVEA 4XJXA 2V1UA 2CF6A 3OMXA 5EERA 3EEFA 3VGJA 1SKYE 3QMPA 4UQOA 2DKOA 4HSEA 5GV8A 3UF0A 4BFCA 1LTHR 3CB2A 3QLUA 1T1IA 3CF2A 1U9CA 4TL9A 3ETCA 1Y8QA 2WHRA 1VBFA 4C05A 3FPSA 3RUIA 1ODTC 2ZYTX 3N0RA 2AOVA 3VJLA 3F98A 4P32A 3E53A 4QJ5A 1PK8A 3HTXA 3TXAA 2X42A 1SC4A 1SEVA 5EWMA 3TTSA 4E14A 1ZNQO 1UKVY 3OECA 4FNAA 2CLMB 4OHXA 3T0IA 1BN7A 1KJYA 2G71A 4KX3A 2WD8A 4NMHA 3U2QA 1ZEJA 4BPBA 1U65A 4EK9A 1CUWA 5CX1A 2NYRA 4HLUA 5IK2A 3ORYA 4NBKA 4MP8A 4BASA 3EXAA 4EEZA 4HK4A 1G0OA 2AN9A 1T1SA 3I32A 4OHUA 1GPKA 4E51A 1FVFA 1PV4A 3L05A 3IVRA 5HJ2A 1X7WA 3S4YA 1YCHA 3TR6A 2JLVA 5IAAA 1ULHA 3OIFA 1AS3A 2VP3A 3PFIA 2PYDA 4G4JA 3D1VA 4AJEA 1H9BA 2RKOA 4CM9A 5HVNA 1SC6A 2CK3A 2Q2OA 3A1UA 4LV6A 3AZQA 5JDCC 1RC0A 2AJLI 2HBQA 2P1RA 4S1TA 1MJFA 1Y98A 1HDZA 4I50A 1EB8A 2ORWA 2QUHA 5JJCA 1FX1A 2B78A 1YF3A 1UBNA 1US8B 1WQ4A 2IU6A 3K7EA 4IJ6A 1SBQA 4QYWA 1Z62A 2Z6VA 3CBGA 5GMOA 4H6XA 2ZBFA 3SBDA 5GONA 4U6QA 4Y7CA 2O2XA 4R1NA 1TUGA 3OT4A 4ND6A 1N2CA 3BK7A 5BUZA 3CB4A 1QS0B 2M6RA 2W2KB 1G8MA 2YZMA 4Y2UA 4KQKA 4D6PA 2NO0A 4O25A 3UQZA 2B1JA 3KVYA 2ASVA 2BFMA 1G8PA 4K88A 4RD0A 1XD2A 3UMSA 5LZ9A 4RTJA 3HJHA 3PA6A 5DHTA 5BSFA 2CDCA 2HMYB 2P7HA 3ITEA 4B6FA 4NMMA 2FWMX 1F2VA 1FXUA 2VRBA 4AJKA 1GR0A 3I04A 4BAGA 5BN4B 1C2TA 1QFYA 2QPLA 1T3GA 4NMLA 5SICE 2JFFA 5IAEA 2O1EA 4JWTA 1CZNA 3LOUA 1Y1TA 2P4EA 2WPNA 2HCBA 1FJHA 2WJVA 1DC4A 1SU6A 2QN1A 2WIDA 4XEHA 5AK4A 2PV0A 1R10A 2WUDA 4CTOA 1J90A 3QFRA 4HQLA 3HADA 2AOTA 4XUCA 3O4JA 1H8ED 2P3LA 4IRMA 1CUIA 1FX0A 2QG9A 2QF7A 3PSAA 1AQIA 3G23A 3Q9NA 4WBNB 3D8BA 1JI3A 3PR2B 4GR5A 4LWQA 4GDMA 4QGBA 4EVQA 2YVKA 1L7XA 1TK3A 3CT6A 4PG5A 2EZ4A 4FKBA 1G55A 3P0HA 3LL7A 2HRZA 2FDCA 1V41E 4TQGA 5E3HA 3SX0A 1Q0PA 4P9NA 4GXTA 3H0EA 3I2JA 2ZI9A 4Q1FA 3NETA 2P78A 2CHUA 3FROA 2VDMB 2HMAA 1K4YA 2O2JA 1LWNA 1C4XA 1TTPB 1CCWA 3T5DA 4EO9A 4RJTA 5BYBA 3PGLA 2WHQA 1Z4IA 2ZYUX 2J1LA 4DT1A 3THWA 1SXHA 1Z7GA 2J9FB 3PGKA 4FMDF 5IT0A 1WCIA 1E3TA 2MR6A 1A5SB 4B7AA 3ZTTA 4OO3A 4OYYA 1LU9A 2CJPA 2IUTA 3G9QA 3MMNA 3N2LA 2O7RA 1G8YA 3CRMA 4YRCA 1XQXA 1NIJA 4U7PB 1WCXA 3SBOA 2PAAA 2C7BA 3K9GA 1LA2A 2PUEA 4JI4B 3WYDA 2O8CA 2QZPA 3RODA 1TGVA 5JEEA 1FPQA 5JAUA 3PUIA 4EG6A 5K20A 4EF6A 2B8JA 1EGAA 1FP4B 3PT9A 3VVLA 1JIQA 1I7LA 1ONBA 1RWNA 3A6EA 3WLRA 4G0ZA 4UBJA 1SXJB 2CJWA 2FSIA 1TD1A 3IFSA 3VSCA 4ZHQB 2AR0A 2WNIA 3ZU6A 1VYTA 1MJGA 3LQRA 3ESRA 4OXYA 2NT3A 1EBFA 1HSOA 4DHWA 3TI7A 4IS3A 3DOFA 3O8NA 1P81A 4L0CA 1QIFA 3LUDA 5DNUA 1B26A 2CNOA 1X7HA 3I6BA 5C2JB 1WXGA 3F9IA 3BORA 2IYXA 3EAQA 3I8SA 4QOFA 1JG3A 4A0GA 4WXHA 3HHPA 2WKPA 4PZDA 3RUHA 3ISJA 4B75A 2PZJA 4DCVA 4DLYA 2C57A 4EYEA 3ELDA 2QYSA 5G1PA 3OLXA 5GVSA 3LA8A 2VTVA 3HPRA 3AV3A 1MCZA 4NJEB 5D8DA 3RRZA 5ENZA 3U5ZB 1E98A 1G18A 2HA6A 1XQ1A 3GL9A 2A78A 2O0MA 3THSA 5JI2E 4NY1A 1T5IA 3BTUA 1RBMA 2JRLA 5ALMA 2K6GA 5G4LA 2BKEA 3G6KA 2WDZA 4U9UA 1XRLA 4HMQA 2OV1A 3BWDD 4NE2A 1OLXA 4NCKA 4Q4HB 4NICA 3WIVA 4BB5A 1Y3AA 4FEYA 3RJMA 1KAGA 4D4LA 4ARCA 3GT7A 3U09A 4MMZB 1C14A 2J45A 2MYTA 4X94A 3IP5A 5E2AA 1LVHA 4A8HA 2JIBA 4OL9A 4BZWA 2BGGA 3AKCA 3KSUA 2Y05A 3DO6A 3I1FA 3OPMA 2XNKA 4Q9AA 3R9KA 4B1FA 5KTTA 1TTTA 2H6EA 5I9BA 3AM4A 1SC1A 2VF5X 3RSCA 4ID3A 3KJFA 2ZBRA 1U5AA 1UK9A 1H0HA 3GNSA 4A8JC 3HUUA 4FJ0A 2QX9A 3SPXA 2E9SA 16PKA 1GRVA 2Q8QA 1DCTA 4OIFA 4D44A 4HUQB 3R7BA 2OK7A 1L9KA 1RFGE 5C4GB 4JI7B 3UENA 2OKGA 3C48A 2VTKA 4WLFA 1FNMA 4HN4B 1MV8A 5KIAA 1PJ2A 2O0LA 2A92A 5GV7A 5M5BA 3VJRA 1W47A 3QY0A 4RD1A 1XZDA 5FXMA 1K3TA 4CRWB 3T4EA 2V98A 2WJAA 5E9JA 2FLWA 1K7FB 2MOKA 2OGZA 2IIVA 4GZ5A 4R1SA 3TNJA 3N2GA 5K2MA 1YRAA 1ULTA 4TS3A 1NUPA 4LXHA 4BKMA 3FDFA 4WJZA 3WLQA 1MC5A 3ONDA 4RK1A 3C8HA 4RTNA 1QFZA 3UPDA 4Z7OB 3K4HA 4DUPA 2H16A 1XAHA 1O1YA 3R3SA 2FMUA 1VC2A 3CPSA 3U62A 3HSKA 4KREA 2VQSA 1RFLA 3MWJA 5JSZB 1P6XA 2X2OA 3UAWA 4BNXA 4FX5A 4R8VA 5KTNA 3R3JA 1VCNA 2QLFA 1WXQA 1YXMA 3G5TA 1DEOA 2XZTA 4L07A 2FHPA 1WTAA 3K9HA 4U3JB 5JC1A 3AWDA 1V26A 1TJ3A 3MJEA 1K06A 1BTOA 1PR0A 1DFHA 3EUEA 3NGXA 4LGYA 3QE2A 4W82A 5ENVA 1KZ7B 4JD5A 4TM7A 1LFDB 5BSRA 4E5UA 3ONEA 4LHVA 4GQIA 4L5JA 2FSFA 4X6XA 5JZBA 2A57A 1UWLA 5D3MB 1A9RA 4XUDA 1NP3A 2IEYA 3JQAD 1EJ6A 1X1EA 2GVZC 2J85A 1UJBA 4JITA 4JZKA 3OHMA 4XRRA 5F73A 3C7DB 4DA7A 4MQEB 3EE6A 4R68A 4U00A 4PV7A 4K1XA 1JVNA 1AKVA 3SHOA 1AQNA 1JQBA 1KE1A 2C5GA 4ALNA 4EI7A 1EXNA 1QRRA 3A25A 3T9DA 1UP6A 2BEVA 4F4JA 3KETA 2BM9A 3FR8A 1J8YF 4HMPA 4JNCA 5CT5A 4S3MA 1SUAA 4K9SA 3TW6A 1PJSA 1PTJC 2FF7A 4TZ6A 1E92A 3HVUA 1H9AA 4BKPA 1VE7A 3CNQS 3ED5A 3MELA 5CVEA 3HL4A 2R6HA 4M4SA 3L7NA 3M6IA 5KUTA 4RKFA 3NHUA 1C5KA 3T54A 2O48X 1V1MB 1Y1KE 1C4OA 2EBHX 4UVGA 3ANNA 4DSNA 1G8AA 2QZZA 5EWJA 3UJCA 5K03A 1M5UA 4DCCA 5CFNA 3JARA 4RK4A 1VE6A 3PNYA 5FBLB 1OE0A 3PC6A 4LE1A 1ISPA 1IJKA 3UO8B 4CQJA 3SCZA 4HEHA 1FSGA 2RAUA 3DOJA 3CKLA 3HA7A 1E4YA 5CYPA 3SQLA 3NXKA 4H08A 4P92A 3HJNA 3L8EA 5ELXA 1NWHA 1CUAA 4KMOA 4R1LA 4V0LA 1XZPA 5DTMA 2BZ1A 1RJ9A 1Z56C 3OJEA 2FUKA 5E1BA 4B7ZA 4JI2B 4D25A 2EP5A 4IICA 3ZYCA 1ZVMA 4UHDA 2B2CA 5G0WA 5H82A 1M10A 1HT2E 2UYCA 1MA0A 2QBYB 1XCJA 2QRNA 3B12A 5DFAA 3GUHA 1O58A 3BA6A 2EZ9A 1HE4A 3FMPB 1K6IA 4QHYA 5SZJA 4MARA 3PXDA 4GOND 4V38A 3ZE8A 1JG7A 1EWYA 2GD2A 4IM7A 3R7DA 4BBPA 5AHOA 3AVOA 3P7MA 2O7SA 3FGOA 1JJFA 4ND5A 4RGVA 1T0UA 3EXFB 4FQ8A 5AVVA 2HJRA 2XVMA 1OBFO 2YDXA 3KVNA 2JJ2D 5M04A 1WZCA 4I8IA 2FLVA 4EUHA 1NY6A 2QN9A 3VO8A 4CYMA 1CP3A 2H08A 2Q0SA 1X92A 1IU9A 3FMGA 4LI0A 1MRZA 2MYPA 4L2IA 3WBBA 3K71B 4HEA6 4LYYA 5CK5A 1D2MA 5ALHA 2Y68A 4QFMA 1C1HA 3VYVA 2VXOA 2WY2D 1PCXA 1CNFA 5TE9A 4BTLA 5I7HA 2H2IA 3AY0A 4C7KA 4FDLA 3C6BA 1WY7A 3KBOA 3VR4D 4CT5A 1ESMA 4MJLA 1RZRA 2CMKA 1E59A 2YWFA 1V47A 3LCCA 5AKIA 1LVUA 1U2PA 1Z26A 4QDZA 4JGIA 5F64A 1GWNA 2WM2A 4CLOB 3LPAA 4A2QA 5JC8A 1EJ2A 3DWGA 4ZYTA 2WPDA 4KW7A 2FPKA 4C4OA 3JASA 3SHVA 2EW2A 4Q4JB 2FUG6 4HAYA 4U2GA 1KZHA 4GMGA 1WR8A 2QLBA 3DTTA 3VO9A 3W7VA 1F4LA 3REQA 3ETLA 1CP2A 1OI4A 1KSGA 1X2EA 1V6AA 2FOLA 2X3YA 4RPIA 1W4ZA 1MXFA 2AS0A 2B8EA 5K0CA 2WYUA 2HLNA 3LZDA 3ZGLA 4FNMA 1US8A 3ZZUA 2CE2X 2A0UA 3DFIA 3AESB 3A11A 5HZGA 3BKWA 4G26A 3H8JA 3C85A 3TQTA 2MYUA 2XGMA 1OWLA 4Z2AA 2Z3WA 5LPNA 1YZVA 2D8MA 1AGRA 2PX2A 1YO6A 1WMBA 2PWBA 4EZEA 2AIRA 3D6NB 3D7LA 2ZYGA 4REOA 1EG2A 3KELA 2YHIB 2FR0A 4I3FA 3KOUA 4PF1A 3GGPA 1OTXA 4RVDA 1U0RA 4KMMA 4MKRA 4PIPA 3W5SA 1P8AA 2O8FA 1A7AA 1FXWF 2AW5A 3H1EA 2BLLA 2YUTA 5DGIA 3S55A 3IUMA 3A4TA 5EKTA 4CQMD 1OAOC 2DQZA 4Z1MD 3ZDAA 4G67A 2VLBA 4B3IA 4BVEA 4ZYYA 4HH0A 2BKLA 5EZYF 5CVVA 1W6RA 1U8AA 1IJFA 3GRVA 3PITA 1MQ8B 4LDAA 5BN4A 2W00A 3E1SA 5HBRA 3HDVA 3ZVLA 2H2GA 1TMKA 3PZBA 4E0BA 2Q1YA 3GGSA 3NIDB 3MMXA 2PVSA 1X9IA 2CY0A 5JBIA 4EFNA 2XITA 4HFMA 3I2HA 4JOBA 5I9NA 2FJ0A 5EGNA 5LP1A 2VNJA 1YL6A 3U60B 3GFBA 1H4TA 2HBRA 3HU1A 2C2ZA 3AVVA 4Q1DA 5BVGA 4XM1A 5LZ2A 1H2FA 2IIBA 1YVRA 2YHUA 2DYKA 2O4CA 3GVIA 1KI4A 1TI7A 1Z3IX 4RWEA 5DT9A 4F91B 3M5WA 1WMFA 4PBSA 4KO3S 4Q66C 3OC0A 5LBIA 2PT6A 2PGLA 4X8OA 1HFWA 1VYVA 5LA6A 3G0BA 4BIMA 1BGVA 4QWMA 1E1QD 3A58B 2P2ZA 2X8BA 2HJVA 3IEMA 4DSZA 1PJRA 1TUEA 4HCJA 4R0VA 4YH1A 1X77A 5FRDA 4F92B 5FBQB 4EMBA 3SVZA 5DYWA 2P6RA 1O9HA 5CXUA 3VVBA 2MT9A 1GZ6A 1QHGA 5C34B 2ID8A 3CINA 1VP3A 2W2NA 1LPNA 2J9FA 3ZXUB 4EL5A 3T3OA 1MEEA 4AUNA 4NRDA 2RBKA 3FI0A 2GN1A 1TF7A 1VBMA 4EP1A 1KDTA 4B3DA 1PHRA 4LF9B 3ZV6A 3NB0A 5A7GA 4AKIA 5A71A 3DBVO 2WQZA 1IWOA 4JN6B 3G2PA 2P9QA 1AGYA 2D2XA 4RSMA 3CKMA 1UMKA 1VMAA 4IX9A 3L0SA 4FXOA 4UAVA 3CNOA 5FFMA 4FN5A 4F60A 3TGLA 1DG3A 2CXNA 1YJBA 4TTQA 4Z4GA 1YB5A 1IQRA 2PTGA 4PANA 2YMLA 1A4XA 3AUXA 3JYQA 3CSDA 4KWHA 1L5LA 3VHLB 5C32A 2Z8ZA 1PGPA 2KJQA 2RG1A 1TECE 1WM1A 4MGYR 5A9RA 1MB2A 3TCXB 4OSOA 4FEAA 4ISBA 4IJQA 1P91A 2HKIA 4DG8A 5HK9A 5SYNA 1VYHA 5JR3A 2J5QA 2V6BA 3CVYA 1JG6A 1IN1A 3QJYA 1A04A 1FVXA 1OIWA 1JHAA 1L4UA 4UHHA 3PC8C 2UAGA 2J08A 3EQ6A 4UQPA 5AQEA 5JZVA 2IXGA 1FXSA 4FTWA 4LGVA 4ENWA 1NBHA 2BFEB 2ZSUA 1LDNA 4IKEA 4Z8XA 3RYIA 3SICE 1SVNA 2JFYA 3UNXA 1HT3A 1TPZA 3DR3A 1W5SA 4BUCA 1D7OA 2IYZA 3HVJA 3HFSA 1YT5A 1KJQA 2NSDA 4JVMA 4HNRA 5TGDA 3BBPA 4CL0A 5EPEA 2PANA 2XUGA 2PGNA 4NJEA 2XTAA 2FFAA 3LP6A 2FNAA 3KALA 1I1QB 2WBLC 4UZFA 2TYSB 4LJRA 1JE0A 4K9MA 1G6OA 2AFHE 1IH8A 3ICPA 2ODAA 5KU7A 1E2EA 1XDBA 3K72B 1XXHA 2WYVA 4U7GA 4ERNA 3GZNB 3T9FA 2IUUA 4EKGA 4B35A 3UCEA 4Q4HA 3SR0A 3PFKA 4XARA 2VHQA 4V2IA 2FZ4A 2FETA 1Y80A 3GIWA 3JVEA 3MCTA 5IANA 5LYYA 2JPDA 3NGLA 4MUMA 5DTRA 3TH5A 4CDGA 3KR0A 1SD1A 4OX9Y 5C5EA 2JFZA 1G3IA 2QL9A 3KB2A 4HQFA 3O95A 2ID4A 1I4OA 3E6AA 1U9ZA 1TEVA 2REQB 3HCPA 4BMVA 4NEGA 2V3VA 3CE6A 1U2SA 3TLXA 3AERB 1V45E 1Z5UA 1FDTA 1IHUA 4HUQA 1UCFA 4ZXPA 3RFCA 3TD6A 1G21A 1YS9A 1XF9A 1P2SA 2AFIE 3M6FA 2FZLA 1KP3A 2OA0A 4RDXA 4J3NA 4IFIA 4NE7A 4DM4A 4E7OA 1KH3A 1JIIA 3HKBA 2R84A 1I1OA 2V9CA 2B3TA 2IZZA 5L3QA 3L4KA 4KPYA 3ZD6A 5FOWA 1MZVA 3DL0A 4RA6B 3TZQA 3WGHA 2PJRA 4O2AB 5HTKA 5T67A 4PLCA 4M9CA 1YE5A 1A8IA 4INOA 5HF8A 3FOWA 3H9BA 4HQ0A 4LBVA 4OK5A 4HX2A 1Z0JA 3S2EA 2CB9A 4PLYA 3TMKA 1W76A 1DKUA 2K4MA 3DDHA 3M49A 3SXUB 1L7EA 5K3OA 1QMPA 1CS0B 1ZSYA 3CR7A 1PE0A 3L77A 2QZJA 1JDTA 5AICA 3STXA 1ZO8A 5T64A 3COJA 2JJ1D 2ZRGA 3HDTA 4A36A 3VR1A 1O87A 3A1EA 3U4CA 2UUCB 3PYLA 4N5DA 3T1HB 2OXFA 2B34A 1ECFA 1DI0A 3GFQA 3DPIA 1AUQA 3JATB 4FEGA 2X1MA 4O1IA 3CIOA 3ZJ5A 1GT6A 1Z8DA 4DY6A 2C03A 1HO3A 1OFHA 2YQ4A 2FG7C 3TD9A 3X1YA 1BMFD 1BXZA 2J87A 2QR2A 3ACCA 1GNQA 1LW7A 1RAFA 1U1IA 4IHQA 3R7WA 4BO2A 3CLKA 1D2HA 3BPSA 4Q3AA 1EUCB 1H93A 5D3MA 1BDHA 3ZHXA 1XDWA 3QW2A 3D9QX 3I9OA 3OQBA 3U7RA 1GEEA 5KOIA 4HADA 2ATIA 1P9OA 2G72A 1PLJA 2BCGY 2IHJA 2JD0A 2O0JA 4MQEA 1KAEA 2XVXA 4NDAA 4TSFA 4B4WA 1PF7E 1Q83A 1M76A 2IKQA 4MMXB 4B3FX 5LN1A 4QUJA 3M34A 1QR6A 2YC2C 1IZYA 4Z2YA 3QEKA 1EPUA 4PQYA 4R8LA 2CV1A 1DAGA 2QTFA 2EZ8A 4LOIA 5TNXA 2X4IA 3AJRA 4I5IA 3FYUB 3E18A 1A95A 3Q8KA 3M9XA 2DAPA 1CR2A 2A59A 1YQTA 3HVIA 3QIVA 1Y9DA 5EG5A 1JAXA 4C5AA 2YXDA 4RQAA 4BFVA 3JQPA 4IHAA 1Q0ZA 3MCVA 2AI2A 1L5OA 4YMSA 2PMDA 1DRJA 1NBME 3GYGA 3PNKA 4A0QA 5CA0F 3JYOA 2FVXA 1U1DA 3NV7A 3S2YA 1Q1BA 1Z2EA 1G59A 3MT7A 4KR3A 4EA6A 4L4SA 2CDAA 4PBTA 4RH1A 3AG5A 3EEBA 1DL5A 2EQAA 3ENQA 2YIDA 3FPHA 4YCMA 3DKVA 2XH8A 3HO8A 2RH5A 3DMHA 1ZBDA 4GX2A 3MUNA 2KMLA 2AG1A 1EVLA 2OPBA 4GVXA 5A4AA 5C5CA 3LK6A 3I73A 3I9V6 2CBXA 4YMVA 3CX8A 1QLHA 3V00A 2XRYA 4U02A 3G85A 3ZE1B 4YV7A 3ZCXA 1OYOA 4JUBA 1H1DA 1JEQB 3TW4A 3WYEA 4CLDA 3VPAA 1WXIA 1JTFA 4BB6A 2I80A 4CG0A 4GMKA 3CNNA 1QF7A 1TU0A 4I55A 4OFXA 5ALIA 3HVKA 3QKWA 4EPWA 5KPJA 1RAGA 1JS1X 1FUKA 1FLVA 3FPFA 4FCTA 3DKIA 3LVQE 3K20A 4HAVA 5SY6A 4AJ4A 3PUWA 1K92A 4Z9FA 4I6GA 1P4AA 3HO6A 5IAKA 5AJUA 2AQ8A 3F97A 5EJ9A 1Y33E 5HOQA 3EXFA 4F0JA 1ECPA 4RHXA 4OHFA 3TW0A 1JXMA 2C5BA 2NZUG 4IGKA 1NGSA 1V35A 4LK3A 2I5PO 3F6EX 4JZYA 4RH0A 1MDBA 1Z5OA 1C4WA 1K5GA 3P0JA 3MWEB 4TQ9A 1JYFA 4YXWA 4DADA 4RQUA 2JG3A 4N8EA 1ZJ4A 1LI5A 1WXFA 1ZS9A 3N8NA 1Z6GA 1UEIA 5K0EA 2Q3LA 2WC1A 5BPHA 4JR0A 3UB3A 5JAQA 1XJ5A 3O2SB 4LHWA 1VGRA 4RPHA 3HEAA 1QU3A 1XPJA 2WWWA 5I47A 2YY5A 3HACA 4RHEA 3PVZA 3UVEA 4DSUA 1U8UA 3CZRA 1Z0IA 1UPUA 2D1RA 4IUDS 3QUTA 2F8SA 4XRGA 1AKMA 3B1JA 2P9EA 3NQ41 5KBYA 4FEEA 3QVMA 3WICA 2IHVA 4ITVA 2J4FA 2QUZA 2Y1FA 1D2CA 3JQDA 2XGJA 3DQZA 3QQPA 3SG0A 3CQ9A 4YT2A 1ONSA 4UVDA 2R8XA 1RYFA 2BDUA 3KEMA 1XTQA 4M87A 4ZT7A 3TMYA 2MSEB 3WNQA 3L8MA 2GZ2A 1U2DC 4C3VA 3GRYA 2DJIA 5JRJA 1G3UA 3BJEA 3VI3B 2LW7A 2FQ1A 4PN7A 1UJNA 4BV8A 2VEOA 4J4HA 3F8WA 1IATA 4C20A 2EFYA 3LQ4A 4BLTA 2WKRA 1U2TA 4PZCA 2OC4A 3HRIA 3I5YA 3G89A 2WRZA 5CVUA 2BFCA 2HQ1A 1J5PA 5DTEA 3RCBA 5FJIA 1E99A 4Y6GB 4PSUA 3TLEA 5KDOA 2D00A 4BMYA 2A67A 2PZFA 3OICA 4BV3A 5AJWA 3T7EA 2PBLA 3IBYA 3F71A 2PLNA 3HU2A 1ZCZA 5ULLA 3UCFA 3WGLA 4INJA 4C3ZA 1FS5A 2IGBA 4G0NA 3K8YA 2HIHA 4Q6BA 1CF9A 2IYAA 4Q7MB 1BD3A 5JMTA 3DDUA 5E1DA 1WB6A 3IV7A 2QVLA 2IV3A 2XUPA 3V2UA 3V8QA 3GLHB 2FLKA 5IBCA 3L3BA 2ONZA 2XADA 4FONA 1PK7A 1YE3A 5EJ6A 3MJTA 1PT8A 3KHTA 4F4CA 4MUGA 4NYMQ 5M7EA 1JJIA 2V9ZA 3E9MA 3GAAA 3K1AA 4MV5A 4RVSA 2YJNA 4M76B 2I76A 2DR2A 1R12A 4W6ZA 3HDGA 1D6JA 1S2GA 4BNLA 4D9KA 2PRKA 3FCCA 4N0EA 3CLRD 4UJ3A 4NQRA 3C87A 1A96A 3FXAA 5IWCA 3V34A 3TSCA 2O2HA 4LJKA 3I3OA 4HRXA 2G83A 3V1TC 4LJ6A 1P5JA 4TYWA 5A1TA 2P9ZA 5MGBA 1XRNA 2AYZA 1K2WA 4WV3A 5DM4A 2YQZA 3EPKA 4ESHA 2Z6UA 2PXCA 4NECA 2BKAA 3CXUA 1PQWA 4TTAA 4J0GA 2NO1A 5CVJA 1U1FA 2BHRA 2CKDA 3GMDA 1CC1S 2HRBA 3F2IA 3HU3A 2NUPB 2YX1A 1YOBA 4L74A 2C2BA 3H8SA 1QVRA 1VIYA 3R9WA 3MTDA 3DE3X 4C87A 1WCYA 2Q7DA 1SK9A 2BFBA 3P1JA 2X19A 3B6ZA 3HKCA 1NSYA 5JAOA 1O54A 2Q3EA 3HB1A 5I7EA 1AKYA 1KY4A 3OE7A 4RW0A 3Q8LA 3EZ9A 3KJGA 1MHPA 3QVSA 3ZW8A 3F0TA 2HCTA 2EFHB 3VDMA 5HIAA 1JPVA 2PFGA 3CZ9A 1E9RA 2W6IA 4FDTA 3WLHA 2E4XA 2GSDA 1A4IA 3GJ8A 1CY8A 1WHSB 3AETB 1LS1A 3WSWA 4DBVO 2SBTA 4KTVE 3BWBA 1TVCA 1IULA 4X1OA 3OO1A 2XB6A 2ZSJA 4YRNA 3MERA 4DR2B 3V42A 1GQYA 4GKAA 4MR9B 1JHUA 4JMLA 3LDFA 4DKJA 2RGUA 1DKNA 4LZWA 4YVFA 3QYJA 2P75A 3WWOA 2HT1A 5L8VA 3OD5A 2H9AA 1CJKC 4ZT4A 1LNSA 4KXYA 4YPOA 5A5EA 5MN6A 4YWJA 2ZRLA 1D4OA 4FCVA 1VL5A 2B3DA 3L40A 1LB1B 2JLSA 5E0OA 3MTIA 4WBSA 2GCGA 1JLLA 3MCZA 1ZC3A 1RPJA 3HB7A 3IDZA 3LY8A 3NOVA 5EESA 5KJ1A 5KVSA 3NG1A 2EQBA 5IJXA 1IRIA 2B21A 3G0CA 1RI4A 3DGFC 1PGOA 4GYYA 3HSYA 4L5AA 3SM3A 2R2GA 1NM5A 2BGLA 3JYLA 4IQGA 4OXKA 4RIEA 3IQGX 4C89A 1UBTS 5EKXA 1XT6A 4JFRA 4RKQA 5ALGA 4UTNA 4MINA 4M1WA 3OFKA 2FE4A 3VJKA 1FU7A 2GK3A 2VZ9A 4PYRA 3H19A 3OZSA 3HCAA 4UNRA 2HA0A 1JHDA 3WFIA 4L72A 2C4MA 1O97C 1IBRA 1B7GO 5JIBA 3GP8A 3CZAA 4UE6A 2W2VA 4ZOEA 1OA1A 1FZTA 3J80A 2LV8A 3CV3A 2IJGX 2OXEA 3ORFA 5FTMA 2FSGA 1QPGA 3FCUB 4EY4A 2ZXEA 3D59A 2NTEA 4JI0B 1I4WA 2Z2YA 3DMTA 4F2DA 1B76A 2PGIA 2BELA 2PGDA 3NH6A 3BB1A 3QMWA 4JJ4A 1MPTA 3MIIA 2XYGA 5DI3A 3RM3A 3WYBA 3IEXA 5K0JA 1JVBA 2B25A 5LFAA 3G0OA 2PIAA 3NFRA 4POAA 1DT5A 1V6CA 2PX8A 1P5ZB 2WU1A 3DZBA 3EISA 4P4GA 3NCTA 1A7KA 1JEDA 5BORA 1KHTA 2OYSA 1NRJB 2REQA 3PEWA 2W42A 8AT1A 4O08A 4KO2S 5A5FA 3BS4A 4O2BB 3AERA 1CZHA 3L9XA 3N6XA 5DV9A 3W1WA 4P3OA 2JAHA 3SFTA 5CFPA 2OZKA 2H5JA 2JGKA 1F4VA 5HZHA 3GDOA 3ZQ4A 2F3RA 1W0CA 3FBTA 4M1MA 4QG3A 3OPYA 2ZAOA 4P86A 1CJMA 2ZRNA 3DHEA 5IAJA 1SRQA 2YWGA 3FWPA 3THRA 2XRZA 3E03A 2Z08A 2P0YA 3NIWA 1QRDA 4CODB 4ZJPA 1N2HA 3B3GA 1FLDA 2GN6A 3BK1A 2QTNA 2RH8A 4Q18A 5BQPA 3EVGA 2YV1A 3O2NA 1MD9A 4XWAA 1O9BA 5CT6A 1K1EA 1NP6A 1P1IA 3IAM6 1P0CA 3SXUA 2C99A 1XBTA 2GD1O 1CS0A 2B4QA 2V6JA 3BMQB 4P0TA 3MUOA 4URYR 4UNIA 3UAVA 2BGWA 3C41J 1T10A 2RGWA 4C2TA 5EC8A 3N0WA 1GGNA 1GPNA 4L16A 1RLJA 2E4YA 4ZEOA 1YV9A 2GA9A 4NYIQ 4DXDA 3I30X 3PQFA 1IIBA 1JWLA 3R7LA 5JRZA 2BEKA 1ADYA 2IQ5A 1EBBA 1JDJA 1L9XA 4BFYA 2JARA 4QQ8A 1M2VA 2XUIA 1MB9A 1TJYA 4RVFA 5EP1A 4FFBA 4I9UA 3Q2KA 1EUCA 1YHYA 5HG0A 2D2IA 4U2CA 4P2GA 5FO1A 4ANFA 2EJCA 1PR4A 3X1ZA 2JLAA 1SHLA 2BZSA 2HCJB 1H23A 3P0IA 2DC1A 3ZYZA 4DRXB 5JCJD 2UZAA 2QTGA 3WL4A 1IHPA 1SPXA 1X7XB 4N12A 4BLVA 3RW9A 1RI1A 1H4SA 4DCJA 5TT1A 3K6SB 1C80A 3AM3A 5KDLA 1FYEA 5TQ0B 3ROXA 4BQIA 4X45A 5KTKA 4FYVA 3AY7A 4WXRA 2CVHA 3TQOA 3OURA 2BFAA 4QYSA 3SZLA 2J67A 3H86A 5FQOA 3OCXA 1VLMA 4XWOA 3O0TA 2P6PA 4NYJR 2GBFA 4TWBA 1G5PA 1QC5A 2XE8A 1O97D 1E7YA 3DDCA 4W1RA 5DYIA 1OWPA 2FXVA 1N92A 4KXFB 1GL9B 1GNTA 1YGPA 5AW0A 2XBUA 1SFRA 1YDHA 2FRVA 3CKKA 4F8YA 1XPOA 4J7AA 4Z4HA 3Q85A 5AXBA 2J4DA 2R0QC 5ED4A 1LPPA 1UMDA 3NYWA 3PEVA 2AQIA 5DB4A 2WE8A 4R98A 1PL6A 3DB1A 2OBBA 4KKVA 4QEDA 4XLZA 3WGOA 3VZCA 4WCDA 3S8MA 7REQA 3KFLA 4D56A 4C6TB 4JQOA 3FPBA 4L0QA 2F6RA 4O4HB 1XTPA 3HXOA 2OFXA 1ZD5A 2O20A 2OORC 1E18A 2NX2A 4BATA 5FI1B 2HUPA 4PRLA 1K7XB 3PRJA 3GEMA 5KZMB 5FV7A 1JEQA 5AJXA 1ZN8A 4WHMA 3DFKA 4RELA 4LE0A 4KPEC 5H4HA 2AF3C 4YRRA 1HL3A 4XAQA 5I7FA 3UAXA 3LDAA 1U2ZA 1MKYA 1G41A 2PT7A 2QQGA 3KQOA 3ADBA 3L7LA 3U49A 3PX3A 5HQ3A 4B48A 4EUKA 1ZMOA 2QJFA 2JFPA 3Q3GE 3ND8A 4GGMX 4BXOB 2FEAA 3G59A 3IIIA 5IYZF 2C83A 4YT4A 4XFJA 3EZFA 1JKXA 2CWWA 4R01A 4XDHA 3THYA 6NULA 3OIUA 1LX7A 4YPFA 2W6JD 2H4WA 5ERYA 1NIPA 1ID8A 1G3MA 4FBGA 1JQAA 2DT5A 4J94A 4HF7A 1LNQA 2GM5A 3D2AA 4KB5A 3HZHA 1CIVA 4IDGA 4M86A 2PCJA 3GAMA 3RS0A 3UKOA 5C8YB 3LLVA 3H83A 4Z0PA 3TX2A 3UJ8A 1W48A 3NVDA 4YRIA 2F8TA 4NZNA 1GCGA 2P67A 3OLQA 2OP1A 5FNZA 5AESA 2PO7A 3H2HA 3OHPA 4WSOA 5CTJA 3O7MA 4RVUA 1FUIA 5DKFA 3WL7A 1KFEB 1F0KA 1RAHA 2IHUA 1GQFA 1P1CA 3FYHA 3LLUA 1AZTA 4GRAA 2IRWA 3AJ9A 3EOZA 3LECA 4POOA 3L6CA 1EAYA 5TMDA 3TQIA 5MFZA 1YONA 2E18A 1DAHA 3EGDB 2QTWB 1YTLA 1Q11A 2JZOA 3KTAB 4IIBA 2XI4A 1ORWA 4F5YA 3LUAA 1ZU4A 3PNSA 5BQXA 3ZJUA 3H75A 4MP3A 2XXAB 4RJKA 2ZJBA 4N6NA 1WF6A 3M6WA 3KUXA 2XJ9A 2OFPA 1DLIA 1G7CA 3CLUC 2JGFA 4RUKA 4MLDA 3SMQA 3ANXA 3W90A 5KNBA 1VJ5A 3IUJA 4ARVA 4ZEVA 1WQ1R 2JLRA 1O6GA 3R3VA 4EARA 1JA1A 1MAUA 3RBXA 4MO2A 1Q7RA 1V5GA 2P3QA 1XP8A 2IVZA 3F4KA 1BCSB 1TQ2A 4GLLA 1IPEA 4RPLA 4B71A 1OT3A 2A1TR 2A9PA 4GYWA 4IJWA 4A2WA 3GJ4A 2DPGA 1U8CB 3C2QA 5A3RA 2PMWB 3IAHA 2JB9A 1ESNA 1LFAA 1UZAA 4G25A 4TL8A 4OFZA 3H1BA 1FRZA 4KZKA 1E9FA 3IDOA 4QBFA 5B2FA 1NVEA 1CFZA 2XQJA 1IZZA 2BCEA 4BU1A 3A2KA 3GJRA 2NV6A 4QODA 1LBTA 4M0MA 1Y1PA 2O05A 4CMCA 2QXTA 5B4UA 3RIMA 1EDZA 1NULA 5J4KA 3F67A 3N70A 1RPTA 4URUR 5EQFA 3BMCB 1K9SA 2VCEA 1OBHA 3AVYA 1ACMA 1VSBA 3BULA 2XUQA 3LDGA 3PHGA 1P31A 3SZ3A 2CVPA 3T7SA 5D00A 1JJAA 1KL7A 2R68A 2Y1OA 2ZYRA 3C6QA 3COYA 4QOIA 3WIDA 1MN6A 2QSYA 3IBSA 5EUCA 4KHPB 3INNA 3T3IA 1NLUA 3RD5A 2W6QA 3OD1A 5BSVA 5HKLA 1J5EB 2HRCA 1BH2A 2F43A 3SMVA 3KWLA 4RNDB 4J29A 4CTNA 1WMDA 4FWTA 4R9VA 2XODA 4GT1A 1M8GA 2MDTA 3RC7A 4ZYVA 1UT6A 3A1NA 4HRVA 3DWIA 3RADC 3UAZA 4H31A 4QASA 2A1TS 5MN4A 3PL1A 2B1QA 2A14A 4GICA 2AEJA 4MJ7A 2MSLA 4ZI5A 2JFOA 3B6MA 3OTQA 4KQWA 3B6IA 5J4VA 2NUPA 3G2QA 4RH3A 4I36A 4RKRA 3QFFA 4FMDB 2JI9A 2ZE6A 3A04A 4Q9LA 5E6UB 4GMDA 1UBSB 1VPEA 3GEGA 4HQNA 2DHEA 1IUOA 3LRTA 2FZCA 3QZUA 1AQLA 4U8HA 1WLSA 1OKKA 2PSEA 1JQ3A 1YZTA 3JWPA 4KIJA 5JQGB 4O59O 1AHPA 3AVUA 2A9QA 1KPGA 5T6BA 2NXCA 4OJYA 3W2GA 4UHJA 2OAEA 4YXFA 3FOFC 2JA2A 3H97A 4DMFA 4DSOA 2C84A 2AHRA 1DC7A 2GH1A 3A9UA 3HYLA 1ZAKA 1YRYE 2E85A 1XRQA 4PR0A 3VV2A 4DMUB 3MWDB 5E6RB 4DL9A 4X60A 2H4ZA 2J07A 1QZXA 5IHPA 4DHEA 2BBWA 4Y9DA 2KBEA 4OSPA 4QUKA 3KK0A 2OCBA 3PUYA 4OMFG 5CJJA 4MGIR 1PRYA 5JS6A 3KKPA 3EVCA 1GDTA 3A9CA 3DZ8A 4XFKA 1GM5A 1U3DA 1SQ5A 1WU8A 4G8CA 3KZCA 4JQZA 1WVIA 4KTTE 4QSHA 1X1DA 4DWVA 1ORRA 1W0KD 4AY4A 1TPYA 3HBJA 1D2EA 3P9RA 5AI9A 1WKBA 3EQ2A 1IG3A 1QANA 3AUAA 2ANCA 4EHAA 2QTVA 4I1RA 4FYYA 2NGRA 3IX7A 3TZCA 3ZGVA 4FOSA 4LMPA 1T1EA 3L06A 1U81A 5DLPA 3NBFA 4D9NA 1DBVO 3RUCA 4BCDA 1BW9B 1D9ZA 2P2SA 3A6HA 2QPTA 2ZJ6A 4Y1GA 3HLKA 4QVIA 5IRCD 1Q14A 5FTNA 2PMKA 4DCOA 5KYXA 5F7ZA 3CT4A 3QV2A 4EHIA 1T8TA 3ER6A 5D6NA 4Z6KA 4ZQIA 2RHMA 3CJTA 3C5EA 1NDUA 1M2OA 1S2IA 3PX7A 4P5PA 4TLMB 4E3WA 4HS9A 5K3DA 3LDHA 4JJ6A 2FUNB 3L1VA 3ZBUA 4H1UA 1VG8A 2IEIA 2XNSA 1BEZA 2WF8A 2YCBA 2AEEA 3MINA 3VOSA 1PJLA 2A5LA 5JZMA 2JFNA 2YYZA 2VNIA 2O8EA 3M1IA 2OD7A 3DEZA 4J1SA 3L0YA 3WL6A 4A6EA 2VHYA 2O06A 1E7WA 5I5GA 3RYCA 5FWAA 4ZT3A 1DMRA 3NTOA 4FP9A 4HDCA 4FFNA 3M4YA 2W8ZA 3PDWA 4N5LA 2X8AA 4A7PA 4MW0A 1W4LA 4JC0A 1AUOA 4RXUA 2Y67A 2ZJAA 2OOKA 3H4TA 4Y30A 3SIXA 4BKOA 1M83A 5BMVF 3LNTA 1TO2E 4DR7B 1T4CA 2WD7A 4DCGA 4H4CA 3CSSA 3C0KA 3COPA 4LRXA 2R1ZA 2AW3A 4O2BA 3COSA 4Y6OA 4EMSA 3C7AA 1W36D 3BCUA 3PEYA 2WVJA 4Q37A 1BXGB 3PFFA 5L4NA 5T41A 3RHFA 4M1ZA 1Z88A 3X1KA 3AHGA 1H0RA 3U1BA 4LJLA 3PFGA 3N39C 3KQUA 2C9BA 3KQKA 2EWWA 3D0KA 4JLMA 4L8FA 2WHXA 4MWTA 1SKYB 3OA0A 2RDMA 5GQSA 2C94A 1EA7A 3TVYA 4L6AA 3IKMB 1UBEA 4YJ2F 5KKNB 1Q20A 1V48A 2G04A 4QUHA 3ETJA 1HE3A 3KHSA 3NGMA 3VR5A 5BNFA 2FJPA 2HUNA 2JGJA 4K8OA 3CF6R 4ONEA 1RRKA 4N3BA 1CEXA 4LNUB 1SHUX 3QIAA 4RFLA 4A5SA 1JZQA 1VSTA 3ANSA 3CLSD 5BR4A 3JU3A 4YO8A 4MWZA 4JEUA 3VC7A 3DO8A 3WGMA 4TWJA 5FTWA 4KAAA 2X5OA 1NPYA 4ZEXA 2AN1A 3IELA 4MVJA 1E2JA 2K7ZA 3N0TA 4W99A 2XUJA 4DDVA 4U6SA 4G5SA 5FA6A 3RYFB 1VIAA 5EY5B 4RTPA 1RP1A 5K0FA 5JCZA 9ABPA 1YOVB