4KWHA

The crystal structure of angucycline c-6 ketoreductase lanv with bound nadp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
b'GNLTGKTALVTGASRGIGRAIAEKLGYAGALVAVHYATGADAAAEVAESIEKDGGRAFTVKAELGVPGDVDVLFEGLERGLKERTGATDLDILVNNAGVMAMGAPEEVTPEMFDRMMAVNAKAPFFIVQRALSVMPDGGRIINVSSGLTRVASPDQVTYGMSKGALEQIALHFSRHLGSRRITVNSVAPGSTDNGSALFQIPEVRETLSQLSTFGEVAEPAAIADVVAFLASEDARWITGAFIDASGGTLLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reductase homolog
publication title Structural and functional analysis of angucycline C-6 ketoreductase LanV involved in landomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces cyanogenus
molecule tags Oxidoreductase
total genus 90
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kwhA00
1LUAA 1TT7A 1ZUD1 1DFIA 1XQ1A 3DBLA 4N54A 4YBZA 2CDAA 4E33A 2WJPA 3TZ6A 1IE3A 2OBYA 3GLQA 1X1TA 2X86A 3MWEB 4CLXA 1YDEA 3OJFA 2EJWA 3ANLA 1ISJA 3L4BA 4D41A 4MVJG 1PGJA 1HE2A 1PL7A 4RVFA 8ADHA 2IZ1A 3ZHZA 2HRBA 2NTNA 4ALKA 1ZSVA 1WMAA 9LDBA 4ND4A 2YV1A 5JYEA 1K6XA 2YHIB 2HMTA 2DAPA 1LRLA 1WXDA 3AOGA 1EQ2A 2POQX 5U1PA 2XOXA 3ASVA 3C24A 4RPHA 5KIAA 3O26A 1HEUA 1P31A 1GTMA 1PQPA 3DHNA 2YHIA 3FI9A 1KOLA 3S2FA 3ON5A 6ADHA 1PZHA 2F00A 1GYPA 1YXMA 1U3VA 4AFNA 1I24A 1UJMA 1GQ2A 4AVYA 3ZNNA 2FWMX 1LC0A 2FN7A 2NQ8A 4CUKA 1ZCJA 1IPFA 3UICA 4J6FA 4N5NA 2HKIA 3QWBA 1H6AA 3TFQA 3PIIA 1F06A 1QKIA 4TVOA 1NPTO 4G2NA 1PJSA 1QYVA 2EHDA 3COSA 3HDYA 4QUKA 1HDCA 1UH5A 1NXQA 1RPNA 5EQDA 3JYPA 2VWQA 3KLPX 1I8TA 1ENZA 4WASA 5A4DA 4MP8A 3V2HA 2V6BA 2BH9A 3L9XA 5CPFA 2ZQYA 3UGKA 5IXYA 2X0IA 3IKTA 2BFPA 5EMHA 1KVSA 2X7HA 4Q39A 4CJXA 2QYTA 2FP4A 3EW7A 2PD6A 3RCBA 1Y8QA 2BRUA 2JCYA 3H6KA 3ZHXA 3PJEA 3R1IA 3KOUA 4CM5A 1H9AA 4D3DA 5IZ4A 2HMSA 4ND3A 4BNTA 3DBHA 2IODA 5B4TA 1E1KA 2DFVA 4XWYA 3GVPA 4JJGA 2O3JA 4ND2A 4WPGA 1RJWA 3WWYA 3JQBA 1GR0A 3D7LA 3G1UA 1XGKA 3OP4A 5DN9A 5ER9A 3H9QA 3MJTA 3V1TC 2AEFA 1HYEA 1YWGO 5J23A 2O2YA 3GR6A 3CIFA 1ORRA 5F5LA 4NBWA 1ZK4A 1SB9A 3KEOA 2HRZA 1GV1A 2Q3EA 4Y6RA 4EJMA 3GEGA 4MVJH 4Q9NA 1I3LA 2PD4A 3ZHBA 4AJ1A 4OIMA 3HDJA 4J7UA 4TKMA 1RKXA 3NDIA 5JC8A 1SOWA 1NQOA 4BO7A 2WSBA 3IUPA 4N5LA 4R54A 2GN9A 1JW9B 3ST7A 4XGKA 5TNXA 4MJLA 1KEWA 3OJ0A 4GWKA 4S1VA 1Q7BA 2OL4A 2GO1A 1ZK3A 4JX8A 3RROA 5FI3A 4YJDA 4B8ZA 3K30A 1CEQA 1EFLA 2V65A 2I6TA 1NQ5A 1ISMA 4D7AA 3NJ8A 3PI7A 5JMWA 1CJCA 3DC2A 3IJRA 1W0CA 3EY4A 4WOJA 1K0UA 5JXWA 3K6JA 4I5GA 4EEXA 2QZ9A 1MUUA 3AM5A 1JN0A 3N7UA 3GNTA 1T25A 1C1XA 2I99A 4ZRMA 4QQRA 3INGA 3EZYA 3A1NA 4MVJM 1PR3A 1ULSA 2YHUA 3D4NA 2XAAA 4TMFA 1ZIDA 3I4FA 1GZ3A 4PZDA 1YE3A 4E6PA 1NVTA 4DTIA 5L4NA 1QORA 4XGNA 3IP1A 1Q7CA 3PWZA 3NDRA 3HZZA 5DZSA 4ESOA 3PDJA 2B5VA 2QX7A 1XELA 3QIVA 3HHPA 5AXAA 1I01A 1HZZA 1Q0HA 1EVJA 1HDRA 1SB8A 4UEKA 3LC2O 1JTVA 1VRWA 3T7EA 1GFSA 4JK3A 3CE6A 3A06A 1N92A 1UAYA 2WMDA 4RZHA 3BHMA 3ZNPA 3CXRA 4DC0A 5IDQA 3H9UA 3DMYA 2Y1GA 2WD7B 1F12A 4TSKA 2G76A 3BA1A 4OXYA 2DTEA 9LDTA 1I3MA 3ANMA 3H2SA 2WD7A 1T4BA 3I6IA 4Q3BA 1YKFA 1XDWA 1B8PA 1LXCA 4WOKA 4CLDA 1SMKA 5A3JA 3VOSA 3PJFA 3OEYA 1ADBA 4CR8A 1PZGA 2ET6A 3U4DA 3PVZA 5G0UA 2GN4A 4KUEA 3FN4A 4MDHA 2GCGA 5H82A 5C5IA 4NFHA 3L6DA 2DU8A 4ZVVA 3D64A 5F1KA 1HF3A 3KEQA 1ONPA 4KWIA 3IAHA 5TS3A 4QT0A 3CPSA 1HYGA 3CUKA 1R4NB 2C2XA 3LT2A 1E7YA 4I5DA 4J2OA 1HE5A 4NZ9A 5ES3A 4WCDA 3V2GA 3PZBA 4CM7A 3FWZA 2PZJA 2C07A 5A5FA 4DUPA 3MEQA 3B6ZA 4MVJA 4Y67A 1R4NA 4L76A 1VL0A 3K96A 4E5NA 1UP7A 1QYCA 4C7JA 1EVIA 1IL0A 4B4VA 4HP8A 2NLOA 3NJ4A 1PJBA 1R0LA 3B70A 1ZNQO 3PIDA 4PLFA 4XIYA 3ZWPA 1I10A 3KYDB 4H3VA 1WNTA 3AY6A 3DBRB 4EDFA 3C7AA 5CDGA 1E3WB 3N58A 4RZIA 2AE1A 3RC1A 1OMOA 1ZH8A 1E3EA 1IB6A 3KYDA 5L51A 2O50A 3JYOA 1E3WA 3OQ1A 1EBUA 1DXYA 4YR9A 2X23A 4FC6A 1ZFNA 2X9VA 1V9LA 2P9EA 1LEHA 4J7XA 3JQCA 4NJMB 4MVJF 1T4DA 1U2GA 2VHXA 1GD1O 1LDYA 3G17A 4X54A 4IXTA 4NBRA 4NJMA 4CQMB 1JLLA 2PZMA 4LRSB 2D4AA 2QHXA 4CODB 4DPLA 3HN2A 4H15A 2ZTMA 1A9ZA 1E1MA 3CZRA 4O5OA 3RJ5A 3Q6IA 3T4EA 5B4VA 4CQMA 2Y93A 3IS3A 2BGLA 4R4JA 4TKLA 4J91A 4KZPA 3VH2A 2Q1UA 4ZJUA 1P1JA 2P91A 2QG4A 3P19A 3BHJA 4RPGA 4MKXA 4UUPA 3S8MA 1S6YA 4DQUA 2Q46A 4HWKA 1DC6A 2FR1A 5A1TA 4FN4A 2EGHA 1ISGA 2QQ5A 2AA3A 4EJ0A 4JJFA 5KKCA 3PJGA 3M1LA 1ID1A 1B26A 2IYOA 2NV6A 1UR5A 4L4XA 4W9NA 2QZZA 4AJIA 3PTZA 1LLDA 4YT8A 1TXGA 3JQGB 3O03A 4WLFA 4CUZA 3GC6A 2Y1EA 1PQUA 1VJTA 1XU7A 2Q4BA 4A27A 1T2AA 2Q1WA 4NHEA 1PGOA 5JMPA 3I4CA 3DONA 1KEVA 2Q4EA 2PV7A 1WAMA 5ER6A 3TL2A 4O59O 3TJRA 3AUUA 5KVSA 3PFWO 4CUJA 4BVAA 5K0ZA 2TMDA 1LX6A 3QVXA 1H2BA 2NSDA 4D42A 3ASUA 2JAHA 1SZJG 4R1SA 2WTBA 4YRAA 3ZWNA 1ISFA 2GUGA 4MP6A 3RUIA 4OM8A 3VZQA 3ABIA 1H6BA 1F17A 1VM6A 5L45A 1HT0A 1DAOA 2W2LA 1D4FA 1U9JA 4JBHA 5LCXA 4DC1A 3GPIA 3GNQA 3CTMA 2WYWA 1MGOA 3H3JA 2AEMA 4KTVE 5CDUA 2VYVA 1B8UA 3A4VA 1O94A 2FR0A 2VN8A 4Y9DA 1I2BA 3OHSX 4KMSA 4JQCA 5JFOA 3ONFA 3I5MA 2QW8A 1DJNA 3WGTA 4BB5A 3WOHA 3DZIA 3N74A 1TA4A 5TQVA 4YB8A 1WPQA 1QMGA 2YFQA 1R6DA 3DMTA 1RM4A 2P2SA 2PTGA 4ID9A 4PGFA 4QEDA 4Q3EA 1R0SA 5L7TA 3A28A 3PQDA 1E7MA 4OYRA 3HDHA 4OL9A 3KSUA 1HDOA 3WLFA 5B12A 4U5QA 1W4ZA 1GCOA 3OA2A 3DZKA 4XD2A 4BKRA 4II3A 1QYXA 4FC7A 4YPOA 3O4RA 2DM6A 1R4MB 3GAZA 4YQYA 2O2SA 4BKUA 2PK3A 4TRMA 4CM4B 3WGIA 4CMJA 1BDMA 1R4MA 2R00A 4A5OA 2QIOA 3DZGA 3GPDG 4NQZA 5BNIA 2V6GA 2J3JA 5IF3A 1EUCA 5KJ6A 5U9CA 1VC2A 4MVJI 4WLVA 3HB4X 4DYDA 4FFOA 1LSSA 3H9GA 3WYCA 1LDNA 3ZZNA 3FD8A 1VSUA 2JFFA 3RUCA 3TNLA 3JV7A 3W4KA 4PLCA 1I33A 2O3RA 1C1DB 1JKIA 2XXJA 1HLDA 5JDCA 4RQUA 1GPDG 2D8AA 3WMWA 3A9WA 2AQ8A 3JQ7B 4C7KA 1C1DA 1H93A 2JFHA 3AFNA 1T1RA 2NTVA 3L4SO 3RFVA 5CEJA 5DF1A 1E1NA 3AOEA 3JQ7A 3ZWVA 3LLSA 1TB4A 5GZ3A 3WGOA 3AI2A 1U8XX 4FJ2A 4J16A 1K5HA 2FPPA 5U4QA 2IYPA 3JQFA 5T64A 1X14A 3KSZO 4BV8A 4P4GA 3KHUA 2JD0A 3SJUA 4E13A 3I9MA 5G0TA 1PJQA 4IZHA 1WDKA 3H3FA 5JY6A 1FF9A 1F8GA 4TZTA 1PZFA 3KB6A 2BGMA 2VT2A 5IZCC 4DRYA 1BTOA 3HUDA 2ZYDA 3WTBA 2Y99A 4LMRA 2WE8A 4AJOA 2WEKA 3F4LA 1Y1PA 1UP6A 3QV1A 1YL5A 3H8VA 1UDBA 5CPBA 4Z6KA 4U7WA 1YONA 4J9UE 4XDZA 3GRPA 5BQFA 1DRWA 1U28A 3L77A 2X0JA 3FPLA 3JQAD 1PGPA 3FRJA 4A03A 1U5AA 1GUZA 4I9NA 4GI2A 3V2UA 1B8VA 4UUMA 2X5JO 1Z82A 2H63A 1DJQA 4AJJA 4NMHA 1L7EA 4J7CA 2OP1A 1EE9A 2NVUB 5JDIC 1VL8A 3ITKA 4LRTB 4FBGA 4FFRA 2NU9A 4L4SA 1DC4A 2NACA 1YOVB 2YW9A 3MCVA 2NVUA 4HY3A 5DCYA 3VPHA 3GNSA 3DHEA 1E0DA 4YA6A 4YJFB 4NJOA 4BGUA 1EK5A 3PP8A 2DBQA 1NAIA 1YOVA 3IJPA 5ILGA 1TT5B 1B0AA 2J3HA 3AW9A 4YJFA 1GV0A 5JCJD 4YJGB 1P1IA 3E6AA 4QO7A 4EEZA 3S2GA 3VDRA 1ADGA 1AE1A 4FJ0A 1NVMB 1GADO 4YVFA 5I9LA 4YJGA 4Z9XA 3OICA 1ENYA 3MZ0A 5CDSA 3OJLA 4YRDA 3BAZA 3P7MA 4A26A 1A5ZA 2VUUA 2E48A 1D1SA 2OO5A 3VVCA 1L1FA 1E6EA 3D5TA 2ZB8A 3C8MA 1KERA 2EW2A 2Y0EA 3VH4A 4E2XA 1KVUA 1JWAB 1NNUA 1Z7BA 3UAGA 5DCUA 3ZDFA 2ZCVA 5F5NA 1ZSYA 1ZMOA 2YFHA 5JE8A 3VPSA 3GUCA 3JQ8B 3Q1LA 4RV9A 3WJAA 2Q2VA 4DA9A 4KQXA 4OKNA 5JAMA 4EUHA 4E30A 3NTRA 3JQ8A 4U6SA 3C1OA 4M49A 3BTUA 4Z0TA 1LRKA 1PU2A 1HXHA 3E5RA 4UUNA 3RI3A 4RLHA 4DIOA 3F5QA 5HRUA 3LT4A 4ZHSA 4EJ6A 2Y1DA 3FWNA 3V8BA 4B3IA 3PPIA 1HL3A 4U6QA 5KJCA 4GX0A 2OBNA 4UAGA 1I32A 4JIGA 2E82A 2D59A 3IUSA 5TIIA 2DUWA 1C14A 4PN3A 1DRUA 3QWFA 3FR8A 3ZWOA 4PCVA 4YAEA 2W98A 2VRBA 4PG7A 2J5KA 3QHAA 4I08A 5G4KB 3WGQA 1MFPA 3EUWA 4OH1A 4IBOA 1GUYA 1PZEA 3W8FA 3AI3A 1T26A 1XKQA 5F3RA 5G4KA 4BO6A 3WLEA 2G5CA 1YB4A 1E3JA 1NHGA 2DBRA 3H5RA 2G82A 2I3GA 2WM3A 5L3ZA 3VH3A 3H9JA 5EERA 4FPXA 4IY1A 1V6AA 3VHRA 4L0QA 1KEUA 2X5KO 3DFUA 2OXIA 2AG8A 2VHYA 1ZEJA 1PJLA 1KEPA 1BG6A 3GVIA 3LVFO 3SVTA 2WD8A 2YV2A 3ZV6A 4R01A 4G65A 1YQXA 2CF6A 1GPJA 3VZPA 4BO4A 1HDXA 1VSVA 2Y1CA 4B7UA 3IQDB 2JD2A 1LLQA 1XU9A 1CIVA 3WBFA 3CINA 1NASA 5ITVA 2W90A 1ADFA 3MJEA 5BSEA 4RF4A 4GH5A 3K5PA 4ZQGA 2HUNA 1NBOA 4IJUA 2GRAA 3PQFA 3PGXA 1H5QA 5KJ1A 1X13A 3H7AA 1KC3A 4CM1A 2UUPA 2EXXA 1HE4A 3HSKA 1ZVMA 2NU8A 3P5SA 1JKFA 4LCEA 3KYBA 5TC4A 1I5RA 4M55A 2DTXA 2CDBA 2DFDA 3NX4A 4IS2A 3VTFA 2O48X 4WCFC 1H6CA 2E6UX 3TN7A 5K6AA 2OMEA 3ZV3A 4FFLA 2IZZA 4DMMA 1UZLA 4YWJA 2J3KA 1EK6A 1P44A 1PJ4A 2NADA 4LN1A 5I9MA 4U8GA 3ZH2A 3WYBA 4W4TA 4JP2A 3GN1A 2EGGA 3WGHA 1YGYA 2PNFA 3TSCA 2Q2WA 4Y98A 4E12A 4ZN6A 3RU7A 4OXKA 2O3SA 2XPCA 5KVVA 3KTDA 2CNBA 4ALLA 4EUEA 3HADA 4EITA 3DXFA 4G5HA 3EAGA 2JCXA 3E03A 5DCWA 1DOHA 3U3XA 4JP3A 1CWUA 2VTDA 2X4GA 1B14A 3DTTA 2C5AA 1LBEA 2WYUA 1YJ8A 1QLHA 2YY7A 3B20A 3NRCA 2XF8A 1PJTA 3ZW8A 3WSWA 5KVCA 3DZFA 4FB5A 4LMPA 3BHIA 4YAIA 1JWBB 1C0PA 1Y9EA 4M8SA 5G0WA 1MG5A 4RF5A 3RAJA 3FTNA 4E2WA 3FCOA 3GAFA 4U0JA 3QSGA 3WIEA 3TRIA 3QRWA 1XR3A 3GN2A 4ALNA 3WG9A 3KM0A 4LISA 3W4IA 2VQ3A 3DAFA 2CFCA 1DC5A 4HBGA 2HJSA 2I5PO 2LDXA 4AG3A 4RF3A 3WWZA 2C29D 3WQQA 3V1UA 1P3DA 3B1JA 2PGDA 3KV3O 3PHJA 3PWSA 4CV0A 5BNFA 1D3AA 1ZXBA 1DO8A 4R68A 5EQFA 1V8BA 3C7DB 3DR3A 4IXWA 1IUKA 1E3IA 1UXGA 1OC2A 4RGBA 4R5MA 5C7IO 1Y5RA 6LDHA 3DQPA 3L6OO 3ROMA 3JD3A 2AG5A 1R37A 1E3LA 3CMMA 4B79A 1EUDA 2BHLA 4KWHA 1Q0LA 5LDGA 5TJHA 1FMCA 1I2CA 2YQ5A 4BNXA 5A03A 2RBEA 4FS3A 2D5AA 3SJ7A 3I9OA 4OXNA 3GHYA 3ZNOA 1P1RA 2I65A 3C7CB 3GVCA 3VKUA 3ZWXA 5DP1A 2HK9A 1E92A 3LZ6A 3RU9A 4I9UA 5A3VA 1XIVA 3PK0A 1Y5MA 2HDHA 2VUTA 3EGOA 4IIVA 4Q3DA 4BNMA 2VCYA 3JD0A 1E77A 2AHRA 3OBBA 4JCOA 4RPJA 2TMGA 4JJIA 5EJ2A 4J4BA 5BSFA 1Y7TA 5F1OA 1SEVA 4NFSA 4BO9A 1YRLA 3AJRA 2I67A 1UXHA 3S1LA 1GDHA 3KVOA 4BNNA 4O6VA 2XXBA 4OGWA 3DB2A 4BO8A 4QSMA 3FSRA 3JTMA 4MKZA 3WICA 4Q3CA 3ZV5A 1RM5A 1PX0A 1T1SA 3I83A 3GQVA 4KTTE 2V6MA 3DFZA 1ZK2A 5I7VA 4J4TA 1E7SA 4K28A 1DFHA 1K6IA 3M1AA 1B2LA 4R3WA 2HK8A 2PWZA 2UV8A 3LLVA 4HFRA 3TL3A 3JQ9C 1YBAA 5TT0A 2X0RA 1U7TA 4EUFA 1OFGA 4KUHA 4BKPA 2VRCD 3Q3CA 5COQA 5G0VA 3WYEA 4Z0PA 3G0OA 3F47A 4FIZA 3X2FA 1YJQA 1XHLA 4DLBA 2Q49A 3FPCA 1NM5A 4XJSA 2AEJA 1HRDA 1VJ0A 5L40A 1WW8A 1N7GA 1CF2O 2ZB4A 3DL2A 1ADCA 2HJRA 3FTPA 4II2A 1WP4A 4AJ4A 5BNTA 1PTJA 1B15A 4ALJA 3C1TA 3U4IA 3IMFA 1U3TA 4W7IA 5I7SA 2AW5A 1AHHA 1ML3A 3E18A 4GWGA 2VOJA 4BO1A 5DP2A 4IDGA 3SEFA 3KLMX 1UXIA 2ZB7A 4XR4A 5I8WA 1F14A 1PEDA 2Z1NA 1PS9A 4I5FA 1D7OA 1VKOA 3PGJA 1LLUA 4BO0A 1LJ8A 1NYTA 4IDBA 1YQDA 2Q2QA 1IULA 3TWOA 3ITDA 4CR6A 4PRLA 2NWQA 4I1IA 4J49A 5A06A 1NPDA 3GF4A 1B3BA 4J0FA 2GZ2A 2EG9A 1GU7A 5ILOA 1BMDA 4O1MA 4R69A 2I3AA 3NAQA 3GEDA 3PRJA 4WLEA 5T5QA 1LSUA 4OSOA 5CP8A 2VZ9A 2YZ7A 4MO2A 1BWSA 3L4BC 3AFMA 4IZIA 2GASA 3ICPA 1CRWG 4BNZA 4OAQA 2JHGA 3OJOA 5K9ZA 4M89A 1ZZEA 4IMPA 1QRRA 3PDUA 1VJ1A 4FJ1A 1TEHA 1FK8A 3ROPA 5FFFA 2RH4A 2UVDA 4CV2A 1IPEA 3ADPA 4B7XA 4G81A 4CMGA 1ZBQA 1ENPA 2BI8A 3DOCA 1MFZA 3ANNA 1GQQA 1PJ3A 2GZ1A 3DBRA 1JVBA 1P74A 2O3UA 3TFOA 3MOIA 5KNLA 2RCYA 5HS4A 3KYCB 4OKIA 4BUCA 1B16A 3LT1A 4BOYA 5AOVA 4RVDA 4XYMA 4FFMA 3LQFA 3RVDA 4CMKA 4N5MA 2X9NA 4ZICA 3P2OA 1QR6A 4DVJA 2C59A 2JCVA 2A94A 4CMBA 1V3UA 4B8WA 4CLOB 1V3VA 4MIYA 2PGLA 2O4UX 4JNKA 4M86A 4NIMA 5DBFA 3F1KA 1LA2A 3ROKA 5C37A 4OO3A 1U8FO 4NH4A 5TX7A 4CMIB 4CLOA 4BIIA 4LVCA 4UVGA 4B4UA 3PFFA 5JCXA 1M67A 2QRKA 1J6UA 1EBFA 2CSUA 1P9LA 4UUOA 4NK5A 1KBZA 1MA0A 2YUTA 3D1LA 2NQTA 4GGOA 3ZN2A 1ARZA 2CUKA 3GMDA 3MJ4A 1LNQA 1GYRA 1ZKMA 3JQBC 4ZD6A 5AQ1A 4DL9A 5JAZA 4JLWA 4WE3A 1HSZA 4A0SA 4WNIA 3R3SA 1YBVA 1Z6ZA 3O8QB 1WWKA 2C54A 4CPDA 5CEEA 4OQYA 4P4NA 1WMBA 5IAAA 1SEPA 3JQDA 3WMXA 1QYWA 3D4PA 4GSLA 3BTSA 4ZGWA 4P8RA 5DULA 3UCFA 4CM9A 2Y66A 2Y67A 2D0IA 3O8QA 4GX2A 3JQGA 1DIBA 3FBTA 4L9RA 1CETA 1UXKA 4LCJA 4XDYA 5MDHA 3ETGA 4TRRA 1CQJA 2NU7A 5JCJA 5TGDA 3ZWCA 2UAGA 4IMRA 3UH1A 1GZ6A 5IDXA 3ZNQA 1ZJZA 5DOVA 5JAIA 4RDIA 3V1YA 1OAAA 3VZRA 1DSSG 2EV9A 3ONEA 3Q9NA 4IDEA 2VHVA 1UAGA 1VE9A 3AM4A 4K1LA 1LDMA 1K89A 1QYDA 1KC1A 1WVGA 2CF5A 4JBGA 1A72A 4HXYA 3OECA 2YJZA 2C2YA 2CDCA 3H4VA 5HBRA 2ZATA 5HS6A 3UW3A 1H94A 2A4KA 5JPIA 5CG2A 1F8FA 4BO5A 4E5YA 3BMOB 1YL6A 1BVUA 3G3EA 3GDFA 1BXKA 2NM0A 3QJ5A 4MVJP 4N18A 3UXYA 4BMSA 5I9NA 1D8AA 2A35A 4BNUA 4DBVO 3BMOA 4BGVA 1DBVO 1EEHA 1DIAA 3H2ZA 4I8XA 3TF5A 3QWAA 1EQUA 1M6WA 3KSDO 5TLSA 1GZ4A 4JXKA 1TI7A 2GR9A 3NYWA 4NFYA 3EK2A 1TLTA 1NR1A 4NR0A 3EVNA 2GLXA 5DDIP 1DIHA 4PVDA 2GD1O 1QSGA 1X7DA 3JQ6A 4DXHA 1DHRA 1PIWA 4EBFA 4AJKA 3QY9A 1C0IA 2D3TA 4GKBA 4R9RA 3R6DA 1U2DA 2FZWA 3HE3A 1QP8A 2B83A 3GGPA 3LF2A 4GPD1 2NVWA 1K2WA 5CDYA 5JYDA 4WGGA 3GMSA 2OUIA 1BSVA 1NQAO 1SCUA 2GERA 3E48A 4FDAA 3ORFA 4TQGA 4QECA 1U7HA 1NWCA 3TQHA 5GMOA 4YT5A 3AU8A 3VAZA 3ZWWA 4E21A 2SCUA 2O23A 4CM4A 3PZRA 2DT5A 3I9NA 1U1IA 1EUZA 1ONNA 3U4HA 2YQ4A 1M75A 1AUPA 3VPXA 1LSOA 1GY8A 4OQZA 7ADHA 3PJDA 1DB3A 4KQWA 3ZU5A 1BRMA 1G1AA 2H9IA 4FSHA 4I9HA 2C7GA 4B3JA 2VWPA 5IN5A 4J3FA 3GG2A 3HDQA 5T8KC 3UKOA 5KOIA 3ZU4A 4F6CA 1NX6A 4YACA 1UDAA 2OOSA 5DBIA 3TOXA 1A4UA 3JYQA 3E9MA 4DREA 3AI1A 3GGOA 4GQAA 3GZ4A 4MIOA 2DC1A 3I9LA 1E7RA 4IS3A 4MVJD 5A9TA 3FF4A 4J0EA 4IDFA 4P22A 4AJNA 5A5EA 4OHUA 1QXSA 2Y1FA 3FNGA 3HB5X 3VTZA 5T6BA 1OBFO 4PZEA 4URFA 4B3HA 4RLSA 5L4SA 4Z9YA 2BFAA 3I23A 4W6ZA 3L0DA 2FSVA 2AQIA 3RFTA 2BLLA 4F46A 2ZYGA 1Y81A 4KP7A 2AQKA 1SC6A 3D0OA 3QQPA 1P33A 3GHHA 4ZRNA 2Z5LA 5C3MA 5ICMA 3F1LA 3QVSA 4WEOA 1T2FA 4F6LA 3ROQA 2IXBA 4DGSA 2RIRA 4LW8A 2DKNA 2X0NA 1DDOA 3B1KA 4IQ0A 5L7WA 4XRGA 1LU9A 4D0SA 1KVTA 2G17A 3EZLA 5C7OO 3GA0A 1XYGA 5L53A 1VL6A 5T67A 3L9WA 1YB1A 4CQMD 2X9GA 3GEMA 3GH3A 4CM6A 2OHXA 4PLVA 2UDPA 2IRWA 4UULA 3U9LA 4KUGA 3U09A 3A14A 4PZCA 4NDNE 4WEQA 2GF2A 2PY6A 3EVTA 1IZ0A 1H9BA 1PS8A 1BXZA 4D43A 4AJEA 2VTEA 3BMCB 4IGFA 1QG6A 1A7AA 3ZWMA 1UP4A 4XQGA 1R16A 4BNKA 3CH6A 5JO9A 1P1FA 4GSKA 5EESA 3BMCA 4J9VA 1EDZA 2AQHA 1O8CA 4W9NC 4FQ8A 4IIUA 4ND5A 3OH8A 2P9GA 2I9PA 4HFJA 4LSWA 4XQCA 2GN8A 1IOLA 4OOEA 1TT5A 2ZTLA 4AICA 2JL1A 5ENDA 1C0KA 5IG2A 4FD3A 3W8EA 3OFSA 3SXPA 1N2SA 4HNGA 4EGFA 1FXSA 4R1TA 5ITWA 1EFKA 1LTHR 2HU2A 2A92A 3TZKA 1G0NA 4DLAA 2FPGA 2GZ3A 1O9BA 2P4QA 1KETA 4IDAA 3IKVA 2B5WA 3KETA 3WIDA 3STHA 2HQ1A 2RHCA 3DZJA 4L8VA 4NU6A 4R5HA 3MJCA 2FPIA 2E4AA 2PKQO 1N9GB 3ENKA 5JSFA 3Q9UA 4ZQHA 1XA0A 3VVBA 2H6EA 4J1SA 3DDNA 4PLHA 3WSVA 4NK4A 2W2LD 3ONDA 2DBZA 1DC3A 3AUTA 1AXGA 3EMKA 2ZJ0A 3F4BA 3OM9A 5H83A 4RPLA 3RFXA 2NTJA 2X1HA 1HETA 4GGPA 2VYVD 1EVYA 1XG5A 2BGKA 3GOHA 4K26A 2CD9A 3V5NA 3DMTC 3NDJA 1DPGA 3ZWYA 1UZMA 2W8ZA 5ICSA 4U0KA 1GEEA 3ENNA 3PQEA 4TRJA 4IGEA 4N7RA 4ILKA 4BNVA 1ENOA 1LSJA 1JAXA 2GYYA 4QFCA 3NT5A 4HFMA 2CZCA 4MPDA 5EN4A 1E7QA 3DBVO 3QE3A 4IQ8A 3W6ZA 4A2CA 1P0CA 4IM7A 2OZPA 4CMCA 3WQRA 4IPTA 1X7HA 4A10A 2B35A 2JD1A 2BFMA 3LT0A 3RC2A 1HTBA 4NBVA 1UDCA 3D3EA 3Q0EA 4R16A 4DQXA 1T2EA 2ZYAA 3UCEA 4FR5A 4YJHB 2O7QA 2R00C 4E3ZA 2PKRA 2FHSA 1MC5A 1VI2A 3JD2A 4J1NA 1W6UA 2C82A 4B7CA 3GFGA 3RUDA 1N1GA 1U4SA 3PHHA 4JGBA 4YAGA 3GUYA 2OP0A 5L95A 3PYXA 5JW6A 1NAHA 2DTDA 5TJ9A 2GGSA 2IEBA 4MINA 2EP5A 5B1YA 1J0XO 5JDCC 4J43A 2D1YA 2UYYA 2BD0A 3UHAA 3M2PA 4CMEC 2FY8A 1QLJA 1SNYA 1OI7A 2YDYA 2Z1MA 4R9SA 1YVEI 4XYGA 3RUEA 2Y68A 3HFSA 1HKUA 4JN6B 2ZK7A 3LF1A 4PLTA 4WECA 5CFZA 1DHTA 3FNHA 1Z73A 4ND1A 2OGUA 2C20A 3SLGA 3EYWA 4M1QA 1I30A 1YH3A 1CERA 2PLAA 4BGEA 3CKYA 1HWYA 1P77A 1JKJA 4DQVA 4WLNA 3UFXA 3WB9A 1Q1NA 1DIRA 3GVHA 3TPCA 1NVGA 3G1TA 4Z0HO 3E9NA 4Z3DA 5F1PA 4K6CA 1ZXLA 2B36A 3ZW9A 3LC7O 5A04A 3ICCA 4ROSA 4UVEA 3CEAA 4LGVA 4XQEA 4CL8A 1R66A 3PHGA 1BDBA 4HNHA 3AUSA 3LC1O 4E0BA 3KBOA 3IC5A 4B4WA 1XWFA 4K6FA 5ADHA 3VZSA 2P5UA 2DLDA 4CV1A 3QVOA 1P45A 3EHEA 3PYLA 3RBXA 4S3MA 3UN1A 4RVHA 3X2EA 5MGBA 4PVCA 3WFIA 4R51A 4FGWA 3RASA 5IN4A 2PA3A 5DT9A 2JKVA 1MXHA 3G79A 3QVWA 4J1QA 5TT1A 3WFJA 3AK4A 4C4OA 4DYVA 2DUUA 4IUYA 2PH5A 3WNQA 1JDJA 5G2OA 2EKLA 4UEOA 4PG8A 5FF9A 3AY3A 3UVEA 7MDHA 1H0KA 5AXBA 3O38A 2PZLA 3F5SA 4YEDA 2GSDA 3P2YA 4BQPA 1JVSA 1MLDA 2EW8A 4H16A 1VPDA 3F6YA 4RVSA 2VWGA 4DWVA 3GG9A 3JD4A 4O0LA 3I6QA 3TZCA 3QVTA 1ISHA 2NU6A 2F1KA 2FSSA 1G6KA 4NPCA 4XA8A 1PGNA 3I52A 1YB5A 3D5QA 1Y8QB 3SBOA 3GY0A 3DZBA 3LK7A 3E9QA 3K2EA 3JQEA 4BO2A 1E1LA 3DBHB 3WBBA 4W7HA 3LU1A 2G1UA 4RDHA 3WDSA 3AWDA 4INAA 2VHWA 1EMDA 3GK3A 2ZKLA 5KJEA 3RD5A 1PGQA 3SX2A 4EYEA 3M6IA 2Q1TA 3FR7A 1E7WA 5JO0A 2WWRA 2E37A 4YCAA 3W1VA 1SBYA 1HZJA 3ZWBA 4GVLA 3VC7A 4PLWA 2ZCUA 3HNPA 4OOFA 3RUFA 4YDRA 4OMUA 3BXXA 8LDHA 1P0FA 4QFDA 3ETDA 4M54A 1Z7EA 4YT2A 1L7DA 4IJKA 3ZCXA 3MTGA 4D45A 3KUXA 2VHZA 1KVQA 3ZV4A 4YRBA 3WGGA 3ZWAA 5COAA 1RM0A 3T7CA 3ADOA 4R3NA 1MB4A 4GMFA 1BGVA 1CQIA 1Q0QA 2DBVO 2IE0A 2QYSA 2X6TA 2WYVA 1T2CA 3K8ZA 3WJ7A 4XYLA 4CMHA 3I9KA 4BO3A 2PH3A 4GX5A 2C5EA 3TDKA 3ULKA 3OMLA 1C1XB 1ZW1A 4PG4A 1EVZA 1UUFA 2HMUA 5A05A 3VPFA 4RL6A 5AXDA 2JAPA 4YQZA 2VYND 3W4JA 5JBIA 3K92A 1E6UA 3U5TA 4KDFA 4GLOA 4Z3KA 4HKTA 3DAGA 1EE2A 2VWHA 1CYDA 3RBVA 3HFGA 1C3VA 4XX0A 1GYQA 1M66A 2X22A 3DOOA 3RUHA 3ZI0A 2GN6A 2D2IA 2O3QA 3BTVA 4GLLA 2O4CA 2B69A 4J4HA 1PS0A 2VT3A 3TZHA 5JY1A 4PRKA 3Q11A 1I0ZA 3SLKA 4GX1A 3NT2A 4CV3A 4FOSA 3FHLA 2Q50A 3C85A 1YS4A 2EP7A 3OEWA 4CLHA 5JNLA 2ZTUA 3UF0A 2P68A 2NNLD 3LDHA 4CLRB 2HO5A 5CHEA 1DRVA 4RO0A 4HADA 4TZKA 3PWKA 4FFPA 4WK6A 3VH1A 4CLRA 5AXCA 2X8LA 4XJTA 3S2IA 2O3TA 2ILTA 1ZMTA 1XQ6A 3QP9A 3NGLA 5K6AC 1Z75A 1FDUA 3BTOA 5CG1A 4KDEA 2C0CA 2R2GA 4WKGA 2NVBA 1PJCA 2FR8A 1U3WA 2IXAA 2YYYA 4ALMA 4UVHA 4D79A 4NBTA 1YQGA 2Y1OA 3QW2A 4GMGA 4RVUA 2JFGA 5KCZA 3BMQB 2H5LA 3RKRA 3L6EA 3Q2KA 3H9EO 1MP0A 1ZSNA 3WGZA 3RBZA 1T24A 4MIEA 3BMQA 3RIHA 3OIDA 1M76A 1MV8A 3CMCO 1W8DA 4WLUA 4E2YA 2EIHA 5EL0A 2EWMA 3VPGA 3INRA 3OIFA 2P4HX 1K3TA 2X58A 5T8KA 1JQBA 1N8KA 3RUAA 4BNJA 5KTKA 3NTQA 3S55A 1T2DA 1X7GA 2B4TO 4F3YA 3R0IA 4P4LA 2BELA 4FOOA 1H2HA 4ZA2A 3E82A 3D3WB 1P1HA 2VNAA 2ZJ1A 2QRLA 2IDZA 1KVRA 3DAPA 4P38A 3JYNA 3HJAA 2D5CA 2DQ4A 3MJSA 5LC1A 1K6JA 4L73A 4XYEA 3C1AA 3D3WA 1IYZA 2RH8A 3RJ9A 3KYCA 5IFLA 3MOGA 4XB1A 4BNIA 1S7CA 4PG5A 3TOZA 3ZU2A 3T4XA 4M87A 3HN7A 1XEAA 5BR7A 4WLOA 4BMNA 4DLLA 5IZCA 5KWEA 4WUVA 2G0TA 4GL4A 1FDVA 3E8XA 3JQAB 4CMIA 1ZEMA 2GPTA 4D0RA 1SAYA 4NNJA 1YL7A 3OQ6A 2HK7A 3CSDA 3JQAA 1B3RA 1RWBA 4I5EA 4E32A 1EZ4A 2Z95A 1XSEA 1YDWA 3GRKA 1I2ZA 2PR2A 5FWNA 4A7PA 3M2TA 5KKAA 1BHSA 4TWRA 4BNLA 1DEHA 1NQTA 1IHYA 1LRJA 2CY0A 3K73O 3L07A 3BYZA 4FCCA 1KYQA 5GZ6A 3ZGYA 4EI2A 1ZK0A 2VNSA 3O9ZA 1ULUA 3LYLA 3B1FA 5CDTA 5CAEA 5JDIA 1PR9A 1NP3A 5FYDA 3OA0A 3CZMA 3NTOA 3GGGA 4UEJA 2X5OA 4PLGA 4QX6A 4BKOA 4BNGA 4CQLB 2VUSA 1F0YA 1Y9AA 2BI7A 2W4QA 2BF7A 2HSDA 3DEYX 4L75A 4MP3A 4PLYA 5CEFA 3AY7A 2AMFA 3DOJA 1E5QA 4E5PA 3PHLA 1NPYA 4CQLA 2YV3A 1SPXA 3QWHA 1GUFA 5C7LO 4Y6PA 3ETEA 3FNEA 3WNVA 4BNHA 4ITUA 3S2EA 1PL8A 5HA5A 2EEZA 1IHXA 2FMUA 2GNAA 2C7VA 3PXXA 4XR9A 4L74A 1A4IA 1BW9B 3VKVA 3F46A 1N7HA 1U5CA 4PFJA 3OSUA 4BNFA 1V0JA 1QV7A 4YTEA 1O95A 5B37A 5HTOA 1LQTA 4PIVA 4QTZA 5COBA 2O7SA 5THKA 1BW9A 4LVUA 1DIGA 1C0LA 3I1JA 3MTJA 4JBIA 4BNWA 3GZNB 1QV6A 2CVOA 5I7EA 1RM3A 4GKVA 4YAKA 5A02A 4FFNA 3BIOA 1I3NA 3GZNA 1PWXA 4RORA 1E6WA 1LI4A 2EJVA 2ZB3A 2PGJA 3H5NA 5GZ1A 3GDGA 3HQ4O 4XGIA 4R1UA 1XCBA 1AN9A 4GVXA 2J5QA 3JYLA 1NR7A 1KY4A 3OJEA 1LDEA 3WTCA 1Q2XA 3SC4A 3AM3A 4MVJE 3ZHYA 1MX3A 5DNAA 2IEDA 2Y0DA 1O5IA 4IQGA 3WGYA 5KJFA 4YT4A 4XRRA 4RF2A 3KZVA 5DBGA 2ZIZA 1O0SA 1W73A 3K9QO 2V7PA 4OSPA 2RHRA 1AHIA 4J2HA 5HM8A 1LDGA 1X0XA 3U62A 3OIGA 3LSYA 1GEGA 4D46A 3MJVA 2JHFA 3I9JA 1ZJYA 2QRJA 1TVEA 2OORA 1FDWA 4AJLA 1M2WA 1U4OA 1GQYA 3OQBA 3C3XA 4E31A 1U3UA 2B4QA 3H5AA 4DPMA 4E5MA 4F45A 4PLZA 5FEUA 4BNYA 2EERA 1IZ9A 1JAYA 3RWBA 1VLLA 5G0SA 1Z74A 4DIBA 3F9IA 3F3SA 1DLIA 1HDGO 1Z45A 2UUOA 4BGIA 4HV4A 4IJWA 4MKRA 2DPHA 4YAJA 3DZHA 4XYBA 2B37A 1NTOA 3NGXA 5AVOA 5BSGA 3DO5A 3IL2A 4ZQFA 5G4LA 3OETA 3DTYA 3PYMA 2PFGA 4NI5A 5THQA 4D3SA 1R0KA 3RQSA 4ALIA 1ZK1A 4ZU3A 1DAPA 1H6DA 5KVQA 2A9FA 4L4RA 5DOZA 3U4CA 3AUAA 4NBUA 4EW6A 4WCFB 4A73A 4BKQA 4E4YA 3JSAA 1A27A 4TROA 1UXJA 4CMEA 2OFPA 1NHWA 1E5LA 2BKAA 4WCFA 3INTA 5T57A 4D44A 2H1SA 2I66A 1CDOA 1PJ2A 2CVQA 1LQUA 4CR7A 4XQ9A 1BVRA 2B4RO 4YYZA 1AXEA 4PLPA 1X1EA 5JC1A 1A7KA 1SOVA 1O89A 1OC4A 2VZ0A 1ISIA 5GY7A 1HYHA 4RCVA 3TZQA 3IDSA 4Y6SA 1O6ZA 1WZIA 3E1KA 4XZ3A 3NKLA 2PD3A 1NFRA 5LDHA 2E49A 4HFNA 4BQRA 3BMNB 3G49A 4BMVA 4IDDA 2Y05A 4EZBA 2FZEA 1R12A 4GBJA 5IJZA 2P5YA 3BMNA 2DPGA 4NU5A 1GCUA 4XB2A 4WJZA 2NUAA 1NFQA 1I3KA 2EKPA 3PLNA 1PWZA 2BFOA 4UVIA 1MXFA 4XCVA 4FGSA 4WNCA 5TF4A 1HDZA 5L7YA 2LDBA 3U0BA 1G0OA 2RAFA 1HLPA 5TSDA 5FI5A 4DMLA 4BHTA 1OZAA 1KS9A 2Q99A 3HWRA 1X15A 3AU9A 3U49A 1DLJA 5I7FA 4IJVA 3IP3A 4HX5A 3UUWA 5JAQA 4UREA 4YXFA 2EKQA 1Q7GA 2R6JA 5A9RA 2HMWA 5I8ZA 1N5DA 4BL5A 2YDXA 3BZUA 3D4OA 4AJ2A 4CM9D 2W2KB 1WDLA 2P9CA 2HCTA 4RJTA 2HLPA 3KO8A 3JD1A 4RPKA 1RYDA 1XLTA 4NG5A 3I3OA 4UVDA 3W6UA 4E5KA 2J8ZA 4OJNA 1PSDA 2W2KA 1V35A 5L4LA 3GVXA 5EINA 5EIOA 5F21A 5JLAA 1HSOA 5IXSA 3WS7A 4DBZA 3NV9A 3R3JA 1UZNA 2CMDA 4CMAA 4ZQBA 1J49A 3NUGA 5IDYA 3KXDA 3PLRA 3EDMA 1IY8A 1NFFA 1YO6A 3DWFA 3QWIA 3UOGA 4LK3A 2BMAA 4GAEA 4W82A 2J6IA 4E2ZA 4AJHA 3K31A 4J90A 3GFBA 3K2BA 5TRTA 4LSMA 4B4OA 1N9GA 1WLYA 4H7PA 4XEHA 3FBGA 5IDWA 3GDOA 1X0VA 4IDCA 1A71A 1NWHA 3HG7A 1MC4A 3GT0A 5H81A 1KIFA 5JS6A 4IINA 4Q3NA 2GDZA 1LDBA 1MG0A 4QXMA 1RYEA 2JJYA 1E3SA 2IZ0A 1P1KA 2PZKA 2Q45A 5L9AA 3ZU3A 1OOEA 2I76A 5ENVA 3WQSB 4O63O 1ONOA 1YBMA 2WE7A 3NT4A 3OF2A 3DHYA 1R15A 2FOIA 4JROA 4BB6A 4QO8A 4TRNA 4RQTA 1HDYA 4XIJA 3WX0A 1LC3A 2J3IA 3PEFA 2Q1SA 2ZTVA 4Y8VA 4ZQEA 1FDSA 4ONEA 1AGNA 1JU9A 5B4UA 4DIFA 1LLCA 5EPOA 3SC6A 4KOAA 3QA9A 4DPKA 3FNFA 3MWDB 2VOEA 2VRCA 1V3TA 4CM3A 1PL6A 2AXQA 1EDOA 1GL3A 1FJHA 1D1TA 2VYNA 1HE3A 3E5MA 3JQ9A 1B7GO 3KRTA 4HUJA 1VKNA 2HAEA 2Y0CA 4AJPA 4YJHA 4J1TA 5A9SB 1SO8A 4Q3AA 2PKQP 4CL3A 5AYVA 1GAEO 2AE2A 4XKJA 2EF1A 5HWSA 1J5PA 2FRDA 5A9SA 3UCXA 1JA9A 1KY5A 4FW8A 1M6HA 3RC9A 1FDTA 3IIEA 3H65A 1BXGB 2B0JA 4MOWA 3RC7A 1PQWA 3RKUA 3Q2IA 2HMVA 4CM8B 3WR5A 4AL4A 3IOYA 2CVZA 4TVBA 1BXGA 4RVGA 3AOEC 3EC7A 1DFGA 3W8DA 4D3FA 3QLJA 3WXBA 4CM8A 3RSHA 4CLEA 4R41A 4K9DA 1Y6JA 4W99A 2ZQZA 2VZ8A 4BV9A 2J5RA 3JCZA 1N1EA 4PG6A 3JQFC 1J4AA 2V6FA 3PHIA 5BSHA 1I36A 5BT9A 1A9YA 1Y8RB 3VDQA 4BS9A 1WDMA 2WDZA 3NEPX 2DVMA 4R1NA 3DBLB 1WZEA 4Z9FA 1Y8RA 1ZO8A
chains in the Genus database with same CATH superfamily
1TT7A 2PCJA 1NBEA 1DFIA 3EGVA 3O8OB 3G8AA 4Q4HB 4YBZA 1EAYA 1TQDA 2FFQA 3PT5A 4GNRA 4HGRA 3ZCSA 4NS1A 4ER0A 5KDOA 1TKCA 3JAKB 3DE2X 3MWEB 4JYBA 2PKEA 1UJ4A 1M6EX 3GCGA 3PNMA 3QU2A 2EJWA 5FBHA 2IU0A 1WSDA 3K4QA 3ANTA 4K9NA 4D41A 3IX7A 1PGJA 3A1VA 4MVJG 2F62A 4XM1A 1PL7A 4MB0A 1ZIYA 4PGMA 2IZ1A 4RVFA 3GPBA 5ALTA 4EGJA 1U28C 1E1DA 1ZSVA 1NJ6A 1N78A 1NY6A 2H1CA 3MWGA 4JNCA 1RIIA 4ND4A 3CA8A 5EZYB 4F71A 1NQUA 2QTVA 2WMYA 3L7KA 1K6XA 2HQRA 4AG6A 3DUFA 1A2KC 4XFJA 2NN3C 1LRLA 1E3QA 1R8SA 1II9A 3AOGA 3U37A 2Q0QA 1M0EA 2AL7A 1USWA 5CCXA 3L0BA 1TZBA 1FSFA 3RQIA 3ON5A 4RZSA 5BXYA 2DFPA 3PQ8A 3KPWA 3P4YA 4ZCMA 1U3VA 5BN3A 2AN4A 2AD5A 1Y6FA 1GZ5A 4NV0A 2ODEA 4F4CA 4MKFA 3ZJ5A 2HK6A 4UUAA 2FWMX 2ZRFA 1II8B 4KNYA 3IAUA 1Z4LA 2X2OA 1SUDA 3KEMA 2HKIA 3EIFA 4BB0A 4RIEA 1QKIA 2LW7A 1NPTO 2GILA 5DHAA 1VPTA 3FAKA 4K9RA 2ZJ3A 5BVGA 3QKWA 2ZZMA 1CB0A 5BWCA 5H02A 4CCYA 3SHOA 1RPNA 3E23A 2VWQA 3KLPX 1KZ6A 1I8TA 4I6GA 1W0KA 2HA6A 4H3KB 3BSSA 5KX5A 5J2UA 5A4DA 3NIWA 3OT1B 3BE5A 5JBQA 4AY6A 3SI7A 5TVKA 2QQEA 1I4LD 2BFPA 2WHEA 1QH8B 3HA7A 4G5QA 5EMHA 3ZCRA 2E1RA 3LUBA 4BQSA 3IEUA 3D6FA 4MHSA 1XZDA 3CF4A 5I7AA 5EXSA 1E58A 1YS1X 1FLDA 4KYUA 5IZ4A 4D3DA 2FN4A 4HMOA 2HMSA 2VHTA 1KQOA 1Q3TA 4BNTA 1IRXA 3EQZA 3DBHA 2IODA 4FM9A 2DFVA 4WPGA 4M0LA 2YL2A 3UB2A 3WWYA 1FW8A 5EYPA 3DXXA 3G1UA 2E4XA 1E64A 1NJSA 4CF4A 2PHZA 1Z2DA 1TK3A 1LK5A 2L69A 3H9QA 3MJTA 4Q93A 5LZ4A 3CIFA 3EISA 3SYNA 5EKUA 1ZK4A 2HRZA 1GV1A 4B35A 1PNQA 2YASA 3LKDA 1QDLB 3GEGA 3IV9A 1KXJA 1YQTA 4MVJH 4NRDA 2PD4A 4Q9NA 4AJ1A 1CZLA 1Z0SA 5JROA 2BFCB 3AP3A 4YNBA 5AJVB 5DVZA 4J7UA 5EG5A 3O1LA 4MNTA 2B2CA 4LZJA 3D1VA 1G3IA 4FNGA 4LJLA 3O9MA 4PS1A 1QVZA 2WSBA 5CJJA 4AMYA 3UM9A 1YI0A 1MVLA 4PAWA 1G59A 4K88A 3ROZA 1BNCA 5JJBA 2X0EA 3UUGA 2GN2A 3SZLA 1AQNA 2GCNA 2OQIA 4MJLA 2JZNA 4MMYB 1JG3A 5AWFC 1J06A 4MV9A 3WKCA 5E1OA 2OL4A 3GPCA 1ZK3A 4JX8A 2EZUA 1Z16A 2B4KA 5FI3A 3H5WA 3W5IA 3WK4A 1CEQA 1RWQA 2V65A 5DBEX 3RIMA 4QELA 5JJCA 4YJ2B 3PI7A 1ZR2A 1KP3A 4MLCA 4RACA 4Y9RA 3O4GA 1OVMA 4LF8B 1W0CA 3PC6A 1J8FA 2GFIA 3TBKA 3CT4A 2ECKA 3TMAA 2Q5JA 3UXHA 1U0GA 4EMSA 5C1BA 1QKKA 3S2SA 2V3VA 4PXYA 3AHCA 1MUUA 4RTLA 3GNTA 4U7HA 1TZ2A 1ZKDA 3PC4A 1C1XA 5EP2A 3HSYA 1B4DA 5GAJA 3TSWA 4QQRA 3VUFA 4OCZA 3EZYA 4FWIB 3Q5EA 2MMGA 5AOCA 1Y6RA 3BMXA 4UBIA 4UU8A 3D4NA 4WXEA 1MAUA 3HKDA 2KWIA 1ZIDA 3I4FA 1GZ3A 1TUBA 1YE3A 4PZDA 4G1EB 3U80A 1ZCAA 5L4NA 1AKTA 3OWOA 3R5TA 5K0BA 1F6BA 2G83A 2QW1A 1X42A 2ZQ5A 2QD1A 4RVCA 5BN4A 4ML3A 5KPJA 4DB4A 3N39C 3IP1A 1Q7CA 2JGDB 1SQGA 2Z2IA 3CNBA 2UZ1A 1WU7A 2FPWA 3NYRA 3PDJA 4O0MA 3RJMA 5JCZA 4OX9B 3NDBB 2DYKA 2BC9A 3HHPA 1QTQA 1RYNA 3AG6A 1L1RA 3BSYA 1OXVA 5TS3A 4AMVA 5AHOA 1IM2A 1PW5A 2JHAA 4UTXA 1IEVA 3CEJA 5JYBA 3R41A 4H0NA 2A67A 3LC2O 4RXTA 2J31A 4JELA 5DIFA 4BXOA 1FP7A 3UJAA 2Q28A 2VP0A 3NUQA 4MJXA 1GFSA 3E53A 5H3LA 3Q7RA 2GVDC 1VMAA 5AI4A 3UGTA 3ZCQA 4EJSB 5KYXA 1YHZA 2Z5FA 2CMKA 3ZNPA 1UDXA 2I54A 4J7AA 2I1LA 1WABA 3VR1A 1XDGA 1Z7YA 3QG5A 4X61A 2NPIA 2H06A 3GUZA 3UT5B 2C83A 2Y1GA 2JGMA 3QLUC 3S0JA 1LBQA 3H2HA 2EFHB 2G76A 2GEFA 3LT5A 4FDLA 1TTPB 3RVJA 2IYWA 1XZMA 2Q29A 4NV1A 1T4BA 1YKFA 4WOKA 1B8PA 1LXCA 5IC6A 1SMKA 3EA5A 1Z5PA 3C15C 3FUCA 3HBJA 1BEZA 2AJDA 2XA9A 4GKJB 1L5VA 3PJFA 2BFBB 1ADBA 1EA5A 4LPKA 2KSQA 3HUTA 2BFFB 2ET6A 4CR8A 1OFVA 1EUQA 4MDHA 1KI6B 1VHJA 3AFOA 4ZMRA 3AX6A 1D2MA 4E22A 3ZGVA 5EIEA 1G41A 2GEVA 3LKBA 1RXYA 1YD7A 3KEQA 4EHJA 4IFTA 4KWIA 1J8YF 3BULA 3G02A 4MPTA 4ESEA 1L5HA 1GKUB 3L5OA 5ALDA 1HE5A 3D4IA 4KGZA 4NZ9A 3V2GA 4DA8A 4ZOAA 1HQYE 2B25A 2WHYA 2JDIA 3FWZA 3QYFA 4D5GA 1K7SN 3MEQA 4OMFG 4KQ1A 1J24A 1A9OA 4IIYA 4L76A 5KYYA 3C6BA 1VL0A 3IO5A 4YP1A 1JHDA 1R3DA 4C7JA 1LPPA 3HP1A 4KYIB 1N2CB 3EQ7A 2OFXA 3D6TB 2PS0A 3NJ4A 4XUGB 1HA3A 2ZJOA 1R0LA 4MV6A 3C6QA 4ZC8A 3ZWPA 4PLFA 3N2EA 4AMBA 2DP4E 2YVKA 2FDXA 1EG2A 3KPJA 3L06A 5AVKA 1M5RA 1V43A 5IASA 3MB5A 4AMZA 4EDFA 1FX0B 5CDGA 2G3YA 3E4CA 3N58A 1T8PA 3A11A 4HRXA 2XBMA 1IB6A 1LNSA 2WY2D 5L51A 1PFYA 3D8HA 2NUBA 3G2KA 2O50A 3JYOA 1W35A 2WJVA 3G5LA 1EBUA 5C1OA 1DXYA 2CXXA 3LHDA 1ZFNA 2AOVA 1V9LA 3CS3A 2P9EA 3CY6A 4U02A 5AIAA 3F7NA 4W8GA 4D4GA 2V7XA 1U2GA 1YJBA 2VHXA 3S7TA 1AC5A 1GD1O 1THZA 2KBFA 3M9XA 2QNRA 5T3UA 3EZ7A 4IXTA 3SP1A 2X19A 4GZLA 1MT3A 4NJMA 3VSDA 5AW2A 4K9SA 4JLAA 2QHXA 3SMQA 5ARCA 3FFAA 3AEQB 2ZTMA 1P6XA 1U7XA 4O4LB 3EJWA 3RJ5A 4B8YA 2VSQA 4CQMA 2Y93A 1XMVA 1W4AA 2BGLA 3IS3A 4TKLA 3V1KA 3WJ2A 4J91A 4KZPA 3IMEA 4KH0A 1F1JA 4Q24A 1ZOOA 3BHJA 5I6DA 1RI4A 2LUOA 1BHQ1 1O87A 4ZDKA 4P35A 1S6YA 1H1LB 5FL7D 5IYZA 1GVHA 4W9MC 1DKQA 2ZFUA 1GGKA 3OTQA 4HWKA 2D1FA 5K99A 1VDZA 2PRKA 2J4FA 2XDWA 1ISGA 1HORA 4LMAA 3G6WA 3M6FA 1QHFA 3RYCB 3HI4A 2DWUA 5LQMA 4H7IA 3GDWA 5KKCA 4KBFA 4GGMX 5BQOA 3NM6B 1IAVA 1ID1A 2GAJA 5EP3A 4DUYB 2NV6A 4US0R 3GGCA 2C94A 3BFVA 3SHFA 4HS4A 3EDCA 2QZZA 2AZXA 1K9VF 3PTZA 1OXXK 4FFSA 1D5CA 4WLFA 5EZ5A 3VR2A 3IV7A 3HVUA 3GC6A 3ZTTA 4F2HA 1O7JA 1XU7A 2IPOA 5JMTA 3D2CA 1T8RA 4A27A 3ABOB 4YIKA 4QGSA 1K6MA 1S8OA 2VH2A 5JMPA 4ERXA 5FTLA 1Z4MA 5IYZF 4M0FA 1U81A 5JS1A 3DDZX 1W2GA 2YYZA 2P5TB 4EW1A 4LJYA 1GQSA 1O97D 2BEWA 3U13A 4BVAA 5K0ZA 2HQOA 2NSDA 1LF0A 1XEFA 3OZTA 4H1HA 1S1CA 2CCKA 5DX8A 5ADWA 3UJ8A 2H9AA 2JAHA 1SZJG 3IRUA 1DAIA 4R1SA 4BCBA 2WTBA 1DOZA 3RAPR 3FUUA 2GUGA 3JWIA 5DISB 4BVKA 2XNJA 5D5HA 3NXKA 3ABIA 2H7XA 3H11A 2RK6A 3FLAA 3NWEA 4XJVA 5IC5A 2PUGA 2GAOA 4JBHA 3RGWS 5CNKA 3ROTA 3A10A 4JT8A 1X74A 3CTMA 2RH9B 2WKQA 3FWHA 2WYWA 1MGOA 3CW9A 2DFNA 3H3JA 4JSTA 3RV3A 4EA6A 3QU4A 4KO1S 1F8UA 1L5QA 2ZJ6A 2F55A 2B5OA 5CDUA 2QN8A 2VYVA 1B8UA 4YHBA 4RMIA 3REOA 2FR0A 3Q9LA 1I2BA 3OHSX 4QASA 5FJJA 2NYAA 3K1AA 4JQCA 5JFOA 3ZJYA 1M83A 3ONFA 5ALZA 2GK3A 4L9WA 1SGWA 1E6LA 1ZITA 1GTJ1 3HHEA 2IBTA 3NONA 2PG3A 1YNOA 3E9RA 4YB8A 4C4YA 2YFQA 1QMGA 1R6DA 3TQFA 3IE1A 3HYRA 1WHSB 2X5XA 2P2SA 1T0UA 1ZU4A 3CBQA 3H5VA 3ZWQA 2AG6A 1C30A 1XHFA 1YRQA 4LI3X 3V33A 4BFLA 3AF2A 2NVOA 2RKBA 3LD9A 2PBFA 1ESZA 1E7MA 4LY9A 3HDHA 3NC4A 2QE7A 4N6OA 2R7AA 3KSUA 5CNJA 3QU7A 1DUSA 1QV9A 1AA6A 1ODCA 3P9NA 4K9PA 4U5QA 4M7RA 2P90A 2UKDA 2V7BA 3P97A 5CBPB 1Z8DA 4I7EA 4U7TB 4UW9A 1YS2X 2G9RA 4BKRA 4II3A 1Y34E 1O58A 1W0JA 3HBMA 4F4HA 5AW1A 2W2VA 4FYJA 4NCXA 1K7FB 4D97A 3G0HA 1TF2A 3O1IC 1Z07A 4OTZA 3HYCA 5WRFA 1GFWA 2O05A 3EWNA 3SHVA 3ZIDA 4D4JA 2OCGA 1WA5A 2GEUA 3GYBA 4R40A 1R4MA 1QKJA 3W7BA 3GPDG 3CT6A 4NQZA 2FR8C 2XBUA 1M7BA 2IIVA 1EUCA 1OAOA 4JL6A 4QGAA 4WLVA 2GAIA 4PGHA 3JQPA 1C9EA 1D4ZA 4MUAA 4OV6B 1D4OA 1QHYA 1QAQA 3GLRA 1NF8A 1XU4A 3HO8A 2AWNA 1F9EA 3RH0A 4EZEA 3HDVA 1MVOA 3O8NA 1IVSA 4TWAA 5D5QA 2CSXA 1PHRA 2CKDA 1SU4A 4OJTA 4PLCA 4BE7B 1KIAA 2GWRA 3CJQA 1C1DB 3D7KA 1MF7A 2QY6A 1DKMA 3D1JA 4FZRA 3U48A 2C9OA 3ORHA 5JVDB 4RQUA 1GPDG 1Z47A 2GT1A 4F2WA 4C7KA 4OFWA 3G0DA 4D4MA 3LP5A 4EW2A 1VL5A 2IK8A 3NNNA 4I1VA 1MB3A 1NKTA 5HF8A 2ZPAA 3FZNA 3DHVA 2NTVA 2X1VA 5FXMA 4DQ0A 3CEHA 1E1NA 2FPPB 1QOPB 2Y4OA 2AI1A 3JQ7A 4MV3A 5ELXA 3IA7A 2PKYX 1CS0A 2PSEA 3AI2A 4IDNA 2ZT8A 4XWAA 3W2FA 1Y6GA 2NZ8A 4J16A 1SN7A 4BPBA 1L7PA 2IYPA 3MUNA 4W63A 3Q7QA 5FLEX 1V1JA 4P4GA 2ZIXA 3GMTA 2I80A 2VAPA 4JC5A 1GGFA 5E0KB 4UHDA 5GONA 4IKPA 1YUBA 1H8HD 1WDKA 2XNKA 3B78A 3JWHA 4NPAA 5JBNA 2XW6A 5JY6A 3KB6A 4IMIB 1HFWA 1VG0B 3BREA 4U2KA 1JIUA 3ZQUA 4DRYA 2D2VA 3WTBA 3CX4A 3IQEA 3W6OA 3S1AB 3CLSC 1MU0A 4RW0A 2VVTA 4U2BA 4AJOA 1Y1PA 2ZBUA 5K2OA 3DE6X 3DV0A 1B41A 1YB2A 5LZ7A 3QV1A 2YJTD 4DRXB 4E70A 1PWYE 3RRJA 2AKEA 2Y0BA 4MI6A 2AOWA 4WZAB 3NANA 4CGYA 1CVRA 3UJDA 3V7NA 2GO7A 4EO9A 1WQ4A 2XZTA 1DX9A 4ETIA 5K3FA 3LCUA 5ANRB 2R68A 4HH0A 2KX7A 1J09A 2HJWA 2C8VA 2ECOA 2YBDA 4MRRA 2UUBB 4KC0A 2GHRA 3FRJA 4TXHA 2XD4A 3J7TA 5GONF 3WMRA 1GUZA 1ZNZA 4GI2A 4H1TA 1XKXA 3JALA 4QUHA 4JQOA 5EWJA 4UUMA 1Z82A 3FUXA 1TCAA 5B5SA 1E0AA 1ECPA 5F7OA 1Y9ZA 1Y6QA 4JKYA 1NN1A 4NMHA 3ZE2B 2Q5IA 1CY4A 2ZBQA 4INZA 1BCRB 2PGIA 1EE9A 3KHSA 1O9GA 4BRUA 2XVYA 1SXJB 2HV9A 2XMCA 2JPDA 4L4SA 1K8ZB 1DC4A 1KO5A 4K6HA 621PA 2GPJA 5BSRA 5K09A 1HNWB 3L1VA 3M5WA 2H59A 5A1JA 3KJNA 1SOUA 3UB4A 4J03A 3PP8A 3UPDA 4BU1A 3VDMA 4BEWA 4FQ5A 4BLOA 1VCIA 5ILGA 2GYWA 3TVDA 4LXTA 2P2DA 2J3HA 1SFRA 4Q03A 4YJFA 5JCJD 3MBOA 4YJGB 2O8FB 2Y4NA 4Z9AA 4AZTA 4RVNA 4XWGA 1Z26A 2O8DB 1HDEA 4HRYA 1AE1A 4YVFA 4DCVA 1U94A 1JI0A 2BV3A 3NHKA 4H08A 4Z9XA 1Q19A 3CUEF 3CVJA 3OD5A 1ENYA 4V0NA 4KOEC 5LWHA 5A2QA 1OBHA 4R7GA 3PXGA 1QIJA 3PQCA 3V2HA 3BAZA 1I5EA 1S4QA 3B5JA 4RV4A 1A5ZA 1RLMA 1UXOA 2HXSA 2VUUA 4ITVA 4JLJA 3D3NA 3JVEA 2G6TA 2XLBA 3COPA 4FMBB 2VQEB 1SQ5A 3QVLA 2O5EA 3M6AA 2ZB8A 2UXCB 2AI2A 3GQBA 4YGXB 4GZMA 2Q41A 3IP7A 4G4JA 4XVUA 4ZCIA 1KVUA 1JWAB 1L4NA 1SBHA 1JMKC 2QL5A 4ZI2A 3THXA 4C4PA 3QTLA 2OXRA 5F5NA 2Q3JA 4HX9A 1ZSYA 3LW7A 5JE8A 3JQ8B 3AR2A 3H2JA 4P4UA 4RV9A 2Q2OA 5ALLA 4PAQA 1RRMA 3K35A 4WXHA 4M0KA 4OKNA 3BXZA 3NBFA 1G7RA 1A1SA 2WU4A 4DJFC 1A5AB 1NX9A 4YO7A 5LM3A 5FLXA 2XADA 1LRKA 1T5TA 1IN4A 2XODA 4JODA 3RI3A 3TRHA 3V1MA 1U5BA 1V5IA 2B99A 1A3CA 2J4DA 1TUIA 2ZLBA 2XDQB 3FWNA 1K75A 3OUTA 4HNAB 4OK5A 3M83A 3DLHA 1CUGA 2MJLA 4B6GA 1NZFA 1RRKA 4GX0A 2WQZA 4KGXA 4Q00A 5FNZA 5TIIA 3WAJA 1Q12A 1NBMA 5JEDA 1PO7A 2IZ6A 1N0UA 2JBWA 4YAEA 3FPJA 2VRBA 5BWLA 4N39A 4JXZA 3P4UA 3QHAA 5G4KB 3PC8C 3N8GA 3QBDA 1C1HA 2N46A 1OFIA 1BA2A 1QZ3A 3AI3A 4D4HA 1SUWA 2V96A 1E1QD 3M3PA 1YB4A 1ZUNB 1E3JA 1VJ5A 1H3EA 3I2JA 4ETNA 4QATA 1A4RA 4ZP1A 2AFVA 3BCUA 4KIGA 3H9JA 3I5YA 5CFOA 1HGXA 4FPXA 3UQYS 2EWVA 1V25A 4V0KA 1QQBA 2GPSA 3L1JA 4H59A 2AG8A 3GFSA 1AUVA 4L2IB 4XPIA 1XJQA 4HZUB 1PJLA 1BG6A 1XRSB 2ACWA 2YV2A 4BWVA 1SHJA 3WXMA 4JLVA 4F1JA 1VSVA 4YJ3B 4P98A 3GCWA 4JI0B 1XDZA 4K9OA 3CINA 4RJIA 2CVPA 2W90A 2Q4TA 3DP7A 4IIEA 2WICA 2FRVA 2HUNA 1NBOA 3LVQE 4IJUA 2PDAA 2GRAA 1T9KA 1X7YB 4BAZA 5HIAA 1RT9A 5K0SA 1Y4SA 4N0MA 4NY1A 4V2IA 5IKEA 1KTVA 1HE4A 4HH3C 2IEGA 4MQ5A 2VL7A 4LCEA 3FSJX 4XXHA 1N33B 4ZI7B 1I5RA 1XZKA 2B78A 2DTXA 3MT7A 2Q9BA 3NX4A 4IVRA 5E4TA 5CCEA 4IS2A 2F3PA 1Y4DE 2O48X 2ONYA 4WCFC 2J0UA 3V7WA 4YPVA 2FW9A 3MHTA 3L41A 1ST3A 2E6UX 2EYUA 2P69A 4XUEA 3R2JA 1PT6A 2WWVD 2OMEA 1LNZA 2OENG 3BICA 4ANFA 3T1HB 3QVGA 4KAFA 4LHZA 1VE5A 4YWJA 3U9TA 2JGKA 1EK6A 1BYIA 2XWJI 1KAOA 3EF1A 4EVRA 3ZBPA 5LIPA 1GPKA 2EG5A 3AHJA 3JXEA 3NKFA 3OX3A 2OC4A 4JP2A 4L95C 4V03A 1YZNA 2C03A 2WD9A 3GN1A 1MO3A 4W4TA 3WGHA 2C4NA 2PS9A 5LB2A 4E12A 4B5KA 1W36C 1Y1SA 3DAOA 3E3MA 1J33A 3RU7A 4GYWA 4ZN6A 1OTXA 1CC1S 1QTIA 2XPCA 3C3YA 3KTDA 4LKOA 3VZCA 3TAXA 3HADA 4PPYA 4EITA 4EUEA 5BMOA 5JXGA 5FORA 3RSFA 3CNOA 4G5HA 3E03A 5AI0A 2J08A 2QV0A 5E6UB 1CWUA 1L7BA 5DIZA 2FEOA 1B14A 4BEVA 3K6KA 3QFFA 1EBBA 1QLHA 3L43A 3NRCA 4FIDA 2FSGA 3DMHA 4O2RA 3AY0A 2EBFX 3W6NA 2FPOA 3ETLA 4LV6A 2A7QA 4IG4A 2YJNA 1P2DA 1DBWA 1GCIA 3TG2A 3O2JA 3A25A 1JWBB 1YIOA 3HEAA 4UATA 3TUIC 2GBPA 1EA7A 3FCOA 1MRSA 4U0JA 3LG2A 2WIAA 3QJYA 4OFZA 3WIEA 2VUHB 5P8WA 1OXSC 3L05A 3QRWA 4GOKA 4ZOBA 3P2MA 2GBGA 4IOMA 4IYRA 4RSRA 5JWRA 4R6WA 2VQ3A 3OFKA 4RUKA 3VO9A 4RHTA 4KLZA 3WGVA 2I5PO 5AJXA 3UGJA 2AH5A 4RF3A 3BFXA 4MV1A 1P3DA 1TCVA 1VBNA 2VA9A 3B1JA 4RIIA 4R7ZA 3GRFA 4G25A 5FBLB 2CMFA 2Z4TA 1J25A 1KMMA 1Z4QA 2BEVB 1W88B 1FYWA 2EFYA 2P1RA 2CUNA 1I94B 2IIQA 5BR4A 2DKOA 3PSAA 1YVRA 2HLHA 1V8BA 3PICA 5ALNA 4A23A 4F56A 5A62A 5JQGA 1E3IA 1E3TA 4RGBA 6LDHA 4UOEA 1PUJA 3JU3A 1CU1A 2P4SA 2QD5A 2RE8A 3BAFA 1MJFA 3JD3A 2DY0A 5FWXA 3K0CC 5H5JA 2Z09A 2FWNA 4W5JA 2OGSA 2C88A 3E7PA 2DX7A 2MSDB 3PG5A 2AJ8A 2CVFA 5KNCH 5K8VA 1N7IA 5TJHA 1VLVA 2Q4OA 2W2NA 5JQWA 4R2MA 4OATA 2QB5A 3MLBA 3FVWA 1M1UA 4M9QA 3VNUA 4K6OA 2RBEA 5IM4A 2EQ5A 1PFGA 2FFAA 4I4IA 2YJ6A 3DFMA 4FGUA 1UKBA 3M5DA 1XC7A 1P1RA 3GVCA 2KMLA 1M2JA 1TEVA 3DLIA 5EXDA 3VV2A 4CF6A 1CUVA 2JGFA 1OFUX 1T5SA 1FX1A 4C2AA 2HK9A 2QMOA 3LZ6A 1TEZA 3LP8A 4N8EA 5A3VA 5E9JA 1Y5MA 5JQGF 1XI2A 2VUTA 3EGOA 4IIVA 3KJXA 4FYMA 2VCYA 5THXA 3JD0A 3TIGA 4BNMA 5HQTA 2AHRA 2MTBA 3FXAA 3KQUA 4LF9B 3MK31 3OBBA 4BDSA 2G4CA 4YP9A 1QG2A 2WABA 2R25B 3T9CA 4HG2A 4NFSA 2VJCA 2XQGA 3ED1A 1UXHA 2WYHA 2Z57A 3RF6A 2PO7A 3L8HA 4QBHA 2QA5A 4QU8A 4GR9A 3SX4A 4BNNA 4O6VA 4EFKA 2XXBA 3GFPA 4QQKA 4QSMA 5IM4F 3FSRA 5DYGA 1ZVJA 3WICA 4E4TA 1XTZA 3KEGA 1HYQA 1BU8A 1CQIB 1A9XB 1RM5A 1PX0A 4MW9A 1T1SA 3TCNA 4BFSA 3LVRE 1D07A 2G36A 3UWSA 5L3QA 4MQFB 1ZK2A 2X76A 3RF7A 3SIRA 3A0UA 1E7SA 3AYXB 2GRUA 1NVVQ 2P0AA 4X6LA 2IYXA 3TXYA 1U0NA 1C5KA 2B34A 2TS1A 1LY1A 1RYYA 4K3UA 2UV8A 4JY7A 4Y0VA 1XXHB 4EB0A 2BHNA 2X0RA 1U7TA 2EOAA 1W4BA 4F96A 1DDIA 1OFGA 4KUHA 3QLVC 3O8BA 1VJCA 2E6KA 3JWJA 3E70C 3G88A 2HBYA 2VXOA 4KLCA 4NQRA 2Q6OA 2NP6A 2V98A 3QENA 4C20A 1KI9A 1XHLA 4OPMA 4TMKA 1VKJA 3IT0A 2FRDC 1NM5A 3GAMA 1E6MA 4E4RA 1D6MA 4B45A 4XJSA 4HR7A 5LB4A 2AEJA 5L40A 5T6MA 3GAAA 4C7XA 3O73A 1CF2O 3KJGA 3NOXA 3WLMA 2HJRA 2VDVE 5BV1A 4DJEC 1V8OA 1WP4A 1N6IA 3C3EA 1PYOA 1FFCA 1IC6A 3C1TA 3U4IA 4AJ9A 3IMFA 2ZYRA 2F2TA 4EHFA 1RQGA 2VDPB 1VHQA 3G8CA 3OZFA 1FLNA 4RHFA 4W7IA 4US2R 2AW5A 1GNLA 2ZSAA 3W34A 1AHHA 4GWGA 4QEKA 4Q48A 3DKPA 1LH0A 4BO1A 3T1YB 3SEFA 3UJ3X 2ZB7A 1NW7A 4CL2A 4EG3A 1LVUA 1PEDA 1M2VA 3LWNA 1T9CA 3BWBA 3I2GA 4I5FA 1E89A 2GSWA 2RH5A 4HOYA 1NLMA 2AV6A 3FDXA 4H35A 4HZIA 4FCVA 4XUCA 4IDBA 1NYTA 3EEFA 1IULA 2KBEA 3E7DA 4TLBA 2E89A 3MW8A 5LLTA 5DGCA 3RYIA 1Z0KA 3BDAA 5LLDA 4QG3A 3T9EA 1B3BA 2CJPA 3REQA 4MRNA 1M54A 1WLSA 1Y3AA 1RFLA 5KTSA 4O1MA 4HPXB 1O54A 1PFKA 4WFIA 2V6IA 4W5NA 3QEOA 3OBIA 1AD2A 5CP8A 3IBTA 4FHEA 3R3ZA 2EATA 1EXDA 4MO2A 1JKMA 5BR8B 1OKKD 2OB2A 5K8UA 3AFMA 2QP4A 4Q66C 1X1DA 2HWUA 2ID9A 3ELBA 1K4MA 4U7FA 4O08A 4DLWA 4RIGA 1K7EB 5E3HA 1JDVA 2LKCA 3OJOA 5HFAA 5K9ZA 3C2QA 3HB9A 1ZZEA 3P9RA 2E2WA 2II6A 4G5FA 1PVVA 1IMJA 1A9PA 3PDUA 4UKDA 1FK8A 2NPOA 4B3GA 1NATA 3I28A 3GLGA 3LPAA 5JEEA 2RH4A 3RVPA 5CA0B 2FMFA 3TD2A 1TA0A 3KXPA 2PGNA 4N5HX 4IEFB 4GXQA 3PQ2A 5EC8A 3ZU6A 5KTTA 1NQVA 4CMGA 4CQJA 1ZBQA 2CL0X 3TZLA 5B2EA 2OGTA 1P9WA 1DIOB 3Q5DA 4UASA 3DBRA 2QT0A 2BWJA 5EKXA 4ZMSA 3KSBC 1JBQA 5HS4A 1OBVA 1B16A 4QTUB 3WQBA 5JSUA 2D5BA 3NM4A 4FFMA 1N4DA 3P2OA 5CDHA 4WADA 2QSJA 4DVJA 1ND5A 3HVIA 4GDMA 5EMNA 4J2TA 1DUIA 1WBDA 4B8WA 4CLOB 2PBZA 3UJ9A 2JATA 4C6SA 2BKXA 2O4UX 1L4BA 5DBFA 1Q92A 2PM8A 3FUVA 3WISA 1SKBA 3F1KA 1I80A 4Q12A 4LNHA 4CKCA 5A3QA 3AFGA 3AGQA 4PV7A 5IBCA 5JZ9A 1P0MA 4MPRA 2P0YA 1PF7E 4HATA 5DN6A 5ECWA 1NZJA 1PLKA 4UVGA 1L1QA 3AJ8A 5JCXA 4YUAA 4D02A 1M67A 3HLYA 3JARA 4YX9A 1P9LA 3KTAA 2G4LA 5C3UA 1DQNA 3N70A 4F91B 4N3NA 1G21E 2OBBA 3GCXA 2YUTA 2VXCA 3NHWA 4YMSA 3R7FA 4GGOA 5C5DA 2BHTA 2PMKA 5CVVA 4NYIQ 4CIDA 2ZSUA 1G7CA 1GYRA 2R6GA 2WHQA 1F6DA 4WTOA 4L4UA 2EKZA 5DSXA 1W9MA 5MHTA 1NJ8A 3PHCA 2CXTA 4WKOA 4IAOA 2XIJA 4PNEA 2CLKB 2FE4A 4BVLA 1X7XB 4LYGA 4Q0MA 1DKNA 5DW3A 1F1BA 2C2ZA 1CUYA 4AZ0B 1F9AA 3ODGA 3KAKA 1YBVA 3U7IA 2QTHA 4RA6B 1Z6ZA 2QRVB 4FMDF 4CPDA 2C54A 2RAPA 2YY6A 4OQYA 2XMZA 2H4YA 1SEPA 1QYWA 1QGDA 4UOZA 2P5SA 2XYHA 3G7SA 3Q0TA 2Y66A 4O5AA 3O8QA 4GX2A 3JQGA 1MA3A 3DPIA 3LLMA 1IMOA 2DEUA 1XTQA 4QIHA 1GQRA 2NZYA 3F0TA 4YRLA 1CETA 1SUBA 1GZDA 3MIZA 3WP0A 4XDYA 3EPKA 2NYRA 3QEBZ 1CQJA 2RKWA 5JCJA 4A0GA 2FQQA 3ZWCA 1JHOA 2UAGA 5IDXA 1GZ6A 3ZNQA 2HJHA 2DZDA 2R1VB 3TS1A 5DOVA 5JAIA 1KY2A 3CX8A 2ZVQX 4FEEA 2GZAA 4NEHB 4LK2A 2OZEA 1OAAA 5G02A 5IXJA 3VZRA 4RS3A 2X9QA 3ELDA 4HN4B 2EV9A 4IDHA 3K9GA 1R74A 4HXGA 4K1XA 1CR4A 3KT3A 3C6KA 3VPAA 1U8YA 5CLHA 2Q5FA 2N0SA 4CHTA 3D0KA 1DO0A 2H1OA 1HG0A 3LSTA 1LDMA 2B9EA 3OCZA 1QYDA 4IDOA 1RHMA 2CF5A 4ES6A 1COZA 4UZFA 1N32B 1X86B 4JBGA 3AUXA 3OECA 4WESA 2YJZA 1GCAA 4CU2A 4CKEB 1IXZA 4Y9UA 1H94A 1Y7LA 4QNMA 1Y7HA 1SD1A 2A4KA 4GI5A 1NY5A 4R0VA 1JH8A 1DBPA 5IVPA 3C3KA 1BXKA 2JLAA 3RLIA 1QGOA 2ZW9A 4G37A 3OIUA 4WFJA 1NXSA 4LDNA 1D8AA 3LQKA 3U7EB 1ZAYA 2WF8A 3B6MA 2FXVA 5CTAA 4QYIA 2VJYA 4BGVA 1UQUA 3A1SA 1HZZC 4I8XA 4BX9A 4ZKDA 4R7TA 2L2QA 1M6WA 3KSDO 2P2NA 1GZ4A 2GCIA 3L6UA 4M88A 2GR9A 3S2UA 4DR2B 5NLLA 1UWLA 1YZLA 1ZIPA 3V00A 3ZZ1A 1U7DA 2ATEA 2WSSD 4RGYA 4TL6A 1NV9A 2R8YA 2WF9A 3SQMA 5KUTA 2B7BA 3C8UA 4B3SB 3R7SA 1X7DA 3GH1A 1DHRA 3GL9A 1B8NA 1ZONA 4LOJA 2OBLA 1JZQA 3ODPA 4GKBA 4LFBB 4JQZA 1F3LA 2V45A 1QP8A 4EJ2A 1WQ1R 3GGPA 2YVLA 3U4MA 3PBKA 2OUIA 1NXTA 2V0NA 3WYDA 3U7GA 3A58B 3ORFA 4EF4A 1LJUA 3ZXSA 1NWCA 3TQHA 1KIMA 3DL0A 1IQUA 3F49S 3UATA 5B1DA 4ZZ1A 3ZWWA 4QT4A 2OM6A 1PUIA 4CM4A 3PZRA 3WLKX 2J0VA 3FJYA 3I42A 4FYKA 2I4IA 2IUTA 3LGAA 1XQ9A 5JTUA 4GKAA 4C7OA 4X3CA 5AKHA 1EH5A 3R7WB 1AUPA 2AMYA 2QZJA 4RFVA 5ALJA 1UMBB 2QP9X 2W6CX 3VU8A 1C3OB 3CGWA 5BVHB 1SU7A 1WXXA 2RBKA 3PJDA 2ZE6A 2WJGA 3ZD9A 4RY9A 3DEKA 3F7MA 5CK4A 4EKIA 1BRMA 4EO4A 2H9IA 4FSHA 3MCZA 4B3JA 4UHCA 2AYXA 3GG2A 3HDQA 3UKOA 1C9DB 4BVEA 1EESA 2JGJA 2AFHA 2OOSA 5IHPA 2YZGA 4D6YA 1A4UA 3KB1A 3IXLA 4Q02A 4KXWA 4TQ9A 1Z6TA 3NYIA 2WJHA 5A5DA 2GX6A 2OAP1 2HPZA 3GGOA 1N2ZA 5DV9A 4RJLA 1ETUA 3IPAA 1UM9B 2J6CA 4IS3A 4MVJD 2BJWA 5A9TA 1P73A 4L50A 4WKCA 4KRYA 2X0KA 4J0EA 1S7GA 2XRYA 3FNGA 2XGSA 2C00A 5CYPA 2WUEA 1CUHA 3PUHA 4URFA 2XB9A 1ZRNA 2HBZA 4DY6A 2FG6C 1H3FA 4OU4A 3UT0A 4BQEA 5L4SA 3O9VA 2BFAA 4Z9YA 3OPVA 1V5WA 3SFTA 3RIEA 1V71A 1WX1A 4ASUA 2AQIA 4I4TF 4TGLA 5ED4A 1S1MA 4MAFA 2BLLA 2ANCA 2VPIA 1NBWB 3AESB 1MIOA 4KP7A 5GM2A 4HNTA 1JEYA 1RZ3A 3D0OA 5DTJA 3ZBTA 3D7NA 4PONA 2OCXA 1RRFA 4JUAA 3Q4GA 3GHHA 1PLJA 3E2IA 2YC2C 5AXDA 2QVYX 5I3CA 4LZZA 5DI9A 3S6JA 3W04A 2JH8A 3WLSA 3QVMA 2AF3C 4H9GA 4IXDA 3VQTA 2W8BB 3VISA 1J1IA 3UMYA 2IYSA 4RK0A 4LW8A 3KUCA 2DKNA 4JR2A 3B1KA 4XRGA 1AZWA 2IL1A 4M22A 2X1LA 3W2HA 5CFNA 1KVTA 2I2AA 3SZOA 3WHPA 1FFAA 1KR2A 2VJBA 5KQGA 1IONA 2I6GA 4TMYA 4BFYA 1J7KA 1I7SB 2HA7A 1W85A 3IHTA 1EU1A 1RJFA 1W44A 3LA8A 1UQRA 4OQXA 1G3QA 5JD5A 2UDPA 3CLHA 5H3CA 4UULA 5HP4A 5LQUA 5F2OA 4BNDB 2H1VA 3U09A 4GT1A 5EE9A 5FV7A 2GF2A 4A0RA 1H9BA 1VIDA 2HA0A 3GJ0A 4QDZA 4R1QA 1TQ8A 4IILA 4IGFA 3UTDA 4ARVA 3HXMA 1QG6A 3SPXA 3NHLA 1RAFA 3ZWMA 1UP4A 2Q3LA 4CIBA 4OQDA 1QIDA 4H7FA 2B3DA 2HC9A 1QIGA 2C9DA 2QMHA 3LQ1A 1CQPA 3ICOA 3LZCA 3L7DA 3Q1KA 5LA6F 3TCXB 2MHCA 3PC3A 1YHNA 2W6ZA 4B71A 4JVMA 1Q0RA 4M1EA 5TEVA 2P9GA 1XD2A 2AJLI 2I9PA 4HFJA 2CNKA 3PPYA 1X7ZA 2GN8A 3F74A 5FCDA 2EX4A 1TT5A 1MDBA 3DMFA 1BX3A 2JL1A 1E2FA 1GGHA 3K5HA 5IG2A 4FD3A 3W8EA 5FWYB 1VLJA 1OWPA 1N2SA 5EAIA 1NVXQ 1I13A 2AHOA 4HNGA 1F4PA 1NRWA 3COVA 3CRW1 3AEKA 1LTHR 3QBVA 5IULC 4OHCA 4LVNA 1ZR4A 3IAXA 2BFDA 1LTQA 4DIKA 2A92A 5E1DA 5I8PA 1G0NA 4JJ4A 2ZYTX 4CBVA 2ZXUA 4Y9SA 1F5SA 1QVRA 2P4QA 3P71T 1XPRA 2ZSKA 3T7JA 4OI0A 1L4HA 2OV6A 2PX4A 1FE8A 1PZMA 1UZAA 2M2IA 2RHCA 4S1OA 1HV8A 1T0HB 1ONSA 4CKYA 1FDOA 1K98A 2QG9A 3N8NA 1WCIA 2E4AA 2PKQO 3A2NA 3ENKA 3F3KA 3OIVA 3X43A 5JSFA 4LF7B 2WTMA 1ELOA 2FJUA 4B9AA 1XA0A 4KEAA 2VF7A 4R2KA 5IFKA 1RMQA 3DDNA 2HXYA 2PZAA 2HOQA 2W2LD 4EJFA 2DBZA 2XMQA 4D6XA 1CDZA 1RP1A 1AXGA 1OI4A 4M7PA 1TJ4A 3COZA 1E5XA 2NT3A 4M46A 1F7VA 5HMMA 4R83A 2BSAA 1ZCFA 1B74A 1NI4A 2GNOA 2PS1A 3RFXA 1ZICA 4RD6A 5TQJA 4C87A 2VH1A 5CD9A 5KSYA 4P5DA 1RMYA 1O94D 1N5LA 2G70A 4CCAA 1D6JA 5GWXA 2WQ6A 3ZWYA 2G9NA 2W8ZA 4JT9A 1GEEA 5MN6A 4TRJA 1HEIA 5AK6A 5AKKA 1U0RA 2ZR9A 4ZZ3A 2HIHA 2RONA 1F4VA 1XNRB 1OIWA 5BN1A 2J87A 2K4MA 2A9JA 4HDKA 1HTTA 4QFCA 4HFMA 4UD6A 1OWLA 3IMGA 3LVBA 3RYCA 5D01A 3NG1A 3OQJA 2O07A 2UVQA 3DFKA 3OF3A 1G7TA 4ATNA 5C53B 3W6ZA 3CGGA 3ZQ6A 4IM7A 2OZPA 2X2PA 2YNMC 5ALQA 4JYMA 4DMHA 4Z8XA 5IVDA 2YR0A 5AOAA 1X7HA 2B35A 1KYVA 3IOBA 3VC1A 4DADA 2JD1A 4RJKA 1DT5A 3ZWKA 5JRJA 2V7UA 4TTIA 1U0JA 3A6PC 3HA2A 4KACA 1LBTA 1UC8A 3FYUB 4Q9JA 5J9FA 4P2BA 3VYUB 4A8PA 4REOA 2EKBA 3O4IA 5CT9A 3H18A 3GMIA 3UCEA 5IAKA 2R00C 5B1H