4KWHA

The crystal structure of angucycline c-6 ketoreductase lanv with bound nadp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
GNLTGKTALVTGASRGIGRAIAEKLGYAGALVAVHYATGADAAAEVAESIEKDGGRAFTVKAELGVPGDVDVLFEGLERGLKERTGATDLDILVNNAGVMAMGAPEEVTPEMFDRMMAVNAKAPFFIVQRALSVMPDGGRIINVSSGLTRVASPDQVTYGMSKGALEQIALHFSRHLGSRRITVNSVAPGSTDNGSALFQIPEVRETLSQLSTFGEVAEPAAIADVVAFLASEDARWITGAFIDASGGTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reductase homolog
publication title Structural and functional analysis of angucycline C-6 ketoreductase LanV involved in landomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces cyanogenus
molecule tags Oxidoreductase
total genus 90
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kwhA00
1E7WA 1WZEA 3DZBA 3C8MA 3EUWA 3TN7A 4HFMA 1H5QA 2WD7B 5B1YA 4CQMD 4Y67A 4XYBA 3Q11A 3WGZA 1XG5A 4KOAA 2CF6A 4ZQEA 4I5DA 1BRMA 1YE3A 3GFGA 3JQ8A 4NFSA 4PLFA 4GBJA 3VHRA 4FDAA 2JL1A 1YL6A 4ZRMA 5K6AA 1QV7A 1PQUA 1Q7GA 2JCVA 2X7HA 4XB1A 5EL0A 1ZEMA 3TZKA 3UF0A 5JY6A 3JD2A 3OSUA 2VHZA 5KCZA 4J4TA 4B79A 1JLLA 4GVLA 2W2KB 1ZK4A 3PYMA 3B1KA 1HWYA 3W8FA 3A28A 1MFPA 2EKPA 4BNMA 3B6ZA 4CJXA 1HE5A 2YFQA 3GY0A 3LVFO 3KBOA 4GPD1 5T6BA 1YDEA 3FR7A 5CDYA 4XYMA 4GMFA 4YAIA 4NBRA 1YRLA 4QQRA 3TDKA 4JNKA 2LDXA 4XGKA 3RAJA 2VUUA 1NBOA 1OI7A 3O38A 4O6VA 2GF2A 1F0YA 1U8FO 3E5MA 4TKMA 3CMCO 1X7DA 3DBHA 3D3EA 3ITDA 2JJYA 1P0FA 3V2GA 5COQA 3AFNA 1HT0A 4I08A 3ZU4A 2FN7A 3C3XA 5DDIP 4FJ1A 4J6FA 4F6CA 1CF2O 3DZJA 3VOSA 4FBGA 1BHSA 2RH4A 5L95A 1P1IA 1GCUA 1TXGA 1HDXA 5T64A 1SCUA 3I9NA 1KVRA 1VL6A 2NU8A 2HU2A 5ES3A 1XEAA 4CLDA 2HJSA 3PYXA 4DA9A 3DMYA 1ISIA 3EZLA 1H9BA 3I5MA 5THKA 3H8VA 1LDGA 4WJZA 2ZCUA 1MV8A 4BNUA 5JXWA 4CM4A 1Y8RB 1ONOA 1HTBA 4FW8A 1K6IA 4DLBA 3F1LA 3PK0A 4YCAA 1CRWG 2WMDA 2JFGA 2YHIB 5TS3A 1I10A 1DPGA 2NTJA 4R54A 4TWRA 2R00C 4CMBA 4E30A 2FR8A 4I5EA 3ZNOA 1ZW1A 4Y9DA 1UP4A 3ZWNA 4II2A 1R4MA 3T4XA 4DBZA 5A06A 3GQVA 1C1DA 1FDUA 2FP4A 3O4RA 3C1TA 1QLJA 4EDFA 4YAKA 1PS9A 1UXJA 4A73A 5FWNA 3KHUA 1MC4A 3RC1A 3ICCA 4G5HA 4A7PA 2D5CA 4E2XA 3QVXA 3PHLA 4FC6A 1I24A 4BQRA 3GEGA 3LK7A 1EVZA 3AI3A 1BMDA 4K1LA 4ILKA 2BFAA 4NMHA 4LGVA 2ZYAA 3ENKA 5FI5A 2D2IA 4X54A 4J0FA 1YOVB 1TT5A 1ZZEA 1U7TA 1ADFA 3TL2A 4J16A 3ZCXA 2WE8A 1ADBA 1T2EA 4YTEA 5CFZA 1YB5A 3TFOA 1C1XA 3AK4A 2PH5A 1K3TA 3LQFA 3VPXA 4DL9A 3D3WB 3H9EO 3Q1LA 2X8LA 4J3FA 4BQPA 3FR8A 3TPCA 5I7FA 1PX0A 4NNJA 1QYXA 3WGGA 1GUFA 3CE6A 2FR1A 1T24A 3GMSA 3PRJA 2JKVA 2VHYA 1QLHA 3IOYA 2G76A 1PZEA 3S2FA 2J3IA 3CXRA 1H93A 1LRKA 3COSA 4WLOA 1P1JA 5JAIA 1OFGA 4WCFC 3I9KA 3FPCA 1ZCJA 3B20A 4PLTA 3BMCA 5G4LA 4C7JA 4HNGA 3JYLA 2EP7A 5ICMA 5KKCA 1E3JA 2DC1A 3HDHA 5T67A 3T7EA 3HQ4O 4GKBA 1Z75A 1LSUA 2PY6A 1E3IA 1P1HA 1NWCA 5JDIC 4YJHA 4XJTA 4MVJG 5K0ZA 4ALJA 2V7PA 2JHFA 2EGGA 3D0OA 4OYRA 3WGTA 4M89A 3HB5X 3FBTA 1PQPA 4RLHA 2WEKA 4CMCA 1TI7A 4B4WA 5A9SB 1H0KA 3JD1A 2GN6A 1LSOA 5JC8A 3RFXA 1E6WA 5HRUA 2QZZA 1V6AA 3FF4A 4RDIA 3P7MA 5L4LA 4RQUA 3C7AA 2W90A 2Y1DA 3U4DA 5JC1A 3PZRA 3WQRA 2RHRA 1GZ6A 4IY1A 2O3QA 1MLDA 1U4OA 3JQFA 3Q2KA 3R3JA 1I0ZA 3LDHA 3GPIA 2YQ4A 1AE1A 1CETA 3GVIA 2Q3EA 1Y81A 4D41A 1Y1PA 4NDNE 4OKIA 4NIMA 4HX5A 1UUFA 2QIOA 2VYVD 3IC5A 4ZJUA 1JW9B 2PLAA 3Q6IA 4GGOA 4DC1A 3JSAA 1R4NA 3RC2A 4FOOA 2EJWA 1E0DA 2PGJA 2V6MA 3DZIA 4CM9D 4E21A 3LC2O 2GD1O 1B7GO 1UXHA 4J1QA 3MCVA 2P9EA 2IDZA 1ISGA 7ADHA 4CLRB 4UVGA 4WGGA 4E12A 4S1VA 4Q3EA 4E5YA 4BNIA 5JS6A 4BB5A 4D7AA 1SOVA 3E18A 3ZNQA 5ENVA 1QMGA 5DCYA 3AI2A 2Y0DA 1J4AA 1WXDA 3PGXA 5IFLA 2O4CA 2JHGA 2FZWA 1F14A 4Q3DA 1PSDA 3EYWA 1BVRA 1P77A 1GEEA 1EUZA 1X7HA 4MP6A 1BXZA 3CTMA 4J2OA 4R3NA 4E5NA 3WGIA 3UW3A 3D4PA 1HF3A 4DIBA 4B8ZA 5DOVA 2D8AA 3NYWA 3HADA 4IUYA 1LTHR 5IDQA 4ROSA 2ZB7A 4HFRA 4B7UA 1S6YA 1I3NA 4JJIA 4IBOA 4IGFA 3ZDFA 1T2AA 2P4HX 4JIGA 2QG4A 4NJMB 2AEFA 4CR7A 4Q3CA 1AXGA 2GN8A 4XCVA 2Y0EA 5HBRA 1V3TA 2CVZA 3KB6A 3TZQA 1H6DA 2QRKA 5TJ9A 2DBVO 2ZB8A 3GC6A 3VZSA 1F8GA 4BB6A 3KETA 1EVJA 2GN4A 3UICA 4DLAA 4EYEA 4CM8B 4YJDA 4MVJM 4R51A 2GLXA 1G0OA 3QQPA 5CDGA 1RM3A 1VSUA 2X5KO 3KRTA 4XIYA 4NR0A 1GYRA 1ULUA 2I6TA 3TF5A 4UUMA 5FF9A 3UCFA 1DRVA 3FN4A 4CM3A 1IY8A 4DXHA 4JCOA 4DYDA 3DMTA 3UFXA 5CHEA 4BO9A 2EEZA 2HK9A 6ADHA 5B37A 3HZZA 3BMOA 1JDJA 3GAFA 5JFOA 3U09A 4A5OA 2VRCD 4CQLA 1ML3A 3GMDA 1UDAA 3WIEA 1O8CA 5JLAA 2NU7A 5G2OA 2PKQO 1ZSVA 2A4KA 3JQGB 4FJ2A 4ESOA 1P44A 4GAEA 3VDRA 1I33A 1MXHA 1AGNA 3L6OO 4W7HA 4UREA 1QXSA 3JQBA 2Q1UA 3MJVA 3PP8A 3K6JA 3GG9A 3NDIA 1HDGO 3I3OA 4JGBA 3HDJA 1MUUA 1QYVA 1P31A 7MDHA 4KDEA 4JJFA 3PI7A 4N5NA 4B3HA 4GWGA 1LRJA 1LUAA 4IDCA 1NQTA 1IZ9A 1O9BA 1GQYA 2Q2WA 5IDXA 2X4GA 4CMIB 1PTJA 2P5UA 2Q50A 3Q0EA 1H94A 2W98A 3A06A 4LMRA 3VZPA 4ZU3A 4CLEA 1PJ4A 4DRYA 1MGOA 1D3AA 1C0LA 2YUTA 4HNHA 1C14A 2FPPA 3VZRA 4IINA 5JO0A 3RBZA 3JQDA 4CPDA 2J5RA 1CWUA 5DBGA 4CUJA 4DTIA 1Y9EA 1ZBQA 1ZSNA 3B1JA 1DC5A 4IXTA 4J4HA 4RPKA 3IL2A 3WQQA 3U4IA 2JFHA 3JQ9A 4J90A 5KTKA 1HYEA 1R37A 3KYBA 4QSMA 3L07A 4EGFA 4IQGA 1E1LA 4UVHA 1WDLA 4NG5A 2GASA 4E32A 3VH4A 1YONA 3RASA 1VE9A 5JE8A 5EN4A 4L4XA 2EF1A 1KYQA 1JA9A 4CM6A 3B1FA 4U5QA 1DEHA 1U1IA 2AQIA 1ISJA 2QRJA 3QWHA 3BTVA 3IP1A 1QR6A 2VT3A 1X0XA 1PGQA 4PG4A 2Q45A 2ZTMA 3DHEA 2UV8A 1XDWA 4U6SA 3JYOA 3BHMA 4FQ8A 2QX7A 4AJ4A 4IQ0A 5JYEA 2G5CA 4ND4A 3H7AA 1SB8A 1KEVA 3H9GA 2ZK7A 3AW9A 4J4BA 3RD5A 3UCEA 2B5WA 1HYHA 3KO8A 5B12A 2O7SA 5U9CA 1A7KA 4H15A 4P22A 4JXKA 1NYTA 2O3JA 5FI3A 3ANMA 4FIZA 1KERA 5KJ6A 3GF4A 4RORA 4AJHA 3OJ0A 1ARZA 3WOHA 4IM7A 4MVJD 3U5TA 4I9HA 2UUPA 4MIEA 1Y8QA 2P91A 2CSUA 1GV1A 1ZNQO 4TVBA 1UZLA 3EGOA 5CDUA 3HB4X 5AVOA 3UVEA 2PA3A 2BLLA 1ZMTA 4GVXA 1G1AA 1R12A 2WD8A 3ETEA 1IUKA 4AJ2A 3DWFA 3V8BA 4FFOA 4H3VA 1TB4A 2W4QA 2O4UX 1PJQA 4YJGA 1SNYA 3OQ6A 3RUHA 5CG1A 1YQDA 2X1HA 3EC7A 3E6AA 1J0XO 3ITKA 3M6IA 2E6UX 1TVEA 3W6UA 1U9JA 4MINA 1CEQA 2VNSA 1X1TA 4PCVA 1NR1A 4F6LA 2WSBA 2O2SA 3DBRA 3ZV4A 3F6YA 1ZIDA 4XJSA 3ZNNA 3D64A 5KJFA 1Z74A 3VZQA 1G0NA 1A72A 3INRA 1NHWA 4OQYA 3RI3A 1VI2A 4R4JA 2VCYA 4IIVA 3RFVA 3ULKA 1T25A 1N92A 1FDTA 2CNBA 4S3MA 2YYYA 2HUNA 4PLZA 4XGIA 1NPTO 3VPHA 3WGQA 2HMSA 5JYDA 3W8EA 1BXKA 5DZSA 1TT5B 1WW8A 3H9QA 5HS6A 3U62A 1DHRA 4BKOA 2GZ2A 4U0KA 2RH8A 5TGDA 4Z6KA 3KLMX 1X14A 4XQGA 3E03A 3WG9A 1C1XB 5BSGA 5MGBA 3QP9A 1RM5A 5JMWA 4PG7A 4WCDA 3JQAD 3E8XA 2CZCA 4XB2A 3QVOA 1NX6A 2OBNA 2O48X 1YQGA 2NNLD 5JCJA 1Q0LA 2HK8A 4XZ3A 2VHXA 3JQCA 3D7LA 4FB5A 3VPSA 1ONPA 2V6BA 2XAAA 3LLSA 1I01A 2I9PA 5L7TA 1NTOA 4GX2A 1SB9A 3ZHXA 5BNTA 3VPGA 3WFJA 2LDBA 4A2CA 4BO6A 4L4SA 2NADA 5ICSA 1E1KA 3GRKA 3HDYA 3ZW8A 1DLIA 2C7VA 2RBEA 3IKVA 5ER6A 4N5MA 3MZ0A 2BHLA 4BMVA 5IZCA 3TZHA 3H2ZA 4NFYA 4PLVA 2EERA 1DDOA 4YQYA 1EFKA 3H5AA 4FS3A 4W99A 3RUFA 5MDHA 2GDZA 3LT1A 2D59A 1R15A 3R6DA 3U0BA 1UDCA 5F1OA 4EUFA 2EGHA 1DB3A 4GMGA 1ZK2A 3GGGA 3F47A 3VVCA 1CDOA 4AICA 4ZICA 1SAYA 3HUDA 1LDEA 3GVPA 4YYZA 3M2PA 2D4AA 1NFFA 2I3GA 3RVDA 2WYVA 3GHYA 5CP8A 5KJ1A 4CL3A 1PGJA 1HDOA 5KWEA 2X9GA 4K28A 1PWXA 3NTRA 2NV6A 2Z95A 4EJ6A 4GH5A 5B4UA 5K6AC 1PJLA 3CINA 4BNVA 2Y1GA 4WLFA 3TZCA 3EHEA 2VOJA 3GEMA 1UDBA 2J3HA 2YV3A 3DAGA 3AOEC 2AA3A 3S1LA 4D42A 1T2CA 3D1LA 3UKOA 4IZIA 4DVJA 1FK8A 4PLPA 4TRRA 4TZKA 1Q7BA 3W8DA 3NT2A 4UVEA 4ZGWA 5JNLA 2B0JA 1T1SA 3WYBA 1R4NB 3QJ5A 1B0AA 4IMRA 1MG0A 4PG5A 4RPHA 4ALKA 1DRUA 4Q3NA 4GLLA 1WLYA 3OQBA 3V1TC 1VM6A 2P5YA 1HSZA 5A5FA 4DQVA 3WNQA 2IRWA 3FWZA 1XSEA 1I3KA 4RO0A 4XQEA 3KYCA 4TMFA 5BT9A 4D3DA 4PZCA 5IN4A 3NGXA 1PZHA 1GAEO 3K73O 4QO7A 1GFSA 4QFDA 1AN9A 3CSDA 1BXGA 4DQXA 4TRMA 3HG7A 3H3JA 2SCUA 4BO0A 4CUKA 1K6XA 2IZZA 4JBGA 4EEZA 4JBHA 4CM7A 1LEHA 4DGSA 1D7OA 1ISFA 1GPJA 2D3TA 3TNLA 3ZGYA 3FTPA 3UXYA 4EI2A 1XHLA 2OUIA 2FOIA 2AXQA 2X0JA 4BO7A 1MP0A 4LRSB 1DJNA 1O94A 1YL7A 4HADA 1ENPA 4BO1A 3DL2A 2EW2A 1PJCA 1LQTA 3RCBA 1U2GA 5C37A 1LC3A 3BZUA 2C82A 4MVJP 4O0LA 1LI4A 3EK2A 1BW9B 5I7VA 1CQJA 3DR3A 5CPBA 2H5LA 5G4KA 1V3UA 4DBVO 1T4DA 1A71A 4ZQGA 1XA0A 1JVBA 3MOGA 2P2SA 1EMDA 1Z7BA 3U49A 5L3ZA 1I32A 4BNXA 5ITWA 5TLSA 2CFCA 2GUGA 1YQXA 1NPYA 3L0DA 4J2HA 5TSDA 3H9UA 5JY1A 1IB6A 4YT8A 3QVWA 4IXWA 4WK6A 3PWSA 2B83A 5U1PA 2BGMA 3PYLA 1EUCA 3O26A 5H82A 3ABIA 4H16A 3OH8A 3AWDA 2CD9A 4QUKA 3DONA 1EZ4A 5EERA 4WUVA 2OP0A 1BTOA 3KYDA 3WFIA 3DTYA 1ZMOA 2HMUA 1W8DA 3PGJA 5L4SA 1KVTA 4DPMA 2DU8A 1MX3A 4CQLB 4R1UA 5I8WA 1QV6A 5BSHA 4P8RA 3MJEA 1HXHA 4XDZA 3WXBA 1O95A 2Q1TA 4UUOA 4AL4A 4KUGA 5G0WA 4UUNA 3A4VA 3BAZA 3DHYA 1GY8A 2QHXA 2RAFA 3ROMA 3SC6A 1N7HA 3PIDA 1H2BA 1NP3A 1AXEA 2CUKA 2VZ0A 2G1UA 1E7MA 1PJ2A 3A1NA 1YBVA 3PWKA 4OMUA 1T2DA 1QKIA 4CLOB 2NU6A 3ZHBA 2I66A 2FSVA 2VNAA 1PGPA 4W7IA 3RWBA 2O50A 1J49A 2Y99A 4XKJA 4E33A 3NX4A 2HLPA 4BNKA 1YKFA 4IJWA 4U7WA 1EE9A 3ZV3A 5EPOA 2O2YA 4LSMA 1PIWA 4Y6RA 3MJCA 3K9QO 4JK3A 5IDYA 5A5EA 5JCXA 1U5CA 2VHWA 1A4IA 4PLHA 4E2YA 2VWHA 4MKXA 3H5RA 1VKNA 3VTZA 4B7XA 5T8KA 4TSKA 1B14A 2R2GA 2D1YA 2Z1MA 1NQOA 4ND1A 4NZ9A 4RF5A 4BGEA 2X0IA 3DO5A 5GMOA 1XIVA 2FHSA 4O63O 2V6GA 5A1TA 4WEOA 4RZIA 3E9QA 4RF4A 3Q9NA 1NASA 3P2YA 4Q3AA 4AJNA 2PWZA 3AJRA 2JD0A 3NGLA 3ZI0A 5B4TA 4CMKA 4L76A 1HZZA 3OM9A 4Q9NA 4CLHA 4EW6A 3BXXA 1SBYA 4OQZA 3ROPA 3MJSA 3AU8A 2VHVA 1ZXBA 1E1MA 4W4TA 1ORRA 4XYEA 1W4ZA 1VJTA 3HDQA 3C7DB 4RJTA 3ZWOA 3D5QA 5IZ4A 3G17A 2IZ1A 4IDGA 1VSVA 3TJRA 4XWYA 1EBFA 3LC1O 4YA6A 3S2IA 3ZU2A 1B3BA 4DIOA 3TSCA 4AJKA 1KETA 3O03A 1F17A 4WPGA 1D4FA 3WLFA 1B16A 2ZJ0A 3C1AA 5JAQA 5CEJA 1ZXLA 4G81A 3GK3A 5KJEA 3W1VA 4RVSA 1WDKA 5J23A 3GRPA 4CQMA 3ZU3A 1ISMA 2Y68A 3C7CB 3WYEA 1BG6A 2H1SA 2NSDA 3AM5A 4CUZA 2DM6A 3IDSA 1U8XX 2YV1A 4AVYA 3PFWO 3GEDA 1N9GB 4HBGA 2Q99A 4XYGA 3H2SA 1BGVA 3GAZA 2O3TA 3GVXA 3U3XA 1MFZA 3QA9A 2H63A 1GD1O 4OL9A 4GX5A 2PTGA 2CMDA 4RVFA 4AFNA 3WJAA 3RJ9A 4ZQFA 5DULA 3ONEA 2AEMA 3STHA 4DWVA 4OJNA 1PQWA 4BHTA 2IYPA 4PVCA 1YB4A 4BO3A 3PXXA 8LDHA 3AOGA 5C7IO 4FPXA 4ZRNA 5L53A 3MOIA 3RUEA 3V5NA 4KQWA 4LSWA 1Y5MA 3JD3A 5G0TA 4C7KA 4AJPA 3ZNPA 4BNJA 1P1RA 3G1UA 1NNUA 1DC3A 3S2EA 3ZU5A 1HE3A 2VYND 1YWGO 2PR2A 1KC1A 2UAGA 2FPGA 2VWPA 3KEQA 4JP2A 2DPHA 1DFHA 3AY6A 1H6BA 3GVHA 3I9LA 4FFMA 3WBFA 5A03A 1S7CA 5JDCC 1Z6ZA 1X1EA 3IUSA 2NWQA 1OOEA 1RYEA 1T1RA 1ULSA 3NV9A 4BNLA 5CPFA 5ADHA 4YJFB 4BV8A 2GZ1A 2VT2A 3FTNA 3BMQA 3GNTA 3JQEA 1LLQA 3JQ6A 3DB2A 4AJJA 1GYQA 5ILGA 4WCFA 3QE3A 2DFDA 3GUYA 4Y8VA 1W0CA 1ENOA 3DMTC 2X9VA 1B8PA 4LRTB 4DYVA 4LCJA 1EEHA 1KIFA 1U3VA 5THQA 2XF8A 1OBFO 1T26A 5COBA 4D43A 3QSGA 4ALMA 2PFGA 1RKXA 3JQ7B 4CM5A 3RU7A 4PG8A 4L0QA 1MB4A 4GI2A 3MWEB 4BGIA 4QO8A 3FRJA 2BH9A 5JDIA 3CUKA 4XEHA 4IDBA 2C20A 2C5AA 3C85A 1PS0A 4M87A 1U28A 4M8SA 2EKQA 4IJKA 1NAIA 1KY5A 1O6ZA 3DOOA 3RUAA 3ICPA 4JQCA 3X2FA 4RVHA 4ZN6A 2WD7A 4F45A 2GCGA 2HQ1A 1Y9AA 2HMWA 2FSSA 4OM8A 3VDQA 3JQBC 3MTJA 3L4SO 4ZHSA 5IJZA 3GR6A 4ITUA 4RF2A 3O9ZA 2OXIA 1GL3A 2UUOA 1YJ8A 2IXBA 3I9MA 2G0TA 2GGSA 3P19A 5JPIA 3UOGA 4L4RA 3I1JA 2VWGA 1PZGA 3SJUA 3F1KA 5DCWA 3INTA 5HM8A 2VRBA 1XLTA 1VL8A 2ZTVA 4MJLA 4BNTA 5F5NA 2YDXA 4QTZA 3FNHA 3DFUA 1SO8A 2GNAA 4OIMA 1VRWA 2DUUA 1HE2A 5C5IA 3JV7A 4B4OA 3O8QA 1ZH8A 1E6UA 1P0CA 1OZAA 4BKRA 4EUHA 1QG6A 3NEPX 1PZFA 5H83A 3S55A 4E5KA 2AG8A 2A35A 4J43A 3K5PA 4XQCA 3PZBA 3JQ9C 4TVOA 3L4BC 4PFJA 2ZYDA 2YV2A 3SC4A 2I65A 4PVDA 1IPEA 1LXCA 1E3LA 3TWOA 3V1YA 3E5RA 3CIFA 1L1FA 1TEHA 3GOHA 4Z0PA 2TMGA 4XIJA 4XR4A 4II3A 4OSOA 4NBVA 2Q4BA 1HYGA 4E5PA 1WWKA 3DTTA 3UUWA 4NU6A 1PU2A 3CEAA 3OJOA 1YBMA 5A05A 3OHSX 2PD4A 2NVUB 1UXGA 3DFZA 1YO6A 1HDYA 1CJCA 1YGYA 2AQHA 5BR7A 3F9IA 3EDMA 3DOJA 5A9TA 2DBZA 3LC7O 1JKIA 1UJMA 1XGKA 3KVOA 2IZ0A 3V2HA 3DZFA 3HN7A 4OH1A 2DT5A 3OA0A 3VPFA 2QYSA 3ZW9A 2ZQZA 1E3WA 1JWAB 1FDVA 4D45A 4UAGA 1QP8A 2Y67A 5G0VA 1HLPA 1Y8RA 2X6TA 2P9GA 2P9CA 2E48A 1OC4A 4I5GA 5G0SA 3H3FA 3MJ4A 4R68A 2YHIA 4R16A 4PGFA 2J5QA 2ZKLA 4HV4A 4NU5A 4A26A 5JBIA 4NBWA 3ONFA 1Q0QA 1SMKA 1WMAA 3WGHA 1BDBA 5LDHA 1X13A 3JQ8B 4L75A 3DAFA 4PLWA 4FD3A 3QLJA 2NM0A 1I2BA 1D1TA 1E3SA 1GEGA 4BV9A 2OMEA 2YDYA 2NU9A 3PPIA 4YR9A 2GERA 2VYVA 5DNAA 4R1SA 4KUEA 3EMKA 3PHGA 1DIAA 3NJ4A 4BNFA 1PJSA 1H2HA 1EQ2A 4YDRA 3I9OA 1XQ1A 5G4KB 5TNXA 1E77A 2P4QA 4EBFA 1H6AA 3PJFA 1KVSA 3ADPA 4L9RA 2O3SA 4O59O 4BKUA 5CAEA 1YOVA 1LX6A 4LVUA 1LLDA 3DZKA 4QXMA 3RBVA 4ALIA 4UEJA 5EMHA 1CQIA 2WJPA 2A94A 4MKRA 1U3WA 1QYCA 1FJHA 3D3WA 3KV3O 1U7HA 5JSFA 2EJVA 3LF2A 3KLPX 4W9NA 3DBHB 3I52A 1CIVA 1BDMA 3CPSA 1ID1A 3PFFA 3PIIA 5TC4A 4XD2A 3ZWVA 1V35A 3PLRA 4R69A 3BA1A 3I4FA 2PH3A 4B8WA 3NRCA 2X58A 3ON5A 2QZ9A 1U5AA 3OP4A 3H5NA 5C7OO 3WLEA 3HFSA 5EQFA 4B4UA 4Z0HO 3AUSA 2X23A 3LT0A 4MKZA 3RFTA 2OFPA 4OO3A 2W2LD 4K9DA 1ZO8A 3RUDA 3KOUA 3NTOA 2QRLA 4O5OA 2G82A 4OKNA 2ZQYA 3OQ1A 1HDZA 4J1SA 4CODB 3TZ6A 4CM4B 1NM5A 1K89A 1LBEA 4Y6PA 1EVYA 4FFRA 4J1TA 4YRBA 3RJ5A 1I2CA 1A4UA 1J6UA 1TA4A 4QFCA 3QY9A 1V8BA 5A9SA 4DIFA 2C5EA 3G1TA 4CMJA 3AUAA 3EZYA 4GLOA 4NK5A 1R4MB 5FYDA 2DFVA 1C1DB 4M1QA 4OOEA 1EK5A 3RUCA 4DUPA 4PZEA 5KVQA 1Q1NA 1TLTA 3E1KA 2BFPA 1M75A 4YT2A 3HSKA 2QYTA 4RLSA 1P3DA 2FMUA 2HMTA 2Y93A 2VRCA 5TF4A 4U8GA 5EJ2A 5AXDA 1DO8A 4D79A 2Y05A 3GDGA 5IZCC 1B8UA 4UULA 4KDFA 4R5HA 4Z9YA 1A7AA 4D46A 2YZ7A 3TFQA 1QYDA 2B4TO 1G6KA 4QECA 4E2WA 1I8TA 4R01A 3HHPA 1Y5RA 1M66A 2FZEA 5IXYA 1HDRA 2E49A 3GG2A 3UGKA 5AXCA 3KSZO 4R9SA 4ZVVA 4J1NA 1ENZA 1RM0A 2ZCVA 3OIFA 4CLRA 3K31A 2VZ9A 1B15A 5KJCA 3NT4A 2TMDA 4YRAA 2BGLA 3TL3A 4CMEC 4AG3A 4RV9A 1JTVA 2BD0A 4BNHA 4J9UE 1XU9A 3OFSA 3N74A 2BFOA 2HCTA 2JAHA 3CZMA 3R3SA 4MVJE 3MJTA 1FDWA 3RQSA 3WBBA 1ZK3A 4OAQA 1ZJZA 2JCXA 1XELA 1NQAO 4JJGA 2WE7A 2PK3A 3ZWBA 1MG5A 1IE3A 3KSUA 3N7UA 2O23A 3AU9A 2CF5A 2PGLA 4KP7A 3F46A 3HJAA 1NWHA 3EY4A 4WLNA 3HWRA 3BMCB 1KBZA 4YRDA 2PGDA 1UH5A 4CQMB 3VH3A 2BKAA 2VOEA 1LSSA 4Z3KA 4HKTA 2JCYA 4NJMA 3GN2A 3DAPA 4KTTE 2AQ8A 2B36A 1EDOA 5HA5A 5KNLA 3QVSA 3JYPA 3QHAA 4MDHA 2F1KA 3FNEA 4YJHB 3W6ZA 2I3AA 5I9LA 1W6UA 3AY7A 4J9VA 4PZDA 3GZ4A 4YAGA 3GH3A 4E4YA 4AJLA 3LLVA 2I76A 4WECA 4OGWA 3W4JA 4CM8A 1Q0HA 1NQ5A 1K6JA 3X2EA 1LLUA 3IJRA 3SLKA 4IDFA 3GUCA 5I8ZA 4CMGA 2X86A 1R0LA 2B4QA 4DREA 2VTDA 3MTGA 1DLJA 1M76A 1HSOA 3VAZA 3QW2A 2WDZA 3FBGA 4BUCA 4CMAA 2YQ5A 5ILOA 3GFBA 4RDHA 5LC1A 5T57A 3RUIA 2B4RO 2BI8A 4P4NA 1GU7A 4WE3A 3D4OA 4KTVE 4IPTA 4FGWA 3K30A 4K6CA 4HFNA 2PZJA 2Y1CA 1PEDA 4JLWA 1KVUA 4E3ZA 5T5QA 2Q2VA 1KY4A 3INGA 2W8ZA 5H81A 1DIRA 3RSHA 1JQBA 1WPQA 3DQPA 3JQGA 3BHIA 2XXJA 1NVMB 3C1OA 1E7SA 5A04A 4CL8A 4IDDA 2DUWA 1PL8A 5A02A 1O89A 4BGVA 5KOIA 1JVSA 4ZD6A 5CEFA 1U2DA 1GQQA 1I30A 1ONNA 3LT4A 1ZK1A 1ZK0A 4FR5A 4MVJA 3H9JA 1WP4A 2EXXA 5BNIA 3GA0A 2RHCA 4FFPA 4UVIA 4W6ZA 1UZMA 1FDSA 2AW5A 1XR3A 3AI1A 2GZ3A 3KEOA 3ZWPA 2I67A 3PQDA 1M6HA 1R0SA 4FCCA 4B4VA 4PLCA 5ER9A 3OIGA 3CMMA 1Y7TA 1GR0A 4CMIA 2E4AA 5GY7A 1NHGA 3DXFA 3LT2A 1E5LA 4N54A 1D8AA 3IAHA 1N5DA 3GLQA 3UH1A 1DFIA 3ENNA 1I2ZA 1R0KA 4NQZA 5I9MA 2I5PO 2BELA 2NVBA 2ZTLA 5IDWA 2X5JO 4CR8A 1HL3A 1XYGA 1YH3A 1TT7A 1RPNA 2PNFA 4Q39A 4D3SA 5AQ1A 2A92A 2YHUA 3GZNA 1ZJYA 1HLDA 4MPDA 2EHDA 2Y1OA 2QW8A 1LJ8A 4Q3BA 4WNIA 3MEQA 3IKTA 2CDBA 2YW9A 4U6QA 4WKGA 2HSDA 3PVZA 5KKAA 4Z9XA 3ZWMA 1HDCA 2R6JA 4J7UA 1U4SA 1P1KA 2B37A 1DAOA 1PJ3A 1Q7CA 1PR3A 3AOEA 4KWHA 2EV9A 5TT0A 3ST7A 5TRTA 5A4DA 1EBUA 1NAHA 3PQFA 4WOKA 2IEBA 3GDFA 3SVTA 3I9JA 1DIGA 4NPCA 3HFGA 2XXBA 3KM0A 3IUPA 5T8KC 3RU9A 1VL0A 2UYYA 3ADOA 3OBBA 4XRGA 1NFQA 3O8QB 3BMOB 3ZWXA 4NBTA 4YAEA 4FGSA 1WAMA 5DBIA 3BIOA 3JQAA 4L8VA 4R41A 3V1UA 3LSYA 1R6DA 3R0IA 3DDNA 3QRWA 1IULA 4EUEA 1LLCA 1UR5A 2V65A 4CV0A 1F06A 3V2UA 2NVWA 1DHTA 3M1LA 2G17A 4WASA 3G49A 3OICA 3BMNA 1U3TA 1NR7A 5GZ3A 4OXKA 4N7RA 2WM3A 1SC6A 3RROA 5KVSA 2DVMA 4EJMA 4PLYA 1IHXA 4QX6A 3OJLA 3WWZA 2GRAA 4PRKA 1I36A 1QORA 1JKFA 1V0JA 2NTVA 1UXIA 3K2EA 5EESA 3QWIA 5DF1A 2J3JA 3PTZA 2VZ8A 1EUDA 3L77A 4FSHA 5TT1A 2Z1NA 3W4KA 4CM1A 1KVQA 1E7YA 4HWKA 4BO4A 1LNQA 2FY8A 1IHYA 3M1AA 1SEPA 4IDAA 1IPFA 4LK3A 4AJOA 5DP1A 1N8KA 2HKIA 3PHHA 2AE1A 2VQ3A 3E9NA 1E3WB 1T2FA 4FFLA 4R9RA 4RPGA 3NDRA 4XX0A 1ZFNA 3WJ7A 2DTEA 3OETA 4TRJA 4Y98A 5EINA 1QYWA 3PDJA 4D0SA 1GV0A 3AUTA 4KUHA 3QWFA 3TOZA 4E31A 3GT0A 3VVBA 1KS9A 3ZWYA 1QRRA 3I23A 3DEYX 4C4OA 3EAGA 3QVTA 4OHUA 3U4HA 3K92A 4NHEA 5F1PA 3F5SA 1MXFA 1GQ2A 2I99A 1GTMA 1NVGA 4DMLA 4J91A 3H4VA 1F8FA 2HAEA 4ZQBA 3ROKA 4GX0A 4JROA 4PLGA 3NUGA 3RBXA 4RPLA 2PD6A 4Z3DA 4N18A 3ZV6A 4LMPA 2GPTA 4M54A 3UN1A 1C0IA 1M6WA 2WTBA 5TIIA 4M86A 2UVDA 2EKLA 2Z5LA 3L6DA 4GX1A 2AMFA 4NK4A 5IAAA 3F4LA 3JQFC 4I1IA 3AFMA 2C59A 3OEYA 4BOYA 1Z7EA 2HO5A 1FMCA 3KXDA 4FC7A 4L74A 4YBZA 5LDGA 4GKVA 3W4IA 1I3MA 3GN1A 4LCEA 4Z9FA 1XWFA 3WMWA 4B7CA 2OL4A 2Q4EA 2J5KA 2J3KA 5DOZA 1OMOA 4FOSA 5HTOA 1QSGA 3I4CA 3L6EA 2NTNA 3CKYA 2X22A 1X15A 1SPXA 1UP6A 2XOXA 4G2NA 1YL5A 4GL4A 3RC9A 5JAZA 2R00A 4D44A 2Q49A 3DZHA 3G0OA 4UVDA 3GHHA 2C54A 4IS2A 1JAYA 1Q2XA 3VKUA 4NH4A 4IGEA 1N1EA 2VUSA 1B3RA 2CDAA 1N1GA 2FWMX 2BI7A 1WDMA 3OF2A 3WSVA 4NBUA 3IP3A 3PDUA 2RCYA 3DBLA 4Y6SA 1Y8QB 1UZNA 3WWYA 9LDTA 5F5LA 5K9ZA 1VPDA 1K5HA 2DBRA 2FR0A 3A9WA 3FWNA 4HXYA 4IJUA 4MP8A 1NFRA 5L9AA 5L7WA 1XQ6A 4BMNA 3ANLA 5G0UA 1RWBA 1WNTA 3M2TA 3QIVA 4MVJF 4UUPA 5F3RA 1OC2A 1IL0A 3NJ8A 4Z0TA 3RKUA 3WTBA 2WYUA 4BL5A 4CV2A 1GZ4A 4YJGB 5L7YA 3ZHZA 3IJPA 3KUXA 4FJ0A 4YB8A 4OSPA 3IS3A 4JP3A 3ROQA 2Y66A 2C29D 3WGOA 5A9RA 3DOCA 1EE2A 4CMHA 2NUAA 2X0RA 4XGNA 3DBRB 4JX8A 5DP2A 3S2GA 4YT5A 4ND2A 4EZBA 4D3FA 3ETGA 3VTFA 2JAPA 3HN2A 3IMFA 2NQ8A 2NLOA 2PZMA 3AY3A 4IJVA 2ET6A 4HFJA 2DLDA 2EW8A 3VKVA 4INAA 2X0NA 2PZKA 5A3JA 4BVAA 2B69A 1O5IA 3DHNA 4LN1A 4IDEA 3A14A 1GYPA 4BO2A 1LA2A 2Q1SA 3GVCA 4MIOA 1C0KA 4KWIA 4YWJA 4A10A 5GZ1A 4OXYA 4RPJA 1HRDA 1X0VA 4MVJI 2HJRA 1FF9A 4P4GA 1X7GA 3UHAA 4NI5A 1H6CA 4B3IA 2EG9A 3ZZNA 4MP3A 3NAQA 2B35A 2E82A 3L9WA 3JCZA 3E48A 2OP1A 1EDZA 3U9LA 2C7GA 3OIDA 3PEFA 1I3LA 2DQ4A 3EVTA 3OECA 2H6EA 4YVFA 4BNNA 4RVGA 1BWSA 1V3VA 2BRUA 1KC3A 2VN8A 2ZJ1A 4EEXA 4EJ0A 4BIIA 2C07A 4I9NA 1EQUA 1LDNA 2HRZA 5ENDA 2GO1A 3JD4A 3LZ6A 4BNZA 3P5SA 1LSJA 1SEVA 1C3VA 4UEKA 3C24A 1LU9A 1CERA 2YY7A 3CH6A 2J6IA 4LISA 1GUYA 5JW6A 1ZUD1 1E7RA 2E37A 3B70A 1BW9A 1O0SA 1LQUA 5CDTA 2W2KA 4AJ1A 3TOXA 4BNYA 1UAGA 3D5TA 3NTQA 3ETDA 2POQX 2ZB4A 3OJEA 1GPDG 4E0BA 1M2WA 4ND3A 5CEEA 1YS4A 1JU9A 5JDCA 2GN9A 2AE2A 1XCBA 4BKPA 4CV1A 3QWBA 1FXSA 3BHJA 2EP5A 2PV7A 5COAA 4E13A 3K2BA 2IXAA 4DMMA 4K6FA 3VH1A 3PJDA 1YJQA 4BKQA 3QV1A 5CG2A 4BO8A 1IOLA 4HUJA 3DC2A 1ZSYA 4OXNA 4WNCA 1PS8A 4BGUA 4XDYA 5KVVA 3AM3A 3Q2IA 5JMPA 2QQ5A 1E1NA 5L4NA 3GNSA 4GGPA 1A9YA 1GDHA 1R66A 2OOSA 2Y1EA 2NQTA 3G79A 3PJEA 2DTXA 2OZPA 4I8XA 3WICA 3SLGA 4LW8A 1JWBB 4XYLA 5C3MA 5IF3A 4RQTA 1UXKA 4I5FA 3I6IA 3MWDB 5AYVA 2BMAA 1RJWA 3HNPA 2AG5A 1RYDA 2O3UA 1VLLA 1LDMA 2ILTA 3L9XA 1SOWA 1L7EA 1PL7A 1UAYA 1A5ZA 3I83A 3KYCB 4AJEA 1DRWA 2FRDA 1DJQA 2AEJA 4CLOA 3NT5A 5EQDA 1BXGB 4W9NC 2RIRA 3F4BA 4E6PA 3DBVO 1P45A 3QWAA 3R1IA 4XR9A 3ANNA 1RM4A 1KOLA 5JCJD 3ASUA 2CVOA 3BTSA 1HKUA 3RIHA 5L51A 1HEUA 3IQDB 1IYZA 2ZATA 3SJ7A 5FEUA 1E3EA 4MIYA 3BTUA 4P38A 1U3UA 1P9LA 5HWSA 1AHHA 1EVIA 1YBAA 4F46A 5AXBA 3GGOA 1NVTA 1VJ1A 2VYNA 2YFHA 4GSLA 3Q9UA 5BSFA 2C2XA 3RKRA 2HDHA 4YAJA 3UAGA 2ZYGA 1OAAA 4IMPA 1DC4A 1W73A 4KZPA 3FPLA 4L73A 5JAMA 3FNFA 4CM9A 3GZNB 1GUZA 2PZLA 1DC6A 4G65A 3OMLA 4ZQHA 1Z45A 1YVEI 3ZN2A 5LCXA 5CDSA 3L4BA 3WX0A 1PR9A 2OBYA 5EIOA 2NACA 3EW7A 1HETA 1K2WA 1N2SA 4B3JA 3BYZA 1DXYA 2PKRA 3FD8A 5GZ6A 5DBFA 1GADO 2Q2QA 3E82A 3WNVA 1Z73A 3Q3CA 3ZHYA 4PRLA 2AQKA 1N7GA 3PLNA 4J0EA 1H9AA 4O1MA 4GQAA 5AOVA 2O7QA 4ND5A 2IYOA 2V6FA 4RVDA 4JN6B 3SBOA 3KYDB 3WSWA 2DTDA 3PHIA 3ZWWA 1P1FA 1GCOA 2YJZA 3TQHA 2OO5A 3JQAB 2Q46A 4N5LA 2OGUA 2Q1WA 1J5PA 4LVCA 3ZV5A 1XU7A 1DAPA 5F1KA 3JD0A 1V9LA 3TRIA 4YXFA 4BNWA 2DAPA 4OOFA 4BNGA 3H6KA 3UCXA 2EWMA 3BMNB 4QT0A 3JYQA 4TZTA 4DPKA 4XA8A 4J7XA 1P33A 2FPIA 4CLXA 3ORFA 4YACA 1D1SA 2O3RA 3ASVA 1M67A 5L40A 3CZRA 4YEDA 2H9IA 2IODA 2ZTUA 1N9GA 3FCOA 4QEDA 1YB1A 3E9MA 2GYYA 4D0RA 1UP7A 4TQGA 3U4CA 1Y6JA 4BS9A 4H7PA 4WOJA 1PGOA 3GGPA 4TRNA 3T4EA 2P68A 1PJBA 3ZH2A 4JBIA 1EFLA 4R3WA 3LYLA 1AHIA 1DSSG 5DCUA 5DN9A 1I5RA 4RCVA 3JTMA 1LRLA 3VH2A 9LDBA 4E5MA 3LU1A 3GPDG 4ALLA 2JD2A 4WLUA 2C2YA 3WQSB 4E2ZA 2BFMA 1HE4A 1VKOA 4U0JA 1DBVO 4NJOA 1NPDA 1LDYA 2IE0A 1BSVA 2X5OA 3WDSA 1ENYA 4PIVA 3KZVA 1E6EA 1SZJG 2Y1FA 2HK7A 4DQUA 4RGBA 5I9NA 1GZ3A 4I9UA 4R1NA 2D5AA 3F5QA 3NDJA 1T4BA 1ADGA 1YDWA 3T7CA 2ZIZA 1ISHA 1B26A 4RVUA 1MA0A 4M55A 1R16A 4M49A 3OA2A 1B8VA 4DLLA 3OJFA 4YJFA 5BQFA 6LDHA 4MOWA 5C7LO 3N58A 4WEQA 5BSEA 4K26A 4DC0A 3H65A 4RF3A 1A27A 4XQ9A 4R1TA 3AUUA 4CR6A 3PQEA 5TJHA 3PWZA 3RC7A 1L7DA 2D0IA 5DT9A 1DFGA 1ZEJA 2HMVA 4NFHA 2Y0CA 4CV3A 3HE3A 1LDBA 1Z82A 3JQ7A 1JKJA 1MC5A 1DOHA 2A9FA 3ZWAA 4TROA 3FSRA 3G3EA 1PGNA 2WWRA 5L45A 1ZVMA 5ITVA 3FI9A 2CDCA 1ZKMA 4DPLA 4ALNA 4PG6A 4ZA2A 5IN5A 5F21A 3I6QA 4MVJH 5I7SA 5IXSA 1PL6A 5TX7A 5KIAA 3D4NA 4A27A 4F3YA 1CYDA 3F3SA 4ONEA 3K96A 1KEWA 4FFNA 1JN0A 4WLEA 3WYCA 3SXPA 3LF1A 1PJTA 4KQXA 5FFFA 1F12A 2IEDA 2GR9A 3DBLB 1ADCA 3FHLA 4YPOA 2C0CA 3ZWCA 2DKNA 1YXMA 4HY3A 4XRRA 5B4VA 2OORA 4A0SA 4R5MA 3WTCA 2EIHA 1WMBA 4BMSA 3NKLA 4IS3A 1EK6A 2VTEA 3WMXA 3PHJA 3WB9A 2PD3A 2BGKA 1E5QA 4EITA 4IIUA 3IIEA 4IZHA 4WLVA 1KEPA 5A3VA 1VJ0A 2BF7A 3DZGA 4KMSA 4YQZA 4UEOA 2XPCA 4J49A 2X9NA 3S8MA 5BNFA 3BTOA 1P74A 2HRBA 1NXQA 4URFA 4J7CA 3WGYA 2J8ZA 2B5VA 3PJGA 3SEFA 3P2OA 4CMEA 4ID9A 1C0PA 3GDOA 4FN4A 4MO2A 4GWKA 3WS7A 4BO5A 1KEUA 8ADHA 1BVUA 2CVQA 2F00A 5JO9A 1B2LA 3AM4A 1DIBA 4A03A 3FNGA 2AHRA 4W82A 4HP8A 4RZHA 1E7QA 4TKLA 1E92A 3KTDA 5U4QA 1DIHA 3BMQB 1HZJA 3GNQA 5I7EA 5KVCA 4WCFB 1VC2A 2PKQP 2W2LA 1XKQA 3SX2A 2GSDA 4YT4A 1PWZA 3WR5A 3ONDA 3WIDA 1IZ0A 5IG2A 2NVUA 1LC0A 3JYNA 2ZB3A 2JD1A 2DPGA 2UDPA 2WYWA 4AJIA 4PN3A 1WVGA 2JFFA 2OHXA 1WZIA 4P4LA 1A9ZA 1JAXA 5AXAA 5HS4A 3VC7A 1K0UA 3EVNA 1AUPA 3OEWA 3KSDO 2VWQA 4IQ8A 2VUTA 3K8ZA 2CY0A 4RL6A 4GSKA 2DBQA 5TQVA
chains in the Genus database with same CATH superfamily
3G9UA 3DZBA 4ZHQB 5EWJA 1DELA 3TN7A 3R7BA 1H5QA 4HS4A 1CUZA 2WD7B 4N01A 4NMXB 1U7ZA 4LWZA 4XYBA 4CQMD 1AKEA 3BRCA 3G0HA 2VK1A 1FUKA 1T29A 3M6VA 1MAHA 4I5DA 4RADA 4HB4A 5LQMA 1BRMA 3GFGA 3DMPA 1SC1A 4IV8A 1KFEB 1W88B 3AVPA 4NFSA 5K3AA 3KB2A 3MCTA 3KT3A 4KSBA 4P81A 3NHLA 2VYQA 1YL6A 1ZWKA 2FK8A 2UYOA 2V1XA 5K6AA 4AY2A 1QU3A 4N5HX 1QV7A 1Q7GA 1WSAA 5EL0A 3CONA 3HHEA 1ZEMA 1W5TA 3N2NA 1WG8A 3CV3A 5EWMB 4KPEC 3EEOA 4RD3A 5KCZA 1M2VA 3K71B 3MM4A 1JMKC 2RGUA 1U1GA 1FYXA 4GVLA 2HWXA 4TMTA 4LY0A 1OXVA 3UOWA 2X0DA 2VDJA 3W8FA 1Z28A 1WRBA 3N6XA 4BNMA 3B6ZA 2P9YA 1HE5A 2J9FA 2YFQA 3PT5A 4C3UA 4Q9LA 3R76A 3LVFO 3KBOA 4WBNF 1SELA 4AG5A 4BAZA 1WB5A 1XCGB 4ICIA 4RACA 1SC4A 4XYMA 5ALLA 3O73A 4E21A 4YAIA 4FONA 5HJ2A 3WSTA 4XGKA 1OI7A 2D1RA 3O38A 1P81A 1IG0A 1EFPB 5DYYA 3B53X 2FWIA 1J7JA 2GF2A 2ZUBA 5ALUA 5HF6A 3CX4A 1U8FO 2JEYA 2Q3CA 2VDRB 2HF8A 3E5MA 3MGBA 5C4IA 3OQHA 4CGZA 3HO6A 1PFQA 4TKMA 3CMCO 1AOXA 4NYJQ 5LYYA 4ENPA 3ITDA 4K88A 1JB9A 4MITA 1UOEA 2VSOA 1OXMA 1YT5A 2EOAA 2Q0SA 4L5BA 4IILA 1Z6TA 4YBRA 4OD0A 5ALFA 3EZGA 5E4JA 3FLEA 1LWNA 2IV7A 3V4PB 3HYRA 5EWLB 4F6CA 1KJZA 3DZJA 4JLAA 4BFCA 1E0JA 3I8XA 1OZ0A 1HG0A 1RYHA 2OBXA 1V8DA 2VP2A 1BHSA 3QE2A 2RH4A 1P1IA 1TXGA 2BTQA 4C0XA 2P35A 3CF2A 1SCUA 3I9NA 3QLVA 3ONNA 2WIAA 1F1BA 3JWHA 4HBZA 4OMDA 2NU8A 4CE6A 3EG9A 1XEAA 3CRMA 4CLDA 3R3VA 3OO1A 4QDKA 4MSUA 2R79A 4B3MB 4MQUA 2CJFA 3A4LA 4HZUB 1H9BA 3HDVA 4OIFA 1YS2X 1XPJA 2QUJA 2ZCUA 3FNRA 4LJ5A 4LUCA 4BNUA 1EH5A 3SZUA 4CM4A 1Y8RB 2C5SA 4KSCA 2VEOA 1N7JA 3NNSA 2ZAOA 4LJ4A 2JFPA 4YCAA 3N2GA 1YUNA 3I04M 1AKVA 3H1AA 2NTJA 4DLZA 3EODA 4TWRA 2R00C 5EIBC 2FR8A 2GM4A 1LPAB 2YTZA 4II2A 4R1PA 2EL9A 4UHHA 3UMBA 1BFUA 2ZANA 3V2IA 4DBZA 3GQVA 1TM3E 3T1YB 3L4KA 5ITZB 1QLJA 1XZDA 4EDFA 2Q2NA 4ZCMA 4N76A 2QTWB 2R8BA 4MQ4A 4JLMA 2ZIXB 3KHUA 4UZSA 2NU9B 4O4LA 1NLZA 4A7PA 2FHPA 1KMHA 3P27A 2D5CA 3PDHA 1IXRC 1MO5A 2O52A 2TMKA 2QXUA 3R5KA 1E2HA 1I24A 1ZP6A 2CXHA 4FC6A 2YICA 3GEGA 3NPAA 4HN4B 2ZVPX 1MA3A 1SHZA 2P9QA 4L5JA 4BQRA 5IVPA 3HP7A 1YA4A 2W6NA 1RLOA 2WU1A 2XB8A 4Q03A 3IEKA 1L8OA 2E4YA 4DADA 5J4KA 1KAOA 4GOOD 4ZVKA 2O2ZA 3A1CA 3ENKA 3SEQA 4W6QA 5DXAA 2CZGA 1YOVB 1SG0A 4BMDA 2HCFA 2HT1A 2QRHA 1DAMA 2A6PA 3FPFA 1ADFA 4LDPA 4FI3C 4BTLA 3ZDXB 5KYYA 1I7PA 1L3IA 5FNVB 2CXTA 4YTEA 3ZUGA 3HZHA 1DBQA 1YB5A 4PPGA 1W52X 2ODBA 4DR6B 2H1HA 3UHJA 1DG1G 4IXDA 4KRXA 1B42A 2P3SA 4ZYLA 2F48A 5GONF 4LZZA 5ES4B 2XT9A 3CNLA 2O7NA 4EHIA 1U1CA 2X2EA 4J0IA 1XAJA 1KDVA 5K3BA 4O2LA 4UUQA 1QYXA 1R5JA 2B8WA 3WGGA 4C3VA 1KJWA 2AUTA 4Z51A 5KWIA 4TQAA 1M6VA 4JL8A 4EHLA 3DZDA 2ZYVX 4RJIA 1P2DA 1Z88A 2G76A 1CUSA 3KKPA 2WYHA 4G1BA 1I7SB 1TNDA 2PCJA 2ZG6A 5AI8A 5JAHA 5KYWA 3COSA 3GJ5A 3VHXB 4AKEA 5JATA 5JAIA 1C80A 2B9VA 3U1VA 4WHMA 4F8EA 1ZCJA 3K8QA 3QUSA 1UBUS 2ZIGA 2CMFA 1Y3BE 4C7JA 4AKGA 4ARIA 2VDLB 3HJCA 3ZIAD 1RU3A 4HNGA 1C7QA 2QUAA 4UU7A 5E6UA 4DGQA 5BN3B 4U9HS 1TTHA 1VI6A 4ZXPA 3HBMA 3KNZA 5KKCA 2HF7A 1E3JA 5T67A 2PSSA 4R6WA 3R7FA 1SCJA 1Z75A 4ZP1A 2PY6A 5FOVA 1E3IA 3NWBA 3ROFA 1TEZA 1D8TA 5JDIC 2OHJA 1M0WA 3PNVA 3D4LA 4MVJG 3JWPA 2VNKA 4LYYA 4NF2A 4XJTA 1XTRA 3R74A 1RXIA 2QTAA 2JHFA 3F8SA 1M1YB 5EJ9A 1JYEA 2JF0A 4OYRA 3WGTA 1TZBA 3D1JA 4B80A 5M29A 4M89A 4GBED 1BX0A 1MT0A 3KLNA 3OEHD 5A9SB 3G2LA 1NVKA 2WEKA 4B4WA 4YCLA 4A6XA 2R5NA 4PPFA 4PSAA 1XP5A 4RZXA 3D8SA 2CN1A 3CR8A 4NX2A 3RFXA 3SVZA 3ZZUA 5HRUA 4EYGA 2QZZA 2NUTA 4TWJA 4RDIA 3OM1A 3CPHA 5L4LA 2UUAB 4QU5A 2C3OA 3L0OA 5AM4A 2BSQA 2PS1A 3B2QA 3LIPA 3LYHA 3U4DA 5KYUA 2RHRA 1E9FA 1GZ6A 2C00A 3ISTA 4G1EB 2E18A 3IBYA 2AOTB 2QL9A 2NSYA 4JOQA 3PL5A 2C9MA 1U7UA 4RTSA 2EQAA 4ND8A 4ZKDA 2IIBA 2VYVD 1TO2E 3K7EA 2RGDA 3K0AB 2ZSKA 3NH6A 3NHAA 3PC7A 4GOMD 2PLAA 1U04A 2B7BA 5C35A 4CCWA 2VP3A 2GVNA 3DV0B 2A3NA 1JDTA 1R4NA 1SWWA 2BHNA 4V03A 3RC2A 4D4LA 4DKJA 1F3OA 1WXGA 4CM9D 5HP4A 1CRQA 2GD1O 2IYNA 1UXHA 4NATA 3FG9A 3MCVA 5EMKA 1V16A 1ISGA 3G8YA 4CDGA 4UVGA 3KSBC 1VJRA 1KP3A 2AG1A 1T8SA 4S1VA 4D6XA 4I6GA 2FK7A 4BNIA 2ZBUA 3RIEA 3B7GA 4BB5A 3CBQA 4PRYA 4CKYA 3GJ6A 4D7AA 2QVBA 3CLVA 4HQ6A 4ZPXA 3ZNQA 5JMOA 3EGXA 1KHHA 3G88A 1UIMA 3OX4A 5DCYA 4BX3A 3AI2A 3LWDA 3MGGA 4JC0A 3FDXA 5BSUA 1J4AA 2QMZA 4E09A 1WXDA 3H42B 2XCIA 2D4HA 3CX8A 3MGKA 3Q0IA 4ZQCB 3L6RA 2DOKA 1H1TA 3N05A 4LYFA 1L4GA 2VZEA 5DGCA 4MA5A 2PMEA 5J4VA 4QVGA 2AW3A 2O20A 4R3NA 2FFQA 3MCAA 2B1RA 1VKRA 2JJ1A 4B8ZA 3HADA 4E1AA 4BMZA 3IHKA 3QELB 4M9UA 3L79A 3A4IA 4ROSA 1I14A 3VTKA 3VR4H 2R48A 1U0JA 4EMUA 2DY1A 4IGFA 5DM2A 2VJYA 4PS0A 1QO7A 4CR7A 2P79A 1ABBA 2EDCA 3M4ZA 3NETA 2IHVA 4XCVA 1VCIA 2AB0A 3AHHA 3MT8A 1ZJ6A 1Y9DA 2HMAA 3KB6A 4TTAA 5KOHB 1RRGA 3G23A 5TJ9A 4HJRA 2ID7A 1P5JA 2ZB8A 3VZSA 2EEPA 3GV0A 1O8BA 2JLYA 3EIFA 2BFNA 2EX1A 3QNWA 4Y2UA 3WLQA 1F8GA 4DLAA 2C99A 4YJDA 5FNZA 2JLVA 2G1KA 1UPBA 2IUTA 2YJ5A 3PDWA 3OPYA 3Q8XB 4QLOA 1G0OA 2Z9DA 4MEBA 1MHTA 1ECCA 2ENWA 3FM9A 3WAJA 1QLWA 5CDGA 3O9VA 1WCXA 2X5KO 3EZXA 1CRPA 3ENZA 3N1UA 2I6TA 4NR0A 3TF5A 1GCGA 4XCQA 2ZJYA 3TD2A 2QV7A 4CM3A 2J59A 1WUTA 3LKBA 4BMYA 2QRVB 4JCOA 1VYHA 2P69A 3EWNA 4R05A 3VAAA 3SIXA 1BNCA 3UFXA 4I1YA 3WGMA 5JEEA 4BASA 4KYIB 2HK9A 3CRRA 1UADA 5B37A 2FF5A 4YRZA 4P0QB 3WRWA 1JDJA 4FDUA 1QRTA 4NE7A 1FFWA 1TK9A 2X2OA 4OBEA 3NDPA 1EFVA 3R0QA 4A5OA 2F43A 3LVBA 3UBMA 1P3Y1 5F9HA 1T3GA 1VDZA 1TA9A 2VKQA 1UDAA 4Q3OA 1VJDA 3RC3A 3TRDA 4C7OB 1FS4A 4LCBA 4F92B 3CZ9A 5EJ6A 4MPRA 1PR0A 4LPKA 4OXIA 1RABA 3JQGB 4FJ2A 4ESOA 1P44A 4GAEA 6PFKA 1ECJA 1FW8A 2Z9BA 3JARA 4YV2A 1PEKE 3CRQA 1MXHA 1KEEB 5IKPA 5HUHA 4UC0A 1X8JA 4UREA 3R24A 3MJVA 4J75A 5D1NA 4AZWA 5DJ5A 3K6JA 1EM8A 3AR7A 3GG9A 2PAAA 4Y7CA 5CA0F 1M2JA 3LHSA 2DQKA 2C31A 2GAAA 3KJNA 1U02A 1EAYA 4BTVA 4DEVA 5EJ4A 4M99A 1ZL2A 2K7FA 2KLBA 1MUUA 1QYVA 3HDJA 8GPBA 1KI8A 1YV9A 5JJIA 2QK4A 1ICEA 4LOAA 2IEGA 4FP9A 4PZAA 4PONA 1Z47A 3O3CA 5AI6A 1JG2A 1QZUA 1VYTA 4IDCA 3JWEA 1IZ9A 1AV7A 1O9BA 4MDEA 3FCXA 2VSYA 1MB2A 2X4GA 1FYDA 3L8HA 5IDXA 3QF7A 2YCLA 4K6GA 1A04A 3PPVA 2W98A 1Y3DE 1OYYA 3O5AA 2BBTA 2CK3D 3A06A 3LP5A 4KAXA 1ZG3A 1PJ4A 2WU4A 4GXRA 5A71A 3TUIC 4CLEA 5BUZA 2YUTA 4ZGBA 5BN4A 2JA2A 1PV2A 5CXQA 4R31A 2ZXUA 1CIJA 1E2EA 1BS9A 3TO5A 2ZREA 3AHGA 3KKZA 1J70A 2B1IA 3D2CA 2WV9A 4G0VA 3WQQA 2BR4A 2JFHA 2DFLA 1G20E 3JQ9A 1V5IA 3QHPA 4LYEA 2JAUA 4M36A 3L07A 4QSMA 5LP6C 5THXA 3GD7A 1E1LA 4IQGA 4KLZA 4UVHA 5T4HA 4C4TA 1RXWA 3WLOA 1P5RA 4HC4A 2YMLA 3EEBA 1JYSA 3FVVA 1L5LA 4I50A 4LDJA 3EMBA 2A5JA 2NYVA 2VL7A 4L4XA 4S1OA 3H6GA 5EN4A 1KYQA 4L4YA 1JA9A 4PQRA 1RKQA 4CM6A 1VBFA 1FMLA 3AQ4A 1U0GA 3DHWC 1OZHA 1ISJA 1JLLB 2BWJA 2P78A 4JR1A 2JJ2A 3I01M 3BTVA 4UATA 1EGVB 1XJ0A 1NF2A 1X0XA 3KHSA 4FLEA 1PGQA 4FEGA 2ZU6A 1KK2A 2ANBA 3WGLA 5BP7A 4NPHA 4REOA 5NLLA 1XDWA 5AM3A 3JYOA 3U5ZB 5A2QA 1XBTA 4NEGA 3C4QA 2QX7A 2AWOA 3PTLA 1UM9A 4TTSA 5JYEA 5AKGA 4H6WA 1ZBDA 2Y4NA 4LFCB 4BDSA 4X93A 4YMHA 5BWBA 3CKMA 3C3CA 1L1RA 1G8AA 2IEAA 2X15A 2WIFA 3CEHA 1GNTA 3FHJA 4UJ5A 4LF7B 2ZK7A 3OIYA 3RD5A 3G2OA 3GLHA 1UJ2A 2B5WA 2C3PA 4FTWA 4XWWA 1HYHA 2AFIA 4AROA 3AEKA 2KBFA 3G85A 4O8CA 3KO8A 4EY4A 3SIRA 4EY5A 4Z4CA 5LZ8A 4DCPA 5GIPE 2CNNA 3HACA 4X5OA 2I2WA 1ZMXA 2O8CB 4H15A 2FG7C 3JWJA 4NMLA 4DLTA 1EB9A 4Q7MB 4GPAA 4JLSA 1CR4A 3AL3A 3KOWA 3JRXA 2V7EA 1NYTA 2D06A 4EY8A 5K09A 3BWMA 5FADA 1LF0A 1X80A 5FI3A 3LUDA 1JE1A 1QCZA 4Z9BA 4RORA 4YRJA 5KAMA 2XTNA 4QNMA 1GT91 3R5TA 1FL9A 4AJHA 4ZDKA 3CRZA 1W4CA 1ARZA 2WAOA 4NCKA 2FMKA 5AK6A 4MVJD 5ERXA 4C0SA 3U5TA 3NBMA 3ZGVA 4O25A 3F5MA 1J56A 4I9HA 2UUPA 2P91A 3AR3A 2AFHE 4B32A 1V1MA 2FZGA 3WO1A 1K5GA 1Y8AA 5CDUA 2J09A 4MUAA 1XZQA 1XX6A 4BC1A 2BLLA 3RSZA 3MWFA 4AYXA 1ZCFA 1SUCA 2D74A 4PTLA 4HNAA 4NCXA 1IUKA 2ZUVA 3Q7IA 3V8BA 2W4QA 1PJQA 2O4UX 3OQ6A 3HUEA 4IG9A 4Q37A 2IPLA 2QI9C 2X4IA 1E18A 3ITKA 3DGEC 3GFRA 2QTNA 3A36A 3LKDA 1JSRA 4IFBA 4JJEA 1UOQA 4RK6A 3W6UA 1OGIA 2B0CA 4MINA 4EMBA 4KNWA 5E9QA 2P6NA 4V0MA 1HNNA 4F9FA 1U9YA 4N0MA 9GPBA 1WSBA 3P94A 1M2NA 1ZIDA 2NT4A 1AF4A 4JB8A 4WZZA 4DF3A 5AIBA 4RABA 3VZQA 1E1RA 3RI3A 2RB4A 1VI2A 1PJ8A 2B82A 2VCYA 4R4JA 3M5DA 3ULKA 4DWVA 2F3RA 5D85A 3T5PA 1O58A 2WHEA 4RVCA 2IY9A 5LMUB 1D03A 2C98A 3HDTA 1PK8A 2IZ5A 2YJ3A 4D4KA 1SXPA 3W6ZA 4WV3A 5JYDA 3PGLA 4G0UA 5DZSA 1DX4A 2BSAA 4ZOLA 5E3JA 1CNFA 5FBHA 3U62A 5FPPA 1U0FA 4EFKA 2B2NA 2H0RA 4DSOA 4R71A 5GV7A 1FFAA 2EFDB 4U0KA 2CMGA 3DWIA 3T3OA 3CT6A 2O0LA 3WG9A 3MSCA 1D09A 4O1HA 4D74A 2BC9A 2OAGA 4C2UA 5JMWA 1ZONA 3CZ4A 3ERCA 1FMFA 5BYAA 1A8UA 5AOCA 4PQYA 2W93A 3FSGD 3JWIA 3AZOA 1CZLA 2Z2ZA 1Y3AA 1E69A 3BS4A 3D6AA 2BUBA 2D2EA 2A59A 3EXHA 3I09A 5EVCA 4C78A 3SVLA 4URVR 3RS7A 1H66A 3EBOA 4PC7A 1TO6A 1U98A 2JIDA 2XDWA 3CNBA 1J97A 4G0ZA 3SYMA 1EFDN 3M1IA 1JJ7A 4ROTA 4A1OA 4FB5A 4NJEA 5CCDA 3WK4A 4PINA 3OZSA 3VNAA 4PSUA 1NTOA 4E94A 5LYJF 2IGTA 3LWNA 4GX2A 4H1HA 1ODSA 3WLLA 5IH3A 5ISMA 3O7MA 2I80A 3VPGA 4XVRA 4A2CA 1JEQA 5ICSA 2IXTA 1OTHA 4GLFA 1N2OA 4UZEA 1HTWA 4L50A 1VSQA 4UTZA 3SS7X 3AJAA 1JDUA 2C7VA 3BSYA 1DAIA 3BGIA 5AKLA 3T9EA 3R4CA 5EHNA 3EZ7A 2PUWA 3ZWXA 5ULLA 3P96A 4BMVA 4WAUA 3AVOA 1OX5A 3TZHA 1F2UA 5ALZA 3H2ZA 2UUBB 3KQLA 2ZS7A 5ALDA 4YQYA 1EX6A 4W99A 5AK4A 5MDHA 3RUFA 4CZ2A 4R8SA 2WUEA 3PCXA 1ZRNA 1QU2A 4QOIA 3GGGA 3LRXA 4RZQA 2QE6A 4KO8A 4ZICA 1FNSA 3DAOA 5KVAA 5KTTA 1LDEA 3MRSA 5TQ0A 4A8JA 4QU9A 4BRWA 4DSNA 1NFFA 2C96A 2HI0A 3LUKA 1CS0B 2Z6QA 1E5TA 5A4MS 2NUAB 3SJZA 2X9GA 4K2AA 4Y9RA 5KQRA 5KWEA 2R1TA 1I1NA 2W58A 2J48A 1DQPA 3I6ZA 4GZ6A 4BFWA 5A1JA 4GH5A 5LNK6 3UQYS 4GC9A 1M2EA 4NZMA 1S89A 4HX9A 4ECEA 5T3YA 1IQ0A 5DM60 3CB2A 2Y1GA 4AZ3B 2O05A 4MAMA 4V0OA 1UDBA 5J2TA 3U19A 1U2EA 2VJMA 3AOEC 2AA3A 2VTKA 3S1LA 2JLXA 4MS1B 2FFHA 1RPAA 1Q7BA 3W8DA 5JNLA 1D2RA 3UZUA 4IZOA 4DV7B 3E22A 1W5SA 2JAOA 3THYB 2QRPA 1DTSA 2G63A 1V9SA 1B0AA 3T94A 1NE7A 3ZDQA 4GGMX 4LHVA 2RH9B 3V1NA 3NOOA 4ALKA 5JFGA 5KUTA 3AR6A 3I4LA 4DE5A 3K6RA 1UWKA 4NBSA 1HQDA 1GRVA 3NKFA 4MUYA 5DFAA 3V3KA 2OXFA 3WNQA 1N32B 1VTKA 4XQEA 1B1CA 1RKVA 2A84A 3BZBA 3KYCA 4QJ3A 3W06A 4ZCTA 4PZCA 4M1KA 4XDHA 1YRAA 3EAQA 4QO7A 5A6SA 1D0SA 1GFSA 1X8KA 4U2DA 1YJXA 3AL2A 2XDYA 1L7NA 3H3JA 4BO0A 5FULA 4FB4A 5JAOA 4BX8A 5JROA 3H4MA 2C61A 4Q1BA 2IZZA 3HKDB 3PFNA 4DV2B 2ZUCA 4ZVRA 4QUGA 2JFVA 3BB1A 3HB0A 4NOJA 5BW4A 4DGSA 4FCWA 2E4ZA 4RNCA 5HF5A 1E1QD 3FBWA 3N8GA 3WGVA 5I8PA 1ZNXA 3SZGA 1Z0KA 1L1EA 1L4MA 1P7PA 3RYHA 4DBLC 2X0JA 4BO7A 2A33A 4HQLA 1IBMB 1C7IA 2CFSA 1OFUX 2H00A 4LRSB 4U3JB 4F7DA 1G7CA 2G36A 2OSVA 1M7GA 4DV4B 1I4DD 3ZVLA 4Z4EA 4KR2A 5JNUA 2OBFA 3RVSA 2R66A 3LWZA 4H9GA 2Z83A 3BZUA 5AKYA 4MVJP 1G5PA 1OI3A 1LI4A 3L84A 3IAUA 1CQJA 3GEPA 2JFWA 1SGWA 2BL4A 1V3UA 4OYLA 5CPBA 4IQ4A 4RVOA 4RK1A 5TXGA 1T4DA 3TH5A 5K8LA 2HK6A 1YCDA 2QIPA 2R3SA 5KTMA 1JVBA 4R2XA 4U8HA 2PGXA 3P9RA 4L27A 4D9BA 5ED4A 3DL7A 1I32A 4BNXA 3A9UA 3LBNA 2WTUA 2CFCA 4FMCB 1MAWA 4R8RA 5H5JA 5LQAA 1BA3A 3WC4A 2QW1A 1PVOA 4IXWA 4ZVNA 3PR3A 1MRSA 3ECSA 1OA0A 3ZK8A 3C45A 3NBQA 1CF9A 1S2GA 3CLTD 4KIUA 5TPWB 4FXOA 3VR3D 1YR7A 2ZRQA 1K86A 4MUEA 1IY2A 1LPOA 3I5AA 4F38A 3PQCA 2GK3A 1EGAA 2FSUA 4WUVA 3DXYA 2OP0A 4GU5A 3BH6A 2O2XA 4C2AA 5DYTA 5MFPA 4DIMA 821PA 2JIBA 5IDVA 2BJWA 2QUKA 2HBQA 1L7VC 4AO6A 3TI7A 1QV6A 1OSNA 3OZDA 1HPLA 3MJEA 1Y98A 1NONA 3NV7A 3UFBA 4FYXA 4R7TA 2ZIAA 1Y3CE 3KD3A 3FPAA 4LQCA 3WMGA 4MWCA 5LOVB 1EJ6A 1BHO1 1Q16A 3JZAA 5CB0A 4NYMR 3C5VA 4B75A 1Y6ZA 1BN6A 1XXHE 1GP2A 2H48A 2P3LA 2VK4A 2FFBA 2P9TA 2QSYA 1U65A 5F33A 1OQAA 3CX6A 1AXEA 4IVRA 3BVPA 5D2CA 4OMUA 3A1NA 2GX6A 3KFVA 4PNPA 2O8FB 3DULA 1T2DA 1T5DX 1VPVA 3ICVA 3W79A 3OPXA 2R1VA 4I5IA 4P34A 1JIUA 1YK1A 2EZ4A 1Z4JA 2FSVA 3UJ7A 1KI1A 5IVDA 1PGPA 1ODTC 3RABA 3AKEA 2FMXA 4HD8A 4XKJA 4KH0A 2IU0A 2A5DA 4IJWA 3QIAA 1Q44A 1H2RS 3ES9A 3KJGA 1PIWA 1SBCA 4JI1B 1BCRB 4UU0A 1NMYA 4JWTA 1RAHA 1OX4B 3WIBA 4B3TB 1Y4UA 1ID8A 3RNOA 3QX3A 4KGDA 1GPMA 2QN8A 3HBLA 3TSWA 4G0OA 1ZISA 2VWHA 1J23A 2H54A 1CDZA 1E2PA 1VKNA 3H5RA 1PNQA 1SXIA 4X63A 2A0KA 4KC0A 2H9AA 3VTZA 3W90A 4CEHA 2QLNA 4MVCA 1IUPA 2Q0XA 1B14A 1ZVJA 2D1YA 2FPPB 2FRVA 2R2GA 4ND1A 4RF5A 2IOFK 1D6SA 4TTPA 3H99A 1MAUA 4I4TF 1XEXB 3HJHA 4B81A 2FHSA 2Q5HA 4O63O 5A1TA 5JG7A 3TSYA 1IAQA 4ZDWA 3EYAA 2ODQA 4RZIA 5DK4A 4AIRA 4EJSA 2A9RA 4RF4A 3FHOA 4QREA 2P4SA 4GR4A 5AKIA 3GEHA 4AJNA 1X7ZB 1KOFA 1RWKA 2MYPA 4MUGA 5B4TA 3HM9A 1ZHFA 5REQA 1SBNE 1B43A 3OM9A 3T06B 4MW7A 3T9FA 3IXLA 4IW3B 4KLNA 1MABB 4BLTA 3EGDB 4OQZA 3EFBA 4JQZA 3BDVA 3R2JA 1HDEA 1ZXBA 1E1MA 4RJJA 1N2JA 4NBKA 3RLIA 3DJFA 3RU2A 3DT9A 1T2NA 4XYEA 3UAWA 3RGWS 4CDNA 1VJTA 4YXWA 4QU0A 3ZWOA 2ZJ8A 3E4DA 2OD9A 1VSVA 3TJRA 4XWYA 1EBFA 3USCS 3FI0A 3LC1O 4YA6A 2QTLA 3S2IA 3TSCA 3SHTA 4QXAA 3O03A 4HCJA 1Q21A 3GX1A 1C41A 1M34A 3MYYA 4LXGA 1F17A 3I34X 3WLFA 1QHHA 3GB9A 4BKMA 4OTZA 4B7AA 3WNCA 4J0KA 3RTBA 1JDVA 2VLIA 1GM5A 1UBKS 2WKWA 2XWQA 4AXXA 1P61B 5IKOA 1PF7E 1VA5A 1WDKA 5J23A 2XYPA 3C3DA 1JG6A 2Y68A 4MUNA 3C41J 3KLBA 4W7SA 2YYAA 4KO3S 3AM5A 1RHRA 1QAMA 4ANFA 3QEOA 2GBGA 2JLQA 4H0FA 4COKA 2D7DA 1Q1QA 5LFAA 5AK5A 4HBGA 3MXTA 1ZD4A 2Q3BA 3TTVA 4CXMA 3GVXA 1KYWA 3WDLA 4UM9B 3THRA 2QYHA 4KHZA 1MFZA 1AHNA 1GD1O 2H63A 3QTBA 4LDAA 4AFNA 4C21A 1P4SA 2FMHA 3L8EA 2MHCA 2GZHA 3ONEA 1WQ1R 1Q19A 3BL8A 3HN6A 2AEMA 2BFBA 3CNOA 1RKBA 3UG7A 4CQJA 1YB6A 2O2GA 3CVYA 4MA4A 4DV3B 3IEXA 3STHA 1ORTA 4BHTA 1YE8A 2BGWA 3QMWA 5H02A 1LWOA 1GPKA 4PVCA 2Q7DA 3RWMB 3KHKA 3RVQA 3MT9A 4IVPA 3CCBA 3Q15C 3AOGA 1NVWQ 3NIWA 2QQ0A 3NGMA 1FDOA 3UUFA 3W3AD 1FXWF 1Q1BA 4HX2A 2BMDA 4P08A 4ZCSA 1VSTA 4R9UC 4DV6B 5CCEA 1ISSA 3ZQ4A 4RHCA 3JD3A 3IE2A 3NRBA 3LOPA 2IW3A 1X7XA 1ZINA 3NC4A 4AS2A 4BVFA 3ZNPA 2JH3A 5J4YA 1VXOA 3G1UA 4BV2A 5L3QA 1DC3A 1NW7A 1P2TA 1YWGO 5HPYB 1T8UA 1YS6A 4ZYZA 3K9LA 1CY6A 1DFHA 5A03A 4EG1A 2GEKA 3MJDA 3B6IA 1UK8A 1QGDA 3CKKA 1Q0TA 2L2QA 1G60A 1CCWA 5TMPA 2WG1A 4PZPA 3K0FB 1NVEA 3MPUA 1GILA 1ND5A 2O8EA 2VT2A 3BEOA 3FTNA 3W0LB 2O8DB 5D00A 1LLQA 2PMBA 1JIVA 2CLMB 3MELA 4X8HA 5HHTA 4HVLA 1ENOA 3DMTC 3D3QA 3A1UA 2YHSA 2HHCA 4DYVA 4BE9A 1KIFA 5KYXB 2IITA 2VEDA 5BSRA 3U7EB 2FPUA 1SOAA 3OKAA 4KN5A 5COBA 1NKSA 5AOBA 4ALMA 5HE9A 4RGYA 5JCOA 1JKJB 1QZZA 1U2QA 1GPYA 2X3YA 1AO0A 4RGQA 2NTYC 1MB4A 3ORYA 2RHLA 4K8OA 1EDEA 1WU7A 3FRJA 2VP5A 1LQ2A 2G4CA 2L42A 4IDBA 2C5AA 3C85A 1U28A 4M8SA 13PKA 1HRKA 1R4ZA 1QVRA 2XLCA 4NBNA 1CUVA 9ATCA 4ZHQA 1Z62A 2P77A 3KPUA 3QJYA 4KQFA 4BBJA 2F1HA 2ACEA 3HBFA 4RVHA 5EKSA 2WD7A 2OPBA 3KEGA 1GQFA 1OCEA 2HNKA 3CF0A 5KQMA 2GCNA 2WNIA 1PT6A 4WXRA 4OM8A 3JQBC 4ZC1A 2IXFA 4ZHSA 5C53B 3GR6A 3W6OA 3N6VA 1ZJJA 1WXHA 3O9ZA 4HTAA 4KXUA 2QX6A 1XPOA 1W88A 2NXCA 2QAIA 2J45A 3U2QA 2FPWA 1XLWA 4G1CA 1E63A 5EMLA 1FNNA 3MCUA 2Z8ZA 2OWDA 3MN1A 3QKWA 5EWMA 4L4RA 1ONSA 3E27A 3AV3A 3SJUA 1NJ2A 1XZPA 3IOBA 2Y3IA 4BLPA 4HNUA 2OYSA 1M8JA 2QR5A 4R2MA 5HM8A 1V2GA 5LLDA 4BNTA 4FFWA 4M98A 2YDXA 3G2IA 3B9PA 3MHPA 5BWNA 1N2BA 3OFNA 2SKCA 5ALRA 4RYLA 1UKYA 1RXYA 4HSGA 1GG5A 5C5IA 1E9DA 1BIFA 3JV7A 2CC2A 3FZQA 3SF0A 5K20A 1ZH8A 1JEDA 5GJWC 5LA6B 1E6UA 3KHTA 1YKGA 4YRKA 4AF8A 1R8SA 2MMGA 1TF2A 3IQWA 3TNDA 1OT5A 1ZD8A 3S55A 1BMQA 3PDCA 5JS2A 5LJIA 3VQTA 1ZNZA 2JJMA 5AI0A 5KYTA 1EIWA 3O9MA 3W5DA 1W46A 4TVOA 1EFPA 2AZDA 3E0QA 3GGCA 4RANA 3SC4A 3B6JA 3ZBQA 3ZCRA 2I65A 1W4AA 1JNYA 4FZJA 4P3YA 1KQOA 4IVQA 2OV3A 2MSEB 1T5LA 2WQZA 4QFMA 3L1UA 4XIGS 1TEHA 2HFKA 1F9AA 2QN6A 2SHKA 3GOHA 3JVEA 4Z0PA 4C88A 4DJ5X 4XIJA 4JQSA 4OSOA 5KDLA 4OK5A 3A0UA 4M1MA 3DTTA 5EWLA 4D9FA 2OFWA 3WGJA 3WRVA 1N6LA 1YBMA 2J3EA 2NVUB 1UXGA 1QUFA 3M83A 5D3ZA 3IT0A 3SQXA 3OJWA 3TCXB 3F9IA 5B1HA 2ZI4A 3ANXA 3W7BA 3D8RA 1VIYA 4LRQA 4MYUA 1UJMA 1XGKA 2ZWVA 1IWOA 1XZIA 5J2UF 3DZFA 2IY8A 4OY3A 5B7PA 3HN7A 2K5UA 3OAAA 1BE0A 2DT5A 1EUQA 3TQTA 4OQ4A 4CKCA 1KZ9A 1NV9A 1M2KA 5JALA 1WDTA 2P30A 4HZUA 4ZAVA 1DVRA 1E9BA 1OWPA 2BGUA 2GM5A 2ZGVA 3B89A 4D45A 3KJQA 5BR1A 1T5HX 1WXQA 1Q1ZA 1Y8RA 4E5DA 4DCVA 2QRMA 2REBA 1OC4A 2WHRA 4I5GA 5G0SA 3OEED 3A04A 4RETA 4AAYA 4R68A 3RKSA 4KR6A 4N48A 2EU8A 4PGFA 2ZKLA 1RWXA 1PZNA 1TM4E 2WUDA 3G2HA 3JASA 5AI5A 3LYAA 4NBWA 4Y18A 1EP1B 2H1OA 1SMKA 2FEWB 4Q12A 5LDHA 1X13A 1GXSA 4N8EA 3UA3A 4NDZA 4PLWA 1Y1LA 3DJYA 5AD1A 2QMOA 4IHQA 1VBKA 2XB2A 2H59A 3EJ6A 1D1TA 1E3SA 1GEGA 1QIEA 2ZIXA 3V1KA 1NATA 1VZ2A 3R0JA 4B8YA 4BV9A 2JHAA 2NU9A 1RLMA 1L7MA 1UC4B 4DM3A 5DNAA 1JMVA 2XF2A 1Z5UA 1XT6A 3SQLA 1PFVA 2IYUA 2H7VA 3DE4X 1PJSA 1TIPA 2WW8A 3UAOA 4DNXA 2C2GA 3I9OA 1QG0A 3QU2A 4N6NA 1QTNA 3GFOA 1S8FA 2W6QA 3L82B 1H6AA 3P26A 4MS3B 5F78A 5JSUA 2BEWA 3ADPA 1X1QA 2B2CA 4YMUA 1NN3A 4HZGA 5FIUA 4EI7A 3L7DA 4O59O 1H8EA 4PAGA 4BKUA 1YOVA 2XYGA 1C3XA 1DEOA 1VIAA 3CRW1 1BEUB 3KOXA 3PKIA 4EKEA 3SJBA 3WMRA 4KE7A 5FNVA 3L0YA 3FWKA 1KZ1A 4ALIA 2A0WA 2BMEA 4W5HA 3QBEA 4F5YA 4UEJA 2CNLA 5EMHA 1ECGA 3BICA 2RHMA 3VC2A 2NP7A 2X19A 4ITVA 4KN6A 1FJHA 1THZA 1MBZA 1N0VC 1U7HA 4XLTA 1AQYA 3KX2A 2EJVA 3O3NB 4HAVA 1XYYA 2V7WA 1M0TA 2R8PA 1W4LA 2X2PA 3DBHB 4W9NA 4EZEA 2ZIEA 2O5RA 3ABRB 1CIVA 2NXJA 3RVPA 2XE6A 4ZYWA 2ZRMA 3KKLA 3L7KA 3IPAA 3PIIA 4MW9A 1SA0B 3MHTA 3FTQA 4R69A 4KWTA 3BA1A 2I8AA 4PICA 4ZALA 5LKAA 4RFSB 2SKDA 2VT7A 3N76A 3PNLA 4C4PA 1EPUA 2FWJA 3VHXA 3H5NA 2ADOA 1I9GA 5EJGA 1G98A 1P91A 2DSNA 1NMZA 1J2YA 5A3RA 2G67A 5C8YA 1QZTA 3LT0A 3T5DA 1DKNA 1WPXA 2C5LA 4CIWA 1V8PA 4IFEA 3TW0A 4BQOA 5GAJA 4D26A 4IEIA 1FRQA 2N9UA 3KOUA 2QRLA 2E4UA 2JGAA 1HDZA 3GLVA 2WVAA 3QG1A 3I12A 3QOYA 4D57A 4P0PB 3C5WP 1UBEA 4WUTA 3ZZMA 2CNOA 1Y6RA 2MOKA 1LJLA 3ILHA 2F9LA 2QN7A 4H77A 2EFYA 5BYJA 3ONVA 1MRZA 1LBEA 4N47A 3E05A 3E7FA 4BVLA 5ALMA 2EBHX 4LHYA 2Z30A 4YRBA 2BP7B 4QPPA 3DDUA 1A4UA 4QFCA 5EJIA 2CL6X 2FW8A 3X43A 4CFZA 5A9SA 5HKAA 4CMJA 3EZYA 4WKCA 1O03A 3GIDA 1WQ4A 3LLUA 1A5TA 1C1DB 3WRXC 4LJ7A 2HXSA 2G72A 2B4YA 4OOEA 3RUCA 3WAKA 4DFDA 5BMOA 5KVQA 1Q1NA 3LCRA 1VLHA 1WUHS 4YT2A 1YIDA 4HDRA 3T1HB 1P3DA 5FO0A 3F7OA 2XUFA 1N3YA 3IUYA 4K87A 1XP8A 5KNCD 5A0FA 5L3VA 4EARA 3KT0A 2Y05A 1WIWA 2GAIA 4KRGA 3BX1A 4RY0A 4TKVB 4D9IA 4BEVA 5HCUA 1A7AA 3K0AA 5FWXA 4JI5B 1FLVA 1QYDA 2QB5A 3NATA 1G6KA 1R6XA 4GEKA 4L22A 2ATCA 3U7QB 3W8NA 4DQKA 4L9WA 4GBMA 1U0BB 4YFYA 2W2VA 3I0ZA 3DV0A 1Z38A 1MZVA 1F0KA 5JRJA 4XB6B 5KSPA 3M6LA 5AXCA 1CW2B 1Z22A 3E23A 4JC4A 1ENZA 2DCMA 1FUUA 1H1LB 1YIAA 1N36B 1ZM3A 1L4BA 2AG0A 2PRSA 5KSZA 1B15A 3DS8A 1C9NA 2ZE5A 1YQEA 5EUMA 1JAZA 4HAUA 2GYUA 3NEYA 4DCUA 4JXJA 3TL3A 4YRAA 3BDIA 3DHVA 1G55A 3RANA 5KNBD 3B9BA 4RV9A 4BNHA 2BD0A 2GN1A 1JEJA 2AN9A 4NS4A 4PE5B 4JMPA 4D9CA 2HCTA 3CZMA 3N2ZB 4BGDA 2H2FA 3AVUA 3DKPA 2YRWA 2NG1A 4IYJA 5IEJA 3WZLA 4FN5A 3C3WA 1UODA 4OAQA 1ZJZA 2XODA 1XELA 3OMXA 4JJGA 3BK1A 4BVGA 4GE3A 4XVCA 5KC8A 1MG5A 3KSUA 1FSFA 3N7UA 5FL7A 1JTFA 1IZYA 3D7KA 3T3PB 4PWYA 2DF8A 3AR2A 5CB8A 3A2LA 3HWRA 1ZVQA 4DXDA 2NZJA 4B6RA 1KBZA 2Y1LA 1P6XA 1SOMA 4K6HA 4TTJA 1XHEA 1P4JA 3AH8A 4QOJA 1ZN9A 2YOHA 4J3JA 4RNDB 5JT1A 4CEJB 4Z3KA 2C2BA 5DLPA 3OLVA 4TMVA 3EQ2A 5LXTB 3GN2A 3DAPA 3Q8KA 5EJAA 1MJGM 1THMA 4RFLA 5JTTA 2HRCA 3HSYA 1OXSC 3JYPA 2WABA 1A7JA 1MCZA 3QHAA 4UTXA 3K9GA 2QRGA 3HCBA 2JAXA 4HUQB 2JGDB 1XEFA 5EQTA 5EXXA 3AY7A 2FSGA 4HLUC 4PXYA 1ATIA 1TQHA 2FWAA 2ZUUA 2JRLA 1QHYA 2DWQA 1X7WB 3UAZA 4IH4A 4WECA 4XUGB 1YRBA 4OGWA 4OYHA 2OB2A 4IIBA 2WSMA 3IALA 3BWBA 2BY4A 3X2EA 3FPJA 4G5GA 3SLKA 3K0SA 4PYLA 4IDFA 4AYTA 1JP7A 2OECA 4N8DA 3ZY2A 2WT9A 4PRZA 4V0LA 5K3EA 3HRIA 5IVHA 2C4WA 3DL4A 4W5JA 2A9PA 1DLJA 4JI7B 1JQ5A 5ILQA 1NBME 1VLQA 5DBOA 4MZDA 3LX6A 5FPKA 2XA1A 1A8IA 5ILOA 1MN6A 4LJ8A 1U9ZA 3GFBA 2RGEA 4RDHA 2ZUFA 2EVWX 1E20A 1LK5A 5K8IA 1KJYA 2BI8A 2C5FA 4L95C 4O4HF 5I45A 2GFQA 1NOJA 4P7FA 2WJ4A