5HR5A

Bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2)
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
424
structure length
423
Chain Sequence
b'KCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRRQAVKSYKSYDFFRHDNEEAMKIRKQCALVALKDVKAYLTEESGQIAVFDATNTTRERRDLILNFAEENSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMDDFLKRIECYKVTYQPLDPDSHDKDLSFIKVINVGQRFLVNKVQDYIQSKIVYYLMNIHVHPRTIYLCRGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEIADLKVWTSQLKRTIQTAESLGVTYEQWKILNEIDAGVCEEMTYAEIQEQYPDEFALRDEEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
publication title Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase, transferase
total genus 155
structure length 423
sequence length 424
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hr5A01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5hr5A02
1E9FA 1ZJ6A 4AK9A 1KI8A 1UBEA 1ZM2A 4YMSA 3KZ1E 3PR1A 721PA 1WMSA 2ZI7A 3H86A 4E5UA 2B7BA 2RGNC 4Q9JA 1DKLA 2F1RA 2QP4A 3LVQE 1E2NA 4KLZA 2IUTA 1G7SA 3VR3A 4HAVA 3E9EA 4I99A 3GLGA 1D2EA 4FD2A 2J3EA 1ESMA 4UQOA 1VIAA 1QVAA 5BXQC 1TTTA 2A2ZA 3EXAA 1T8PA 5GVSA 3LL4A 1P72A 3WRYC 5M04A 3PQCA 4HYYA 4Z54A 4FI3C 3TAUA 3VR6A 3AVUA 4IVRA 1VHLA 5IK2D 3A1VA 3FFAA 1SKYB 1N6LA 4G5QA 1ZYUA 4DZZA 3DKVA 2Q6TA 4LJ5A 2YNMA 2C96A 4LSGA 1OJLA 4JSTA 1B23P 2VF8A 4QM7A 2QP3A 4M1WA 1G5RA 1OHHD 4LYFA 1XEWX 4A6PA 2P6UA 5E95A 4PAOA 4NBSA 3NBFA 2WPDA 1P4SA 2QAJA 3GEIA 3LBHA 1BIFA 4LC0A 4KXFB 3BH7A 4D0LB 2JLYA 3HU1A 3GLFA 1OV4A 2XOKA 1R10A 1T3SA 5FBVB 5HPYB 1NIPA 4C30A 3OFND 1FMLA 4D0NA 4AD8A 3M1IA 2P75A 2OUKA 1RC8A 1G8PA 1ZD1A 2WWFA 1Z0DA 3PVSA 1XD2A 2ZE8A 3PUZA 4M1YA 1N6KA 1IONA 1E0JA 3CX8A 4NE2A 4A82A 3MXOA 4Q48A 3DMDA 3MMPA 3NH6A 1ZUHA 2RMKA 2ZJYA 1HE1C 3Q7PA 4E07A 1E79A 5FBWB 1ZM9A 3GJ7A 1DOAA 3AVWA 3QUSA 4P0TA 3X1WA 4LPKA 4V0ME 1VG1A 3QXHA 2GA8A 4H1VA 1FPMA 1AGPA 1HT1E 2ORIA 1FBTA 2VBCA 4D26A 2A3RA 3EPLA 4LV5B 1ZMXA 2IF0A 4DUGD 3I3SR 3AKCA 3V4RA 1FNMA 3A6PC 2AK3A 2IYTA 3OAAD 3ICQB 1RIIA 2QL6A 1DG3A 1XMJA 2ZE6A 1OKKA 1YZKA 2W6ID 1OXTA 4Q1AA 3B1WA 5KHOC 2D7CA 3AVXA 1ZCAA 2CBZA 4DEYA 3LH5A 1E2MA 4TZ6A 5JSZB 2H7VA 1GM5A 3TW8B 1CBUA 2ODBA 2ZPTX 4ASUD 1OIVA 4PC3A 4RD6A 2NO7A 3UIEA 2Z83A 4BFZA 5J4KA 5JI3E 3NWJA 1SK8A 4MKHA 1NL3A 2P6MA 2QENA 1V7QA 5HCNA 1Q1QA 2RGDA 4LJ4A 2ZVPX 4YXWA 2Q0HA 2JJ1A 5KDDA 1XPOA 2YOFA 3EA0A 3CRRA 5BYJA 4HAWA 3MUFA 2HLDA 4CEJA 4FIDA 4UNQA 3SOPA 1WE2A 5AK0A 1KY3A 2WZQA 3X1YA 4RZUA 5B2ZA 1DVRA 3TUJC 1E4VA 2C9OA 4XVRA 1TQ4A 1LFDB 2IS6A 4V0OA 3V9PA 3R8FA 4NCHA 1E0SA 3THOA 1N6OA 3QKRB 5AUPB 5CYPA 4JBXA 1XJQA 4M9QA 4O2RA 2PMDA 4ARSA 4HLDA 5DI3A 2GESA 3U3OA 3WRXC 3K1JA 2GTPA 1IBRA 4KHZA 2ZE7A 4B74A 4Q7KA 4U7DA 2JIZA 2ZS9A 2V4ZA 3Q3JB 4Z1MA 2RFLA 3ZZ0A 4A8JC 2RGXA 3UMSA 4JKYA 3ZDQA 4YQFA 3A4NA 1KI4A 4WIAA 4C3ZA 5J40A 3KKMA 1KZ7B 2ONKA 2PEYA 5EE3A 2QBYA 1IY0A 3ZQJA 4WAUA 3U7EB 2XNSA 2V55B 1US8B 1TU3A 4QBGB 1OLOA 3PUVA 1UBFA 3WP1B 1MV5A 4KFSA 3DMNA 4KAXA 3KTAA 4OI0A 1KNXA 2VP6A 5KSPA 1XRJA 4DRZA 2V1UA 1ZNZA 1GILA 1NIJA 3BH0A 3EWAA 1Q57A 4W9MC 4DDWA 3GLIE 4WXPA 3THXB 5KNBA 2J0UA 4UJ5A 4LGMA 2Z6VA 4YMVA 2D7DA 1E2LA 2XZPA 3HPRA 5HCIA 4OHYA 3D4IA 2PZFA 2QPAA 3AUXA 3QIAA 2EWVA 5JWRA 1Z5ZA 1EFCA 1FL9A 4GT1A 1P75A 2EFHB 2ZJBA 4M21A 3KQHA 221PA 4CIDA 4EDHA 2BIFA 1SQ5A 4OJKA 2BMFA 3LD9A 1LF0A 1Z6YA 3W34A 2QRZA 4FWIB 5F3WB 1ZNXA 5JECA 3OIUA 2V7QD 1IHUA 1KOFA 2W6JD 3RS2A 4HUTA 2EKZA 4P3YA 1P2VA 2JATA 4PSKA 1FNNA 2W2XA 1II0A 4JYCA 2FMXA 3SQXA 2WICA 4US2R 2NZ8A 3N70A 1UDWA 4NPHA 2A7QA 1U8ZA 1CVIA 4W5WA 1T8TA 3RC3A 3SFVA 4I1OA 4II7A 2IA5A 5FPSA 3NHAA 2GBLC 3IBYA 4LHWA 1CU1A 3DOFA 2QY9A 2XXAB 2P6NA 1LY1A 2IL1A 1G3RA 1OW3B 4BZPA 3VX4A 5KO2A 2WU0A 4S2EA 1KGDA 3U7FB 2I1QA 4DLWA 3T12A 4RSGA 1TPZA 2DWQA 2UZ3A 4Q4JB 4N3NA 5BQ5A 3BXZA 4DDVA 4IDQA 4NHOA 4GFDA 1WBDA 5FOTA 3AP2A 2A5JA 3SNHA 4B47A 4PC7A 4TMZA 4JSYA 4PANA 4A2WA 1NY6A 5GADl 1ND6A 3KB1A 3QG1A 2A9JA 3DO6A 1FTSA 1JQJC 1L4UA 2CNWA 1DKOA 2QE7D 3NFYA 5JWOA 3R7WA 3U4QA 2QGNA 1E9RA 421PA 2PX0A 1UJCA 2DB3A 1IM2A 1G5TA 1LF5A 2F1HA 2ZRFA 1QZXA 4K81B 2H4XA 1Q3HA 1A82A 1VDZA 2D3WA 4QL3A 2WJYA 5G40A 2DFTA 4OHXA 3A4MA 3QEOA 1OYWA 2V8OA 4MYCA 4D82A 5AJVB 3AUYA 4BLRA 3IIMA 3LFUA 4XTRA 1AKYA 3TIFA 1T5LA 3UKDA 1O87A 2ZU6A 3CX7A 2YOHA 3B7GA 1UJBA 1C4OA 1WDTA 1Z0IA 2CCJA 2ZANA 3V4FA 2JLUA 3AGQA 1XTIA 4KU4A 2H1LA 2WJHA 2YN2A 2ZYTX 2ZVQX 4X8OA 1Z6TA 4R2HA 4RD1A 5DISB 2HEIA 1LVGA 1LW7A 1XXHE 2Z4RA 4KFUA 1KDTA 4EIWA 3L8YA 1CP2A 2BWJA 2F7SA 2OFWA 2Z4SA 3CZQA 5HTKA 3KXLA 3GFTA 1EWQA 4FXPA 5FOXA 4KSBA 1A7JA 2OCPA 3FPAA 2NPFA 2PZGA 1KK1A 2NZJA 1ZCBA 3KXIA 4ZDIA 1GKIA 2BKUA 3CF2A 1G4AE 2JCSA 1ZNWA 4F91B 1AQYA 2OCAA 3EZNA 4LCBA 2PX3A 1F2UB 4BFYA 4Q5IA 4EAQA 5C46F 2O8EB 2A5DA 2B6HA 2O0JA 3ND9A 4JBWA 3D8BA 3IUYA 3EAQA 4YLGA 2CHQA 2R6AA 3NKVA 3W3ZB 2QPOA 2DR3A 4ARZA 3PEYA 2H4ZA 4Y0VA 1YZLA 2QQ0A 5JJIA 5TMPA 1AZTA 3GJ8A 3D8HA 3BOSA 1ZP6A 2ZRAA 2JLRA 1HE8B 2X2FA 2GVDC 1DS6A 2FJUA 4HZIA 3WYFA 3MCAA 4Q47A 4ARVA 2A9KA 4LBZA 3AH8A 3IBGA 1A1VA 3T06B 1JR6A 4A92A 3KJIA 5EE1A 3AF1A 4HZUB 1Z2CA 3B6EA 1JNYA 1NKTA 1UKYA 3QENA 4W5HA 2GAAA 3K0CC 1CR2A 1KYIA 3BFVA 4PXAA 1XPRA 1TIPA 3QNUA 3PUYA 4PQRA 3KKNA 3LW8A 3DVLA 4Q01A 2XZOA 1W4RA 2OO7A 3K09A 2VPPA 5IHPA 2CVHA 3MWYW 3EIHA 2WWIA 1YE8A 3MGCA 2OM2A 1XQ9A 2SHKA 1WB9A 1NI3A 621PA 1Q3TA 5C2JB 2HF8A 3PXGA 3NC1C 4MQBA 1DO0A 4UNRA 2CEAA 4MITA 4M9ZA 3FE2A 2ONJA 3EX7C 2W0SA 3EIQA 2ZRBA 1Z08A 1HA3A 1XFAA 4WW0A 3RVBA 4Z8XA 2PLRA 1KMHB 2QGZA 3A1WA 1ANKA 3NBZC 2LKCA 3DOEA 3WNDA 4U00A 1NP6A 1JJ7A 4JJZA 2BKEA 2QROA 2HPAA 4MDEA 1GKUB 3SZRA 2WAXA 5GJVC 3B2EA 5AJYA 5JEEA 3QKSB 1KO8A 2CXXA 2QM8A 4IEEA 1FMJA 1W36C 3R9WA 3IHLA 2ZUDA 4MRVA 3H84A 4XD7A 1OXVA 4DCVA 1DAIA 2P6OA 5TXGA 2ZSAA 4OJQA 4GOJA 2IWRA 3FHTA 3GP5A 4R9UC 3LRPA 2C5LA 2O5VA 4ESHA 3TR5A 5IT5A 1MABB 4JS0A 5CK5A 3FWYA 4QXAA 4GP6A 1KO4A 2B8WA 1E3MA 2RGBA 3NTUA 1Z0FA 4BRWA 5JSZA 2ZM5A 3T15A 4DEXA 4NYJQ 4F92B 1W2GA 1UKZA 1TU4A 4A0HA 4IJ6A 5EE5B 2IKQA 4UKDA 1G64A 2ZSFA 3NDPA 5EE9A 3LNCA 3EG5A 2WOJA 2OWDA 2AR7A 5CB6A 2FEOA 1PJRA 3BB1A 1DKQA 1ZC4A 2HT6A 1SGWA 3OHMA 2EU8A 2C9CA 5LB4A 2RCNA 4DT1A 3OEED 1FFHA 2ZREA 4OK6A 4ESVA 3T61A 1P5ZB 3CPHA 1Z6AA 1XTRA 5CDFA 2AD1A 3TUIC 3BBPA 2KWIA 1N5JA 3CBQA 3DKPA 3JZAA 4GBMA 3VHLB 2GK6A 4M4SA 1EFHA 4QNMA 2XNDD 3GLGE 2N42A 2HF9A 2VHQA 3MWJA 2WNHA 4LPSA 2LCFA 4ACBA 2NOAA 3FGNA 1G3UA 1CEEA 1H8HD 4YDHB 1RRFA 1M74A 4QNRA 4EJSC 2CJWB 1SXJE 4EPRA 5FTLA 3QKRA 3C7TA 1Y3AA 1MO3A 3IGFA 4M1OA 5CM8B 3ZQ6A 1M7BA 4TL7A 4NCIA 2ZRNA 3T5DA 5B64A 2CHVA 3KKQA 1HUQA 4G01B 4B6FA 1ZIPA 4Q7MB 4KVGA 2ZETA 4PHTA 5CLLA 4M1TA 3SS8A 1CRPA 2C99A 4OQMA 2QP9X 1JEEA 5KSZA 1U8AA 3FJYA 5DHAA 4Q4HB 4CW7A 2OBMA 2VRWA 4GPIB 1Z6GA 1NLFA 4NYMR 2BV3A 1E32A 2MMCA 1AQUA 3GLFE 4G3XA 5AUNB 3KFVA 1GAJA 4DSTA 4M1SA 1W48A 1XJ0A 1CS4C 1US8A 4MGYR 3QF4B 1TQDA 2XSZA 4JVSB 1EXMA 3TW4A 2FFAA 3KQLA 1NVVR 3EOZA 2ZS7A 1S3GA 1TNDA 2FSIA 1SKQA 1ZU4A 1D6JA 1W5SA 3ASZA 4D4JA 3DHWC 3I1FA 1XXHA 1Z22A 2GDJA 1ONBA 821PA 4JOBA 1K5GA 4FDTA 3THYA 4OQXA 1R5OA 2LWIA 4HDCA 1QHGA 3QPUA 4PC6A 1FP7A 1MH1A 4A8JB 3U2QA 4QOSA 2WMNB 2P6RA 2IYRA 5E7MA 4AROA 4V0LA 1VCMA 3NG1A 1Z2AA 2HV8A 521PA 3N2EA 1G20E 1H8ED 1W1WA 2BEKA 4OI2A 2WBLC 4HDQB 1FQKA 4HLCA 3BFXA 4A6XA 4ZIRA 1II9A 4IXMA 2JGNA 2ZI3A 4B2PA 4GPZA 3E1SA 1HEIA 2XTMA 4G5GA 2BOVA 3U7GA 4B35A 2R65A 2DHRA 1YRBA 5EP2A 4KLNA 3B8HA 4LJ8A 1C1YA 1IXZA 2GWHA 4NCJA 1ELOA 1M34E 1XZPA 2X8AA 3SC3A 4XVUA 3VX3A 3FYHA 5HZKA 1KO1A 1MT0A 2QEQA 2ZRHA 2ZRLA 1PV4A 4XIGS 2DFKB 5FPYA 3K9GA 1RKBA 3Q9LA 3FHCB 5D3QA 1AS2A 1G16A 1G6HA 1QRAA 5KOYA 1G5PA 4HLUC 4LK2A 3P20A 3KQUA 2O8DB 5JI2E 2A5YB 3T1QA 1DAGA 2G83A 3HYTA 3LAWA 4EFLA 4A0GA 1OIXA 4MUAA 1QBKC 4PZZA 5B57C 5HR5A 4BLQA 2O8BB 2FNAA 1GNQA 4NL4H 1OFUX 1IHPA 1CXZA 3X1ZA 4B2IA 5G3YA 1Q12A 1XTJA 4TQUS 4DLRA 2JAQA 2R8RA 5CK4A 1YZQA 3RS3A 1QVRA 4TTRA 2J7KA 2BMJA 5SZKB 1G17A 1Z83A 2CE7A 1XDBA 3SJCA 2H18A 1N3BA 2N46A 2ZR0A 1GP2A 3SU8A 2YOGA 5FOVA 2Z0MA 4Q7LA 1XZQA 4TMTA 3VKGA 4DC9A 2G88A 4P4TA 2NTYC 2G0NA 4C2UA 1ZRHA 2D2EA 2I3BA 4NTZA 4LJ9A 1N5KA 5JWHA 2WSSA 1COWA 1XF9A 1E1RA 2AD5A 1KHTA 1P2TA 2GJ8A 1IN7A 1SHZA 3NTLA 3T35A 2X1VA 4PHHA 3SJAA 5FBLB 1RIFA 4Q1BA 3PENA 1F6BA 2VSXA 5C4MA 1KK0A 2HCBA 1O3YA 3FDIA 3T1TA 1ZD8A 2FPKA 2CE2X 6Q21A 2JEOA 2O0KA 1DTSA 4MKIA 1VECA 3L0PA 2C04A 2QTHA 1T3HA 1L2TA 3DZ8A 4LJYA 2ODEA 3CUEF 5EQTA 1NKSA 3KB2A 4YMWA 1KSGA 2QMOA 5G53C 1SZPA 5DSZA 4Q4AB 4F4JA 2G0TA 4PZYA 1EFRD 3MJHA 1KY2A 2GZAA 3QI2A 5DYGA 3N2IA 4ZI3A 2D74A 4L16A 4NU0A 1FP6A 1NVXQ 2IW3A 2FPMA 3CF6R 2ZJZA 4BPBA 5CJ2A 4FDUA 1F2UA 3VR4A 2O8EA 3AVVA 1TF2A 1I4LD 1XMSA 4ERNA 1G3IA 4QIHA 1IN6A 4J0QA 4Q1DA 3OESA 2FE4A 3KDSE 1JEDA 1IXSB 3GP8A 1NT4A 2JJ2A 2HYDA 5CIWA 3RNLA 1UBCA 1NBMA 3EZ9A 4RVCA 2YHSA 1X8KA 1Z29A 2HCJB 4IKEA 4D4LA 1G8GA 2ASEA 3K9HA 4Z51A 1SXJA 4OI1A 3TK1A 3TSZA 2OAQ1 1P73A 4TLBA 4JOCA 4ZCMA 3AGPA 4HZUA 3EIEA 4ABYA 1KKLA 4HUQA 3EARA 1Z06A 2AXNA 1PUJA 1X3SA 2VHTA 4MYTA 1UPTA 1YZUA 4IEIA 3RLFA 3QE0A 3CNLA 4N0DA 2RGNA 4B3CA 4BWYA 2JLVA 4Q02A 3RRZA 2ZJOA 5AJZA 2GCPA 2EFEB 1JPNA 2DPXA 2ZAMA 5FTMA 3W90A 4PAQA 3ZZUA 3L43A 4UNPA 1NVWQ 1SKAA 2E9SA 3L82B 4D2IA 3M4YA 4UJ3A 1MKYA 1M7GA 5FTJA 3CZPA 1HQCA 4FMCF 5FTNA 2OLKA 3EZ7A 3HU2A 1T0JB 1KI2A 1E9CA 1TQ6A 2YN0A 4BEJA 3Q8XB 1R5NA 3CPJB 5FUYA 2JDIA 1XD8A 2PZEA 5FL7D 4C0HA 4O3MA 4GOXA 1KMHA 3C16C 3N5CA 1W4CA 2VP4A 2ZSEA 4LRWA 4YDSA 4XWOA 1V37A 3U3RA 4PZLA 4AKGA 5TARA 3TQCA 1QHHB 3AF4A 5A4JA 1HURA 1UM8A 2H57A 4PPNA 3KX2A 3BE4A 2CK3A 5J4VA 5F9HA 1C7ZA 2HUPA 2ZE5A 4MGZR 3QJYA 2QT0A 3HR7A 1KTVA 3WBKA 5HE8A 2YVUA 3QKUA 3IEVA 1X8LA 3K0SA 4TMVA 2IHYA 1U0HC 1R0ZA 5FPHA 4P32A 5K8UA 2EVWX 1YZNA 1T0HB 1V5WA 2C9YA 3GLHE 1CJVC 1LV7A 1U8YA 4R2IA 2H52A 4BFSA 2F55A 2ZI6A 4TT3D 3UWKA 1MABA 3SDZA 3CKLA 4GPTA 2BVNA 4LWZA 3FDZA 5UKDA 1DAFA 1CJTC 1I2MA 1CJUC 1BOFA 5FI1B 4BLPA 4R71A 3GLIB 1JAHA 3S1AB 1YR6A 2HT1A 4PC2A 1D9XA 5A5GA 8OHMA 3VMFA 1DEKA 3BB4A 2EYQA 2B7CA 4B3GA 3R20A 1KDOA 2BBOA 4O0MA 4UXIA 1KI6A 1K8RA 1N6HA 4RZ2A 1W0KD 5EP3A 1XWIA 3OF5A 4BLOA 1N0WA 2ZI4A 2FFBA 3LQRA 2D62A 4RZXA 3PEUA 2GEUA 2IYUA 4P4SB 1W36B 2PMKA 1KI7A 1M1YE 4DDUA 3GJ0A 4QKQA 2XJ4A 5CITA 3HP1A 3GW8A 3I5YA 1XCPA 1J8MF 4GZMA 4OK3A 4KI0A 4C7OB 3IILA 2J41A 4JLAA 4XH9B 1E2JA 5DYIA 4BLTA 3U6KA 1XEXB 2MSEB 4FCTA 5TDHA 1TMKA 4Q1EA 1D8TA 3OEHD 4TL6A 2IX3A 3EPHA 3LXXA 1R0XA 2REBA 1C80A 3RANA 2ZUBA 4JVNA 2OEPA 2ZAOA 2WVJA 3MAAC 4JT2A 1G6OA 4I4LA 3ZYCA 1SKYE 5HKKD 2HDNB 4EUNA 4PZAA 4EPTA 1VTKA 2VIIA 1KMQA 3AKEA 1TX4B 2W58A 3C5HA 3CM0A 4TWZA 3CR8A 2P77A 1U0JA 1E1QA 3U44A 2GEDA 2Z5FA 2H17A 4HSEA 4Q4HA 5TVKA 2QZ4A 4NZYA 2REXB 3TAHA 1I4DD 3AV0B 4BLSA 3LG2A 1X1RA 2NMVA 3ADKA 2QMHA 4QM6A 3PCRB 3VQTA 1XJCA 4O25A 2FFHA 2IUSA 2GILA 3GEEA 3QF7A 1XCMA 4EJSB 3D6AA 3QF4A 1GVNB 4DLYA 5EJEA 4OHZA 2GJAA 1HT2E 2GXQA 4D6PA 1DAHA 4FWTA 1R2QA 3PUWA 4QBIA 2A6PA 4TZ0A 1Z8FA 1UEIA 1PVOA 1F3OA 2ECKA 1JR3A 1RVDA 1W2HA 3EZ2A 5H8WA 2RHDA 4PO9A 4A8JA 5G41A 2OBNA 4M9XA 1QHNA 4ODIA 3T5GA 4CT5A 2GRJA 3UMRA 3ADBA 2KJQA 1RPZA 3P27A 3B1YA 3BJIC 4IHQA 2WPDD 4POAA 1ZNYA 1OB5A 3GJ3A 2OCBA 2R6DA 4OI4A 2XZLA 2NO9A 1YZTA 4BASA 3FKSA 4MGKR 3KQKA 2XOKD 2X19A 2OCYC 1Z3IX 5FL3A 2VQSA 3NDBB 1EK0A 3HJNA 2O8FB 2J59A 4MRRA 3KUDA 5DLQC 3B1VA 2Q9BA 4LX0A 3O8BA 4PHFA 1RJ9B 4LDJA 1ZBDA 2PEZA 3VNVA 1J99A 2P9FA 1P2UA 5DGXA 2W83A 1ZUIA 3Q5DA 4Q4LA 1E2QA 2ZI9A 5EZ5A 3PIRA 3CF0A 2ZJ2A 4C2TA 1W4BA 5H1YA 5JEDA 4LJAA 2QAGC 3RWMB 4QJ5A 4AG6A 3EW9A 2FG5A 4RJLA 3R8CA 1E79D 1KI3A 4ZKDA 2OSBA 4CDGA 2IYXA 1VHTA 1OE0A 2AN9A 3IIJA 2ATXA 5CDFE 1RZ3A 3UMFA 1WQ1R 3W6NA 4JLVA 5IF9A 4CEIB 2UKDA 3ASYA 1GWNA 1II8A 5TB5A 5SZIA 5EZ6B 1J7KA 4NCNA 5JCPA 1VMAA 2Q21A 4EO9A 2JASA 5KSYA 2P9YA 1LTQA 3IHWA 1OKKD 1SVWA 3K0FB 2ZSDA 4I81A 4OQFA 1DBSA 3F0TA 4PZ9A 1E69A 4CGZA 3LLUA 4IOJA 2PH1A 3I8XA 1GITA 1R5BA 3AQ4A 3OE7A 3WYAA 1S2MA 4QHYA 5K8TA 1G3MA 2YV5A 1P61B 1GL9B 4NYIQ 3AF2A 5K8IA 1JB1A 4DKXA 4IW3B 5J5CA 1HQYE 5H68A 2QN6A 1NNEA 3WMEA 1PLKA 3T1OA 3CLVA 4JKIA 4B2LA 2VF7A 3D3QA 3IIKA 4YXWD 1XEWY 2JJ1D 3OI7A 1DAKA 4EMBA 2VHJA 4XWAA 4TSRA 4FW9A 1DG1G 1R0YA 2ENWA 2FX3A 3CRVA 2HLDD 3AP3A 5ELXA 4DLSA 4E09A 3B85A 4KCGA 2GETA 5DI9A 3K70D 1OH7A 1ZU5A 4BQSA 3THWA 3TJZA 2N1BA 4NMMA 3GLHA 2VA8A 1GRQA 1Q1ZA 2AL7A 2CMKA 2LKDA 2VYFA 3ICEA 3H1TA 5EXPA 3L8ZA 5DN6A 4IOMA 2GXSA 1DO2A 5FI0B 5IRCD 3CPEA 4AKIA 4MYHA 1KAOA 2HJVA 1GSIA 3A4LA 4R7ZA 4MKFA 4HAUA 2KI5A 2OXCA 3BC1A 2J7PA 2JIZD 2KE5A 3TSWA 4DSNA 1E2IA 4Z1MD 2NGRA 2BEJA 1I2DA 3VKWA 4AYXA 2BM0A 2QA5A 2RGAA 3KJEA 2GXAA 4M53A 2KBEA 2IEZA 2I4IA 4B48A 3W6PA 2H5EA 3CNOA 5LD2C 3M6AA 3I61A 1W0JA 4FCWA 4TLAA 3F5FA 4B3DA 2FDCA 2CCGA 4RFVA 4U02A 4MA4A 2R6GA 4I1UA 1N5LA 2BDTA 1TUIA 3HWSA 4JIMA 3VU9B 3O8DA 3DDCA 3J81k 1CRQA 3DB1A 2VSOA 3CIOA 2QQEA 4PX9A 2WHXA 3RABA 4OYHA 4Q19A 1OFTA 2GF0A 1QDEA 3RAPR 3EA5A 1OH8A 1FZQA 5CM9C 1VG9B 4RFSB 5KPDA 3B13B 4IRUB 3VFDA 3FMFA 4HBZA 4AURA 3GD7A 2QORA 4N1AA 1W46A 2HXYA 3BAFA 4RD3A 1BS1A 2FSGA 3TR0A 4HB2A 3EPJA 1YJXA 1AJEA 1QFXA 2P2YA 3E2IA 2IS2A 2BHRA 5AUOB 3WHLA 2FOLA 2GJ9A 1UF9A 2ORVA 3BORA 3KFXA 1KK3A 4JLJA 1NN3A 4MYUA 3PUXA 3IO5A 4GOKA 2H92A 3FMIA 3DCYA 1JBKA 3FVQA 4TL8A 4IVPA 2RKOA 2NO6A 3ZS9A 3IQXA 1NLYA 2RHMA 3FMPB 4WBSA 4LUCA 1DAEA 1HH4A 1EGAA 1AN0A 1N0VC 1QHIA 3UWOA 2CL0X 2PLFA 1SVMA 1R4AA 1OXUA 4FMDB 1XPUA 1CR1A 1KO7A 4AYTA 1G19A 3SFZA 3K0CA 1E2FA 4ITRC 2OE2A 2OZEA 4QJ3A 2IXEA 1DELA 1SKBA 1OB2A 3AP1A 4URUR 4AWXA 3DM5A 1YRAA 1LS6A 4MH0R 1JXOA 4C0AC 1IN4A 1KJZA 4IDOA 1OT3A 3RSOA 3M0EA 2GAOA 1GFIA 5D3MB 1KNQA 2O0HA 4MRSA 1ZW6A 3EC2A 3I32A 5GVRA 4HATA 3RSLA 1SVSA 2UVQA 3TUZC 3SJZA 1MOZA 3TH5A 3ZHCA 3L2OB 1BMFA 1UJ2A 3NC0C 3SHFA 3FHOA 3L0OA 2CNWD 4NCKA 2MSDB 5LBIA 4YMTA 1GL6A 1EFTA 1M2OB 2A30A 3QVVA 1RRCA 1OH6A 4TSFA 4KODA 3HJGA 4US0R 4HB3A 1U81A 4NYJR 1VG8A 2YC4C 4LI0A 1ND5A 1XD2B 2F6RA 1OFIA 3V00A 1OFHA 3ZIAA 3K4PA 3T34A 1T91A 2NQ2C 1NF3A 3U3KA 4QJ4A 5B30A 1SVOA 2QTVB 1OIWA 3MFYA 1D9ZA 3QXXA 4M22A 1KDRA 1Z63A 3DPUA 4HLQB 4A36A 2P5SA 4P4SA 1CR0A 2F1JA 3PITA 3TSOA 1YKSA 1HY3A 3VHXA 2VHUA 4PHGA 1QHYA 1I4TD 4C7OA 4EPYA 2EWWA 4RY2A 5FFMA 5DO9A 1XEXA 4B33A 3KKPA 4A1FA 4D4KA 4JVLA 2C95A 4DCUA 4WVFA 3P26A 4QHTA 4RKFA 3TVTA 4PPFA 4TTPA 5TV2A 3C14C 1NBME 2DY1A 5AUQA 5G3ZA 4LZZA 3TNFA 1R7RA 2X2EA 1KK2A 5KTYA 4PGMA 2KB0A 1AS0A 1SHKA 2WKPA 3B82A 3G82C 3IKJA 4LOAA 2H16A 3WP0A 3JZMA 4OK5A 2F1IA 4DSOA 3NHBA 2Z43A 3NIBA 1ZVQA 4PQFA 2VTKA 2ZYUX 1NN5A 4TMXA 3I72A 4EQ6B 2D4HA 1XU4A 3OIWA 3I92A 1U98A 1XTQA 3L0SA 1JECA 2OAP1 3AF0A 4QRHA 1PLLA 5FOSA 2FU5C 3CB4A 2F3TA 1ZC3A 1YFKA 1IN5A 4C0SA 5BYKA 3CNNA 2GCNA 2J46A 3K0EA 4PPGA 1U9IC 2XTZA 2YJTD 2FV8A 4FN5A 4LHZA 1AA9A 1IOZA 3ADDA 2P5TB 2NIPA 3WMGA 4B3BA 4EFMA 1SVIA 2Q3FA 3HPQA 2QNRA 1R6BX 3THXA 5BN4A 1J2JA 2RGCA 1IAQA 3AKDA 5E4FA 1Q1EA 3DZDA 4OQLA 1GUAA 4G5OA 2IXFA 5KDLA 3W5JA 3QQ5A 2IYQA 2IYZA 4YONB 1KZGB 2J9RA 2X77A 2C98A 1P9NA 4NYMQ 5FPTA 2QBYB 2GHIA 2YC2C 4JL8A 1IN8A 2PJZA 3LVRE 4O2LA 1EX6A 3WBJA 1QHFA 3E9DA 3KKKA 2QSYA 2VP0A 1CJKC 2GEVA 4I1SA 4PAMA 2ZYWX 1NVVQ 3KJGA 1Y63A 2EKBA 4D81A 5EE0A 4ZKEA 2PL3A 4TYYA 4IDHA 2EOAA 1P6XA 5C4GB 3UATA 4KBGA 1G1MA 4NKRA 1L8QA 3LX8A 4PR0A 4B76A 2J0VA 3QPVA 4V0NA 1T4GA 2J0UB 1FTNA 2XTNA 3A8TA 5IK2A 2WNIA 1JI0A 2V9PA 3A1UA 5JFGA 1F5NA 5JMTA 1UAAA 3RRNA 1P9RA 1GZSA 2XXAA 1Q0UA 1JXMA 2IBMA 2ZRCA 1CULC 1N25A 1UFQA 1OHHA 2QRNA 4ZDWA 3HR8A 3IPXA 3UXMA 4ZDJA 2R44A 4Q4JA 2PCJA 3SEAA 4LHXA 3QXJA 2VLIA 4XD7D 3QSYA 4CEIA 5LB2A 3JVUA 4GP7A 2P78A 1CJMA 3MBKA 4D80A 3ZZTA 2R9VA 5E7IA 1RW4A 4EKDA 2FFQA 4DCTA 2YYZA 2HIAA 4KFTA 4KYIB 4B44A 2MMGA 4U5XA 1CTQA 4DLUA 1T8UA 5EUQB 3K0FA 3OFNA 4G5SA 4BFXA 2PBRA 3IT3A 3I62A 4BFVA 1G7RA 2QAGB 4QGFA 4RCYA 2QMEA 3LX5A 2EFDB 4LBWA 4M0LA 2B8TA 2R6FA 3KJHA 1E2GA 4Q7JB 2JLQA 2XGJA 2E87A 3EPKA 2OWEA 4PO1A 4P33A 4FCVA 3IDQA 4OBEA 4OHWA 2XAUA 1E0AA 3I8SA 4BFUA 1UEJA 1KSFX 1MRSA 3C8UA 1OH5A 2JLWA 4IJMA 1UKEA 3A1TA 3B60A 1XTKA 4ARUA 3D6TB 121PA 1MRNA 2DWPA 2XITA 3X1XA 2GF9A 2YKGA 4X8HA 2ODNA 1S9DA 4JLNA 3OIVA 4F7WA 5CB8A 4PQYA 1GNRA 3KKOA 4CF7A 3TRFA 2ZRGA 3BFKA 4IDPA 4RD2A 5L3SB 3R7WB 4DUGA 3U4QB 4XOIA 4QGGA 2BCGY 1G291 5EP4A 1XCGB 3OAAA 5CIQA 1DADA 3X2SA 2OV2A 1TAGA 3NBYC 5FBQB 4FMBB 2ANCA 2CVFA 2W6IA 2ZRPA 4DLXA 5DE3A 4EPWA 1XNJA 2DFLA 3R7AA 2WWHA 4GMDA 1G41A 1JR3E 4ASUA 1FUUA 2EQBA 3CWZA 1C9KA 5GJCA 2RH5A 3MD0A 2IHBA 3MLEA 1E59A 1KJWA 3WY9A 1L7VC 1GTVA 1RRGA 2C03A 5FR1A 2FZLA 2RAPA 3IT1A 2J87A 3PG5A 2BMEA 1BYUA 4LJ6A 1P3JA 4F4CA 5AR1A 1OYYA 3MWKA 3VNUA 5KYKA 5P21A 2AX4A 3WYGA 3R9XA 1Q20A 2ZRDA 4QGAA 2XSZD 4MGIR 2QG6A 1E58A 2XB4A 4AIIA 2A5FA 3VU9A 1RRPA 1CIPA 5SZJA 1P9WA 1XD9A 3ONWA 5PGMA 1N6IA 4DB2A 3H0KA 3P32A 2IF2A 4JBYA 3LW7A 5FUXA 4LYHA 2ZS8A 4Q18A 4IVQA 4RFSA 1SXJC 3TVDA 1E0KA 1R8QA 2IYVA 1VKJA 3EZ6A 4Q9HA 4WZBE 4AI6A 3CRQA 3A58B 2GVZC 4QG7A 5J4HA 3RDPA 5BW8A 4F4IA 4N0EA 4CRWB 2ZRIA 5LD2B 1MO4A 2ORWA 1LB1B 3GJ4A 4ZCIA 2EFCB 4LYJA 4KSCA 2WSMA 4OL0A 4ARZB 3C4JA 2G3YA 5F2EA 3BB3A 5SZHB 2ZXUA 4DBLC 3QBVA 1NSFA 1NMXA 1VCOA 1QHSA 5AWFC 2ZJ5A 3U3MA 2WWGA 1MO6A 4WOPA 3W8NA 3CR7A 4PSVA 3RYTC 3FB4A 1YQTA 2JLZA 4H1UA 4URWR 4V02A 1G8YA 3A37A 1TQ2A 2VL7A 4WA7A 4Q9IA 4EFNA 2GFIA 4HB0A 2XX3A 1Z07A 4MRPA 1EX7A 1XB2A 1G8HA 1PUIA 4WXRA 3AM1A 4TMKA 4DXAA 2R62A 1TF7A 1QG2A 2P0EA 1H2FA 3QY0A 2IYYA 4JVMA 1T5IA 4R98A 3D31A 5D3MA 3SI7A 4C0KA 2C2HA 3LBNA 3LQQA 1G7CA 2RGEA 2EYUA 2IS4A 4V0KA 3QKSA 1QHXA 3TQFA 2FH5B 3AVYA 5JHGB 2WJIA 4NP6A 4A15A 2AFHE 1GRRA 2GCOB 4E3WA 2NG1A 4MDFA 2IT1A 5GJWC 4BUJA 2V7QA 5B58C 5FH9A 2W2TA 2W6JA 3C5CA 3HU3A 2ZJ8A 2GK7A 2WV9A 2VSFA 1W5TA 4D25A 4URYR 1RYFA 3U3JA 4URVR 1RPTA 1IJEA 1OXSC 1NG9A 2ZU0C 2OT3B 1YU9A 2FGJA 3WNCA 1CKEA 1S1CA 2I1VB 4BECA 1TADA 1TF5A 4ZDKA 2GKSA 2IYWA 5J4LA 3AVTA 2W2VA 2OESA 1CR4A 5EXSA 4HAXA 2WSSD 4F93B 1COWD 2IXGA 1E1RD 5JS8A 2D06A 5KU1A 3MJRA 4UNSA 4IJ5A 4JLMA 1AIPA 1GNPA 3O8RA 1NN1A 3DM9B 1WCV1 4HEJA 2H0QA 4LY6A 3RS4A 3H4MA 3B1XA 4LYAA 4B71A 1S0UA 1N2CE 2ZITA 3PFIA 2W0MA 1XP8A 3FFBA 2CLSA 4W7SA 1H65A 3OZXA 3O8CA 2NO0A 5A0FA 1U0LA 3UG6A 4JMPA 5E7JA 1ZD9A 2P2ZA 3P4YA 2P65A 2QE7A 2IWHA 1ZUNB 2CJWA 3K70C 4WZAE 1HYQA 4C9BA 4BZQA 4CVNA 2BC9A 1RPAA 1CF4A 2PT7A 4BFWA 1DKMA 2BBWA 1VYUA 1VG0B 1BYIA 3K4QA 4EQ6A 4DT1B 4Q00A 3BIFA 4JL6A 4K46A 2WJGA 2GJKA 2DBYA 4IOLA 4XSHA 1QWOA 1NVUQ 3G5UA 2QSZA 4Q03A 3FTQA 4DB4A 4BZXA 2AFIE 1E9AA 3LBIA 3ADCA 1CLUA 1LNZA 2WIAA 4C4PA 3AKYA 1DARA 4CEHB 1H2EA 1BKDR 3ZGXA 2JJ2D 1G21E 1GDDA 1U99A 2IS1A 4AY2A 1NBMD 3PGMA 4DCSA 3Q5EA 3A36A 2XEXA 5JRJA 4PFSA 2F9LA 1DKNA 4Q21A 4TL9A 1SXJD 4IOKA 4DCNA 2EW1A 2FWRA 3LA6A 2R2AA 4G0NA 1D2NA 1F48A 4XVQA 1S9HA 4XJXA 5ANRB 2V3CC 1IJFA 3ZD6A 3WHKA 2BJWA 4PPQA 1WF3A 3QKTA 5KSOA 4L5BA 3W8RA 2DFNA 5HZHA 2GZDA 1RYHA 3VR1A 2P79A 5DNYB 4FMDF 4KO8A 2YWFA 1BQ3A 3E70C 1Z28A 2WKQA 4GI7A 1N6PA 3K9NA 5L3QB 1JALA 1VYTA 2K5UA 1KSJA 3Q72A 2VEDA 3QPWA 5CJPA 5C18A 3ECCA 2WMOB 2CL6X 1JPJA 4GMXA 4K8OA 1E9EA 1AK2A 1MR3F 1DAMA 2JDID 1XXHB 1VIYA 1G7TA 4DIDA 5J47A 1XEFA 5FTKA 4JLDA 1E2EA 1VCIA 4OKSA 5L3VA 1U2RA 2F43B 2FF7A 2ZIAA 3BERA 3QBTA 4MRNA 3SQWA 2CL7X 4ZCLA 2C8VA 3THYB 3GMTA 3MSXA 2CK3D 4DLTA 2ZR7A 2Q3MA 3A1SA 1AS3A 4KJZA 3FMOB 2IYLD 3SYNA 2O8DA 1SVKA 2JLSA 4A2QA 4KV9A 3VR5A 1BO6A 3ZVRA 3CWQA 3K9LA 2BCJQ 2Q9AA 4TN1A 3HDTA 4B3XA 4L4UA 1ZM4A 2O8CB 4W5JA 1KO5A 2O8BA 1SULA 3WNBA 4ZIRB 5JBQA 1UBGA 3CH4B 1R0WA 2G1KA 3QG5A 2PA0A 2WOOA 2FPLA 4M1KA 5JS7A 2L0XA 3AB3A 5TY0A 2WWXA 4Q66C 4Q9LA 1EG7A 3MRSA 4X8MA 1E2HA 5EXTA 2TMKA 3WXMA 2QAGA 1VYVA 1X6VA 2GBLA 4AKEA 1GG2A 4NYIR 2ZRJA 5JHHB 2YWHA 4HB4A 4FMCB 3TMKA 4CT4B 4M8NE 3VAAA 1Z6XA 5FUVA 1FUKA 2P2LA 1QG4A 1Z47A 1M7HA 1Q21A 1D2MA 2BJVA 1ODFA 4V03A 2B21A 3JVVA 2AKYA 4RZ3A 4MUBA 3ND8A 5DH9A 1DPFA 3AEZA 1Z0AA 2ZSBA 4TYNA 3RWOA 1ZIOA 5JJKA 1NRJB 1DKPA 3LNTA 1FQJA 1T3LA 3IT2A 2H8KA 1T9HA 2CLCX 4KYUA 1ZM7A 3DL0A 3UK6A 4CYMA 4Q9KA 4KITB 3P1JA 3B5JA 4LBVA 2AK2A 5L3SA 1YR9A 3FKQA 1N6RA 1G3QA 3BRWD 4NONA 4UXHA 3VTKA 1JAIA 2B92A 1OF1A 4QBHA 4JLOA 2A78A 2HJGA 1U94A 3KUCA 2UZIR 4BRUA 2ZEJA 4DJTA 4G5RA 3SBEA 1UKVY 5CX4A 1QF9A 2F3RA 2AWOA 3B1ZA 1JQLB 3K8YA 5GJBA 4XWKA 1NG1A 3NBXX 4EPXA 1S96A 3CW2A 1TL7C 1GOTA 3K0AB 4C0JA 1E1QD 1S3SA 3BK7A 4KFRA 4Q4AA 1FZTA 3B78A 3BD9A 1EESA 2V1XA 4GSYA 4B73A 3ZS8A 1YR7A 1F2TB 3OEEA 1W44A 1AKEA 4L9SA 4M1MA 3GPLA 3PJRA 1ZAKA 3GJXC 4V0MA 2BM1A 2QU8A 5JZVA 4ACAA 3UPUA 1FOEB 1FX0B 1YJ5A 2ZRMA 1A2BA 4LHYA 2XNDA 1E2DA 1GRNA 3TE6A 4P4UA 2P9ZA 1K5DA 2OLJA 3C7KA 3NXSA 4DLVA 3RHFA 5L8VA 1BH2A 1H8HA 5BN5A 2V6IA 1N6NA 5JJLA 1Q1BA 5FBRB 2FA9A 2P3SA 4A2PA 1DE0A 1NMYA 1ETUA 1NY5A 2VP2A 3NEYA 4JLBA 5AJWA 1JR3D 4OHVA 4Z8YA 5K8LA 3WMFA 1WP9A 1NSTA 4DIEA 2NO1A 3EC1A 3BS4A 1S8FA 3Q85A 3W5IA 1E2KA 1VPLA 4A9AA 3ZH9B 1X86B 2HXSA 1EWRA 4CZ2A 2AKAB 2ZRKA 3F3KA 1N0UA 1UADA 1KJYA 3NH9A 1M6NA 1OSNA 1UDXA 3RS7A 5H70A 2VH5R 3FKSD 3SE0A 2VP9A 2D2FA 2V6JA 5JRZA 4E03A 1XTSA 3C15C 3UG7A 4URXR 1NJFA 2OFOA 1D5CA 2ZI5A 1J90A 2AWNA 5EXXA 4JODA 3GLGB 1FW6A 4P31A 3K09C 1KI1A 2G77B 5HE9A 1BQ4A 3AVOA 1G8FA 2J1LA 1E98A 1SXJB 3NEJA 3B9QA 5EP1A 5FOWA 4M2LA 4DWJA 2OFXA 4HUQB 1ESNA 4ZPXA 5FUWA 3FOZA 1P60A 1B0UA 4Q1FA 1QHHA 2WJJA 3IO3A 2ATVA 2WKRA 4TLEA 3K53A 4XTCS 2CCKA 4PC1A 2FSHA 4RD0A 3LO5A 2BBTA 3AF3A 3GFPA 3UANA 1E99A 2R6CA 2QT1A 3EWSA 2GCOA 3ETLA 1H8EA 4RCZA 5KDOA 5FOUA 4WZ6A 5KPJA 1E4YA 3GLFB 1KI9A 2P30A 1TEVA 2ZUCA 4Q1CA 3SHWA 3IEUA 4LJ7A 2Q3HA 4Y0AA 2C77A 2ZYVX 4L8GA 3EZFA 5LDDC 4L15A 5JLJA 4DLZA 1SK9A 5JCZA 1AZSC 3OE7D 2F90A 2DWOA 2IUUA 3SYLA 3CRMA 1IQPA 3W9YA 3GLIA 3S1AA 1WBBA 1E9SA 1AM4D 3IT0A 3I73A 1XMIA 5IDVA 2WTUA 4YMUA 3SR0A 4GNKA 2GXUA 4D4MA 4DHEA 1VCNA 1F60A 1L4YA 2WIBA 5BN3A 3E5HA 1X8JA 3QXCA 2ZTSA 4RD4A 3MWLA 3B9PA 2J0SA 2HHJA 4C0QC 3KL4A 3MG9A 4M9SA 4TQ9A 2QMUA 1OXXK 5FR2A 3QXSA 5KUTA 2E1RA 1GIAA 3CH5A 2Q9CA 3TKLA 3FDZB 1RE0A 4ON9A 2DYKA 2ERYA 4AG5A 5DN6D 4TYQA 4TTQA 2WWWA 1E6CA 1X1SA 4LV6A 4B3FX 1KI6B 4A0RA 2WJVA 3O0TA 4DSUA 2XB2A 1G4UR 2CDNA 1W4AA 1ZM3A 4UXJA 4C0LA 3PEWA 1A4RA 2J7PD 3ZD7A 3IQWA 3T1VA 2OILA 1RFLA 5KNCA 2REOA 2WAYA 1WRBA 3X1DA 1V43A 1YHNA 2AHOA 4QBFA 5BWMA 3H2YA 2F9MA 1XX6A 1HV8A 1E94E 2OBLA 2EFGA 3O47A 4BE7B 3ZVMA 1W0JD 3GQBA 4D0GA 2J0QA 4CEHA 3GJ6A 4CEJB 4KVAA 3W6OA 4YC7A 1P2SA 4X8LA 3DEFA 4EJSA 4HI0E 3K70B 3G0HA 3RRYA 2JJ8A 4JZKA 1C81A 2FZ4A 1MO5A 2OG2A 4AYWA 1NMZA 3KXKA 1T6NA 1YR8A 4EPVA 3W3AA 4JJKA 1A5TA 2IC5A 3I4LA 1Z0KA 3LWNA 5LPNA 2OHFA 1J8YF 3U60B 1KDPA 4TMWA 1Z0JA 5DI3B 4F38A 3E9CA 1GKYA 3U44B 3Q7QA 1EFRA 1WXQA 2P67A 4IDNA 3BWDD 3CONA 3CRW1 2W00A 1YZGA 1IY2A 3AVPA 4AKHA 2Y8EA 4LHVA 4B32A 1P7CA 3U7HB 4G1UC 4ZV4A 4US1R 5J4YA 5EUMA 4TYWA 1U9IA 2DCUA 4JT4A 1LS1A 2O52A 1TEXA 2QI9C 2QTFA 5L3QA 4DVGA 3RS5A 3HYRA 5AJXA 3P4XA 2YZ2A 3EASA 4H9GA 2QPTA 4HAYA 3SJBA 2ENUA 4NH0A 5FPKA 3ZVNA 2O8FA 4L9WA 5F98A 1E2PA 1IXRC 3F8TA 4GZLA 1A2KC 2ERXA 1RJ9A 2JA1A 4HAZA 3KTAB 2F43A 4I1VA 4B6EA 1S1MA 2CHGA 2OXRA 2VP5A 3GCGA 2HYIC 5DHFA 4MKGA 2RB4A 3GFOA 4A4DA 2KBFA 2PCLA 2KSQA 4JYBA 1SVLA 5F9FA 2RGGA 1G18A 3U61B 1PZNA 2YWEA 4JL5A 5KNDA 2V54A 3LXRA 3AVQA 2J45A 4BGDA 2O8CA 2BBSA 1EBBA 4JLKA 3RRMA 3D7MA 1KAGA 4E22A 3NVAA 1BMFD 2ZROA 1GL7A 2PJRA 3RC8A 3IPYA 3F2IA 2GZHA 4XSGA 3OIYA 3ZVLA 3ZLJA 1AGRA 2QM7A 1P62B 4GL2A 4C0BA 1NLZA 4TSFD 3REGA 1G9XA 5E3HA 4B43A 2GJSA 3LDAA 1WA5A 5L3RA 3ZIAD 1R8SA 2QNIA 4HDOB 4TLDA 3C41J 1YVDA 2FGKA 4TQAA 5FL7A 4JLPA 5DIFA 2FEMA 4HLUA 1XMVA 3TGPA 4PO8A 3U5ZB 1W36D 3CX6A 4FINA 4B34A 2ZR9A 4OQNA 2G6BA 1IY1A 4QC2A 4KBFA 5CLQA 3SN6A 3LV8A 1TUEA 2YWGA 4RKEA 4DDTA 2IYSA 1KKMA 2PT5A 1S4QA 1ZINA 1II8B 2YINC 3BGWA 3CO5A 4LC1A 1E9BA 2QUZA 3U6BA 3R9IA 3L0IB 3ZJYA 5CDHA 4PSAA 1Q44A 2ANBA 1KSHA 2GNOA 4S35A 1W7AA 1U90A 4QGHA 4TT3A 4NDZA 1XBTA 5CU7A 1E96A 1JJVA 3BH6A 3GP3A 4BEBA 1KIMA 2IK8A 2NPIA 3SYKA 4ZI2A 2G1JA 1M8PA 3QEJA 2C78A 2XJ9A 1PLJA 2AXPA 4TYPA 1E9DA 3PEVA 4LBYA 1OPXA 3K0AA 4TLCA 4BFTA 3QOFA 1W0KA 5C1BA 4URZR 1W47A 3TLXA 2BMDA 4AC9A 2CLDX 1EFUA 5CYOA 2ODWA 1F2TA 4UNNA 3TBKA 1W49A 1N5IA 2MSCB 2A5GA 3GEHA 4ILEA 1FX0A 1J70A 4GDFA 2J5XA 3THWB 2WWYA 3RS0A 4A0FA 3F3YA 4QFMA 4B75A 3GLHB 2G9NA 3KQNA 4ZO4A 4IFBA 3OEHA 2WM9B 4IFEA 4GRAA 2JLXA 3SBDA 3LLMA 2FN4A 1HTWA 2ZJAA 1NN0A 3REFA 1K6MA 4LV8B 5HKKA 4PTLA 1NJGA 3QVUA 2FSFA 4IXNA 2VO1A 3LY5A 3I5XA 1Q22A 2VHCA 4QHSA 3VR2A 3VKHA 3PV0A 2IEYA 2ZQ5A 3GJ5A
chains in the Genus database with same CATH superfamily
4MPDA 4DEVA 4AJEA 4AK9A 1YO6A 2BI7A 5KMGB 4EEXA 3PR1A 1ST2A 4MLPA 4UTNA 1GUYA 1KF0A 3E8SA 3IMGA 1DKLA 2RGNC 1MOQA 2RI6A 2A5LA 2QP4A 1EBUA 4MDYA 3M6UA 3TB4A 1R0KA 4AL4A 4C03A 1I9CA 1L7EA 3EISA 4IQ0A 4YP5A 3N28A 4I99A 3GLGA 4FD2A 1MJGM 2J3EA 4C7JA 3WOHA 3GA5A 4UQOA 1VHQA 3VGJA 4E5MA 2Y68A 3WWZA 3VVCA 3CKKA 3OT4A 3K8OE 3LA8A 1C7QA 3NALA 3TZKA 3KSAC 1QGOA 3X2EA 3PQCA 4NV1A 4X7BA 3S5JA 4Z54A 1SUSA 3NPAA 5EQFA 1NAHA 3AVUA 1VHLA 2D1YA 2Z1MA 2HB6A 4X7MA 2AYXA 1DZ3A 2AQKA 1LJ8A 1X42A 2GF2A 2QQFA 3EXG2 4RIHA 4FQ7A 2C9DA 4HDMA 3DL2A 1OJLA 4I9GA 1RWMA 2H54A 3DNFA 4MR8A 2GYWA 4BE4A 2XYRA 4OLHA 2DQZA 4CKXA 1DIHA 4K40A 1KZ6A 2QP3A 3AINA 2WWVD 5F5NA 1XEWX 2ACEA 4PAOA 3AIIA 1CQPA 1RJDA 3L7BA 5CH8A 3M3DA 3NWOA 4QTTB 2PKQP 3VISA 2V6BA 5CCBA 1E92A 2CLKB 3F6CA 4M9CA 4RGQA 5CVTA 5EYPA 3ILXA 1OV4A 3UKJA 1YAJA 1M2VA 3KSRA 5FBVB 5HPYB 4C30A 1V1MB 2PVPA 2FPPA 2XMPA 3DKIA 3GYBA 4S0ZA 4LSMA 4ML3A 2OUKA 5FB3A 4IDFA 1G8PA 1ZD1A 1EG2A 4LSZA 2WWFA 5DXJA 4JP1A 2H5IA 2BUBA 3MCZA 4F8JA 4PZ0A 4MJLA 5K20A 2HQSA 1HT0A 4QXMA 3BDIA 1I4EB 4GPEA 3G8DA 2Q2NA 4TS4A 4ENWA 3NONA 2VDNB 4LRYA 1ZUHA 1JKJB 1M10A 4E07A 3HMQA 1E79A 2XWQA 5FBWB 4C6TB 1TZCA 4N39A 3H1GA 1ZH2A 3AVWA 4MINA 3HUDA 4P0TA 4CV2A 3CO0S 1PBNA 3QXHA 1FS5A 1SUBA 3A10A 2GA8A 3UW3A 5EIOA 4ZOLA 2JFFA 1C4XA 1FPMA 4RTLA 4G0UA 1FBTA 2VA9A 4WGGA 1TJ4A 2DBZA 4EI9A 2IF0A 3I64A 5B7QA 4L6AA 4LOKA 3ZK8A 4L2IB 1AQIA 5JQGF 3GRYA 3JQBC 3T7KA 5KTOA 3A6PC 3FDFA 1S7CA 2NN3C 3ORRA 2QL6A 1OKKA 5HF5A 3B1WA 1ZCAA 5COAA 3C5WP 1E3IA 4F6CA 1ZN9A 4R2MA 1RWKA 1GY8A 3KAPA 1CBUA 2ODBA 3TW8B 1WNFA 4G1FA 1OIVA 1P8AA 4PC3A 4RD6A 3TIVA 1QGYA 2QLBA 2WIJA 2Q8QA 3P9RA 5EIXA 3CS3A 4YJ3B 1SEPA 4QICA 3ZHRA 1JQBA 4QEKA 1VSUA 1NL3A 4X45A 5HCNA 4D8UA 4RMGA 4S0XA 1SB8A 3VH3A 3PX2A 1HZZC 1Q1QA 4UTRA 1GGEA 4LJ4A 3I42A 4ZRDA 1WG8A 2QT9A 4QJBA 2JJ1A 3KOOA 5C37A 3RSHA 4YT8A 2AOXA 3CRRA 3EXEB 3RBZA 1ODLA 2ERCA 3OX1A 4BNDB 5E8JA 2W4QA 5JRDS 1YZVA 4YRIA 4MUYA 5BT8A 4KQ2A 4GECA 5FA8A 5AK0A 1YIAA 3L4EA 4HN4B 1P4AA 4W82A 4XVRA 1TQ4A 3L3BA 4XPZA 5ALSA 3CSSA 2GM4A 1QH9A 2ADOA 3R8FA 5C1DA 1GUZA 2J5RA 1KPGA 2RDMA 4BKMA 5AUPB 1JWLA 1XJQA 1BNCA 2PDAA 1T1IA 2R1TA 4M9QA 1WZNA 4O2RA 4HLDA 3TZQA 3LIIA 3D0RA 4GM1A 1NZDA 5H59A 3W79A 2I65A 2BLNA 2EKQA 2YFYA 3JSAA 2EF1A 2W6CX 2BH2A 4GI2A 1IBRA 3NAQA 3PGVA 2O5CA 2VSYA 2C5AA 2Y2UA 4F84A 1RC0A 2RFLA 3ZCUA 4FFDA 3UMVA 1U02A 4ALKA 3RBAA 5K45A 4YQFA 4JKYA 1JE1A 1UBNA 1KI4A 1WTAA 3GVXA 5KYYA 3AFHA 1KZ7B 2PEYA 3HN6A 3T7TA 5IJWA 4YP0A 1IY0A 2H8GA 1XTTA 3U7EB 3O8NA 2Y92A 1RZRA 4WZZA 4RV5A 1KJQA 1TU3A 1Y4UA 4QBGB 1NR1A 4HO1X 5SICE 1DQSA 1OLOA 3PIDA 4IAOA 1ZXLA 4AP5A 2ZUEA 4EHFA 3DMNA 5JZ9A 4LGVA 3KTAA 3AI2A 4E2YA 1LEHA 2HTFA 3EFHA 1XRJA 3R3VA 4TS1A 4LWOA 4Y0NA 1U8FO 1DQNA 1EX1A 2E1PA 1C0PA 3KOMA 2FHSA 2PFGA 5EFOA 3WADA 2NSLA 2J6IA 3THXB 4OHRA 2D2XA 4UJ5A 4Y1RB 1PL6A 2JFYA 1N77A 2D7DA 1E2LA 3QVGB 2C3UA 1T5BA 3DE3X 3VXKA 1EVYA 4PYOA 5JCZA 3WK9A 3PQ3A 4ND7A 5BT9A 2EFHB 2ZJBA 4MX8A 5C5IA 3IDFA 3RPEA 4EDHA 2XYVA 2BIFA 3HBAA 3WAJA 1W85B 2BMFA 3GA0A 1LF0A 4PLVA 1RHMA 3E0QA 4FWIB 4CDRA 5B1YA 4FZ5A 2NADA 4QQNA 2A8YA 2V7WA 4K26A 2W6JD 3RS2A 3DCNA 3H42B 4UDNA 3FUVA 1XEAA 2J48A 1RQ2A 2JATA 2JNWA 2O0MA 1SQ6A 2DBVO 3ZLTA 1AGYA 1PHPA 3DMRA 3ESZA 3SQXA 1C3EA 4US2R 3MRXA 3ZXIA 1ZOPA 3DMGA 3C3YA 3GO4A 3K9BA 5AK6A 1AKQA 3SHVA 2WHEA 4XIFA 2O4CA 4W5WA 1UT6A 3TM5A 3SFVA 3CBGA 4II7A 5KOJA 1PD0A 2WTAA 1MUUA 2BI8A 2PBLA 4UASA 4XX1A 1NURA 2GBLC 2PRSA 3IBYA 1H6AA 1CU1A 1QF7A 1KVUA 2OB1A 2OM6A 4XRRA 2P6NA 4QDKA 2CT8A 1G3RA 5HJ2A 5ILGA 5EG5A 3VX4A 3PFBA 3GOQA 3I28A 2WU0A 4CE6A 5FUQA 1G8SA 5HM6A 3U7FB 4IDGA 1S6YA 2E48A 4QU9A 4RSGA 3F74A 5D00A 1QAQA 2UZ3A 3VI4B 2XWJI 1DQYA 4LRQA 4JP5A 3TTVA 3MTDA 3ILVA 4CNBA 3UT5B 4NHOA 4HDNB 2VJOA 4G97A 4GFDA 5A5DA 5IDWA 2VT6A 1DJNA 3LDUA 4Y7CA 5FOTA 2A5JA 2IGBA 3OQMA 3TVYA 4PANA 4HVAA 4ZQFA 2QJTA 3E27A 1TA4A 5BSVA 2HRBA 1T15A 4EW1A 2VZEA 2QE7D 3NFYA 4RM2A 5JWOA 4BX8A 1UJCA 2EJVA 2PX0A 4Q37A 2BL4A 3SZGA 2QUJA 3R3JA 4QYIB 2GHTA 1OI2A 4RCVA 1WMEA 4KQHA 3V2GA 4C04A 3HJCA 4EJ6A 3WG9A 1VZ3A 2FVYA 3QP9A 3EEIA 4OHXA 4BRSA 1X3LA 3QEOA 2ZWMA 4MYCA 1QAMA 3DE2X 4K5QA 3AUYA 3RYFB 4BLRA 4D82A 1YNSA 2X7XA 3W6ZA 3GMSA 2XMDA 2ETXA 1CUXA 1MXHA 1SBHA 2UUAB 3TIFA 1VL8A 3A7EA 1MOPA 3MWGA 4BO4A 1CUBA 4FFOA 1D04A 1VOTA 4H6XA 1C4OA 1WDTA 2ZANA 3C8DA 1XTIA 4R51A 1FYFA 1CUUA 2H1LA 2O20A 2YN2A 4N40A 3AXTA 2JCYA 3X43A 1Y3CE 2HEIA 4RMIA 3E22A 1DINA 1NBWB 1PS9A 1U5AA 2R751 4L7VA 5T4HA 3TLKA 3VBEA 3T9EA 5EHQA 3V33A 3CISA 3BIXA 1CP2A 1PNVA 2BWJA 2OFWA 2Z4SA 3L8YA 1U3GA 3CZQA 5DRYA 1NUAA 1M5RA 2L2QA 2QTRA 3KXLA 4QE3A 3O84A 5NULA 2DKOA 1VRCA 4FXPA 3BQNB 4QFCA 4Y6QA 1QZ3A 1EWQA 4B4KA 2XCSB 1EK6A 1M6WA 2PS0A 2PZGA 3JAWA 1KYZA 1RJEA 1Y37A 4GZ5A 4YGYA 3WGMA 4EHLA 4CMKA 1XGKA 4HOYA 5ES4B 1MOSA 3DMHA 2BKUA 3SR4A 3SC2B 1JPVA 2JCSA 3WGUA 3MJCA 5JY1A 1XZKA 3FPJA 1C3OB 3VYVA 4DLKA 4JDPA 3R3SA 3DS8A 1P6QA 3K1TA 4ZQHA 5CB4A 3KEGA 3EZNA 4LCBA 2NV6A 3E23A 2PX3A 3HN2A 5C31A 5JVDA 1YI8A 2O8EB 2X4LA 1P9OA 3UK2A 4D96A 3IUYA 1XO1A 4R68A 2I62A 1CUWA 2B1QA 4KNWA 4KQFA 2DR3A 4ARZA 1QX4A 4IDAA 4LVCA 5K5EA 2Z2IA 2QQ0A 4URFA 1MEOA 3PEYA 5TMPA 1AZTA 2REQB 4RH0A 3B9RA 4EA9A 4JC8A 3BOSA 3ZIUA 1N2HA 1ZP6A 1Q92A 2ZRAA 5T4EA 4OLBA 4R2KA 2X2FA 4QQ8A 4X3OA 2AKEA 1WMFA 1WXXA 2D3TA 3EDRA 4FP9A 2UU9B 3CKMA 3ZC3A 2GAIA 4LBZA 3IBGA 3D81A 1A1VA 1E3SA 1K6JA 4IZOA 3OE5A 3TEMA 5J58A 4WK0B 3B6EA 1KEEA 3FOBA 3K0CC 1CR2A 2XNKA 2BRUC 4PXAA 4BE9A 1XPRA 3PUYA 1P2FA 2HRDA 3SF8A 4LF6B 5BYBA 5FWNA 3H4TA 4FGSA 2W90A 5GINE 2XZOA 1GCUA 2E89A 1Y5LA 1Y82A 3OE4A 1W4RA 2VPQA 3O26A 2OO7A 4IWXA 4AJ4A 2VPPA 3LCMA 2XYQA 1K0FA 2IHKA 3LDHA 3MGCA 1NC3A 1M67A 1XQ9A 2H1SA 2WHQA 5LQUA 3GVPA 3R0QA 1NI3A 2QUIA 4HRAA 4RVGA 4EF4A 3PIIA 5LCXA 4RULA 4GPAA 1DC4A 1JHVA 4URHA 1I4WA 3O4IA 2I7VA 3W9UA 2QW1A 2WWRA 4U0JA 2BFEB 4M9ZA 5FHQA 1NGSA 5JC8A 3BDAA 3N6RA 1HA3A 1MQ8B 4IR7A 1XDZA 2AOWA 2ODQA 4WW0A 4BBAA 4Z2AA 5LMZA 4FM9A 1ANKA 1NE2A 3IOYA 2ZWPA 1YR1A 4ZQEA 4DABA 1H9CA 3GPIA 1PJAA 2HPAA 4HWKA 1XKXA 4D5EA 1GKUB 3DTYA 3GNSA 1DQPA 3OOEA 4KKVA 3UGQA 2IZZA 4AJHA 5DN9A 2WKSA 2XT0A 4LZPA 4RKWA 4YCCA 3NHWA 3QKSB 2CXXA 2QM8A 4ETWA 5BNZA 4JFRA 1EP3B 3LBFA 3EA4A 3R9WA 3Q2OA 3IHLA 2ZUDA 1T8RA 4OH1A 1JA1A 4XD7A 3DOHA 1OLUB 2P6OA 3WB9A 4LDQA 7ADHA 2PRIA 2IS2A 1QMGA 1T0BA 2XGGA 3N2LA 2IWRA 1EJ0A 3GP5A 3FHTA 2C5LA 2O5VA 2P68A 4JJGA 2E5WA 3DEHA 3S2YA 4E5PA 4P34A 1PFWA 2HQOA 2IHVA 4OBBA 4ZZ3A 3D7NA 4K9LA 3IIEA 2B8WA 1ZI6A 2OQRA 3SEFA 5JSZA 4FZRA 3IUMA 5G0TA 4D3SA 1ZK2A 1W2GA 1RS0A 1Y7LA 3CC8A 1KIFA 3JD4A 4KRGA 4P5PA 4UKDA 4J9UE 3NDPA 2ZSFA 4BC1A 2EEPA 2V03A 3OP4A 1P77A 2WOJA 4QOFA 5HBRA 1NU8A 3NT4A 4F9EA 5F3RA 1V47A 1PJRA 2R8PA 1P33A 3BB1A 2ID4A 4DVJA 2HT6A 3KVRA 3LE8A 2EU8A 5KINB 4F72A 2RCNA 2C5EA 3TTSA 4F5EA 4OK6A 2UUPA 3WKAA 2IP1A 3RWBA 5CDFA 1BZYA 2AD1A 4BE7B 2KWIA 3QVLA 3RVRA 3G89A 3HCPA 3RK4A 4GBJA 3MGBA 1B41A 1XIVA 4QNMA 3HRHA 5EIFA 4TM8A 2ZRQA 5LQCA 2HF9A 2HI0A 1MVOA 1DTWB 3FGNA 3RT7A 2Q0QA 4B8ZA 1FFXB 3ZDXB 4YDHB 1RRFA 4PLCA 1M74A 4GPD1 3ND7A 4Y2SA 4QYTA 5EMJA 1NOKA 1GUBA 1JX6A 2J3MA 4RK4A 3HG7A 2P6PA 5BRJA 3T5DA 4BQIA 3ANXA 3AJEA 5B64A 3KZVA 3U81A 4JXXA 4RH1A 1P1JA 5CLLA 4RELA 4M1TA 2Y1OA 3WLKX 4R9RA 4M60A 2C99A 1Y9DA 1EVKA 4A6EA 5I8ZA 1U8AA 2RSLA 3FJYA 4EY7A 1DMRA 1EFKA 3OFJA 3C3PA 4Q4HB 2VI5A 3H4IA 4TV9B 5B4TA 4GPIB 2CLHB 4Q3AA 3SSOA 1U7PA 4JC0A 4GAEA 1E32A 4EHAA 3EWNA 3FYDA 2VPWA 1Z8DA 1Q0TA 1NVEA 1GRCA 2WP8J 3KFVA 3RB8A 4DQKA 1BHJA 4M1SA 2XY4A 1W48A 1CS4C 1US8A 2RJNA 1NTRA 3TW4A 3WYBA 2FFAA 3KQLA 5T3UA 4DJAA 5A4KA 2XAAA 3VPFA 2V74B 3D4BA 4ZCSA 2FSIA 2YV1A 3WFJA 2BFBB 1D6JA 3ASZA 2Q1XA 2EX4A 3G13A 2ODAA 3N0WA 4OXYA 4MJ7A 3HCCA 1L3IA 1ZEMA 2JIQA 2V6MA 3I1FA 4I5GA 4C0XA 3EB9A 2UXCB 2XCTB 5A1TA 4ZEXA 1JBQA 4R8SA 1QUFA 1QK3A 4RZQA 3UHFA 1XQ6A 2IE8A 3GH1A 2EX1A 3GLTA 4YRNA 5ILOA 3THYA 3KP1A 2GPWA 4OLFA 4PC6A 1QHGA 5I9TA 1K7SN 1MH1A 1XVVA 2DTXA 1MLDA 3DHYA 3PSHA 3PE4A 5AM0A 2W6QA 3QH4A 2P9CA 2P6RA 2IYRA 4LCEA 4RXTA 5E7MA 3ESQA 1Z2AA 1RP1A 3JYLA 5JO9A 5BR1A 3PKIA 3SXUB 1V26A 1G20E 5B36A 2BEKA 3HZHA 3TG8A 1D0VA 2WBLC 3RUAA 3T4XA 3ZIDA 4PW0A 4CKBB 2G5TA 5CH3A 2GYVA 2R8EA 4K87A 1OLXA 2JGNA 4B2PA 3E1SA 3PPIA 5C80A 2CD7A 2XTMA 1NXVA 3CEHA 2I8CA 3IURA 1AN9A 3RKSA 3ROTA 4C0WA 1JZSA 4WBNB 1XYVA 4D4GA 3U7GA 2XW6A 3KB6A 3DC7A 2VZ9A 2Y0EA 4JX9A 3S2SA 5TEVA 4U1RA 3ASUA 2GWHA 2FMTA 4BO7A 1A77A 2X8AA 3ROZA 3KJXA 1TVCA 5JZMA 1KO1A 2Y67A 3HYNA 1Y1RA 3K35A 4L72A 2CYCA 1MB3A 1RKBA 3K9GA 4EVRA 3MMZA 4LDNA 2W5UA 4F8EA 1G16A 4RLFA 1QRAA 1PEKE 1QO7A 1UMDB 1WKBA 1UPAA 3N7AA 3P20A 4HLUC 4LK2A 3IV6A 4BWVA 1Z0UA 4C01A 1A96A 1YSCA 5JI2E 4LMAA 1ZI8A 5ITZB 2A5YB 3T3EA 1DAGA 3LAWA 1SOMA 2BP7A 4Y6PA 2NXJA 3OKCA 1OTXA 3QLUC 3MWEA 2O8BB 2ADFA 3ZWVA 1HL7A 3UJBA 4B2IA 4O2BB 3E5NA 1Q12A 4HFMA 1ILWA 2AN1A 4TQUS 2AFVA 2EGGA 2DKNA 3RVMA 1VHDA 1YZQA 2ONZA 3FOFC 1PJQA 4G2NA 2PO7A 1T9CA 1Z83A 3O91A 3VTAA 1USGA 2FJPA 3SU8A 4M49A 1KU0A 5FOVA 2WZDA 2Z0MA 1OBVA 4MKRA 4NBUA 2NXWA 1JBEA 4GBGA 4Q7LA 1WEHA 3PDHA 1EHYA 1X7XB 3AHHA 1FF9A 3FLEA 1N57A 3K0KA 3LZDA 3PFNA 4O4HA 3H83A 3SKVA 5AQ1A 5JARA 1E6KA 4EVSA 1KQFA 2VWGA 1ZRHA 2AG5A 2LXNA 2I3BA 3DAGA 3E0XA 4UBKA 5EESA 4J1TA 5THKA 4CR8A 4EITA 2WSYB 1VPEA 2N0SA 2WHPB 3IRUA 1OPRA 2C5BA 4M7PA 4EUFA 1AU9A 2G71A 2GJ8A 1IN7A 1NJSA 2VFAA 1SHZA 2CBGA 1AURA 3OD5A 4REMA 3BM5A 3F3SA 2Z5GA 3EQ9A 3SJAA 2FLKA 3OKPA 2XLBA 2OC4A 5HXAA 4CQLB 4ALLA 3HS3A 1MTZA 5C4MA 4ZO9A 3ZBTA 3O4VA 5JLAA 4EY6A 2R11A 2HCBA 1O3YA 3ZNOA 2JEOA 4IIDA 1SHUX 1DTSA 2C2BA 1YMUA 3G0DA 1J1IA 4MKIA 2G82A 3ZE6A 4NENB 1Y8QA 3B5IA 4KLAA 3DTTA 1W5AA 4PFKA 5MFPA 2C04A 2JBAA 4EOGA 1L2TA 1AKRA 3DZ8A 4LJYA 3IAXA 4YCAA 3FOEC 3ECSA 5EQTA 1NKSA 2VXYA 2P0YA 1L7OA 3RSZA 4OCZA 5F33A 4CTMA 1JYFA 1N1GA 2V5UA 3HKDA 3RYHA 2O2YA 3GELA 2VZ8A 4Q4AB 3GT0A 8ADHA 3MJHA 3V80A 1IRIA 1KY2A 3UPTA 3R5XA 3K6SA 1HTTA 2PT6A 3TW6A 3N2IA 4ZI3A 3DWGA 3BHMA 3BHIA 3QXGA 4NU0A 4QPZA 4JJ6A 5KOIA 4KO3S 5CJ2A 2OOKA 1YB6A 3MTIA 3PCXA 1F2UA 4CN9A 5A2GA 1MVNA 1RU3A 3EW7A 2I5PO 2O2HA 3R09A 1TF2A 1G3IA 2VQ3A 1IN6A 2FE4A 1VPVA 2IOFA 4LZJA 1W5EA 4QBKA 1JEDA 3Q7SA 1KY5A 1JAXA 3LPCA 4KN9S 1JRLA 1NT4A 1RBMA 4EY4A 3TMYA 4N5HX 1UBCA 1NBMA 5C7IO 4RVCA 3BXXA 5CTAA 2Y9MB 3FBWA 2CUKA 4OJYA 4YACA 5H0IA 3IQIX 2HCJB 1B14A 4IKEA 4D4LA 5AVQA 5HIMA 3LWZA 3ZJ5A 1A8IA 1SXJA 3TK1A 4X9XA 4NCBA 1A9TA 2D0DA 4G1VA 4BVBA 3QOXA 1VSBA 4JOCA 4TLBA 3TF5A 2JHPA 4C7MA 4ZCMA 4HZUA 3EIEA 3DJFA 4YR7A 1KKLA 3E58A 3EARA 1Z06A 1EX9A 1PUJA 1U0SY 1X3SA 2AXNA 2CD9A 4P08A 4Q00A 3IMFA 4XJTA 4N0DA 3RLFA 2NU6B 3VOBA 2RGNA 4LY3A 6PFKA 3TFOA 5D5QA 3HJRA 4D42A 4R2JA 4KL8S 2JLVA 3P0IA 4Q02A 2GCPA 2EFEB 1HLPA 2DPXA 4ALMA 2FSVC 3LZ6A 2FXVA 3NBKA 2E9SA 3L82B 1MZVA 2AFIB 2J6CA 3EIOA 4NULA 1OX6A 3GR6A 4D2IA 4PYLA 3UWSA 1XU7A 5IBCA 5JDIA 1A9RA 1E1DA 1E5XA 3EEOA 5B4VA 3CZPA 3VPHA 1HQCA 4FMCF 2XQVA 4Q4CA 3A2MA 1M66A 2PKXA 1KI2A 5GOZA 1PZGA 2AMFA 5KHAA 1HDYA 3DT9A 1TQ6A 3E82A 3K9CA 2PZEA 1XD8A 2QTZA 1I3NA 2DPGA 1NVMB 2QQ5A 3A27A 4RY8A 5DBIA 5TJHA 3F7OA 3Q3VA 4I3FA 1KBQA 1KY4A 1ULSA 1V37A 3C16C 3N5CA 3HSKA 5KCZA 3O92A 1EUQA 1QHHB 2FTKE 3AF4A 4LRSB 1VRWA 4ND6A 4RO0A 3KSZO 1XHEA 1BXRB 2O14A 4PPNA 3VV2A 5C8YF 4QDZA 2Q2OA 2OXIA 5F9HA 2MWMA 1BFKA 5CT8A 2YY5A 1IZ7A 3QQPA 1KTVA 2CZGA 1K8XB 2NSDA 3L7AA 5HRCA 5HE8A 2YVUA 2Z98A 3N2ZB 1DHRA 4DS3A 4L22A 1ZRSA 3OECA 4TKZA 5AXCA 4H77A 2CXPA 5AVJA 1YZNA 3A06A 4OM7A 5KKNB 1T0HB 1D2AA 2Z2XA 1FTGA 3QLVC 3N2KB 4R2IA 5CA0B 4BFSA 2CXOA 4TT3D 1MABA 1ULZA 4FE4A 3L0CA 4K1LA 3CKLA 4GPTA 3A6FA 4WH0A 4LWZA 4BWGA 5BSFA 1Q0PA 3GCDA 2A57A 2WSLA 4FDLA 4KAFA 3OPXA 2E5FA 3AUFA 2HT1A 1SXGA 5AKYA 2OYCA 1Z56C 2ZGVA 3P5SA 4PC2A 8OHMA 2IOHA 1DEKA 2B7CA 1LX7A 2IU3A 4I4TF 3DLTA 5CG1A 2QVBA 2RHOA 3R40A 3EBOA 2O2SA 4NIMA 4RPLA 5EP3A 3H19A 1N0WA 5KSWB 2ZI4A 5HEKA 1WHSA 2OCGA 2XCIA 4M76B 3QV1A 3A9SA 3CVVA 3IA2A 1W36B 1M1YE 5E4YA 1THZA 1X1BA 4UHKA 2CHFA 1C2TA 2PSJA 3PPXA 1BGVA 2YL2A 3ZE9A 4GZMA 4C4RA 5DHSA 2AXEA 3QNWA 2J41A 1BE0A 1TUBB 2QPLA 3U6KA 5BQPA 4KPUA 4HH1A 2X8JB 3UGJA 1Y5IA 4Q1EA 3OEHD 1IHYA 2N3ZA 4ZVPA 3WV5A 5DM70 3EPHA 1DU4A 1P29A 1R0XA 3LXXA 1XR3A 2REBA 4X90A 1UMCB 2ODTX 2WVJA 2I3AA 4UPDA 4LDPA 3GEDA 4X3PA 3W2TA 1Z0ZA 4BO8A 3KU1A 2IIVA 2PXCA 4EPTA 2VIIA 1HZZA 3JRWA 3UB4A 3C5HA 4FYPA 5BMVB 4POOA 4WADA 1KP3A 2Z95A 1JVBA 1FE8A 3L77A 4TWZA 1G9SA 1U0JA 3U56A 4R8MA 1IVNA 2MSLA 4BLWA 4ZT6A 3U44A 2R79A 3KPJA 4HSEA 1T1EA 1WVGA 1XHFA 4ID3A 4NZYA 1I4DD 4BLSA 5FWXB 3QITA 3GQVA 2ID8A 3ADKA 1NI4B 4HZGA 1UMBB 3JYNA 1T9DA 5JSHA 4TTVA 1DDGA 3PCRB 4M3NA 3VR3D 1S02A 1XNQB 4QM6A 4LF8B 3V32A 1I1NA 3MTAA 1M72A 4HQOA 3GEEA 1IEQA 4L3VA 4PLPA 4XCQA 3QX3A 1QV9A 3QF4A 1H4QA 1DWQA 1PQUA 1GVNB 3SJUA 1I2ZA 2BZ0A 1I5OA 5IU6A 4J3JA 2V0NA 5DM1A 4H0CA 2CB0A 1R2QA 4LGCA 5JCXA 5JXWA 5ARDA 2JVKA 4KACA 1BS2A 1H9AA 4M1EA 4M9RA 1KC1A 1U1CA 2XMRA 3U7RA 1PVOA 1YS6A 3U3ZA 4U2EA 1F3OA 1R0LA 1D7AA 1M6HA 1W2HA 1R4MA 2Z5LA 1SCAA 2Y3IA 3LF1A 3DVAB 3OE1A 4ODIA 3PA8A 1OTYA 4PIPA 4CT5A 5H16A 3EDCA 2CNOA 2NZUG 3ODGA 2ILVA 4FYKA 5CJJA 4I8IA 1DWUA 3M49A 3UMRA 4JGGA 4TV8B 4DQ0A 2AZDA 2OCBA 3GUCA 1NV9A 4DV6B 1GYRA 3FKSA 3EVNA 4N5IX 1DC5A 4MGKR 3WBBA 3KQKA 1S7GA 3LHKA 3QBJA 4UEKA 4UVEA 5MN5A 2ZBFA 5IWAB 5FL3A 2VQSA 4P5EA 3T9DA 3NDBB 1X1AA 4BQNA 4K9RA 2O05A 4MRRA 1HFKA 3KUDA 1P5JA 4I14A 2VYVA 4LX0A 1HRDA 3FSGD 1PFYA 2O1WA 3M5CA 1GHTA 3N2YA 1PFUA 2PEZA 4MV7A 1GGMA 1J99A 1GU0A 5DGXA 2W83A 1J20A 4KZKA 3HB7A 5ED0A 2OORA 4RK1A 5EJ5A 2DT5A 4LJAA 4H15A 1S2IA 3BG5A 4CLDA 1IE3A 1W1IA 4WZBA 1Q16A 3BZWA 3EW9A 4WNAB 3O1IC 4KWTA 4ZKDA 4GXRA 2YY7A 4L8LA 2AR9A 5IXSA 3TG2A 1JA9A 1ZGBA 1OE0A 2IYXA 1V7CA 2ATXA 2IYNA 2VKTA 3JY6A 3OJ0A 1A7UA 5DTIA 1GXSA 3AWDA 3DH0A 2C9BA 3IV9A 3A2LA 3CLUC 5HUJA 2EW8A 3V8QA 4NU6A 4MS4A 5IF9A 1RJGA 1M1XB 1NQUA 2G40A 2YR0A 2UKDA 5SZIA 2VJNA 1J7KA 1SBZA 2RBEA 1VMAA 2Q21A 2QRUA 5K1ZA 5I7FA 2G4LA 2I9PA 1LTQA 2MSWA 2PUGA 4YCSA 2E4ZA 1WVIA 5E1OA 2F8MA 4I81A 4RENA 1YJQA 1DBSA 1TQ8A 2FSSA 2OVBA 4IUYA 3M89A 4X1KB 5AKGA 4YJ2B 4R8KA 3U4CA 4PG8A 3SNKA 2QLFA 1S2MA 5AW9A 2I29A 3FTEA 1GUFA 1WZCA 2YV5A 3MINA 1P61B 3MT8A 5JFOA 4NYIQ 4BAZA 1JB1A 4DKXA 5J5CA 2YMMA 3EUAA 2I80A 5H68A 1PLKA 3ACDA 2FG6C 7REQA 5EPOA 1L5OA 2R4TA 2XPCA 4ROTA 2Y1XA 4TSRA 4JUFA 2AQHA 5C1IA 1DG1G 2ENWA 3CRVA 2HLDD 2VJLA 1GSAA 1NI5A 4KCGA 3ZGOA 3REQB 5DI9A 2JVJA 1OH7A 2OTCA 3I9FA 3JQDA 3AZPA 4DV3B 4NY1A 4M36A 2N1BA 4MWBA 4Y2QA 4KR6A 1K92A 5HKLA 4NMMA 8AT1A 3ZLUA 1GRQA 4KQGA 3DLPX 1JGTA 4C20A 2LKDA 2GCEA 5K99A 1WB6A 4Y6GB 4CF5A 1G6KA 5DN6A 2H07A 1DEOA 2J4CA 1PEYA 1XJ5A 3IP5A 5IRCD 3FCEA 2VYNA 4AKIA 4MYHA 2HJVA 1QYCA 3C4QA 3DF9A 4Q3KA 4ZA2A 4V1CB 1L8AA 4MKFA 3IVXA 4G89A 4WJLA 4CQMA 1VC2A 3BC1A 3PDIA 2KE5A 4BNYA 2C2OA 3AEQB 3L7LA 4Z1MD 1YMVA 5BSGA 1E2BA 2BEJA 1I2DA 3O2QB 1KRWA 2BM0A 2B1GA 3TNYA 3DSRA 5L4NA 2QZ9A 2GXAA 3E61A 4CKYA 1HT3A 4CF6A 3Q3GE 3VJKA 4B48A 4K0RA 1B2LA 3P9NA 4LXIA 3QPAA 2H5EA 5AVVA 2A0YA 3I61A 1JIQA 1VCHA 5LQSA 1WUHS 2W2KB 4TLAA 4FILA 1C29B 2I78A 2QUHA 4LZOA 1RXCA 3BRCA 3M8KA 1KYVA 3HDYA 4J7AA 2C3MA 3P2IA 3CU5A 3UF0A 4RFVA 1WPQA 4WNCA 3LCRA 4MA4A 2R6GA 2P91A 3EXFB 3A6DA 3HXOA 1QGDA 1E6EA 3A6HA 2K2QB 4MWDA 3P9YA 2BI4A 1NF8A 4KXXA 4R69A 1YJAA 4TWAA 4B7AA 4DG5A 1TVKA 3L4BA 3F67A 2X41A 3SZUA 3J81k 4OP2A 4AJNA 3DB1A 4ZAFA 1DQZA 2OV8A 3CIOA 2QQEA 5HIKA 4ZEOA 2PXXA 3LUKA 4OYHA 2GF0A 4WESB 1QDEA 3RABA 1TECE 1MX9A 1RPJA 5IXJA 1PX0A 3GEMA 1W4ZA 2YQ4A 3NJRA 3QUTA 3F1LA 2PU7A 4ZVKA 6LDHA 4CM5A 3LPDA 3VFDA 4JAVC 5G0VA 2AZTA 4JNKA 2VTVA 1KXZA 4L4XA 4BZZA 2QORA 1TYEB 2OV4A 1KRXA 2WYHA 3OUTA 5BWOA 1LWNA 4YV0A 3JS5A 4X60A 5DF1A 3TOZA 3FPKA 1TM7E 1JF8A 2PXAA 3ANMA 3E2IA 3LC0A 4HFNA 4L95C 3KWFA 3TXYA 4G0YA 3W4IA 4E3ZA 1SVUA 1UF9A 2CEKA 4BNLA 3BORA 4Z5XA 1KK3A 2XZDA 4JLJA 4LGYA 3VPBA 1XZJA 2BHTA 2H92A 3FMIA 3BGIA 4GOKA 4OI2A 1CUFA 1NQXA 3DE5X 3QELB 4OFBA 3JAMA 1DIAA 1HDIA 3K96A 4PVDA 2CLLB 4Z9AA 1NDHA 2RKOA 3OT5A 4IVPA 1MFZA 4QEZA 2GN2A 4WBSA 1KWKA 1V1MA 1DAEA 4KWEA 5KQGA 1A95A 1XRMA 4N54A 1DQRA 2ZT6A 4KPFC 3ZV5A 1QHIA 3VGPA 4AMBA 5I4IA 2C88A 1XZBA 4IQFA 3UJ3X 4C08A 1Z4LA 1G19A 4AYTA 4B3HA 1S8AA 1EVQA 3K0CA 4ITRC 2BRUA 1RABA 3OTOB 2O8CA 2IXEA 1NXQA 3FCUB 3MCTA 1R6TA 4RTKA 3ZCSA 1BSVA 1GV1A 1MDBA 5ALDA 3OJWA 1LS6A 1FTWA 2LIVA 4GMGA 4BNTA 2GPAA 3OZCA 1CHNA 1XYYA 3AX6A 1OT3A 4K28A 1IPEA 1XVIA 2GAOA 1GFIA 5D3MB 3V1LA 1DWOA 3ELBA 4PLWA 2JS7A 2O0HA 1B8OA 1WZ2A 5JMPA 1NFQA 1ZW6A 3EC2A 5I51A 1CQWA 5D01A 1SVSA 1EUCB 2UVQA 3I5YA 3RT1A 3QFSA 1GZ3A 2EJCA 1BMFA 1UJ2A 1HO3A 3G8AA 4N3BA 5DDIP 1V96A 1M2EA 3LJKA 3N6VA 4BX3A 4EB6B 4OX9B 4DY6A 1KDYA 1VKHA 2V65A 2A30A 3PC6A 3F7MA 3QVVA 4TSFA 1VB5A 4L2IA 4U6QA 3VA7A 5JATA 3EMBA 1AQJA 2YC4C 4LI0A 1ZEJA 1OFIA 3C45A 3OQ1A 1YGPA 4HGZA 3C85A 3ZIAA 2FETA 4MQEA 2PYIA 3TTUA 1EFVB 2QTVB 1OA0A 4YJDA 3TW8A 4M22A 3ZE8A 1U1FA 2QN1A 4PZCA 3QWFA 2PSHA 4QYXA 4P7JA 4YJ3A 3SX4A 5K6AC 4UBMA 2CNLA 3BTSA 3DLBA 2YMPA 1G20B 2NUAA 3QEBZ 5J2UF 3NM4A 1JP7A