5HR5A

Bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2)
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
424
structure length
423
Chain Sequence
KCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRRQAVKSYKSYDFFRHDNEEAMKIRKQCALVALKDVKAYLTEESGQIAVFDATNTTRERRDLILNFAEENSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMDDFLKRIECYKVTYQPLDPDSHDKDLSFIKVINVGQRFLVNKVQDYIQSKIVYYLMNIHVHPRTIYLCRGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEIADLKVWTSQLKRTIQTAESLGVTYEQWKILNEIDAGVCEEMTYAEIQEQYPDEFALRDEEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase, transferase
molecule keywords 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
total genus 155
structure length 423
sequence length 424
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hr5A01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5hr5A02
4TTPA 4D4JA 4M1KA 5J4VA 1JR6A 4BFWA 2WKPA 4ASUA 1XEWY 2GAOA 4AKGA 5CDFE 1Z29A 4HSEA 2Q3MA 3OEEA 3LVQE 4PHTA 3W5IA 3WP1B 2R62A 2OWDA 3CWZA 3DO6A 4LHYA 5DYGA 1WB9A 4Q1BA 2N1BA 3VX4A 2J45A 2ZSBA 5JZVA 4URUR 3IPXA 3MJRA 3AP2A 2J59A 4HLDA 4N0EA 3SI7A 2YOFA 3ADBA 4H1VA 1MO5A 1T8UA 3T1TA 3B9QA 1CEEA 3T06B 1E2GA 3NFYA 4V0MA 2Z0MA 2V7QA 4BZXA 2ZRCA 1CRQA 1XD9A 1ESMA 3HPRA 2E87A 4IRUB 3LX8A 3W8NA 5JWHA 2GK7A 1NMXA 1OH8A 1W1WA 4B75A 3ND8A 3A4MA 4ARZA 3V4RA 3CF6R 4Z1MD 1G64A 1QVAA 4QOSA 3UG7A 4PC2A 4B6FA 3RRYA 2IHBA 3NH9A 3G0HA 4JKIA 3AVOA 3UMFA 1VYVA 2OHFA 5M04A 2QBYA 1XFAA 1NI3A 1P72A 1VCIA 4UNPA 1XWIA 2YC2C 2CNWA 1XX6A 1OH5A 2O0KA 1EGAA 2FNAA 4ACAA 3FB4A 4TWZA 3O8RA 1YZLA 4OQLA 4WZAE 2ZI4A 1A2BA 1GL9B 1CIPA 1DE0A 2ZRJA 4FN5A 1OXUA 3D31A 3JZMA 3TLXA 2WKRA 1X6VA 2F1IA 3DZDA 2REXB 1R7RA 1A2KC 2H18A 4BFYA 3IT0A 1KOFA 4EIWA 1Z07A 1F48A 1ZM2A 2CVFA 2EYQA 1GL7A 4MITA 3K0FB 3NTLA 1JEEA 2GRJA 3B78A 3IEUA 3KUDA 4EFNA 1LB1B 3BB3A 3AM1A 3QXSA 1AS0A 2OXRA 2XOKA 2ZI3A 3O0TA 1L8QA 2BBTA 3RLFA 2EFHB 4LSGA 3PQCA 1R5NA 4C0KA 2YN0A 2AFIE 3AV0B 2CE2X 4Z1MA 2JLQA 4V02A 4KFRA 3THWA 4PQYA 1N6KA 1C1YA 4MKIA 1XU4A 4L16A 3PENA 4KCGA 4JVMA 2JJ8A 4C0AC 3SR0A 3BH7A 3FPAA 1TTTA 1XTSA 4Z54A 4MRSA 5FL7A 1E2DA 4GOXA 1II8B 3NXSA 1T91A 4HLUA 5AJZA 3DKVA 3LNCA 1AZSC 4WXPA 2H16A 2VP9A 3WNDA 3AH8A 1TU3A 2A9JA 2J87A 2ZJ5A 4URXR 3E9DA 3LRPA 5FBLB 5HCIA 1FMLA 4B6EA 1U9IC 1D2NA 1VG8A 2VL7A 3IIKA 4E22A 4ZI2A 4HZUB 3HYTA 4AYXA 3LBHA 3MXOA 3MGCA 1Z0IA 5LPNA 1IN8A 4W5HA 3ADCA 3IQXA 3VR1A 2RAPA 1OFHA 5GJCA 1NVUQ 3EWSA 4TTQA 1KMHA 4PSKA 4KODA 4FDUA 2CBZA 2H17A 4TYNA 3QXJA 1KDTA 3RVBA 3RS7A 2QQ0A 3KJEA 3HPQA 4MYUA 4BASA 4CT4B 4D0LB 3ADKA 3BFXA 3OAAA 1GKUB 1FPMA 3CLVA 3GLHA 3V00A 4XWKA 2GXUA 3AVTA 1Q20A 5FTNA 4FMBB 5JJLA 1EESA 3LQQA 5D3QA 5L3VA 2AKYA 5CK5A 4R7ZA 5JBQA 1H2EA 1CR0A 2W2XA 2IYUA 4DT1A 4HLCA 1KJZA 3BK7A 2H4ZA 4JLAA 3AEZA 2IYYA 2WWGA 4V0NA 3RDPA 2GA8A 3UWOA 1AS3A 2IEYA 2D2EA 1P2TA 4PHFA 1E94E 4Q4HB 1E2HA 1KZ7B 3IT1A 4O2RA 1N0WA 3I5YA 6Q21A 5SZJA 3PEUA 2WWXA 4RFVA 4P33A 5EUMA 4BLOA 4M1WA 5BWMA 2MSEB 2FSIA 2O8BA 4PAQA 1KY2A 4WBSA 1T5IA 4PGMA 1XF9A 1U99A 1Z0DA 3C41J 2RGAA 3GJ5A 4HAYA 2ZETA 3GLIB 1G16A 4KBFA 5CDFA 1SKBA 2W6IA 3MUFA 2PJRA 2A5GA 3TR0A 2P67A 4Q21A 4BLTA 3E9CA 4OHWA 2FFBA 5JHHB 4L8GA 2QTVB 3GJ7A 2DB3A 4GPIB 4RD2A 4TZ6A 2NO7A 2F6RA 1HT2E 2GDJA 2VIIA 2WZQA 1QBKC 4GPZA 5DNYB 2ZI6A 1E2FA 1E98A 4B43A 1G41A 1IN7A 3KJGA 1Q3HA 3MWYW 4OL0A 3WBKA 1OH6A 3MCAA 2A3RA 2MSCB 5FR1A 1AKEA 1FBTA 4R2HA 2J0UA 3B8HA 2XTNA 1ZU4A 1D6JA 2BMEA 1XJ0A 5K8TA 2GWHA 1M34E 2IK8A 1E9BA 5EE1A 2DHRA 4YMUA 1G3MA 3CNNA 2FZ4A 2NTYC 1ZMXA 1OF1A 2WSSA 1COWA 1KI6A 1JECA 1KI9A 3HU1A 3OAAD 2ZSAA 3MLEA 4ITRC 4Q03A 4Q66C 5JS8A 4V0LA 2HLDD 3AP3A 4PC1A 3LG2A 1G3IA 2IWRA 3T12A 3BC1A 1OFUX 3W9YA 3R8CA 1KSGA 2F1RA 3BXZA 2WWYA 4LHZA 4EJSA 1XQ9A 4PZLA 3L2OB 2GETA 1P6XA 1KZGB 2CXXA 4LBZA 1CKEA 2WMOB 3TVTA 2A7QA 2X8AA 1JPJA 4KXFB 2W0MA 2ZRHA 3AKEA 1IM2A 1XMJA 1ZBDA 4QHTA 2WICA 4KFSA 3SJCA 4EMBA 4CT5A 1C7ZA 4PC6A 1ZP6A 1ZRHA 1AQYA 1F6BA 3I8XA 4R2IA 4KLNA 4GOKA 5C4GB 4ZKDA 1AGRA 1TQ6A 4TL9A 4RD1A 2ZAOA 4FXPA 4QHSA 1JAHA 2ZVQX 3W3AA 1JEDA 2J7PD 4Q02A 4BE7B 4LGMA 4Q47A 1CJUC 2CMKA 1WXQA 3N70A 1G1MA 4JLKA 1PVOA 1HA3A 2CK3D 4Q7LA 1HH4A 2FZLA 4IW3B 1W46A 1COWD 1SKAA 1Z5ZA 3GP3A 1W0JD 2CE7A 1KSHA 4B48A 2C5LA 2HF8A 1NRJB 3THYA 1Z47A 2NO6A 1S4QA 3TUIC 3QI2A 2OWEA 2V6JA 4Q4HA 2EOAA 4HAUA 3QE0A 4FW9A 2QE7A 3Q9LA 1DAGA 5HKKA 2QM8A 1E9RA 1II9A 3GJ0A 5FH9A 4ZIRA 4TMWA 3SFVA 2V8OA 4Z8YA 2GBLA 2A5JA 4F38A 2A2ZA 1RPZA 1G8FA 1M7HA 2GJ8A 2ZRFA 1A1VA 5JCZA 2P9ZA 3SS8A 4D26A 2QE7D 1AM4D 5EP1A 1OHHD 2XB4A 4LV6A 5DIFA 3SJBA 3T1QA 5H8WA 4RZ2A 2V1UA 2WNHA 3KKPA 2CDNA 4B3XA 1Q44A 2FA9A 2R44A 4PZZA 4JVSB 5TARA 3ECCA 4PZAA 1ZU5A 3TQCA 3EIHA 3MBKA 2P9FA 1ZUHA 4BGDA 1ZIOA 1FFHA 2I1QA 4ZDWA 4GT1A 4IDQA 1UJ2A 2WJHA 5FTMA 3O8BA 1XZQA 5SZHB 2IF2A 3FVQA 4D0NA 1GFIA 3L43A 1D2MA 3RSOA 2J7PA 4UJ3A 1SKYB 2P5TB 3MSXA 1NJGA 2I4IA 1W4AA 1TUIA 2QMEA 3AVUA 2WAXA 3TUJC 3WYFA 5DHFA 3SQWA 4HLUC 3TNFA 2ERYA 4A8JB 3RC3A 1W36B 5JMTA 4L9SA 4AKHA 3AVWA 2N46A 4YMSA 3MG9A 1WF3A 4ESVA 2OO7A 4ARUA 4HZIA 1UADA 4LWZA 4NE2A 3CPEA 3GFOA 3GJ4A 4M0LA 2AR7A 1W48A 2VA8A 1E0SA 1QG4A 2IYSA 1DEKA 1KTVA 4IHQA 1QHSA 2B21A 1CF4A 3NWJA 3VR2A 2FN4A 3VTKA 2FJUA 1TEXA 2R2AA 1SVMA 2OESA 2XITA 3FMIA 3NKVA 3P32A 1I4TD 5CLLA 1KIMA 2HV8A 3REGA 4QG7A 4QFMA 1I2DA 5CK4A 1N6OA 2V6IA 1ZNZA 2H57A 3FTQA 4W5JA 1GRQA 5C4MA 1OFTA 2RFLA 1IHUA 1G3UA 2JDID 1X1SA 4S35A 2OSBA 5EP4A 3LAWA 4FCTA 1GDDA 4XWAA 5LBIA 3ASYA 1FUKA 2ZAMA 1EFTA 4A9AA 1VECA 3TQFA 2FPMA 1FTNA 4NYIQ 5EXSA 3B85A 2EU8A 1BOFA 1FUUA 4M53A 4US0R 1ZD9A 4JT4A 5F9HA 3KFXA 1T3HA 4KYIB 1TU4A 4E3WA 1VCNA 3AQ4A 1EWQA 2NO1A 3KL4A 1M1YE 2P2YA 2P3SA 4O25A 4PO9A 2ZS9A 1G21E 1XCGB 1CTQA 1OFIA 3U3KA 4RCZA 2IS6A 1MRSA 3B1WA 5E95A 4A15A 4KFTA 1Z2CA 2GAAA 4K46A 5E7JA 3TW4A 1F2UA 1B23P 1QHGA 4ZCMA 4PC3A 4DT1B 5CDHA 2BCJQ 2OZEA 3A8TA 1XJCA 4B3BA 4DCNA 4B2LA 1CULC 1OIWA 3EA5A 1VIAA 4OHXA 4DDTA 4ZCIA 3RRZA 4B71A 2RCNA 4A36A 2YWHA 3IIJA 3CNLA 1E96A 1N0UA 2ZJYA 1LFDB 1N25A 4V0KA 5TB5A 3T61A 3VU9A 1E0JA 4BLPA 5KPDA 2OCBA 1BQ4A 1DO2A 2QY9A 1ZYUA 3JVVA 2I1VB 2ZRBA 1MABA 4H9GA 2PEZA 1V37A 3GEHA 5EZ6B 2FSGA 3BD9A 4TQUS 3Q7QA 2W6JD 4JL5A 2ZJ8A 3HR8A 4B35A 2REOA 1Z63A 1U0JA 3DZ8A 1P73A 3QENA 4Z51A 4ZPXA 4LK2A 1RRCA 5TVKA 3MFYA 1E58A 3K9GA 5J40A 4EJSC 1VMAA 3UMRA 4BFZA 4OJQA 5AUPB 1RRGA 4B2IA 1N6RA 1C81A 721PA 2H1LA 1KK3A 2YWFA 5FTLA 1CS4C 1OXXK 1SKQA 1SQ5A 1TF5A 3IHLA 3TSWA 4YQFA 3OESA 2VHUA 2ORVA 3X1XA 2WKQA 4AY2A 2C78A 1ZNYA 2FF7A 2Q3FA 1WCV1 1W36D 4LBVA 1RPAA 2ENUA 2LKCA 3CZQA 4YXWA 3HP1A 4PQFA 4B2PA 2F1JA 5CYOA 2F7SA 1TF7A 1CR4A 3PEVA 4D2IA 5DE3A 2FFQA 5FBVB 4PPQA 4AK9A 1Q0UA 1TF2A 5F98A 3KXIA 2C77A 1OV4A 2QN6A 4ZCLA 3KKNA 4IXNA 5J5CA 3U4QB 1WQ1R 5ANRB 5FPHA 1MT0A 1S3SA 3CRVA 4RKFA 4IOMA 5AUNB 2K5UA 5CX4A 1D9ZA 2ZI5A 2ZRGA 2ZJAA 1R8QA 3T35A 1KI6B 2DFLA 5JWRA 5BYJA 1TAGA 1W49A 1XB2A 2BCGY 2AXPA 1GP2A 1ZUIA 2NO9A 1AA9A 1P9RA 2RHMA 2W2VA 2VHJA 4PPGA 4WZ6A 4BRUA 3BGWA 2QBYB 1JJVA 4M1MA 1KSFX 3OEED 1GITA 1JAIA 2GZAA 4IDPA 2HT1A 1ZD8A 3LDAA 2EWWA 1NKTA 2ZJBA 3WHKA 4DKXA 4IVQA 4DB2A 2VPPA 4JLDA 1LVGA 4F4CA 3DM9B 1KO1A 2ZVPX 3VAAA 121PA 4MRRA 3THXA 1RVDA 5TXGA 5BW8A 4JIMA 1FZTA 2RGXA 3SHWA 1E2PA 1HTWA 3B1XA 3VHXA 2DYKA 2P6NA 1XXHB 4M9ZA 3PEYA 3B5JA 5B64A 1BYIA 3RYTC 3FOZA 1PV4A 2YHSA 5K8UA 2BM0A 5P21A 2G83A 3ASZA 1FQJA 3K9HA 2HYIC 1AN0A 2IXGA 1P62B 1BMFA 4GDFA 4U7DA 421PA 2R65A 2IYTA 2ZE5A 2IW3A 4WOPA 4IVPA 3H84A 2C9YA 1FOEB 2GZDA 1NP6A 2LCFA 5GJBA 2G77B 1U8AA 2ECKA 3MAAC 4MRPA 1N6LA 5TMPA 4I1OA 3KQKA 2ZJZA 3CF0A 4A2WA 1H2FA 2IYLD 4C3ZA 1DVRA 1O3YA 2QNRA 4A8JA 1NBMD 1OHHA 2OUKA 1EFHA 1AKYA 2XSZD 5KOYA 2GHIA 3P27A 4RSGA 3EIQA 2UVQA 5C1BA 2HXYA 3A4LA 3H2YA 2GVDC 2ZYVX 1Z2AA 1JPNA 1E9CA 1SHKA 2KE5A 2MMGA 1P2VA 4JOBA 1GRRA 4DDWA 2ONJA 1DS6A 1CJTC 1H8HD 1CJKC 1MO6A 2FH5B 2RGGA 2Z43A 3QXHA 4KU4A 2IUUA 3FKQA 1E79A 4XSHA 3GW8A 1JNYA 5FOUA 1GRNA 1W36C 1WP9A 5DHAA 3R9XA 4CYMA 5F3WB 2ZANA 4ZDIA 4KLZA 3GJ8A 5DI9A 1Z6GA 2BEJA 2BDTA 1JR3A 4NCNA 4C0LA 5CM8B 1YR7A 4A6PA 1S8FA 4RD4A 5SZIA 1ZUNB 1OKKD 2XJ4A 4MGIR 2Y8EA 3GLHB 5E7MA 3ZDQA 4A2QA 1G8HA 2IYQA 4XD7D 4DLVA 2FSFA 2JJ2D 4IVRA 2XZOA 1IN5A 3GCGA 4TMZA 4GP6A 4DEXA 1Z28A 2O0HA 2AX4A 2HJVA 4JVNA 3E9EA 5DYIA 2BC9A 4AROA 2EKBA 2GJKA 4EKDA 1L7VC 2QMHA 3NEYA 4DSOA 3FFBA 4E07A 2GCOB 2WNIA 1E59A 5A4JA 3K09A 1JR3D 3TE6A 1S3GA 5KO2A 2BEKA 2N42A 3U7FB 1C4OA 4M21A 1WE2A 4CVNA 4JJZA 4ARSA 1JQJC 3QEOA 4TL8A 3THOA 1NJFA 3IT3A 1RIFA 3OIUA 1KO8A 4JKYA 4XTRA 5B58C 5FUXA 3FFAA 1XPRA 3KTAB 5H1YA 1OXSC 1NN5A 1T5LA 4FMDF 4MRNA 2QPOA 2J9RA 2GTPA 3ZGXA 2VTKA 1JXOA 3UWKA 2CJWB 2O8CB 1G20E 1H65A 3WXMA 1G7RA 4YXWD 1X8LA 1ND6A 3QOFA 2B92A 3PR1A 2A9KA 4UNSA 4Z8XA 5FBRB 4Q1DA 2VLIA 2JASA 3ZIAD 4J0QA 4V03A 3HWSA 4ZDKA 1P7CA 3NBZC 3U6KA 1TQ2A 3PGMA 3K0CA 2DWQA 3ZYCA 1XPUA 1GZSA 1UBEA 1E1QD 2P5SA 2C96A 1SVWA 1MR3F 1AZTA 2O5VA 2A5DA 1K5GA 2ONKA 1XNJA 4WA7A 4X8LA 2WMNB 5AJVB 2G1JA 1YHNA 4I1UA 3D3QA 4US2R 5JEEA 1OIVA 2EWVA 1ZIPA 4DRZA 1IHPA 4OQMA 4D4KA 1FW6A 1VDZA 2ZEJA 5IDVA 4NYJQ 4JLOA 3EPHA 1P75A 4Q7MB 5KTYA 4DHEA 1I2MA 2ZM5A 2XTMA 2REBA 2Q9AA 4P31A 2YC4C 1E2QA 4AKIA 1NIPA 2D4HA 1OPXA 2AK2A 1WBDA 4OQNA 4QM6A 3UANA 3BERA 3WRXC 1BQ3A 4A92A 3SDZA 4KAXA 4Q7KA 4DBLC 2ZE6A 1JI0A 1GUAA 1VHLA 4A0GA 2ZQ5A 5FTJA 3AVXA 3LBNA 1KO5A 4GZLA 2OXCA 3NG1A 3AKCA 3I92A 1QZXA 1YRBA 2PX0A 2CLDX 1KAOA 3AF3A 4LJ6A 1DAMA 4QRHA 4EDHA 4OI0A 3CRQA 1RJ9A 4IDNA 1AJEA 3EOZA 3P4YA 1Z0AA 4TYPA 4CGZA 1KY3A 4BLSA 3NIBA 1XDBA 2KJQA 4JMPA 1Q21A 1RYFA 4MYHA 4OHVA 3CPHA 1GSIA 2A78A 3AGQA 2RH5A 3SNHA 1F2UB 5C46F 3QXXA 1G19A 3PUVA 3LBIA 3D6TB 2G88A 3ZS9A 1NMYA 1Q1QA 4GZMA 4JL8A 5DN6D 4IOLA 3RWOA 5JI3E 2ODBA 2Q6TA 4JLBA 3CH5A 2CL6X 4NCIA 4R9UC 4DCUA 1RC8A 3FDZA 2AD1A 3FKSD 2HEIA 4GI7A 1U0HC 2P0EA 3IUYA 4G01B 2JDIA 4P4SA 4RFSA 1GAJA 4DDVA 4NYMR 2ZI7A 4JVLA 2ZUCA 3K0AB 4N3NA 4XJXA 4EQ6A 2UKDA 2IT1A 2RGEA 1R5BA 3IO3A 3T1VA 3FHCB 2NG1A 2O8DA 3QUSA 3CBQA 2ZUDA 1AGPA 2YVUA 1N5JA 4P3YA 2O8FB 4MUAA 4TSRA 1NF3A 1H8EA 3AF4A 3I73A 4MUBA 4GRAA 3SJZA 4KSCA 2WJIA 2WJYA 4GP7A 4TMVA 4EPVA 1KK0A 2QAJA 1N5IA 1FMJA 5EXXA 1E6CA 3EW9A 1GOTA 3FMFA 1NY6A 1ZM3A 3RRNA 4JLMA 4YMWA 4LPKA 3QJYA 1MH1A 5CITA 1CR2A 2C98A 1XEXB 1KDPA 1ZCBA 3QQ5A 2B6HA 5FTKA 3TBKA 4F91B 3UMSA 2GEDA 3HU2A 1SHZA 2W83A 4RJLA 2Q3HA 3U3MA 2IUTA 3B6EA 2YKGA 2D7CA 5ELXA 1XXHE 1IY1A 2QEQA 2XTZA 5EE3A 3PXGA 2ZRLA 2QL6A 3EPKA 3UK6A 2JJ2A 3AVVA 1HV8A 5LDDC 1DAIA 1G4UR 5LD2C 3KQUA 1T3SA 1WMSA 2OFOA 2NPFA 3U3OA 2NGRA 3SOPA 3U3JA 5AUOB 2O8DB 1KK1A 3VR3A 3QF4B 4IFEA 1DAFA 1G7SA 1ETUA 2WSMA 5AJXA 5CIQA 1KMHB 2VP5A 3QVUA 3QY0A 4FMDB 1QFXA 3X1DA 3PCRB 5L8VA 3L0PA 3E1SA 4JZKA 1J8MF 4IKEA 3IILA 4L4UA 2CCJA 3R7AA 3TVDA 3A1TA 4LDJA 5LB2A 3SZRA 1CU1A 2EFDB 1CR1A 4DDUA 3KFVA 4CEJB 3D4IA 3HR7A 1XD8A 1E2JA 4BEBA 2JLZA 3OFNA 1ZAKA 4QGHA 2ZREA 4UXHA 3LW8A 2KWIA 2ZROA 3G5UA 1HE8B 1ZM7A 4CEIB 2DFNA 2AN9A 1UAAA 4HUQA 3ZIAA 3LFUA 4KO8A 1ELOA 1VG1A 4C0QC 2IS2A 2R9VA 4DLWA 4M2LA 2GEVA 2JGNA 1J70A 5KSZA 1GM5A 5UKDA 3U3RA 4HI0E 4BLRA 4CF7A 5HZKA 3OIVA 3ETLA 4OQFA 2HCBA 1J99A 4JBWA 2P75A 2BBOA 1DPFA 4H1UA 1Q22A 3I3SR 2VHCA 4HDQB 1NNEA 3GEEA 4C4PA 2G6BA 2H7VA 3K4PA 2JAQA 1XEWX 4M9QA 2F3RA 1W47A 5EE0A 3A1UA 1A82A 4NL4H 2QGNA 4LYFA 4P4TA 2VF8A 3KZ1E 5FPTA 1YR6A 4A0RA 3NEJA 3QG1A 2QSZA 2XX3A 5HCNA 4B3CA 2CHVA 4DVGA 5CB8A 2HCJB 2J0QA 1R0YA 2O0JA 5AJYA 3CRW1 4RVCA 1UKEA 2RHDA 3P1JA 2X19A 1XEXA 4JS0A 4FD2A 2QGZA 2NO0A 3ZZTA 3LO5A 2BOVA 3CX6A 3EARA 4NYJR 2GILA 1A7JA 3EX7C 1YZNA 2OV2A 2FOLA 5FPKA 4XOIA 1UBGA 3M4YA 5CB6A 3CB4A 1QRAA 4KI0A 1KMQA 5FI0B 1KO7A 3KQLA 4FCVA 1KYIA 1PUJA 2IF0A 4A8JC 3DCYA 5DI3A 3UKDA 2ZIAA 4OBEA 5JLJA 2W2TA 4IDOA 2PZFA 2WIAA 5A0FA 1SK8A 4DLXA 4LI0A 4HAZA 4Q19A 1M6NA 3DHWC 2FEOA 4UQOA 2C9OA 4XSGA 5J4YA 3KXKA 1E0KA 2G9NA 4YLGA 3JVUA 4Q4LA 3RNLA 1W44A 2VSOA 4I1SA 4QNMA 4OHZA 1LV7A 3CPJB 2H92A 1BS1A 2QP3A 4OK3A 1TUEA 2C8VA 2PL3A 3GMTA 1YZKA 3RC8A 2F3TA 1EX7A 5TV2A 3B2EA 2QT0A 1II8A 1W5TA 1P2UA 1N6HA 1KI7A 3FDZB 1LS6A 4RD6A 2IWHA 4S2EA 5IHPA 1T8TA 2GEUA 4BEJA 5JRZA 3ZS8A 1NG9A 4O2LA 3W8RA 4EPRA 1E2EA 4A6XA 2NIPA 3DMDA 1Q1ZA 1YZTA 3QPWA 4LHVA 3THXB 4D25A 2OAP1 3GLGA 1YQTA 1QHXA 3ZZ0A 2EVWX 2I3BA 1K6MA 3W6OA 5KU1A 1E2KA 2GK6A 3R20A 2BBSA 2YJTD 1KKMA 3FGNA 3M0EA 2BMFA 3Q5DA 4M9SA 2GCPA 3K70B 4R98A 1BKDR 4NYMQ 3U2QA 4FMCF 1DKQA 1NBME 2X77A 3SJAA 2PT5A 1OT3A 1YVDA 3DEFA 4B33A 3GP8A 2F1HA 4ILEA 2ZYUX 4FWTA 3D6AA 5BYKA 1Z0JA 3QKUA 2H0QA 4LC0A 1V7QA 1J7KA 1UKYA 3GQBA 3Q8XB 5GADl 1ANKA 1SVLA 1FP6A 3OE7D 4RY2A 3X1YA 3T5GA 3EZ6A 3VNVA 4MGYR 4GNKA 2ZS7A 4PXAA 2A5YB 2CK3A 1YR9A 4URWR 3AVYA 3A4NA 1YE8A 4TQAA 2ZS8A 2QORA 1E69A 2ZJ2A 2JLUA 2WOJA 4M22A 4PX9A 5D3MB 3P20A 2QRNA 4P4UA 3OF5A 3F5FA 4JLPA 2P6RA 3H0KA 5IK2D 2YOGA 2J41A 1QG2A 1F5NA 3RABA 1ZD1A 3REFA 4DLZA 1DAHA 4WZBE 4AIIA 1BYUA 1CP2A 1IAQA 2ENWA 1MO3A 1DARA 3VKHA 1SVKA 4A0FA 4B3DA 1EXMA 2NQ2C 1NN3A 4D80A 2FFHA 3D8HA 3LXRA 5KNBA 1EX6A 3WY9A 3NBYC 2XB2A 2VSXA 4FINA 1PLLA 1SZPA 1CXZA 2FGJA 4NPHA 5EUQB 3WRYC 3ND9A 3K0CC 1BIFA 2F55A 1NLYA 2CCGA 3BAFA 2ATXA 2JLSA 4C0HA 2JIZA 2BJWA 4NH0A 5FOWA 2GF9A 1W7AA 1NSTA 2OBLA 5DO9A 1E4VA 3ICEA 5G53C 1L4YA 5TY0A 2E9SA 1D9XA 1P3JA 4FI3C 3K9LA 3Q7PA 4DSNA 1QHIA 3WYGA 2WV9A 1Z6TA 4LJ4A 2GESA 4N0DA 4BLQA 2FE4A 1LW7A 2VQSA 2J46A 4LUCA 1HYQA 2PCLA 4BFUA 4POAA 3Q85A 3ICQB 2Z4SA 4D4MA 1VYUA 2ZR9A 4F4IA 3W5JA 1B0UA 1X86B 1E3MA 3I5XA 1Q57A 2ZU6A 1IXZA 1DAEA 2NZ8A 4G5SA 4Q9LA 3NDPA 1W0JA 1XCMA 2CL7X 3WMEA 1L2TA 2O8FA 3HJGA 3I1FA 1ESNA 3T34A 4NDZA 1HE1C 1QWOA 4C0SA 4UKDA 3NH6A 5G40A 3C7KA 1RIIA 4DXAA 1DKLA 2EYUA 1FTSA 1EFUA 3C8UA 3GLGB 4CDGA 3RS3A 2PX3A 2ZRDA 5CM9C 3QSYA 3FHOA 3TH5A 1R10A 1E1QA 1N3BA 4WVFA 1GIAA 4I4LA 2Q9CA 2G3YA 4JYBA 2FSHA 5FBQB 3TIFA 4AI6A 1UF9A 2WBLC 3K1JA 4WIAA 2FDCA 1X1RA 1SVOA 1XMIA 5G3YA 2QAGB 3ZLJA 5HE9A 4LX0A 2CL0X 5B2ZA 5JECA 3IDQA 5E7IA 1Z3IX 4BZQA 5DSZA 4FDTA 5HE8A 4PC7A 3A37A 4EUNA 2WWWA 1EWRA 4WW0A 3EC2A 5AR1A 1HQCA 5EE5B 3TSZA 1RJ9B 1YKSA 3N2IA 2JLWA 5HPYB 3R7WA 2OCAA 5HKKD 1NSFA 3GLFE 1IBRA 5L3RA 1DELA 3QPVA 4HDOB 4DWJA 5HTKA 3VR6A 2NZJA 3AVQA 3HYRA 3EZNA 2HF9A 4A2PA 1US8A 4ASUD 4HEJA 1ZW6A 1U9IA 3W3ZB 4OYHA 4JOCA 1P5ZB 4C2UA 1J8YF 3MRSA 1QHNA 4LJYA 4AG5A 1EFCA 2BV3A 2KSQA 4NTZA 5D3MA 3KQNA 2ZR0A 2GJAA 4HZUA 1W2HA 3I32A 1KO4A 2QROA 2R8RA 3UIEA 3B1VA 3GJ6A 1KK2A 4G5QA 4PSAA 2G1KA 4DB4A 5KHOC 4B3FX 3L0IB 5FOSA 5FOXA 1OKKA 4NHOA 1VCMA 2PZGA 1QHHA 4NBSA 2ZRAA 4QC2A 3VKGA 1JQLB 4C0JA 1KDRA 2BBWA 3VX3A 1W4RA 1F60A 1XTIA 1BH2A 2RGCA 2W6ID 4TZ0A 1AS2A 1SXJD 2W58A 4JSTA 2VYFA 5DLQC 2FX3A 1H8HA 3HJNA 3VKWA 4PAOA 1W4BA 3GPLA 3EIEA 2OBNA 4PSVA 5GVSA 2OFWA 1FQKA 2H52A 5C18A 3JZAA 4M1TA 2HT6A 1IQPA 3B9PA 5A5GA 2UZIR 1DG3A 3N2EA 3AB3A 1HURA 4LPSA 4U02A 3KKKA 4GSYA 3CM0A 1CBUA 1J2JA 2HJGA 3PJRA 4LYHA 4IDHA 1Z6XA 5DGXA 5JI2E 1XP8A 1X3SA 1N6NA 2V7QD 2O52A 4EQ6B 4URVR 5JCPA 1YRAA 4OHYA 2QNIA 1FNNA 1TX4B 1DOAA 2VEDA 2GXAA 2B8TA 2ERXA 1DADA 2H8KA 4LV5B 3SE0A 4QJ5A 1G5RA 1VTKA 1G7TA 1Z6YA 2QUZA 4NU0A 1K8RA 2V1XA 2HPAA 1LS1A 1F2TA 1NVWQ 3ZQJA 4DLTA 4TSFD 3TR5A 2AK3A 5DISB 4UNRA 4Y0VA 3H4MA 1Q3TA 2FPKA 4DLYA 1SXJB 5J4HA 2JIZD 4QBHA 1GWNA 2QT1A 3PUWA 2NPIA 4WAUA 3U5ZB 1KI3A 1RKBA 2CNWD 4RCYA 3IHWA 4KHZA 4PPFA 3NVAA 5EXPA 2ODNA 4HAXA 3ZHCA 2D06A 1FX0A 4PO1A 4QM7A 3AP1A 3SYKA 3QEJA 3CZPA 4B44A 4X8MA 3TKLA 5FPYA 5L3QB 3C15C 5KYKA 2XEXA 2SHKA 1S9HA 1MO4A 2PLRA 4D6PA 1E2LA 2PLFA 1NLZA 4KV9A 2A6PA 2DCUA 4RD3A 2RGNA 2JATA 4B3GA 3QKRB 1NVVR 3ZVRA 1IN6A 3CIOA 2ZYWX 4ABYA 5B57C 4YONB 5BN4A 2GCOA 2YOHA 5LB4A 3NTUA 2E1RA 1H8ED 4EPWA 3BWDD 4Q1EA 3AKDA 5EE9A 1QDEA 5KSPA 4Q01A 2XJ9A 3NHAA 4C7OB 1P2SA 2XZPA 1N5KA 1G5PA 1U98A 4HB4A 2F90A 1FNMA 3TJZA 3I4LA 1IXSB 2Q21A 1Z08A 1ONBA 3TAHA 3ZD7A 5KNCA 2G0NA 2F9MA 1ZJ6A 3CONA 5CIWA 4Q00A 2D7DA 2IXFA 2R6DA 4ZIRB 2PMDA 2EQBA 1U2RA 2HLDA 4JSYA 4CIDA 2ZI9A 1CJVC 5EP2A 2QRZA 2C95A 3CRRA 3VR4A 4TLBA 1N5LA 4PQRA 3U44A 2IXEA 2OG2A 4NONA 3ZH9B 621PA 4UNNA 3PUZA 2P78A 4B73A 3V4FA 3CNOA 4R71A 4PAMA 3PV0A 2GVZC 1JB1A 4G5RA 3I8SA 2IL1A 3HU3A 2QPAA 1VG0B 2YNMA 2VP2A 1TQDA 3EZ2A 4QJ4A 1M7BA 2MSDB 3BBPA 2UZ3A 2BKUA 1OYWA 2ZUBA 2WTUA 1DO0A 4IOKA 3WP0A 3DOEA 3EWAA 2AKAB 3SBEA 1XMSA 1KI2A 2H5EA 2DR3A 2JJ1A 3MJHA 3KQHA 1VIYA 1PJRA 4WXRA 4B47A 1RZ3A 4KITB 4TYYA 2J3EA 4DLRA 1N0VC 2QPTA 3LD9A 3PUXA 4LJ9A 3CRMA 2DWOA 2QM7A 3A36A 1YFKA 4IJ6A 1Y3AA 2HIAA 1NVVQ 2PJZA 1VPLA 2D62A 1S9DA 2QP9X 2HYDA 3EC1A 3PG5A 1IJFA 1TADA 2OLJA 1QF9A 4DSUA 4E03A 3WNBA 2XOKD 5FBWB 3WBJA 2ZXUA 5L3SA 2XGJA 3OIYA 3IGFA 2ORWA 1P4SA 2OCYC 3H86A 4US1R 5AUQA 5FL3A 3T15A 1ZC4A 3AF0A 1R0XA 4DUGD 3OI7A 5JJKA 1T0JB 4MDFA 3F3KA 3CX8A 1KGDA 4QBFA 1OXVA 4GMDA 3U61B 4UJ5A 4G1UC 4Q5IA 1Z0KA 4A1FA 1LNZA 3I72A 2VF7A 1SXJC 3GLGE 3NDBB 4NZYA 1T9HA 2ZTSA 1G8GA 4QHYA 1ZCAA 3DKPA 3LY5A 3V9PA 1XD2B 2CEAA 3RANA 5JSZA 4HDCA 3GJ3A 1M74A 3PITA 2J7KA 2FU5C 2WM9B 4F92B 1Z22A 4MH0R 3O8DA 4QBGB 3PUYA 2IUSA 8OHMA 4C7OA 2OLKA 3AVPA 5CLQA 4ZKEA 3AUXA 1N2CE 4HUTA 1IN4A 2GF0A 4Y0AA 5C2JB 1XBTA 1OLOA 2AFHE 3RS4A 4TSFA 5KSOA 2PEYA 3C16C 3IIMA 3L0SA 5FPSA 2Q9BA 2PT7A 5L3SB 2DPXA 4BQSA 1PZNA 4TL6A 4EO9A 1T3LA 4LYJA 1S1CA 4BZPA 3MWLA 1L4UA 4Q1FA 3KKMA 1NKSA 3TW8B 3GLFA 4D4LA 4OI4A 2O8EB 5FOTA 1I4DD 3BORA 4ESHA 1HEIA 3QIAA 4UXIA 3FHTA 1OIXA 1EBBA 1KNQA 4NYIR 3QKTA 4KSBA 2Z6VA 5B30A 1E1RD 1DAKA 1RRPA 2J1LA 2PMKA 3OZXA 2PA0A 4HB3A 3DMNA 4KYUA 4BUJA 1UM8A 2ZR7A 4L5BA 4LYAA 2RMKA 3LV8A 4QGGA 3T5DA 4PHHA 4KBGA 5KNDA 4XD7A 2IC5A 1U8YA 1E9AA 1ZNXA 1GKYA 1Z0FA 2IYRA 2VO1A 5JSZB 3PIRA 1QVRA 4IEEA 1O87A 2WPDD 4Q9HA 3S1AB 5CU7A 2EKZA 2ZSEA 4CRWB 1VHTA 3A1VA 3UPUA 3UATA 2V55B 2O8CA 1YR8A 3WHLA 3W90A 1RYHA 3BE4A 4RKEA 4P4SB 2GJSA 1Z06A 3A1SA 3PEWA 1GKIA 4DLUA 221PA 4ODIA 3FDIA 3LLUA 3SN6A 5GJVC 1Q12A 4AC9A 2HXSA 2Q0HA 3GD7A 4NCHA 5F2EA 1KHTA 1Q1EA 2FV8A 5EP3A 4OKSA 3QNUA 3GJXC 2C03A 2ZRKA 4A82A 1EFRD 2QA5A 4L15A 3KKOA 2F43A 3EPJA 4TT3D 2WWFA 3OEHD 1XTRA 4MKGA 4ZO4A 4OJKA 1ZINA 2KBEA 1R4AA 1E1RA 3GEIA 4LJ5A 1LTQA 4JLJA 2XZLA 4FMCB 5JHGB 1KSJA 3X2SA 2J5XA 1M8PA 2FGKA 4E5UA 1Z6AA 2P65A 2XNSA 3CR7A 5GVRA 2RGBA 5EQTA 821PA 4HBZA 4B34A 4Q9IA 3W34A 1TQ4A 4LJ8A 2D3WA 5H68A 3QF7A 1JALA 4HB2A 1E9FA 3TMKA 1N6IA 1YJ5A 2YV5A 3L0OA 2WJVA 1YZUA 5CJPA 1BMFD 5FOVA 1DTSA 3PVSA 3WMGA 1MOZA 4DLSA 1DKOA 1G8PA 2FMXA 4BFTA 2P9YA 4JT2A 4M1SA 4YC7A 4U5XA 5KUTA 3DPUA 2XXAA 1SXJA 2WJGA 2CHQA 1SXJE 5BXQC 4M1YA 3GFTA 2CLCX 1XTJA 3MMPA 3EASA 2JCSA 3EPLA 1P9WA 2BMJA 2DWPA 4B76A 5E3HA 4DC9A 1QHYA 1S0UA 3CF2A 1XXHA 3KJIA 4TLEA 2EW1A 4B32A 3IKJA 4AYWA 5HR5A 5HZHA 1X8JA 1U94A 3MWKA 1R2QA 1XZPA 1SVSA 2RB4A 2QQEA 3R9IA 4O3MA 3I61A 5KDDA 1WDTA 4MA4A 2IKQA 2P6MA 1ZVQA 3R7WB 2OM2A 3U7HB 4W5WA 3K09C 3QKSA 3GFPA 1OE0A 4KJZA 4AG6A 2WU0A 2DY1A 4PR0A 4LJ7A 1UEIA 3SYNA 1RE0A 4Q9KA 3SYLA 3MWJA 1XTQA 2ZSFA 3B1ZA 3NC0C 4Q48A 4EFLA 1S96A 3L82B 3TGPA 3UG6A 1SGWA 1G5TA 4LJAA 2V3CC 1YJXA 1OB2A 4CEJA 2LKDA 1KAGA 1CVIA 1D8TA 4DCSA 1WBBA 1UJBA 2HHJA 2ZRIA 1E79D 4PPNA 4UNQA 4JLNA 4M9XA 2FG5A 4P0TA 3K0AA 1T4GA 2IHYA 1ZM4A 5FUVA 4DCVA 3C5CA 1HT1E 3CWQA 4LHWA 3C5HA 2OE2A 1R8SA 3NC1C 3QKRA 4LBWA 2J0SA 4HUQB 1GNRA 3F8TA 4HAVA 2TMKA 4ARVA 1W5SA 3HDTA 1GILA 2WAYA 1DG1G 1KI8A 2OEPA 2OILA 3BJIC 1KJYA 1VKJA 2YWGA 4MGZR 2DFTA 1GNQA 2QP4A 4Q1AA 1SK9A 3QBTA 5G41A 2Z5FA 3NHBA 2QENA 3LWNA 2B7CA 4I99A 5FUWA 5IF9A 2BWJA 3B1YA 1SVIA 1XPOA 2CLSA 1E9EA 1ODFA 1OXTA 3BFVA 3WMFA 3CKLA 2GCNA 3ONWA 1PLJA 5JEDA 1MRNA 4LRWA 2F43B 2IYZA 4CZ2A 2V9PA 4MYTA 4QGFA 4LC1A 4YDSA 3L8ZA 4DCTA 4OI2A 2Z4RA 2ANCA 3BH0A 1K5DA 3FWYA 3X1ZA 3E70C 4CEHB 4URZR 2FPLA 3VU9B 4W9MC 4LOAA 1US8B 4C30A 4NMMA 2QMUA 3BB1A 2IYVA 1G291 1R5OA 2C9CA 4QKQA 3OHMA 2ASEA 4RZXA 3RS2A 4OK5A 1U0LA 5FI1B 1P9NA 1R0ZA 4W7SA 3THYB 1OH7A 4DSTA 2CCKA 1UPTA 3C14C 4LZZA 2EFGA 3TAUA 2WJJA 3B60A 2R6FA 3RSLA 4AWXA 4BFVA 4ZDJA 1SULA 4KVGA 1C80A 3Q72A 1MKYA 4EFMA 3IT2A 2ZE8A 4DEYA 3ZQ6A 3G82C 4IXMA 4HLQB 1SKYE 1G6HA 3QPUA 3N5CA 1UKZA 4KFUA 3DVLA 3A58B 4EPTA 2IS4A 2VSFA 2XNDD 3KUCA 2LWIA 2QMOA 3K0FA 1IONA 5G3ZA 2PCJA 4CW7A 3IBGA 3WNCA 4YMVA 2P2LA 5EZ5A 2WWIA 5BQ5A 3VNUA 3BRWD 1P60A 3X1WA 4EPYA 1KI1A 3J81k 4RFSB 4V0ME 5K8IA 2ORIA 1LF5A 4F93B 4FCWA 4N1AA 4M1OA 1Z83A 3DM5A 5L3QA 4QGAA 2NMVA 2CHGA 2NOAA 5DN6A 1M2OB 5DH9A 4XIGS 5H70A 1VG9B 4PTLA 4TYWA 1NL3A 2FEMA 2R6AA 1E32A 3FMPB 4OQXA 3DOFA 4GFDA 4AYTA 1TNDA 3FYHA 4MRVA 3QVVA 4HYYA 5AK0A 2WVJA 3SQXA 5IK2A 3K70C 1II0A 2PH1A 1LF0A 4EPXA 2C99A 1IY2A 4LY6A 2L0XA 1F2TB 1PUIA 1A5TA 1WRBA 3OEHA 1P61B 1YZGA 4JBXA 1A4RA 1NIJA 1W0KD 2D2FA 2D74A 4QL3A 4YDHB 3UXMA 1XTKA 1FZQA 3QF4A 1IXRC 4Q1CA 1T8PA 1NVXQ 3IQWA 2P2ZA 4JLVA 3E5HA 3CR8A 3OE7A 2A30A 1R0WA 3CW2A 1GTVA 3IO5A 3O8CA 3IEVA 5JFGA 3CX7A 1IOZA 3FE2A 2AWNA 4BRWA 4JODA 3IPYA 3VHLB 4PO8A 3U7GA 1JJ7A 4BPBA 4JBYA 3B82A 1E2NA 4Q4JB 2P6UA 4P32A 1XCPA 3AF1A 2ODEA 1D5CA 3EZ9A 4L9WA 3TRFA 1FX0B 2KI5A 2IX3A 3RS5A 4DIDA 4DZZA 2RGNC 5AWFC 1S1MA 1MV5A 5LD2B 4I81A 1DKNA 4IJ5A 3K0SA 1D2EA 2WIBA 3D7MA 2YYZA 1W4CA 3U60B 1G7CA 3U4QA 2H4XA 2V4ZA 3R8FA 4IOJA 3DDCA 2GZHA 4GOJA 3VMFA 1E0AA 2AXNA 4K81B 2C2HA 1U8ZA 4GMXA 2IS1A 1XEFA 1YU9A 1AIPA 5DI3B 4TMXA 4IFBA 1QHFA 1NN0A 3K4QA 1E4YA 2X2FA 4TLAA 3ZZUA 2BKEA 3SEAA 4ACBA 1CLUA 4E09A 4ZI3A 3EA0A 4ARZB 5E4FA 4A0HA 1T0HB 5J4KA 2WHXA 2ZE7A 3ZVLA 1TIPA 3ZVNA 4XH9B 4XWOA 3EZFA 2XAUA 3DB1A 2ZJOA 1LY1A 3GLIA 2P79A 2XNDA 1HY3A 1OJLA 3AGPA 4M4SA 1BO6A 2JEOA 4TMKA 2ZRPA 4EAQA 4BFSA 4ERNA 5CYPA 3EXAA 3U44B 2BVNA 2IYWA 3OIWA 3FMOB 4BFXA 3RS0A 3K9NA 4QXAA 4Q18A 2P77A 4II7A 4LHXA 2QTFA 1E2MA 3QBVA 2ZSDA 4FIDA 4RZ3A 4Q9JA 3VR5A 1RFLA 3A1WA 2CJWA 2GXQA 4TQ9A 2YWEA 4BWYA 1NLFA 2DFKB 4KVAA 3F0TA 2XXAB 1F3OA 2Z83A 1XD2A 1XJQA 2AD5A 2PZEA 2BIFA 4LBYA 1GVNB 1G17A 4I1VA 1WA5A 2KB0A 3D8BA 1KJWA 4QIHA 3LX5A 4XVRA 2RKOA 1ZM9A 1UKVY 1HQYE 4D0GA 3LLMA 2DBYA 2BHRA 3M6AA 5CJ2A 4DUGA 1G9XA 2R6GA 1AQUA 4TN1A 1KKLA 4PZYA 3KTAA 4DJTA 1TEVA 4U00A 1E99A 5JJIA 2VP6A 2WPDA 1RW4A 1GG2A 2HDNB 2VHQA 3KB2A 3KKQA 5FR2A 5GJWC 4TLCA 1YZQA 4X8OA 3RHFA 3SU8A 2PBRA 1E9SA 1QHHB 2OCPA 4IJMA 4RD0A 4ON9A 2CVHA 4MQBA 1DKPA 3AUYA 3SFZA 4PANA 1Y63A 3K0EA 1CJMA 2OFXA 1R6BX 3EZ7A 2OAQ1 1NMZA 4NKRA 2GKSA 2IEZA 1W2GA 2OT3B 1XMVA 1FP7A 1UDWA 4UXJA 4NCKA 4QBIA 2P6OA 1NBMA 3TK1A 3F2IA 2AWOA 1EK0A 3E2IA 3ZD6A 5JRJA 1ND5A 2W6JA 3B13B 4C0BA 4Q4JA 1C9KA 4AKEA 4TT3A 1N6PA 5FUYA 3LNTA 3OFND 3L8YA 1EFRA 3CH4B 1UBCA 3KB1A 3WYAA 4MKFA 2ZPTX 3ZVMA 3BIFA 3S1AA 2GNOA 1JBKA 4O0MA 4HATA 3KJHA 4JYCA 4TYQA 5IRCD 4QNRA 1UDXA 3K70D 2VHTA 5FFMA 5PGMA 4NCJA 4MDEA 3EG5A 1G3QA 3LH5A 1AK2A 2FWRA 1W0KA 1KI4A 2GXSA 2X1VA 3GLFB 2O8EA 2VP0A 1ZC3A 3QG5A 5JS7A 1M7GA 5TDHA 1UBFA 2JLRA 3NBXX 1TPZA 3PFIA 5KDLA 2IA5A 2AHOA 1E2IA 2VP4A 3W6PA 4LV8B 1RRFA 1FL9A 4X8HA 5J47A 5BN3A 3T1OA 2JLYA 2BMDA 3FKSA 1I4LD 2QU8A 4HAWA 5F9FA 3LL4A 2B8WA 4D82A 1TL7C 2B7BA 3KXLA 3O47A 1T6NA 3TUZC 3U6BA 3ZJYA 3BFKA 2FFAA 4CEIA 1S2MA 4M8NE 1Z8FA 4OI1A 3GLHE 3CO5A 3BOSA 1NN1A 1OYYA 1X8KA 4FWIB 2W00A 1V5WA 3RRMA 1OSNA 3R9WA 1DBSA 4DIEA 1IY0A 2BM1A 3Q3JB 1G18A 2W0SA 4URYR 5EXTA 3RAPR 4JJKA 4GPTA 3FJYA 4TLDA 3QXCA 3Q5EA 4PFSA 4TMTA 2GJ9A 1XRJA 4G5OA 2R6CA 1OW3B 2G0TA 2VBCA 3A6PC 1HUQA 3SBDA 2X2EA 3AKYA 2BJVA 1VYTA 3BS4A 1GL6A 1G6OA 2WSSD 2QAGC 3M1IA 4TL7A 4TTRA 4F7WA 4YMTA 5EJEA 5J4LA 3SHFA 4PZ9A 1VCOA 1G4AE 2J0UB 3EAQA 3W6NA 4C2TA 2ZRMA 1Q1BA 2JLVA 2V54A 2YINC 3LW7A 4Q4AB 5SZKB 3U7EB 5IT5A 3GLIE 2JJ1D 2AL7A 2HUPA 2P30A 2QSYA 4RZUA 2VH5R 4AURA 4MKHA 2JA1A 3P26A 2ZRNA 1NT4A 3VFDA 2KBFA 3AF2A 3H1TA 3C7TA 2J0VA 4JL6A 3KX2A 4XVQA 1TMKA 2MMCA 1JR3E 4BECA 3KDSE 4MYCA 4GBMA 2C04A 4LCBA 2YZ2A 5FL7D 3SC3A 4ZV4A 5JWOA 2QI9C 3BH6A 4B74A 1EG7A 4QJ3A 4G5GA 2WOOA 4A4DA 1KNXA 4EJSB 3DL0A 3RWMB 2GBLC 3MD0A 3P4XA 4C9BA 1GNPA 2XSZA 3LA6A 3LVRE 1DKMA 2QTHA 3LQRA 3CUEF 4OK6A 4G3XA 1CRPA 2QZ4A 4PHGA 1G8YA 2VRWA 1IJEA 1E9DA 3I62A 2WWHA 4MGKR 5KDOA 4K8OA 2IBMA 2ZU0C 2QAGA 4XVUA 2ANBA 3TSOA 3C4JA 5KPJA 2JLXA 1PLKA 2A5FA 1NG1A 2OBMA 3F3YA 4V0OA 4G0NA 1RPTA 2ATVA 2O8BB 4GL2A 3THWB 1ZNWA 4XTCS 2RGDA 2ZITA 4Q4AA 3VQTA 3QKSB 1UFQA 1UJCA 2YN2A 4HB0A 1U81A 521PA 1V43A 3GP5A 5AJWA 5KSYA 4AD8A 1UEJA 3B7GA 1OB5A 3IBYA 2GFIA 1NY5A 3BB4A 2F9LA 1MABB 3K8YA 3ADDA 2QG6A 4NP6A 3NBFA 5K8LA 3LXXA 4IEIA 4D81A 3K53A 4CEHA 1J90A 2IYXA 1KDOA 2ZYTX 4Q7JB 2EFCB 5BN5A 1JXMA 1U90A 2EFEB 2ODWA 1G3RA 4F4JA
chains in the Genus database with same CATH superfamily
1WMAA 2YRXA 4TTPA 3EXEB 3R9KA 5CEEA 2P9QA 3E58A 4M1KA 4BFWA 4KDEA 2H2IA 2NUBA 3D3WA 1XEWY 1V2GA 4Z99A 1LZKA 5CDFE 2Y1DA 1Q95A 2Q3MA 3L4BC 3OEEA 4FFBA 5A4KA 3WP1B 2R62A 1GHTA 3BZBA 2JD1A 3HO8A 4JGIA 2BYTA 1PJTA 2DF8A 2P7HA 3GT4A 4PVDA 2WIGA 4RVDA 3WOVA 4BIMA 3IL2A 4HLDA 2J59A 1USKA 5DYWA 3SI7A 3DYIA 4FR2A 3A9WA 4ETIA 4H1VA 2B6NA 1MO5A 1T8UA 1JSLA 2HCTA 3L8DA 1FFXB 3OOSA 2AZTA 4O4JA 1E2GA 3T06B 3W2GA 4ERXA 2QN2A 3PX2A 3CUKA 2Z0MA 4HQRA 4Q9AA 1JDPA 2E5LB 5FNVF 3IR5A 4JXXA 1XSEA 3NUQA 3N2ZB 1XD9A 2OR3A 1ESMA 4U7TB 4CN8A 3HPRA 2E87A 4KIUA 4S12A 5CUQA 4IRUB 4W5QA 3NBUA 1WZIA 3AW8A 2XGMA 3G6WA 3F46A 3GDHA 4KWEA 4BJ3A 3A4MA 1UBHS 2P8SA 1HSZA 5JU6A 3H3XA 1PT9A 3V80A 3I2HA 3LCRA 4Z1MD 1B2RA 5ICMA 1JDTA 2LCIA 1NVKA 1M2OA 3AFIA 1ZH2A 2KQUA 4L74A 4MAAA 3QMMA 4O4LA 4OL9A 4OP3A 1SKMA 1Z25A 4JKIA 2ADOA 4DF3A 5KU7A 5JXIA 1SXPA 3I2IA 2PVCA 4D1YA 1XFAA 1NI3A 1AB5A 1V41E 3KPVA 1VCIA 1E3JA 1TAQA 4UNPA 5LQRA 1AHIA 2H07A 2UXCB 3TOCA 1ZWKA 2C57A 4WLOA 2N3ZA 4N4AA 2ZUTA 1M72A 1CJCA 3H87A 3ROTA 4TWZA 4WJLA 3L4SO 4OQLA 1I6WA 3ZWBA 1W0CA 1RHUA 3PNBA 4WZAE 4NZNA 1DE0A 4Y2XA 4U7FA 3ZK8A 3RFFA 3WWYA 2R00A 2B4TO 3DZDA 2REXB 1A2KC 2H18A 4M9UA 4MB2A 3ETDA 4EIWA 1UWLA 4MK4A 1C3XA 1G63A 1OAKA 2EYQA 4MITA 4QQRA 2M6LA 3C3PA 4PIPA 2GRJA 3HGMA 1IY9A 3B78A 4BCBA 3KUDA 5AT1A 2FLWA 4IH1A 4WT7A 3DE2X 4ECEA 3GNLA 3IRVA 1AS0A 4FTWA 1NDQA 4U2EA 1GQOA 5ED0A 4BNDA 4CKWA 2Q1UA 1FJXA 8MHTA 1L8QA 4K86A 2H4FA 1I5EA 4IJVA 4MMYB 1ISGA 2AN4A 2IUYA 2DFPA 3QUBA 1V1RB 4PPYA 3L4EA 4QEDA 1FSPA 5TQ0A 1C1YA 1MAVA 5DNUA 4QT4A 2QHXA 2Y77A 4UUPA 1TTTA 3FPAA 5DGCA 1A5AB 5LYJA 5FFFA 2B3TA 1VQ1A 5COQA 1ZQ9A 1ZSYA 2DC1A 2QRQA 1FSSA 4OQQA 2QMZA 5AJZA 1YBHA 4AWBA 5BYAA 4OGKA 3WNDA 4D9BA 4INJA 1UMBA 4AVYA 2A9JA 1QZZA 1Z4JA 1AB6A 1W5AA 4Y18A 4N3BA 1JE1A 2VC2B 1GRVA 3UJ7A 1FMLA 3L7YA 1D2NA 4QPNA 4UHJA 1PWHA 2DLNA 4F71A 4R16A 3LBFA 1KYQA 3NT2A 4PSDA 1RNLA 2K2QB 2OPBA 1XJ5A 1Z0IA 3AHIA 4FVTA 3LC1O 4LEIA 3HXLA 1QKJA 5HF6A 5LA6A 4DUYB 3ZU2A 2JEZA 1QGUB 2ZLBA 1LW6E 2O2GA 3GN2A 3IQXA 4GSKA 3VR1A 4EJ0A 5KYXA 2ALJA 2EEZA 1Z56C 1NVUQ 2AFVA 1VDMA 1DC7A 2JJQA 1C14A 2LNDA 4NSNA 1LJ8A 2G9RA 3WC4A 1ZR4A 2O8VA 1KMIY 4PSKA 4QNNA 1TVEA 5I9NA 2I99A 4YRZA 2H17A 1DXHA 1Y8QB 5T41A 4TYNA 1KDTA 2Z04A 4WJKB 3RVBA 4UCQA 2WIFA 4CT4B 4CG1A 1K92A 4ZVQA 1J8FA 3TPFA 2X15A 4MW1A 4FKBA 2DPYA 3ME5A 2H9YA 1V6CA 2WV7A 4Y2YA 4J4TA 5FTNA 3NQ41 2Y3IA 1DAPA 2YXBA 4R8RA 1T4CB 4UUOA 2J3HA 1T5BA 3OZAA 2W2XA 2IYUA 4Z5XA 4DT1A 2QTTA 4Z86A 3M9WA 3I23A 3IULA 1ZUNA 4V0NA 5JDCC 3DZBA 1DO8A 3GIWA 3WR5A 1AS3A 2IEYA 2BGKA 1JXAA 4DA6A 3AHGA 2FQXA 1OBOA 1JQAA 3WIVA 3IP6A 5DCYA 4OG2A 3WB9A 1PP4A 1AC5A 1IOWA 2EAUA 2VJAA 4LY9A 4J2TA 3FWKA 5CT6A 2Y1CA 4ZQHA 3PEUA 3TLGB 3TXXA 1J8DA 5JW6A 5EUMA 4BLOA 3I6BA 4C6TB 5K2OA 3DG9A 3PYXA 3VJMA 2CUZA 1WU8A 3A7DA 2O8BA 1KY2A 1XALA 1T5IA 2G9ZA 3DFMA 5JS1A 4RTQA 2C0PA 5G0WA 4A2CA 2J6IA 3AY0A 1TO6A 2RGAA 4BUCA 3GLIB 2H1RA 3TWOA 2X3FA 1KQPA 4P3PA 5CEJA 3MUFA 1D2AA 2P67A 4V2IA 4BLTA 3MNFA 4L8GA 3GJ7A 3MHPA 3OPMA 2IU0A 4X61A 5LUBA 1T5HX 1C3EA 3DXXA 1EIZA 1ZK1A 5DNYB 4QOIA 4LVOA 3N8HA 5JSUA 4N41A 3OJLA 3PTZA 1HDCA 2VTVA 2HF7A 4JGBA 4M38A 1FVFA 2PXAA 2C1EA 5A9RA 3PZBA 1W8DA 3QWBA 3WBKA 4BMVA 4CQLB 1ZOLA 2ZIVB 1C3LA 3K6JA 1DBPA 1BKYA 1MIOA 2E4WA 4HN9A 4R2HA 1G2OA 3OX2A 5EKSA 1HT0A 2HIMA 1Z13A 3HXKA 4JJ8A 5CYGA 5LP1A 4TS4A 1ZU4A 1C9NA 1FDOA 1XJ0A 1TA0A 5K8TA 2XQIA 1SZDA 3FOCA 1E9BA 2QW1A 1K0UA 1BMQA 1T1RA 1I2BA 1OF1A 1TZKA 3IHTA 4IHJF 5TF0A 1HK7A 1XIVA 3MCUA 5F7XA 3FMGA 3WA7A 1ZA1A 1MRZA 3QU4A 3R41A 1JECA 1KI9A 4HNAB 4ITRC 4Q03A 4Q66C 4YAWA 3QXGA 5DLPA 1KA9H 1W1UA 4FLFA 3DT9A 3QPDA 3T12A 1OFUX 2ZBRA 1A8SA 4R0VA 1BJKA 3R8CA 4OGFA 2A57A 1FYXA 1JWLA 3PXCX 1TJ5A 5JAZA 5CCBA 3H5OA 1I36A 4FU0A 4WADA 1KZGB 2QVBA 4V38A 2AJLI 4RF5A 2QX6A 1U2QA 1B0ZA 2X8AA 3BKWA 3STYA 4KXFB 4W8GA 4YECA 2W0MA 2E85A 2WC1A 4GXRA 3RC2A 3AKEA 4F72A 5F9MA 6ADHA 2EQ5A 3R4VA 2G08A 1N2OA 3E8XA 4LE1A 4BGIA 5JYDA 2HY7A 4YASA 3FROA 3BIWA 4H3VA 3CLUC 5EMNA 1ZRHA 2RC5A 4BMYA 1ZN7A 4LDRA 2RI6A 4KLNA 3BTSA 4MWCA 1JG4A 3QITA 4FXPA 4YPVA 1OFGA 1X1AA 3DT6A 3QWIA 4X65B 4BE7B 2FVYA 5JV5A 4Q47A 3S0JA 1CJUC 1MO2A 1QO0A 4JLKA 3NHLA 3JRXA 1PVOA 1HH4A 1YBFA 2IX9A 4XYBA 4ENWA 5DXFA 5CLFA 3RU9A 5JRDS 3CVVA 3INRA 5HJ5A 1COWD 1WW2A 3M49A 2C54A 1RMQA 2P41A 1GZVA 5ICCA 1B4DA 4GH5A 4GPD1 4R6XA 3WP0A 2HF8A 5M29A 2PJDA 3A3YA 2NO6A 2O2JA 1U0NA 3QI2A 4UMFA 3SEZA 4CMIB 1Z7BA 3JAKB 3K5PA 4Q4HA 2H4YA 3HKBA 4BO2A 5HXAA 3QYAA 5JY6A 2C29D 4OOFA 2VPXA 1IIRA 3KAJA 4RK6A 4EJMA 2C5HA 1WCIA 2QM8A 1E9RA 2VDJA 3GJ0A 4LZPA 5JCJD 2PRZA 2V3VA 2H5JA 5KX5F 4Z8YA 4DVJA 4B80A 3KSAC 4F1JA 3PDHA 5DLDA 4I8XA 3OCYA 3SVZA 3W3AH 1RPZA 1G8FA 3FOWA 3PGJA 5CLIA 2P9ZA 4ECAA 4UUAA 5JCZA 4X60A 4EHFA 2YWXA 4LS3A 3SJBA 5H8WA 4RH1A 1YZHA 1NUHA 3QNMA 4RZ2A 3TB6A 2V1UA 1YUNA 1QIEA 1A7UA 3ECCA 1Z73A 4M6WA 4P6VF 1Y1QA 5AI8A 4A8HA 1PR2A 4TRJA 1TM5E 5CA0A 4L8VA 4OBXA 4NENA 2HLNA 4JC0A 1LBIA 3MTEA 4KWIA 1UJ2A 3FUCA 2ODAA 4JSRA 4E1AA 4AMUA 2C0QA 4RKQA 4G8BA 3RSOA 3AXTA 4UJ3A 1SKYB 4AJ1A 4PNEA 1T0UA 1NJGA 1NUTA 1R3UA 5DNAA 2QMEA 4W1PA 2WD9A 1ZMTA 2FZVA 2F59A 3FTCA 3K1YA 3TUJC 2Y1WA 5GM2A 3X2FA 3SQWA 2BR5A 4CDMA 4EVQA 1LLDA 5KIAA 5BSGA 2ERYA 1IRXA 1N1EA 1RR6A 5T6BA 3G2HA 4L9SA 3RC3A 3RVNA 3ZKWA 4A8JB 2GJ4A 4YMSA 2RJNA 3MG9A 4HL6A 4M8LA 2OO7A 3RREA 1Q84A 2PU7A 3LWBA 1UADA 3IVRA 3OJFA 1MX9A 3KSZO 4RH0A 3KJFA 4ZMSA 1ACJA 2TS1A 1GO2A 1F06A 2QXYA 4M0LA 5BQXA 1CUGA 4IJKA 3VPDA 3BDVA 1KTVA 3GMDA 5LQAA 2B21A 1XI2A 4M8IA 1CF4A 3TX2A 1AMUA 4R3NA 2FN4A 3VTKA 4RZQA 3ZBQA 2OV1A 5JFTA 2IEGA 2XITA 1ID1A 1I4TD 1YRQA 3HCPA 3O3NB 1LA2A 4LA4A 1QZUA 2Q4TA 4PIMA 3O1IC 3B2NA 1I2DA 4CHTA 4KRXA 3JV7A 3COWA 4DIBA 3OHSX 1P2DA 1OFTA 3G7SA 4JFAA 2FW9A 3IAS6 4FCTA 2G06A 3PFGA 5K0SA 5AM2A 1QIIA 3ASYA 1FUKA 2ZAMA 1VPEA 2UVDA 1M54A 1DLJA 1QLJA 3BCRA 1YL6A 3FCOA 4CETA 3EUAA 3V1TC 1RHRA 2FPMA 3PLAE 2QZSA 3NNDA 1XZMA 4QXRA 5J5AA 3IAAA 5EXSA 3B85A 1K2VN 3E9MA 1FUUA 2DCMA 2AHRA 2JI8A 3B7WA 3LUGA 4KQWA 4M53A 4NFSA 5J2TF 3H8VA 2XGGA 3AUFA 4IIEA 3KFXA 4PBRA 3VHXB 5ILOA 4CNBA 4GKVA 4ER3A 1KVRA 4KYIB 1KH1A 2O8NA 2XWPA 5DHPA 3L05A 2FVXA 1R9JA 5FP0A 4YRAA 1E6WA 5LYJF 1SCKA 3KL4A 1KP2A 1M1YE 1M2GA 4HGZA 4DN6A 3K1TA 2O3JA 4CFSA 1G21E 3GEDA 1C0KA 2RHTA 3QYJA 2NT3A 4XFDA 3QPBA 1OFIA 5H3HA 4B46A 5I5EA 3ILYA 1NDUA 5IJ0A 1K89A 2OY0A 2ZWOA 2WTAA 3IUEA 1TCCA 3TW4A 2VDMB 1PFWA 5FHQA 3CSUA 4HRYA 4U2CA 5DTMA 3S99A 1WMEA 2B7LA 2EP7A 2XGOA 4JEMA 5A9SB 1GUFA 5KKNB 2WR8A 4DT1B 1CNEA 5K0EA 1CWUA 2WB4A 3A8TA 4KQ9A 1XJCA 2FRDC 5DNEA 2C9ZA 2P4UA 1E5VA 3KJZA 1N0UA 3ND7A 3O3CA 4BLPA 4ZRDA 3F4BA 2R3SA 1MEJA 1YOBA 4QFCA 4F4UA 3P45A 5EIWA 3JVVA 2A1UB 2HRZA 2PGAA 1W2WB 3GEHA 5EXDA 1GU0A 1ACLA 2AG8A 5AKYA 5CFRA 1W34A 1OLXB 5BMOA 5J3JA 3HLKA 4GUAA 5ENZA 1P73A 3HBAA 3PPWA 4G6ZA 4LK2A 4F11A 5TVKA 3VOBA 4B81A 5JYEA 1I0IA 1E58A 3OF3A 2F9FA 1VMAA 4XB6B 5AUPB 4OJQA 4OJTA 4PG4A 1VMDA 4E21A 4G0WA 2ZUFA 1KK3A 3HR4A 4AJEA 5FTLA 1CS4C 3ZY2A 4DXHA 3BZWA 1TF5A 3IHLA 4O2BF 3AWDA 5KKAA 3WQSB 3RUFA 3OESA 1AT1A 1L5NA 1U3TA 3T3MB 4A6EA 2W37A 2P3OA 3GVHA 1E1CB 4XEHA 5C8YA 1ZNYA 2XQKA 1GZ6A 4EGCB 4BXOB 2HC9A 5J9FA 1B8UA 3WDLA 3AR6A 3CZQA 3D2CA 4MARA 4YXWA 3HP1A 3OX3A 3RK4A 4B7UA 1OLSB 2IKSA 1JAZA 2CF5A 4DWWA 1WMDA 2EHDA 1TF7A 3TJRA 5DK6A 3VHRA 4E5DA 1WPXA 5AI0A 4D2IA 4E13A 5DE3A 2MIIA 5K3OA 1UPUA 4DHWA 2PIDA 4J43A 4PPQA 4TS1A 3EFOB 3RIEA 1I80A 5ECYA 3TTUA 3LX6A 5F98A 3D6MA 3GDFA 1M34B 2UYCA 1GJRA 3KKNA 3R6LA 4IXNA 4G0QA 4R51A 3TDNA 4F97A 5BMVB 4NQZA 1MT0A 3E22A 4RKFA 4IOMA 2K5UA 4IUDS 1D9ZA 3G17A 2QY6A 5IJ9B 1VE6A 1RAGA 2KPOA 4KGDA 5JSKA 3T35A 2DFLA 3GGCA 4B6SA 5I7RA 4C22A 5JWRA 5BYJA 3ZCTA 3QQPA 1XB2A 3AR7A 5DYYA 1ZUIA 3PXEA 3ZDZB 3E3NA 2O7SA 3OH8A 4PPGA 2OSVA 3USES 4J9UE 3ZGNA 3WRYA 3CJTA 3OEED 4KQ6A 3U49A 3HCBA 2GZAA 4YUZA 2AVNA 3ZXSA 3NIWA 4KXUA 4TMFA 2EWWA 3WHKA 4DKXA 4DB2A 1EP1B 3D3KA 3Q7SA 4IVQA 1LVGA 1JIVA 1IDN1 4AICA 2P9CA 4K5QA 4B6OA 3WOHA 5T4BA 5TXGA 2Q49A 4DFDA 5BW8A 1FZTA 3ZK9A 3OLVA 4Z7JA 1PJBA 1ZH0A 5KYUA 4O2BB 5J63A 1GV1A 1EUCA 2GEBA 3MINA 2P6NA 2ZYRA 1XXHB 3UM9A 4M9ZA 2J3QA 3FLAA 1ES9A 4KPFC 4E5PA 3QVLA 3RYTC 4CG3A 2OQRA 1SU6A 4UU8A 3RH0A 5IUKC 3TLJA 1V47A 2XIQA 4EX6A 2BM0A 4N9QA 2JAOA 5P21A 3RRJA 2XE6A 3DC2A 4ZYVA 5K0CA 3LTNC 2Q28A 1Q0RA 1QOPB 2SKCA 3LQ4A 3CG0A 4OBBA 2BCEA 2WEKA 1USVA 4I4CA 3TCKA 4F0JA 1CZNA 3GF4A 4HX2A 3UYLA 4DQKA 4U7DA 5B7NA 3DLBA 1L5HB 2IYTA 2IW3A 4YUAA 4GLFA 1W85B 1ZK3A 2A0UA 2PQ0A 3MAAC 4JBLA 4MRPA 3EYAA 5G02A 4OV6B 5TPZD 3C24A 1U3DA 3N0XA 5EIOA 4PONA 5EERA 4M0PA 4NBRA 1DVRA 4ZANA 5JO9A 4IIJB 1FU7A 3ZWYA 4JB0A 4A8JA 1MB2A 2H4HA 1AKYA 1SCQA 2I4MA 3WGTA 4B7ZA 1NBEA 3G0OA 4RSGA 3JQPA 4LYYA 3O7WA 5H4HA 3HA5A 2IBSA 3OCJA 5JASA 3N6VA 4RSMA 4ZTBA 2G4VA 3AUAA 1W581 4LZOA 4BO8A 2OGSA 3A4IA 3TOXA 3WLQA 4XASA 1DS6A 1CJTC 1LCIA 3IVGA 1MO6A 2FH5B 5BSRA 4KU4A 2GSDA 1YZ3A 2Q5OA 4GEGA 1XDWA 3E9ZA 1ZPDA 2PMEA 5FOUA 4A8PA 4AJNA 4OB8A 5AXCA 1FXWF 1TK2A 1FYWA 4UQPA 4AZ0A 4CFYA 4CYMA 3R9XA 1IZYA 4C4YA 1L5OA 4LI3X 4ZHQF 3GJ8A 1JEOA 1L7XA 4IXDA 3W79A 3H1GA 4NCNA 2NU8B 5A9TA 4AO8A 8ADHA 5LOVF 4MSUA 3PICA 3LQYA 1S8FA 1CFJA 4O59O 1X14A 2FRVA 5F3DA 1I01A 4EITA 3BEOA 4MGIR 1QOZA 1X70A 1U2PA 1R12A 5K3CA 3S7ZA 4A2QA 1UODA 4IVRA 1TIBA 1BA3A 1Y9DA 3V32A 2XZOA 1Y1SA 1IN5A 3AERB 4GVPA 2G40A 4PO3X 2BZ1A 2C7BA 3OE4A 4YREA 5BOSA 4HEHA 2AX4A 1TU0A 3E9EA 3LPCA 4JVNA 2BC9A 4AROA 1Y9JA 2PMBA 3AQIA 5EYPA 5JH7A 3L6RA 2MCFA 1QTQA 3PYLA 4EKDA 1KP9A 1A8UA 1XRMA 2PS3A 2B8NA 3N7TA 5L9AA 3WAJA 2X40A 3BK2A 4MAMA 2VOEA 4KXXA 3PLRA 2N42A 1E5QA 3U7FB 1J8QA 4UU0A 3ZU5A 1AD2A 4JJZA 2FW6A 4CVNA 1JQJC 1WEHA 3BXGA 3N87A 3IT3A 4D99A 1AQ6A 5BV7A 3WJAA 3C4VA 2WJZB 5FUXA 3FFAA 3RAFC 4YYZA 3KTAB 5EWJB 1G8JA 1QIFA 1L7QA 2CSXA 3IEMA 2AFRA 1VE9A 1CY0A 3DUWA 3LT0A 5C8VA 1IMOA 1CRLA 3UWKA 1JXOA 3ZGXA 2CJWB 2P2CA 2PQ6A 2OO3A 1RZUA 4TTSA 2QVYX 3F6CA 3RD5A 3G1UA 1NULA 4MV8A 2B92A 4CV0A 4EYEA 1TZJA 2G04A 3JYPA 2O2SA 4R31A 4Q1DA 3T41A 4KUHA 4RQUA 2R7MA 4J0QA 4F2DA 2X5KO 1MXHA 3HWSA 1P7CA 1U0SY 1TQ2A 3PGMA 4EHAA 1UIRA 2IFTA 1CNFA 1MDBA 2H2HA 4UAJA 1GZSA 1XPUA 1P29A 4D9MA 1AZTA 1MIOB 2O5VA 1N7JA 2NVUB 3TTXA 1XNJA 4UDNA 3TQSA 4EI7A 2WMNB 5AJVB 2DY0A 2J9GA 3NWBA 1LI4A 3AIKA 3D3QA 5LMNB 1QTIA 2H59A 2EWVA 3S55A 4K9RA 2ZTHA 1ZIPA 1IHPA 1EEXB 3ET4A 4FGZA 5EHNA 4OQMA 1FW6A 2A4MA 4OA8A 4EY3A 1VDZA 5IDVA 5HSGA 4NYJQ 4DKJA 2YHIA 2KS6A 4Y8VA 5ITZB 1IYZA 4LHEA 2XTMA 2O3SA 2HA0A 2Q9AA 1P3Y1 1NIPA 1IWBB 1UZMA 1Z5GA 2CWWA 1OPXA 2QVLA 4XQ9A 3BERA 2R48A 4JR1A 5CTAA 3WRXC 4E51A 1QYXA 3RYFB 1NZFA 5DCWA 1DXOA 1F0NA 4TLMB 1A8HA 5HJEA 1GUAA 1QYDA 1VHLA 2ECOA 1JMYA 3AWIA 3T94A 1XRRA 3QMPA 4RTMA 1MOPA 3B5IA 5FTJA 4EI9A 1GCOA 2LPMA 2PE5A 1VSVA 2YN4A 1Q83A 1IBLB 1TM1E 3SK0A 3FLBA 5CT5A 1PFQA 1ZLYA 1QZXA 4KZPA 1QCCA 2PX0A 2VUIB 1KAOA 2I0FA 4LJ6A 4NZMA 3WE7A 2HMAA 4OX9Y 3Q9SA 4IMJB 4M99A 3EOZA 3I42A 4PYQA 2G80A 4BO7A 3MOSA 1Z0AA 2EJUA 4D9KA 4AWAA 2DT8A 3S2EA 1XVLA 5DOZA 1A8QA 3NIBA 3QX9A 4XARA 4MYHA 4W99A 1Y5MA 2A78A 3CPHA 4RTOA 3ZK7A 2J33A 2RH5A 3IBFA 3SNHA 3S2IA 3QXXA 4MUFA 2ZB7A 1G19A 1WUHS 3LBIA 4CWAA 5EHZA 4CM6A 3T5BA 4DTIA 1B41A 1GNLA 1Q1QA 4GZMA 3FZNA 1OBVA 4DQUA 3T5PA 2BGRA 5KJ6A 2Q6TA 2NVWA 1ULTA 2HNBA 4DCUA 3Q3IA 4QUEA 3FDZA 4LF5B 4ZO8A 4PYMA 2O2YA 4M7WA 1KYWA 4JYMA 5JZOA 5LZ4A 3DR3A 1VLLA 5TEWA 4RFSA 4WASA 3VJLA 2WMYA 3VU1A 3IJ5A 4DDVA 4MKRA 4S2UA 4NYMR 4L4YA 1BA2A 1ULUA 2ZI7A 3RAGA 1IXYA 3TDKA 2ZUCA 4XJXA 3BXFA 4G1FA 3RVRA 1NUSA 2RGEA 1R5BA 3T1VA 3FHCB 1F4PA 2CJYA 1C4KA 1JHYA 4YLYA 5EMLA 1NDHA 1AGPA 2BUBA 2ZUDA 3DFZA 3KEOA 5HTOA 4OHUA 2OYSA 4UE2A 2ZSJA 5KYGA 3TJMA 1RLJA 3TI9A 1QH1A 5JC8A 1NF3A 2VK1A 4GRAA 1EVKA 4S24A 3WO0A 2ATEA 4CU5A 2LIVA 2WJIA 1PT6A 4QFDA 2X4LA 1C30A 1JKJA 3K72B 2RDMA 2ZZKA 4P58A 5U9CA 1FMJA 5FFNA 1E6CA 3DS8A 3EW9A 3R7DA 1ZM3A 5C7IO 1V5IA 1V1RA 2PWYA 3HUDA 1R0KA 2PTHA 4LPKA 4RKYA 3FTEA 3HYNA 2J67A 4BBJA 1I7SB 4F9TA 1XEXB 1KDPA 4G24A 4RAOA 4BBPA 4PR3A 4F91B 1ULHA 1A5SB 3UMSA 1R27A 4DW8A 3ZYZA 3F98A 4RJLA 1L5QA 3TD6A 3U3MA 2IUTA 2OAEA 2XKAA 4MWBA 4R8VA 3AJ8A 3DLCA 1AGNA 3LHSA 1IMJA 5ELXA 3JWIA 2QEQA 3AHJA 3BRCA 4KMMA 1EVYA 2QL6A 4FR0A 3EPKA 2JJ2A 4RAQA 5L3ZA 3AVVA 1DAOA 3R3YA 4H3KB 4KG7A 4MLPA 4RWZA 3A6ZA 1LDMA 3O31A 3BN3A 5BR1A 1Q3KA 1WMSA 2JD0A 2OFOA 4OHCA 3U3OA 1H2XA 5AVQA 5IKMA 5AUOB 2JBAB 2QTWB 3VR3A 3QF4B 5EQFA 3A1DA 2C59A 4RA9B 4DQDA 4HRVA 1ETUA 1EM6A 1MN6A 4G97A 1USWA 3BSWA 3JR3A 2VP5A 2VPIA 3QVUA 4FMDB 5FEMA 2WYVA 2Y68A 3C6BA 2BMVA 3NHYA 1ZCZA 3PCRB 4L8LA 3L4KA 3DPIA 2CBGA 5EYPB 4J3NA 4WFKA 5KI6A 4JZKA 1XUOA 2QRKA 1U0OC 3K94A 4I1IA 4IKEA 1OTYA 2WB2A 3LC7O 4EW2A 1SD1A 3BMQA 4LDJA 2FWMX 1CU1A 1IH8A 2EFDB 1CR1A 4JC4A 3SZRA 3Q7TA 4CLDA 5KYYA 4CEJB 4HWRA 2DJ5A 3STUA 2XIJA 1WEKA 2IOQA 4M49A 2LZ0A 2C58A 3LW8A 4G0VA 1HDIA 2OBXA 1NJ2A 3RVQA 5A6VA 4ZJYA 2WT9A 5IAGA 1T5OA 4ZOBA 2H4WA 1LK7A 4NAVA 4RPLA 2EW2A 4DQ0A 4UUQA 4R41A 3IQHX 3E9NA 1M66A 2MINA 5FI3A 1OV6A 4TOIA 1VG1A 2GPSA 3I9KA 5TX7A 4INOA 2R9VA 4C0QC 1E1YA 1T8SA 5KSZA 4YJGB 4C4AA 1GM5A 1N2XA 2BFEA 3O8QB 5UKDA 3WJ7A 5HZKA 4N6OA 2NU9B 3UHAA 4OXYA 1DPFA 1ORTA 1Q22A 1TK3A 1UZUA 2HX1A 2VHCA 3KL2A 5CCDA 2B5WA 3LT5A 1VGQA 3GA7A 4H17A 4C4PA 2FW8A 1QC5B 4EB8A 3AR5A 3OA0A 5EWMB 5ELMA 2GEJA 3HVJA 4Z7QB 2XYVA 4B3SB 4YIHA 3BGVA 3L5KA 3VH3A 3W05A 1LDGA 1A82A 2XECA 3A1UA 3JVIA 3QLUA 3QU5A 4KQJA 1QV7A 2I4RA 2VF8A 2GNAA 4GBGA 1XVTA 1IVYA 4QQ8A 3ZCXA 2P3LA 2X9GA 3E5NA 1WUYA 3FVRA 4EW6A 3DMHA 3HXOA 1G2QA 2HA6A 1T4MA 3CHYA 2XX3A 1YMUA 5HCNA 4B3CA 5CB8A 4ZHQA 5JMOA 4FYIA 3VYTB 3L8EA 4ND3A 5BUSA 2YUTA 2O0JA 1XTPA 1MGOA 2H51A 1KEEB 2F00A 1UKEA 2JCXA 4QOEA 1A95A 4FJ0A 1RYNA 4JS0A 1U9JA 4RVCA 5IPFA 1TJPB 2QGZA 3HB5X 2JZOA 5JATA 4J0DA 4J75A 4ARCA 3CX6A 1YHYA 1RAAA 2GILA 3L7CA 2OV2A 2VZEA 1OROA 4KYTA 5FPKA 4H7IA 2P1ZA 1Y3DE 2V5VA 3M4YA 4KXLA 1QAQA 3ZV3A 3CB4A 3N39C 2GBFA 5JH7B 2KHZA 3HVHA 1HKHA 2WTBA 1QRAA 4OTZA 4PV7A 2OORC 5FQNA 3LQFA 3KQLA 5LQDA 1EIWA 2AMYA 4LDAA 3FWZA 3DCYA 5IVIA 3NUZA 4BN5A 1BE6A 4FHFA 3UKDA 1XQYA 3ESXA 3WLHA 4OBEA 1X0XA 2W2TA 3RI3A 4B4WA 2HRCA 3FDJA 1G9TA 1CK4A 1O6CA 1VJ5A 3ED1A 3R24A 2X8LA 3DHWC 4HNGA 4UAGA 4UQOA 1L4HA 2C9OA 4XSGA 4Q9DA 4TUYA 4UOZA 4Q4LA 2VSOA 2W8BB 4I1SA 1LNSA 4Z53A 5KINB 4OHZA 1FBNA 5K8JB 1OGJA 1Z3CA 1SURA 3LLCA 2PNJA 5IJ9A 4CR7A 2IH2A 3UWDA 1MXFA 2F3PA 2PL3A 3DZCA 3SSMA 3U4IA 1ODJA 4P4NA 1EX7A 2GO1A 2QJOA 5TV2A 2UYQA 2NYRA 3EAFA 4B31A 1KI7A 3ETCA 1Y3BE 5B3LA 1TFUA 1MJGA 1ZL0A 3A4YA 4X93A 1KPHA 3H2JA 4BEJA 1P0MA 3PR3A 4GQBA 4OXXA 1Z2OX 2YJ5A 4YJ3B 3TG8A 1IAVA 2QI9F 3AX6A 3DMDA 4L02A 4EVRA 2FWAA 3QPWA 4BRZA 1AMNA 4D25A 2BHNA 1PL7A 4RY0A 4UD6A 5CXXA 1XE3A 1Q7GA 3W7AA 1ADGA 3IEXA 1PJ3A 4BWVA 2IELA 3C98A 3TH5A 4E5NA 1KVUA 4JI6B 5KU1A 1N3IA 3R20A 2J3MA 2BBSA 4NVRA 5IH7A 3M0EA 3G0GA 3RFVA 2NUTB 1SUCA 4R98A 1FSGA 3U2QA 4EYGA 3R3HA 5T64A 1DKQA 4JXJA 4LY3A 2PT5A 1OT3A 1YVDA 4B33A 3UY4A 2F1HA 4KC0A 3T7KA 3OMXA 4A26A 4WXYB 4C3OB 3KJQA 5BSFA 1XTUA 3HYSA 1Z0JA 3I4CA 4NEGA 1O08A 2CVQA 5JNSA 3HM9A 1SVLA 3OE7D 1FP6A 3R0ZA 4DG5A 2PUDA 1HNWB 4P7GA 2PL9A 3ACCA 2ZJ7A 3DMGA 3RF7A 4MLCA 1DEXA 2CK3A 3A4NA 1GQYA 4GMFA 1Y34E 4KUGA 2QORA 2FR0A 1E69A 2P5UA 2PU5A 2ZJ2A 2XKJE 1KJ9A 3AJAA 3OEWA 5CW2A 1BE1A 3HXMA 2QRNA 1ECJA 4EYSA 4P4UA 2Z1MA 2A9PA 3WB2A 1U2GA 3DBRA 5M3BA 3V2HA 5IK2D 2EC5A 2YOGA 2J41A 4ARBA 1PSWA 2RGUA 2FG7C 2XH8A 4IV0A 3IOMA 5CDYA 1ZD1A 3DEZA 3IXQA 4N7BA 3CCBA 1ML3A 2ENWA 2ASVA 3I9V6 4FFBB 4N47A 3UAVA 4MQMA 3VKHA 4EB3A 4A0FA 4B3DA 1EXMA 1VLQA 2FFHA 4P8RA 1Z4IA 3D8HA 2BRUA 3EXEA 3NBYC 4C4TA 1L7MA 2XB2A 4NPHA 2EBHX 1ADYA 4DSZA 2X6TA 3ECAA 3HKEA 3ND9A 2QX9A 2D59A 1TUGA 2XYQA 2CCGA 2RAVA 1MP0A 3BAFA 1ENPA 1MNQA 2JLSA 1FS5A 1I3KA 1MUUA 1OC4A 3ACBA 4KKVA 3EDYA 4LYGA 3MF4A 2RAUA 2JIZA 2ADFA 2BJWA 3OIGA 3VNSA 1UEXC 5AKIA 5FOWA 1W7AA 2GHRA 5CURA 1I7NA 2I4LA 1AMOA 5TY0A 2E9SA 1LK5A 1U8FO 2OV4A 4M36A 1EINA 2C1ZA 2QDXA 1CHNA 4E5SA 3NALA 3K9LA 4EYQA 3QLUC 4Y30A 5HKOA 2XYGA 5DSXA 1MCZA 1Z0UA 1Z6TA 1XAGA 1WB4A 1XLUA 3BEDA 1JXQA 4LE2A 3VZPA 2DWCA 1KY4A 4OQYA 5FADA 1ZGJA 1QWSA 1WUJS 3H5AA 2P5YA 4M88A 2B0CA 4A23A 3RU7A 3BTOA 4BFUA 1PR3A 3D8UA 2DQ4A 1ZGHA 4E11A 2UYHA 5LR6A 4NMXB 4GOOD 4F4IA 3EZXA 1PV2A 3A7EA 3EGDB 2PKQP 4K26A 4BQNA 3I5XA 5E2AA 1IXZA 1U8EA 2NZ8A 2MSLA 4XWWA 1TCVA 1L2TA 1SUBA 1KEVA 2XWQA 4FFRA 2R4UA 5KAMA 1ESNA 3V8MA 4HADA 1GLGA 3O9MA 4H6XA 4UKDA 5E6UB 1VSBA 4C0SA 4PZDA 4YJHA 5T7BA 1TO2E 2GX6A 2H6EA 2CD7A 3IUJA 4DXAA 2XNHA 2EZ8A 2FUNB 3FPFA 1PV1A 2A0XA 1U4OA 3HBNA 3C8UA 3LTEA 2Q5IA 2POCA 5EVJA 3GLGB 2E55A 1M6EX 5U4QA 1XFDA 3CT6A 1SUPA 4Z9XA 2AG1A 1BGVA 2NP7A 1SUIA 1XZBA 4X24A 1E1QA 1SAYA 2W4MA 3KEMA 3KYIB 4I4LA 2XCSB 3A2KA 1JQBA 2G3YA 3TIFA 3W4KA 2P4SA 1HI9A 4AI6A 3KC2A 3T7EA 1G2IA 1X1RA 1J5EB 1F8FA 2NU7B 4RPHA 5L45A 1K1EA 5B2ZA 2XY4A 2HJHA 3LPDA 5JVDB 2PZMA 1IBMB 4YRPA 4PNZA 2C20A 3TSZA 1TOAA 2VK2A 5AJUA 5GIPE 4F21A 1RCTE 5TIIA 1AF4A 4RIIA 1A9SA 1FRQA 5HKKD 1RC1A 3U1VA 3GLFE 1V8DA 5L3RA