5HR5A

Bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2)
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
424
structure length
423
Chain Sequence
KCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRRQAVKSYKSYDFFRHDNEEAMKIRKQCALVALKDVKAYLTEESGQIAVFDATNTTRERRDLILNFAEENSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMDDFLKRIECYKVTYQPLDPDSHDKDLSFIKVINVGQRFLVNKVQDYIQSKIVYYLMNIHVHPRTIYLCRGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEIADLKVWTSQLKRTIQTAESLGVTYEQWKILNEIDAGVCEEMTYAEIQEQYPDEFALRDEEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transferase
molecule keywords 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
publication title Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
pubmed doi rcsb
source organism Bos taurus
total genus 155
structure length 423
sequence length 424
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hr5A01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5hr5A02
4MRSA 1L8QA 2PMKA 4WXRA 2XNDD 2F3RA 1ZMXA 2IYRA 1UKYA 2IYQA 4PPFA 1OF1A 4OHYA 4NYJR 5F3WB 3QJYA 3NBFA 1C81A 5HZHA 3QXHA 1EX7A 4IOJA 4EJSB 5AJWA 3UWKA 5JS8A 1DKMA 3RLFA 4A82A 4FINA 3CZQA 1NBME 4JSTA 1UFQA 3L0IB 2GFIA 2JJ1D 4EJSA 1DPFA 3B1XA 4EFLA 1NY5A 1XPOA 3FYHA 2QY9A 1N25A 3U7GA 2UZIR 1R0YA 4OHZA 4HI0E 1W4BA 1DAKA 1KTVA 4KVGA 3ETLA 1LVGA 1N0UA 4GOKA 4LHVA 4LJ4A 1B0UA 3OAAA 1T9HA 2H92A 4RCZA 3U2QA 1A7JA 2WJGA 5CB6A 2HUPA 5CDFE 1AQYA 1G5PA 1Z3IX 2LKCA 3C5HA 2FEOA 2ZSBA 3TH5A 3KFXA 1G16A 3VTKA 1QVAA 621PA 1NLFA 4PC1A 1KO8A 3UATA 4G5GA 2QQ0A 4Q5IA 1XMIA 5DHFA 4Q01A 1U0JA 1RYFA 5FOSA 1JQJC 4ITRC 4DCTA 2ZUDA 2ZJYA 5EJEA 4A6XA 1RFLA 1XD8A 4B75A 3OF5A 3TK1A 1W49A 2D7DA 2WIBA 4ZI3A 5KPDA 3DVLA 1QHSA 2KSQA 3MXOA 2GCOB 3OAAD 4LI0A 2YWEA 1SGWA 4M2LA 5AUQA 3WMFA 4G01B 3QG1A 1QHYA 2GCOA 4YXWA 4ZKDA 1JBKA 2ZETA 4MRNA 2J46A 4ZCMA 1T91A 2NO6A 2ENUA 2WWIA 3SDZA 3U6BA 3KKOA 4JJZA 5JWOA 2EQBA 2FN4A 1H2EA 1S8FA 2WMNB 1CIPA 1DELA 1E2PA 4KBGA 1YRBA 3BD9A 1DAFA 1KY2A 3IKJA 5GJCA 1XXHB 1ZD9A 3FMFA 4NBSA 1CRPA 2OCYC 3C7TA 1ZM3A 3RRNA 1ZD1A 1N6OA 2DFLA 4KFRA 1GSIA 4Q9IA 4A8JC 4Q03A 1VYUA 4XSHA 4DSNA 3B60A 4YXWD 4QHTA 4Q1BA 3RWMB 3KFVA 1YZKA 2EFDB 3GMTA 1IHPA 1Z07A 1A82A 1IM2A 4PFSA 3DMDA 2PX0A 3F8TA 2C78A 3MWYW 1NVUQ 3HYRA 1P2SA 4U5XA 5JWHA 3A1VA 4OJQA 1WBBA 1D9ZA 1Z0AA 1AS2A 2HF9A 2VPPA 3OEEA 4M53A 4JL5A 1HE8B 1E2JA 1FQJA 1R2QA 2EWVA 2P77A 1OHHA 3SYNA 5GADl 4GOJA 1J70A 1G8YA 2R44A 2WJYA 2ZI6A 4V0ME 1OIXA 5FPKA 3HU1A 3RRZA 1XTQA 4PR0A 3CH5A 4Q4LA 3K0EA 4BECA 5DNYB 3I3SR 2YOHA 3B9QA 5DSZA 4C3ZA 3AP1A 3Q7QA 3VU9B 3HDTA 3CRW1 3I5XA 2YVUA 5C4MA 4TZ6A 4C30A 3VU9A 2FF7A 1P9WA 1Z29A 2ORWA 1T8TA 3UMFA 1E2NA 3OEED 4NCKA 4AYWA 1UBFA 5GJBA 2J7PA 1DO0A 2RH5A 4Q1DA 1SXJC 3ASZA 3VR1A 1OHHD 5FI1B 1UAAA 1N5JA 2GK6A 1RC8A 4IVQA 1RVDA 5DLQC 2H0QA 3TR5A 4B6FA 1N6NA 5J4LA 1IN7A 1E9DA 1VCOA 3SJBA 1KI6A 1M1YE 3L0PA 4LHYA 4BZPA 1MR3F 4DDTA 3Q5EA 1ETUA 1DKOA 2BHRA 2H8KA 3OE7D 4LYAA 3A1TA 1JAIA 3BB4A 3ZD6A 4MDEA 1DKQA 1J7KA 3FJYA 1O87A 1EBBA 1XTRA 3W6OA 4N3NA 2NQ2C 2OXRA 3DKVA 1FQKA 1P4SA 5FUVA 1M6NA 5CB8A 1TU4A 1U2RA 2J59A 4B3CA 2F1HA 4OI4A 2J7PD 1OE0A 3CBQA 2OILA 5DYIA 1ZNWA 3W3ZB 1OXTA 4JSYA 1YJ5A 1R0XA 2GETA 2ZU0C 2XTMA 2QP3A 3WXMA 1RZ3A 1KSHA 3B2EA 3FMPB 4MGYR 4YMWA 2DR3A 4UXHA 1CLUA 2HLDA 4AG5A 3T35A 1KDRA 4D80A 5IT5A 4E3WA 1F2UB 4W5WA 1YR7A 4LBVA 2XOKA 5BQ5A 1F2UA 2YWGA 1T6NA 4AC9A 1G17A 4C0LA 3K4PA 4WA7A 3QEJA 3LBNA 4BRUA 2R9VA 3KJIA 3P1JA 1Z08A 2ERYA 4HAXA 1X1RA 5FUWA 2BMDA 3IO3A 4D4MA 4D4LA 1E99A 4TTRA 4TQAA 4RY2A 2G3YA 5EUMA 4LK2A 3TJZA 1Z2CA 4XD7A 3CRMA 3PCRB 4UXIA 4MGZR 2QMOA 2RGGA 2GNOA 3R7WB 1QWOA 2R6FA 3LLUA 2QNIA 1CKEA 3R7WA 4DLRA 2QUZA 2PL3A 2HLDD 2XTNA 2C2HA 5A5GA 2ZJAA 1NL3A 2IYUA 2YWFA 1OH7A 1WXQA 1Z83A 4UKDA 4KFSA 2V8OA 2XOKD 2VP4A 3ND9A 2IKQA 1CJKC 1F60A 2GZDA 1Z0JA 2BM0A 2ZRNA 1L4YA 5G40A 2PEZA 4AKHA 3NDBB 4M1MA 3WRXC 1UDXA 3CF6R 1C7ZA 3K09A 4DLYA 5K8TA 4B73A 3KZ1E 5FR1A 5FBRB 1T3LA 2ODWA 3WBJA 1E9BA 3A4LA 1RIIA 4CYMA 4XD7D 2H4ZA 2WKQA 2ONJA 5PGMA 2WWXA 4P4SB 4TWZA 4F92B 4TYPA 3AQ4A 4P4SA 4WZ6A 4OJKA 5KDLA 2XZOA 5EE0A 3PEVA 3VR4A 4US2R 3GLFE 2QENA 4JVMA 1ZNZA 4LJ7A 4EJSC 1VKJA 1XJCA 2KWIA 3GP8A 4YDSA 1G18A 1H8EA 5FTMA 3TRFA 3BOSA 1NT4A 1JQLB 3NFYA 2G83A 1CP2A 1XCGB 2ATVA 2W6IA 5E95A 2WWFA 2W2VA 1A5TA 3WYFA 3U5ZB 4F4CA 1QZXA 1GL9B 1P7CA 4HUQB 3T5GA 4Q9KA 1EFUA 3O8RA 4QRHA 3FKSA 4HUQA 2JLWA 2JDIA 4PO8A 2X1VA 2C98A 1AJEA 2A5FA 3QPWA 2CVFA 2DWQA 2N1BA 1P62B 2H52A 5EXPA 1KO4A 1OH6A 2AKYA 2ZPTX 1UKEA 5B58C 4KBFA 2NGRA 2OZEA 3RSLA 1H8ED 1P2TA 5HE9A 3F0TA 4M1TA 4NYMR 4BLTA 4KI0A 2ZU6A 3IIKA 5LB2A 1DO2A 2ORIA 2W6ID 3RRYA 2BV3A 3QBVA 3P32A 1TQ2A 1NP6A 3FKQA 1OYYA 3VHXA 4TSRA 3SBDA 4DLXA 4N1AA 3BH7A 5G41A 1U8YA 1KAGA 1OIVA 3FKSD 3ZZTA 4US0R 3EC1A 2R6GA 2JDID 2F1RA 4JZKA 4AKEA 2GXAA 3B7GA 4B2PA 2QU8A 4QNRA 2BKEA 1UBEA 1YZNA 3C4JA 1XRJA 3U44B 3K0FB 2JAQA 4M9SA 1K6MA 2QA5A 5J47A 2NZJA 3K70B 4JODA 3U44A 3K0FA 1BKDR 4Z1MA 5BN5A 3PFIA 1F3OA 1G8PA 1Z28A 4FI3C 2V55B 4RCYA 4B34A 3IQXA 3UANA 3EXAA 3WBKA 1OIWA 1BO6A 1FNNA 3MLEA 1AKEA 4MRPA 4RD1A 2FGKA 2R2AA 3AF4A 4NHOA 2C04A 4PC3A 4UXJA 4WXPA 3ZVLA 3I62A 1NN5A 3RS7A 4DKXA 1Q22A 4DHEA 1VHTA 2H1LA 2PT7A 2DFTA 5JS7A 1DKNA 3AVXA 4Y0AA 4BFYA 1AK2A 1Z6XA 2BVNA 2QTHA 5K8LA 1BQ4A 1SULA 1WRBA 4GPZA 4UJ3A 3P26A 2QQEA 1A4RA 5BYKA 1O3YA 2MMCA 1LFDB 4NU0A 4F38A 4Z1MD 1W47A 4C0QC 3ZD7A 3QI2A 4TTPA 4BE7B 5JEEA 3CPHA 3L2OB 3K70D 1KAOA 1W36B 3LNTA 2AX4A 3NH6A 2QE7A 2QMHA 3D31A 4O25A 2ZYVX 2O52A 3GPLA 2HPAA 4K8OA 1N6PA 1P5ZB 3KJEA 2ZVQX 1BYUA 5KYKA 1W0JA 3AF1A 1G6HA 2RGXA 3GJ8A 3NIBA 5GJWC 4DJTA 4C2UA 3PEYA 2Q21A 2QRZA 3LDAA 2W0MA 3QXXA 4H1UA 1W2GA 1YR8A 1G7SA 3TVTA 5GVRA 4BFSA 3EIQA 1G7RA 4B32A 1YVDA 5DO9A 3P27A 4XWAA 4BFXA 4BZQA 1VG1A 1E0SA 1Z0IA 2DWPA 2C9CA 2H18A 1NRJB 2A7QA 2QE7D 1OSNA 3LA6A 1IN4A 1W36D 2I1VB 3KDSE 4Q02A 5CYPA 1HQCA 1N6RA 1W0JD 1E2QA 2H57A 3KJGA 4KV9A 2OE2A 5FBWB 2G6BA 4B74A 5K8IA 1MRNA 4AIIA 3VHLB 4URYR 1JB1A 4QHSA 1NIPA 4JKIA 3EZ2A 3E9CA 4PZZA 4JBXA 4KO8A 3W3AA 3I4LA 4ARSA 4NPHA 2V1XA 1E0KA 5GVSA 1E9AA 1R4AA 1E98A 1UBCA 3I1FA 1LV7A 1R0ZA 2RAPA 3X1DA 4TZ0A 4Q1CA 3R20A 3GLGE 2XTZA 2IHBA 4C0JA 4EQ6B 4HAYA 4IVPA 5FL7A 3IEUA 3VNVA 3AKEA 4JLMA 1IBRA 4EQ6A 2DYKA 2R6CA 1MO3A 1UPTA 5E4FA 3U3KA 2CXXA 2QM7A 2QORA 5EXSA 2R65A 3TQFA 4R2HA 1NMYA 2V9PA 1QHXA 3MCAA 4PC6A 3V4RA 1YQTA 3BRWD 3LFUA 4HAVA 4L15A 1W46A 1MO4A 2IHYA 2VP6A 4FIDA 2QAJA 4M9ZA 3KKMA 4B76A 1OB5A 4TN1A 1I2MA 2I1QA 1M8PA 2HCBA 2RHMA 2W00A 4A2QA 1G8FA 1WA5A 4URZR 3U3OA 4DDVA 1OXSC 3ONWA 4JYCA 4ERNA 3RYTC 1X8JA 1OT3A 1KI8A 1VIAA 2YNMA 5FL7D 1ZM4A 5AR1A 2F6RA 2QTVB 2QN6A 2PZFA 3VR2A 5HCNA 5B57C 3V9PA 1C1YA 3HR8A 2EU8A 2H16A 4M1SA 4C7OB 3EZ7A 4ZO4A 1NVVR 4OHVA 3QF4B 5BXQC 4TLEA 2EKBA 4C7OA 1DOAA 1ZVQA 5JJIA 1ELOA 2GXUA 3QF4A 1K5GA 1KHTA 1D2MA 2ZJ8A 5G3ZA 1NN1A 3QXSA 4PXAA 2W2TA 3T61A 4YMUA 2ZYUX 4NDZA 2DFKB 2GAAA 1FMLA 2GWHA 8OHMA 5TB5A 4HLQB 1EWRA 1CXZA 3GEEA 1N6IA 2NG1A 4GZMA 3REFA 4IOKA 2WWYA 1IN6A 4D26A 2GBLC 2P30A 2OBMA 1JAHA 1RRGA 3K09C 3PITA 3U3MA 3SOPA 4A8JB 1KI3A 1E2LA 1G4AE 4IKEA 1H65A 4POAA 1YRAA 5KDOA 1EK0A 2CL6X 2FA9A 1KIMA 3A36A 3EIEA 4MYTA 4MYHA 2VHUA 3NVAA 1FTNA 2V6JA 4A8JA 4IJ5A 2ZRHA 3QKUA 1GZSA 4Q00A 2GVDC 4KLZA 2O0JA 4LJ6A 2CL0X 2ZS9A 1N5IA 3X1XA 3UMRA 2QP9X 4A2PA 2GEUA 3GLIE 1FNMA 1UJCA 1D5CA 2CK3A 2YINC 3A6PC 2GRJA 3WHKA 2NO9A 1E2FA 1AS0A 4A0RA 4C0AC 1P2VA 3KXKA 1NIJA 2G0NA 5C46F 1N0VC 1XBTA 1TTTA 5FL3A 1GDDA 1SVIA 5CIQA 3B1ZA 4RJLA 1FUKA 3HJGA 5KSPA 3EASA 2KJQA 1R8SA 4ON9A 3G0HA 4NZYA 1ZUHA 4QOSA 4EPRA 4QM6A 2HXYA 4A0HA 1FL9A 2CK3D 4DLVA 1GKYA 2PT5A 2JJ8A 4M1YA 1KDTA 2C9OA 4W5HA 4C0SA 1LS1A 2AWOA 2D74A 3KUCA 1TF5A 4KYUA 4Q4JB 2PEYA 3TW4A 2OWDA 3GW8A 3GJ5A 3GJ4A 3K0SA 3QVVA 4Q4JA 4HYYA 3RAPR 4O2RA 3KJHA 5CITA 2WV9A 4EPTA 1GNPA 1BYIA 5FPSA 4S35A 4V0NA 2JLUA 2D62A 1KMHB 5FBVB 2NO0A 2IC5A 4ARZB 1Q3HA 5D3QA 1ZM9A 5DE3A 1KMHA 3U3JA 5KTYA 3GJ7A 3TLXA 4ARZA 3CRQA 1AIPA 5JRJA 2BCGY 2J5XA 3SJAA 2HXSA 2CL7X 2P6UA 4E5UA 3AP2A 5P21A 3IT1A 3CR7A 3MBKA 2F3TA 1HTWA 1A2KC 4MUBA 3K70C 3GP3A 1ZIPA 3B82A 5J40A 2PJRA 2XXAB 3O0TA 3ZYCA 2WOOA 3KB1A 2W58A 4HDOB 1GOTA 2D3WA 1TUEA 5F9HA 2OG2A 1ZYUA 5HPYB 1E2DA 1KO5A 3P4YA 3K1JA 1ZJ6A 3D8BA 4C0BA 1AA9A 2ZRGA 2OLKA 5C1BA 3IIMA 3LQRA 5SZJA 1M34E 2UZ3A 3AEZA 4PC7A 4JLKA 4D0GA 1QBKC 3WP0A 3N5CA 1NG1A 2VLIA 3BXZA 1Q1BA 2AFHE 1SHZA 2FPLA 2IK8A 3NTUA 4WVFA 3GJ0A 4UNRA 1RPZA 4DWJA 1FPMA 2WIAA 2GZAA 1NKSA 2VYFA 3I8SA 5LD2B 1S1CA 3X1YA 2D2EA 2A5JA 4K46A 4D4JA 4IRUB 2MSCB 4XVQA 3BH6A 4CF7A 4DB4A 1DARA 3OESA 2QSYA 1W36C 4BASA 5JHGB 5K8UA 2JLRA 1P3JA 1KY3A 5F9FA 2YN0A 3VQTA 3OIUA 2DHRA 1WB9A 3LO5A 1SVWA 4BQSA 1HT2E 2JJ2A 1EFCA 1PLLA 4PPQA 1Z8FA 4ASUA 2WU0A 2X19A 4KAXA 1SVSA 3KXIA 2ZJ2A 1NI3A 2ZRMA 4XTRA 2YZ2A 4FMCF 3E5HA 5FI0B 4NL4H 2ZJBA 2F1IA 2CE2X 1GIAA 3C7KA 1HY3A 3F2IA 1TF7A 2JA1A 3GLHB 3JZAA 3QKRB 4LHZA 2VHCA 3JVVA 1E1RA 5E7JA 4JT2A 3QKRA 1GILA 3BFKA 4YC7A 4RKFA 2YC4C 4L16A 2SHKA 2EFEB 4D4KA 1FZQA 4Q7LA 1II9A 2CBZA 1N5LA 3ASYA 1ANKA 4PTLA 5EP2A 2JJ2D 2ZRKA 4A36A 5AWFC 4ASUD 1Z0FA 1AKYA 1G20E 2CHGA 2B7CA 1DAEA 2EW1A 2FH5B 2PCJA 3R9XA 1NN0A 5JCZA 4B2LA 4X8LA 4DLWA 2P79A 3WYAA 1VG8A 3OIYA 1ZNYA 1US8B 2AN9A 2O8FB 1E1RD 1US8A 4FD2A 2IUSA 2R62A 1R5BA 1IAQA 1LF0A 2P67A 3NBYC 2O8FA 1SHKA 5IDVA 3IT2A 3EPHA 5HE8A 4A2WA 2ZTSA 1Y63A 4H9GA 2IYWA 2A9JA 3E1SA 3RDPA 1K8RA 1OFIA 1HQYE 3B1WA 2VHTA 1J99A 5CJPA 2ZRBA 3WMEA 2AK2A 3GQBA 3I73A 4DVGA 1TPZA 1P2UA 2B8WA 2ZUCA 1BQ3A 3E9DA 2RB4A 1L4UA 2VEDA 4Y0VA 5TDHA 4QNMA 1NLYA 3FFAA 3ICEA 1WP9A 4JLNA 1Q12A 4I1VA 3MUFA 4XJXA 1N6HA 3LLMA 2WKRA 3PUYA 3QPUA 3I5YA 4LYHA 1G41A 1RKBA 2OCPA 1UKZA 4JLAA 4LGMA 5EE9A 2H7VA 4US1R 5EZ5A 2BCJQ 5FTKA 5HKKA 2PZEA 4LC1A 2LCFA 4OQXA 2B92A 3IDQA 1W0KA 2UKDA 3X1ZA 3X1WA 3THXB 3DCYA 2RGNC 1GNQA 4AG6A 3THXA 1UBGA 4NKRA 2D2FA 4Q19A 1E9CA 2ZRAA 1ZBDA 2Y8EA 3EAQA 3TR0A 5JLJA 2FMXA 4BFUA 5DGXA 4HLUA 2GJSA 3TBKA 4K81B 1WF3A 4DCSA 2PZGA 3BWDD 4TMKA 4C9BA 3U6KA 1XEWY 3I32A 2G0TA 4IEEA 3T1VA 2WM9B 3LWNA 2WJVA 3RS2A 1UJ2A 4F4JA 2P0EA 1XXHA 4B6EA 5HKKD 4JBYA 3A58B 1TADA 2OLJA 4PO1A 1N6LA 1W0KD 3RC8A 2BIFA 2FDCA 1TU3A 1XCMA 3N70A 5FPYA 4PSAA 3W5IA 3ND8A 3SS8A 4BLQA 4BEBA 3FMOB 1SKYE 2F1JA 5FOWA 1AS3A 4OKSA 3T5DA 2V4ZA 1Z63A 1F6BA 5CLLA 2V6IA 1BMFA 1R10A 4LJAA 5JWRA 1YHNA 2KBEA 4DLTA 1NBMA 3KQLA 1CJMA 5JI3E 1CBUA 1JJVA 1J2JA 2ATXA 3ZS8A 1KOFA 1NJFA 2CE7A 3AH8A 2AKAB 4BUJA 3DOEA 1W5SA 4ZV4A 5JECA 4I81A 4OHWA 1C4OA 2EYQA 3K9LA 2J0UB 3LG2A 1AZSC 3ZJYA 1ZNXA 3LH5A 3HJNA 1HT1E 2AWNA 2J0UA 3OE7A 4I99A 2HYDA 5B2ZA 4LHXA 5CDFA 4LYFA 2RKOA 4KXFB 3K4QA 4DSOA 4DLSA 4U7DA 1IXZA 5HR5A 1IONA 4XSGA 5KSOA 1TEXA 2GEDA 1BMFD 2OCAA 2P5TB 1T4GA 5HTKA 3ADDA 2FFAA 1NBMD 2YJTD 3T1TA 3EG5A 2V54A 2A9KA 4HB2A 1VTKA 1F5NA 2A3RA 2BWJA 4M8NE 1Q20A 4V0KA 3AVUA 2V7QA 1SKBA 2ECKA 2ZUBA 2OWEA 2WWGA 2WJJA 3FDIA 4QBIA 2WNHA 4TYQA 2OHFA 5LBIA 2FSGA 5J4YA 5DISB 4P4TA 4GOXA 5EUQB 1EFHA 1W7AA 1S0UA 2F7SA 1ZIOA 4AY2A 4QJ4A 1MABB 1ND6A 2NOAA 5JFGA 3B6EA 4II7A 5FOUA 4GPIB 1MABA 1OXVA 3CWZA 1WQ1R 2QEQA 4LUCA 4EO9A 1JALA 4TL7A 1KK2A 1L2TA 2O8DB 1Z2AA 5J5CA 1E1QA 5CK4A 4MDFA 1NG9A 3LVQE 4XIGS 2P6MA 1U8ZA 1KSGA 5FH9A 2O8DA 3ZHCA 4FMBB 4TMTA 4IJ6A 4F93B 1TQ4A 3PGMA 1U8AA 3AVTA 2V7QD 5JI2E 3BB1A 1S4QA 1VECA 4KCGA 1E59A 2GAOA 5A4JA 2Z6VA 3CLVA 4XWKA 3DZDA 2IWRA 4F4IA 2HEIA 4B44A 1KJYA 3O8CA 3GD7A 4NE2A 2OSBA 2O0KA 5C18A 4BRWA 1IN5A 3BORA 4TMVA 4MH0R 1E1QD 2ZSAA 3VAAA 1D2EA 2ASEA 5LD2C 3Q3JB 1DTSA 3KUDA 5CJ2A 4XVUA 1DVRA 1CS4C 3PQCA 3TUIC 3UPUA 3UMSA 4F7WA 1Z0DA 2EVWX 2G9NA 1E9SA 3SYLA 1E9EA 2ODBA 4FWTA 4CZ2A 1ZC4A 1JNYA 4WIAA 1WBDA 1X8LA 1LS6A 2IL1A 1E79A 3QBTA 2IF2A 2P6NA 4JBWA 3LX5A 1CU1A 2W0SA 3NHAA 2YOGA 2P2ZA 3QXCA 1XJQA 4X8OA 3VKWA 4Z51A 4IXMA 2D06A 4HDCA 4YONB 5BN4A 2GBLA 1U81A 3CPEA 2HJVA 2O5VA 4GNKA 2WOJA 1M74A 1NF3A 2GK7A 3CONA 1ZW6A 4MYCA 1UM8A 3JZMA 1DAHA 1VHLA 3C8UA 4B47A 2K5UA 3EARA 4PO9A 1MKYA 1W1WA 4JLBA 2JCSA 3KXLA 4JMPA 3AKYA 3B85A 5BW8A 1TAGA 3CM0A 1JPJA 1OYWA 1W2HA 4IXNA 4A0FA 4B3FX 3AF3A 1VCNA 3B5JA 3DPUA 1Y3AA 3M1IA 4NYIQ 4QFMA 4FN5A 4X8HA 3EWAA 4UNNA 1E79D 1JEDA 2I4IA 3H2YA 4DC9A 3FGNA 4GMDA 2IS2A 2F43B 2WNIA 1M7BA 1HE1C 2F43A 3W6PA 3VKGA 2R6AA 5G53C 4G5SA 4KYIB 3AUXA 2Z4RA 1E2HA 2Z0MA 1KI1A 3R9IA 4QXAA 2P75A 2W83A 3ZZUA 3CF0A 1E2MA 1KJWA 3S1AB 3GP5A 2P6RA 2QROA 2BBOA 1GRNA 1XZQA 2VQSA 1KI2A 3S1AA 3T1QA 4DBLC 1QHNA 3AV0B 4BPBA 3T06B 3F5FA 2PH1A 1QHIA 4ODIA 2ZSDA 2YC2C 4OL0A 3WNCA 2IUTA 3X2SA 3K0CC 4QBFA 1OH5A 2OAQ1 1RE0A 3SEAA 2VF8A 4UNSA 3ZVMA 4AROA 1T8UA 1G3RA 1S3SA 2V1UA 3R9WA 3FMIA 1Q1QA 2QPOA 2VP9A 3EA5A 3NEJA 5H1YA 4EMBA 2JLQA 2ZANA 1G9XA 4RVCA 4ZCIA 4R71A 1GNRA 5TXGA 5JZVA 3E9EA 3QKTA 4ZI2A 2GESA 1IY2A 4LJ8A 3SN6A 3R8CA 5JSZB 3AVVA 2ZSFA 4HLUC 4MKGA 2ZE5A 4G0NA 3AUYA 3ZS9A 2Q0HA 4P33A 1QFXA 5JSZA 2XNSA 3IBGA 4HB3A 1E9RA 5SZKB 1R7RA 1VG9B 3L0SA 4TSFA 5JBQA 3U7HB 5KUTA 1XMJA 4LC0A 1UJBA 1DKLA 3REGA 4GI7A 3NWJA 2EFHB 2XB4A 3GEHA 2ZQ5A 4DLZA 3BH0A 3GFPA 4GRAA 5AJVB 5E7IA 1N5KA 3P4XA 3VNUA 4I1SA 4FCTA 4UNQA 1D6JA 4B3BA 5KO2A 2QBYB 1MV5A 4DSUA 2ODEA 5SZIA 3H0KA 3EPKA 4ZPXA 1FUUA 3AB3A 2QBYA 5UKDA 2IX3A 4PHFA 1G3QA 1WDTA 2GEVA 4MGKR 1CEEA 1U0LA 4PPGA 2FZ4A 4DLUA 2XSZA 2IXGA 1IJEA 4EFMA 3AVOA 2RGEA 2HF8A 2B21A 3TSOA 2IW3A 4TSFD 5TMPA 2QAGC 5AUPB 2KI5A 3K9HA 1XTIA 2RGBA 5F2EA 3SZRA 3QE0A 4DCNA 5CX4A 4R7ZA 1KI9A 1FX0B 4LBWA 3GFTA 1CULC 1EFRA 4C0HA 5FTLA 1YZLA 1ZINA 1FX0A 3M6AA 2P78A 3ZVRA 4ZIRB 1U9IA 1ZU5A 2FGJA 2IEZA 3LBIA 4YLGA 1NNEA 1ESMA 3EPJA 5CM9C 4PHHA 4OI2A 4CIDA 3QVUA 4ZIRA 4GPTA 3UKDA 1ZC3A 3QNUA 4MRVA 1XPUA 4BEJA 5EE1A 5EXTA 4A92A 5AK0A 5KSYA 1S1MA 2XSZD 4Z8XA 4U00A 4B48A 4PX9A 1T3SA 1U99A 4E22A 3B1YA 4IOLA 3EPLA 2FSIA 2ZSEA 4EDHA 4Q1EA 3VR3A 1HUQA 4HLCA 4CT4B 4EFNA 2REOA 3U60B 2BOVA 1EFRD 3T12A 3ZQJA 1Z22A 3DL0A 2QZ4A 1BIFA 3PUVA 2BMJA 2FU5C 4AWXA 4B3DA 1E6CA 3IHLA 3RANA 3SR0A 3TKLA 1YU9A 3BFXA 2GTPA 2EKZA 3IT0A 2QRNA 4ZCLA 2A6PA 1XMSA 4PAQA 2CHVA 2IEYA 3QKSB 4R2IA 1ZRHA 2ZE8A 1NJGA 2A5YB 4BFWA 3F3KA 1LF5A 3DM5A 4LX0A 1IHUA 4DSTA 2PCLA 3QUSA 2AD5A 1Z6GA 3CUEF 3IO5A 3C15C 3C5CA 2P9FA 1V43A 2ZR0A 2ZEJA 3NH9A 1KNQA 2I3BA 2GHIA 3L0OA 3FPAA 4QGGA 5LB4A 2H4XA 4O0MA 4E03A 2GXSA 4MKIA 1AGPA 3MG9A 2AK3A 2NZ8A 4LHWA 3JVUA 2EYUA 2JLSA 2ZRIA 2LKDA 1S3GA 4PHTA 3FDZB 4M21A 3IILA 4X8MA 5DYGA 4W5JA 4XOIA 2GF9A 4R98A 3TSZA 3FDZA 1TQ6A 1T8PA 4CEIB 1G7CA 3IIJA 5FUXA 221PA 2XGJA 3ZZ0A 1X3SA 3FFBA 3AP3A 1XPRA 1FP6A 1FOEB 5J4HA 4RD2A 4EIWA 2RGNA 3MWLA 3TAHA 3TMKA 1SXJE 4JLPA 2WPDA 2DBYA 5H68A 1A1VA 5JRZA 4TL9A 2ZRLA 4IDOA 3ZQ6A 5E7MA 5CM8B 4D25A 3DHWC 4L4UA 1G8HA 3RNLA 4HB4A 2Z43A 1CR0A 5LDDC 1Q1EA 2VO1A 721PA 2F9MA 4WW0A 3RS0A 1YE8A 3WMGA 4C2TA 1Z06A 2Z5FA 4LV6A 3U4QB 3OFNA 4N0EA 4NH0A 3SFVA 3UXMA 1VG0B 3CWQA 3U4QA 1DAGA 4LV8B 5BN3A 2GF0A 2ANCA 2GA8A 5IHPA 4G5OA 4WZAE 4Q7JB 2QT0A 4EPXA 2J0VA 4AK9A 2BC9A 2FFBA 2IS1A 5BWMA 2DPXA 5F98A 2WPDD 3KKNA 3C41J 3U61B 3ZLJA 3CF2A 2VIIA 1W4AA 1MT0A 5HCIA 1XP8A 2QL6A 4JKYA 1DG1G 2NPIA 4V0LA 3V00A 2OFOA 4A4DA 1KK1A 2ZRDA 2WKPA 4TL6A 2FSHA 1CJTC 4DUGD 4EPVA 1DBSA 1XD2B 1W48A 4TQ9A 3OFND 3GLGB 1VCIA 4QHYA 3W5JA 1KDPA 1XD2A 4ZDWA 1S9HA 2MSEB 3Q5DA 4MITA 1KO7A 2ZRJA 3GLGA 4BFZA 2WMOB 3AVWA 3AM1A 1IY0A 2F9LA 3DO6A 2JEOA 1UDWA 1W4RA 3AVPA 4PSKA 3NC0C 5FR2A 2WTUA 2A30A 1OB2A 1T0JB 4TLDA 2VL7A 4TLCA 1E32A 2WSMA 5TVKA 4W7SA 3PUXA 2QNRA 3CZPA 1OXUA 2X8AA 2FX3A 4TYNA 1DADA 4KSBA 2QI9C 3WNDA 1OPXA 4GFDA 1H2FA 4AYTA 4HLDA 2BJVA 2VRWA 1N3BA 1SVKA 1YR6A 3K8YA 1GITA 4OK6A 1S2MA 4FMDF 1SKQA 2ANBA 2AD1A 2BKUA 3CW2A 2VTKA 3U7FB 2BMFA 3KQHA 1SVLA 2FJUA 1I4LD 1VMAA 4FXPA 2KB0A 2VH5R 1EWQA 2JIZA 3L43A 4PANA 1XMVA 4NCIA 3SE0A 2GJ8A 2OO7A 4CVNA 3MRSA 4A1FA 2XJ9A 2ZI3A 3E2IA 4PQFA 2YKGA 1OFTA 4PAMA 4TQUS 5JEDA 3QQ5A 1SK8A 1LTQA 1XU4A 3EWSA 1RRFA 1U0HC 4NYJQ 3W6NA 2JLYA 1OH8A 3SI7A 4CGZA 2A5DA 3MMPA 2A2ZA 1FFHA 2VF7A 1Q44A 1E2GA 4NCJA 3W8RA 1NSFA 2IT1A 3VX3A 5M04A 4PC2A 5JJLA 4WZBE 3D4IA 1VIYA 2C5LA 2XXAA 4P4UA 5CIWA 2CLCX 2RGCA 3HR7A 1D8TA 2PX3A 4ILEA 2JIZD 4L5BA 3W90A 5KPJA 4O3MA 5EP4A 1KZ7B 1OFUX 4GSYA 1JR3A 1R8QA 2J9RA 2ZYTX 3QF7A 4ESHA 2YHSA 3MSXA 2PLFA 3MWKA 4Q18A 2EFGA 2FG5A 3DMNA 4RD3A 1JR6A 2ZI4A 3DB1A 2W2XA 4L9SA 2Q9BA 2ZM5A 2GILA 2ERXA 3FB4A 4IDHA 3SFZA 4BFVA 4D0LB 1I2DA 2IYZA 2OCBA 4F91B 4U02A 2QT1A 5KNDA 3ZVNA 2OFWA 4A0GA 3RWOA 3LXRA 1KJZA 2CNWA 4QGAA 4EPWA 4PZ9A 4Q9LA 4JJKA 1E2KA 4KHZA 5L3QB 3B78A 3F3YA 1B23P 2REBA 4JL6A 3KB2A 5FPHA 1U9IC 5L3QA 1R0WA 2CMKA 4HAWA 2GKSA 1ZM2A 3UWOA 1JR3D 1AN0A 2HHJA 1GWNA 3NC1C 4TL8A 2H5EA 2QMUA 4YQFA 2HV8A 4URWR 4DCUA 3QSYA 4LV5B 3PXGA 821PA 1G4UR 3LRPA 5G3YA 3UG7A 3DKPA 4XTCS 1T5LA 1XF9A 4LPKA 5EE5B 3RHFA 5C2JB 3IPXA 5L3SB 1PVOA 1QHFA 3GLHA 4V02A 2B6HA 3PEWA 1TUIA 2CNWD 2OUKA 5JMTA 1GP2A 4NONA 1XDBA 4B35A 1PLJA 3P20A 3I61A 1UKVY 4OQFA 4PZAA 2OV2A 3SBEA 2J3EA 3VR6A 2Q3HA 4URVR 2RMKA 3NG1A 4IEIA 4ARUA 1XB2A 2VA8A 4YMSA 1KZGB 5AUOB 1AQUA 1XXHE 4KJZA 1G3UA 4M1KA 2JLXA 3CX7A 4MA4A 3WNBA 1T5IA 2ZROA 4BWYA 2ZYWX 3PEUA 1P72A 1XWIA 3EIHA 4JS0A 2HT1A 2Q9CA 1GL6A 1RPAA 4EAQA 2H17A 4O2LA 1Z0KA 1KI7A 5KSZA 4A15A 4JLOA 1CVIA 2ZS7A 2AR7A 3SHFA 2ZI9A 2VP0A 3OHMA 3ICQB 1QG2A 2X2FA 1TMKA 3HYTA 2O8EB 3FHTA 6Q21A 4M9QA 1R6BX 3B1VA 4UQOA 2O8EA 5BYJA 3MWJA 3LL4A 4AURA 3RS4A 4QIHA 4OBEA 3Q72A 3L8YA 2JASA 2P3SA 4D2IA 3FHCB 4V0OA 2BJWA 1G19A 3K0CA 4WAUA 2ZITA 2GXQA 3PJRA 2B8TA 3QXJA 3IPYA 4ZKEA 1P9RA 4B71A 1ESNA 1FP7A 1PUJA 2ZR9A 3AVQA 2FFQA 3MJHA 4RD0A 1HV8A 5FUYA 4BLPA 4KLNA 2WJHA 3MFYA 2HDNB 4A9AA 1OJLA 2CHQA 3D8HA 1HYQA 3IGFA 4D6PA 1GRRA 4JOCA 3QOFA 2IYTA 1Z5ZA 2E87A 3CIOA 4ABYA 2PA0A 4KODA 1EX6A 4NCNA 1X1SA 2Q3MA 4DIEA 3SC3A 4QJ5A 3TE6A 3PENA 2W6JA 1Q57A 4B43A 2ZS8A 5CLQA 2AHOA 5EP1A 3BE4A 2IXFA 2WWHA 4D82A 2A5GA 4DRZA 3OEHA 1KK0A 2BBWA 3BERA 2BEJA 3CNNA 3MD0A 3BBPA 3U3RA 4IDNA 3EW9A 3SJZA 2C9YA 2OESA 4EUNA 3C16C 1WE2A 3KTAB 4B33A 2ZR7A 4JVSB 5DI9A 3OZXA 1E94E 5FBQB 5TY0A 1SKAA 2QPAA 3KTAA 2QAGB 2D4HA 3A8TA 2IYLD 1E2IA 4V03A 1KGDA 2W6JD 2QAGA 2N46A 1N6KA 3D6AA 3FOZA 4WOPA 2ZJOA 2X77A 3CB4A 1YKSA 2E9SA 5IF9A 4FMDB 1NKTA 1P73A 1DEKA 3AF0A 2P6OA 1RW4A 3OEHD 2Q9AA 4RD4A 4MGIR 3VKHA 2OBLA 3QG5A 2D7CA 2J7KA 3H4MA 4DEXA 1BH2A 1UEIA 4KVAA 1V7QA 1LB1B 3SU8A 1GUAA 3WRYC 4ACBA 4NCHA 3PV0A 2XB2A 2QTFA 3B8HA 4LZZA 1IOZA 2LWIA 4IFBA 5H8WA 1YZQA 2XZPA 4QG7A 2WZQA 5DN6A 3W9YA 4L8GA 3TAUA 2AL7A 3N2IA 2XX3A 4PQRA 5CDHA 3RABA 4GBMA 1RYHA 4HB0A 5FOTA 4TYWA 1ODFA 4P0TA 4EPYA 2J87A 4FCVA 5L8VA 1C9KA 2ODNA 1CR1A 3GCGA 2IUUA 4C4PA 2YWHA 3W34A 2PLRA 3I92A 2BBSA 4CT5A 4Q1FA 1NMXA 3L82B 2QSZA 4CRWB 3K0AB 1P60A 1TQDA 3HU2A 2FSFA 1PUIA 3DOFA 1KKMA 3K0AA 2C03A 5DN6D 4Q4AB 4G5QA 2BM1A 1KI6B 4Q4AA 2GCNA 2TMKA 4TMWA 1MOZA 1E4YA 4LYJA 1IXRC 3ECCA 2YOFA 3SNHA 5FPTA 1SK9A 4QJ3A 3LW7A 1YJXA 1ZP6A 4M1OA 2X2EA 2IYVA 2MMGA 2A78A 2OAP1 1KO1A 2VP2A 3OIWA 4IW3B 3CRRA 3PR1A 4YMTA 1CJUC 1JXMA 3BJIC 3FWYA 1E0AA 1OLOA 4FMCB 1SKYB 5DH9A 3ADKA 1W4CA 2J45A 1GTVA 3LX8A 4HSEA 3EZ9A 1NVXQ 3LV8A 3RVBA 4JT4A 4RFVA 2YV5A 1S9DA 3TIFA 1GAJA 4DEYA 4TYYA 2FFHA 3CNLA 1XNJA 4NYMQ 2J41A 2CVHA 4FDUA 1D2NA 1H8HA 4GDFA 4RZXA 4IDQA 4TMZA 1I4DD 2KE5A 4BZXA 4V0MA 1FW6A 1GM5A 4HAZA 5L3VA 2ZI5A 1UF9A 2UVQA 5L3RA 3HP1A 1ZAKA 5IK2A 4CW7A 4KSCA 3IBYA 2G77B 3MGCA 1D9XA 1II0A 2WICA 3IQWA 2YN2A 3SYKA 1TEVA 4KITB 2HYIC 2ZAOA 3QENA 4LJ5A 2C95A 3QPVA 3UIEA 1N2CE 3PG5A 3V4FA 4I4LA 2IF0A 3LBHA 4GP6A 4MYUA 2GJ9A 4GL2A 1IQPA 1M7GA 4Q7KA 2QP4A 1KNXA 1KDOA 2DWOA 3NKVA 4RZ3A 4S2EA 3TUJC 1ZCAA 3VR5A 1ZUNB 1L7VC 4JVLA 2XZLA 5C4GB 1H8HD 5J4VA 4Q66C 2HCJB 2REXB 2YYZA 1BOFA 3EC2A 3TQCA 1M7HA 4HDQB 4LBYA 1EG7A 3SQWA 3A4MA 1ZD8A 4FW9A 2BBTA 1QRAA 5IK2D 4Q21A 2IA5A 1E96A 2CDNA 3SHWA 2RFLA 4BFTA 1KKLA 3OIVA 2L0XA 2EWWA 2P2YA 3Q85A 2ZE7A 1YZGA 5D3MB 3KKKA 3T34A 2FE4A 4NP6A 1U98A 5D3MA 1JEEA 1XCPA 1G64A 4Q9HA 2DY1A 5LPNA 2ZI7A 3TGPA 1Z47A 1VCMA 4XH9B 2R6DA 1GL7A 3GJ6A 3RC3A 4DCVA 4IFEA 4MUAA 2ZJZA 1IY1A 1Z6AA 3IEVA 2NO7A 3GJ3A 2JATA 1NLZA 3GFOA 4CDGA 3E70C 4NMMA 1HURA 1SVMA 1NN3A 2J1LA 3LD9A 4GP7A 2ZXUA 4YDHB 121PA 4JL8A 3A1SA 2CCJA 3PIRA 3CNOA 1RIFA 1E3MA 4KU4A 4YMVA 3PUZA 4LY6A 3FTQA 2VHQA 1P9NA 4JOBA 3VMFA 1DG3A 3L8ZA 2IBMA 1XZPA 3LY5A 1XJ0A 1YR9A 1XTKA 1E4VA 2NMVA 1G21E 4LDJA 4JYBA 4CEJB 1Q0UA 2IWHA 4URXR 4LJ9A 1YZUA 2JGNA 5AUNB 1G3IA 1VYVA 4CEJA 2JLZA 1XQ9A 5JCPA 2CJWB 1RPTA 3EOZA 421PA 1FZTA 2KBFA 2CJWA 2ZE6A 1EESA 4RZUA 4PGMA 2WWWA 1AZTA 3LVRE 4L9WA 1J90A 3NEYA 4M1WA 3W8NA 4E09A 5DIFA 5KOYA 3DEFA 3A37A 2QG6A 2QM8A 1J8YF 4XWOA 1NVWQ 4W9MC 4I1OA 2J0SA 4QGFA 2PJZA 5ANRB 3EX7C 1JXOA 2B7BA 2RGAA 1G291 5CK5A 1YFKA 2FOLA 1XEWX 1XX6A 3QEOA 3THWB 3K9GA 1G5RA 5KU1A 4JLDA 4TT3A 2CLDX 1DKPA 3KQUA 4QC2A 2NO1A 3LAWA 3THWA 5JJKA 2EOAA 3RS5A 3GLFB 1DAIA 1R5NA 3AKDA 1VDZA 4I1UA 3H1TA 4LBZA 3GLFA 3R7AA 1KI4A 2C99A 4IDPA 1ZU4A 4NYIR 5EE3A 4R9UC 4M0LA 3IHWA 1HEIA 4JIMA 5KHOC 2G1JA 5EXXA 5DI3B 3I72A 1KYIA 3O8DA 4OYHA 3ADBA 5A0FA 3M0EA 2ZJ5A 2FEMA 2VBCA 5DI3A 5JHHB 4BLRA 4KFTA 1G1MA 3T1OA 3U7EB 3UG6A 5GJVC 1KK3A 3A4NA 1P61B 1KSJA 3BAFA 4TT3D 1MO6A 3G82C 3RSOA 1G7TA 3WP1B 4Q7MB 3TUZC 2Q3FA 1QHHB 4G1UC 1NVVQ 2BDTA 3LNCA 3KL4A 3BS4A 1F2TB 1TF2A 4G3XA 5EP3A 2AXNA 1N0WA 4BLOA 1QHHA 2ZVPX 3G5UA 1X6VA 5FTJA 1F2TA 1HA3A 3DM9B 2VSFA 1RRCA 1CJVC 2ZRPA 4XVRA 4OK5A 4JVNA 1EXMA 4P32A 4Q1AA 4D81A 1GG2A 1MO5A 2ORVA 2VHJA 3A1UA 1S96A 1KSFX 4M9XA 3BIFA 3DDCA 4TLAA 4N0DA 5J4KA 1P6XA 1JPNA 4UNPA 4A6PA 3AVYA 2NTYC 3ZH9B 1NMZA 1DAMA 2QPTA 2CEAA 2P9ZA 1G3MA 5AJZA 4PZYA 3AF2A 3KKQA 4P31A 3WY9A 4IOMA 1COWA 2Z4SA 4CEHB 1GRQA 1GVNB 5KNBA 3T15A 3THYB 4FDTA 2P5SA 1M2OB 1Z6YA 2PMDA 3VFDA 4CEHA 1HH4A 4DT1B 3WHLA 3THYA 2RGDA 3QKSA 2V3CC 1CR4A 2R8RA 4Q47A 2QGNA 4LSGA 4URUR 4DT1A 2N42A 2WHXA 2ZRCA 4PSVA 4Q9JA 1KMQA 1LY1A 3PUWA 2CCGA 3NTLA 1GFIA 2OEPA 3O8BA 4EKDA 3IUYA 4OI1A 1ZM7A 4IVRA 4DIDA 1QVRA 1Q21A 3NBXX 4AKIA 3Q9LA 1U90A 3C14C 2XEXA 1XD9A 1COWD 2WAYA 1XTSA 2HT6A 2JLVA 2F90A 1I4TD 3IT3A 1MH1A 2WVJA 5IRCD 3BB3A 3HWSA 1TL7C 2ONKA 4CEIA 3CO5A 4LCBA 5ELXA 4HAUA 3TVDA 2ZREA 1C80A 4TTQA 1G8GA 3MJRA 1X8KA 4LPSA 2P2LA 1FTSA 4BGDA 5B64A 3EZFA 3H84A 2WBLC 4D0NA 4G5RA 4HZIA 2XAUA 2O0HA 1V5WA 4OHXA 4JLJA 1AGRA 1AM4D 2VP5A 4DDUA 3KQNA 2C96A 3KKPA 2G88A 2GCPA 4HUTA 2ZAMA 3FE2A 4AI6A 3RS3A 3HU3A 1PV4A 2WSSA 4DUGA 3J81k 3A1WA 3NDPA 1IXSB 4GMXA 2OT3B 3DZ8A 4M22A 1E58A 3QIAA 3THOA 4M4SA 1II8B 4QM7A 2G1KA 4QBGB 4LRWA 4AKGA 2AXPA 3AKCA 1II8A 1SZPA 4PHGA 3D6TB 3TSWA 4RZ2A 4B2IA 2O8BB 3EA0A 4J0QA 1Z6TA 2BEKA 2O8BA 4MKHA 4OQMA 1XTJA 3WYGA 2IS4A 1J8MF 4C0KA 3BFVA 4PPNA 4DB2A 3BGWA 4P3YA 3TNFA 4B3XA 1FMJA 2FV8A 1QF9A 5FTNA 1JR3E 2WSSD 2GJAA 1OXXK 2P9YA 5H70A 1E0JA 1EGAA 2OBNA 2FWRA 1JI0A 1WMSA 4QGHA 4RKEA 4HBZA 1XEFA 2WJIA 1W44A 3AGQA 5FOVA 4QL3A 2ZIAA 5KDDA 2Z83A 1XEXB 2ZRFA 1TNDA 1UADA 2P65A 2VSXA 3FHOA 1A2BA 1LNZA 4E07A 5CU7A 1T0HB 4ESVA 1UEJA 3BK7A 2ENWA 1XEXA 4LJYA 4HZUB 4ARVA 2GJKA 3B9PA 3D7MA 3LXXA 4HZUA 2J0QA 1TX4B 2CCKA 3GEIA 4OI0A 1CR2A 1T3HA 1QDEA 4DXAA 2NPFA 2GVZC 2C8VA 4UJ5A 1QG4A 1TIPA 5TV2A 4MKFA 4OK3A 4RD6A 5EZ6B 4RSGA 4IHQA 3LW8A 2HIAA 1DE0A 2FNAA 1GKUB 2OM2A 5HZKA 3R8FA 1OW3B 4LWZA 1U94A 2DCUA 4BLSA 4HEJA 1BS1A 3O47A 5AJYA 3GLHE 3TW8B 1CTQA 5B30A 3UK6A 4WBSA 4H1VA 1SVOA 1VPLA 5TARA 3VX4A 2QGZA 4ACAA 1GKIA 4PQYA 1SXJB 3AGPA 2FPKA 2IYYA 3KQKA 4GZLA 3QY0A 2EFCB 1JECA 2HJGA 1SXJA 3FVQA 3Q7PA 4ZDKA 2QMEA 3NHBA 4NTZA 4DZZA 1E9FA 2DFNA 3N2EA 4Z8YA 5E3HA 2CLSA 1OKKA 4KFUA 4Z54A 1IJFA 1W5TA 3PVSA 3D3QA 4TMXA 2RHDA 3NBZC 4Q48A 5KNCA 2Q6TA 2GZHA 3EZNA 1ONBA 3B13B 4QKQA 2OFXA 3RRMA 1R5OA 5CYOA 4JLVA 1JJ7A 3OI7A 5EQTA 1DS6A 1ND5A 2GDJA 5DHAA 4OQNA 2F55A 3Q8XB 2XITA 3HPRA 1PZNA 1XFAA 4HATA 5FFMA 3SJCA 3GLIB 1G6OA 3K9NA 4LOAA 3KX2A 1V37A 3CPJB 3I8XA 1VYTA 4ZDIA 1SXJD 3GLIA 1IN8A 1PLKA 3K53A 4DDWA 4QBHA 1K5DA 2IXEA 4ZDJA 1Q3TA 1G5TA 1OKKD 3CR8A 2FPMA 2AFIE 3MAAC 3NXSA 3M4YA 1FBTA 3ZIAA 2BMEA 2MSDB 4GT1A 1NSTA 1Q1ZA 5SZHB 1ZUIA 1ZCBA 4AYXA 3HPQA 2DB3A 3SQXA 2O8CB 3H86A 2PBRA 1WCV1 3LQQA 1F48A 1RJ9B 4MRRA 4PZLA 2O8CA 1E2EA 2OXCA 1RJ9A 2E1RA 2RCNA 2IYXA 3EZ6A 4MQBA 3CH4B 3BC1A 1P75A 4PAOA 521PA 1OFHA 2XNDA 4Q4HB 3CKLA 4FCWA 3ADCA 4IJMA 4FWIB 5FBLB 1NY6A 3CX8A 4Q4HA 3ZDQA 1EFTA 1LW7A 1MRSA 1YZTA 5L3SA 2IS6A 1CF4A 3CRVA 4AD8A 3CX6A 2C77A 1OV4A 2XJ4A 3ZIAD 4B3GA 1PJRA 2NIPA 2JJ1A 1X86B 1CRQA 5FOXA 2WAXA 4RFSB 1QHGA 4TLBA 4OQLA 5AJXA 2FZLA 2IYSA 3GJXC 4RFSA 1SQ5A 1RRPA 3ZGXA 2VSOA 1E69A
chains in the Genus database with same CATH superfamily
3MMXA 4MRSA 1FRQA 1VPEA 1FQOA 3WRXA 4OD0A 4KR3A 3M6FA 3MHTA 4OO3A 1C4XA 5HDBB 4HJXA 4YUVA 3IS3A 2FPUA 4EF6A 2XWJI 5IVPA 3QLJA 3SX0A 2IYQA 4PAGA 1T4DA 1DZIA 1GR0A 2JW5A 3OTOB 2O1SA 1C81A 3QJYA 1YUBA 4OFWA 3S2SA 1PYDA 2V96A 2A0WA 4ZVTA 1YTUA 1GCAA 3E7FA 1EVYA 3BDVA 4YIHA 3RLFA 4KO3S 5JS8A 5LP6F 2GFIA 3OZRA 5EWJB 4EJSA 3F7TA 3WIUA 3B1XA 4UTVA 2V98A 4BMXA 2QW8A 2QY9A 2IEAA 1FSSA 5K01A 3U7GA 4UE6A 1CNFA 1A9RA 1R0YA 4HI0E 3RTBA 1DAKA 1A76A 3OBBA 1MJGA 1LVGA 2D1TA 4ZCRA 3NHRA 4I6EA 3NPAA 1X87A 2AW3A 3OAAA 2M1ZA 2H92A 4JEMA 4RCZA 1A7JA 1GFSA 1OCEA 1YACA 3U2QA 2HLHA 1NFRA 1X1CA 1Z5VA 3V4PB 3WNVA 5JFTA 1G5PA 5AK4A 3U1VA 4CM4B 1WOYA 5K03A 3C6QA 1JLLA 4E4RA 3QUQA 3DDNA 1T5TA 3TH5A 5BWOA 3M7IA 1N5MA 5JAOA 3CW9A 4TV8A 4ITUA 4O1IA 3LQFA 2Z09A 3A1NA 2G1AA 1LNSA 4HGRA 1TVKA 4UBLA 5FOSA 1RYFA 3EW7A 3AEKB 3O8QA 1JQJC 4UQPA 5EJEA 1GZHB 1BRTA 4A6EA 1BG6A 4I4CA 1QGDA 2ESRA 1W49A 5T4BA 2D7DA 5HFAA 3FVTA 2WIBA 5LNK6 2PXAA 2Q5FA 2XTAA 5HIMA 4KXLA 4B81A 5BOSA 4RV5A 2BPOA 3A4VA 2TECE 1IPEA 4G01B 1QP0A 4MS3A 3RVPA 3WWYA 5D5PA 2EKLA 1VOTA 4QDUA 4YXWA 3C74A 4QOGA 1MW9X 2IU0A 2ENUA 2WWIA 3SDZA 3L8GA 4BC1A 1P5JA 2FXVA 1WX1A 3CV3A 4G5HA 3RRXA 3S5JA 3W3AH 3JALA 1G8KA 1O95C 4BRSA 1CC1S 1IQRA 4NESA 4DR5B 3O26A 4RDIA 4NS4A 1FFBA 1TT5A 1IVSA 1CIPA 3KYCA 4XGKA 4B5LA 5L53A 3DVQX 1X80A 3BIOA 3MB5A 4B82A 3JYQA 1SCQA 2B4AA 1P45A 1GRCA 3EQ6A 3UO8B 2ZYRA 4LTDA 5F51A 5D6OA 2JAWA 2PX2A 2BJHA 3HGQA 2HSDA 2BELA 1VL1A 3D6HA 2WF5A 4HX9A 2J5BA 4Q03A 4NK4A 4XSHA 1X15A 3K6KA 1KJQA 4WXHA 4EW2A 1FXWA 1YA6A 1JBEA 3Q7TA 1Z07A 1JU4A 4GLBA 2VJMA 4W1QA 4L9RA 4PFSA 1E6UA 3ZXYA 4AB1A 1GCUA 3DMDA 3IFSA 5GM1A 2ZB3A 3HYRA 4CHGA 2GPWA 4HTFA 4EQZA 3R3SA 3TEMA 3A1VA 4NJMA 1Z0AA 1AS2A 1OILA 2HF9A 3OEEA 4YI3A 4JL5A 2IIQA 3WO0A 1YVRA 4PBSA 1EH5A 4XJTA 4UDNA 3C7AA 5ALRA 2ACKA 3BMNA 3HUEA 3U40A 3UYLA 1DOZA 5LUAA 5DCUA 1E1MA 3SYNA 2ORED 4GOJA 3SWWA 4NZMA 3C3EA 3V48A 3DP7A 2PAFA 3G8CA 3HU1A 2X5KO 3RRZA 3KQPA 1O6ZA 2XIJA 2F62A 2J5RA 3EWIA 3FUWA 3LY7A 4Q4LA 3VPSA 1O9BA 4TKMA 4Z3OA 1Z0ZA 3I3SR 1NP3A 3VHQA 2UUAB 4I5GA 2IH4A 3HDTA 1CZKA 3AOEA 3F98A 1R8JA 4KTTE 5EEGA 3MIZA 2YVUA 4EF4A 4EI9A 2ORWA 4NCXA 1XSEA 4G81A 1E2NA 1FLNA 1XAJA 3BSFA 5EERA 3UMFA 5I48A 2I6XA 3OURA 4WNYA 2VYNA 5DM70 1O0CA 1DIBA 3BZWA 4LXTA 3ET4A 3RRFA 5GJBA 2RH5A 4Q1DA 1C7EA 4U5QA 3UJ8A 1OHHD 1BFKA 2BP7A 2QVGA 3HMKA 1EGHA 1K7FB 1RVDA 2H0QA 2IOHA 2YUIA 4AUKA 4BP9A 1FVFA 4DF3A 1AZWA 1RQ7A 1Z4MA 1M2HA 4DQ0A 1Z7YA 3MF4A 3N3BC 4ENUA 2OHIA 3BHNA 2AA3A 3Q7RA 3PSAA 3FHJA 3RI3A 1XVAA 1PR2A 1ETUA 1O77A 3RJTA 3URKA 3OE7D 1DKQA 3A1TA 3ZD6A 4JLUA 3ZIDA 2JRLA 3P0JA 3PQ4A 1JFVA 3AUSA 3GV0A 3NM4A 4Z99A 4CV2A 2VTVA 3MWEB 2W8BB 4FGZA 3NS7A 4Y2UA 4DMUB 2QRGA 3ZWMA 1XTRA 2BTQB 1UK8A 5CVDA 2G09A 1P4SA 3VZDA 4P83A 2JAHA 5CB8A 3AU9A 2WV7A 3JSAA 4B3CA 4PRLA 1VB5A 4CTOA 4UTRA 2J7PD 3LLSA 3MWFA 1EVKA 2NU7A 1ZNWA 3RVBA 4I4NA 1OXTA 2GETA 4YV0A 2VA9A 1EJ0A 3BA1A 4ZJZA 1RZ3A 1XNGA 5LU8A 3B2EA 2BGUA 4MGYR 2G36A 2RG7A 5CP8A 1UFRA 5H81A 5CPBA 2FPWA 2QB5A 4N6OA 1F8FA 2Q8PA 4AG5A 2UXCB 4RIGA 4MQLA 4W4TA 4E3WA 1Z4JA 3DBOB 3DFUA 2RBKA 4LZWA 4LBVA 3SS9X 3QLVA 3EAGA 5EIOA 3WGHA 3WKCA 4MHOA 5BQ5A 4AC9A 4C0LA 4C78A 2XLBA 2EJWA 3K4PA 1C2TA 2NNWB 3MTAA 5AHKA 4MW5A 4BRUA 2R9VA 3HLTA 3P1JA 5FO0A 2PJUA 3UT5B 1E99A 4TTRA 3SF0A 4HDNB 1BWRA 2HADA 1AE1A 1PR6A 1L5MA 5JG7A 3KS9A 1JJIA 4TUYB 4MGZR 1QWOA 2RGGA 4UXIA 4WN9A 5F5LA 4WUTA 3WNZA 2ZWAA 1BRMA 1F0NA 1XTZA 3D3JA 4MV9A 3K9CA 4OHRA 3D8NA 1YB6A 2I3DA 2HLDD 4Q82A 3KO8A 3ESDA 3QU5A 2WAOA 3QWHA 4L75A 3RC7A 2RBEA 1OH7A 1WXQA 4UKDA 3RSQA 4B4DA 2A5LA 3FWPA 1JDUA 2XOKD 3ND9A 4JX8A 1CJKC 3A9SA 2BM0A 2QYOA 5LP6A 3EIUA 1CFZA 1K06A 2PEZA 3NDBB 2C94A 1RYBA 1S3IA 1BW9B 1UDXA 1FDTA 1IZ7A 3GAFA 3O9MA 4UDXX 4AVYA 4BBJA 1QRSA 4DLYA 1G98A 2OV1A 1ZJZA 4HNHA 5FR1A 1T3LA 2ODWA 3ORQA 3AEQA 1E9BA 4WEOA 3V8EA 3VNRA 2MT9A 3QP9A 1YMUA 3A4LA 1TXGA 5PGMA 4CYMA 5KOIA 2ONJA 3ZU6A 1Z6QA 2WWXA 2XWSA 4YJFB 4Z4GA 1PJ4A 4LTNA 4TYPA 4EHAA 3OQIB 3EIXA 4J2TA 3NDRA 4P4SA 4UBMA 3PEVA 4GXQA 3VR4A 3HN7A 3GLFE 1ZNZA 1ZX1A 4LJ7A 4JJ6A 4WKNA 4PYIA 4AKTA 3W6UA 5DXJA 4FK8A 1H8EA 1CRWG 4NLLA 2IY9A 2ZB2A 3BOSA 3C6KA 4EFDA 2E49A 3H1FA 1XCGB 4O1HA 1EDDA 3IRVA 2SKEA 1UJ6A 2H0RA 2W6IA 4JNCA 1YXMA 1MN6A 1OAKA 2W2VA 3U9TA 1R50A 4GS5A 3LBAA 4EB8A 1P7CA 1QGOA 1KS9A 1NBOA 2PL1A 3T5GA 3UAYA 2WVGA 4D4JA 1W59A 4LJRA 4BMDA 4HUQA 5A7HA 3B9RA 1ISIA 2X1VA 1B42A 4GLJA 2HIHA 1AJEA 4UZEA 4YVFA 3PWZA 3WK6A 5IDXA 1ZFNA 3EFOA 4ZCSA 2XUFA 3QPWA 2CVFA 2A86A 2H2DA 2N1BA 2Q7XA 2VZLA 1OBHA 4L78A 5BQXA 2A4KA 2E7ZA 3E82A 3LKZA 1OH6A 1HLGA 2ZPTX 1L7MA 1QIEA 5KYXA 4KBFA 5BSRA 2OZEA 3G0IA 3RSLA 1REQA 3EVFA 3LT1A 2QVYX 4NMHA 2FQYA 4LCJA 3D0QA 4M1TA 3TLAA 3C3KA 4LZPA 4TMFA 1RMQA 3KLNA 3SX4A 5LB2A 3K3PA 3VHXB 2ORIA 4B45A 2QY6A 1X0XA 3FPSA 5ELMA 4BX3A 1PFKA 3QY9A 3R6TA 1TQ2A 3AHFA 1OYYA 2B30A 2XUGA 5ALTA 5CAEA 4N1AA 5EKUA 1NQVA 4WNCA 3MINA 3W1WA 5JROA 4NCBA 3Q1KA 4FYVA 5IBPA 1N2CB 3I04M 1LX6A 3B7GA 4IQFA 3NAGA 4KO2S 4UAVA 3Q3GE 2BFPA 4MR8A 4ZO7A 4PYRA 5HRAA 3B1FA 1YJCA 2M6RA 4RKWA 2D5IA 4F1JA 2JAQA 2J32A 1PE0A 1V5FA 2I7VA 5CYGA 4YJ3B 4JODA 3MT8A 1D2CA 1N3LA 2WIJA 4Z1MA 3VNBA 4D8YA 4O4JB 4KMRA 3IVXA 3EQ9A 1STOA 4R2WA 2O2ZA 3QELA 3IQXA 3K72B 4NFHA 5GGXA 1S2OA 1OIWA 4BEWA 2PKYX 5F7XA 3AJ9A 3TZBA 1RJGA 4NHOA 1GLNA 1U63A 3O4VA 3OC0A 3ZVLA 4HDSB 4IF6A 2PT7A 3DW3X 3EULA 1FMTA 2IHNA 3F3MA 3VC1A 2BTEA 1SCAA 4PQEA 2XCIA 1NLMA 1RYNA 4HRVA 2OORA 5J2UB 5K8LA 1ULTA 1SULA 1FPQA 4GPZA 5CNIA 2QQEA 1A4RA 2GPYA 4K6CA 2OO5C 4AICA 3SZMA 3SMVA 4FFMA 4CQMA 1PX0A 1FSZA 3ADPA 3MJ4A 3GO4A 3QI2A 4M7WA 3CPHA 4AX4A 4D5EA 2QR2A 1T2DA 3NNDA 1JPVA 2QMHA 3D31A 1IB0A 3WE7A 4BNMA 5A6SA 2ZYVX 1CRPA 1NYTA 1PUXA 3KKZA 4W7IA 3NYRA 1BVRA 1LGYA 4M0MA 2ZVQX 4D8UA 1VMKA 1W0JA 3LCCA 3MJFA 4JV5B 4TS9A 1NMSA 1ZGBA 2IUFA 2RGXA 1P0FA 3GJ8A 1QE3A 1I1NA 1DT3A 3HL0A 4HNSA 4OLHA 1M72A 2Q21A 4FNGA 5D7BA 4Q6WA 4BVKA 3LDAA 4H1UA 4MQEB 4PY2A 1W2GA 2J30A 5BUSA 2AJCA 2C9MA 4DIUA 2OGSA 4LZOA 3VKUA 2OB2A 1G21B 2ON6A 4QWWA 3EIQA 3OFVA 4B32A 2G8LA 2WLTA 3QMPA 4WESA 3WMGA 1OI3A 4XWAA 5I7EA 1DNPA 4H27A 3ZWXA 1KXZA 1X92A 1UPUA 5ALIA 4CCYA 1M6YA 5CEJA 5LQUA 3ML1A 6REQA 1MD9A 1XAIA 4QFCA 2I3GA 4J91A 1TYBE 2XF2A 2J3DA 1XQ6A 1AHHA 3B89A 1Q11A 1E2QA 1YDFA 3KJGA 2OE2A 1MNAA 1VPVA 1UPBA 4AIIA 2D0IA 3EZLA 5JRDS 1HYHA 1XE3A 2FUEA 4QHSA 1NIPA 1OI2A 5G2OA 3JCZA 5REQA 4CKCB 1CJBA 3W3AA 1V3VA 3BGOS 1GD1O 1WQ4A 3ONNA 1E98A 1QDUA 2MTBA 1DPGA 2REQB 2Z2KA 3I1FA 4IP0A 2LVBA 1LV7A 4N7JA 2RAPA 3TW0A 2W90A 4G1MB 4TZ0A 1JA0A 3R20A 5CNMA 1PEYA 2WIKA 2XTZA 3C48A 3H42B 3LLCA 4HAYA 1IBCA 5FL7A 2IHJA 3VNVA 2E85A 4QPDA 5D3KA 2D1SA 2DYKA 4QEKA 4CCSA 4PZ0A 4Y98A 4JR0A 3FDFA 5EXSA 1CEQA 3M83A 5G0SA 1BJKA 2FX5A 2V9PA 2ZCUA 4MCJA 2CMDA 3MCAA 4PC6A 1KP3A 1F4VA 4O4HB 4H1TA 2XKJE 1PV1A 4R9SA 1J2UA 4FQ8A 1GCIA 3WLSA 4P2BA 3SVZA 3FSEA 4RGVA 4HEHA 5CDTA 2NWQA 3VBCA 2W6PA 3AB8A 1CNMA 1OX5A 3L3BA 4B76A 1Z62A 3EDCA 5FADA 4GX5A 4NENB 1CB7A 4DDMA 2EP8A 3W2HA 5KWVA 1RP1A 3N7TA 4URZR 3OJCA 2FE1A 2UAGA 3PFFA 5AK5A 2DCMA 3FNIA 4IEFB 3R7LA 2X1LA 1FSFA 1D4AA 1KI8A 1NC3A 2WWTA 1R64A 1ZM4A 5AR1A 1S2NA 3W7AA 3F9CA 3VR2A 4EJMA 3JAWA 4FTWA 1XV5A 5KWSA 3L6EA 5HILA 4C7OB 2OXFA 4ZO4A 4J7CA 4OHVA 4ZVLA 2FSVA 1LU9A 2WJ4A 1KP2A 3TZEA 1ZVQA 1FRVA 5JJIA 1GPNA 2I33A 4EUKA 3L41A 2X8JB 2ZJ8A 1MG0A 5BRNA 4PSDA 4N03A 3IKTA 1Z5PA 4YMUA 1YR3A 3OMWA 3QBEA 2DFKB 3CZRA 5CFZA 2XE7A 3TZKA 2NG1A 2D8MA 4UCQA 3WWPA 2DGDA 3TTVA 1WXDA 3FIJA 4IOKA 5I4BA 4ZAYA 2P30A 3HJGA 2OBMA 1JAHA 3OPMA 4I55A 5KU7A 2HMVA 1HWYA 1M76A 1G4AE 4POAA 3EGOA 4IR7A 4EX7A 2J9FA 1QGYA 1WTAA 2CL6X 2FA9A 3A36A 4IJ5A 13PKA 1FTNA 3KL2A 2J4DA 4TRJA 1AQJA 4XRGA 1EXVA 1CQPA 3C70A 2A1UA 2GVDC 2W2NA 4FDVA 1OUMA 2ZS9A 4ZRDA 1N5IA 2Q4RA 4J75A 1HMYA 3UMRA 3CISA 1NNSA 1MB9A 3HXMA 3GLIE 2CXNA 4MVJA 2ZIEA 2IV7A 2A4MA 3A1EA 2GYYA 2GRJA 3LTEA 3WHKA 3UOGA 5K3EA 1MH9A 1EM6A 4CF4A 1Y7HA 1SIWA 3DZJA 4PONA 2NSHA 3I5AA 4AO8A 1PWYE 2CYCA 4QUKA 1P2VA 4Y7DA 2Q1SA 3M4XA 1N1EA 2VHZA 2JFVA 3W5CA 3HVKA 3ICOA 4BP3A 4ZVPA 1NIJA 4MK4A 3BIJA 4DNXA 5C46F 4AT1A 3ZQ6A 1DC7A 4RF4A 1HNWB 1GA4A 2LDXA 1XVVA 3RT9A 1N1MA 2GSDA 4C29A 1S7CA 1H3FA 3EDOA 5KNBD 2DQKA 5JS2A 3S99A 1EU1A 4BZWA 3TIGA 1Y4SA 3TZ6A 3PNSA 1KGSA 3EY4A 3QEMA 2FR8C 1ZUHA 3FHLA 4HWRA 3NMUF 1IVNA 2Q3DA 4C6TA 1GO2A 1FL9A 3DGEC 2F17A 1YB1A 4PYKA 3X1MA 2JJ8A 2JD2A 4IKPA 1G8MA 4WL0A 1SC9A 1LS1A 1YDHA 2C5FA 2D74A 3DVSX 5EHNA 1GZUA 1M0SA 3DAHA 4LDQA 5H3HA 2VRBA 1FLDA 2OV6A 1ODIA 3M82A 3RAPR 1M3SA 3AM5A 2A14A 3BREA 1VE1A 3L8HA 3M3PA 3ORSA 4B1FA 4D6YA 1FTQA 3IE2A 4RADA 5CITA 3V33A 1GNPA 1I2ZA 2OCLA 4NBWA 5FPSA 2QRMA 4KLCA 2NXEA 4EG3A 1ECJA 2VZ9A 2B37A 3O4FA 3PQ2A 2IC5A 1Q3HA 2EAUA 3LCVB 4PBRA 4RJJA 1KDVA 1XRNA 2I8AA 1KMHA 2SECE 2ZP1A 4RGBA 1NW6A 4ARZA 4DLLA 1YULA 5JIBA 4E11A 2G70A 2QDXA 4XGQA 3NWPA 3IT1A 1NW7A 2PMEA 1P6QA 2V6MA 1XVIA 3QA9A 4L6CA 1E3JA 3RWBA 1TI7A 4DV1B 1UBLS 3LP6A 4C87A 4DSZA 1QC5B 3GP3A 3A6ZA 4KREA 3FPKA 5CFPA 4QVIA 3UA4A 4BV8A 5T67A 1TUEA 1KU0A 2VF5X 4YGXB 5HPYB 3UGKA 4MRAA 1ZJ6A 4FZJA 4JDUA 2OLKA 2EBWA 3BWXA 3LQRA 5SZJA 3AEZA 1J8VA 1RNLA 1TK9A 3IOEA 1QBKC 4JLKA 3T4XA 4MW6A 4BLUA 3IIIA 4DJ5X 4QG3A 1L7RA 4L4XA 3N5CA 3HB0A 1N5RA 4BO4A 4E5VA 1Q1BA 2R4QA 1F9AA 5A4MS 2YBDA 2IK8A 3L8DA 4WVFA 3GJ0A 1N2XA 5AO9A 4OHKA 1FPMA 2WIAA 5JAQA 3VA7A 3ILHA 2VYFA 3MM4A 1B0PA 1UJNA 4U7WA 2XYQA 3JWIA 4Q15A 5AP9A 1VA5A 2W6QA 2CKMA 3SSAA 3T4PA 1C8KA 3BH6A 4DB4A 3PNLA 3UTDA 2QSYA 4NZNA 1C14A 3MNFA 4BASA 2DX7A 1Q0TA 4EG0A 1P3JA 1R74A 3GT4A 4ETWA 4BQSA 1SVWA 4RL4A 1VJGA 5BMVB 5ICEA 5JCXA 1PLLA 5J43A 2GM4A 2R00C 4EB6A 2X19A 1TIKA 4KAXA 4X41A 5EZYF 3KXIA 3OPNA 4KPGA 3K6RA 1R3DA 2ZJ2A 3SIPA 4XTRA 1ZGZA 4FMCF 1GXSB 3ZBTA 1M0EA 4FSXA 4F5ZA 5IU6A 1E62A 1CZHA 1GIAA 1HY3A 4OYLA 3GXOA 1JFRA 4BNLA 2JA1A 3UAXA 5BUCA 5AKEA 5IYZA 3LXUX 1DJNA 3ZQ4A 1UWKA 3OUUA 4Y6OA 2IITA 4RMIA 1M54A 3NTRA 4L16A 2SHKA 4B8ZA 4ZREA 4HNAA 2BI8A 3ASYA 3F9RA 1NM5C 1WDLA 3F7NA 2P4HX 2PWPA 5E9JA 5A7FA 3GROA 1LNQA 2JJ2D 4U7HA 1Z26A 1PR3A 2R1VA 3EXG2 3C5VA 4NV0A 4KIWA 2CHGA 1N77A 2EW1A 3L4SO 4CCAA 2Z1DA 5F73A 3EMVA 3R9XA 4WZBA 2DM6A 4A5SA 4CF6A 2FOXA 3B6IA 1QQ5A 1L9XA 2C92A 2IY7A 4X8LA 5L3ZA 4DLWA 3U56A 1GPH1 1HZZC 3DA8A 1HE2A 2FPPB 2IDMA 3QJGA 4ILKA 2AN9A 2UYYA 4D8TA 1BMQA 3F7MA 1I9CA 6AT1A 3ESBA 4I1RA 1BU5A 3KOOA 1US8A 5EJ8A 5JZSA 3E9RA 2R62A 3MVEA 2OVFA 3GL9A 3PVCA 4J29A 2O8FA 4ZC1A 3SZLA 4AN0A 4CMHA 5BURA 2R60A 2JJQA 2A9JA 4H9GA 1LH0A 1ZEMA 5G0UA 1LBQA 4ONEA 4CLOB 2F4NA 5C5IA 3MPUA 3B1WA 2HSWA 4RF5A 5JNSA 3GQBA 1FFDA 2Y68A 2PX8A 3ZNPA 1A5AB 2AFIB 1TPZA 1P2UA 2B9EA 4MQMA 1BQ3A 2PSFA 4HEA1 3HO6A 3C2QA 4JYZA 2VEDA 4K0KB 3WGLA 4Y0VA 3QX8A 1X42A 3K2EA 4XCVA 3OETA 2NV0A 1LLDA 4I9UA 3ISVA 1WHTA 2H08A 4O3FA 4DBVO 1P7YA 1A9XB 1PDWA 1WCIA 4OQDA 3RSZA 3WGZA 3I5YA 1X1QA 4FFVA 4IG9A 1TYDE 5KYWA 5IX8A 3TX2A 4JLAA 2OCPA 1UKZA 3KYDA 5EE9A 1YGYA 1QFSA 3RQIA 1J5PA 4LC1A 2G04A 1T1IA 4I0WB 2B92A 1LZKA 1W0KA 2XCLA 2QTLA 3IDQA 2AHRA 4BQRA 4DUZB 3THXB 4AG6A 2DG2A 3CPSA 1UBGA 2I6QA 1AHNA 3EGIA 2ZRAA 1R6TA 3H1EA 4IHJF 2OKCA 5JLJA 2IYEA 3TR0A 3IR7A 5JSFA 2B61A 2GJSA 3VOTA 4RPGA 4IDDA 1UXGA 1BNCA 3QFCA 4TKZA 3TO5A 3LUKA 1WV1A 4C9BA 1XEWY 1I7LA 4HX2A 5EWMA 1Z7GA 4KXQA 1W5FA 2NUAB 1UOOA 4I36A 4DGSA 1EK5A 5LKRA 1D0VA 3S2GA 4K40A 1KVQA 3HJRA 5ENVA 2CV2A 5JJLA 2PWAA 3BGVA 4MZXA 1RM0A 3PYXA 3R6DA 4EY8A 5L45A 3RC8A 3L7IA 4AM8A 2FDCA 1XCMA 3N70A 5FPYA 4GRDA 2HWWA 2Q49A 1KZ9A 5KKAA 3VJKA 3W5IA 3BRCA 3ND8A 5IDYA 5I51A 3KPVA 2F1JA 1AS3A 4P7BA 1YDMA 3C8ZA 1JYEA 1BDHA 2QXUA 1BMFA 2V6IA 1T4MA 2XB8A 3BKXA 4LJAA 4YJGA 3UUGA 3VRHA 5K3AA 4DLTA 1PZFA 2QJTA 1V1MB 2EQ5A 1CBUA 2O3QA 3P19A 1JDNA 1JJVA 1UZMA 2ATXA 2O5RA 4EEXA 2BGWA 4G0WA 4GM0A 1KOFA 1EP3B 2HF2A 2WZDA 1B8VA 2DQZA 1ZMTA 1X7GA 1VFNA 3HCOA 3BXXA 4KQMA 2IDZA 1ECPA 4G36A 2R2GA 4OHWA 3E03A 3TQIA 5A2QA 3K9QO 3PQDA 4P4NA 3A1CA 4X1KB 4OXQA 1ZNXA 3ZJYA 4H59A 5D51S 3GZNB 4EB3A 4II2A 2J0UA 3C5WP 3QI7A 3S2FA 2HYDA 1EPUA 1WUYA 1Z39A 3NGXA 1U3WA 3EJWA 3DKKA 4LYFA 4CM1A 1K3TA 1UMKA 3K4QA 4M88A 3RVMA 3L4BC 1IONA 4F3KA 3E1GA 4CTNA 1KYYA 2GEDA 2P5TB 2ZBQA 1T4GA 1PFGA 5H4HA 3LUCA 4BO3A 5B36A 5FQNA 2O2YA 3LQYA 1GVHA 1IFXA 1ECCA 2Y1KA 4QSMA 3IL2A 4HRXA 1F5NA 5GZ6A 4UEOA 4D41A 1L8LA 4M8NE 3PB3A 3AVUA 1E1NA 4YJ2B 4DAOA 3U4MA 1CQZA 4QBIA 2WJJA 5D1NA 4ESOA 5ILQA 1R9JA 2OHFA 3NV9A 4H77A 2FSGA 4DV5B 4P4TA 4GOXA 1RABA 4U2GA 1A95A 5F77A 3L7BA 1Y7TA 5T3YA 1R0RE 4B6OA 4UTPA 1KZ4A 1FP4B 2WKSA 2WINI 3GUVA 4EJ6A 2VJDA 1L4HA 3JVDA 3JAMA 3B2NA 2FKNA 4II7A 1LRLA 4PINA 1K66A 4N3CA 5FX2A 4EATA 1WQ1R 2QEQA 4ZEVA 3MHPA 3H9QA 5BNZA 1KK2A 1QYWA 1P1FA 3FGOA 2XKAA 3KOUA 1LRJA 2B8JA 5H82A 3MCVA 4OSEA 1I7SB 3OD5A 4HCJA 4LQCA 5FH9A 2O8DA 1E61A 2ZJ7A 3DE0X 2FW0A 5DK6A 2EGUA 1U8UA 2WUVA 3HCWA 4MCIA 4MYSA 4TMTA 1TJPB 2JHPA 3T4EA 3AF6A 2C7RA 2V97A 4ZYYA 2WJAA 4F93B 3AVTA 3FNHA 2V7QD 2FEWB 3LRTA 3VSBA 1S4QA 5JVDF 1E59A 5TEVA 2BH2A 2GKGA 4Y8VA 4MJ7A 3WK8A 4XWKA 3Q8MA 1EB9A 5LM3A 2IWRA 4B44A 2ZIVB 4YV1A 3VYRB 1EFPA 4LXHA 1KE1A 5I7RA 3O8CA 3E0QA 4AZ0B 2QJOA 1K2WA 4PNZA 3T7SA 1N9GA 2OSBA 2XQKA 2OYCA 5C18A 3KIPA 2AZMA 2XUOA 2BFBA 1U65A 4ZOLF 1CQIA 3BORA 2CV0A 1QX4A 2O2XA 2NUTA 1E1QD 1UMCA 1NXWA 3M33A 1KP9A 2QTNA 1DTSA 3GYBA 5CJ2A 5F35A 2XCRB 2C8KA 1DVRA 3PQCA 3D5TA 3UPUA 1JHAA 1YBMA 1ZO8A 4XVHA 1Z0DA 4RACA 2G9NA 4JFRA 3SYLA 3A28A 4CLRB 3IAFA 4LFCB 1NNLA 5K6AA 1LSJA 4MWSA 1KJ8A 2BH9A 4MO2A 1WBDA 2RC6A 1LS6A 2IL1A 3IP3A 3L05A 1G2IA 2P6NA 1BAPA 2V0CA 2YZ7A 1VSVA 3WAGA 2W0SA 5DGIA 1TO1E 2UUBB 1PS8A 1UMDB 4L07A 4YP0A 3QXCA 1XJQA 4RF3A 1A77A 4E15A 4X62B 5KWEA 3AY6A 3KB6A 3FYUA 3TFQA 1USIA 3OTWA 2GK7A 3JQGB 5DHSA 4MW1A 2XV1A 3PRKE 1DAHA 4LVCA 3EZYA 4ZHQF 2B99A 3JASA 4I1YA 4EA9A 3EARA 2IBSA 5DOZA 3N2YA 4ZQFA 4JLBA 4JMPA 4L8WB 3FPEA 2E4VA 3L7YA 1UP4A 4PN3A 4A0FA 4IXNA 1JTFA 4DR1B 2ZBPA 3IULA 1F6DA 1SUSA 2WU1A 3H5NA 4OIFA 2JFOA 2VWGA 3KD2A 5JZ9A 2VDRB 3DPUA 5H3LA 1JAZA 3EZGA 4IAOA 4QFMA 3U49A 4UNNA 3WWOA 4B3RB 4UU7A 7MDHA 3MIIA 1J22A 3MILA 3R3JA 3DLTA 3H2YA 1QE0A 3E22A 4N6GA 4GMDA 3DWGA 3SQLA 4PWYA 5KJCA 6ABPA 1F8XA 3RROA 4MEBA 5IH3A 4Q0MA 2FF5A 1SOVA 1LI4A 4RIIA 1APBA 5G53C 3THRA 3VKGA 3M9XA 4G5SA 1DDGA 3JV7A 1DBVO 4KYIB 3UOAB 1OZHA 2Z4RA 1E2HA 5BNIA 5EJFA 4NAHA 2WY2D 1O94D 1QLHA 1D7OA 2WMDA 4YRKA 2RHWA 4RSMA 1MJFA 4IGAA 3WFIA 3WLAA 1OX6A 3FD8A 2V7WA 1DAPA 1Q0PA 2DP4E 2VQSA 1ONPA 3S1AA 2BTOA 3KQVA 2N9UA 4TTSA 3RVQA 3NIGB 4BO2A 2G07A 3FVWA 3F5FA 3V6LA 1QHIA 4ODIA 4L1KA 1IE3A 2C2WA 1DU4A 1BZYA 1T36A 2OAQ1 3SEAA 2O54A 3IAAA 5FQOA 5GONF 2VH1A 1FUEA 4NI5A 3BDAA 3GA7A 3GDOA 1ECGA 3R9WA 2OFFA 3ICVA 2BZSA 2GPNA 5EC8A 3EA5A 3TPCA 2JFQA 1A8UA 5LZ2A 3QYPA 5D86A 2I4LA 5KYYB 1U6KA 2NUBA 4YRSA 3WQQA 5JZVA 4DR4B 1WY5A 2CZGA 3QKTA 5ADWA 2GESA 1ZICA 5JXGA 3H2GA 3AI1A 5HJ5A 5JSZB 4HLUC 3ADOA 4G0NA 1OU4A 4JBNA 3ZS9A 3O4IA 3L7MA 3ONFA 5F76A 3WMRA 5B12A 1D4FA 2C5GA 2HDHA 2HRDA 2NX2A 2XNSA 5A0TA 5LQJA 2W6ZA 1ZH2A 4I1IA 4A27A 4LC0A 2IH2A 1EVQA 2ZIWB 4LCEA 3F5SA 3CNBA 2MJLA 4EO7A 1Y9AA 3OPYI 3REGA 1LK0A 1OFUA 2XB4A 3E35A 4B4OA 1IHXA 1VE6A 2A0UA 1LBIA 3GFPA 3NBQA 1N5KA 3KSUA 3OJEA 4J1TC 5AJVB 1R4ZA 1QQ7A 3I4CA 1DFIA 1D6JA 2CKDA 5KO2A 1MV5A 4FWBA 4DSAA 2TRSB 2WHEA 3H0KA 5SZIA 3EPKA 3ROPA 2NVBA 5BR4A 5KTKA 5D2CA 2IX3A 2QBYA 1VSBA 4ZYTA 5HQ3A 3EVDA 4MGKR 5F7OA 2FR1A 2ZTHA 3P9NA 5AM4A 4NMXB 2HMAA 4JBHA 2XSZA 2IXGA 4XCQA 4EFMA 3Q6NA 2RGEA 3DBLB 1WLYA 2VTBA 5HHTA 3WIVA 3M49A 4JBIA 4K2HA 3F73A 3D2AA 2KI5A 4BAZA 2HMWA 4FEEA 4DCNA 2BFWA 5CX4A 3W5AA 1X1DA 1Z73A 1DQNA 4C0HA 4KYTA 1UCFA 4PLPA 4EYSA 5FTLA 3DEYX 1ZINA 3DF9A 3DR3A 3E4CA 4QJIA 4DR3B 2P78A 1K0FA 1NVAA 1U9IA 1G5IA 3A6LA 4NU8X 4XA8A 5K3DA 3RVNA 4ZIRB 4PHHA 4DG8A 2HQBA 1J20A 4Q3KA 5BUZA 5F1PA 3ZKWB 3CVUA 1WSBA 3T3OA 2PMBA 5BNWA 2WF8A 1E1DA 3QWFA 1LUAA 4P5DA 4NSNA 1XPUA 3KWJA 1XU9A 3Q0TA 1E3EA 4MVJM 4NC9A 1BXRB 4HD8A 3WSTA 2A0YA 4OSOA 5AK0A 4A92A 1O9HA 4EUFA 1CDZA 3LKDA 5KSYA 4W5OA 4U00A 2GFHA 4ZI5A 1W88B 4L8FA 5A4DA 4YRZA 3EK2A 4IOLA 3EPLA 3A9VA 2ZSEA 4WOKA 5KCMA 3QVGA 3MCTA 4FQ7A 1PKXA 1V16B 1Y9DA 2OCKA 2Z1MA 1USGA 4HLCA 2XUQA 3U60B 1CEYA 2C4VA 3L8CA 4B84A 2AVNA 2H3EA 1UUFA 3AHDA 3DL0A 1Z8NA 4KN5A 2QZ4A 4RPCA 3PUVA 1W8DA 3LC1O 2HPHA 2I78A 4RANA 4DC0A 4DYHA 4RTQA 1HDRA 4JUIA 1VRVA 3MYYA 3VBEA 1RWVA 4NVRA 2H2HA 3IHLA 4OHCA 3MC1A 1D7AA 5AH0A 4XE5A 1YU9A 3TKLA 3BFXA 1YS1X 3D5EA 3VUEA 2GTPA 2EKZA 2RHOA 3ZLVA 5JVDA 1NW4A 3NZEA 4Y30A 1JSXA 3SC2B 4KI7A 4N8EA 4DR2B 4BFWA 3QHPA 5BW4A 5ITZA 1ZA2A 4D3ZA 5E2BA 4CKEA 3ND7A 4DSTA 3ZQKA 4WXYB 1D4OA 3DR5A 4J4TA 5JZOA 4EYQA 1ORHA 2O3JA 5DNDA 1O6GA 5C81A 3G2HA 4ZOLA 4R51A 3V8MA 4W5TA 2ZEJA 3S2IA 2PKQO 3C3PA 3J7TA 1ZI6A 2EF1A 4OYYA 2HQRA 1ZI8A 4GI1A 3RKSA 4DMFA 4ROTA 2IPXA 3TD9A 3N0RA 3E3OA 4AF8A 1TZCA 2WD7A 5JNTA 2VDWA 2AG0A 2EYUA 2Q9UA 2ZRIA 5FXMA 4CODB 2FJ0A 5KTTA 2FCAA 5DGTA 5FWDA 5I9SA 2QTBA 4RKQA 3U80A 1DX4A 1M2KA 4XOIA 4Z4IA 2HNKA 1T8PA 1IK4A 4WBNF 4CEIB 4J07A 1UANA 2AOUA 1UFVA 2C2BA 2OZLB <