4KWHA

The crystal structure of angucycline c-6 ketoreductase lanv with bound nadp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
b'GNLTGKTALVTGASRGIGRAIAEKLGYAGALVAVHYATGADAAAEVAESIEKDGGRAFTVKAELGVPGDVDVLFEGLERGLKERTGATDLDILVNNAGVMAMGAPEEVTPEMFDRMMAVNAKAPFFIVQRALSVMPDGGRIINVSSGLTRVASPDQVTYGMSKGALEQIALHFSRHLGSRRITVNSVAPGSTDNGSALFQIPEVRETLSQLSTFGEVAEPAAIADVVAFLASEDARWITGAFIDASGGTLLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reductase homolog
publication title Structural and functional analysis of angucycline C-6 ketoreductase LanV involved in landomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces cyanogenus
molecule tags Oxidoreductase
total genus 90
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kwhA00
2GR9A 1YVEI 3NT4A 3IIEA 3RVDA 1AXGA 1H6DA 1GD1O 3JQGB 4MIEA 4D42A 1ISHA 1MXFA 4EZBA 4FW8A 2J5KA 1YB1A 4BMSA 1P1HA 5CDGA 4ILKA 3AY3A 2FPPA 3JV7A 2GNAA 2VZ8A 3LT2A 2B0JA 3ZZNA 1E7SA 4OOFA 3DBLA 2Q49A 1UAGA 3NDIA 1SNYA 3VPXA 1IB6A 3JD1A 3JQ6A 2HMSA 5AYVA 1CETA 2OBYA 2Y1OA 5H82A 1YOVA 3UN1A 1CQJA 2O23A 3WQRA 3WTCA 1L7EA 2CMDA 2EHDA 5IJZA 1I0ZA 1YGYA 3GFBA 4E21A 3JQFC 3GAZA 1JKJA 2NQTA 1SMKA 4XQEA 5EIOA 3OIDA 5I7EA 2CDBA 1DO8A 1NQOA 2W90A 3WBBA 1ZW1A 4NK4A 2IXBA 2HKIA 4FCCA 4PG5A 3DO5A 4CMIA 1U4SA 2DAPA 2DUWA 4J7XA 5EERA 3JQDA 3DZGA 3HB4X 1Y81A 3G0OA 3WX0A 3AM3A 1V8BA 4Y8VA 5I9NA 4R16A 3M1AA 2QZ9A 1VL6A 2PGJA 3IP3A 5KJFA 2C2YA 4XGNA 5G0WA 2BFAA 4HV4A 3CKYA 4EUFA 4ND1A 3FD8A 1DFIA 1I5RA 3CPSA 1G0NA 4ZD6A 2UAGA 4WCFB 1JKIA 2WWRA 1BWSA 2WYUA 3GF4A 1JTVA 1QORA 4PZEA 2JFHA 1I3KA 3M1LA 1E1LA 1G6KA 4QQRA 4BB5A 5K9ZA 4DIFA 3FN4A 1NVTA 1Z6ZA 4RVGA 3SC6A 4B7CA 4ONEA 3RKRA 2AQIA 1DC3A 4RVFA 1UP6A 5L51A 2X9VA 3BMOB 3KETA 1GAEO 1X1EA 4HFMA 4J0EA 1Y7TA 2HU2A 1E6UA 4QFCA 5CEEA 2ZB7A 2FP4A 3GVCA 1KVQA 2P5UA 1EK6A 3F46A 4I5FA 4YTEA 3ROMA 5BSFA 3ZV4A 3VPSA 2FZEA 4DLBA 5JXWA 1NTOA 1CWUA 1YBMA 3O26A 4XJTA 5G0VA 4GGPA 3ZH2A 5B4UA 2C20A 3FBTA 3LU1A 4ZRMA 3CMCO 2RCYA 1IPFA 4E5YA 5IN4A 5FYDA 5TLSA 2X8LA 4IDCA 1ISIA 4CV1A 3K6JA 5I8WA 5C7OO 3E5RA 2Y68A 4ND4A 1MB4A 3JQAA 4ZA2A 3NRCA 3ZU4A 4NJMB 1LDGA 2Q1WA 3FSRA 4HY3A 1GPDG 3I6IA 1E7YA 3PYMA 4PRKA 3W4KA 3ZV6A 4CM9D 2VWGA 2VHXA 4CUKA 4P4NA 1OAAA 4O63O 3H2SA 2DQ4A 4KWIA 2FSSA 2PD3A 5JO0A 1EE2A 1BTOA 3JD3A 4MPDA 3V1TC 1YBVA 3P2YA 1U2DA 2QG4A 5GZ6A 3PP8A 3TOXA 1IL0A 1R15A 1T2AA 3LK7A 1MA0A 2DC1A 2PKQO 4BQRA 2VOEA 3E9MA 2Q99A 2PGDA 1U4OA 4XB1A 2WD8A 4J1NA 4WLOA 2VYNA 3G1TA 4KWHA 1J5PA 1LRKA 5DCUA 3H2ZA 3OM9A 1SB8A 3ZV3A 3KBOA 1YB4A 3RC7A 5A04A 2BD0A 3H5RA 4A7PA 4IDFA 3JQ8B 1NPYA 3GHYA 3PRJA 3FTNA 5JAIA 3PWKA 2VT3A 3CUKA 5H81A 4WOKA 1LJ8A 3ZU2A 4XGIA 4BO9A 5CDYA 4AJPA 1N5DA 2VUUA 5HA5A 3MEQA 5L53A 3Q6IA 1PL7A 2HDHA 3V2GA 1QYDA 1IHYA 2IXAA 3AUAA 3DMTA 3LYLA 4OGWA 4YA6A 4H7PA 4BO5A 4CR6A 1B3RA 3F1KA 4DLAA 4TVOA 4IGFA 2X22A 1GZ6A 2FR8A 2J3IA 3RSHA 1W8DA 1Y6JA 1ZKMA 2P9CA 4CQLA 1U7TA 3BIOA 1Y5MA 1KVSA 1BMDA 1GY8A 2PA3A 3ZWAA 3JQ9C 1HDOA 2EGHA 4NK5A 3W4JA 2CSUA 3IJRA 2AE1A 4F46A 4CQMA 2VOJA 3L77A 2NQ8A 4UVEA 1NVMB 4PLTA 1P1RA 1PJ2A 1A7AA 2H5LA 4OQYA 4K9DA 1HE2A 4DQXA 2HK9A 4N54A 5JAMA 3BMCA 2BELA 1O9BA 3I1JA 2D3TA 3JQGA 4D79A 2Q1TA 1ZJZA 4H3VA 3WLEA 4BKOA 1DLIA 2H63A 3ZNOA 2X6TA 4QTZA 5T8KA 1MLDA 1NX6A 2HLPA 1KY4A 4GMGA 5DBGA 1XYGA 4XYLA 3N7UA 3K2BA 4ROSA 3RBVA 4R5MA 3AUSA 4PVDA 4Z9XA 4Z0HO 3WXBA 3F5QA 1P1IA 4OYRA 1Y8RA 1LSUA 5K6AA 2BFMA 4AJJA 3NT5A 2YV3A 4BNGA 1A9ZA 3RUDA 4MVJI 3O4RA 4EEXA 3D7LA 4RL6A 1ML3A 1IHXA 4O6VA 3PLRA 3HDYA 2NUAA 2VWQA 4E5NA 4IDGA 1Z82A 2X0IA 3RJ9A 4OOEA 4I8XA 2C2XA 4TROA 3FBGA 3VH2A 2OO5A 4U7WA 3ANNA 1WMBA 3PIDA 3VPGA 1FDSA 3TOZA 1HLDA 2Q3EA 1QYXA 1UR5A 2PV7A 4PLVA 3U3XA 3DZIA 4R68A 3E9NA 3ROPA 3BTSA 4Z9FA 1S7CA 2DTXA 1SEPA 5IDWA 3FTPA 4NR0A 3KVOA 2AG8A 4I08A 2A92A 1DXYA 3DBRA 1LSJA 4NNJA 2DM6A 4XA8A 3RFVA 4CUZA 1Z74A 5F1KA 1NQAO 2NWQA 4W7IA 2VUTA 1EVZA 3AY7A 5JDIC 1DHRA 3IUPA 4AJHA 4YT8A 2HK8A 2HMUA 4L4XA 4MVJH 1TT5B 3RC1A 2Y1CA 1QRRA 1LQUA 1SEVA 4GX2A 4F45A 3IKVA 3N74A 1WW8A 2PH3A 4MIYA 1P0CA 5ENDA 3LF1A 1R4MA 1XQ1A 2B83A 3DAFA 3BMOA 3AM4A 5BNTA 1HDXA 3MCVA 3WNVA 3OECA 3KSDO 3Q9UA 1Q7CA 4YJFB 5T57A 3TZCA 4BGIA 3O03A 4IQ8A 4BNTA 2O7SA 3F6YA 2FR0A 1R66A 3TJRA 1XCBA 4NJOA 8ADHA 4N5NA 2GO1A 1FDVA 3I9LA 3MOGA 4MVJE 3TZKA 2YFQA 4YT5A 3PFWO 3OIGA 2DBVO 1J6UA 1UXHA 3Q11A 2RIRA 4GVLA 1SB9A 1VSUA 1WMAA 9LDBA 1U2GA 5L3ZA 2NM0A 4MVJG 2EP7A 1H0KA 1Q7BA 2D1YA 3VPHA 5JCJD 1XKQA 1ZFNA 1BXZA 2X5JO 1KC1A 2ZTMA 1R16A 4ND5A 4DIOA 1O8CA 4CODB 4Z3DA 6LDHA 4N5LA 4BO7A 4TSKA 3PQEA 4GLOA 3V8BA 1KVUA 1A27A 3GNTA 1KS9A 2AEFA 5JDCC 1PZHA 5G0SA 4PLYA 1PU2A 2QYTA 2VYND 4N5MA 4XQ9A 5A5EA 1DOHA 4ITUA 4M87A 4R1SA 4PZDA 4A10A 1VJTA 1WPQA 3HDHA 4MP6A 4KDEA 4BGUA 3G3EA 3KEQA 3JQBA 3GVXA 3BMNB 4E5PA 1UZLA 1I10A 4RPGA 4OXYA 3AFMA 3O38A 4D41A 2J3JA 5A3JA 2EERA 4GGOA 1HE3A 2NLOA 3I23A 2JL1A 4BNZA 2Q4EA 4AJ1A 2ZYGA 1BGVA 3DAPA 4R3WA 1KVTA 2ZK7A 4FPXA 3B1FA 3E48A 4RO0A 1LSSA 1R0LA 3BA1A 3H9EO 4LN1A 2VZ9A 1MG0A 1NQTA 3QWBA 3UCFA 2Q4BA 3AOGA 5KOIA 4J1TA 2X1HA 5F1OA 2D59A 5ICSA 1AHHA 5TGDA 3ETGA 3R6DA 3JQ8A 5HS6A 2AQHA 4PLWA 3KSUA 3PJFA 1P9LA 2X58A 4L76A 3I9NA 5A9SB 4RF5A 3DDNA 4YACA 4BB6A 3RU7A 2CF5A 1F0YA 1T2EA 1UJMA 1UXGA 3A4VA 1CJCA 2GRAA 3FPCA 1EVIA 3RUEA 1T24A 4HUJA 1BDBA 1XG5A 4R1UA 4EUHA 1UZNA 5G4KB 4CM6A 3UVEA 3ADPA 1IYZA 4NBVA 2B5WA 1D3AA 4OJNA 1BG6A 2Y1GA 2UUPA 4QT0A 1X0XA 4WPGA 3TZ6A 2EJWA 2O7QA 3OBBA 4GSLA 3ETDA 4IXTA 1N7GA 2HMVA 4GMFA 5A03A 5BNFA 1E7RA 3OH8A 2WEKA 4MP3A 4ZICA 5IG2A 3HDJA 2IODA 2Y0EA 4EUEA 4YEDA 3TNLA 4YJGB 3F4BA 3ANLA 5C7LO 4UREA 3RUFA 4OQZA 4ALKA 4TRNA 4NFSA 1PSDA 2H6EA 4WJZA 2NVBA 1C1XB 3DHYA 3EDMA 4X54A 5EQDA 1LLUA 1M76A 3INRA 2GYYA 4K26A 3QWHA 3BMQA 3D0OA 3FF4A 3VKUA 1QLHA 1GV0A 3BYZA 2CDCA 3R3SA 1GQQA 3U62A 3LF2A 3KO8A 4L4RA 4MVJD 2G82A 2O2YA 3PZBA 1EDZA 4BO0A 3JD4A 4A5OA 2E37A 5COQA 2ZJ0A 4BMVA 1UUFA 2GGSA 3ONFA 1EVYA 3KYDB 2VRCD 4XRRA 2GN6A 1QKIA 3MJ4A 3VC7A 1ZK4A 2HJSA 2JCYA 4FN4A 5CP8A 4CLRB 3PYXA 1XGKA 1WLYA 4XYGA 1FMCA 2GUGA 1E7WA 1YKFA 3DR3A 3LDHA 1FDTA 2JKVA 3GZNB 3W6UA 1I3NA 3ZW9A 3ZN2A 1DRWA 2FY8A 1ZVMA 1OMOA 5DNAA 4LISA 3DFZA 1ENZA 4K1LA 3ZWMA 1T1RA 4CM1A 5JAZA 2BKAA 4QO8A 4RF3A 2GZ3A 5JYEA 1LLCA 1E92A 1U3TA 3OP4A 2YV2A 1RYEA 5AOVA 1QV7A 4B4WA 3JD0A 1Q7GA 4RF4A 3DOCA 3EVTA 2Q1SA 3VTFA 4WKGA 4BNWA 1I01A 3PYLA 4XIJA 2HRZA 5EJ2A 3X2FA 4NG5A 4CUJA 3DBVO 1T2FA 3OJLA 1XR3A 1P3DA 3PXXA 4JQCA 3EC7A 1I2CA 4YJFA 3OFSA 1LXCA 3NT2A 3DMTC 4ZQEA 3UCXA 4FJ2A 3JSAA 5TT1A 1GDHA 2JD1A 3CIFA 3A1NA 1LTHR 1W73A 3OMLA 4UUPA 3NAQA 3FNHA 3G1UA 1N7HA 3WICA 1K2WA 3MZ0A 2FPGA 3QQPA 4FC7A 4G2NA 2QRJA 1ONPA 3GG2A 1YL5A 4BO6A 2B36A 3ST7A 1K6JA 1V3VA 3E1KA 4YAKA 1X7HA 5JCXA 3L9XA 1T1SA 1VLLA 1ZUD1 1TLTA 4TMFA 1WVGA 2R2GA 1H93A 4RVUA 3RASA 4AJIA 4KMSA 3U4HA 1LDNA 2ZCVA 2V6GA 4W6ZA 4Y6SA 1BW9B 2QHXA 1DJNA 2BF7A 1KC3A 3PVZA 4BNKA 4JP3A 1DHTA 3VDRA 2C54A 1TXGA 1XA0A 3PI7A 3Q0EA 4CV3A 5ER6A 2PD4A 3L4BA 5EPOA 1L1FA 4JN6B 1EQ2A 3NV9A 3W6ZA 1YJ8A 2NVWA 5JPIA 5T8KC 2QYSA 4XDYA 2O3JA 4E12A 3D4OA 3CEAA 3QY9A 2D2IA 4YR9A 1MX3A 2VTDA 4MKXA 3QVTA 4E0BA 1YXMA 5IZ4A 4XR4A 2X7HA 1RPNA 2BFOA 3BXXA 4J4BA 3WGIA 3ONDA 4R69A 4D0RA 3D64A 4NU5A 5K6AC 3D1LA 5HBRA 2NTJA 3RKUA 3PHLA 2JFFA 4R51A 4LW8A 5TSDA 1ZK3A 4EEZA 3B20A 1LRJA 2X4GA 4QSMA 4RPLA 1A4IA 1RWBA 3SVTA 3T7CA 2CVOA 4JBIA 2IZ0A 4YQYA 1RM4A 4OSPA 4J3FA 4Q3BA 4WCDA 4CM8B 4XEHA 2HUNA 4WLEA 1F8FA 4Y6PA 4AFNA 3NUGA 1ZO8A 2EJVA 1N2SA 3I52A 4IS2A 6ADHA 2FMUA 4O59O 4DMLA 1HDYA 2VYVA 5KJ6A 2X0JA 4BUCA 2SCUA 2GDZA 3QRWA 5JSFA 4FJ1A 2DPGA 5CEFA 2WSBA 2WTBA 5G4KA 1Q1NA 1VL0A 2VN8A 1HDCA 2PY6A 5FI3A 3E8XA 9LDTA 2G0TA 1E3IA 3E82A 3HADA 4HBGA 5HRUA 4OSOA 1VI2A 1YWGO 3Q2IA 2P91A 3EZYA 4KTVE 3ON5A 3ZHZA 2B4TO 4W7HA 3X2EA 2I5PO 3WYCA 3AI2A 5K0ZA 2JJYA 1U1IA 3DTYA 2OGUA 2J3HA 3RWBA 5CFZA 2D0IA 1HE5A 3JYQA 3NTRA 1HDRA 2IYPA 5JS6A 1A5ZA 3GGGA 3OA2A 1HWYA 7MDHA 4TWRA 4YJGA 3GVPA 3ZHBA 4RLHA 3ITDA 4HNHA 4J91A 4DQUA 1NFFA 3GOHA 4DA9A 1RM3A 4RZHA 2EKPA 3C7DB 2H9IA 1CQIA 3DQPA 4XB2A 4S3MA 1DEHA 5L7WA 1VJ0A 3HN7A 5KJ1A 3ZWOA 1ZCJA 3OSUA 4FSHA 2DFDA 2WM3A 4O0LA 3RFXA 5L4LA 3WGYA 2HAEA 2I99A 2EEZA 3WWZA 3ASUA 4BS9A 4WK6A 1A72A 2W2LD 3NYWA 4KUGA 4ZGWA 1C0PA 2HCTA 2BH9A 3FWZA 1KVRA 4AJEA 2PWZA 1H2HA 3D3EA 3INTA 1HZJA 2HJRA 4L4SA 2A9FA 3L9WA 2OMEA 2AG5A 4YAGA 1GU7A 3HZZA 4OXKA 2R00C 1M6WA 3MWDB 5F5LA 5TQVA 1Y1PA 1NBOA 3ZCXA 1JVSA 2Z5LA 4GBJA 4NFYA 4P22A 4DVJA 1KEPA 5JC1A 4R5HA 1VC2A 3K9QO 5DBIA 1WNTA 1J4AA 2JHGA 1R0KA 3OF2A 4IJWA 3I5MA 3JQBC 3GQVA 2EKLA 4CLRA 1E3WA 2JFGA 4PLGA 4DC0A 2Q1UA 4HKTA 1LSOA 5G0UA 3TDKA 4PGFA 2B4RO 1YL7A 4E30A 5DULA 3F9IA 4HFJA 5B4VA 1H5QA 2NU9A 3KM0A 4IQGA 2AA3A 3WYBA 3QLJA 3NTOA 1RYDA 3O9ZA 4JX8A 4CL8A 4CR8A 5KKCA 5KKAA 2W2KA 2ZTLA 3C3XA 1LDEA 3NGXA 3DOJA 3QVOA 4KQWA 2PKRA 4W4TA 2O50A 4QEDA 4EJ0A 4AL4A 2ILTA 4R9SA 1YQDA 3VTZA 3L0DA 3UXYA 3U09A 5ILGA 1YL6A 3GY0A 4XX0A 2YW9A 1SBYA 3ASVA 4E32A 2GCGA 1DJQA 2Y0DA 1UDBA 1TT7A 2WD7B 1ENYA 2WYVA 4A0SA 3KYCB 4JROA 3GAFA 1Z75A 3FI9A 2VTEA 3I9OA 3ZHXA 2PZLA 2ZB8A 1VM6A 2Q45A 2C5EA 3DZHA 4BNYA 1Q2XA 1ULSA 4KUEA 2AMFA 3GLQA 3KRTA 5A3VA 5KVQA 2B35A 4BNVA 1YJQA 5IN5A 1JU9A 2OP1A 1YQXA 2PLAA 2RHCA 3QIVA 3RQSA 2G1UA 2OHXA 5ER9A 4HXYA 3DBHA 3OICA 4PG7A 2V65A 3V1UA 4DBVO 1C14A 4ID9A 3LZ6A 1F06A 1LC0A 4U0JA 4BNLA 4XR9A 1PTJA 3F4LA 3PJDA 3MWEB 4INAA 5ES3A 2AQKA 5ITVA 5KVSA 4J0FA 1OOEA 2CZCA 3NDRA 5DCYA 5CG1A 2DTEA 1DDOA 3LT4A 4B3JA 3EK2A 4R4JA 1U8XX 1BW9A 3JQCA 4ALNA 5JW6A 3OA0A 1X15A 3ZWXA 2AEMA 4CMAA 1LLDA 2ZYDA 4BGEA 5A06A 4ZQGA 5L40A 4G81A 5L4SA 4B4OA 2W8ZA 1E1NA 1QLJA 1G1AA 2YV1A 4PN3A 1JAYA 3UKOA 4AJLA 4DPKA 4I1IA 3OETA 1T25A 2ZATA 4FFLA 4RZIA 2B5VA 2NACA 4IZIA 3ZWNA 1LX6A 2J6IA 4PCVA 1YE3A 1ADCA 3EGOA 5TJHA 1XLTA 1SC6A 1CYDA 1YRLA 2Z1MA 4TZTA 1K6IA 2O3TA 1NM5A 1LNQA 1M66A 4FBGA 3VVCA 1K6XA 2OL4A 2X5KO 5JAQA 3INGA 1NFRA 2BGKA 3OHSX 4IIUA 5F5NA 3WGHA 5A02A 5MDHA 4YYZA 4OAQA 4XIYA 3VH1A 2JAPA 3EAGA 2DVMA 3TFOA 5CDTA 2IRWA 1ZMOA 5FEUA 1P1KA 1DIAA 5JMWA 4CLEA 3GT0A 3LQFA 3T7EA 1ZSYA 4GKVA 2ET6A 1JWBB 1NR1A 2ZQZA 3WGGA 1HLPA 1DPGA 4OH1A 4FGWA 2PZMA 1PS0A 5LCXA 1V6AA 4P4LA 4CM4A 1DBVO 4CPDA 2JHFA 3WNQA 1UXJA 2IE0A 4J49A 1M6HA 3ZNNA 3OJFA 2FHSA 3QWFA 4D43A 5JNLA 3N58A 1B0AA 2XXBA 1ZIDA 4NHEA 2JCVA 1O6ZA 3JTMA 1HZZA 2IYOA 3UFXA 4CM7A 2X0NA 1LQTA 1XDWA 3IJPA 1GCOA 4MJLA 3RC9A 2CVZA 2I65A 4DWVA 2IZZA 4TVBA 5A9RA 2NADA 3H5NA 4DL9A 3JD2A 5JY6A 3KZVA 3WIDA 4D45A 3HSKA 1ARZA 1JKFA 1V9LA 3P7MA 4FFPA 1NAHA 3DZKA 1LA2A 5EMHA 1O0SA 1PWXA 2HMWA 3CSDA 2J5RA 3FWNA 2R6JA 3NEPX 4AJKA 4DYDA 4YT4A 4NBTA 3ENKA 4OKNA 4GX0A 3FNEA 1M2WA 4LCEA 1PQPA 4MO2A 3S2GA 1XU9A 2PR2A 4FD3A 5CDUA 2P5YA 4GAEA 4RF2A 2LDXA 3F47A 1I3MA 3GA0A 3TL3A 1VL8A 4A27A 1R4NB 1ADFA 4NIMA 4XCVA 1DFGA 1QP8A 3GZ4A 1OBFO 2O2SA 3U9LA 4Q3CA 3MTJA 3SBOA 3HE3A 3SLKA 2TMGA 4CMJA 1JW9B 1EUZA 4CLXA 3H8VA 5HS4A 2VHZA 3E03A 4MVJF 4I5DA 2A94A 2NVUB 2Y1EA 4OKIA 3TFQA 1B8UA 1BVRA 3L4BC 4WCFA 1M75A 3H4VA 3W8DA 3KLMX 4U8GA 2O3QA 5I7FA 3RBXA 1E3JA 1OFGA 5IF3A 3I3OA 2OUIA 2Y1FA 2OOSA 4EYEA 2AHRA 3DMYA 4RVHA 4FQ8A 2QRKA 4YJHB 2G17A 2J5QA 4A73A 4PRLA 2XF8A 3IP1A 2V7PA 4R1TA 4ZQHA 1E1MA 3LC2O 4URFA 3VH4A 3MJCA 4Q3NA 1YQGA 3JQAD 5IDXA 1RKXA 4ALIA 1GZ3A 3L6OO 5HM8A 4J2OA 2G76A 3AI3A 4TRRA 3VDQA 1R12A 3VAZA 5MGBA 4I5GA 8LDHA 1F8GA 4Z3KA 1PZGA 5COAA 1F17A 1AXEA 1GYRA 4C7KA 1FDUA 2PNFA 1I30A 1A9YA 3FR7A 4JBGA 4YVFA 3WGTA 2B4QA 3D5QA 5L7YA 2QW8A 4R01A 2R00A 1EBFA 3UF0A 4NJMA 5ICMA 2P68A 1HDGO 4PLCA 4DBZA 2C7GA 3G17A 1MGOA 4R1NA 2I3AA 2RAFA 2UDPA 3DB2A 3QP9A 4BMNA 1E1KA 3PDUA 1IUKA 1ZH8A 3AM5A 3VZPA 3ZWCA 1P74A 4Y67A 2NU8A 4LVUA 4M49A 1TA4A 4DTIA 2IEBA 1E3LA 1H2BA 2OZPA 3IOYA 1E6WA 2AEJA 5HWSA 3C7AA 2FN7A 3HUDA 3FRJA 3V2HA 3B1KA 1HYEA 3ZU3A 4BNIA 5L4NA 2YHIB 1EBUA 4YDRA 1H6BA 5AXDA 2I66A 3V1YA 4D3DA 4E31A 4KTTE 3SJUA 3WGZA 4FFRA 1GQ2A 4IXWA 3W8EA 3GDFA 2PK3A 4DLLA 2EV9A 4ESOA 3ZNPA 4E4YA 4J7CA 1Z7EA 3L6DA 4C4OA 5FI5A 2YHUA 3R3JA 1UH5A 2XAAA 3ZI0A 2UVDA 3HJAA 5KVVA 4CM5A 3VOSA 4DREA 1NHWA 4DUPA 4D3SA 4MKRA 4PLHA 4GPD1 4B7UA 3VKVA 3LC7O 1ADGA 2VQ3A 5JFOA 4CQMD 1DSSG 1JN0A 1PL8A 1Z45A 1ZEJA 4RQUA 1Q0QA 1GEEA 1CRWG 3R1IA 5A9TA 1I36A 4BNFA 1H6CA 1C0KA 1CF2O 2PZKA 4A2CA 3H3JA 1OI7A 5ADHA 3DWFA 5IDQA 2DPHA 1I3LA 2WJPA 1PQWA 3P2OA 2EWMA 4PFJA 3S1LA 2AE2A 1T4BA 2BI8A 3LT1A 2GN8A 1W0CA 3M2TA 3GC6A 3ONEA 3RD5A 2DTDA 3LC1O 1NWHA 2EIHA 1C1DB 2YQ4A 1QYVA 2Q46A 4HFRA 1D8AA 1XELA 5ENVA 1NYTA 4YQZA 3SJ7A 1SPXA 3GMSA 4UVIA 3H3FA 2Y66A 3U49A 2POQX 2VUSA 4FGSA 1Y8QB 3IDSA 2CY0A 3EHEA 1ISFA 1B26A 3EZLA 4FFMA 1U9JA 3HFGA 3P19A 2Y05A 3UGKA 3BAZA 4BOYA 4P38A 4GH5A 4WEOA 2CFCA 4O5OA 1PGNA 3WS7A 1NXQA 2FZWA 5I9MA 3AUTA 3QVSA 3GEMA 1HRDA 3S2FA 1U3UA 1ZMTA 2D5AA 3KLPX 3PPIA 3VVBA 3GEGA 5BSGA 1F12A 3ABIA 3OQ6A 1BVUA 3WSVA 1DIRA 1YOVB 2XXJA 3UCEA 2HRBA 4GX5A 4EITA 1QSGA 2E82A 4HX5A 4D7AA 2YFHA 2EF1A 1IOLA 4YWJA 4CL3A 2P4HX 2Y0CA 5FFFA 4AJ2A 1GR0A 3EVNA 5L7TA 1DIBA 2O3SA 1A71A 2BFPA 1KOLA 5IFLA 3AI1A 4CV2A 2JAHA 1NPTO 1ISMA 1WDMA 1PS9A 3I4CA 4RPHA 1PGPA 1GL3A 4UULA 2Z95A 1ZK2A 3HDQA 4CMIB 1PJCA 2TMDA 3TZQA 4D3FA 3PJEA 2QIOA 1DC5A 5BSEA 2AW5A 4G65A 1C0LA 1CIVA 1GUYA 4BKPA 4D44A 4UVHA 1QV6A 4JK3A 3CXRA 4R3NA 2A35A 1K5HA 4OIMA 1PJLA 1PWZA 4FDAA 5B12A 5FWNA 1TT5A 4NZ9A 4WEQA 3IL2A 1MV8A 1PR9A 1SOVA 2GERA 3PGJA 2NV6A 4BNHA 3BZUA 4I9NA 4L9RA 3UICA 3L6EA 4E2ZA 4J6FA 2NU6A 3JQ7B 4BHTA 1GYPA 3BHIA 4NQZA 3TQHA 4IMPA 4B7XA 1HL3A 2WMDA 3ROQA 1JLLA 2CD9A 2J3KA 1PGJA 4BO8A 1EFKA 3DZJA 1PZEA 4GLLA 3IUSA 4K6CA 1PJTA 3LT0A 3RIHA 1Q0LA 2NTNA 1EUCA 2HO5A 5JY1A 1DAPA 1S6YA 4PG8A 5EESA 1I33A 1EMDA 1NP3A 3K8ZA 4RV9A 4PIVA 1LU9A 3D4NA 5IAAA 5KIAA 1P1FA 3C7CB 1W6UA 1AN9A 1DC6A 3HNPA 4LSWA 3L07A 1XHLA 3AU9A 4CMEA 1B15A 1J0XO 4JIGA 4TZKA 1VE9A 1WAMA 3QJ5A 4ALMA 4CLOB 2BHLA 3O8QB 5TF4A 4ZVVA 3QW2A 1TEHA 3DONA 1X7DA 3JQAB 1K0UA 4MINA 2ZTUA 1HYGA 4Q3DA 4GVXA 1EK5A 2YYYA 3QHAA 1PR3A 3GRKA 3E6AA 3WMXA 4D46A 4BO4A 2QRLA 4U0KA 3BMNA 4BO3A 4DYVA 4J4TA 3K5PA 4JJFA 4YAJA 5DDIP 4HP8A 3OJOA 1R37A 1Y5RA 5IDYA 1DC4A 3D5TA 2JCXA 3PWSA 1OC4A 1AGNA 2OP0A 5I7VA 1JQBA 3DAGA 2I6TA 3QA9A 1BSVA 4NMHA 5KCZA 3U0BA 4J9VA 2HQ1A 2D5CA 3WFIA 4B4VA 4CM9A 4D0SA 4UEOA 4G5HA 1PIWA 4E5MA 4IIVA 4R41A 3WIEA 1D1SA 2DU8A 2PH5A 5G0TA 4Z6KA 1XQ6A 4TKLA 2C0CA 1XSEA 4L0QA 3ZWBA 1HXHA 2OBNA 3K30A 2BLLA 1VJ1A 4DPLA 4E5KA 4P8RA 4FOOA 3IS3A 1B7GO 3OJEA 3ZV5A 5ITWA 2P9EA 4JLWA 5A9SA 3U4IA 3QWIA 4FS3A 4OM8A 3RUAA 3I9KA 4E3ZA 1BHSA 5JC8A 5HTOA 2PTGA 3F3SA 2G5CA 1HSOA 1O89A 1HF3A 4XYBA 4GKBA 2DBZA 3JYLA 3WFJA 4J1SA 3PEFA 1FDWA 3A14A 4U6SA 2WE7A 4YJDA 1ISJA 3EYWA 1YDEA 3DTTA 3EUWA 4A26A 1KIFA 1MP0A 2UV8A 5T64A 4WCFC 5DP2A 4CQLB 3AFNA 4QXMA 4OO3A 3BTOA 2BGMA 1PJ3A 2I67A 3V2UA 2Q2VA 5B1YA 4WLUA 5T67A 4WLNA 4CQMB 1NR7A 1MFZA 2VCYA 3C1AA 1DB3A 5H83A 1OC2A 3ZDFA 1I8TA 4MVJP 1V0JA 1ONNA 4UUNA 1XIVA 3CZRA 1Y9AA 4DC1A 3MTGA 2V6BA 2WDZA 1C1XA 3DC2A 1IPEA 3BMCB 3GPDG 3SLGA 1LI4A 3OEWA 2BGLA 3Q1LA 3DOOA 4M8SA 3H7AA 3JQEA 1I2ZA 3QVXA 2F1KA 5C7IO 1X14A 3HQ4O 3K73O 4WASA 3GVHA 3UW3A 3WGQA 5A5FA 2V6MA 4ZRNA 4K28A 3GFGA 1N8KA 1X0VA 3Q3CA 1Y8RB 2OXIA 3W8FA 3WQSB 4EJ6A 1O94A 3OJ0A 2X0RA 3C1OA 2C29D 5I7SA 4BV8A 5AXBA 4JGBA 1U5CA 1UXIA 3KYDA 3JYOA 1N1EA 5IZCA 1LLQA 1DIHA 2C7VA 3TSCA 1U3WA 4Y98A 1LRLA 4JP2A 5EINA 4J7UA 4IJUA 3RFTA 1IZ0A 3K92A 3GZNA 3GGOA 1P1JA 2PFGA 4W9NC 3VHRA 4BVAA 3NTQA 3GNQA 4PLZA 3F5SA 3QSGA 1UXKA 1E3EA 4I5EA 5CG2A 3PK0A 5BQFA 4LVCA 4PLPA 4YCAA 5C5IA 3KSZO 3I9MA 1UDCA 3L4SO 3GK3A 3Q2KA 1ZBQA 2EXXA 3MJSA 1GEGA 5KNLA 3DL2A 3DBRB 1MG5A 1LBEA 3WMWA 4RDIA 4UUOA 4DRYA 4IDEA 1X1TA 4LSMA 4BO1A 1LDMA 2NNLD 3GNSA 3H6KA 4BGVA 1TVEA 1E6EA 5JMPA 1GZ4A 3JQ7A 4FC6A 4FR5A 3WQQA 2EKQA 1B16A 3QE3A 3AJRA 4EJMA 1P33A 5CHEA 4YB8A 1UP4A 3ETEA 1FF9A 4HWKA 4OHUA 5KVCA 1P31A 4J43A 1R4MB 4MP8A 5TC4A 1I32A 2UYYA 4YAEA 3NKLA 4CV0A 2D4AA 3H5AA 4ZU3A 3S8MA 4WNCA 3UOGA 3A28A 5ILOA 4RPKA 2FWMX 5JBIA 2VWHA 2WE8A 1DAOA 3RROA 5KTKA 4AICA 2Y67A 2W4QA 1DLJA 3MJEA 1GCUA 2C82A 3AW9A 1N1GA 4IM7A 4UVDA 4C7JA 3GGPA 3ZNQA 5G4LA 1JVBA 3M2PA 3IKTA 2QZZA 4EGFA 5F3RA 4CLOA 4M86A 1ZSVA 3D3WB 3O8QA 3GN1A 3QVWA 3TL2A 3ZGYA 4BQPA 4CLDA 1B3BA 5AQ1A 1N9GB 1LEHA 4PG4A 4BV9A 1GYQA 2BRUA 3GRPA 2EP5A 2Q2QA 1GUFA 3A9WA 4H15A 5IXSA 3FNFA 1LDYA 4MIOA 3FR8A 4KOAA 1ID1A 2IDZA 3AOEA 1O95A 4W99A 1MXHA 2CDAA 2PZJA 3IMFA 4ND2A 4Q3EA 4RPJA 3ZHYA 1TB4A 2GN4A 5FF9A 1IZ9A 3FNGA 4R9RA 3T4XA 5A05A 1EDOA 2H1SA 5THQA 2PKQP 2RHRA 4XWYA 2VZ0A 4OMUA 4MKZA 4S1VA 1P0FA 4KQXA 5JCJA 1U28A 5KWEA 1NHGA 2IEDA 2RBEA 2LDBA 1ZK0A 1MFPA 2DT5A 4ALJA 4BNUA 5TIIA 4FB5A 3DXFA 1QMGA 2P4QA 4F6CA 4J2HA 4UAGA 3RU9A 1VKNA 2VYVD 2O48X 2DLDA 2DKNA 2ZKLA 3DEYX 4ZQFA 3RAJA 2IZ1A 3MOIA 2ZTVA 3BTUA 1WWKA 2FPIA 1G0OA 3OQBA 3ZU5A 1EQUA 1V3UA 1EZ4A 4CM3A 3H9UA 4XKJA 2E49A 3JYPA 4HFNA 4E6PA 5L45A 1Y9EA 1BRMA 1F14A 4GX1A 4CM8A 3PLNA 4L75A 3TWOA 4NBRA 2VHWA 3BHMA 1E7MA 1H94A 3RUHA 3D4PA 4WECA 4M54A 4OXNA 5THKA 5U9CA 3WDSA 2VHVA 5I8ZA 2YDYA 2YUTA 1NFQA 1HEUA 3OQ1A 4PG6A 4IPTA 1ZXLA 2E48A 4B3HA 1PX0A 1PJBA 2Y93A 4BO2A 1WZIA 4J90A 2Y99A 2J8ZA 3ZW8A 3ZWVA 2CUKA 1WDLA 2E6UX 2VRBA 2AQ8A 4DGSA 2I76A 5DT9A 3I6QA 4L8VA 1ISGA 1C0IA 1GPJA 3LLSA 4IZHA 1T2CA 3C24A 4CMKA 4DXHA 1WP4A 3DZFA 1KEVA 1MC5A 1WXDA 4N18A 5CDSA 3LVFO 3MJTA 3NJ8A 2Y1DA 2BI7A 2JD2A 2O4CA 1JDJA 3H9JA 5DOZA 2D8AA 2O4UX 4TRMA 4QUKA 1GFSA 3GN2A 4LMPA 4W82A 1PGQA 4KDFA 4WLFA 4Y9DA 3DHEA 4QFDA 3VZQA 2O3UA 4UVGA 1VPDA 2P2SA 1H9BA 3TRIA 4J1QA 1JAXA 4CLHA 2O3RA 2HK7A 3H65A 4IDDA 5J23A 5AVOA 1ONOA 5L95A 1MC4A 3NX4A 1VRWA 5DBFA 1GQYA 2RH8A 2CNBA 1UDAA 3AU8A 3HB5X 3IC5A 4XJSA 1PJSA 1MUUA 1U3VA 3BMQB 5COBA 3ZWPA 4CMBA 3B1JA 4YRAA 4QECA 4HNGA 4CMEC 1KERA 2B37A 3H9GA 3UHAA 3ZWWA 1JWAB 3ADOA 1A4UA 3HHPA 5BR7A 4AJNA 5EN4A 3PQFA 1K3TA 2FOIA 4GI2A 4J16A 4JNKA 4L73A 1BXGB 3S2EA 1E7QA 1I2BA 2RH4A 1M67A 5LC1A 5C37A 3NJ4A 3W4IA 3C8MA 2CF6A 2FRDA 4BNNA 1YO6A 1C3VA 1XEAA 1E3SA 1KEUA 2VWPA 2VNSA 4BKRA 1NASA 4XQCA 1NWCA 4MVJA 3UUWA 3HG7A 3SC4A 3U4DA 3COSA 4WUVA 4B3IA 3E9QA 2OORA 4LK3A 4JJGA 4MDHA 3EY4A 3BHJA 1HDZA 1O5IA 5DCWA 1ZZEA 1HYHA 4EDFA 4MVJM 3V5NA 3AUUA 1R0SA 3CZMA 1Z7BA 1BDMA 3PQDA 1PEDA 2VRCA 4IGEA 3FCOA 4FFNA 3TN7A 4BNMA 1EEHA 3AWDA 1HETA 1XU7A 4YPOA 1N92A 4NBUA 2WD7A 3VH3A 4A03A 3KYCA 4FIZA 3ENNA 3WLFA 4DIBA 5B4TA 4LCJA 1D1TA 1ENOA 1W4ZA 4IUYA 5BT9A 5JO9A 5DF1A 3OIFA 4XYEA 4AVYA 5CPBA 4BKUA 5BSHA 5T6BA 1E0DA 4RORA 1ULUA 4WNIA 4H16A 3GH3A 3QV1A 4IS3A 1HT0A 4ZJUA 3WJAA 4Z0TA 3RUIA 3ULKA 1KEWA 4AJ4A 2P9GA 3ANMA 3KHUA 1SOWA 5F1PA 3JQFA 3CMMA 4N7RA 3C85A 5F21A 3RUCA 5I9LA 2Z1NA 3LSYA 3ICPA 2ZJ1A 1L7DA 4Q3AA 4QX6A 4E2XA 2XOXA 3D3WA 1PS8A 3GR6A 4CMHA 4RDHA 4YT2A 1N9GA 4XDZA 2FR1A 2UUOA 3PFFA 4E13A 3WTBA 5U4QA 1E5LA 4W9NA 2ZB3A 3HN2A 5BNIA 4NFHA 1WDKA 2X5OA 4CMCA 3A06A 2AXQA 2NSDA 4XZ3A 2GD1O 1FJHA 4WLVA 4ALLA 1X13A 2NU7A 3CTMA 1A7KA 1NQ5A 2WYWA 3TZHA 3UAGA 3WJ7A 1Q0HA 4IY1A 1VKOA 1ZJYA 3AK4A 1PJ4A 2ZIZA 1CERA 2V6FA 4RVDA 4E33A 5TRTA 1QR6A 3DHNA 3IQDB 1SZJG 3JYNA 4ZHSA 3E5MA 4RJTA 3PJGA 4JJIA 4U6QA 3NGLA 4F3YA 5KJEA 3S55A 4P4GA 3GVIA 2Q50A 3JCZA 4TKMA 3WBFA 3PDJA 1D7OA 4FJ0A 4ZN6A 1BXKA 5DN9A 2C59A 1V3TA 3LLVA 3K96A 3UH1A 4WOJA 5A4DA 3K2EA 5TS3A 1QYCA 3F1LA 1DFHA 1GUZA 2YZ7A 4NPCA 1ZXBA 5IZCC 4IDAA 1ZEMA 3WG9A 1WZEA 2PGLA 4IDBA 4IMRA 3KTDA 4YRBA 2ZB4A 1PGOA 2YDXA 4RCVA 1Z73A 1H6AA 3RBZA 1EUDA 1H9AA 5B37A 5EL0A 1QG6A 1FXSA 4IINA 4KP7A 3C1TA 2JD0A 4NBWA 4GSKA 3ITKA 4BKQA 4GWKA 1LUAA 3PTZA 3I4FA 2VT2A 2X23A 4BNJA 1PJQA 4YXFA 4EBFA 4WGGA 4ZQBA 3STHA 4RLSA 1ENPA 4IBOA 4CMGA 3WR5A 1EVJA 4NH4A 3G49A 1KYQA 2GN9A 3SXPA 1P77A 4YAIA 4ND3A 1B8VA 1ZSNA 1YB5A 4K6FA 1AUPA 5GY7A 5GZ1A 2EW8A 3U4CA 2GLXA 1CEQA 4WE3A 2ZYAA 4GQAA 3WOHA 4AJOA 4EW6A 5IXYA 3DBLB 4NDNE 3WSWA 1U5AA 5TX7A 1OZAA 3FPLA 3CH6A 4XYMA 2DBQA 4XQGA 4B8WA 5TJ9A 3WWYA 4XRGA 4LRTB 4JXKA 1T2DA 4R54A 4BIIA 4YRDA 1CDOA 3OEYA 1SCUA 2HMTA 3VZSA 7ADHA 1PL6A 1GTMA 1QYWA 2VNAA 2GSDA 2EG9A 2F00A 2YQ5A 4B4UA 4BL5A 5EQFA 4QO7A 1TI7A 4KUHA 4IJVA 3ROKA 4LMRA 1EE9A 1ZK1A 3GUCA 4YBZA 2YY7A 4MOWA 5LDGA 3PHJA 4IQ0A 3DFUA 4PZCA 2GASA 3KYBA 3PHIA 5L9AA 1B8PA 1R4NA 3T4EA 1J49A 1BXGA 1PZFA 3GHHA 4DPMA 1K89A 1SAYA 5DP1A 5DZSA 2QX7A 3I9JA 2OFPA 3GEDA 5CEJA 3AOEC 3EW7A 2NVUA 4M1QA 1RM0A 4KZPA 2W2LA 5DOVA 4DQVA 3ICCA 3VPFA 4I9HA 2DFVA 4Z9YA 4II3A 3JQ9A 1E3WB 1U7HA 4RQTA 2FSVA 2A4KA 4FOSA 2DBRA 4J9UE 4RVSA 4L74A 1P44A 4Z0PA 3RI3A 4YJHA 3K31A 2GZ1A 3RJ5A 4XD2A 1NAIA 1HSZA 1U8FO 4J4HA 4NI5A 5U1PA 4E2YA 2ZCUA 3DZBA 1NPDA 1HTBA 2W2KB 2X9NA 3Q9NA 1IY8A 3E18A 1NNUA 3PZRA 1EFLA 1DRVA 2GPTA 5JE8A 3WGOA 3GPIA 2W98A 3VZRA 4IJKA 1DRUA 2X86A 2ZQYA 3NDJA 3PHGA 1AHIA 4JCOA 3ORFA 2PD6A 3MJVA 3PIIA 4M55A 4UUMA 5TNXA 4CJXA 4RGBA 1VSVA 1UP7A 2EW2A 4UEJA 4BNXA 4B79A 3KOUA 2XPCA 3B70A 3GDGA 3PWZA 2NTVA 4PLFA 1HE4A 3PGXA 3WYEA 3GMDA 5JLAA 2EGGA 1V35A 3TPCA 5CAEA 3CINA 3R0IA 4HADA 4DMMA 4GWGA 2QQ5A 5GMOA 3KUXA 3DBHB 4JBHA 3RCBA 1QXSA 1E77A 1LDBA 1R6DA 3PHHA 3GG9A 3HWRA 2YJZA 1YONA 4GL4A 4Y6RA 3QWAA 5CPFA 5KJCA 5A1TA 1AE1A 1JA9A 5GZ3A 2C07A 3KEOA 3KB6A 4XGKA 1B14A 1GADO 1NVGA 2YHIA 2HSDA 2GF2A 5AXCA 1YDWA 2E4AA 1T4DA 5T5QA 4B8ZA 1UAYA 5AXAA 3H9QA 2GZ2A 3IAHA 4M89A 4Q39A 4U5QA 5JYDA 5LDHA 3I83A 4I9UA 3U5TA 1SO8A 1DIGA 1ORRA 5JDIA 2I3GA 4F6LA 1FK8A 2BMAA 3ZWYA 4UEKA 4LRSB 3GDOA 1RM5A 2CVQA 3WB9A 4OL9A 5TT0A 3KV3O 1P45A 3KXDA 3SX2A 1RJWA 3S2IA 1D4FA 1E5QA 3B6ZA 4Q9NA 3HFSA 3AY6A 3RC2A 4TRJA 1I24A 1PQUA 1YBAA 3FHLA 2X9GA 4PVCA 1IULA 1ZNQO 3M6IA 1GV1A 1YH3A 3BTVA 3TF5A 2B69A 1T26A 4O1MA 2DUUA 1ADBA 3EMKA 2Q2WA 2VHYA 1LC3A 4E2WA 1C1DA 1B2LA 4NU6A 4FFOA 4TQGA 1YS4A 1KY5A 1UZMA 3P5SA 4II2A 3SEFA 4CR7A 4AG3A 3GUYA 1IE3A 1X7GA 3G79A 3W1VA 4LGVA 4EI2A 1KBZA 1KETA 1XWFA 2C5AA 1Y8QA 5C3MA 1HKUA 4CM4B 5JDCA 5G2OA 3CE6A 2I9PA
chains in the Genus database with same CATH superfamily
4RMHA 3NT4A 4R98A 1AKYA 3AEXA 1S8AA 3IIEA 2E4XA 1AXGA 1PG0A 1EJ6A 1JHDA 3LG2A 2BBWA 3VU8A 1L4BA 5CCDA 3ZTWA 1ZOSA 4BLUA 4CEHB 3AEKA 4EZBA 1ISHA 2OR3A 1AC5A 3K2QA 4FW8A 3C39A 4YASA 1NI5A 3V33A 2P90A 1YB1A 1YR7A 3SDSA 4BMSA 5CDGA 2E89A 3S6JA 3FDFA 2GNAA 3SYLA 4IX1A 3LT2A 2F62A 1VMAA 3R6TA 3MWYW 4YALA 2V7QA 3OZEA 2W5UA 3HU2A 1GPLA 3VR6D 3NDIA 1IB6A 1YB7A 2GJAA 4ZO7A 1TF7A 3GUZA 2OBYA 3PI6A 2Y1OA 1LZKA 5CJJA 3WQRA 1CQJA 5KTYA 2FG5A 1DG1G 3GEIA 2EHDA 1I0ZA 3H5LA 1UC5B 2H7CA 2NG1A 2VAVA 1L5GB 4E21A 2PO5A 1G9TA 1MQSA 2R6FA 4XAQA 2GVDC 1GKLA 2NQTA 2PL3A 3E4CA 1AY0A 2ZVDA 3DFIA 3LL7A 5HKKD 2BGIA 3OIDA 2CDBA 1NQOA 1VG0B 5FHRA 2NUAB 4UHBA 1UINA 4BFUA 2LNDA 2BGUA 2MCFA 4RDXA 1W94A 2Z08A 4P7BA 1H1LB 4WFQA 4N48A 3SHTA 3S1SA 2XA9A 3QEBZ 3DSRA 5A4JA 2BJVA 4G37A 3M82A 1D9ZA 1IVNA 3MMZA 2DUWA 3RF6A 4ARBA 5FUYA 1F4LA 3O3NB 2QVCA 3LRXA 4RD2A 4C08A 3IBYA 1H4TA 3KKZA 5IH7A 3RLIA 3WX0A 1PR6A 4KXUA 4C20A 3Q41A 1YT5A 4TT3A 4B2PA 1SBZA 5LZ7A 2HL6A 2C2YA 2FMHA 2BFAA 2JGJA 3O8OA 3KX2A 4EHFA 1FDOA 3NR2A 1KDYA 1NQUA 1L3CA 5A5DA 3PUJA 2QS9A 1G0NA 1V7QA 3A1TA 1EVLA 4NZOA 2UAGA 3T41A 4CF3A 2EW1A 1QU2A 2H4HA 1Z0FA 1ZVJA 2WYUA 3NEYA 2GM9A 4QFBA 3WKEA 1CUUA 3GF4A 3OE4A 1JTVA 4M22A 1G4HA 1FFXA 3DYBA 3DZCA 4BNDA 3H19A 1RXIA 1G6KA 4QQRA 1HNZB 1G8JA 3FFTA 3GEEA 3SC6A 3GJ5A 3EF0A 4X60A 4B7CA 1FP1D 2AYYA 2JHCA 4F9FA 1BX3A 1NYRA 3MWFA 3BMOB 1ZD4A 2GPBA 3PC3A 3BBPA 1XROA 2WM8A 4PTLA 3BMXA 2XLBA 3OCWA 1IK4A 1YZNA 4KNWA 1DCTA 3JRNA 2ZUEA 2ZB7A 2IU4A 1DUIA 1NN3A 2VDOB 1OA0A 3N8GA 2P5UA 1GZHB 2YVKA 4JUCA 5BSFA 2Z04A 2ATVA 2ODAA 4US0R 4Y9SA 5C32A 2FZEA 3LQKA 3BL5A 3WKCA 4DLBA 1NTOA 5JXWA 1PDWA 3AEUB 4WZ6A 3PFCA 1CRLA 3SQWA 4KZKA 1BS9A 2DQKA 4ZRMA 5HRCA 1IPFA 3AEYA 3BE8A 2J0SA 2EKZA 5HXAA 1FFWA 2P9JA 5FYDA 2X8LA 1R6BX 4IDCA 3VAAA 2AGVA 4A3SA 2V7TA 4CV1A 1YCFA 3C45A 3K6JA 4RZSA 4DMKA 1BOFA 2BFBB 2YV4A 3WLSA 1R8SA 1SPBS 1UC8A 3JQAA 5F52A 1WOMA 1K8YB 4IGAA 3RVSA 5LXTA 2KYRA 3EBLA 1IEXA 4CM9D 4PRKA 5JNWA 4CUKA 1NXTA 4IDHA 2HN9A 2RH5A 3IAFA 4D9HA 1XDUA 3H2SA 4KVGA 3O3CA 5A1JA 2PD3A 4JQOA 4RS3A 1W5AA 3FZQA 1CR4A 4HTAA 1C9DB 1MIHA 4P5DA 5GQSA 2KWIA 2NU8B 2B3DA 1BTOA 4MW2A 5KZMB 3FOCA 4UBMA 3AYXB 4RFLA 2F1JA 1EGHA 5GZ6A 3W04A 3N1UA 3PP8A 4FEAA 4LHSA 4A8TA 4AQDA 4C6RA 4DDUA 1W36D 2PUCA 4B8YA 2J3EA 2DC1A 2R8PA 3F0TA 4WI1A 5A6SB 5JADA 1JX6A 4JT4A 2C5BA 2G28A 4KKVA 3SZ3A 5LQDA 1QS0A 1GZSA 4XB1A 1VP9A 4H0FA 3WYNA 5IVKA 1D0SA 3BXPA 1I0LA 1NOJA 4J1NA 1KBOA 1WZCA 1XQWA 3OKPA 4BYGA 4C4SA 3N07A 3G1TA 2QDXA 1J5PA 3PTAA 5DCUA 5CA1B 3OM9A 2H4JA 3MT7A 3C5CA 4XLZA 4ZDKA 4DMLA 3U3OA 3KBOA 1YB4A 2FUG6 2HDNB 3NWOA 4PXYA 3ROFA 5CITA 4DT1A 4CU2A 2BD0A 3IUBA 4Q03A 4KRYA 3LGAA 1VHDA 4QKQA 3Q0TA 4HVTA 4I1PA 4TM8A 5HK8A 5GADl 4PIMA 2ZUBA 4KL8S 4M0LA 4X8HA 3W6PA 3PWKA 4A23A 2QENA 3SS9X 3TEJA 4JCCA 3TUIC 3DOHA 2EJCA 1OT5A 3NIDB 4XGIA 5CDYA 1KZ6A 2YV5A 4YBRA 3DXXA 3IVMA 4L85A 4ZCQA 2PVPA 3F73A 5TY0A 2WHEA 4CXMA 1E0KA 2NIPA 3GBVA 3HXKA 3KZ1E 3Q6IA 4P2GA 5C31A 4AYXA 3C97A 4GF5A 4F4IA 4DMCA 2IXAA 3ZLJA 3LYLA 4OGWA 1ZU5A 5HFJA 3WDKA 1B3RA 2E7ZA 3FYUA 5EOVA 1P9OA 2PQ6A 2JG3A 1LPBB 4YNBA 2CFTA 4FMDB 1G55A 2JI8A 2VNJA 3LQ1A 5K3BA 3RFUA 4JP8A 4G23A 4EHNA 4I66A 5FKJA 4DLYA 1GTJ1 4A6DA 4YGXB 2PA3A 4GPAA 3VNUA 4GZ5A 1I4EB 2GM5A 2QM0A 3G6WA 3JQ9C 1LI7A 3W3AH 4BVJA 4DA7A 1V5WA 4XVQA 3W4JA 4LE0A 1V16A 2XYGA 1C29B 1FFBA 3C2QA 2VOJA 2AL7A 3BXOA 4AQYB 2XNJA 3N2IA 4JFRA 2NPFA 3RYFB 2EAUA 3EIHA 4U00A 3ZQ4A 2E4ZA 2FDCA 4OQYA 5FPHA 2Z4RA 4LGMA 4K9DA 5H3CA 4DQXA 3AIOA 5JH7B 4LC1A 5J58A 4TQAA 1G8KA 5FOSA 3I92A 2WTXA 1O94D 4KFTA 5K99A 4UTNA 1GRQA 13PKA 1M1ZA 1NOKA 2TMYA 3LIIA 1DJLA 4OXIA 2Q1TA 4YRCA 4FEYA 2VNHA 2QXUA 4M21A 4YMUA 1F7VA 1DLIA 1JSLA 1SHKA 1CS4C 1Z12A 1D1QA 2VAWA 3OX4A 1UPTA 4H7HA 3G0HA 3AF5A 4Q1DA 2O8CA 3TQRA 5LZ4A 1MLDA 1F0NA 5CB8A 3NG1A 5HIMA 3RO7A 5LA6A 5DBGA 5A5VA 3N7UA 4N9QA 3V1NA 2XB9A 3VGPA 4UE2A 5BV1A 3AUSA 2ZSAA 3FKSD 2PWBA 5AK6A 3C3PA 3ANSA 1L3BA 5ERGB 3ZGVA 2HK6A 1P1IA 3F5QA 4OYRA 4CDGA 1YMVA 1WHTB 2GTHA 3EG9A 4MA4A 1LSUA 2RGXA 1USIA 2P62A 1AF4A 2H4XA 3HKDA 4IYRA 1FTWA 3IQEA 2JEZA 2YZKA 4OEHA 3ZK9A 2Y6VA 5AHWA 3FMFA 3HP1A 1IHXA 3K8YA 2Q6TA 5ITZB 5H4HA 4WZAE 3MPUA 4KNVA 3LIPA 4DUZB 4OY3A 2BGGA 2P2ZA 2VWQA 3ZXIA 4XASA 4NS1A 2XWSA 3WKBA 5BQ3A 3NBAA 3RC3A 3IQHX 3HV0A 3VHQA 1V39A 1XWIA 4OJKA 1YJCA 4I8XA 4EKNB 2J09A 5I7WA 5JYCA 1DEAA 3VH2A 1WXXA 2ONKA 2OO5A 3IT1A 3ANNA 4U7WA 5FL7D 1MV5A 4WKBA 5DLDA 4E14A 1MQ8B 3EIXA 1RHQA 3VPGA 3ZHVA 1HLDA 1QYXA 4BZZA 1J2TA 4R68A 1D6SA 2YNMD 4Z4EA 3KNZA 4Z9FA 1SURA 5F73A 1UKBA 2DTXA 5AJYA 1T5HX 2QG6A 2JKZA 2RG7A 1CUWA 1E9EA 1C0EA 1OAKA 3ZHTA 5DNCA 5AI6A 4I08A 3WGKA 4CF7A 2XD4A 2A92A 4YRJA 4NNJA 1UZUA 3G1WA 4XA8A 5ESRA 2KMLA 2QXTA 3A05A 2NWQA 3LKVA 1AKEA 3V4ZA 3AY7A 4AJHA 2QB5A 1ZICA 5B30A 3RU3A 4H7IA 3TLCA 5JD5A 1H2RS 1TT5B 2ZIFA 1NRIA 4DVGA 4LJLA 4TLMB 1LQUA 2PUBA 2OV8A 1SXGA 1T6BY 3BL6A 4GX2A 4F45A 4I55A 1U9CA 1Z8FA 1IZYA 3IKVA 3T52A 4BMPB 8MHTA 1DNPA 3ZBUA 4HPXB 1YRYE 4OKSA 5ENDA 1M6VA 3EPRA 3FWKA 1XQ1A 1P19A 3LCRA 4S1WA 4K5QA 1TIPA 1VMIA 2G40A 2VFAA 3ZU6A 4D1YA 5IABA 4C5BA 3GP3A 4TL6A 3DE6X 1E9DA 1WXGA 2VP4A 4H59A 1GKUB 4DG8A 1H8EA 3AZOA 4YFVA 1U8ZA 2HSGA 4F92B 1NVWQ 4BNTA 3F6YA 3VU9B 3V7FA 4RBNA 3WXMA 1N3IA 3NS7A 4BDTA 3I9LA 1UMDA 5H7XA 4YT5A 4DLSA 2ZANA 1C7FA 2DBVO 2K4MA 2YW2A 4GVLA 1KZGB 2RIRA 1WMAA 1DAEA 2VP5A 1YU9A 3HI4A 2OOKA 3HB7A 3Q1KA 2AJDA 2D62A 2ZIXB 2YQZA 1EP3B 2POCA 2R8BA 3OMXA 4G36A 2BLNA 5FFNA 3SY8A 4LWPA 1JDBB 4BB0A 4ZAXA 4X3CA 4HDNB 3ENZA 2IS4A 5CK4A 3JPYA 1G5QA 2JGNA 2B9VA 1DMSA 4S2EA 4OQDA 4TSKA 3PQEA 3OX3A 3VHLB 2VYND 4H6VA 3RAEC 1JILA 1OAOA 4XQ9A 2R97A 4KPGA 4M87A 1H2EA 4C9BA 1WPQA 3HDHA 5KYWB 4PO9A 2XMGA 3K0FB 3HXTA 3VJKA 1N32B 2FSFA 2OHHA 3HXOA 2FPKA 4GM0A 4RPGA 1G7SA 5LWQA 3ZTYA 4P84A 2J3JA 1N2CE 2EERA 5AR1A 1K75A 2QAIA 3I23A 4XVRA 1UBHS 2BFEA 4BNZA 5I8PA 4KSCA 4AJ1A 2Q9CA 1YZQA 3V9PA 3DLCA 2E6KA 2ZK7A 2X8JB 3JASA 2KE5A 3ZVKA 4MB0A 1LSSA 3CY6A 5EWLB 2QNRA 3H9EO 2VZ9A 1NQTA 3UXEA 1T6YA 4REOA 3HL0A 4ARZA 5DI3A 3UV6A 1IY2A 1UPCA 5KOIA 5JQWA 1W35A 3KR0A 2WR8A 4PX9A 2AJCA 3ELYA 1SR8A 4BBJA 1PNVA 4IFEA 1XMJA 1AHHA 3OQJA 2ZI5A 2FJ0A 2E5WA 3BDIA 3KELA 4PNZA 5TGDA 3JQ8A 4I50B 5HS6A 2ZCJA 3SZUA 2QMHA 1B6GA 2W6OA 3BGOS 4XWGA 3S4YA 4UAVA 4HXEB 1TMGE 3FTEA 1P9LA 5IX8A 2JI6A 1NW5A 2R5WA 2X58A 4EKIA 3TIIA 2G5GX 2PSFA 1C8VB 2BWJA 4PQFA 4CI0B 1T1EA 4D8YA 3RRJA 4RF5A 5IFKA 1IBSA 4BB6A 2WSSD 1G7CA 5DHPA 4AWXA 1F0YA 5D3ZA 1UJMA 3R6LA 2CEKA 2PFSA 4NEHB 1CTQA 5GM2A 2XW6A 2DWQA 2JFOA 2REOA 3IPYA 1MABB 4FFBB 1R0XA 1WSWA 4PAQA 2JBWA 5B7GA 3CJTA 3K7EA 1ZISA 2FPRA 1XG5A 4EUHA 1WTCA 3V6MA 2AFHB 4ZCMA 1UZNA 3D8TA 2NZYA 2CW5A 2IQ5A 5DN6A 3AEZA 3QITA 5G4KB 3U7EB 3T38A 4JJ4A 1A8QA 1AGXA 1J8YF 3A2MA 3BJZA 3GU3A 4MH0R 3QTTA 4GKAA 4F9TA 4GDFA 1EP9A 2YX1A 3EFOA 4MUHA 1DBIA 3H6GA 4ZEWA 1D3AA 3AVVA 3ITNA 4NZZA 2EJWA 3NFYA 4GSLA 1JT9A 3ETDA 1N7GA 2GN1A 1LW6E 4L57A 1X1SA 5FTMA 5FLEX 3I72A 1S4MA 2BGRA 3T5DA 1T4CA 1Z4MA 2ZT6A 1N25A 1I4TD 1CZRA 2Y0EA 2KLHA 4TMTA 4EUEA 4YEDA 3TNLA 5LQRA 2V0GA 3L79A 2C92A 5AKYA 3G7NA 2WHYA 1JSXA 1U81A 3ANLA 4P1ZA 2OD7A 4A8JB 3D1JA 4RTNA 3L7LA 1U2TA 2HWWA 3RUFA 4TN1A 4ALKA 5CXSA 5L3SA 3EXIB 1CR0A 1RMYA 1PSDA 3HVIA 3TIGA 1NY5A 4KFUA 2NVBA 1C1XB 2RKBA 2VP0A 1ZONA 3H86A 4MW6A 1CK4A 4ZZ1A 2X3FA 3TRJA 4CIDA 1CEEA 3EVDA 4LHEA 2WJ4A 1REQA 2JIOA 2A3RA 4R84A 4EG6A 1UODA 1RKVA 2CMHA 3QWHA 4WOPA 3WK7A 4N9WA 4OD0A 4B3DA 1O97C 3P9IA 2PXAA 2QUKA 2VCHA 2WWGA 2BP7B 1UBTS 3IXLA 1WPRA 3AR7A 3KO8A 3O7WA 4L4RA 1DKOA 3UZUA 4B81A 2WNIA 1IMJA 5IAKA 5DW0A 3MLBA 4DRXB 4KXYA 4DYHA 2QT1A 4YQFA 3QMVA 1T3GA 3D6MA 4GR4A 2OG2A 4WGFA 2QNBA 4MO9A 5E6RB 4BO0A 3LLUA 2I71A 2JGIA 4M6WB 4A5OA 2E37A 3G5UA 5COQA 1SUAA 2ZJ0A 4BMVA 1UUFA 5CX4A 4PFQA 3KYDB 1G291 1T5SA 2AZXA 4JL5A 1R0BA 1AB5A 2GN6A 4Q3KA 3ZWDA 1QKIA 4NBNA 3BFPA 5AOBA 3ZE7A 3IPRA 3ZLTA 4D6YA 4LF9B 3P2KA 4OK3A 3M1IA 1XGKA 2CE2X 4RQBA 1D2NA 2GUGA 3QEMA 4UAJA 4XYGA 4LI3X 1YKFA 4GRDA 3QUCA 4UFOA 1RRVA 5FOWA 4AT1A 3NH9A 3W6UA 4DLKA 3R6WA 1IBCA 3AFGA 3URMA 2FY8A 3PXEA 1NTRA 2X8BA 3D3JA 3FETA 3QOWA 2CV0A 3I5UA 1CY7A 4O3FA 1SVIA 4TTIA 4KXVA 1ESDA 2FCRA 5LQAA 4HMOA 1AM4D 2AKEA 4BCDA 1JEJA 4HWOA 2BKAA 4QO8A 2P6RA 4HB4A 1N6NA 1T2VA 2QTHA 3LOUA 3A9RA 5HKBA 2GZ3A 2I7DA 4LX8A 2Q8PA 2CXTA 3LK6A 3B8EA 3PV0A 2YV2A 1A9RA 1VCOA 3ZX5A 1BH2A 1M2OA 2MINA 2QVXX 3NCHA 1QHHB 2EIXA 1KL7A 5T3YA 3RTBA 5IC4A 2NO0A 3P96A 3TFWA 2LV8A 1FJGB 4EA9A 3DT8A 2Q1SA 2A5LA 3NBYC 2ZBQA 4WKGA 3ED1A 1I01A 1WQ3A 1FXWA 2DKFA 2QU7A 2VDWA 3P2JA 1ZA2A 4F21A 4YP1A 2XZDA 1XMQB 1XR3A 3PXXA 3Q7SA 4EEKA 1VIVA 1U4NA 2DSNA 2BPOA 1CUHA 2C4KA 3OFSA 3QELB 1LXCA 4HRXA 4HRVA 1NUTA 2VPIA 2WUFA 3RYTC 3S0JA 2FUG1 3DMTC 4QWMA 5EGNA 3UCXA 2QRMA 4YJ3B 2A67A 2V6JA 3IERA 1IJKA 2EHJA 2RHDA 5JMOA 2ZJ5A 16PKA 2W6JA 4EY7A 5D6OA 5JYBA 2JD1A 4JAVC 4C07A 2R5FA 2KQUA 1TVKB 3REFA 5BV2P 3WICA 4R9UC 4P6VF 1SXJE 1QYRA 5ERYA 2QRJA 4HCJA 1U2PA 5CCXA 1Q0TA 1QH8A 3A6HA 1UT5A 1M2KA 1M8KA 2Z56A 3HMQA 3PC4A 1X80B 2WC1A 4YAKA 4D81A 1X7HA 1X3SA 3ETHA 1RLJA 5I4BA 4OQFA 1CY6A 1H93A 1J99A 2AUTA 5IJAA 3EEIA 5CFQA 1UKCA 5C46F 2E21A 3M83A 1XZFA 2W2NA 3A1UA 3OU7A 2XGSA 4LF5B 4N39A 1ZH0A 1XA0A 1SCBA 1KI7A 1CVLA 1YVRA 5LP6A 2PGOA 5EPOA 1UADA 2JJ1D 3DYVA 2Q6OA 5JXGA 3L0PA 1ZM7A 1EQ2A 3W6ZA 3GXOA 3WOVA 621PA 4D0LB 1N2XA 3LBIA 4FZ5A 1PKXA 1KHTA 5AM4A 5JPIA 5SV2A 3S5UA 1G5TA 3SX0A 2XEXA 3GWZA 2WZCA 3CEAA 4PZ0A 4EHJA 5B7QA 2BFCB 2D2IA 4YR9A 3NUQA 1GGEA 3QVTA 2CHEA 3WAKA 1J5XA 4E0BA 2CLMB 2R1ZA 5IZ4A 4FHEA 2GEBA 3NPAA 4EFKA 2BFOA 4IHJB 3SEAA 3BXXA 1Y33E 1P5JA 2O2GA 1UIRA 2HYDA 2KW5A 3ONDA 3D64A 3GEBA 3QLUC 3D1LA 3DG9A 1TVCA 1HE1C 4L9WA 2I7VA 3PHLA 3OT1A 4KK4A 4LW8A 2G9NA 3RJZA 3WL3A 4EEZA 5KYYA 1BXRA 1LRJA 2X4GA 4QSMA 4RPLA 1DWOA 4HAIA 2NZUG 2OHJA 1UBOS 1E5DA 2FZCA 4LA4A 4O4JB 5LZ8A 2WWIA 3AF0A 1EXWA 1K06A 1NDUA 2QY9A 4Q3BA 5LU9A 4B6RA 2RB4A 4XEHA 4BCBA 2HADA 1P39A 5FA6A 4Y6PA 2FX2A 1VXOA 3VC2A 1ZLYA 4ESHA 4YCCA 3BSWA 5KWJA 5BMVA 2EJVA 4NMLA 5BYBA 1TNDA 4M1SA 4JP1A 1RLTA 2PCJA 2VYVA 2SCUA 2WHPB 2QX6A 4QDTA 4BWYA 4JQYA 5KSOA 1Z16A 4IIXA 4X85A 4PC6A 2PANA 2AVDA 5K0TA 1ZUWA 2ZG6A 2PY6A 4KQKA 4NOJA 3E8XA 5JXHA 3IHTA 5A71A 1YS9A 2PT9A 1UKVY 3C14C 4O1HA 3EGWA 2OBXA 4HBGA 5HRUA 3F78A 1YWGO 2VK1A 2GTIA 3ETCA 5K8VA 3PQ5A 3PXDA 2OXFA 2Q3FA 1W19A 1Z35A 2P91A 3F74A 5CD1A 2B4TO 5C52B 4D26A 3WYCA 3AI2A 1OI2A 1Y9DA 1ZIOA 3RWBA 2OGUA 5CFZA 4JJEA 4UXHA 1HTTA 2ODPA 4LZJA 5TE9A 2QQFA 1YDGA 4PFKA 1A5ZA 2PR7A 2AFRA 3UFXB 3OA2A 2F43B 3OZWA 5D2CA 3VZDA 5M29A 2C9MA 3KLNA 4J91A 1NFFA 3GOHA 4FI3C 2NP7A 2ACWA 3CPEA 2PIDA 2NZJA 3RK4A 2H9IA 4ENQA 2DQZA 5IH3A 5L7WA 3IAEA 5MN6A 1NVUQ 4NDAA 1VOTA 3OSUA 3RFXA 4EABA 2YICA 2WIFA 3IQIX 1IUOA 1TK2A 4QQKA 3WGYA 4F1KA 5JS7A 3VR2D 2O5RA 4FE3A 2I6GA 2MIIA 1EFHA 1QFJA 1S2GA 2B94A 2R60A 4YN3A 1DKQA 4WK6A 1A72A 4EY4A 3NYWA 4KUGA 5AW8A 4ZGWA 3ROEA 2IIQA 1H2FA 3MJFA 4MQMA 5P8WA 2P7HA 3INTA 4LRQA 5DMHA 3RNOA 4MMXB 4DIUA 2HJRA 3NVKI 2PTHA 3D2BA 2ZVPX 2C8VA 2PYDA 3KDPA 1XDSA 3L9WA 1X7ZB 2EARA 2AG5A 2VPWA 3JATB 2R00C 2RGBA 1PWEA 5F5LA 4ZCSA 5CCBA 1NBOA 3F7NA 2BMVA 5DKFA 2G5TA 1E9FA 1JR6A 4NLLA 2B7LA 3R3XA 1U8TA 2CCJA 3I45A 2CL6X 3CEJA 2Y2UA 3NHWA 4TV8F 1IXYA 3W5AA 1N7JA 1SQ0A 4QOIA 1PRYA 5HX7A 1WNTA 3GCDA 1J4AA 2H0QA 2N1MA 2UXCB 3OF2A 5E3HA 2CSXA 4JOBA 6GPBA 3BXEA 3EIWA 1C7IA 5SICE 2W6ID 2EKLA 2OZLA 2Y6UA 2GPSA 1M7GA 4PXSA 4PGFA 5BW5A 5DULA 1L8OA 3COYA 3IXMA 4NDZA 3VC1A 2P35A 3FB4A 1H5QA 3NBFA 4HQRA 1EFRA 1GQRA 1QZZA 4G0QA 4KBFA 3LW7A 4JDPA 5E6SA 1O96B 3MS4A 3T1NA 3UMYA 1E3QA 2JFXA 2AA3A 3EVBA 3Q3IA 1B8NA 3M34A 3QLJA 2IHYA 4JX8A 4R1MA 4CL8A 4KR6A 4RZ3A 1EWYA 5KKAA 3QG5A 2ZTLA 1D0IA 1LDEA 1NJ5A 1XRQA 1GKKA 4EG0A 5DTIA 2PKRA 5DSTA 4QEDA 5HOQA 1K6MA 2XMZA 3U7GA 3LFUA 4J1TC 3VTZA 1RHRA 4QNRA 3VTAA 3U09A 4WADA 3QLEA 2PMBA 5L3RA 3W06A 4AP5A 1XHFA 1LPMA 1T6XA 3KKKA 4HATA 4RKFA 2XRYA 3GY0A 4U8HA 4EB6A 2YW9A 1SBYA 3ASVA 4OQNA 2GCGA 3IV7A 4ZP1A 3DDWA 1DJQA 4E32A 3PU6A 4OHZA 1MBZA 4A0SA 3L7IA 5KYKA 4JROA 3GAFA 2REBA 3BF7A 2AOUA 1XZLA 2IT1A 3R20A 4K2HA 2Q3MA 3ZHXA 2PZLA 2ZB8A 4L2IB 1H0HA 5A7GA 4EO4A 3DZHA 3JVUA 1ULSA 4KUEA 5EE9A 5DHQA 3OHMA 4H3HB 4O2BA 2AMFA 4FDLA 5BN3B 1JF8A 4JYBA 2B35A 4BNVA 3PNKA 3HJCA 3LUHA 2IZ7A 2ID7A 2OHXA 3BH0A 4RY8A 2XDQB 3H2HA 3L82B 2CJPA 4PG7A 4PQRA 2GNPA 2OFWA 1C14A 4DBVO 2M98A 3H18A 5AKZA 4G6ZA 3RYCB 4R1OA 1LC0A 4QNMA 4NYJR 1E32A 3F4LA 4XR9A 4BLVA 4INAA 5ES3A 4ZEMA 4WH0A 2CYBA 3FPKA 4ZO9A 2F4NA 3V4LA 5KVSA 3FAZA 3CVWA 2VTBB 2CZCA 3ONVA 3TL6A 5EMNA 2NUPA 1SVKA 2DTEA 3F6PA 3WO1A 1T5LA 3ZHQA 3D1VA 3LLCA 5ILQA 3RARA 5DWVA 1O9HA 2FPXA 1R9MA 1ZOPA 3R40A 4QOHA 6PFKA 4BU0A 4UNSA 3O5AA 6Q21A 3JQCA 1D2CA 5K0CA 2B1JA 3ZIDA 2QJRA 1RI2A 1GLVA 4OHMA 3D6JA 4OFXA 1LLDA 2ZYDA 4RHEA 3TRDA 4FP9A 5KC9A 2NU7B 4G81A 4UU0A 5L4SA 5AVKA 4IIEA 4YUAA 1QHSA 3E9YA 1QCZA 1QLJA 3V4PB 1G1AA 1FNBA 2YV1A 1D6MA 4UQPA 2W2PA 3KT0A 3STTA 1RWMA 4WKCA 1Z0UA 4X71A 2FE4A 2C9DA 1T25A 4MRRA 3KG2A 1NMXA 4RNDB 4RZIA 3HM2A 2NACA 3SVLA 4EPWA 5JUWA 1MW9X 2J6IA 1YE3A 4RIGA 1ADCA 1Y8CA 1Z0IA 5FPYA 3OZFA 2ZSJA 4RFSB 1QHEA 3F9CA 3MRSA 5TJHA 4XFJA 3KQWA 1V5GA 1THTA 4TZTA 1C3EA 1K6IA 3VV2A 1U7ZA 2BKEA 1K6XA 1T0IA 2Y9PB 3K16A 2NV2B 2XUJA 1JQJC 2BEJA 2OL4A 2X5KO 3INGA 1NFRA 3GLUA 5F5NA 3BSSA 4EM6A 3SICE 5CA0B 1B0PA 5MDHA 4YV2A 3VH1A 3Q9LA 4OGLA 4REQA 1CUYA 1U7UA 4G1FA 4MKIA 4OJMX 1UKEA 2R2AA 4QD3A 2F2TA 3F6SA 5AKKA 4P08A 5D5PA 1J5EB 1M34A 1YACA 5A4AA 1WUKS 3LQFA 3H2KA 4ACAA 3EHDA 4GKVA 2P2LA 2WBLC 4YQEA 1Z63A 3L8EA 3W3AA 3EOZA 1MEEA 3R0VA 5D3MB 2QRHA 3R5FA 1MT0A 3GP5A 3KB8A 3IRVA 1BMFA 1PS0A 5LCXA 1V6AA 1XQYA 4YLYA 2V7QD 2XIQA 4YI5A 4RXMA 5EWJB 2JHFA 3NASA 4WL0A 4ZV7A 1UXJA 4ODIA 2IE0A 4J49A 2ORYA 3NHSA 1M6HA 3DLTA 4B6JA 821PA 1XLVA 1MAVA 3HN6A 4D43A 2Q5IA 3HKBA 3QWFA 5K0JA 1JIVA 2FWNA 2PKWA 4IJ6A 1UDRA 4B6PA 2XXBA 1QGYA 1XALA 5DNVA 5KWVA 5T4FA 3MYRA 4BQOA 1D2HA 1M6NA 2JCVA 4IVRA 3GPCA 1O6ZA 3AR2A 2IYOA 1KYYA 3CLUD 1QQAA 3VISA 2X0NA 1LQTA 3MS7A 4KR2A 3TOVA 3G9XA 2GF9A 3ZYZA 5AVQA 2NADA 4DL9A 5JY6A 4FEEA 4P33A 1XI2A 3OC0A 3R3HA 3M6AA 2JLBA 4PPQA 4KPUA 2XAUA 3VKFA 2I1QA 2GJ9A 1LA2A 1J70A 3N5CA 4HEHA 1IHDA 1CP2A 1OXSC 2VJPA 2ZBRA 4TT3D 2GOYA 5FOQA 2JCGA 3CSDA 5AMXA 3FWNA 3QBEA 5T6BA 1MD9A 3FX2A 3C3MA 3OZ7A 4Q4LA 5EI5A 5IK2A 1A3CA 4P3OA 4CHGA 2GAOA 5JJLA 4NBTA 2JFYA 4OKNA 4MB6A 5DM1A 2VDJA 1OWPA 2UZ1A 3FNEA 4LCEA 4PRYA 4YRRA 5EIHA 3VBCA 4YUZA 2PR2A 1YF3A 5KOHA 2IZOA 3VHXB 2C42A 2R7KA 3CVXA 4Y2YA 1CDZA 1FW8A 5EIWA 3QFHA 3LUPA 1BS2A 1L2TA 2ERCA 5K3EA 1JQ3A 2HJWA 3DOEA 3UMRA 1QUFA 4BRUA 3N0WA 5BNWA 1GSAA 1R4NB 5AI8A 1DFGA 1QP8A 1ZP6A 1OBFO 3GZ4A 4MHTA 3U9LA 3SBOA 4KHPB 1J25A 3VI4B 1BJKA 1L7PA 4QDZA 4F4FA 4PYNA 3IMCA 3AVOA 3SSMA 4G56A 3E03A 4ZVRA 2YKGA 4BQSA 4M37A 4NXMB 1D09A 2BEVB 2C4TA 2VQ6A 3DAYA 5ICCA 3WRYC 4CE6A 2NVUB 2AZ4A 3U6KA 2Z5VA 3RS3A 3TFQA 3ZKWA 1MAUA 1B8UA 5FUMA 3L4BC 1M75A 4B6OA 4ER0A 3CNHA 4QNNA 4L5YA 3W8DA 1TTHA 4U8GA 2O3QA 4LXQA 4UUAA 5B1EA 1DOZA 4DUYB 3AVYA 2A86A 3UWDA 4Y9TA 1B0ZA 4NCKA 4OH1A 3Q88A 2EFDB 2Y1FA 4PBSA 4PINA 4EYEA 1RRCA 2IPNA 1RHKA 3UJCA 1WL8A 1X7WA 1ECFA 1ZHHA 4ZI7B 1DBPA 1NDHA 2QRKA 2WIJA 2J5QA 1KORA 2NU6B 3KTOA 4HDKA 4L5JA 2O8EA 1SY7A 1UC9A 2XF8A 2V7PA 2Q9AA 4E4RA 1DJMA 1E1MA 3REQA 1BKDR 1KRHA 4QWWA 1YFLA 3VH4A 2JIQA 1VIYA 3JQAD 5IDXA 3V8VA 3PGKA 5KTPA 1K5DA 2A9VA 3C5WP 3G8CA 2Y92A 4Y2JA 3B1ZA 1Y6ZA 3L6OO 4GVPA 4C4RA 4H31A 2ZDGA 4J2OA 2G76A 1ZU4A 3AI3A 1MTZA 4ZCLA 5F7OA 3IA7A 4I5GA 4Y30A 1IQ0A 4Q7EA 2BM9A 5EXTA 4YUVA 3ZW7A 4Z3KA 1Q0RA 5COAA 3NTLA 4KIJA 1L5NA 1NZFA 3T7IA 5D00A 3H5WA 5GVSA 1RQNA 1FDUA 3OQIA 3ZZ1A 5CDFA 1SHZA 5H0IA 1IIBA 2FG7C 4YMWA 1PEAA 4TYMA 3ZD6A 1JI0A 3PR1A 1EBFA 3OT5A 3TOSA 7GPBA 1ZIXA 2ZYIA 4G26A 5DW3A 1U7WA 2PKYX 2P68A 3H0EA 4OB6A 4YMVA 1J2EA 1R8QA 4DBZA 2O8DB 1V8ZA 4U2GA 1MGOA 3S40A 3GCGA 2RAFA 3DB2A 2UDPA 3QP9A 1ESZA 2F9FA 4QULA 3FOEC 4AS3A 1YTUA 2GCOB 4BLWA 1HFWA 3W2HA 4MZXA 4JEHA 4Y67A 3QXCA 4LVUA 1MOPA 1CW2B 2FOLA 1E2HA 1K2VN 3NC1C 4M49A 3TQFA 3HU1A 4DTIA 1W29A 4JT2A 4WY5A 1G8AA 2OVFA 4PNPA 4RK6A 2OZPA 2PUVA 3C7AA 1H3EA 3LECA 3FRJA 5J43A 4G8DA 1JAIA 1DZ3A 2Q0XA 3Q6NA 2OQVA 3VBEA 2XHEA 5L4NA 4HAVA 3QG1A 4NCIA 4NSNA 4YDRA 5AXDA 4P5EA 3V1YA 4CG1A 4D3DA 4YMHA 5B6JA 2C2GA 4ZVPA 3GDFA 1PYOA 2BBOA 3VDNB 3ZNPA 1PW7A 2FQWA 5JATA 1POXA 2M2IA 1CZUA 4GEKA 1Z7EA 3DMHA 2QJTA 3GW8A 3RF7A 3UUGA 2BHNA 4H1VA 4X1KA 4KRFA 2YHUA 3R3JA 5IM4A 1UH5A 3ETLA 3MTEA 3C3KA 4RJIA 4TTVA 4CKBB 4TYYA 1ESCA 3OU2A 4HYYA 4NE7A 3HJAA 4ER3A 5AVZA 1EWVA 1XVAA 3UXMA 3NTVA 4AZ3B 2GPYA 1BHO1 5F7ZA 1Y4AE 2I2FA 1O9GA 3FDJA 4JMPA 3TDNA 3UHOA 2EFEB 4DDVA 1W36B 3PWTA 1ACJA 1C3LA 2P1DA 3HYCA 5I5EA 2FQXA 2AZMA 1IN5A 4UNNA 5ALMA 3VSCA 4EKYA 5BN5B 1KE1A 1TJ3A 2B4KA 2EDAA 4LGYA 3SEQA 3EPHA 1GTVA 2CLLB 2Z2ZA 2VQ3A 3M3PA 2REQA 4JJAA 5JFOA 4GW3A 3NDBB 3E2MA 2O8BB 2Q8QA 4X64B 4A0RA 2QJFA 1JN0A 3L7CA 5JZ9A 1ZEJA 3NFRA 3T3DA 3H97A 4BNFA 4GBMA 3LXRA 2MWMA 5EXPA 5T4BA 1QPGA 1P80A 4NG4A 4QXOA 4JLMA 5ADHA 1OI7A 3DWFA 2J5XA 2QAGA 1TKBA 1BWQA 1K86A 4RIEA 2FN4A 4EK9A 3AKYA 3I5AA 4AULA 2JAXA 2VT7A 5FTJA 5EGSA 1JDTA 2IWHA 1J0EA 2JVKA 5HM6A 3T61A 3HL4A 4HFRA 2XE6A 4UHCA 1JDVA 1T9AA 1ZGJA 2KBEA 1GDTA 5ENVA 2P4EA 2XUIA 2GK6A 4YQZA 3RODA 3HYLA 5DPMA 3UW1A 1DMRA 3GMSA 1NW9B 1Z68A 2YWBA 1FRVA 2POQX 3IHWA 4FGSA 1Y8QB 3H4TA 3IDSA 1UPFA 2I3BA 3FMOB 3LOQA 3AUFA 1ISFA 1B26A 3QBJA 1F2TA 4IXDA 4FDVA 2C3OA 3MQ4A 4FFMA 4TSRA 3T9DA 5DYWA 2QTVB 3OOSA 4CKEA 3DDHA 3E9RA 4F6RB 3E0QA 2P8SA 2W11A 2EKBA 3FLMA 4JLDA 1T9GS 4GH5A 1P62B 2RHHA 3M4NA 4WEOA 5DLEA 4WWHA 3WS7A 4DW8A 2AYZA 3WJ2A 2INGX 3DQQA 1Y37A 3QVSA 4WOCA 4B40A 4OB8A 3GEMA 5F9FA 1YR6A 1U3UA 3LBNA 3C6BA 1CJBA 1KPHA 1YCDA 1U5BA 1YJXA 2GEUA 3KLPX 3AIKA 2K5UA 2BGNA 1VKHA 1A5TA 2XQIA 1XCPA 2P8JA 5BWMA 3U7QA 1B74A 2CYCA 3OQ6A 1II8B 3V00A 4DM4A 5DX1A 3W5CA 3WSVA 1YOVB 1BNCA 2WJHA 4HBZA 3ICEA 2HRBA 4Q48A 4GX5A 5I6DA 2GEVA 2OECA 1I2MA 1KK3A 1IOLA 1IHOA 4JELA 3K53A 2J6HA 4KN8A 3TNJA 1WCYA 2VDKB 2MSNA 2DJ5A 1UMCB 2Q6LA 2X40A 1PTJC 3AERB 2L17A 3G2MA 3SXUB 3UA4A 2I03A 2O3SA 4OHYA 3ZVLA 5SY6A 3SR4A 2JAWA 4FOTA 1XWWA 1WDMA 1N75A 3HCBA 3I4CA 3RS0A 5HQTA 1ZK2A 3KLBA 1M2FA 2TMDA 3PX2A 3VJLA 4OB7A 1I9CA 4QJ4A 4ZT6A 3EZ2A 2J08A 3K2IA 1Y6FA 4NCHA 4P3XA 4CEIB 4C7OA 1C30B 1R3UA 3O9MA 3F5DA 1FNNA 2ECFA 3ESYA 3I9V6 3ROZA 3N2KB 3PXAA 3HJTA 1KSJA 1YULA 4ENVA 5PGMA 2PBFA 5CNMA 1QV6A 1THZA 3CXRA 1H8ED 5FI1B 1K5HA 2B99A 4AX8A 5B12A 3K1AB 4EY5A 4WEQA 3T5TA 4GBED 1PLJA 3N7AA 1PR9A 3MCTA 3PGJA 4JI0B 2NV6A 1SK9A 3KC2A 2XT0A 2RAVA 4DHWA 3UICA 3PPXA 4H6WA 4N03A 2AX3A 4NOMA 1UWKA 4F4UA 3A7DA 4BHTA 4NQZA 3BHIA 2BDEA 4J07A 4GU5A 3BC1A 3C87A 4N3BA 1HL3A 4NICA 3FOFC 2CD9A 2CLIB 4Q7MB 3PVCA 4KG7A 2J3KA 3D8HA 2FEPA 1PGJA 1EX6A 3PUVA 4BO8A 1PZEA 2VQSA 1M33A 4IF4A 1PJTA 2APJA 1RR6A 1PTKA 1NM5C 2EBHX 2Y4OA 3SQXA 4AI6A 3NV7A 4CKCA 3LV8A 1JEEA 1IM5A 2BKXA 1UKZA 2JIMA 3BF8A 4LJ4A 5DWQA 3UMGA 3UMCA 5HR5A 5JY1A 5IKMA 4S05A 3CRZA 3IHLA 2ZDQA 3K8ZA 4IIBA 4RV9A 2JW5A 1LU9A 4PIVA 3ZKAA 5C81A 3K70D 1P1FA 3C7CB 1CDDA 2CJWB 4YRQA 1DC6A 4AN4A 4MRMB 3AILA 4ED9A 1OA1A 4GXNA 1ATZA 1WLSA 1X8JA 1XHLA 3SDZA 1P2UA 1KI3A 3C8ZA 3TKYA 4JIGA 1JP7A 1YIDA 3O73A 5IT0A 2UXDB 3BFVA 5I47A 1E1QD 2QPAA 2BHLA 3K20A 1NSTA 4NEQA 3U19A 5B1HA 5J2UB 1S01A 3TE7A 1WKCA 3RSLA 1E9BA 1DGQA 3DONA 3CM0A 4MINA 5AI5A 1UEIA 2PMEA 3D3NA 3C7TA 4OQMA 2ODEA 4RA6B 2Y9MB 4WKOA 1I7LA 4GPBA 1EK5A 4ZOAA 1AA9A 2FEOA 1PR3