4KWHA

The crystal structure of angucycline c-6 ketoreductase lanv with bound nadp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
GNLTGKTALVTGASRGIGRAIAEKLGYAGALVAVHYATGADAAAEVAESIEKDGGRAFTVKAELGVPGDVDVLFEGLERGLKERTGATDLDILVNNAGVMAMGAPEEVTPEMFDRMMAVNAKAPFFIVQRALSVMPDGGRIINVSSGLTRVASPDQVTYGMSKGALEQIALHFSRHLGSRRITVNSVAPGSTDNGSALFQIPEVRETLSQLSTFGEVAEPAAIADVVAFLASEDARWITGAFIDASGGTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of angucycline C-6 ketoreductase LanV involved in landomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces cyanogenus
molecule tags Oxidoreductase
molecule keywords Reductase homolog
total genus 90
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kwhA00
3WB9A 1ZSVA 1HSOA 3I9KA 1ADBA 1XLTA 4WJZA 3E9QA 4FD3A 3MEQA 4MPDA 4DMLA 5MDHA 3MTGA 1HT0A 4E32A 5AOVA 5KJ6A 1E6EA 1LTHR 3BHMA 4CQMA 1R37A 1NFQA 4I9NA 1ZXLA 2J5RA 3X2EA 1PGOA 5CDGA 1E7RA 6ADHA 3E03A 2OFPA 3UGKA 5F5NA 1QLJA 1TI7A 3GDOA 3W6UA 1AXGA 1YDWA 1EUZA 1CQJA 2EHDA 5JDIA 4P4NA 5EJ2A 2E82A 1LSOA 3QWHA 2RHCA 4ND1A 3G0OA 4OAQA 3KEOA 2A4KA 3VAZA 2C0CA 5L53A 3ABIA 5A04A 3A14A 3LQFA 5EL0A 2VQ3A 4RLSA 1ZUD1 1MXHA 3W1VA 3WBFA 3ETGA 1LRKA 3TFQA 1B16A 2VRBA 1KEPA 1DO8A 4D43A 4RQTA 3PGJA 4XYLA 4PG4A 4D3FA 2OHXA 4Y6PA 4YAJA 3DDNA 3MJEA 4LW8A 4PFJA 1DRWA 1SAYA 3IP3A 4ZQBA 3ZHXA 5TT0A 4BNHA 4NBWA 4BNYA 2JCVA 5KOIA 1EEHA 1NQTA 4MP8A 3KYCB 4HADA 3BMOA 1LRLA 1O94A 1LQTA 1T1SA 2J3IA 2EJVA 3GFBA 4MVJD 5ILGA 4D45A 4DLBA 3AU8A 4NPCA 2F00A 4MO2A 1DRUA 1C1DA 2X5KO 3JD3A 2GSDA 5DP2A 1C1XB 3KM0A 3ANLA 1ULUA 3DHEA 3HDHA 2AE1A 3PHGA 1AN9A 1NNUA 1VKNA 3HFGA 4LSMA 3TN7A 1XQ1A 1ZFNA 3A06A 2GZ3A 3PQEA 2BFPA 4L76A 1HTBA 1X0VA 1HE2A 1NHGA 4CV3A 3GNQA 4GL4A 4BQPA 2Q2WA 3WSVA 1JKIA 4WCFA 1VLLA 3JD4A 4J4BA 2B35A 4CM8A 1TT5B 4TMFA 3F9IA 2CF6A 4YTEA 4UVHA 2QYSA 1QSGA 3M1LA 4PRLA 1EDZA 2H9IA 2X6TA 2FPPA 3JTMA 5TS3A 1ZKMA 3OEYA 3FR7A 5A9SA 3KO8A 2B5VA 4R16A 1P9LA 4QO7A 5ENDA 1XCBA 2W2LA 2GN8A 3TFOA 2D5CA 4DWVA 1UJMA 2PH5A 4TZKA 1ZXBA 4BMSA 5CAEA 2HQ1A 5I8ZA 1IHXA 1HZJA 2VUUA 5B12A 4W9NC 1EMDA 1QG6A 3KBOA 3OJLA 3WICA 1QORA 5AQ1A 5ITWA 4K6CA 3RQSA 4BGUA 3NT4A 2B69A 3KUXA 4NG5A 1GYQA 5TX7A 3C7CB 3HNPA 3VHRA 1VE9A 5JCXA 2PLAA 3I9NA 4IZHA 2OP1A 5ICMA 3B1KA 2V6GA 3PK0A 3QSGA 3V1YA 4R01A 4CLRB 5JS6A 3AUTA 1H6AA 1C3VA 2AA3A 2OXIA 1PJ2A 2X0NA 3U9LA 5L7WA 4XR4A 3SX2A 1BTOA 4L74A 1V3UA 2XOXA 1ONNA 2ZB7A 2VYND 3PI7A 1M67A 1NR7A 1HLDA 3JD1A 1K89A 2JHFA 2VHVA 3RC7A 4W99A 1AGNA 4KZPA 3TZ6A 4K1LA 1FJHA 1K3TA 4HFMA 3WFJA 4XGNA 4XRRA 4CV1A 4DPLA 2Z5LA 5HRUA 1ZZEA 4E13A 3U09A 5CEJA 1ZH8A 2HKIA 4IDEA 4K9DA 4YJDA 4RF4A 1HDXA 1R0KA 3GGPA 1E3WB 4FFRA 1DEHA 1QV7A 3ON5A 3GDGA 5LCXA 4H7PA 4CPDA 2D1YA 3TNLA 1H93A 4RDIA 4D44A 1CQIA 3U4IA 3F47A 3UCEA 5L95A 3DAFA 4DBVO 2OUIA 2BI7A 3IAHA 3P19A 3PFFA 3NYWA 3L6OO 3H2ZA 2NQ8A 4XGIA 3GZNB 3DHNA 2HK9A 1UXJA 1YXMA 3U3XA 1R4NB 2XXBA 3GF4A 2PKRA 1V0JA 4JCOA 4WLUA 4XZ3A 4BOYA 1YB4A 4MVJM 4ZQEA 3D5TA 1G1AA 3FBTA 1EUCA 1CYDA 3JYPA 1K2WA 3UICA 2VZ9A 3PWKA 2BF7A 4FGSA 3UKOA 2Z1NA 3DZIA 1EBFA 4UREA 4D3SA 4E2XA 5A9RA 3QWFA 1UZNA 3ZWYA 4R4JA 3DHYA 4E5PA 4EJ6A 4WNIA 3TL2A 4JXKA 1I2BA 3GOHA 3CMCO 2AXQA 4JP3A 1Z6ZA 1RYDA 3MJ4A 1ISGA 4CMKA 4NBTA 1J4AA 3DAPA 5A3JA 2GRAA 3LF2A 3EDMA 4E5KA 3DBRA 4ND3A 4J2OA 4CR8A 1HLPA 4OO3A 4DREA 4IMPA 1BG6A 2QX7A 1F06A 3WGTA 2B83A 3JQEA 4PLHA 4YDRA 3WDSA 2NADA 4FFNA 3NX4A 2F1KA 4XR9A 3GRKA 2CFCA 3ZDFA 4BB5A 4DIFA 4WGGA 4J3FA 3BTUA 3K2BA 3AU9A 1EZ4A 4B3IA 1QYWA 1WZEA 2QZZA 2UYYA 3GT0A 5HS6A 3ADPA 4GMFA 4Z9FA 4DQUA 1LSUA 2WSBA 2Y05A 1WXDA 1KEWA 1U3UA 1N2SA 1A72A 1U2GA 5ILOA 1E5LA 3GNSA 3HUDA 4KQXA 4DA9A 5JAQA 4OJNA 4ZA2A 5U9CA 1BVRA 3H9JA 4U0JA 2X22A 4C4OA 2O7QA 3OETA 4XIYA 2AQKA 4LCEA 3V2UA 4BKOA 5CDTA 5JYEA 3UXYA 4BO4A 4XEHA 4NZ9A 2AEMA 2VWPA 2D0IA 4NU6A 2VT3A 1XIVA 2OOSA 3ZWBA 2DFVA 4XKJA 3BHJA 1JVSA 4JROA 4RO0A 3DEYX 1ZSYA 4RDHA 2I66A 4Y8VA 3ONFA 4FFPA 4A73A 5IG2A 2PV7A 3C1OA 5U4QA 3G49A 1YL5A 2EG9A 3L0DA 3ANMA 3CTMA 1E3SA 3BYZA 3VH4A 4EUEA 4CM6A 2O23A 2WM3A 4BNVA 3ZWPA 1T4BA 8LDHA 2DBVO 2WTBA 3I6QA 2G17A 4PLVA 3GG2A 4FR5A 3MOGA 2I67A 3PJFA 2AMFA 3AM3A 4YAGA 3INTA 5JCJA 2JL1A 3GR6A 4XJSA 3M6IA 3WQQA 4OKIA 2CUKA 4AJNA 3RU7A 1UXKA 1A4IA 1QYXA 1PJTA 2DVMA 5A05A 3FR8A 1Y81A 2NVUB 3EVTA 4DLLA 3CEAA 3GFGA 2I99A 3RCBA 2D59A 1Q0QA 3F46A 3G79A 1S6YA 4OOFA 5DF1A 3C85A 1YOVB 4UUPA 3W4KA 3WWYA 5JCJD 3PRJA 3VZRA 1U2DA 3BMNA 3ZHBA 2AEJA 2DM6A 2CMDA 1EK5A 5ENVA 1Y8QA 1X7DA 2NNLD 4C7JA 4PVCA 4XYMA 4NJOA 1NHWA 3AI2A 3SLGA 4M55A 3V2HA 1LUAA 2O3JA 3DTYA 5THQA 1ENZA 2DAPA 3L4SO 2RIRA 1EUDA 3WGOA 1Z75A 3RI3A 3IC5A 4O63O 4YRAA 2QYTA 3DBVO 3FI9A 4YPOA 4M54A 3FD8A 3Q11A 1ZJZA 1UXIA 3A1NA 2GPTA 2YHIB 4CUKA 4GSKA 2WYWA 3S2EA 3D4PA 3BTVA 5DCYA 4EITA 2NLOA 4FDAA 3AFNA 1M6WA 3BHIA 4CMBA 4G5HA 1EE2A 4YJGA 3ZN2A 7MDHA 1QYCA 1HE4A 4J2HA 4BNMA 1RWBA 5T64A 1YO6A 3DOJA 4DUPA 2A35A 2PNFA 2GASA 1GYRA 3WGIA 3EVNA 4YAIA 1Z7BA 3GH3A 4NH4A 1LSJA 1HDRA 5A3VA 3VPGA 1B3RA 3OA2A 1GZ4A 4GGOA 1P1JA 2GO1A 3C1AA 4BO7A 1LC0A 4MVJA 4UEJA 4CM9A 1SOWA 2AEFA 5T57A 1Z7EA 4MVJP 3RUIA 3UF0A 4TRNA 2VHZA 3EK2A 1OFGA 4OHUA 3OBBA 4Z0TA 1P1FA 4IDGA 3VVCA 5JAMA 1EBUA 1ZW1A 3R6DA 1B0AA 4OXNA 4NJMB 1SPXA 2GN4A 1IPFA 3RBXA 1NYTA 3NGLA 4RPJA 2LDBA 4EDFA 3JQGA 1DIAA 2C59A 1LLQA 2YQ5A 5ER6A 2O4CA 2ZTVA 4WNCA 1SOVA 2EGGA 3NTRA 3ZU4A 5JMPA 5KWEA 3RVDA 3PLRA 4RPGA 2NV6A 4D46A 3WIEA 4OL9A 3WIDA 3H9EO 4PZDA 3JQAD 4GH5A 5KNLA 3QW2A 1VL8A 4YEDA 3FCOA 1NVTA 3JYQA 4E5YA 3PPIA 4RL6A 1R12A 4F6CA 3ZNQA 2EXXA 4BKUA 5JLAA 5I9LA 4K6FA 4RF5A 3WFIA 3IKTA 2DLDA 4E5NA 3MJSA 1YQXA 3PJEA 3Q1LA 1LA2A 5U1PA 3WTBA 3GAFA 3H5NA 3SLKA 4RQUA 3PZBA 4DBZA 3MWDB 2YHUA 4MOWA 3O8QB 5JE8A 3MJVA 4ZGWA 4LVUA 4WEQA 4J6FA 4ZU3A 1PJ4A 4WUVA 3AUUA 3KLMX 1AHIA 4CMIB 3CPSA 4IM7A 4NU5A 1B26A 4W9NA 3RFXA 1E5QA 1GADO 3GEGA 3QVTA 2D3TA 4RF2A 1A5ZA 5A1TA 1DC5A 1YJ8A 3PGXA 5DOVA 3EZYA 2FZEA 5CG2A 3LC7O 4CODB 3OA0A 2NU8A 3FRJA 4BMNA 4GVXA 2J8ZA 3PEFA 2GNAA 4WLEA 3RKUA 1HF3A 4ALKA 4I08A 4TRJA 1N9GA 3DC2A 5EPOA 1OBFO 2PA3A 2QHXA 4KUHA 3NUGA 3EW7A 1LDNA 2Z95A 4R1NA 5I9MA 3WQSB 1M2WA 1N8KA 3WYBA 2BI8A 3PXXA 2EGHA 2O3UA 3OP4A 4XYBA 3U4HA 1SBYA 4KTTE 1ZCJA 4KTVE 4A2CA 2ZKLA 1GL3A 5JO0A 2JHGA 2NTNA 1H94A 4AJ1A 2C7VA 1ZSNA 1U1IA 1UXGA 3AY7A 3UCXA 1J5PA 3I3OA 9LDTA 3TF5A 3LLVA 1JU9A 3FNGA 3RFVA 4CUJA 3ZWAA 1C0IA 3DZGA 1NPTO 3O9ZA 4XQ9A 1GCOA 2EKPA 3PWSA 4HFRA 2EERA 1JA9A 1SB8A 2CDBA 1YB1A 1M75A 3I9MA 5H83A 4MVJF 5I7VA 4CR7A 2D8AA 3X2FA 5KIAA 5F3RA 1JAXA 4MP3A 2HMTA 1GUYA 5KKAA 1WAMA 3NJ8A 2VRCA 3CMMA 4J7CA 1FK8A 1DLIA 1G6KA 1PS8A 3E82A 4HBGA 4Z3KA 5ADHA 1CF2O 1DFGA 2AQ8A 1YL7A 1ENPA 2FWMX 3QWIA 1HDCA 4Q9NA 2AE2A 4NR0A 3BAZA 1Z82A 1VC2A 3CIFA 3KEQA 3TQHA 5K6AA 3GPDG 3DMTC 2DPGA 3FNFA 1ID1A 3GPIA 4ALNA 5GMOA 5I9NA 5LDHA 1P1HA 1LQUA 3IQDB 4BO0A 1DXYA 2AG8A 1UZMA 4KUGA 4IY1A 1XQ6A 1RKXA 2X4GA 4AJ4A 2NVBA 2I65A 4DYDA 1BHSA 4XB1A 4GWKA 4XQEA 4EYEA 3I4CA 2E6UX 3WS7A 4BGEA 3RC9A 4ND2A 4Z0HO 4OQZA 1X1TA 4BUCA 4AFNA 2RH4A 5JDIC 4NDNE 2FSVA 3ANNA 3OM9A 3KLPX 4ZQHA 3RAJA 3G3EA 3IJRA 4PGFA 2IZZA 1PS9A 4D7AA 2Q4EA 4NBRA 3P5SA 1YQDA 4PZEA 5TNXA 3R0IA 2BGMA 4UULA 3N7UA 1OC2A 3LDHA 1HE3A 3QVSA 2CVQA 2W90A 4ROSA 4J0FA 2H1SA 3U4CA 2Q49A 4J1QA 1P31A 2HAEA 4J1SA 5ER9A 4TROA 3V1UA 5DT9A 2HCTA 5JY6A 2HMUA 4FFLA 4IJUA 1E7MA 4MIOA 2VWQA 1JVBA 1U4OA 2G76A 3M2PA 1Y9AA 1I2ZA 4YJFA 3ZWOA 3K2EA 1WZIA 3P7MA 3UCFA 3ROMA 5JAZA 2DU8A 1X1EA 2BELA 1A9ZA 2NUAA 4Q3DA 3RBVA 3HN7A 3VH2A 1V8BA 4B79A 3GVIA 4WLNA 4M49A 2WE8A 2PZJA 7ADHA 3HB5X 3ZWNA 3ZWVA 2E49A 3BMCB 9LDBA 1U5AA 4MP6A 3WMWA 4N5LA 3ADOA 2HJSA 1H9BA 2P5YA 3DB2A 4LVCA 3UVEA 2HMSA 3UOGA 1A7KA 1BXGA 2Z1MA 3M1AA 1U5CA 4GLOA 2H5LA 3GUYA 4MJLA 4EUHA 3JQFA 2YZ7A 4BVAA 3WX0A 3OEWA 3BMOB 5G0SA 2IYOA 5K6AC 1C0PA 4ZD6A 5KJ1A 2CY0A 1N7GA 4Y67A 3DTTA 4E33A 1C1DB 1O6ZA 5CDYA 2DPHA 5COAA 2PZLA 1W6UA 5L7YA 1HETA 1HDZA 4A26A 1KEUA 1BW9B 2VHYA 4NQZA 2ZYDA 2PGJA 1Z45A 5FWNA 2WE7A 4YJHA 3RBZA 4DMMA 3H5RA 1EK6A 1FDWA 2B5WA 4FS3A 5GZ3A 5MGBA 5G4KA 4XWYA 3EZLA 4E2ZA 4WCFB 4NK5A 1NM5A 1E1LA 3PFWO 2CVOA 3H3JA 4FFMA 4C7KA 3GQVA 1OAAA 1HL3A 5KJEA 4CM8B 1TT5A 4J90A 4QFCA 4FQ8A 2PD6A 3GVPA 3ZHZA 4KMSA 3COSA 3W8FA 2ZIZA 2ZQYA 3SBOA 3SEFA 1UP7A 1ZK1A 1GU7A 1HYHA 3VDQA 4DLAA 1PSDA 4UVGA 3D1LA 5B4VA 1I10A 4HX5A 2P9EA 1GV0A 4JNKA 3O4RA 4OIMA 1GYPA 4NI5A 1MGOA 3S2IA 4BKQA 3OHSX 3PDJA 2C5AA 4IQ8A 3GVCA 3U62A 4RLHA 5ES3A 3JQ8A 3ZHYA 3PHHA 2B0JA 2CZCA 3K9QO 1G0NA 4XYGA 3D3WA 3GEDA 1T24A 1UP6A 3Q2IA 4XD2A 3ZWWA 5FYDA 1XU7A 2TMGA 1RJWA 4PRKA 5G0VA 3VH1A 2FRDA 4EBFA 4EUFA 2YUTA 1E3EA 2B37A 5CHEA 2JFFA 4ALMA 1EE9A 1NASA 1PIWA 4BO8A 4DVJA 4NFHA 3H5AA 3R1IA 1VSVA 2UAGA 4A03A 5IN5A 4RVSA 2PKQO 4YRBA 1R16A 1M6HA 2FPIA 3ASUA 1XSEA 1SCUA 2Y1EA 5T8KA 2X0IA 2X86A 1S7CA 4L9RA 3E9NA 1B8UA 3VPFA 4CLOB 1V35A 3Q9NA 3UHAA 1H9AA 3B1JA 3AI3A 2P9GA 1MP0A 1UXHA 3M2TA 5EN4A 2XPCA 4IS3A 3ENNA 4NK4A 3AUAA 2V7PA 4Q39A 4DYVA 4PG8A 2NVWA 4I9UA 1NR1A 1E3WA 2PGDA 2W98A 3MJCA 4BNUA 4GKBA 1HWYA 3VDRA 1H5QA 1KYQA 1IPEA 2O48X 4YVFA 5BQFA 5KJCA 3W4JA 5DOZA 1U3TA 2ZCVA 3OJ0A 1ZO8A 3JQ9A 4JN6B 1C0LA 3NTQA 4JIGA 1DC4A 1VKOA 2BH9A 4E6PA 1J49A 1ZMOA 3GN2A 4NIMA 4AJOA 2ZTUA 3EYWA 4ITUA 3WTCA 3I1JA 1FDVA 2DKNA 1ZEJA 2TMDA 5EQDA 2JCYA 4NMHA 4E31A 3TPCA 5L4NA 4OOEA 5KTKA 2H63A 4YA6A 5F1KA 1JKJA 1MC4A 2FOIA 2HK8A 3ZV3A 1B14A 1RPNA 4CM3A 3NRCA 3CZMA 2NTJA 1UUFA 3QV1A 4GKVA 2YJZA 3BTOA 3QJ5A 5BR7A 4AVYA 2B36A 3D7LA 4NBUA 5AVOA 4INAA 1DFHA 3PQDA 4L8VA 5C5IA 1H0KA 4KUEA 4JP2A 2Y1DA 4AJ2A 3LSYA 2LDXA 1XYGA 3DZBA 1ZJYA 5DZSA 2HSDA 3OICA 2PH3A 4N54A 3G1UA 3DBRB 4D0RA 3U49A 2Q1WA 4BNJA 1JQBA 4IZIA 3PYXA 1DHRA 1XR3A 4A7PA 4I5DA 2G0TA 4MVJI 5CFZA 5IAAA 2IZ0A 2ZATA 2JFHA 2I5PO 1E92A 4UUOA 4GX1A 5CP8A 5LDGA 4IINA 2O3SA 1I33A 1LDGA 4ONEA 4BGVA 3FF4A 4R9SA 5L51A 1C0KA 4YBZA 3UUWA 3WR5A 3JCZA 4JJIA 4Y9DA 3VPXA 3QY9A 2VHWA 4DPMA 5DN9A 4UUNA 5KKCA 2Y1CA 5COBA 1EQUA 2BMAA 2FMUA 2DBZA 2YDXA 4Z6KA 4MIYA 1XGKA 2Q3EA 4QXMA 3W8DA 3QQPA 1Y8RA 1VRWA 2E48A 4QTZA 3BMQB 5L40A 3U5TA 3EHEA 2JD2A 2Q45A 1YQGA 4J91A 3AUSA 4Z3DA 2AW5A 4L75A 4BB6A 1NPYA 3S8MA 3JQBC 2A9FA 1DC3A 2J6IA 3ZCXA 3Q0EA 3JQ6A 5KCZA 1GEGA 3A4VA 2WWRA 3QWAA 3GLQA 4B4WA 5IF3A 1AUPA 2Y93A 4CL8A 2I9PA 3NJ4A 1O5IA 3PP8A 5KVSA 1K6IA 1R66A 1C14A 2GN6A 3KRTA 4QSMA 4WE3A 1SMKA 4H3VA 2PY6A 3DFUA 3GVHA 4IJVA 5BNIA 1A71A 2V6MA 3FSRA 3OJEA 4NBVA 3GVXA 4JJFA 4LRTB 2ZB4A 2SCUA 3DZFA 3WGYA 1Y9EA 1VJ1A 3F6YA 4P22A 2JFGA 1QRRA 3DMYA 1I36A 2HU2A 5F1OA 2DFDA 3RROA 4UAGA 4HV4A 4ZVVA 3KV3O 4UEOA 4IDDA 3DOCA 2ZTMA 3ZU3A 4IS2A 4QUKA 4WK6A 4BNTA 1VM6A 1CJCA 3JQ7B 4B3HA 3HFSA 4BL5A 5JXWA 2VZ8A 2JCXA 1LXCA 2ZJ0A 4RVGA 4URFA 3A9WA 2DUWA 3A28A 1JTVA 2IODA 5L9AA 5A9TA 1P0FA 3JYOA 3Q3CA 3LC1O 4X54A 5G2OA 3TDKA 1H6BA 2NU7A 3LT0A 5JMWA 1DJNA 1I30A 3E8XA 1B7GO 3GC6A 2X1HA 1EFKA 4BNNA 1PJCA 2CF5A 4B3JA 3RD5A 3ITDA 2VUSA 2X9NA 3WNQA 4YXFA 2G5CA 1D1TA 3HDYA 2HLPA 1D8AA 4CL3A 1P45A 4PN3A 1HDOA 1UAYA 2GDZA 3BIOA 4O0LA 4ZQFA 3HDJA 4F46A 8ADHA 1F8GA 2VN8A 2O2YA 3B70A 4P4LA 3NTOA 4NNJA 3HN2A 3ZWMA 3VKUA 2QRLA 1WDKA 4CUZA 1A9YA 2NM0A 1E3LA 3QP9A 3JQDA 2R6JA 1ZVMA 4TRMA 3ICPA 1KY5A 1EVZA 1SC6A 3GN1A 4L73A 4R54A 4BKPA 4J7XA 1D1SA 2B4RO 3U0BA 4AJKA 1X7HA 3ZU2A 1KERA 1VL6A 5IZ4A 3NKLA 4RPHA 1SNYA 3NDIA 5EERA 1N7HA 3MJTA 3MWEB 4G65A 3ITKA 2QZ9A 1I24A 1BWSA 1BSVA 2VTEA 1PQPA 2BGLA 1JN0A 3WLFA 1PGNA 4D79A 4EI2A 2X23A 3JQFC 1U3WA 2D5AA 4EGFA 1EVIA 2OMEA 3JQGB 3ZH2A 3ASVA 4A10A 2C20A 4E21A 3WWZA 4OGWA 3JD2A 4WLVA 3WNVA 3D5QA 5TJ9A 4OM8A 5JC1A 4RPLA 4ZN6A 3SVTA 4HFJA 1BXKA 5IDQA 3GMDA 2AG5A 5FFFA 3VVBA 4K26A 4O1MA 4E2WA 3IL2A 1ONOA 1TEHA 1YH3A 4HNHA 4CQMD 1YB5A 4CMJA 1GAEO 1MV8A 1I8TA 3SJ7A 3ULKA 3VTZA 1BXZA 3KYDA 2EV9A 2NWQA 2C2YA 3JQCA 3IJPA 4BO6A 1DIBA 3NT5A 4ND4A 4RV9A 3ETDA 4JBIA 1HYGA 3RJ5A 3PVZA 4L4XA 1V3TA 5B1YA 1UH5A 4PG6A 2DTXA 2WMDA 1AXEA 2DBRA 5IZCA 3DMTA 4DIBA 4FJ0A 5A06A 1JAYA 4A5OA 2C2XA 2XXJA 1QV6A 4J43A 2EW8A 3H65A 3C7AA 3AFMA 2O3TA 1H6DA 3FN4A 3PZRA 4KDFA 4FB5A 3UN1A 4QQRA 1UR5A 2C7GA 4W4TA 3S55A 5K0ZA 4ZRMA 1UDBA 3DBLB 2VUTA 2PZKA 3H9QA 2VWGA 1KC1A 1IYZA 1MX3A 1IB6A 4HY3A 3K92A 2P5UA 5IDWA 3TOXA 1ZMTA 3WXBA 4CMHA 3H9GA 2BRUA 4NFYA 4PZCA 4RGBA 2QRKA 5F21A 4YT5A 1U7TA 4E0BA 4D41A 2VYVD 4YB8A 4D3DA 4R69A 4YQZA 3DR3A 4PLGA 2JD1A 4IGEA 4JLWA 1YVEI 4BNKA 1YRLA 4Z0PA 1DAPA 2VYVA 3C1TA 4PLPA 4R3NA 3F5SA 1GUFA 3GZ4A 3TSCA 3WQRA 2B4QA 5BSEA 4BHTA 3MOIA 1GDHA 4CQLA 2Y66A 1CDOA 2PWZA 4WASA 1JLLA 3JQ9C 1Y6JA 1DHTA 2FR0A 3I52A 3D4OA 1GPDG 5TT1A 1T2CA 1TXGA 2NU6A 3IOYA 4N5MA 4QO8A 1F0YA 2IEBA 3RUEA 3T7EA 4AJLA 4CMGA 4RCVA 3E6AA 3F3SA 1DIHA 4YWJA 3UW3A 3OQ1A 2QRJA 1NAHA 3KTDA 3P2YA 1NXQA 3QRWA 3OF2A 2I76A 1E0DA 4U8GA 3L4BC 3I5MA 1WW8A 5JO9A 2BHLA 4KWHA 1U7HA 3ZV5A 4TWRA 2R00C 4BNZA 1PWZA 2YQ4A 3L9WA 3OJOA 4R5MA 4TRRA 5JAIA 4W7HA 4LSWA 3SJUA 1GUZA 2PTGA 2ILTA 1H2BA 4YYZA 4IJKA 4M87A 1A27A 2X9GA 1FDTA 1YGYA 4RVFA 4XGKA 3ZI0A 1X13A 4B8ZA 2DUUA 2X7HA 4QEDA 2HMWA 5KJFA 4RORA 3VKVA 1FF9A 3KSUA 1QMGA 4PG7A 5TQVA 2XF8A 3IS3A 1NQOA 4CM9D 1E7QA 1A4UA 4FOOA 5CG1A 4II2A 3ONDA 4MDHA 1ADCA 1VJ0A 2GZ1A 3HWRA 4U5QA 4F3YA 4D42A 2QQ5A 3TRIA 1PJQA 1BVUA 5FEUA 5IXSA 4TSKA 1XU9A 2Y1FA 4G81A 2Y1OA 4YJFB 1J6UA 1GQYA 4YCAA 1QYDA 1YJQA 1LX6A 4ZJUA 5I7SA 1JW9B 5HM8A 1PZEA 2ZB3A 4BNIA 4O59O 2P4HX 3RWBA 5EIOA 1DFIA 4XIJA 4PLWA 1D7OA 5T67A 2Y67A 4DGSA 4DQXA 5I8WA 1KIFA 1E1MA 4L4RA 5I7FA 3BMCA 4ND5A 4HKTA 4YRDA 3INGA 4LRSB 5IXYA 2D4AA 1XELA 5B4UA 4I5EA 3WLEA 1YBAA 3JQAA 1TLTA 1EVYA 1BXGB 4LGVA 3OH8A 1LU9A 1QKIA 5CDUA 2X5OA 4XX0A 2VTDA 3H9UA 3RUHA 1M76A 4CMEA 5G0UA 1GFSA 1Y5RA 2CDAA 3GNTA 2EP7A 1RYEA 2I3AA 2W2KA 3OIFA 3AM5A 3VC7A 3TOZA 4GQAA 4KWIA 1PR9A 3Q6IA 3C24A 4LMPA 1R4MA 1KETA 1PJBA 3NGXA 3PWZA 1BDMA 3GDFA 1E6UA 1ZK3A 3ZW8A 1ZK2A 4H16A 1BW9A 1ZK4A 2W4QA 4B7UA 1WMAA 1Q0LA 2HO5A 5F5LA 4AJHA 1E1NA 4N5NA 3L77A 4R5HA 4YJHB 5GZ6A 2NTVA 1DRVA 1SB9A 1NTOA 3PHLA 3HDQA 5G4KB 4EW6A 2NQTA 3B6ZA 1DIRA 3BXXA 1YS4A 2WYUA 3DZHA 5DCWA 2VWHA 5A02A 4OMUA 1J0XO 1PTJA 1Y7TA 3TZQA 4GGPA 1KBZA 4YQYA 2X58A 5KVCA 2BGKA 2EKQA 3K73O 3QIVA 1B3BA 4EEZA 4FOSA 3KZVA 3VZPA 3QWBA 3WBBA 4M8SA 3UAGA 1BMDA 1NP3A 2GF2A 1I3LA 4A0SA 3E9MA 3W4IA 2YFHA 1OI7A 1SEVA 4FN4A 4CMEC 2CNBA 1N92A 1YBVA 4Q3BA 3DOOA 2YV1A 2P4QA 4PCVA 2BFAA 4L0QA 4ZQGA 3ZV4A 3JQ8B 1Y5MA 2RAFA 2IXAA 4R1TA 5JY1A 3WG9A 3D3WB 1RM0A 1TT7A 4JQCA 3HZZA 5KVQA 5JC8A 3N58A 1DJQA 3AOEC 4R1SA 1CEQA 3KYBA 4PIVA 1ZNQO 1YL6A 2P2SA 2GGSA 2PFGA 3WYEA 2VOEA 2E4AA 3F1LA 3S2GA 4H15A 3QVOA 4BNLA 2RCYA 1NFRA 1HDYA 5GZ1A 4I1IA 5FI5A 2EKLA 2Q2QA 4FGWA 1MA0A 4BKRA 1LDYA 4AICA 2R00A 3GK3A 1MFZA 1GD1O 3BA1A 1A7AA 2J3JA 2UVDA 3QVXA 3ZV6A 1LDBA 2Q2VA 1ZEMA 4FC7A 1P44A 4MVJG 4CLXA 3GY0A 1I2CA 1PGPA 1T2DA 4CLOA 3T4XA 4BO1A 1R0SA 2GLXA 5G4LA 3V5NA 3PTZA 4J9VA 5CDSA 5HWSA 3DZKA 5HTOA 3JQBA 4P8RA 1X0XA 5IDYA 1LDEA 2J3KA 1R6DA 1KVUA 1B2LA 1KVSA 1E1KA 2DT5A 3IUPA 2BFMA 4CLHA 1NQ5A 4MVJE 5TF4A 3LU1A 3W8EA 4O5OA 2Y0CA 4AJPA 1DLJA 1MC5A 1IE3A 5A5FA 2WD7B 2ZCUA 4XRGA 4J0EA 3E5RA 1PR3A 4JX8A 3TZHA 3GHHA 1LLDA 5CPBA 1PJSA 3HB4X 4BO9A 1ONPA 4I5FA 2I6TA 2VCYA 4LK3A 3KXDA 4E3ZA 5JYDA 1Q1NA 3PHIA 3H4VA 3CUKA 3GRPA 3CSDA 2PKQP 3RKRA 3ZGYA 3AY6A 2C07A 4U0KA 1OOEA 1IULA 5H81A 5LC1A 3V2GA 1GTMA 3HADA 4J1TA 1NVMB 3DXFA 3OIGA 3NDJA 3QHAA 3TJRA 3ETEA 4I8XA 4AJJA 1GCUA 5DULA 4YR9A 5DBGA 2RH8A 1YWGO 4K28A 4CM4B 4D0SA 3RC1A 4IDBA 4RF3A 3AK4A 4QX6A 4ZICA 4WOJA 1B8VA 2C82A 3HJAA 3RU9A 3ZNPA 4YT4A 5TIIA 1QR6A 2BD0A 4YACA 3DBHA 2CDCA 4IMRA 4J4TA 2FSSA 2O4UX 3LC2O 2VRCD 1CWUA 1PWXA 2YYYA 3I23A 5G0WA 5T5QA 3RIHA 3ZNNA 1FDUA 1LSSA 3CKYA 1AHHA 4DQVA 4ESOA 3VH3A 1L7DA 3PIIA 1GPJA 3Q2KA 5AXDA 3PYLA 1DIGA 4M1QA 4R51A 3I6IA 5DBIA 1V9LA 1R0LA 2Q1TA 1MUUA 1O0SA 5JFOA 3LT4A 3EGOA 1FDSA 4Y6RA 2FZWA 1RM3A 1KVRA 2PGLA 4TKMA 2EWMA 4IJWA 1Z74A 4FFOA 1OZAA 6LDHA 1Y8RB 1GZ3A 4R3WA 5AYVA 2FPGA 4CQMB 1HRDA 2FP4A 3O03A 3BMQA 5EINA 1M66A 2I3GA 4Q3CA 4Q3NA 4XB2A 2ZYAA 1PGQA 4M86A 4HNGA 5HS4A 2AHRA 5TRTA 1JWBB 1MG5A 1XDWA 2RHRA 3DL2A 2NACA 5THKA 3VPSA 2ET6A 1PEDA 2FR8A 5DDIP 1PL8A 1HE5A 2Q4BA 4BGIA 1AE1A 4WOKA 1U9JA 3QA9A 3IUSA 3GHYA 4I9HA 1K6XA 4FPXA 3AWDA 3H8VA 2HRBA 1ISIA 3F5QA 4II3A 1HEUA 3H7AA 2Y1GA 3S1LA 2C54A 4RPKA 1Q7CA 1I01A 2QIOA 1E77A 4S3MA 3ZU5A 1IHYA 5CPFA 1DAOA 1JDJA 1B15A 1VI2A 3LT1A 4AG3A 2GN9A 3KOUA 2H6EA 4WECA 2Q50A 3V8BA 5JNLA 5IN4A 2D2IA 3RASA 2EW2A 2A94A 3OMLA 4GMGA 4RVUA 1FMCA 4EJ0A 2YW9A 4BMVA 3KYCA 3E18A 3OQBA 1U8FO 1ISHA 4Q3EA 2ZTLA 3CXRA 4WLOA 1E7YA 1P77A 3JQ7A 2VYNA 3KSZO 1N5DA 1O89A 1YE3A 4JK3A 4PLYA 3TZCA 4CV2A 5H82A 2X0RA 4IBOA 1LJ8A 1T2FA 4W6ZA 4GX5A 1DOHA 1C1XA 1KS9A 4IIUA 3WGHA 1UZLA 4U6SA 3RUFA 4YAEA 4CM1A 4KQWA 2CD9A 4L4SA 3C3XA 3KVOA 3ONEA 4HXYA 3D4NA 3QE3A 3WJAA 3S2FA 3I9LA 2BKAA 1UAGA 1L7EA 4DIOA 3JYNA 4JBGA 4WPGA 1EQ2A 5T6BA 2AQIA 4QECA 4ALLA 1ORRA 1NWCA 4PVDA 2PZMA 3E48A 2HDHA 3KB6A 3EUWA 1KOLA 4CJXA 1I32A 1MXFA 5TC4A 1GQQA 4DC0A 4HUJA 3ROQA 2DTEA 1T2EA 1U3VA 2GZ2A 3PLNA 4GX2A 4WCFC 2HUNA 2VT2A 4GBJA 4B7CA 2FY8A 5A9SB 2ZK7A 3TL3A 2FN7A 3HHPA 3INRA 4WKGA 1DC6A 4PLZA 4JGBA 2P91A 4CM7A 2IRWA 2NU9A 2Q1SA 1KEVA 1WDLA 5C7OO 1YONA 2P9CA 2YFQA 3D64A 2X9VA 2VOJA 1VPDA 3L4BA 4B4OA 1O9BA 4XYEA 4BQRA 4IIVA 1IZ0A 2OBYA 4CLRA 4IQ0A 3PQFA 3MTJA 2IXBA 3I9JA 1NAIA 5FF9A 4Y98A 3WJ7A 1Y1PA 1GEEA 3C8MA 5L45A 2DTDA 4J16A 1DB3A 3CH6A 3FNEA 1XHLA 1ML3A 3OIDA 1ZK0A 4GPD1 1UP4A 3H6KA 1UDCA 2JAPA 4IUYA 3IKVA 3IP1A 2OL4A 4ID9A 4WCDA 1TVEA 1U4SA 2EEZA 2PR2A 3K5PA 5CEEA 3L9XA 1NPDA 2ZYGA 1WVGA 4W82A 2OORA 3NT2A 2VNAA 2HK7A 2IEDA 2WDZA 4FCCA 4MINA 1QYVA 2UUOA 1LEHA 3PJDA 3LYLA 2V6FA 1ZBQA 5B37A 3O38A 1XEAA 3KYDB 5DCUA 4A27A 3D0OA 1IZ9A 2PD4A 1W73A 3RUAA 1GR0A 1LDMA 4BIIA 3GAZA 4J9UE 4KDEA 4EEXA 1F8FA 1XKQA 2PD3A 1WLYA 1TB4A 2Y0DA 3QLJA 4XQGA 5EMHA 4J7UA 4CR6A 3GZNA 4HWKA 3OECA 1R4NA 1JKFA 5BNFA 1T4DA 4TKLA 1DDOA 3NV9A 5DBFA 4E2YA 3FWZA 3AM4A 1ADGA 1T2AA 1SEPA 5L3ZA 4U7WA 5TGDA 1ULSA 2OO5A 4NHEA 1UDAA 3WGGA 1LLCA 4UVEA 5HA5A 3EC7A 3DBLA 3RSHA 3R3SA 1WPQA 3AW9A 4Y6SA 1U28A 2VHXA 3OSUA 2O7SA 4EZBA 1PZHA 1V3VA 1Z73A 2OP0A 4FW8A 5L4SA 4HFNA 1P74A 4J4HA 1E3JA 3VOSA 1WDMA 3K31A 2XAAA 4WLFA 1XWFA 2C5EA 3QVWA 3ZWCA 1IOLA 1LBEA 1KY4A 1PL7A 2Y68A 2B4TO 1RM4A 4IXWA 4G2NA 2V65A 4XDZA 1NFFA 2WYVA 4TVBA 5T8KC 4AJIA 5K9ZA 3ZWXA 3CINA 2X8LA 2Q99A 3HQ4O 4MIEA 3JYLA 4IQGA 4E5MA 3I9OA 1OMOA 1QP8A 3AY3A 4M89A 1KC3A 3PJGA 4CM5A 3GMSA 1NX6A 5DP1A 1OC4A 3D3EA 1X15A 1CRWG 3GUCA 3VTFA 3RFTA 4OSOA 1O95A 3IMFA 4UUMA 4CQLB 3OFSA 1RM5A 3SC6A 4RJTA 3EMKA 1FXSA 1ADFA 1CETA 1GY8A 1HXHA 1NWHA 1XG5A 4OQYA 1P33A 1Q0HA 1EDOA 4O6VA 3TZKA 1IL0A 2J5KA 3K96A 5F1PA 4BV9A 5C7LO 1PJLA 4MVJH 2IDZA 3WOHA 3AOEA 2JD0A 1WP4A 4J1NA 3U4DA 4GAEA 3VZQA 4JBHA 1DSSG 3I83A 3H3FA 5JPIA 4F6LA 3JSAA 3WGZA 4YT8A 2HRZA 2IZ1A 3ZW9A 1K6JA 3PDUA 4BO5A 1ISFA 3V1TC 3FPCA 2DC1A 3F4BA 4JJGA 1X14A 4S1VA 5IDXA 3H2SA 1N1EA 1YBMA 1PU2A 3KSDO 4Z9XA 4TVOA 1KVQA 4UVIA 3OJFA 3LVFO 3W6ZA 4R41A 1NBOA 4ILKA 3L6DA 1R15A 3K30A 4BNXA 4IDCA 4DTIA 2BFOA 3G1TA 2OGUA 1E6WA 2OBNA 3WMXA 4ZHSA 2CVZA 3C7DB 5IZCC 2RBEA 3AJRA 3FHLA 3LLSA 1ISMA 1YDEA 1E3IA 4GSLA 3F4LA 4TZTA 3SXPA 1P3DA 3IIEA 4OH1A 2GD1O 5AXCA 3PYMA 3LF1A 3ZNOA 4YAKA 3AOGA 3ZZNA 4ALIA 4PLCA 4DRYA 1U8XX 3CZRA 1BRMA 2VNSA 4IGFA 4NFSA 4W7IA 3VZSA 5JBIA 2NVUA 2FHSA 3T4EA 4OKNA 3O26A 4CMCA 4GX0A 4GI2A 1GZ6A 1K0UA 5EESA 1LRJA 5KVVA 1YOVA 2IE0A 3P2OA 3T7CA 1HKUA 2G1UA 3BMNB 1P1IA 2VZ0A 4DPKA 1P1RA 1H2HA 3BTSA 4GLLA 1K5HA 3FTNA 1Y8QB 4IXTA 3E1KA 5IFLA 4YT2A 3BZUA 1NVGA 3B20A 1WWKA 3RUDA 2WJPA 1W4ZA 2QG4A 5DNAA 5JDCA 4E30A 1VSUA 1DPGA 2EJWA 4I5GA 2JJYA 2DQ4A 5A4DA 1E7SA 3JV7A 3L6EA 4UVDA 3JQAB 5I7EA 1YKFA 1G0OA 2POQX 2YHIA 1MFPA 2YV2A 2C29D 4OSPA 5TLSA 2ZB8A 2R2GA 4FC6A 3ROKA 1JWAB 3K8ZA 4XA8A 3HSKA 1F17A 4RVHA 4YJGB 2W2KB 1WNTA 1F14A 4DC1A 3WSWA 1V6AA 4FJ1A 3NDRA 4GVLA 3WYCA 4BNFA 4PG5A 1R4MB 1Q2XA 3L07A 2FR1A 4CLEA 2JAHA 1W0CA 3FWNA 1VL0A 4BNWA 4BNGA 1HSZA 2O3QA 1WMBA 2Y0EA 1E7WA 2W2LD 2WEKA 3DWFA 1HDGO 4AL4A 5C37A 1NQAO 2P68A 3HE3A 4R68A 4HP8A 4CLDA 1HZZA 1PX0A 4UEKA 4OXYA 3PHJA 4TQGA 4XQCA 4LCJA 4XJTA 5TSDA 5BSGA 3LT2A 2BLLA 4OYRA 1F12A 5JSFA 3ROPA 1ENYA 3ENKA 4B7XA 3FPLA 1H6CA 1MG0A 4NJMA 4B8WA 4MKZA 1X7GA 4RZIA 3I4FA 4R1UA 2O3RA 3SC4A 3DAGA 4N7RA 4B4VA 4B4UA 4DL9A 4QT0A 2UV8A 4RVDA 3TWOA 3ICCA 2UDPA 3DZJA 1CERA 2QW8A 4ZRNA 5AXAA 4KP7A 1Q7BA 4J49A 2HMVA 4FJ2A 1I3KA 1T1RA 2W8ZA 1DBVO 3ST7A 4E12A 1IY8A 2EF1A 2CSUA 3OQ6A 1D4FA 1MB4A 5L7TA 5AXBA 3RC2A 4ALJA 2GERA 1PZFA 4FSHA 1GV1A 4LISA 5CEFA 2WD8A 3LZ6A 5BT9A 2JKVA 3EY4A 4FBGA 3FTPA 1W8DA 4LMRA 4Z9YA 4IDFA 3STHA 1D3AA 1PJ3A 1PL6A 1BDBA 4IDAA 3O8QA 3ORFA 4P4GA 1PQWA 3KHUA 3R3JA 1HYEA 4Q3AA 1KVTA 4CMAA 5FI3A 5BSFA 5BNTA 3DFZA 5IJZA 5L4LA 1MLDA 1ZIDA 1Q7GA 4PLTA 1ISJA 4CMIA 1EFLA 1EVJA 3F1KA 3RJ9A 3DQPA 4N18A 3N74A 3WGQA 2DBQA 2ZQZA 4DXHA 3PIDA 3RUCA 3FBGA 3NEPX 5A5EA 1I5RA 3FNHA 2GYYA 3AI1A 4BV8A 3UH1A 1I3MA 4XCVA 3UFXA 2HJRA 4WEOA 1CIVA 5EQFA 1N9GB 3DONA 5JDCC 1O8CA 2E37A 2PK3A 4AJEA 3HG7A 4RZHA 1XA0A 2WD7A 1TA4A 3GGGA 2Y99A 5TJHA 5C7IO 3JD0A 5B4TA 5GY7A 2G82A 5ITVA 4PLFA 3E5MA 2J3HA 3IDSA 1PGJA 1BGVA 1B8PA 3B1FA 3GG9A 4BO2A 5JW6A 1PZGA 2EIHA 4QFDA 2YY7A 3GGOA 3MCVA 3VPHA 1LI4A 3GEMA 5A03A 2AQHA 4LN1A 4FIZA 4KOAA 5C3MA 5HBRA 4GWGA 1T25A 4R9RA 4U6QA 2Q1UA 3LK7A 2A92A 2OZPA 2Q46A 1ARZA 2NSDA 4EJMA 1QXSA 4F45A 4MKXA 4XDYA 2V6BA 2IYPA 3MZ0A 1ENOA 4CM4A 2O50A 1LNQA 1P1KA 2EP5A 3GA0A 2GCGA 1LC3A 2GUGA 1GQ2A 1QLHA 1I3NA 4P38A 3K6JA 1L1FA 2J5QA 2X0JA 4OXKA 1IUKA 3DBHB 3CE6A 5ICSA 3KETA 2O2SA 2YDYA 5J23A 2UUPA 1I0ZA 2GR9A 4E4YA 5BSHA 4BS9A 4BO3A 1PS0A 3G17A 4CV0A 1N1GA 2X5JO 2YV3A 1SO8A 1VJTA 3Q9UA 2ZJ1A 4IPTA 1LLUA 1SZJG 1T26A 3NAQA 4MKRA 1P0CA 3EAGA 5G0TA 1PQUA 5COQA 3DO5A
chains in the Genus database with same CATH superfamily
1ZSVA 1HSOA 4PV7A 3U7HB 4OREX 2DQSA 2HR1A 4JI7B 2Q4DA 2JHPA 4G0WA 1ESDA 2BBSA 2QUIA 4ISCA 3B6IA 3IQIX 1EX9A 4GXQA 3MEQA 4KPFC 3TNJA 4DMLA 1CQXA 5MDHA 2XAUA 1FQKA 2Z8YA 2Y9PB 2IEAA 1TCUA 2QTGA 3ECAA 1TZBA 1R37A 3HDTA 5LQMA 1N33B 2NZUG 2O6LA 1GNLA 4I9NA 4J75A 1K3UB 1PGOA 3NP7A 3UJBA 1E7RA 1A95A 2R7AA 2X8JB 4K0KB 1Z4NA 3ZDDA 5LKAA 4JY7A 2ZBQA 2B4KA 3MA0A 3W2IA 1QLJA 4IOLA 3U39A 3OX3A 4NH0A 4H4EA 3G5LA 3W6UA 1YDWA 3HJUA 1EUZA 4I81A 4LXUA 1B42A 5EGNA 4P4NA 1Y1LA 3ORHA 4N5IX 4TOIA 4ZT3A 5EJ2A 3NBYC 3DCNA 1OFIA 3T06B 3TYXA 3ISVA 1FFXA 3HBAA 2F8LA 2DR0A 2A4KA 2WWIA 4C7MA 2HRDA 2WINI 3VAZA 2ZRMA 2J4DA 3N8KA 2RJ3A 5AUQA 5KNDA 2QK4A 1A2QA 5EL0A 1I1QB 2B0CA 2QLFA 4CIYA 3KL2A 1GHTA 1MXHA 1RRKA 1A96A 2HF8A 5AKJA 3W1VA 3WBFA 4CCWA 4U7DA 1H9CA 3SXJA 1CZOA 5C5CA 5JECA 4WFIA 2CB0A 1L7OA 1XJCA 2IEZA 3HJNA 3CZQA 4XYLA 3JAKB 2HLDA 2NT4A 2XDWA 2OLEA 4D3FA 1J25A 4Y6PA 4BVEA 1A8IA 1ESCA 3D31A 1NONA 1BE6A 1Q0UA 2B4AA 4ITRC 2ICAA 3MJFA 4BNHA 4NBWA 3ILVA 4KQFA 2DCUA 4PZYA 3TQOA 3VJMA 3KYCB 4AD8A 2PHZA 4HADA 3AF4A 1V96A 2EHJA 1NTRA 2OXTA 1G38A 3AR9A 4H6VA 2WIBA 3CLRD 4LF9B 3BRWD 1BD4A 1YJAA 4ZKDA 1QIJA 2XQKA 3L84A 2WT4A 3I34X 5FPPA 1KIMA 4YRTA 3JD3A 2R4UA 4ZZ3A 3KJFA 5CIQA 1C1XB 3C5EA 3FPJA 2FEMA 3K7EA 1ULUA 1T8YA 1UBSB 3HYTA 1G42A 2D2XA 2N1MA 4HNAA 4LSMA 3L8ZA 1V45E 1ZFNA 1Y89A 3A1SA 4DG8A 4FKZA 3PQEA 4CCYB 4A15A 3MD0A 3V1KA 3CKMA 4C21A 4IDQA 3NCHA 3I39X 1HE2A 2OHVA 1GFWA 1KZ6A 2ZU0C 1BE0A 1UMBA 3CBGA 4GL4A 4YRSA 5AM5A 2JH8A 3C4QA 1FFHA 1DZ3A 2WHQA 3ILXA 3L7OA 4BAUA 2OGSA 2Q6LA 3W5SA 2JLZA 3V80A 3LIIA 1NVXQ 1RWKA 5ED4A 1NNI1 4GP7A 1QE3A 4CM8A 2Q3HA 4N0MA 2H0RA 3QG1A 4M1EA 3KTFA 2WF7A 1HO3A 1P6UA 4EM6A 1HR0B 1QOQB 3PLAE 5K8TA 4TN5A 2OLJA 2X6TA 2XNCA 3KU1A 5BVHA 1E2JA 3KYJB 4PXAA 3SJBA 3IURA 1X38A 1O94C 2MSNA 4QNNA 5H1YA 5I7AA 4ZEMA 2B5VA 4R16A 1P9LA 5A9SA 1RXVA 1FLVA 3F0TA 4TWBA 2PRSA 5CIYA 4U1RA 2GN8A 1NV8A 2J85A 2Q6OA 1UJMA 3JWIA 5IBQA 5E6RB 4B17A 4MJ7A 1YVRA 2GCOA 4BJ5A 2GYWA 4JLOA 1UK6A 4KKXB 1LPAB 1A8QA 3HU3A 1RKBA 3D8SA 1THGA 4GZ6A 4KG7A 1FFCA 2DY0A 1ADYA 2SBTA 3C7CB 1U7DA 1VE9A 3HNPA 1XDSA 2PLAA 3K4PA 3KALA 4JAVC 3V00A 3W2TA 3C3DA 3IB3A 4RVOA 1ZM7A 2OP1A 4V0OA 3BH0A 5FR2A 2O5RA 2HV8A 5B7GA 2WR8A 2QUBA 4R01A 5JS6A 1FSSA 1UBCA 1XAJA 1O97D 1Z6AA 3TLCA 1LTKA 1C3VA 1ZESA 3AX6A 2B61A 1PJ2A 1FX1A 1EFDN 3I0ZA 1O6GA 4UBLA 3SJAA 5L3QA 5L7WA 1G17A 3SX2A 4EFKA 2VP6A 3QZUA 1PR1A 1Y3HA 3O75A 1K7FB 1V3UA 1M1YA 1VL2A 3EB9A 2XKKA 3VNBA 2HQOA 3JARB 1MH1A 1WXFA 5BY2A 1YRYE 1HLDA 1HEIA 1NKTA 2O1XA 1K89A 2JHFA 1KZ9A 2EQBA 2VHVA 2FOXA 2HTEA 3GFOA 4QXAA 5IVDA 2QL9A 5B57C 1AGNA 1XMJA 1ZC4A 1E2PA 2FKNA 2WJVA 4K1LA 4KZPA 2K5UA 4HFMA 3FGOA 5JQGF 4XRRA 3GRCA 2DPLA 4I55B 4RYLA 1QZUA 3L6RA 4ZMBA 4DPLA 1UWKA 1EXDA 3ZJVA 5HRUA 4E13A 2WFLB 4M7RA 5LUBA 3DXZA 1ZH8A 2HKIA 4K9DA 4GR5A 5DBHX 1E6KA 5EE0A 2ZAMA 1QFMA 1R0KA 3R77A 1UKBA 5C8DA 5CVTA 4FFRA 1DEHA 5JJIA 4A8JC 2FW7A 4EB0A 1CRLA 1L5QA 3SVZA 1EHCA 2PMWB 5EJFA 1TUEA 1UT6A 4Q9IA 2M98A 3QBDA 3DT9A 3IVGA 3M83A 2CFTA 3O7MA 2QMOA 3K0FA 1MAUA 1CQIA 3UZUA 4OM7A 4C4SA 5L95A 4CKEA 2OUIA 5DNCA 1ETUA 1SCAA 5CFOA 3AZOA 4WXRA 2P5TB 3NYWA 2NQ8A 2Z30A 2FSPA 3DHNA 2PZBA 5BW4A 1YXMA 2NO6A 3S40A 4HPWA 3T3GA 1JSXA 5KEIA 4I3HA 4B9AA 1OJLA 1WV0A 2OR3A 2PKRA 2R65A 4L16A 1I4OA 2C96A 2PXXA 4Q7EA 4QEZA 1YB4A 4MUFA 1D4ZA 2VJNA 4WLUA 4ZQEA 3U1BA 4JQZA 3TLBA 5FOWA 1XFAA 2KJQA 1NF3A 3FBTA 2QL6A 4G09A 3OPYA 1BO6A 5AK4A 3K1AA 1IZ7A 3UJ3X 3YASA 3FUXA 1CYDA 3BXGA 1OZFA 3ZDRA 2H2IA 5DXFA 1D0VA 4Q02A 3EIQA 2XB8A 1KH1A 1XLTC 2BF7A 3KK0A 3OTHA 4M1ZA 4JLPA 1JZSA 1Y6QA 1EBFA 2HA5A 2Q0SA 2Z1NA 1XEWY 2IXFA 3MILA 4JLUA 1ODJA 4MVCA 3ZWYA 5C4MA 2ZJOA 3JALA 4EJ6A 1YKGA 3TL2A 3V34A 4QT4A 4Z49A 5HJ5A 2JF0A 1XTVA 2GARA 1KPHA 2WKQA 2QF7A 4KO2S 4DHWA 2C4TA 5K4AA 1WZUA 1QZXA 1EHIA 4CYMA 1ISGA 1IOZA 2VSYA 2PQ0A 4YRKA 4NBTA 1J4AA 3DAPA 5AKGA 2I0FA 3CR3C 1ABEA 1XZMA 1C4WA 4N5DA 1UF9A 2WYHA 4H3SA 4IHJA 3VYSB 1QC5A 1WS6A 4GZLA 3UFBA 3SYMA 2FPLA 3DBRA 4ND3A 4P4UA 4P5EA 4E5KA 4E4TA 5CVJA 3CUTA 4CR8A 1L4YA 4IUCS 3NANA 4DY6A 5FI1B 3GU3A 2C78A 2ZI4A 3WBJA 3WY9A 4K6HA 1BDJA 2AFIA 3T4PA 1KJWA 1F06A 3BF7A 3C5VA 2B83A 4PLHA 3WDSA 5AVYA 2ZTSA 2CLSA 2HPAA 5I5GA 2YJTD 5DW0A 5JADA 3VGPA 3NX4A 3KP1A 5DPMA 1CUHA 1Z2DA 4LWOA 1QR2A 1MAAA 2ZAIA 3VX4A 3ZX5A 1V1JA 3KB8A 5DNUA 4ZCRA 1KQPA 3QELA 5G40A 4DE5A 4TTPA 1JKMA 1NSTA 1U99A 1XZAA 2JKYA 3CPHA 1PUXA 5E38A 1WZEA 2XSZD 4I1OA 4LXIA 3WKEA 1AD2A 1CDEA 1JPVA 4H1VA 4DQUA 2WSBA 1SVMA 2Y05A 3FOBA 4NZOA 5CW2A 4Q5IA 5ILOA 1A72A 2FN3A 1E5LA 1NF8A 2IHYA 3HUDA 3RS5A 4DA9A 1XV5A 5JAQA 1IG3A 2DP4E 3N1UA 3H9JA 4FDUA 1IK6A 3QKSB 2O7QA 3LNCA 3DDZX 3F78A 3L8YA 3OZTA 2R84A 4LCEA 4JQSA 4WIAA 1C29B 3ANXA 3EBOA 3V2UA 4F7WA 3PR3A 2GVNA 1EK1A 4ZO8A 1WW3A 4JVSB 4JBXA 1E9AA 3EZ9A 4BZQA 1KFKB 1YZUA 1SD2A 2R6ZA 2OOSA 2VT3A 4LYGA 2DFVA 1ZHHA 4TMKA 4MYSA 2H11A 3OI7A 5ICFA 5B1EA 2X7JA 5BWMA 4S05A 3DEYX 3PNBA 1EIWA 2I66A 2AMYA 2VUHB 4BLOA 3TBKA 1Q92A 5AI0A 3QFFA 2CNDA 4L9WA 5GONB 5U4QA 3G49A 4TXHA 5HMMA 1LPNA 1OQAA 3OHMA 4QPZA 2WIAA 1KU6A 3CTMA 4C2TA 1CUCA 2D1SA 2R8ZA 2WF5A 4OMCA 5MN5A 5FUVA 3ZGZA 1EGAA 3A3PA 2X2PA 3QHQA 1T4BA 1T4GA 5EUBA 3VO2A 1TUBA 3PU6A 2WQ6A 3AUKA 4FR5A 4XD7D 3L7LA 2YW2A 3O9MA 2SCUB 1U3GA 4P98A 1SUPA 1NM5C 1XZPA 4HXFB 5C51B 1Q3TA 2OHIA 5G1OA 3INTA 1R8YA 4NMXB 4P36A 4JC4A 1ZRHA 2FP3A 4HJXA 3QKTA 2HSJA 4LDPA 3RVPA 3JZMA 2FVYA 3B2NA 3GR6A 1IRXA 1CZNA 1UXKA 3UMCA 2BC9A 2C2MA 1A4IA 2QQFA 1PJTA 1X87A 4TSFA 4F5YA 2WWHA 3OCJA 3F3MA 5A3SA 5E3HA 2O8EB 1M7BA 2PFSA 3FR8A 2FPXA 2X0EA 2NVUB 4DLLA 5FUXA 1TKCA 4NYIQ 3VDXA 5HRAA 1TM1E 2D59A 2IBSA 3KZMA 3N3AC 3F46A 1DQYA 4RL4A 1PE0A 2I54A 3C85A 4UUPA 5AK3A 3RIMA 3H1PA 3W4KA 3WLAA 3PRJA 2R0QC 5CD1A 1R7RA 3FJ1A 1KMHA 2KSQA 1PLKA 3M4ZA 4HMOA 5D1HA 4A1OA 4EPVA 1JAIA 3CX3A 2NNLD 4G41A 2Z6AA 1QLWA 1BH6A 1YSCA 5CRIA 1I80A 4LBWA 4RSHA 5J4VA 2PM8A 2Y3IA 1SOUA 1M7HA 4M55A 4OI1A 4AZSA 1CY1A 1QJ4A 3DTYA 3C3YA 4EPTA 4HDMB 5EIHA 3L4SO 3WO1A 1NLZA 3AW8A 2RIRA 3I05A 3RI3A 4K9LA 1JIUA 1OLUB 4LWPA 1YOBA 3OLXA 3FI9A 1EFVA 1NATA 1UXIA 4CUKA 4XM2A 3A6LA 3UGTA 5KDOA 3DTVA 4LK2A 3U6BA 4Q19A 2GJAA 3D4PA 3BTVA 4ZQIA 3S2EA 4OLJA 1LBHA 2NLOA 2E89A 2YVLA 4N48A 1SY7A 3OQHA 1M6WA 1P2VA 4LZJA 2IOFA 2C4MA 2O2EA 5LJLA 2ZSAA 4G5HA 1E1QD 3ZE0B 1CY8A 3ZN2A 2QZSA 1YIOA 2XOKA 3EPRA 4IWYA 3KPJA 2Q2NA 5C4GB 3EGEA 4HAXA 1AKUA 5LU8A 5T64A 1JG4A 1JEYA 3KJGA 4ARIA 2PNFA 3NQ41 2IIQA 1J8YF 3N28A 4FFDA 4NU0A 3GH3A 1RLTA 4BQIA 2YHSA 2HXGA 1FXWF 4C0HA 1CXZA 1B3RA 3BSFA 3AHDA 3GFVA 2IYFA 1P1JA 2VVTA 4HX2A 3CF6R 4QUIA 3BOSA 3C4VA 1D5WA 4GXNA 4TV9F 4WMLA 4Y6OA 5FNZA 1H3NA 3I6BA 2AEFA 4C14A 5AW4A 2FWBA 3LOUA 1IOWA 2ETXA 4OQLA 5ALXA 4Q48A 5EEHA 2EYQA 3AJDA 1N78A 2JDID 3MWEA 4TRNA 2C0PA 4GYJA 2ERXA 3E5HA 4PNHA 2I8AA 3EUAA 1G4HA 3VVCA 1ZW1A 2B8JA 2PX4A 4RK1A 2HJGA 1FDRA 3R6DA 4PYKA 5DTRA 4NJMB 5H3CA 1Y1RA 1F4VA 4HX9A 1U80A 4TMZA 4MQEA 3U4GA 5LVAA 1U2GC 4LSZA 4EDFA 5JQGB 3I2GA 3RADC 1MAHA 1YHZA 1G5IA 1ORVA 1BQEA 2BHSA 2PFKA 3A3OA 3LJKA 2O4CA 1ZS9A 3L7BA 3QFTA 4P7JA 4Q05A 1YR2A 1SOVA 2O8CB 2EX0A 2KPOA 1Q21A 3R7SA 4OH7A 4HUTA 4MB2A 2QT1A 2BHRA 5ALFA 1CR2A 4B76A 4UM8B 3FKSD 4E5SA 1H2AS 2IDJA 2G1PA 3JQAD 1CUUA 3P32A 3RFFA 1F1BA 3R5FA 4RC9A 1N2CA 1FYEA 1VL8A 5FBVB 3ZXSA 2BEUA 2C2GA 4QOIA 4YEDA 3QJGA 5HIAA 1NVTA 1S89A 1OT3A 1R12A 3ZNQA 1WE2A 2EXXA 4DA8A 2QD2A 3CEMA 1WUYA 2R62A 3HWWA 4A3SA 4EPWA 1J1IA 2ZREA 4RF5A 2NQ2C 3WFIA 4A4DA 4E5NA 3TTTA 3Q1LA 3NC1C 1OASA 1DBQA 3H5NA 3SLKA 1BMFA 1W47A 3PZBA 3WTBA 3D7RA 1KYTA 3K9WA 3D3JA 4KQ2A 1AIPA 1U8TA 4ZGWA 1R88A 4WEQA 3VFDA 5K05A 4RTRA 4WUVA 4BC1A 221PA 3KLMX 3KEGA 4WZZA 1DMSA 5CUQA 3U48A 4CMIB 5TGTA 5AJVB 1CR6A 3AWIA 4PNZA 4DSOA 1D2EA 1E5QA 3L0BA 3BT7A 2D3TA 1WHTA 4O1HA 1YJ8A 3ZBTA 2V7TA 5DOVA 3EZYA 5CG2A 3FYUA 2KQUA 3UA4A 4Q9KA 5BPHA 3FSEA 2AFHB 2C98A 5EE9A 4RTKA 5FWYB 4GVXA 1H1LB 5JANA 1SK9A 1W85A 2XVXA 2P6UA 5KYXA 3O8CA 3PSHA 5SICE 3FGNA 2D74A 4PO9A 5B7PA 2CKDA 3H2HA 3RKUA 1PV4A 3PXEA 1O87A 4HMQA 1N9GA 3DC2A 4Z86A 1OBFO 1ZGGA 3IDAA 3K8QA 2QHXA 3Q8MA 1ODTC 2BBOA 4KO1S 2H16A 3NUGA 1N1DA 4LGCA 1C4OA 1RP7A 5KCMA 1LDNA 5JBNA 4MV5A 4JLKA 4LJ8A 4EABA 4W5RA 5BMVA 4RHTA 4R1NA 4LMBA 2NXEA 1UMDA 1M2WA 1N8KA 3C39A 1DAMA 2BI8A 1QUFA 1E62A 2AYYA 4UHBA 3WYBA 2O3UA 3A2KA 2PJDA 4QD3A 2PZFA 3H5TA 1NVBA 4OU4A 5HTKA 2ZEJA 4KTTE 1ZOPA 5LP6C 1J23A 5AUOB 2XXAA 4AY5A 4YRGA 3IEMA 2E55A 5JO0A 2D7CA 5TS2A 4H4DA 3EA0A 1H94A 3HDGA 2PUFA 1IBSA 4UTVA 1UXGA 2QAIA 3LLVA 4HG2A 4TLDA 521PA 3L49A 1L4HA 3FRHA 3ZWAA 3DZGA 1E5VA 2I2BA 3KQMA 1J07A 1NPTO 3DZ8A 4UKDA 2AOTA 4P81A 1GCOA 2EKPA 2XWJI 3PWSA 5DNWA 1LV8A 4ZANA 1K5PA 3U13A 3UMBA 4F8JA 3ZOKA 3VO8A 4DCCA 3HXPA 4LUCA 3EGVA 2QN2A 4HSEA 1P62B 1QH1B 5KIAA 2GN1A 5F3RA 5HKBA 3MIIA 1AS2A 4CNQA 3ICOA 3R8XA 2W7TA 1RQXA 2VRCA 3QUCA 2BGGA 3E82A 3H11B 4FYWA 1MORA 1CF2O 5A7FA 2AQ8A 1HDCA 2H52A 2V7EA 5G53C 3TCXB 3VR6A 4E7OA 3IO3A 2WA2A 5E2IA 1V16A 5EJ8A 3ZS9A 1OTYA 3SIRA 2V5UA 2DPGA 3FNFA 2G04A 1G6OA 1Y37A 1F60A 1GT91 3NAGA 1T5HX 3NBMA 2ZAYA 3IQDB 1QFXA 2OXEA 4JZYA 3WHIA 3GAMA 1XQ6A 2I6GA 2X4GA 5JJBA 2I65A 1LCIA 1BHSA 2C3UA 4XQEA 2V3CC 2HQSA 2XGMA 3I4CA 4EYEA 5K8IA 3WS7A 5J2UA 1CC1S 3RC9A 4Z0HO 3V8EA 5JDIC 1UKYA 1X1TA 3OQNA 2NN3C 4LG1A 1Y1TA 5H68A 3ZHQA 1KI3A 2FPRA 4N01A 3DV9A 4PIMA 1UPXA 2FXIA 2FG5A 3OM9A 1RRVA 4V0LA 3IJRA 4JU8A 1IEQA 5D3ZA 1JPUA 1S96A 1XCPA 4NBRA 1A8PA 4XVCA 3B9PA 1M9NA 4MQLA 2YVQA 3AM1A 1NQVA 1F2TA 2BGMA 2PKEA 4RK5A 1CUZA 4UULA 2CXTA 3N7UA 1JA1A 1CQWA 2WOJA 3HI4A 3BBLA 4J0HA 4TN1A 4W1RA 3TL6A 3K72B 4ROSA 1Q22A 1X7XB 5EE1A 3WI7A 2FFJA 4P80A 1P31A 2HAEA 4J1SA 4XPIB 2VAVA 5KTNA 3ZQKA 1W1WA 4DUYB 1IHDA 1NXTA 1P5ZB 1ZD1A 5DT9A 3AL3A 1GAJA 3I09A 2HMUA 5JY6A 1SR8A 2JGAA 1MRZA 1MZPA 2QL7A 4KQIA 2Z3WA 5G1PA 3GELA 3V7UA 4OATA 4KSCA 2QUKA 1OV6A 4HATA 2G76A 3RTDA 1Z18A 4YJFA 1I2ZA 2XNJA 5FTJA 2OHFA 3P7MA 3L43A 3E9EA 2FWNA 3T5DA 3SNHA 1PYOA 2DU8A 2R86A 2NUAA 4Q3DA 1XDZA 4F06A 3HN7A 5DX1A 3KC2A 1P2SA 1PG2A 1AB5A 4FNOA 3F2IA 3T35A 1WPRA 7ADHA 3ZWNA 3VR4D 2BR4A 2QI9F 1V1RB 1VMAA 2GEUA 1KPGA 3BMCB 2YRWA 3CWZA 1WB4A 3EQ6A 3SQMA 3T1YB 4BX2A 4GT1A 4N5LA 3IR7A 4CEJA 5JOQA 2Z9BA 1SRRA 4LVCA 2ZIVB 3UOGA 4GLOA 1BXGA 3TLGB 4MJLA 3OZAA 3JQFA 4JJZA 4H08A 3WX0A 4BVAA 5J2TB 5FNVF 1H1DA 2X9QA 2FPKA 2VS1A 3BMOB 4XX0B 4F3TA 2C9ZA 4O4HB 1UKEA 1V5WA 1Y3IA 5KJ1A 3OFVA 2YWXA 3BFVA 3ZU6A 2B6NA 3M49A 2DHRA 4D3ZA 3AHEA 4I50B 2WWYA 1NUTA 1C1DB 2M6KA 3SHQA 3KOWA 3TB4A 2I2XB 1FOEB 3U3MA 1PT8A 2VO1A 2DWOA 2H1WA 1MEOA 4JR0A 2GJ8A 2HRRA 3WK7A 3VJRA 2ADOA 1Z2PX 1PDOA 2WLSA 5E3JA 5BW8A 4LFBB 5DTJA 4RA6B 5LBIA 2PGJA 1VLMA 2AMVA 4P31A 5FWNA 1AUXA 1N34B 3RBZA 1RLMA 3AXTA 2XNKA 1WG8A 4M7PA 4NX2A 4DMMA 2B5WA 3F8TA 4FS3A 4C78A 4WCFB 1Y0BA 4RWEA 2FNAA 1OUMA 4C7KA 2V8BA 1HL3A 4P6VF 5C2JB 2C2WA 2ZSUA 1PCXA 2A0WA 2ZUWA 3DW3X 3LPCA 1Q50A 3ZE8A 3ZHZA 4Z7JA 4R6XA 2F9MA 1WHSB 1V37A 2A58A 3COSA 3S4YA 4BEVA 5DSXA 1PNQA 1YZVA 3RSCA 3W7VA 2N9UA 1N6LA 2FPPB 2RHBA 4V3CA 5AHWA 1PVDA 4F3CA 4UVGA 4DBLE 2IXDA 3LRXA 1I10A 3WL6A 1LBSA 2QTRA 2B25A 4JNKA 3W05A 1KZGB 4EPYA 4Q1EA 3UAWA 5HDBB 2ZXUA 1E3TA 4OIMA 3QOYA 1Z0IA 1GYPA 2GM5A 2P79A 4NI5A 1A88A 2GPNA 3OLWA 4BKQA 3OHSX 1NBEA 3PDJA 1OLXB 5BOSA 4K9PA 3M4YA 2YWFA 3JQ8A 4N3GA 2B0JA 1GNRA 4QQKA 2CZCA 4TUYF 1G0NA 2INGX 3RREA 1J0CA 4BMXA 4Z53A 2Y9MB 3E35A 3T4UA 2ZIXB 2QUHA 1E9BA 1FNBA 1OX6A 2ZWOA 3I64A 1NY6A 5G0VA 3MB5A 5K3BA 3C1UA 5IRCD 1KH3A 2HYIC 1J8FA 4EUFA 2YUTA 3U3RA 2R6HA 4AQYB 2EFCB 1HMYA 2JFFA 4RVNA 4D8VA 4Z3OA 1G7SA 3H5AA 3R1IA 5FRDA 1J2TA 3CF0A 16PKA 1THZA 2UAGA 3O21A 3AESB 3G0DA 3PXAA 5AQEA 2HXSA 5IN5A 1WKBA 4RVSA 3STYA 3V46A 1UC8A 1SQFA 2J4FA 3PNKA 4DAOA 5KX5B 1M6HA 2W5UA 2X2FA 4PZUA 1SCUA 4L3OA 5I47A 3C6XA 4X6XA 5FPQA 1S7CA 3D6VA 3E9NA 4DLWA 3CWQA 1B8UA 1Q1ZA 1RMYA 3VPFA 2O2HA 4RKRA 4AUEA 1ZZGA 4O2AB 2WZBA 1H9AA 3DDUA 3AI3A 1E6CA 5FPSA 2P9GA 1MP0A 1E8NA 4EYGA 5EN4A 4IS3A 2E6KA 1A9TA 2GM3A 3ENNA 4QUDA 4DANA 1OX4A 2HN9A 2Z09A 1FW8A 1V7ZA 3CU5A 3RSGA 4DYVA 5F23A 4I9UA 3ABRB 3CLSC 1ZA2A 3G02A 4GBED 4MKHA 2OO7A 3R7WA 3MJCA 1RFGE 4MCJA 2G5GX 1T6ZA 4BNUA 2F4VB 1X92A 4O4JF 5CDFE 5EVJA 3VDRA 4LOIA 2D1TA 5CVCA 3TSAA 4H1WA 2W2NA 4IF6A 5A7HA 1IPEA 1SVSA 4B84A 1UEXC 4YVFA 5EJGA 3UUFA 4HVLA 5LKRA 1AQJA 5DOZA 1U3TA 2TYSB 1VI6A 4MRAA 4BLUA 3AEUA 1JHVA 3DUFA 1ZO8A 3JQ9A 1ZVQA 1PN3A 2QVGA 3FSGA 2J1LA 2JRLA 4DA4A 3IUQA 4P4SB 4AKGA 3ZJTA 4MXDA 2P4UA 1POWA 2ID7A 5CA1B 2OSVA 1GGVA 3E9CA 1FDVA 1GP2A 4C0WA 5K4GA 2DSNA 3I1FA 3S6JA 3TXYA 1SU7A 4GDMA 3VRHA 2TMDA 3EQ9A 4G8CA 2JCYA 1P7PA 3B89A 3LP5A 3ND7A 5FOTA 5L4NA 3RWMB 1W30A 3TD6A 1EBBA 2JFVA 2ZR7A 3PEUA 3TAUA 2FDCA 5AVRA 2XKJE 3WHPA 3WKDA 4HLCA 4EF5A 3K09A 3NRCA 4PSKA 3DFMA 3X44A 3UJ8A 4P54A 1FIUA 1JRLA 1LBQA 2COUA 2RHMA 4LVOA 3TNYA 4L50A 1NJ2A 3BWBA 1V5GA 3BTOA 4BAZA 5IJ9B 3U7GA 5KTMA 1ZN7A 5AVOA 4ZZ0A 1DFHA 1SHLA 4LJ4A 2NZXA 4H1HA 4JP2A 2IWHA 2R9VA 2Y1DA 3DE7X 3EZXA 4AJ2A 1XYGA 2ST1A 1RQLA 1WKCA 3DZBA 3WYNA 4YMHA 1JWLA 1L7AA 3LHFA 2Q3MA 1GQFA 1EM6A 1MT0A 3BEOA 3NOQA 2I8LA 4EO7A 2PH3A 3C4JA 3KQSA 4N54A 1QCZA 2BONA 2IT1A 4EI9A 4E09A 1YQQA 5KYWB 3ESRA 1GNTA 1Z4JA 1NIJA 2GS9A 5CFZA 3AF6A 2FPWA 3LT5A 1M2VA 3OT5A 2QP4A 5DYNA 4GX1A 2R60A 1TMKA 5CP8A 4XM1A 3U7EB 3KR0A 2WU8A 2O3SA 4Y2YA 1LDGA 2X4IA 1FBNA 3QKIA 4ONEA 5ECGC 4RACA 4R9SA 1D9ZA 3AUJB 4ZHQF 1KDPA 3UUWA 5K1ZA 2CXSA 3NHKA 5EAIA 3CF4G 4U3JA 4Y9DA 1JBQA 4HN2A 1MC1A 3KOMA 1UAAA 4UUNA 1MOSA 2RGNA 3D2AA 3LBAA 1KBQA 1XGKA 2REQA 4ZEXA 2Q3EA 3A36A 3ZK8A 4C01A 5JCZA 1FLNA 5JXIA 2JIBA 3VC3A 4G4IA 3QQPA 3PE3A 4RANA 3HO6A 3TLMA 3T6KA 2Z5FA 1YJ5A 2PLRA 1TMOA 5DK4A 5IABA 3KKLA 1MPTA 2IYXA 3WNBA 3FF1A 5LP6F 5IEBA 4Z3DA 3QKRA 2QRVA 1JZQA 1V47A 1OI3A 2J6IA 3ZCXA 1QANA 5KCZA 1GEGA 2KS6A 5BNZA 3QWAA 3GLQA 4DRXA 2H1FA 1TF7A 3PP8A 3V7NA 5DM60 5DTEA 3I9FA 4L8WB 4Z1OA 3K32A 1E9CA 4EYQA 1LD3A 5IBPA 3AIIA 3CJTA 4PZPA 4RHCA 1JX6A 3TVTA 1WCWA 2DSTA 3DA8A 3CYFA 4QSMA 4WERA 5IKOA 7AT1A 1RE0A 4DMFA 4PHHA 5JHGB 1HG1A 1G2OA 4OQFA 4MPJA 2PY6A 4P3OA 4J0IA 1NN5A 4RLFA 3HBMA 3TAHA 1JFSA 3FCUB 1ZAYA 3DZFA 4FZ3A 4CF3A 1K1EA 2CC2A 2JAOA 2I9KA 1VJ1A 3F6YA 4ZVQA 3UJHA 2JFGA 3THYB 1DWOA 1JIKA 4L02A 2W6IA 4ZCLA 1PT5A 3MMPA 2ZPAA 1FXWA 4KPGA 4R2HA 4UAGA 1XE3A 4XI9A 4ZVVA 5J5CA 1WNFA 3KV3O 5K51A 4HV4A 1FYDA 2HA3A 1GDDA 3DFIA 2GCNA 4IDDA 3MLAA 1M8GA 1FP6A 4HCJA 4NCBA 2QR5A 4BNTA 4LY3A 1Q6ZA 3OZRA 4RMHA 1VM6A 1DX4A 2B7BA 3IX7A 5JNWA 1TJPB 2AYZA 2J3LA 1A7UA 2ZJ0A 3A9WA 4ZI7B 3NBQA 3UXEA 2A0KA 1QP4A 2AJ8A 4G4SO 3E7XA 4QPCA 1WDWB 4Q7JB 5A9TA 3C48A 1JECA 1NGSA 1JYSA 1XVVA 5NULA 4PQRA 4DABA 3N53A 3MSCA 3PD1A 4X95A 3TDKA 4MW0A 4RUKA 3LT0A 4X3CA 4C6TA 2HREA 5FLXA 4FM9A 1EZZA 1D8TA 3PUWA 1B7GO 2QJOA 1FQOA 1QZ3A 2JA2A 2Y1XA 4PYQA 5ITSA 1EFKA 1TDJA 3GXOA 4K88A 5JS8A 2KM1A 5EE5B 3ITDA 2A30A 1OLOA 3GGJA 2X9NA 4OY3A 4IEIA 1DDIA 5EJ9A 4JMLA 1D1TA 1D8AA 2GPYA 2VTVA 3ZQ4A 1Q7RA 2GDZA 4NF2A 2MSLA 4W9RA 4ZQFA 3UW1A 3HDJA 2VQFB 1XAHA 1YDFA 2O2YA 2V0GA 3ADKA 1QG2A 5EXTA 3VKUA 5FQNA 4PC6A 2QRLA 5BYJA 1E79A 1A9YA 2NM0A 3KPYA 5CX1B 4YUVA 1FFGA 2R6JA 1XTKA 1ZVMA 2J0EA 1C7RA 2Z3VA 2NSJA 3LDFA 4TRMA 3P9IA 1QHGA 3BXOA 4NL4H 5IJ0B 4QHSA 2JGFA 3GN1A 4FFBB 1PAUA 4MS4A 1USIA 4QTYA 1Y34E 1RRFA 2BAGA 1SVKA 2B4RO 3U0BA 4AJKA 4NONA 1X7HA 3DMHA 5DM4A 2P9ZA 4QGFA 2ECKA 3LUKA 3T5GA 1NN0A 2HWUA 4NVRA 4RBNA 4CTNA 4QC2A 1T13A 5E0OA 3VM6A 4UHDA 4G65A 5A6SA 3P9SA 1P9RA 3UHFA 3ZVKA 3BL5A 2JLVA 3GIWA 4M1YA 1OTXA 4DR7B 3OE5A 3EH1A 3NBFA 4F3NA 2VTEA 1SVLA 1PQPA 4PC2A 1E20A 4L57A 4C4XA 2E1RA 1JN0A 3M81A 1PGNA 4EI2A 1DAFA 2EBUA 2JGIA 2X23A 4KQ9A 3JQFC 2B6HA 3TD9A 1VBFA 2DFPA 4RK7A 3WHKA 2VPTA 4XSGA 4C0SA 4L6AA 5SYMA 1GLNA 1LZLA 3TSYA 2B30A 2BP7B 5KOJB 3JQGB 2A86A 3F8SA 1A8UA 3ASVA 5GWXA 4MQFB 3OLYA 5AK0A 3BM5A 3Q8KA 2OAP1 4GPEA 4WLVA 2MYNA 3WNVA 4DCUA 5JC1A 4TMYA 1UBLS 4ND6A 1C9YA 1BXKA 1BDHA 3IGFA 3KCQA 4NJEA 4RGQA 3S2SA 4AO7A 5FFFA 3U56A 1YA4A 4UTPA 2QNBA 2EBFX 2A9QA 4PQYA 3U81A 4N76A 5C8ZA 1TEHA 4BTVA 1NJ1A 3RKSA 4CQMD 3CVUA 1VZ3A 1GAEO 3SJ7A 4N6GA 4M3NA 4YGYA 3VTZA 2HPZA 4RCYA 4CKCB 2IHZA 4JYBA 1SA0A 3JQCA 4NOMA 2G9NA 3IV6A 4EYKA 1KMNA 1TZKA 3ILYA 1XDUA 2J67A 5KTPA 4RV9A 3T34A 5MN4A 2ZRIA 2ACWA 2CLCX 2CNWA 3M3HA 3MWDA 3RJ5A 4OHYA 2J9FA 2ES4A 3CH7A 2LNDA 1UADA 1XJ0A 4WY2A 1Z5GA 1UH5A 2ZVJA 3PF8A 4RD2A 2DTXA 3PF9A 1AXEA 1P1CA 2CLDX 2XD9A 5IZCA 4DIBA 5CM9C 3AUFA 4A5OA 2XXJA 1OR8A 3PFHA 5FLEX 2FJPA 3H65A 1WUJS 2CWDA 5I7WA 2EJTA 1H6DA 2O3TA 4FB5A 1E8DA 2XNDD 1Z4KA 3WA6A 4C4RA 5K0ZA 4ZRMA 1UDBA 3TGPA 2VUTA 1OI4A 4QFMA 4E70A 4ESEA 4MWTA 5EMMA 1U7PA 2VWGA 4FP9A 2VZEA 1MX3A 4HY3A 5EMNA 5IUKC 1MEJA 2IHTA 4OBWA 3G2MA 2P11A 4CMHA 4CDNA 1RQPA 2BFFA 1WR8A 1W4BA 2WJGA 4G1FA 2BISA 4WT7A 4Y2JA 1NDHA 4PNEA 1TF2A 3B1WA 1ACJA 3CNNA 3N86A 1NVFA 4M7OA 1AHNA 5AT1A 5BWLA 2DECA 5IT4A 4YT5A 3R5KA 2OAEA 4TWJA 1KK2A 2IJGX 2VYVD 3CLUD 3MTAA 5FYQA 3U37A 4E0BA 2X6QA 2CFSA 4EG4A 2RHGB 3H8JA 3Q85A 2WJHA 3W2FA 5GVSA 4M9ZA 4C3OB 2HHHB 1PFWA 3WRWA 4C2AA 3PEEA 4HB3A 3LY7A 4TL9A 4OQ4A 3IVRA 1HT3A 1YVEI 3OM0A 3TI9A 4F12A 5CFMA 1VG1A 1QG4A 2OKCA 3REGA 4BNKA 1DG3A 1OAOC 1YRLA 1YBFA 1SBHA 3EUEA 4H7IA 1X8KA 4IYJA 1TCCA 5J40A 3A1DA 1HC7A 4JP5A 4IIJF 1EYZA 3WWPA 2AJDA 1GUFA 3TTXA 2P2ZA 3WQRA 2GBCA 2QRUA 1YMVA 5THXA 5DYTA 3SU8A 2NZVG 1NJSA 3GI1A 4RIHA 2E5LB 2XVYA 3MOIA 4CQLA 2Y66A 2YFYA 1YQWA 2PWZA 3MAJA 3VNRA 3SC2A 3A4IA 1PYGA 3D81A 4HWSA 1R0ZA 4DUZB 2K2WA 2CV2A 2NU6A 4INJA 1G8GA 1M8FA 2FGJA 1L7QA 1RI5A 1QYIA 4JBYA 3RUEA 4LC0A 1U8YA 3D3KA 1GPAA 3E6AA 2YBDA 2P65A 5K5EA 3JY6A 2JVKA 1DIHA 5TB5A 4RDXA 3UW3A 1D6JA 5INTA 3P2YA 1KJIA 1VSTA 4FMPA 5EZ5A 1A97A 3QRWA 5TPZD 3AVTA 1JI3A 2I76A 5CBPB 3PCTA 3RAFC 3I5MA 2Q29A 1K27A 2IXGA 1J09A 1BVYF 1KAEA 2Z04A 3BCUA 3G9XA 4KWHA 4B8YA 1CUYA 1U2TA 5GJCA 4TWRA 1NVWQ 1A9XB 3W2HA 3EXHA 3B2QA 4FLFA 4CRWB 4UBIA 1UWLA 3AP3A 1REQA 2IIPA 4FOLA 4ACBA 5JAIA 1ZU4A 5K3DA 5TPWA 4URVR 3FA2A 3FUUA 2VNJA 2ILTA 1H2BA 4LKRA 4IJKA 1A27A 1IIRA 1E58A 2X9GA 1FP1D 2I6UA 4KB5A 2CE7A 2X7HA 4DLYA 1YTUA 2QV0A 2I78A 3IUJA 4HBZA 2BY4A 5J1TB 5KJFA 2QLNA 5KQRA 1XNRB 1S8FA 2HCFA 4RETA 1S2NA 1QMGA 2H5IA 4IIJA 3TBHA 3ECSA 3IS3A 4D0NA 2FQYA 3WQHA 4G56A 2FFQA 4J7AA 4AQ7A 4FOOA 1HL7A 2CJPA 3H1FA 1V11B 4II2A 3FUWA 4MW4A 4Q12A 3FGPA 5EHNA 4G0YA 2PUJA 3TECE 4F3YA 4D42A 2QQ5A 1P60A 2IEIA 5TY0A 3TRIA 3QE4A 4JDUA 1MQ9A 1P4JA 3WRYA 5A2QA 2QENA 3CZAA 1XD2B 4B5LA 1UT8A 1XF1A 3C98A 1QFSA 1XU9A 2QVXX 2Y1FA 4TSKA 4WDRA 2L17A 2CVFA 2Y1OA 5ESDA 1DKRA 1SUIA 2A84A 2QJWA 5EP4A 5AICA 4PO1A 1YJQA 4B3XA 3ND9A 4BFSA 4MUMA 5I7SA 1QF9A 2CYAA 1PZEA 2ZB3A 3AKZA 4O59O 2G4LA 3Q9LA 1MMFB 4ZI5A 1DFIA 1GQSA 1R5JA 1SHZA 2I1LA 3NRBA 1D7OA 4QDJA 4Q9HA 1W4RA 4P33A 4B2IA 1QO9A 3AIKA 3DVRX 5I8WA 2GT1A 4L4RA 4CF7A 2P2GA 3CE9A 7MHTA 1DC7A 4YRDA 3L6CA 2CLFB 3HCPA 1U1FA 4J0CA 4I1SA 5B4UA 3DXYA 1UOPA 5GONF 3MYRA 3DEIA 3X0DA 4GLBA 2CXQA 5EJMA 2DJIA 4MKIA 1OLSA 5FUBA 2ZIGA 1I13A 2VTDA 3EDRA 3H9UA 3JWGA 1Z4MA 5ADUS 4QQNA 2YY5A 4BRZA 4CMEA 1L5OA 3GNTA 1RXIA 3FMPB 4MUBA 2COKA 5D3MB 2XMBA 3O0DA 4YP1A 3A4NA 3AM5A 2MWMA 1LWOA 1QDUA 1Z2OX 2B34A 5CB4A 1UDRA 2C5GA 5TVGA 3ABOB 1PR9A 5K3OA 4N6NA 3H5WA 4B6PA 4JOCA 1KETA 3R9IA 3NGXA 3TCKA 1NMZA 5EG5A 1BDMA 5ADVA 2J6BA 2I7DA 2FPMA 1XO1A 3DO5A 1TU4A 2BJVA 5BOVA 1AKRA 3WZ2A 4H16A 1NXXA 5A2GA 1WMAA 3ZPXA 2HNKA 3I9V1 4JSRA 4AJHA 4ZYTA 1AN0A 2IYZA 2J87A 1PZXA 3BE5A 3HMKA 1X1SA 4QOSA 3EFEA 2ARKA 2IK8A 4YJHB 1O0CA 1CE8B 2YBEA 1TQHA 3PHLA 3F8WA 3HDQA 1A5BB 3KD2A 1ZGZA 4RX1A