4KWHA

The crystal structure of angucycline c-6 ketoreductase lanv with bound nadp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
GNLTGKTALVTGASRGIGRAIAEKLGYAGALVAVHYATGADAAAEVAESIEKDGGRAFTVKAELGVPGDVDVLFEGLERGLKERTGATDLDILVNNAGVMAMGAPEEVTPEMFDRMMAVNAKAPFFIVQRALSVMPDGGRIINVSSGLTRVASPDQVTYGMSKGALEQIALHFSRHLGSRRITVNSVAPGSTDNGSALFQIPEVRETLSQLSTFGEVAEPAAIADVVAFLASEDARWITGAFIDASGGTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Reductase homolog
publication title Structural and functional analysis of angucycline C-6 ketoreductase LanV involved in landomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces cyanogenus
total genus 90
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kwhA00
3RASA 5I9MA 5K9ZA 2GD1O 1QLHA 5AQ1A 4ZD6A 4R4JA 3ONFA 4ND1A 5T57A 1MGOA 4ND5A 1HEUA 1I8TA 3AI1A 1DFIA 4YQYA 3RUAA 1KVUA 2C07A 1CETA 4YXFA 2HK7A 3KV3O 2HJSA 5A02A 1ZK1A 3FNHA 4IIUA 2VHZA 1U9JA 5THKA 3D5TA 1CERA 3O9ZA 2B83A 1U3TA 3KRTA 4NJMB 2ZYAA 4WEQA 3WX0A 5JNLA 2X9NA 3C24A 4Z9XA 2ZTMA 4B3IA 2UYYA 2E82A 2IZZA 4BOYA 3NUGA 5COQA 2EV9A 4GQAA 2A94A 4QXMA 1C1DB 5TQVA 3H5AA 4M8SA 3RJ5A 3AUTA 4H7PA 1I32A 1QMGA 2RH8A 3N74A 4IDEA 4GMFA 3LLVA 5L45A 4BB6A 1JKIA 1KIFA 4JJFA 4XA8A 2AMFA 1BDBA 1X1EA 5DF1A 5AYVA 4CMBA 4OHUA 1F8FA 3PPIA 4B7UA 2UUPA 2XXBA 4XCVA 5U1PA 5JSFA 4I1IA 1ZXLA 3O26A 4L4RA 1ISIA 4DREA 4EBFA 2DU8A 2AXQA 4KDEA 5BSEA 4JROA 4FB5A 1LC0A 2C5AA 4Z9YA 1AHIA 2HMSA 3OQBA 3ULKA 1GZ4A 3IMFA 2VWQA 4LISA 3QWHA 1GEEA 3PIIA 4NU5A 1BSVA 2NTNA 2BI7A 3RC1A 4ZQHA 3QWFA 1U2GA 1E3WA 1NNUA 1MP0A 3EAGA 2C82A 4YJGA 4IGEA 4DXHA 3GRKA 2PR2A 2Z95A 4FGWA 4FJ0A 1BDMA 2P5YA 2Q3EA 3GUYA 2VZ9A 4BMNA 1PWZA 3IUPA 1RKXA 1DAOA 2X5JO 2Q45A 3EZLA 4DPMA 5JFOA 2AEMA 1R16A 2VNAA 3PHIA 2AQ8A 2Q2WA 3H5RA 3UCFA 1H2BA 3CPSA 2V6BA 1HZJA 2DTDA 5KJCA 3Q1LA 3IIEA 5EMHA 3WS7A 4IY1A 4YACA 1V3TA 4B7XA 1NXQA 4QO7A 1E3IA 3VPGA 1I5RA 2PZMA 1H94A 2C7VA 4NU6A 2O3UA 2YV1A 4U8GA 3I9MA 4BGEA 1IZ9A 1I2ZA 3JYOA 4PLPA 1UXKA 1C0IA 1EDZA 1JAXA 4QSMA 4W7IA 5C5IA 3ITKA 3TNLA 1YOVA 4E30A 1XKQA 3BAZA 1KEUA 1ONPA 3JYLA 4RPKA 3E9QA 2NNLD 2X9GA 3T7EA 1KY4A 3I83A 3VPFA 1SEVA 3X2EA 5JY1A 3T7CA 5AXDA 3T4XA 4N5LA 2NQ8A 1X0XA 3GT0A 3OEYA 3PYLA 4HFRA 3H7AA 4HNHA 5JO0A 3H4VA 2FZEA 2BRUA 2J5RA 2OBYA 4ZQBA 3O03A 1PGOA 3AFNA 2CDAA 2O3RA 5G4LA 4MVJD 8LDHA 4UULA 2P9CA 4CM1A 2P5UA 3RQSA 1U5CA 3H8VA 4DPLA 4O59O 3QWBA 4BV8A 3PDUA 1R6DA 3HSKA 2QZZA 1ONOA 2OP1A 3QE3A 2NSDA 2NU7A 4PFJA 3JQBA 3HADA 2Q2QA 2AQHA 4MIEA 1ADGA 2FZWA 2GDZA 1I3NA 4GWKA 3ZGYA 5JCJD 4XGNA 4B3HA 1T4BA 3KLPX 3DO5A 1UDBA 2G17A 3WWYA 4NBTA 1K0UA 3GNTA 2YV2A 4HFNA 1DO8A 4E6PA 3WSVA 1RM0A 4DL9A 1Q7BA 3MEQA 5L53A 1KERA 4D0RA 4CM8B 3A06A 5EESA 1KOLA 1C1XA 3OM9A 1JN0A 2W2KA 2ZCUA 4GBJA 1FF9A 1IHXA 2X9VA 4BV9A 5GY7A 4WEOA 2A92A 5FF9A 3WMWA 1TLTA 3HJAA 1A71A 2AW5A 2GZ3A 3IAHA 5ILOA 1EFLA 3K92A 1LLQA 4KTTE 4EW6A 5KCZA 3RROA 1OC2A 1EMDA 1YONA 3VH4A 3JD1A 1NPTO 3M6IA 4EUEA 2WWRA 4WLEA 3JQAA 3R3JA 5H82A 4LK3A 3NDIA 1Y81A 3A4VA 3INRA 1DIHA 2WMDA 5L9AA 4JGBA 1QYDA 3C1OA 5BSFA 4NBRA 1ENYA 1ZVMA 5KJEA 4QFDA 1LJ8A 1U2DA 3NEPX 1WXDA 4IDBA 4XRRA 4J43A 1QYXA 1YQDA 4IZHA 3E48A 3V2GA 3AU8A 3UCXA 4TKMA 4TKLA 4BGVA 1R12A 1U5AA 4BUCA 3EC7A 3ZV4A 4CMCA 1BXZA 4AICA 4Z0HO 3AUSA 4EJ6A 5HS6A 3DTYA 4ZGWA 1H6DA 2QZ9A 2WD8A 1MXFA 1MA0A 4KDFA 2GR9A 1C3VA 2D2IA 2ZB8A 3PXXA 4BNMA 3GPIA 3RUIA 3AOEC 1DIGA 1TVEA 5JYEA 4BO1A 1SMKA 2QRKA 2NQTA 3OECA 4WECA 3L9XA 1O89A 1GL3A 5JAIA 1A5ZA 3BXXA 2FN7A 5IF3A 4MVJF 2VTDA 4OGWA 4U0KA 4D0SA 2YYYA 4MVJG 2GGSA 2DBVO 2FR1A 1ZW1A 5I7FA 4QX6A 4UEKA 1PS0A 1VSVA 4UVEA 3TJRA 1WDKA 3H65A 5JAMA 4XX0A 6ADHA 2BFOA 4JLWA 1P33A 4G81A 4XB1A 2X1HA 2D5CA 2R00A 1R4MB 3FTPA 3DBRA 4GX2A 1H5QA 4AJ4A 1AHHA 3Q0EA 1E6UA 3RU9A 1T2CA 2B4QA 1DB3A 4KUGA 2BHLA 3ADOA 3IJRA 3PGXA 3AJRA 3VOSA 3AM4A 4R3WA 3WJ7A 2X7HA 1Q7CA 1GY8A 2Z1NA 4J2HA 1MC5A 3VZRA 1M67A 4UVGA 1UR5A 2EWMA 3IQDB 4J7CA 3ZWBA 3ONEA 4GL4A 3RWBA 5T8KC 2VUSA 4BGUA 4YT4A 4NJMA 4CL8A 1M76A 3L9WA 2V6GA 1U8FO 1I24A 3D3WB 4R1SA 4FFLA 3IDSA 3TL3A 3WICA 1W73A 4Z3KA 4IGFA 4NFSA 4RZHA 4GSKA 3LC2O 4L74A 3OMLA 1P45A 4CV2A 1IB6A 1T1RA 1X15A 5CG2A 3NTQA 1R4NB 1U1IA 1PZHA 3GN2A 3C1AA 5A1TA 4HY3A 1C14A 4RORA 3WDSA 2F00A 4B4OA 1LSOA 5KVVA 2EXXA 4LRSB 1B3BA 4BO2A 4G5HA 1HXHA 2GPTA 5TIIA 1GUFA 4Y6PA 3RCBA 2J3KA 1JKJA 1E7WA 1EVJA 2G0TA 5AXAA 2YFQA 1GYQA 4NG5A 1LA2A 3NDRA 5DN9A 5HS4A 1LSUA 1I30A 3TOZA 5CDTA 8ADHA 2QG4A 1XSEA 3UGKA 4YAGA 5AXCA 1UUFA 3GF4A 3DAPA 1U3WA 3KB6A 4QFCA 3B1KA 1O9BA 1JAYA 3PQEA 1ISHA 4A2CA 3RUHA 1H6AA 4NHEA 3GVIA 1BTOA 3QVWA 3FBTA 1JVBA 2OUIA 1VJ0A 1E3LA 1S6YA 3PI7A 2DVMA 3Q3CA 5GZ6A 1Y5RA 3WR5A 3K73O 3PVZA 4RPHA 3H3JA 1OC4A 5JPIA 1HDZA 5COAA 3RKUA 3NTRA 1GAEO 2NM0A 4MP3A 4YWJA 1SB8A 4IXTA 1B8VA 4PG5A 4BO4A 3KYDB 2PD4A 1P77A 1BW9A 1ZKMA 1F12A 2CD9A 3FRJA 4TRNA 1E1LA 3WLEA 3VZSA 5IG2A 5IZ4A 1LI4A 3DEYX 3DR3A 5CP8A 3JQCA 1AXGA 2NWQA 3S2GA 1ENOA 3FPLA 4OM8A 1SBYA 2NU6A 4WE3A 3JQDA 1EZ4A 3U4DA 2I66A 4H15A 3N7UA 4LRTB 4K28A 1GZ6A 4JCOA 2VWGA 2VYND 2ZK7A 1U28A 1GFSA 3ZV3A 1Z74A 1Y5MA 4AJKA 1R0KA 1SZJG 1E7RA 3GAFA 4JIGA 3GQVA 2H1SA 4FJ1A 5KJFA 4H16A 2VWPA 3C1TA 5JLAA 3E82A 4N18A 3RC2A 4PLZA 1YBVA 2HO5A 3ZWYA 3I6IA 3NDJA 4WLNA 3CUKA 4CR7A 2OBNA 3TN7A 1DAPA 3FWZA 4NIMA 4RGBA 4XYBA 4AJPA 4MVJM 2JD1A 5L7WA 3JQGB 9LDBA 3UHAA 3GN1A 4BMVA 1Y6JA 4AJJA 3M2PA 4I9HA 1FK8A 1PGQA 3U4IA 2BGMA 1KC1A 3ICCA 4J90A 1XQ1A 4P22A 3ZWWA 1DLJA 3GH3A 3C7CB 4PIVA 4II2A 3D4NA 3G1UA 3B70A 4ZVVA 3GEGA 4GX0A 5DOVA 2EKLA 4YAEA 5IJZA 2ZB3A 4Z3DA 3RD5A 3MCVA 1LDEA 1PL8A 2OHXA 3HFGA 1EE2A 1NM5A 2V7PA 4PLWA 3PHJA 1I2CA 5JCXA 4CLXA 4CM8A 2I3AA 3GGOA 3FR7A 2Q1WA 4I8XA 4NDNE 4PRKA 4D42A 1AGNA 3JQ8A 3WBFA 2NLOA 3DZIA 5ER6A 2CUKA 3S55A 4E13A 2R2GA 1GEGA 1MLDA 2OOSA 4CMAA 4I08A 2IODA 3CXRA 4W82A 3DFZA 4K6FA 4UEOA 3DTTA 2H5LA 3K5PA 3CH6A 3ABIA 1B16A 2E49A 2YY7A 3FCOA 3INTA 4FC6A 4M55A 4XDYA 1EK5A 3ZW9A 1M75A 2JAHA 3EVNA 3IUSA 3ZWPA 1WAMA 4PCVA 1LDGA 4BNFA 5IDXA 5I9NA 5MDHA 1DIAA 4P4LA 1Y7TA 3HUDA 4EDFA 5U4QA 3L0DA 4RVDA 1F06A 2CF6A 3RC9A 4ESOA 1D3AA 1ZJYA 5F5LA 5B1YA 4GWGA 1XLTA 1PL7A 1EVIA 3BTUA 5HA5A 3CMMA 3S1LA 2WYUA 4L9RA 4CM3A 1LRJA 3IL2A 3JYNA 4E2YA 1PQUA 1PR9A 5TNXA 1N7GA 5EQDA 1H9AA 2R6JA 2VHYA 2IYOA 4BNIA 1YBMA 2CSUA 4GGOA 1PJ2A 4E12A 3I9LA 5IXSA 1HSOA 1B15A 2AEFA 2WE8A 2Y0DA 5L4SA 4M49A 2HMTA 3QVOA 4OO3A 4EEXA 3JQ7B 1GUYA 1CYDA 5AOVA 4WUVA 3W8EA 4AJIA 4URFA 5IDWA 2NU8A 4Q3BA 4LSMA 2P91A 3K30A 4N7RA 1XWFA 3LF2A 1VKNA 3ON5A 1GYRA 1P0FA 3HDYA 3LQFA 2GN8A 4XQ9A 3OIGA 1E6EA 4IQGA 4WGGA 1NFRA 1VSUA 3KO8A 3BTSA 4D3DA 1G0OA 1AUPA 4AG3A 1MB4A 3OA0A 3D4PA 2VYVD 4YB8A 3WGGA 2CFCA 3HDJA 4EYEA 3ZU3A 2FP4A 4WLUA 1BWSA 4Q3CA 1WWKA 5FEUA 3P19A 1RWBA 3I9JA 2OP0A 1FDWA 4AJOA 4DMLA 4DLLA 4D79A 1UZNA 3ANLA 2VRCD 3BMQB 3PJGA 5BQFA 1K2WA 3MJVA 3TFQA 2W2LA 3HN7A 3NGLA 2PKRA 2CDCA 2Y0CA 3LVFO 4E5NA 2Y66A 1DEHA 1N1EA 3BHMA 2EKQA 1YWGO 1E7YA 1LDNA 3L6EA 3ZHYA 2J6IA 5A9SB 5KVSA 3F46A 4CMJA 3K9QO 1LNQA 2HJRA 1HE4A 4XR4A 4DMMA 2OORA 5CEFA 3DWFA 4L0QA 1QYCA 1CQIA 5COBA 1VC2A 1SOVA 3BMOA 4UUMA 1K6IA 3D3WA 3CIFA 3PTZA 4HV4A 1O94A 3BZUA 2W8ZA 2VN8A 4I5FA 2W98A 2PZLA 2I99A 3EHEA 3W6ZA 4BNHA 5G4KA 4AFNA 4TQGA 2W4QA 1F0YA 1VKOA 1XCBA 3NT2A 4E2WA 3QVXA 1PX0A 3BTOA 1GCOA 4XJSA 3WSWA 1M6HA 4A0SA 3MWEB 5GMOA 1ZMTA 3KSDO 3TZHA 1R4NA 1ZJZA 3QHAA 4GAEA 1I10A 3NJ4A 3F5QA 1PGJA 1ZSYA 2C7GA 2UVDA 5THQA 4KOAA 2D59A 1P1JA 3I9KA 3KHUA 1D7OA 3WQSB 1MUUA 4MVJH 1HDCA 2DAPA 2O7QA 4INAA 1HTBA 1B14A 4EUHA 1EBFA 2WSBA 1BRMA 1NVGA 3AM3A 2EEZA 1P1HA 2EP5A 1O95A 1NASA 2GLXA 3BTVA 4D7AA 3CTMA 4MKRA 3PLRA 5HM8A 1ZNQO 2HAEA 4K26A 2GF2A 4J1QA 3KYBA 1VPDA 5JBIA 5JDIC 4FFNA 5KNLA 5CHEA 5ITWA 1P1RA 2P9EA 4OH1A 4CMHA 1ZO8A 4NJOA 3G0OA 2HMUA 3GEMA 1MXHA 3PRJA 1ONNA 3IP3A 1HDXA 4YAIA 2DBRA 3LT4A 2PD6A 4WCFC 4YDRA 1E92A 3JCZA 4RPLA 5EIOA 3SC4A 3SJUA 3TZKA 3WQQA 3PFFA 4JNKA 4TSKA 5B4TA 4RVUA 5FI3A 2WD7A 3FTNA 3JQFA 2FR0A 3IS3A 4HUJA 4KWHA 4ZQEA 3H9QA 3GVHA 4IDAA 4RVHA 4PVCA 3ZNPA 5KTKA 2C20A 3ETEA 2GN4A 1XU9A 3KYDA 1QORA 2X8LA 3ZI0A 2HUNA 4ND2A 4RDHA 2C2XA 1GR0A 2X0JA 3H9GA 4XYEA 2BH9A 2JJYA 5L7YA 4HX5A 4U5QA 4L8VA 1WLYA 1PJBA 3KEQA 3OJFA 3DMTC 1ISFA 4WLOA 5T6BA 1MG0A 3TDKA 1LBEA 3OP4A 3PFWO 1I2BA 5BR7A 2X22A 2BLLA 5B37A 1DC4A 5IDQA 4B8WA 1BMDA 2IZ1A 1FJHA 1X7DA 2O2YA 4FPXA 4G65A 2DFDA 4A5OA 4D45A 1B8UA 1E3SA 4I5DA 4PLVA 3UICA 4II3A 3U62A 3MJ4A 4CMEA 4AVYA 1T2EA 4P8RA 3PDJA 1H2HA 1YQGA 3PJFA 4BNZA 5BNFA 2WJPA 1S7CA 3V1TC 4C7KA 3OJ0A 1N2SA 3OF2A 4UEJA 4AJNA 4EZBA 1DHRA 1GQYA 1QXSA 4RJTA 2X0RA 3KVOA 2ILTA 1GQQA 2VCYA 3JQGA 4IQ8A 1HL3A 1E1NA 3WGZA 3O38A 3L4BC 3U09A 4AL4A 4XD2A 1DPGA 2J5KA 2QX7A 2D0IA 3LLSA 2VYNA 4DYVA 2ZATA 2GYYA 2D8AA 2PA3A 1NAHA 3VPSA 4PLTA 2O48X 3GDFA 3IC5A 3FF4A 3DAGA 1BW9B 3QA9A 3WGHA 4OXYA 4CLEA 1X7HA 2O3TA 2X5OA 4IMPA 2QW8A 3GAZA 3JSAA 3P2YA 3NJ8A 1TT5B 1R37A 2ZTVA 2E37A 5I7VA 4NPCA 2ZQZA 3MJSA 4BNLA 2PKQO 1IL0A 3C85A 3H9EO 3H9UA 3OQ1A 3R1IA 4IPTA 1NQTA 3LSYA 2X0IA 3M1AA 2WYVA 4YA6A 4TRRA 3HE3A 4I5EA 1L1FA 2EW2A 1JWAB 5LCXA 1ARZA 1WZEA 2B5WA 4NZ9A 5T5QA 2PTGA 3GK3A 4BB5A 2JCVA 1JVSA 1XU7A 5C37A 4YT5A 3WGIA 3MJCA 3U0BA 2NVUB 4Q3EA 3RBXA 4O5OA 2QHXA 4BQPA 4ITUA 2Y68A 4MVJP 3JD2A 2JAPA 1B26A 5A9TA 3E5MA 3NRCA 4J2OA 2O3JA 2PD3A 4LW8A 3CZMA 3TRIA 1A72A 4WOJA 1G6KA 1PJSA 1TA4A 1HYGA 4HWKA 1LQTA 1T2AA 2ZIZA 3C8MA 4RQUA 4FFPA 4OJNA 1E6WA 1PJTA 4L4SA 4CV0A 3JQ7A 3P2OA 3KM0A 2DUWA 2Q99A 1OOEA 4LGVA 3HHPA 3EY4A 2VRBA 3C7AA 2D4AA 1DC3A 1ISGA 3JQ8B 1NPDA 2PK3A 5KJ6A 3OA2A 2TMGA 4D44A 5CG1A 3KZVA 4FQ8A 1OBFO 2J8ZA 4XQGA 5A05A 4ZN6A 3EZYA 3IKTA 1Q1NA 1UXHA 4IJWA 3QLJA 4GKBA 1HWYA 2QYTA 1HKUA 1SEPA 2NACA 5KKAA 1WVGA 4NBUA 3WGTA 4BO7A 1Z75A 4PG4A 4W9NC 4O1MA 2GRAA 2EJVA 1J6UA 4CQLA 4TRMA 2PFGA 3GY0A 1BGVA 4IZIA 1QSGA 3DBHA 3PWSA 3UN1A 5BSGA 2GZ2A 3BMQA 5L3ZA 2WEKA 4QEDA 1LSJA 2YHUA 2OGUA 1DLIA 4R9SA 3KOUA 1MX3A 2Y93A 3EDMA 5A9SA 4R01A 4PLCA 1ADBA 4Z0PA 2HMVA 5K6AA 4R9RA 2VYVA 3ZHXA 5CDYA 5TS3A 1NWHA 1SCUA 2EGGA 2IDZA 3KBOA 4UVDA 2UUOA 5I9LA 4WOKA 1RJWA 3ZWXA 4XYLA 1ZK2A 2FOIA 1PU2A 3F1LA 4YJDA 4J7UA 4YPOA 3F47A 2W2LD 3G1TA 1EUCA 2OFPA 1YL5A 3S2FA 2QRJA 3E8XA 4BNXA 2VRCA 2YUTA 3AUUA 5AVOA 4PN3A 1ZBQA 3V1YA 1Y9AA 1PR3A 1E3JA 4TWRA 2FSVA 2NVWA 3AUAA 2C29D 1KS9A 5IZCC 5FFFA 4R1TA 4A10A 4WJZA 4UUOA 4TVOA 1VL6A 5JDCA 4RZIA 4M86A 2Q49A 3JQ9A 4CMKA 3JD0A 4OYRA 4CR6A 4WCDA 4CV3A 3O8QB 1RM4A 4YAKA 1AE1A 4LSWA 5H83A 5L40A 1Z6ZA 3D3EA 5DP1A 1E7QA 4QQRA 4CUZA 3WB9A 1OI7A 2JD2A 1TXGA 2CNBA 1RYEA 1W8DA 5JAQA 1W4ZA 1FDSA 1UDCA 3AI2A 3VH2A 4A73A 5CEJA 1I3MA 2PH5A 4PRLA 3BMOB 4OOEA 3QV1A 4DQVA 1BXGB 2X6TA 4IDCA 2XF8A 3BMCA 1HE3A 3H6KA 1WW8A 2BKAA 5DULA 2EP7A 2PNFA 3PHHA 2LDXA 2JFGA 3ZV6A 3TFOA 3F1KA 4YJHA 4YVFA 5G4KB 3L6DA 5BSHA 5HBRA 1MG5A 4FGSA 3JD4A 4BO8A 1VM6A 1QYVA 1E7MA 2Q1UA 4J0FA 1BHSA 3GMSA 3RIHA 1PTJA 1RYDA 5I7EA 5EPOA 3FI9A 1EBUA 4LCJA 3W4JA 4O6VA 4R51A 1NR1A 1U8XX 4Y6SA 1N7HA 5G2OA 1PQWA 4B3JA 4K9DA 2J3JA 3QQPA 4FFRA 1V0JA 4RLSA 4J4HA 2RCYA 2CVOA 1KY5A 3AU9A 1YKFA 3MOGA 4J91A 4U0JA 3RUCA 5BT9A 4FOOA 4Q3DA 3PHLA 3MJTA 3F6YA 2HK8A 3X2FA 3WGQA 2Y1OA 3DC2A 4CUKA 1EK6A 3HG7A 4AJHA 3QSGA 1EDOA 2BD0A 1V9LA 4KQXA 3ZU5A 2XAAA 5KVQA 3LT2A 5KWEA 1MC4A 3ENNA 4CV1A 4E5YA 4WNCA 4RF4A 7MDHA 3LK7A 4MVJE 2HRZA 1H0KA 2HDHA 1Z7BA 4UVHA 5F1OA 1H6CA 5B12A 5JC8A 2O23A 4RF3A 3CKYA 5K0ZA 1LX6A 1A9ZA 2VZ8A 4XB2A 4LMPA 1L7EA 4MDHA 2UAGA 1E5LA 1WMAA 2JCXA 5G0VA 1IY8A 1DFHA 1M66A 3WTCA 1SB9A 2WD7B 3ETDA 2B35A 3PGJA 1UH5A 5TJ9A 4ID9A 2B4RO 3GPDG 3I52A 2Y1CA 1I36A 3F4BA 2OL4A 3PQFA 3ZWCA 5ITVA 4QUKA 1R66A 4D3FA 2HK9A 4KUEA 4CQMD 3GEDA 4ZA2A 4U6SA 1JTVA 3ZNNA 3RJ9A 2D1YA 1EEHA 2EHDA 3OSUA 1YL7A 4UAGA 2EF1A 3ZDFA 5GZ3A 3H3FA 1Y9EA 4HP8A 1T4DA 5G0WA 3ZH2A 3L77A 4FOSA 4Q3NA 4RO0A 4PG6A 1TT5A 3CE6A 4JBHA 1LLUA 3GZNA 4CJXA 1ZFNA 5IAAA 1NHWA 1XG5A 4G2NA 4JJIA 2Q4EA 3LYLA 2VHXA 3PJDA 3WNVA 3K31A 1P0CA 4FFMA 3ANMA 3ROPA 3NGXA 3U9LA 3A9WA 4E4YA 2Y1DA 3PK0A 4E32A 3OJEA 2I6TA 4K6CA 4HXYA 4XJTA 3I6QA 1KETA 3ROMA 1IULA 1EQ2A 3QP9A 4IJUA 2DKNA 2X4GA 3RI3A 3WYCA 3TZ6A 3JQEA 3JV7A 1NAIA 4CQMB 1D8AA 1ISMA 1G1AA 4MIYA 2A35A 1JLLA 1Y8RB 2NVUA 3BHJA 2B37A 1PS8A 3EK2A 4XIYA 4XGKA 4CM4A 5IN5A 4YYZA 2EJWA 1U7HA 3I9OA 5ADHA 5BNTA 3ROKA 2BGLA 1C0LA 1UAGA 2YQ4A 1WMBA 1AN9A 2X86A 3K2EA 2H6EA 2I3GA 4Y9DA 3EYWA 4BNNA 2EG9A 4BS9A 3E9NA 3UOGA 1GZ3A 5DBFA 2V65A 2IYPA 3FWNA 1W6UA 3AW9A 1UZMA 1VL8A 2JD0A 3DZGA 2I65A 3D5QA 4KZPA 1ZK3A 3BA1A 3E5RA 4IS3A 2DPGA 4ALLA 4Y67A 4ND4A 4L4XA 4MJLA 2EERA 3PZBA 2PGLA 1ADCA 2YZ7A 4BO9A 4Q3AA 4J1NA 1SO8A 1DSSG 1GUZA 2B0JA 4HADA 1T1SA 3DZBA 3QWAA 3K2BA 4OSPA 2DC1A 3RUFA 5DCYA 1YXMA 3RKRA 1I01A 2RBEA 1O6ZA 3FBGA 2EW8A 4QTZA 2PZKA 1E7SA 3VKUA 4O63O 3GVCA 4DIFA 2ZQYA 2AE1A 5TT0A 4E21A 2Z1MA 4PLFA 2JCYA 1O8CA 1D1SA 4IM7A 3TSCA 3WIEA 1U4SA 4J9UE 1GPJA 3RFXA 1UP6A 2A4KA 4JP2A 4UUPA 3WWZA 1VE9A 4GX5A 4BNUA 1FMCA 5A3JA 3Q6IA 2CY0A 1GD1O 4ILKA 2QYSA 4CPDA 3HDHA 2FPGA 2V6MA 3FNGA 4R1NA 5G0SA 1TT7A 1YE3A 3KSZO 3WYBA 1MFPA 4D46A 3JQBC 3OHSX 3ZWOA 1NFQA 3S2IA 1DOHA 2BFAA 5F5NA 1UP7A 5CDUA 1ZK4A 4HKTA 3RBVA 4RV9A 2RIRA 1JDJA 4J49A 4TVBA 3UKOA 2PWZA 3KSUA 1K3TA 5HWSA 2H63A 1DIBA 2YHIA 3C7DB 2XPCA 5DCUA 3H9JA 1A4UA 3UF0A 3JQ6A 4WKGA 4U6QA 2ZB4A 3HB5X 4OQYA 5B4UA 3LC7O 1FDVA 1I0ZA 4LN1A 2F1KA 4KQWA 4TROA 3MTJA 4DC1A 3ADPA 3UFXA 4NBWA 4GMGA 2C54A 3DHYA 4CMIB 3UUWA 4J6FA 2O4UX 3TZCA 4ALJA 4Q9NA 2DM6A 3CMCO 1P1IA 3FPCA 2OZPA 4CQLB 1P1KA 2YFHA 4ROSA 5IN4A 3AOEA 2O3QA 5ENVA 2Q50A 2UV8A 5A04A 4PLHA 4UUNA 3DBHB 3O8QA 1KC3A 1QRRA 4R3NA 3WOHA 2VT2A 2VHVA 4CLHA 2FMUA 2X0NA 4MKXA 5TJHA 6LDHA 1L7DA 1V3VA 1PGNA 5EL0A 2YQ5A 3R6DA 3R0IA 4FD3A 4OKIA 2GASA 4D41A 1E1MA 3DONA 4MPDA 3CEAA 3SLKA 1NVMB 3KLMX 3GVXA 5TRTA 1LDMA 1YJQA 4J3FA 5A3VA 3ZWNA 4GLOA 3ZHBA 4CM5A 5A03A 3MZ0A 4BIIA 3KETA 3LU1A 3HN2A 4FS3A 4RVFA 1YGYA 1PJ4A 3NT5A 2Q1SA 1GPDG 4RCVA 1DHTA 5TGDA 4AJEA 1E1KA 4B4UA 2HLPA 3IKVA 1OFGA 5JO9A 3PYMA 3RAJA 3Q11A 3LC1O 3U4HA 2FWMX 7ADHA 4CLRA 1HSZA 3D4OA 1BXGA 4FFOA 4JN6B 1TEHA 4R41A 3GFGA 1LUAA 2B4TO 3Q9NA 1CQJA 2Y99A 4GPD1 3KTDA 1P1FA 1F14A 1EE9A 2GN9A 1UXIA 4MINA 5T8KA 5A06A 4CLOB 1GTMA 4N5MA 5LDHA 2J5QA 2AQIA 3DZHA 4YT2A 3GGGA 2Z5LA 4LVUA 2G5CA 2ZB7A 2O50A 4BGIA 4OKNA 1ADFA 4RL6A 4RQTA 4WLVA 2TMDA 3DFUA 3DL2A 3E1KA 3NT4A 1PZEA 1EUDA 4CMGA 4BO0A 5L7TA 1Q0LA 1DC5A 2G82A 2VT3A 4IS2A 4M54A 3ZWAA 2R00C 1NWCA 1ZSNA 5C7OO 1DRUA 4BKPA 2GERA 3AFMA 3VVBA 1QV6A 3MOIA 1H9BA 5I8WA 1CIVA 1HE2A 1PJ3A 1DJNA 3DHNA 5TSDA 4RPGA 1Z7EA 3KUXA 5MGBA 2Q2VA 1ULUA 3GUCA 5I7SA 3DDNA 2W90A 4YQZA 2CDBA 2GUGA 2UDPA 3JYQA 3WGOA 5CAEA 1EVYA 4WASA 4RF2A 1SOWA 3PEFA 2WTBA 2QIOA 3BMCB 4J0EA 4XZ3A 1GADO 3DHEA 2B36A 4BKQA 1YVEI 3LF1A 3ZN2A 3IJPA 1VI2A 4YJHB 4BVAA 3QW2A 4CLDA 2C0CA 2RHRA 4YRAA 5A4DA 5TT1A 2AG5A 4CM6A 4AJ2A 2QQ5A 4FR5A 1HE5A 3SJ7A 4WCFB 3GZ4A 4F45A 4H3VA 3NTOA 4CM7A 1Q0HA 3DBLA 4GVLA 1QKIA 3EUWA 4KWIA 3EGOA 1LC3A 1CEQA 2Y1GA 1RPNA 2XXJA 3I23A 4QO8A 4TRJA 1MV8A 4RDIA 3SXPA 1Z73A 3OJOA 2FY8A 3Q9UA 3NX4A 4FW8A 3WGYA 1IPEA 5I8ZA 1HF3A 1T25A 5L51A 1YS4A 1IOLA 4A27A 2O7SA 1P3DA 1LXCA 3BHIA 1K5HA 4KTVE 4XQEA 5LDGA 3GNQA 4ALMA 1JW9B 1HYEA 4OL9A 4F46A 1HT0A 5EQFA 3LZ6A 3NV9A 3QJ5A 3JYPA 4F6LA 4NBVA 4CQMA 3R3SA 1ZIDA 1VL0A 4PG8A 4EGFA 1Y8RA 4UREA 1VJTA 4JQCA 3UVEA 1PZGA 5FWNA 1M6WA 1UXJA 2GO1A 1IPFA 1XR3A 3GHHA 4DIOA 4XEHA 4EI2A 4CODB 1DC6A 4F3YA 1UDAA 5F1KA 4PZCA 3U3XA 1LLDA 2O4CA 2IRWA 2OXIA 4PZDA 4DPKA 3PWZA 4HBGA 1U3UA 4DUPA 1HYHA 4IBOA 1KEPA 3VH1A 5DCWA 3V2HA 1KEVA 1NP3A 3BMNB 3WFJA 2PKQP 4WLFA 5ENDA 4ZU3A 4P38A 3V1UA 1LQUA 4J4BA 1NQOA 2NADA 1XIVA 2ZJ1A 3GZNB 1ENZA 4E5MA 4Z6KA 4BNYA 3F3SA 1ZCJA 3TOXA 3IOYA 3SEFA 4FDAA 4JJGA 2X58A 3DB2A 2YDXA 1XHLA 5AXBA 3VDQA 2BMAA 1PJLA 3FR8A 4IJKA 2YJZA 2I9PA 2DUUA 3VPXA 4B8ZA 2Y0EA 3SBOA 1EVZA 3AM5A 3TQHA 5HRUA 5H81A 2V6FA 4OMUA 1E3EA 5CEEA 5JW6A 3W1VA 4BKRA 3GC6A 3A14A 2JHFA 4NK4A 3T4EA 3VC7A 4ALIA 4AJ1A 1KEWA 4CM4B 4GLLA 3S2EA 1IHYA 5ER9A 1UZLA 5EN4A 4RLHA 3VHRA 1YL6A 1B2LA 2NTVA 1D4FA 2ZCVA 3ONDA 2P2SA 2DPHA 4ZJUA 2LDBA 2CZCA 1R15A 5KJ1A 3GG2A 3DQPA 4J9VA 3OIDA 1ZSVA 3AK4A 4FC7A 4DC0A 3HNPA 2XOXA 5TC4A 1Y8QA 4BO6A 1EQUA 3EMKA 4HNGA 2FR8A 3ZU4A 4RVGA 4W4TA 1EFKA 3AY7A 1ORRA 1JWBB 1KVTA 1X13A 2G1UA 1CF2O 3WIDA 1YO6A 2GSDA 3I4FA 4B4VA 4DGSA 4Z0TA 5T64A 1EUZA 3OJLA 3DMYA 3JTMA 1LDYA 2NV6A 4JK3A 3GRPA 4YJFA 1YB4A 5ICSA 5IFLA 2GZ1A 1IYZA 1C0KA 1QP8A 1BG6A 3H2ZA 4FIZA 4XKJA 3ROQA 3UXYA 3K8ZA 4CMIA 1IZ0A 1CDOA 3AWDA 3FNEA 2DLDA 4GX1A 3UAGA 5KVCA 2IZ0A 3OEWA 4GGPA 1IE3A 4U7WA 3KYCA 2VTEA 1C0PA 5DZSA 3B1FA 3GFBA 1YH3A 3TL2A 4UVIA 4DQXA 5DDIP 5CFZA 1OAAA 2DTXA 1GQ2A 1UAYA 3B1JA 4XR9A 3WJAA 4OSOA 4GVXA 1YBAA 2DBQA 2X23A 2ZTUA 1A7AA 2EGHA 1KVRA 3MWDB 1DXYA 4A03A 3W4IA 4PG7A 4P4GA 3RFTA 3HDQA 1N9GB 5JE8A 4DVJA 5LC1A 5A5EA 1GDHA 1I33A 2I5PO 1SNYA 2Y05A 3VTFA 4CM9D 1PSDA 1XDWA 2J3HA 3LT0A 3OFSA 4P4NA 4ZQFA 4MIOA 4E3ZA 5BNIA 4R54A 5CPBA 1YQXA 2C5EA 2ZYDA 3EW7A 4NK5A 1H6BA 4NNJA 1HDGO 3FHLA 1NQ5A 3ZZNA 1VRWA 2PGJA 1JQBA 2YHIB 2J3IA 4YCAA 1LTHR 4LMRA 1DIRA 2HKIA 1I3LA 2FPPA 3JD3A 1ENPA 3D1LA 4KUHA 4AJLA 2G76A 4PLGA 4F6CA 1PEDA 1ZEMA 1NBOA 3VVCA 1GU7A 4R68A 4CLOA 3N58A 4M1QA 3RUDA 1U7TA 3ICPA 4DBZA 3PIDA 4IUYA 3ITDA 4MVJI 3U49A 4E31A 1M2WA 5J23A 4BKUA 1WDMA 3BYZA 4WPGA 3GOHA 3WG9A 4J16A 2VZ0A 1HRDA 1P9LA 1W0CA 4JP3A 4NQZA 4Y8VA 4QECA 2PLAA 3DBVO 4M89A 3ZHZA 3B20A 2D5AA 3B6ZA 1V3UA 1FDTA 1T2DA 2JL1A 1WNTA 2P9GA 4FJ2A 4NH4A 4IQ0A 1XEAA 5A5FA 1V35A 1JU9A 4GSLA 4IDFA 3I9NA 2VUUA 3RC7A 3VKVA 1E5QA 3Q2IA 1ZUD1 5A9RA 2JFHA 4OIMA 4KMSA 4DLAA 1ULSA 3DOJA 3PP8A 1LU9A 3ORFA 5F21A 4I5GA 1FDUA 3ZWVA 4XRGA 1PQPA 3DZFA 2HU2A 4NR0A 3GMDA 1ZXBA 3F5SA 2E48A 3ST7A 2JHGA 3I3OA 4DLBA 2PGDA 2AA3A 2GCGA 4HFMA 3E03A 3G17A 1U4OA 4CLRB 4QT0A 1JA9A 5EERA 3G3EA 2DBZA 5DOZA 4L73A 4NI5A 5JY6A 1XYGA 5JDIA 3HWRA 1O0SA 3DXFA 2ZTLA 4R16A 5U9CA 3HB4X 4A7PA 1GYPA 2AHRA 5JS6A 3SVTA 1Q7GA 1AXEA 5G0TA 3PYXA 4OXNA 4WCFA 2I67A 2JKVA 3SX2A 3WNQA 1ML3A 4C4OA 2FRDA 3E9MA 4DTIA 3IP1A 2BFPA 2PY6A 3COSA 3HFSA 3TF5A 4IJVA 1PWXA 1O5IA 2FPIA 4MP8A 4PLYA 5HTOA 1ZK0A 3DZJA 1C1DA 4ONEA 4OOFA 1QG6A 1V6AA 2PZJA 3PQDA 4XIJA 4FCCA 3NYWA 3TWOA 3WMXA 4CUJA 1Q0QA 2IEBA 1QV7A 3WLFA 5B4VA 5DBIA 5TX7A 2O3SA 2DFVA 3RBZA 3ZV5A 4JXKA 2GNAA 3VDRA 4PGFA 3SC6A 2AG8A 1JKFA 2C59A 5IDYA 3VZPA 5DT9A 3E18A 3ZWMA 3FSRA 1OMOA 3W8DA 4DYDA 4IXWA 4YEDA 1J5PA 2D3TA 2DTEA 3DMTA 2CVZA 4IINA 1K6XA 4J1TA 2ZKLA 2Q4BA 3CZRA 5CPFA 3QY9A 2CF5A 1HZZA 3Q2KA 4L75A 1SAYA 2YDYA 2WE7A 2VUTA 4W6ZA 2WDZA 1G0NA 2POQX 1LEHA 4BHTA 1BVUA 4XWYA 3I1JA 3L07A 3JQFC 3WQRA 1YRLA 1K89A 5DNAA 3QIVA 4E0BA 4HFJA 3M1LA 2E6UX 1DBVO 1KYQA 3OICA 3GLQA 3EVTA 3VAZA 4IMRA 1FXSA 4N54A 3H5NA 2HMWA 2ZYGA 3OQ6A 1KVQA 3BMNA 4BNJA 2HCTA 2JFFA 3DBLB 2IXAA 5EINA 5KIAA 2BFMA 1J49A 1XGKA 3L4BA 3I4CA 3KEOA 3M2TA 2FSSA 2CMDA 4Y98A 2IXBA 2VOJA 3WFIA 4DWVA 2VNSA 3PHGA 4GH5A 4BNTA 2GN6A 3PLNA 4YR9A 1YJ8A 1NVTA 2Y1EA 3GDOA 4JBIA 5JAZA 2O2SA 3DAFA 4ZRMA 4C7JA 3TPCA 1TB4A 5TF4A 1HDRA 1F8GA 2BELA 4W99A 1MFZA 5JYDA 1NQAO 4XYMA 1DRVA 1PJCA 3AY6A 1HDOA 4D43A 4MOWA 4CMEC 3DZKA 9LDTA 4CL3A 3P7MA 4ALNA 1NR7A 1XELA 1SPXA 1YDEA 3U5TA 1HETA 3ZNQA 4PVDA 3UW3A 4E2XA 5L4NA 2ZJ0A 4M87A 2ET6A 4J4TA 4BL5A 3MJEA 4E5PA 5CDSA 1BVRA 3I5MA 1NPYA 1ZZEA 3DOCA 2Q1TA 4OXKA 4FBGA 1E3WB 1VLLA 4YJGB 2OO5A 4XQCA 1PJQA 3V2UA 1PS9A 2YW9A 1LLCA 2RAFA 4DQUA 4D3SA 3D0OA 2SCUA 5T67A 1CJCA 1H93A 1B7GO 5JC1A 3E6AA 3RVDA 3K96A 1GV0A 4ALKA 3WYEA 3S8MA 2HRBA 3LT1A 2RH4A 4W7HA 1SC6A 5DBGA 1LRLA 3QVSA 1OZAA 3GGPA 5EJ2A 3OETA 4TZKA 4ND3A 2C2YA 4EJMA 4Z9FA 1CRWG 2AQKA 1D1TA 4TZTA 2AE2A 4DBVO 5ICMA 1ZH8A 1PIWA 4FSHA 3ZNOA 4XYGA 3G49A 1N5DA 1E77A 3OIFA 4EUFA 1WPQA 5DP2A 3HQ4O 1NYTA 4ZHSA 1K6JA 3GA0A 5JMWA 4YTEA 1YOVB 4R1UA 2DT5A 3O4RA 3AOGA 2HQ1A 4MVJA 2AEJA 3A1NA 2Q46A 4BO5A 1DRWA 5CDGA 3UH1A 4BNKA 3TZQA 4MO2A 2OMEA 4EJ0A 2A9FA 1LSSA 4ZRNA 4ZICA 2P68A 3PJEA 4WK6A 5F3RA 5L95A 1KVSA 3ZCXA 4I9NA 1YB5A 3ASVA 4YRDA 2BF7A 1X14A 3RUEA 1N92A 4W9NA 3W6UA 1HDYA 4EITA 3OH8A 4L76A 2VWHA 1I3KA 1N9GA 1Q2XA 1GV1A 4FN4A 5JCJA 1WZIA 2P4QA 4I9UA 1NTOA 4NMHA 1Y8QB 4YRBA 1J0XO 3VPHA 3WBBA 3GDGA 3K6JA 5KOIA 1IUKA 4BNVA 3ASUA 3GVPA 3VTZA 1XA0A 1R0SA 1HLPA 3F4LA 1LRKA 4TMFA 4CR8A 4BQRA 1HLDA 2WYWA 4B7CA 3ZW8A 1B8PA 2X5KO 4YJFB 3VZQA 1KBZA 4B4WA 3RSHA 1NX6A 1PZFA 3AY3A 1RM5A 3CINA 5FI5A 2NTJA 3L6OO 1P44A 1TI7A 1A9YA 4R69A 2I76A 3RU7A 3RFVA 3QVTA 4GKVA 3AI3A 4MKZA 1N1GA 4S1VA 1BXKA 1XQ6A 4OAQA 3JQAD 3KYCB 4CM9A 4RPJA 4A26A 1ZEJA 3ENKA 3P5SA 4IIVA 4DRYA 2EKPA 4X54A 3BIOA 1A27A 1GCUA 2QRLA 3L4SO 4BKOA 1QLJA 3VH3A 3GNSA 3F9IA 4R5HA 5IZCA 1C1XB 4OQZA 4RVSA 3UCEA 4LCEA 2W2KB 3W8FA 1QYWA 1X0VA 4MP6A 1B3RA 3ZU2A 4EEZA 2VOEA 1E0DA 2E4AA 5KKCA 5C7IO 2P4HX 3MTGA 2CVQA 2PV7A 3GG9A 4S3MA 1PGPA 1VJ1A 1T26A 3OBBA 4DA9A 1A4IA 1NHGA 1UJMA 2B69A 2DQ4A 4K1LA 3D64A 3SLGA 1WP4A 2PH3A 1WDLA 1DJQA 1T24A 2B5VA 4YAJA 5K6AC 3D7LA 1R4MA 2IE0A 4XDZA 2NUAA 1ISJA 1Z82A 2YV3A 3FD8A 4JBGA 3JQAB 1X7GA 4BNWA 5JXWA 3V5NA 2FHSA 4J7XA 2NVBA 4PZEA 1UXGA 5IXYA 2RHCA 3NKLA 3QRWA 1LDBA 1CWUA 1RM3A 3KXDA 4KP7A 3C3XA 4E33A 4N5NA 5ES3A 3FNFA 2VHWA 4ZQGA 1V8BA 1X1TA 4IDGA 1ZMOA 1YDWA 2H9IA 4Y6RA 4YBZA 2HSDA 1DFGA 1U3VA 4YT8A 3GHYA 3WTBA 5L4LA 4NFYA 2NU9A 5G0UA 4E5KA 1QR6A 1UP4A 2VQ3A 3DOOA 3U4CA 2Y67A 3CSDA 3LDHA 3NAQA 3QWIA 4B79A 4JX8A 5TLSA 1YB1A 2Y1FA 4LVCA 1F17A 3FN4A 3A28A 3WXBA 3GR6A 5JDCC 3HZZA 4IDDA 5F1PA 3JQ9C 5JMPA 3STHA 1ID1A 2WM3A 2EIHA 1P31A 4BNGA 4RF5A 1P74A 3ANNA 1A7KA 2BGKA 3ETGA 3INGA 1R0LA 4XGIA 1Z45A 4E2ZA 3PZRA 3G79A 3V8BA 4NFHA 5FYDA 3W4KA 1NFFA 4DIBA 4J1SA 5ILGA 4BMSA 5C7LO 5GZ1A 4O0LA 1B0AA 1N8KA 4BO3A 4Q39A 3PWKA 2BI8A 1Y1PA 1T2FA 4R5MA 4GI2A 3H2SA 1PL6A 1J4AA 2IEDA 3DBRB 5C3MA 4WNIA 1DDOA
chains in the Genus database with same CATH superfamily
1C9DB 5I9MA 1DX6A 1U8UA 2OHIA 4MWZA 2D2VA 2JW5A 1KHTA 2WTXA 3AJEA 3N2KB 3R40A 4P5PA 4WNAB 4EA9A 1UF9A 3AI1A 4WKNA 1DFIA 1ZM3A 4RA9A 5CVEA 1OFUA 3C98A 4K81B 5FUVA 1N25A 1P5HA 1QZTA 2AK2A 3LQRA 1PVVA 4Q5IA 4UBOA 1ICIA 1BH6A 1GKIA 1K5PA 1XZCA 1J21A 1JJVA 3SDBA 3KOXA 4ENSA 2WDPA 4HNRA 4QE3A 5AFSA 3T12A 1CERA 1XVTA 3O9ZA 3BRCA 3KRTA 5D84A 3R6WA 4W1SA 5GOTA 2ZT6A 2JCGA 3DMNA 2B30A 4WEQA 5KI6A 2JLZA 1TPYA 1QX4A 1DAHA 4RH0A 3C24A 1G55A 4DFDA 3U3OA 3MUNA 2NZJA 3GAMA 1P3JA 2IZZA 3CONA 4RLQA 1XPJA 5KNBD 1FBNA 1W5FA 3PUWA 5K01A 4YP5A 5KWIA 4GQAA 4DNPA 2JH3A 3IHLA 4G5GA 3SQWA 5TQVA 1C1DB 1L8QA 3H5AA 4MAAA 2Q5LA 4MQ4A 3EIWA 1EJBA 2JEZA 1HNNA 4GXRA 1UBCA 4PINA 3ODPA 2YXPX 4GMFA 5CLHA 3JWJA 5L8VA 1JKIA 1SOAA 1FJ2A 4ZO9A 3CRQA 5AKXA 2O2GA 3BVPA 3GIDA 1F0KA 3W6NA 3O8CA 1WXHA 1PFWA 2AMFA 1DDIA 2A5DA 3LE8A 5GJBA 1GDDA 1F8FA 2ODNA 5ANRB 3AIIA 1H1DA 2AJCA 2J5XA 5H4HA 5U1PA 2C42A 4TWBA 4U39A 1O08A 3V1KA 1RZRA 5I7HA 1DKLA 4L4RA 2YY6A 4FYYA 1D2GA 3RGGA 4GICA 4J76A 4JROA 5FTKA 4B74A 5TMPA 1LC0A 4RY9A 1NYQA 5GV7A 5ECDA 4DR3B 1AS3A 1GZ4A 1I6MA 2JLQA 4EMUA 5IJWA 5JCOC 1E2KA 4D02A 4JC4A 3R9IA 4YY3B 2WWIA 3ZQ4A 3RS5A 1GEEA 3V4VB 4C0AC 1DCFA 1SKYB 2BI7A 3RC1A 4ZQHA 2I34A 5LQRA 1Q14A 1LW7A 4TKVA 4I9FA 4OP1A 2O06A 3EAQA 4IDPA 5JWOA 2ZT5A 5DLYA 3T0FA 4DVGA 3GRKA 2PR2A 4FGWA 2A3RA 4FJ0A 1OXVA 3FCAA 4RSMA 3WLOA 5JH7B 4H6VA 1Q20A 1RAHA 1LX7A 1ZN8A 3AERA 1CUJA 3IEKA 2VZ9A 3IUPA 3R0XA 4FNOA 1VL1A 2O0HA 2QS9A 4N03A 3DCYA 3DV0B 3TSAA 1TYZA 3LA8A 2P78A 2Q0XA 4RDCA 5C2JB 2XNHA 1PO7A 3GJQA 3PBKA 2IPXA 3J80A 1DZIA 2VNAA 4KN6A 1NOKA 5F2KA 3ZBQA 1REQA 3H5RA 1M2GA 2WP8J 4IDHA 1OI3A 3CPSA 3VYTB 2XAUA 1B4DA 5E4FA 5KYTA 3QG1A 2GCIA 1SXHA 3RSFA 3V8QA 4B3GA 1HZJA 2IHUA 3DEHA 1QFJA 3FMGA 4KE9A 3SN6A 5K8UA 3V3KA 3DSRA 2WWYA 1WG8A 2OGZA 2ONYA 4A4DA 4DIEA 4IY1A 1SKMA 4TV9A 4FB4A 4WN3A 1NXQA 2FWBA 4FE4A 3FIUA 4J0JA 5BWMA 5KTSA 1ZD1A 4K9RA 4A8JC 3CLUC 2C7VA 3CF4G 4NU6A 2YV1A 2JJ8A 3COJA 4L3OA 4BGEA 1FTWA 1IZ9A 2PHZA 3BM5A 4B6EA 1I2ZA 2YL2A 4PLPA 4Q34A 5HZHA 2JHPA 3FOEC 1UXKA 4D4LA 4W7IA 4QSMA 4EP1A 2ZYUX 2JHAA 3TNLA 2CEAA 2ESRA 3GA5A 3PITA 3NBUA 1YOVA 4QAQA 4E30A 4F38A 1XKQA 1JHZA 2DHEA 3BAZA 3L6UA 5HQTA 5LMNB 2BSQA 4CKBB 1UMBA 3NANA 1Z18A 1V43A 2HD4A 3FYDA 2EFYA 3B3QA 1R0YA 1GRRA 2C77A 2R6CA 3FUCA 4XTCS 3TNDA 2X9GA 4G67A 7GPBA 4UTNA 1DKRA 5K5EA 2Q62A 3KTOA 3RS0A 5SYMA 3T7CA 4IGAA 3HDGA 2DGDA 4RBNA 2NQ8A 1X0XA 3PYLA 4HFRA 3W2TA 1E0AA 4HQKA 3H7AA 4HNHA 4JVOA 2PUEA 4Z1MA 1FFDA 3VJRA 5EG5A 1H2EA 2J5RA 2OBYA 2RJ3A 3BIFA 3D6FA 3LCCA 3O03A 1PGOA 4M99A 5IAJA 3TE6A 5JANA 2Y6UA 4NCNA 5KNCA 5G4LA 4YCJA 1XX6A 1FYFA 1CUAA 1FS4A 2YRWA 3K0EA 4WFQA 4ZO4A 2P9CA 2SCUB 3HKDA 3RQSA 4CTMA 3R5TA 1U5CA 2YCBA 1F38A 4KXFB 4IH9A 1WZUA 4KXMA 2PUFA 1ORVA 2X3YA 2JFOA 2ATCA 1G21A 3LT5A 4CU2A 4EENA 3HSKA 1SCAA 1OLUB 3D3NA 2ZITA 3VVMA 2NQ2C 3QE3A 4DR2B 1UFKA 2MYNA 4EPWA 4J0GA 3HADA 5LN1A 5DW3A 1C9KA 2VT7A 3RT7A 4LI0A 5G1NA 4MIEA 4QYXA 1ADGA 2ZRIA 4B82A 1RPAA 5JD4A 5GONB 1TQ6A 1I3NA 2AX3A 2EFJA 3A9VA 5DM60 2O0KA 2WQ7A 3THXB 1UADA 2RHLA 1SGWA 2QTBA 2YJ3A 2AV6A 4X0EA 3WHPA 5F3WB 4XXHA 3GNTA 4MV0A 5J2UF 2PWAA 1BCRB 8OHMA 5DBEX 2XZLA 3FYUC 4MJ3A 2OKGA 4DL9A 1Q7BA 1V5WA 4G9GA 3O83A 3D6UA 2IOYA 2UZIR 4JC8A 1TO2E 2JKZA 3SK0A 5JFGA 2LR0A 3A06A 5EESA 4WOPA 1JA1A 4RXTA 1TW3A 3OM9A 3QOFA 2BFBA 2JIMA 3BBPA 4Q16A 2ZCUA 4GBJA 4L8WB 4N1AA 1FF9A 1BRTA 5ALPA 5GY7A 2A92A 5FF9A 3OHPA 4FGLA 4H31A 2HWKA 5LP6C 3DFIA 1FSPA 1U7OA 4K6HA 3REFA 3U81A 4DWWA 1JSCA 2PX6A 2ZBQA 3R23A 3U7HB 1KDOA 1XCJA 5ALJA 4FE7A 1Q1AA 5ILOA 1EFLA 1TVKB 1YR2A 3K92A 3LUKA 1LLQA 4FEGA 5D1HA 4RJJA 1ETUA 4KIWA 3A4LA 1OC2A 1EMDA 3UAVA 3IXQA 3QVKA 5BSWA 5MN6A 3ZE1B 2FSHA 4EUEA 1CNFA 2PMWB 4D98A 4LK3A 3A4VA 5K4GA 1DIHA 9ATCA 1F6DA 1ST2A 1SCQA 2WMDA 1XTPA 4YQFA 5L9AA 1ZWLA 3LY7A 4HVTA 1KP9A 2GHRA 4QOGA 5BSFA 3A04A 4N40A 3DNFA 1UFVA 4QFDA 1LJ8A 1XJWA 4UU1A 1ST3A 3N2ZB 4CDNA 5JXHA 1W5EA 1WXDA 4YRFA 4RFLA 4XRRA 1NF9A 1QYXA 2IYYA 3E61A 1PG2A 3UCXA 2ZIAA 4TKMA 1E94E 2VT6A 2VUIB 1ECGA 4QUJA 3EC7A 3ZV4A 4BUCA 4COOA 1BXZA 4AICA 1CEYA 4MW0A 2QP9X 4BB9A 3JAWA 1F2TA 1BX0A 1OLSB 1TQDA 4ZGWA 2HRCA 2WD8A 2VH2A 2UU9B 4ROTA 2FLWA 1TPZA 1KU6A 2EG5A 2GR9A 3KYJB 4NYJQ 4K46A 1WKCA 4BP3A 4HNAB 3VQTA 4BNMA 3AOEC 2NPOA 2W2XA 4F7WA 1ODJA 2YS7A 3EEFA 3TQQA 5CCEA 5HK9A 3VDNB 2FE4A 3OECA 3L9XA 1O89A 1VLQA 2GAOA 1GL3A 4OFXA 2DJ5A 1JXQA 1SXGA 2DB3A 2FN7A 5IF3A 1V4BA 2VTDA 2YW2A 4OGWA 2QOEA 4U0KA 4D0SA 4GC9A 2FPUA 2J67A 2MCFA 2H06A 1U65A 4CYMA 4L4ZA 1U2EA 5BMOA 5I7FA 4ACAA 3UENA 1PS0A 3FKSA 1VSVA 1A95A 1QNFA 1B0ZA 4P98A 1N2CA 3DLIA 3WL5A 6ADHA 4ZXPA 5EHXA 2Y1WA 1UPBA 3RDPA 5JBQA 2PL5A 5IASA 5IMSA 1O96B 1SPBS 2Y1LA 4OLAA 3IP5A 1ZGJA 2VP0A 3OVMA 4EMTA 4NAHA 1UPXA 3SFZA 5AOBA 3DBRA 4GX2A 1TLFA 1QIFA 3H5OA 4LDQA 1E6UA 3R5XA 4L0CA 4RVOA 1M2FA 5JG7A 3RU9A 1DB3A 4TLCA 2IOFK 3B3AA 4OK6A 3QEJA 1J33A 3V97A 3RRJA 3VOSA 4HF7A 4O4LA 3LUFA 2DY1A 1LV7A 3AM4A 4N6NA 1W6RA 2X7HA 4P3OA 2Z1NA 3QF7A 1TAUA 4QHSA 4DJAA 1UT8A 4JL8A 5K3BA 2H2AA 3GU3A 1JLRA 4UVGA 4XCXA 3T8YA 3ZJTA 1B42A 1UR5A 1VHWA 2WWWA 4RXMA 5J4LA 3ONEA 3UG7A 2NO1A 2NPIA 3RWBA 3S70A 3UWKA 2RAPA 5T8KC 5IKXA 2ZGVA 1M0TA 3W9YA 2QN9A 5E6SB 4BGUA 4YI3A 4IKEA 3W78A 4NJMA 1MX1A 2C7OA 3EXHC 1Y9JA 1NULA 1M76A 4BJ3A 1IK6A 2KQUA 4QODA 3GPBA 3PC4A 2ZIXA 4BLUA 4F21A 1M6VB 4R1SA 4D3ZA 5JSZA 5HTKA 3IDSA 4CFYA 1M34E 4ZO6A 3DHVA 3TNYA 1W73A 2ZRBA 1K7CA 5SZHB 3WNZA 1GSOA 2MSWA 3L1KA 1XCPA 4ZVLA 2IFTA 2R4UA 4MVCA 3WLMA 4B2LA 4F71A 4Z3OA 2GBCA 2WC1A 3O95A 1XRSB 3U4MA 1RXVA 1LH0A 2FOLA 4FOLA 4CV2A 1IB6A 1T1RA 3KQTA 3R41A 1R4NB 1U1IA 2EYUA 3M4YA 1PZHA 4OHWA 2F8MA 1S3SA 5A1TA 4MHTA 3CQ9A 3KUDA 4KAJA 4RORA 3WDSA 2F00A 3DLAA 1T29A 1ODCA 1XMPA 1G7SA 5JECA 1KI8A 1ZL0A 2GPTA 5EJGA 4F9TA 2P6MA 4N39A 3AUYA 3STYA 5TIIA 1CR0A 1GUFA 3UKDA 1SHLA 2IX3A 4PZYA 4A6EA 1NF2A 3HXTA 1JKJA 4L7VA 1GLGA 5DTJA 1WS6A 3B9QA 5ERYA 1JEJA 1XMXA 5AXAA 4Y9RA 3KIPA 2YFQA 3WB2A 2ACVA 1LA2A 4ZO8A 4KX3A 3CKMA 3O94A 4QBKA 4RA9B 5LBUA 5AW5A 8ADHA 3KPJA 3MIZA 4AY6A 5GWXA 1PYGA 2A9KA 1AK1A 4X7BA 2CXQA 2OM6A 3GF4A 3QYJA 1U3WA 3KB6A 3B1KA 4YALA 1JAYA 1K7XB 5F73A 1S8OA 5DSZA 3TR6A 3UWOA 3V4ZA 5AVTA 2PE5A 2IOFA 1YB7A 2CFTA 1KYXA 2B1RA 2RGXA 3QVWA 4HPWA 4GBED 4I2VA 4Q18A 3SEAA 4BVEA 4M98A 4RJIA 3FYHA 3E9CA 3S2UA 3H8WA 3EPKA 1T6NA 3COWA 1EVEA 3H0EA 2DVMA 5K09A 3IILA 2V7TA 3BWVA 2F6RA 5GZ6A 1Y5RA 3EH2A 4BUJA 1Z2DA 4RPHA 1BIFA 3CEMA 5CB6A 5JWRA 3K0CA 4BMXA 3CN9A 1U2QA 2PKXA 2OBBA 2DR0A 5COAA 3RKUA 4A0HA 3UUGA 4AWAA 4HDNB 4DS3A 4FLFA 4YCCA 5I3ZA 2AMLA 1HE1C 2ZR0A 4H1TA 1WHSB 4MP3A 4YWJA 4NE9A 4PG5A 2R5WA 2C0PA 3KYDB 3AB7A 4JLVA 4L6CA 4LJ7A 2PD4A 2ZWVA 3COPA 3QKWA 4UUBA 2XB6A 1NP6A 2WJVA 4GOJA 3TQFA 3VZBA 1RRFA 3HBLA 5AJWA 3LBHA 2ZIVB 5IZ4A 5EE0A 3DR3A 3G02A 2AUTA 2WKPA 1AXGA 3EDRA 4ENRA 1NJ8A 4N6GA 4EO9A 1RBQA 3QU9A 1JHOA 1K5DA 1PJZA 4EPVA 1WETA 3KZNA 2NU6A 3JQDA 1EZ4A 3SS9X 3U4DA 1E60A 4H15A 5A6SA 1W8IA 1W93A 3WXMA 4AX4A 2H65A 4K28A 3HB1A 2J3QA 2VYND 3QITA 1TOAA 3ZDAA 1GFSA 3ZV3A 4FBMA 4BECA 4MWBA 1Y5MA 2QORA 2FEXA 3WLTA 3W5DA 3A9RA 3NBXX 1A69A 2JJ2A 1A4RA 2OUKA 1IH8A 4TKVB 4UNSA 1R10A 3RV3A 1TX4B 4L5YA 5TPZD 1HORA 1E2QA 4UD2A 4PWYA 4V2UA 3QBTA 1QZXA 2P3LA 1W5SA 1SVSA 3AF3A 4PLZA 3NWBA 1CR2A 2HO5A 3ZWYA 5J2TA 3F9CA 3LPLA 3NWPA 1GXSB 1YR7A 3CUKA 2OBNA 1VLJA 2FX5A 2QT0A 1W581 1DAPA 2HLDA 2OILA 4AJPA 3TLMA 1RRPA 3LXUX 2JLRA 1REQB 3R44A 3CZCA 4BMVA 2JCSA 1Y6JA 4M88A 4I9HA 4L4UA 4RNDB 1J2EA 3CH4B 2RI6A 3LKBA 3OD1A 3IAFA 1RJFA 4LZZA 1FQOA 4TX1A 2HCRA 3RS9A 3U4IA 1KE2A 4WKCA 4ARIA 4UBKA 4B35A 1ATIA 1CF9A 3ICCA 4TV9B 1F8XA 1DQNA 1YA6A 1Y6FA 1DAEA 1UT5A 5K8LA 3C7CB 3CKKA 1FS6A 4HAVA 3MMPA 1R0XA 4BBZA 1TZKA 4D57A 2BGJA 5HE9A 3HM9A 4ZVVA 5JSYA 1HEYA 2J4FA 4OKSA 4A8HA 3NC0C 4D6PA 1CUUA 421PA 2EKLA 4YAEA 1PKXA 3LQ4A 4O8ZA 4Z3DA 3FG9A 3K9BA 6AT1A 1G5IA 3HXOA 3A1FA 4KACA 4TYYA 3CLSC 2HYDA 3R9XA 1EM8A 3RWOA 5JCXA 5CIQA 5A3SA 4CLXA 4CM8A 4PRKA 1PG5A 3IDAA 2YUIA 5FV7A 5LXTA 1AGNA 4ETNA 3N6VA 2YJ5A 2ZI6A 4R9VA 3A6HA 2W00A 4ACBA 5IRCD 4MLCA 2CWWA 3LDUA 3A1CA 2F1IA 1GEGA 1MLDA 3LHIA 2OOSA 2VHTA 2XYHA 1D0SA 5TARA 4NVRA 5AOCA 5HG0A 4WD3A 2YZKA 2AN1A 4JQOA 4W82A 3K0BA 5BRJA 4FYIA 4I55A 2FPLA 2VXCA 2Y1XA 1WJGA 3N87A 3L4KA 1PTKA 2CXTA 1JBKA 3WLNA 4C0JA 4CE6A 1TUBA 5BWLA 4X9XA 3RK1A 4EL5A 1YR8A 4FC6A 4GIBA 1EK5A 3MILA 3EVNA 4XDYA 3DF7A 4PCVA 4DSTA 1LDGA 1YHNA 1ETHA 4KQHA 4Q00A 3C14C 4KHPB 1Y7TA 5IJXA 1SQ6A 3HKDB 2C9BA 4J0HA 2G88A 1XJ5A 2PKWA 5I51A 3QU4A 2C4NA 1FPMA 1ZM7A 4Q1VA 3RC9A 1G9SA 4LF5B 4HWTA 4TN1A 1XD9A 2ADFA 5F5LA 2SKEA 5KNBH 1XLTA 1PL7A 5ICCA 3CMMA 3UEOA 2WYUA 1ACJA 4MQFA 4M9RA 1LRJA 2FGJA 2FQXA 2OK8A 3IL2A 4UPVA 3JYNA 3QMPA 2DE0X 3KSRA 1PR9A 3ND5A 4R71A 3WIUA 2R6JA 1VI5A 4CL2A 1I9CA 1JG1A 1PEYA 2ZTSA 1GPBA 4L3VA 4DG5A 4E12A 2MYPA 1O4WA 4HB2A 5JNUA 1HSOA 1QAMA 3PVSA 2WIDA 2D74A 5CVVA 4YCNA 3TW8A 2Y0DA 3SJCA 3QVOA 1BDHA 2IYXA 4JR1A 4OHFA 4RKQA 1B6RA 3ZHSA 1M8FA 3UOWA 5IAOA 4TV9F 5IDWA 2NU8A 4Y2QA 3GCZA 2GUWA 2BR3A 4LSMA 3OTWA 2P91A 3K30A 3W9SA 1G9TA 1RQGA 5EJFA 5K0LA 4JI0B 4K2HA 4XQ9A 4KDRA 5EEHA 4IQGA 1VSUA 4B3SB 3CH7A 2WYOA 1AUPA 1BS2A 1DX4A 4G0NA 1M2HA 3SM3A 1X9GA 2FQ1A 4YB8A 2OT3B 3ZU3A 3SZ3A 5IMBA 1JLMA 2PCJA 4Q3CA 5AI0A 4CEHA 1NXPA 2QTVA 3VDMA 3OZEA 2H0AA 3T3MB 5HOEA 1RWBA 3I9JA 3S68A 4UCXA 1TZJA 4ESHA 4DMLA 1Z4OA 2I1VB 4NCIA 2A0FA 1QH8A 4IX1A 3V34A 2CNNA 3LLMA 4DLLA 1QO0A 1Z5UA 3EQ6A 1L8OA 1P4GA 3MJRA 5DBHX 3RRYA 4YXWD 3A1TA 2IQIA 3BMQB 3GDHA 2RFLA 3PJGA 2QB5A 4JYPA 2V1XA 2LBPA 4H3SA 5C8YB 2HBYA 2HMYB 3EXAA 3WVNA 2R66A 2W2LA 5JRZA 1MTZA 1ZLXA 2PH7A 3OY2A 3PFNA 5KINB 2Y0CA 3L04A 1Q22A 5J40A 2AS0A 4XDHA 1L6RA 2IPNA 2YVUA 4TXMA 1E7YA 3H2YA 5CFRA 1MAWA 5A9SB 5MHTA 2J6IA 2O6HA 5FPPA 5HJEA 1DBSA 5K3DA 1LNQA 2HJRA 3WQHA 4TS4A 3CLTC 1GL7A 1OX6A 3OM0A 1BN7A 3W2EA 2EJTA 1QYCA 1CQIA 1TM5E 2QZPA 2QTLA 2CK3A 1C9EA 1RZVA 3O1LA 4PX9A 3IULA 1TW2A 2XKJE 5DO9A 1NN3A 1V6CA 2FU5C 4U02A 1SOVA 1F2TB 1NMQA 3JAWB 1RQXA 1U6JA 4R1OA 2OE2A 3ZGLA 1A0OA 8GPBA 4LF9B 1O94A 3Q40A 4J0QA 1CD5A 1XEWX 4J16C 3IVMA 2PZLA 2I99A 2EZ9A 5DMHA 4N7JA 1CRQA 1F0YA 1G16A 1XCBA 1OAOC 4TV8A 1N4AA 1YE5A 3BWCA 3BTOA 1GCOA 1BQ3A 1QJ4A 3WNBA 4KNVA 4B5KA 1M6HA 4A0SA 3KB1A 3KSDO 4GOXA 1WMFA 2EP8A 3TZHA 1WF6A 2H1FA 3C3DA 2ARKA 3TM4A 1GN8A 1ONSA 2Z3VA 5ALDA 1N2CB 3I2JA 5THQA 1FFAA 1I4TD 1UBRS 3OFVA 5HMLA 1D7OA 2IYAA 4RGQA 3MLBA 3LA6A 1PV4A 4INAA 5AI8A 5ESRA 4CIWA 2B8WA 4R05A 3I6ZA 2FI1A 1EBFA 4RENA 5GQSA 2J9ZB 5LMCA 1E32A 4XWWA 2EEZA 1IN4A 1L7QA 3MG9A 2YH2A 3M89A 5GGYA 2GLXA 3BTVA 5DE3A 5FADA 3CTMA 3L7CA 5B7QA 4MKRA 5I8PA 5EA2A 1FTQA 1KO5A 2B25A 2HAEA 1SBTA 3CZAA 1X8LA 4EHKA 2JJ1A 1JG2A 3ZJUA 1YSCA 4FCTA 5ITWA 1T9AA 4PQYA 1YKGA 3RS8A 1RXUA 5F76A 2XJ9A 2BONA 5JI3E 2IVFA 3GLFB 5MGNA 1ZBDA 3CPEA 3PS9A 2WR8A 3ZKWA 3FCSB 3C3JA 5IW8A 3AHCA 1N0VC 4C0LA 3IMKA 4YDRA 1E92A 1EBBA 3JCZA 3KKPA 2FRDC 3DM5A 4KIJA 4WVFA 1F8YA 1T13A 3QXGA 3TKAA 2G6TA 2OK7A 1NYLA 2AC2A 5DXFA 5JSZB 5FI3A 3HCOA 2WD7A 4JIMA 4UE6A 3RE1A 1T6XA 3FTNA 3JQFA 3R76A 1L9KA 3IS3A 1IB0A 3CBQA 2IHNA 2BM8A 4CG2A 3H8JA 1CUYA 3OF3A 2CCKA 4DDUA 5KS2A 2H2IA 2AMJA 1C80A 3TBFA 2FZVA 1Q2UA 1ULBA 2COEA 2FV8A 4K9QA 4WL0A 2OPHA 4C2BA 3E3OA 5IXJA 3LO8A 3LSTA 1TO6A 4HB3A 3ANXA 4MYSA 2C96A 3FGZA 1H0SA 3CE9A 4C0BA 3MXOA 4C7OA 2GEUA 1E9VA 3VNSA 3W3ZB 2H4JA 2PRYA 1GR0A 1FQKA 3BPSA 1OREA 2ID7A 4M1MA 4XYEA 5LYJA 2JJYA 4XVHA 5TY0A 1L4EA 4U5QA 2AR0A 2PXAA 4LA4A 4U2GA 4B31A 2WD9A 2Q3MA 4YWHA 1J24A 4WLOA 3BF8A 3OZFA 2PSHA 1QHGA 1MG0A 1RHMA 1LBEA 2L69A 3KKQA 3EGEA 4BB0A 2X22A 2BLLA 5J4YA 1BWQA 2IX9A 4DG9A 1U63A 1P8JA 4B8WA 4FPXA 2QZJA 1X7DA 2QV7A 1NTRA 4JHXA 4MRMA 1LV8A 5FRDA 4G4JA 4I5DA 4TMYA 4PLVA 4CMEA 1S2NA 1Y5IA 1ULTA 4Q7KA 3U62A 4OREX 4BN0A 2MSNA 1XPUA 1QGDA 4O4LF 5DWDA 5AM4A 3HCAA 1O5OA 1H2HA 1YQGA 2UXBB 3FJOA 4F2PA 2NNWB 2E1RA 1PNVA 1FRQA 1S7CA 1Y4SA 3V1TC 1TFUA 2ZJBA 3VR4A 4OM7A 5J5CA 1M7HA 3CW9A 1WUKS 1G8HA 4PGGA 4X7PA 4BFXA 4ZAWA 4Z49A 4GVPA 1WTAA 1TYCA 5BSMA 1O58A 4TWJA 1VCMA 3C48A 3L7LA 4CCWA 4CKEA 4AL4A 4BBJA 6Q21A 4QDZA 3QBJA 3W7BA 1A9XB 1X1AA 1DPGA 1QHSA 3KHTA 2QX7A 3KTFA 1JMVA 2HEIA 1RADA 2BDEA 3GL9A 3FSJX 3KJZA 1SVNA 3MM4A 5KTPA 2GYYA 4N0EA 2PA3A 1MT0A 3NATA 3VPSA 4X45A 3DD1A 2Y1KA 3IC5A 4QUGA 4RL4A 4REQA 3FF4A 4WESA 1Y1LA 2NAPA 1JDPA 1YFJA 2F1JA 2ZJ4A 1KJ9A 2C8VA 4CLEA 2O3TA 5FAXA 1JBQA 1RKVA 2FDRA 3CZPA 3QFSA 1CIJA 3NJ8A 1UM9B 5ALIA 5I7VA 1SZDA 1T0JB 3BXHA 5K05A 2NU6B 4BNLA 2XHZA 3QYAA 5HZGA 2JRLA 2IBTA 3PQ2A 4JOCA 1JH9A 1T35A 2HN9A 2ONJA 2AHOA 5A6SB 5EAIA 4YUZA 5AW0A 2HXGA 4IPTA 3LGAA 4BY9E 1KI9A 2BFCA 4WT7A 1L5HA 2WNHA 1QH1B 1CFZA 3M1AA 3GFOA 4LWPA 5KTYA 2Z8ZA 4TRRA 4XVUA 2VS1A 1L1FA 1THZA 2C99A 1KZGB 2EW2A 4OHBA 5CB8A 1SBZA 2R751 4Q6WA 4WH0A 4DAOA 1L4FA 1DQZA 1XMIA 3BG5A 2ID9A 5K4HA 1C7JA 3O8LA 2ODWA 3I2GA 3Q1KA 4OI1A 7AT1A 2JCVA 2OO5C 3OM8A 5C37A 2F3SA 2GZHA 1Y7PA 2HF2A 2OCLA 1B6GA 1ESCA 3L6BA 3NC4A 4C4YA 2O5EA 2B61A 1HR0B 4O5OA 4ZEWA 4K3UA 2EIXA 2XTNA 4J8PA 4PGHA 2YYZA 3FGPA 4OJMX 5E2AA 3T38A 4MGYR 3UMCA 4BQPA 2Q5EA 2LUOA 4YUXA 2RDMA 3S1AA 5J4HA 2O05A 1TU3A 4XPIA 1KNXA 3REOA 3E4DA 4MVJP 2NZVG 1AO0A 2C57A 3R3WA 3TNFA 1W5AA 4YAOA 2UUAB 1AQIA 4IILA 4WOJA 1G6KA 3OE5A 5E2IA 5KYNA 4CVNA 2HXSA 1PJSA 2OLKA 2BKXA 3UATA 4BFVA 5CLIA 3B9RA 3IAM6 2V8BA 5DTRA 2WOOA 1LQTA 4QUBA 4U6NA 1B2RA 4ZOAA 5F4ZA 2XTMA 4EB8A 3JQ7A 3NKVA 3P2OA 4RKYA 5KVAA 3P94A 2DUWA 2QZ4A 4DNFA 3LL7A 3O3OB 2H2FA 4FYHA 3HHPA 1QPBA 3CIOA 4Z8YA 4JI6B 3UB3A 3V80A 3R9XB 3STTA 1EM8B 2EDAA 6PFKA 1R74A 3K6SA 5LXTB 3FB4A 1VRCA 3BREA 3JR7A 1NPDA 4HPXB 4TM7A 3OA2A 4N7MA 2OCBA 2L19A 3KZVA 1TRHA 2YNMA 5EP3A 4XQGA 4CKYA 1OGJA 3EZYA 1O97C 4RYDA 3UMSA 5AUPB 1A4XA 3BB1A 4I55B 4QPZA 1ZJJA 4W8OA 4LFBB 1SEPA 1HKUA 2DUNA 2XUAA 3D6MA 2BTQA 3PC8A 2OV3A 3EJ6A 4AP5A 1MC1A 4A6XA 3B36A 1TUBB 3WGTA 3VR6A 1Z75A 3T5AA 1TJ4A 4W9NC 1W35A 2EJVA 4CQLA 1K8QA 4TRMA 4WBXC 5AH0A 2PFGA 1QTNA 4J07A 1QFMA 5LWHA 3ZQJA 1U0TA 1FFGA 3IQGX 1RS0A 3BZWA 3ORSA 3UN1A 1VSTA 3PB3A 4IYRA 1YDHA 3U48A 1R8JA 2IYNA 3EUEA 2VJPA 2VP5A 2XMBA 3DL4A 4R9SA 2ORYA 3NFYA 2C4KA 4IAOA 2WIFA 3NHLA 1VYVA 2VUHB 5J2TF 4EY6A 5EQTA 5ELMA 1FQWA 5IEBA 3SBEA 5AVRA 5HF9A 4FUTA 3QXSA 4PYKA 1EZZA 3ZXYA 4R9RA 2AZ4A 1V37A 3MRTA 1EH5A 4LPKA 5TS3A 4G0YA 1Y42X 4UVDA 5H68A 5I9LA 4UXJA 1AMUA 1T9GS 5EUCA 1Q0UA 3ZWXA 1ZK2A 3H1EA 4QNMA 2B2NA 4XYLA 1WEHA 3AR5A 3HBAA 5FPHA 4ZMSA 3F47A 3HCPA 4D26A 2QLNA 3EISA 5AVZA 2H1RA 5K3EA 1YL5A 2H1HA 4NNPA 5JHGB 3KOWA 4BNXA 3AUUA 3PR1A 4ZPXA 1Y9AA 4D1YA 2PQ0A 5AW4A 4LXHA 4UMEA 4CN8A 1WXGA 1RKQA 3GJRA 4TSRA 2D1SA 2AFVA 4K9MA 5LXTF 2D7JA 2NG1A 3ETNA 5JRDS 4CEHB 4RELA 2P2YA 2QTVB 4DSZA 2A1TS 4J3NA 3C41J 4QJ3A 4B33A 5EJ5A 4DR7B 1C3XA 3R24A 4RMGA 4P82A 5I9IA 4I1UA 3T5CA 1QH8B 3ICEA 4C5CA 1KZ1A 4QUEA 1QO7A 3JD0A 1NDHA 3LX4A 1P9WA 3Q7TA 4WCDA 3M6XA 3ZE2B 5C4IA 1FUKA 3O8QB 2AVNA 1XMJA 1RM4A 4IHKA 4IEFB 5LZ4A 4QQ8A 2CZGA 3D3EA 1E7QA 1BROA 1RZ3A 2XTJA 3NHPA 4XM2A 5CJ2A 3T3HA 5F5XA 1SD2A 4EJSA 2UYCA 4KQEA 3K5HA 4QQRA 3WB9A 2I7CA 2G08A 2V58A 3F7OA 1U8TA 2ZJ8A 3MGGA 1W8DA 5JAQA 3OC6A 4F8YA 4CIBA 3AI2A 3VH2A 4A73A 3Q10A 2QPAA 3H2GA 3N75A 4P4SA 3ROEA 3OKPA 1I3MA 1NV9A 1P0QA 4NEGA 1CQIB 3LZDA 3QLVA 4MRPA 4N5IX 5CLQA 1SC1A 3PGLA 4MZDA 3T1OA 3AESB 1T1EA 1GPLA 1ZRHA 4DLUA 5SV2A 1XJQA 1M2VA 5AM5A 4M7OA 1WXFA 3CNHA 2K2WA 1SXJB 2J6CA 3QV1A 1HKHA 4ZQCB 4O4IA 4DQVA 1I7DA 4NPHA 1BXGB 2X6TA 3GRUA 4BBPA 1R6TA 3V4OA 2RAUA 3KE9A 4QSHA 3NKFA 6GPBA 4XSHA 5I9TA 4OGKA 2R65A 2WIBA 3BAFA 4IKPA 5DULA 3WAKA 3V4RA 1YS6A 2C8LA 2PNFA 2VK1A 2WZDA 2LDXA 3IQWA 3TFOA 1Q84A 4AULA 3LP8A 4YVFA 5IVPA 1IJBA 2FF7A 3BK2A 4MI6A 5E6RA 1NVAA 2F3TA 4LS3A 3KB2A 1S2LA 2OFXA 2YN0A 4BO8A 4C0SA 1E7MA 3GRFA 1OTXA 1PTJA 4U9UA 1GPYA 4GPTA 2GJ8A 1NDQA 4NMLA 3W4JA 1MZVA 3R4CA 2E21A 5CU7A 3V55A 2VNIA 1DKMA 4D3XA 3E9RA 3UGTA 3WV4A 1NUUA 1ZM2A 4FFRA 5EMKA 4TUYA 4C0QC 5AUOB 4JA2A 2CVOA 3U1TA 1EHIA 1M8PA 3VO2A 3ONWA 5JZ9A 3WAGA 3D0RA 2P90A 4Q3DA 3X2FA 1KFKB 1HL7A 1V11A 1J9GA 3P97A 4OHCA 4AJHA 1PQYA 1VPVA 2BD0A 5J5VA 3STVA 4QJ5A 2XAAA 1PFGA 2CLOB 3B6KA 1MC4A 1BKDR 1FMLA 3LT2A 4US0R 5KWEA 5AHOA 4JI4B 2I55A 3P0EA 2A9JA 3D1JA 1MB0A 1V71A 2FWAA 3LK7A 3QV2A 3KLNA 4KLAA 7MDHA 4IW3B 4UMDA 3ONNA 1AKWA 1RI4A 2MYTA 5JC8A 1H3FA 1QRTA 3ZGNA 3RIMA 1P39A 2D0DA 3KEFA 4MDHA 3K8QA 1WMAA 3NBYC 1DFHA 1M66A 1NBAA 4OJQA 1SB9A 1V8FA 2WD7B 2X13A 3EFBA 4OU4A 3RANA 2GZSA 2OQRA 3V7FA 4XSVA 1XYVA 1UH5A 1UQRA 2VDPB 5TJ9A 1NQXA 3RRNA 3Q5GA 2B4RO 5DEOA 1H1LA 3WAJA 2Y1CA 3F4BA 3PQFA 5IUNC 4QUKA 2I6XA 1ICEA 2SECE 2GHTA 4CQMD 1U0RA 1JTVA 1RKBA 3VHXA 1T5LA 3OUZA 4J3JA 1FX1A 1LBIA 4C7OB 2I2FA 4PPFA 1N77A 3H3FA 4HP8A 4TV8F 1T4DA 5B6PA 1Y4UA 1ZNWA 2OV1A 3D7RA 3FCXA 2PX2A 1LLUA 3IVRA 3R7DA 4CJXA 1CXZA 4P54A 4O3MA 1XG5A 4JJIA 1JEQB 2VHXA 2NPFA 2QN3A 5BR4A 3K31A 3NOQA 4X62B 1Z5VA 3I39X 3ANMA 3ROPA 2PUVA 1KYWA 3NGXA 2C4UA 5DU2A 3U9LA 1W96A 3IPRA 3O8NA 3KQKA 1ZNYA 3BF7A 1WABA 3FLMA 1RPZA 1MGPA 3FSGD 1YQEA 2ZUCA 3WRVA 1C0EA 3SF8A 5IULC 4XJTA 4MRMB 4KO8A 3Q3IA 1D07A 4H7JA 4O1IA 4UFOA 3TMYA 1TIKA 4QNNA 3ZHCA 2OGTA 1ANKA 5BR1A 1E1RD 3JV7A 4DXAA 3I28A 1D8AA 4EYSA 1LPSA 3OT5A 3LW7A 3B7GA 4FQ5A 3ONVA 1PS8A 3EK2A 3DVQX 4XGKA 4XIYA 1WMSA 5DHPA 4CM4A 5IEJA 3GLFA 2WFAA 4I4NA 4QA9A 3IR7A 3ROKA 2YWJA 2ZI5A 2WSSA 4BKMA 3T34A 1WMBA 1QFXA 3PTLA 2XDAA 1Y6QA 4CKEB 2XMCA 5DPMA 1UPTA 5LA6B 4BLVA 2G25A 4CIAA 2WJJA 4X84A 3EYWA 4NH0A 1S02A 4ZV4A 3MMZA 3CLSD 1T1IA 4XIGS 5FBRB 3RVBA 3U60B 3GNLA 3GQBA 3OCVA 5SZKB 3VKGA 5AW3A 3VU9B 3D2AA 3V4FA 2IYPA 2QLMA 3BWYA 2QW1A 3D5QA 4KAFA 4REQB 2IUYA 3E5RA 3PX2A 4JLJA 3CLRC 3QSYA 3R3VA 5A0VA 3HNOA 4X6UA 3K9HA 4URYR 4X20A 5C1DA 2EERA 1ADCA 1WCYA 3EMVA 3ICWA 4BO9A 2YXDA 1CY2A 1NVWQ 2A9PA 3HU2A 4OTZA 4Q3AA 2FHPA 3VA7A 1DSSG 1JZQA 4MQEB 4UASA 3E35A 1KYTA 2ID8A 4FFBB 4OSPA 3RC3A 4WOCA 5DCYA 2WU0A 4DLZA 3PKZA 1YXMA 4FS8A 4HZUA 4EZBA 2C83A 3IOMA 5AJHA 5CDHA 5LYJF 1QGED 3AETB 1L5HB 2IS6A 3EPPA 5BVHA 3GI1A 3QFCA 2CDRA 1X7YA 4AUKA 3THWB 5C34B 1ZM4A 1GCAA 1RRMA 2ZQYA 3HFJA 2HWXA 4H17A 2WG2A 1GP2A 2O0JA 2Z1MA 4JS0A 2C1XA 1FTSA 4LJYA 5TT0A 3RJMA 5AVWA 1O8CA 1D1SA 4ZTZB 1OH7A 2MU1A 3IEVA 1SIOA 1U4SA 2VPYA 4RD4A 4RNCA 4M0UA 4FHEA 2Z9CA 5CVJA 3HLKA 1UBUS 2HI0A 4GX5A 3COZA 1J8QA 4BNUA 4L3WA 4GR5A 4DCGA 5LLTA 1E9SA 3Q6IA 1MQ9A 4LJAA 1IDN1 3USES 1OZHA 1PR0A 3IMGA 3C3YA 4RV4A 3GJZA 2WUGA 3CJQA 2OB2A 2Q5FA 4MGHA 4C4SA 3FPAA 4OPMA 4Q66C 4XPIB 5E4JA 2UZ4A 3L84A 3G6WA 3FPBA 5EUMA 5IH3A 3OAAA 3WYBA 1MFPA 4CN9A 4DW8A 4GW3A 1O5TA 3OHSX 3VUEA 1VKHA 3L40A 2H9AA 4BVLA 1WVMA 1ZCAA 2CGEA 2QVZX 4MRAA 2ZAGA 1RLOA 1NVBA 3CB2A 2BFAA 4L72A 5F5NA 4EO7A 5JNWA 4XAQA 5TEVA 1ZK4A 1BS9A 2AEEA 3OWXA 4TVBA 2JI9A 1TQ2A 3KSUA 3A2KA 3ZXSA 2G71A 2YHIA 2B99A 4A16A 2XPCA 2YXNA 1CRZA 1O0CA 4U9IS 3H9JA 3K6SB 5FHQA 5J59A 3UF0A 1GAQA 4WKGA 2YHSA 4F56A 4U6QA 4CXMA 1KGDA 4G85A 1R00A 2ZB4A 5B4UA 1N6RA 3JZAA 1JI0A 1KJ8A 2F1KA 3CFYA 3STWA 2Q9BA 4GRIA 2J87A 2XLCA 3FPHA 3W5IA 2EX0A 2JBAA 2YBEA 3O7MA 4HATA 5EUBA 1M1NB 1QH0A 3AIOA 3COVA 3L8ZA 3UFXA 4GMGA 2C54A 4OAPA 1QIGA 4BVFA 2P4UA 3ED1A 3SHOA 3UUWA 4BWGA 3TZCA 1ODLA 1U7WA 2BTQB 1KQNA 4ALJA 4NRDA 1T3TA 3G8AA 4RY2A 2NP7A 5K1ZA 4JI1B 2OTCA 2VQEB 2DM6A 3G8BA 3F5FA 4JJ4A 4MW1A 3ND9A 4XM0A 4CQLB 5HKBA 4ROSA 5IN4A 4IUCS 4UBMA 3H2BA 2JFBA 3T3DA 5A04A 4X61A 5SY6A 4UUNA 5EKDA 2G83A 4R3NA 1DCKA 1KC3A 3ZBPA 1EWQA 1DUSA 2FDXA 2G8LA 2VHVA 4C0HA 4WBNA 3CLTD 2PUHA 4MKXA 2A0WA 3O5AA 1L7DA 1I2AA 2ZRJA 2I62A 1GZSA