1X7XB

Crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
329
structure length
329
Chain Sequence
b'EYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-oxoisovalerate dehydrogenase alpha subunit
publication title Molecular mechanism for regulation of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase complex by phosphorylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 124
structure length 329
sequence length 329
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1x7xB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1x7xB01
2C31A 3ZHSA 2J9FA 1UMCB 2JI7A 3HYLA 5EJ7A 2JGDA 1X7YA 1JSCA 2EZ4A 3EXEB 2O1XA 2VK1A 1ITZA 1Q6ZA 2BEVA 2R5NA 1X80A 3M6LA 2G25A 4K9PA 4QELA 4C7XA 2VK4A 1UMBA 1OZGA 2X7JA 4K9KA 5ERYA 4JUBA 4Q9DA 4K9NA 5EJ9A 5K6TA 1QS0A 1L8AA 1X7XA 3AHJA 3DVAA 2EZ8A 4RJIA 5I51A 3AHHA 1UM9A 4JD5A 1R9JA 3OE1A 1POXA 3EXIB 1TRKA 2Q28A 2OZLB 2BP7A 3DV0A 1V11A 2Q5JA 2BFCB 2XTAA 2Q5LA 3AHGA 2V3WA 4K9LA 1NI4A 3JU3A 2YICA 2VBIA 4FEGA 1DTWB 3M49A 2BEUA 4QQ8A 3EXHA 1UMDB 1QGDA 2JGDB 2BEWA 2FWNA 1OLUA 4KXUA 1UPBA 1T9CA 1V5GA 1T9DA 2WVGA 4JUFA 1UPAA 3EXHC 2BEVB 3EXG2 1X80B 5EJ4A 5DEIA 1OLSB 3FSJX 4QPZA 2Q5QA 3KOMA 4GG1A 5EJ5A 2C42A 1QPBA 1V1RA 1QS0B 2BFBA 1YHYA 3FZNA 3F6BX 3DVAB 5I5EA 4KXWA 1X7ZA 2WVAA 5HHTA 2JLAA 3IAFA 5I5GA 2AG1A 3OOYA 2BP7B 3DV0B 2IHTA 4GM0A 3AHDA 2EZ9A 3ZHQA 5K6RA 3LQ1A 1V16A 2JI8A 3EYAA 1W88B 1NI4B 2UZ1A 5AHKA 2VBGA 1V5EA 3IAEA 2C3UA 1WCIA 1GPUA 1V1MA 2Q27A 3E9YA 4K9MA 4D5GA 1TKBA 1OLXA 1U5BA 4JUCA 3EXFA 2BFDA 2Q5OA 3D7KA 3LPLA 1X7WA 2EZUA 2AG0A 1T9BA 5HGXA 4JUAA 1KEKA 2BFEA 2G28A 3DUFB 4MQ5A 2BFBB 3F6EX 5EJ6A 4KXXA 1X7ZB 3MOSA 2C3MA 1UMDA 2J9FB 3ZHUA 5DGDA 2O1SA 1UMCA 1V5FA 1OVMA 2C3PA 1TKAA 3AHCA 4GM4A 3AHEA 1X7YB 1V16B 3RIMA 4K9OA 4COKA 3EXEA 2JIBA 1MCZA 3M7IA 1YI0A 2IEAA 1UMBB 2VJYA 4WBXC 2DJIA 4K9QA 1WCIB 4XEUA 3ZHTA 3AI7A 4FEEA 2JLCA 4MZXA 2VK8A 1YBHA 5I4IA 4JUDX 4MPRA 1T9AA 1IK6A 1B0PA 5EJMA 1X7XB 1OLXB 3AHFA 5K3SA 2IHVA 5HJEA 1Y9DA 1N0HA 4JU9A 1UM9B 3L84A 3LQ4A 1X7WB 1RP7A 5K2OA 1V11B 3HWWA 1YD7A 2BFCA 4RJKA 4KGDA 3AHIA 1NGSA 5HYVA 1YNOA 5EJAA 1YI1A 1Z8NA 2BEUB 1DTWA 2WVHA 3EXHB 2QTAA 4JU8A 3UK1A 2YIDA 2BEWB 4GM1A 1OLUB 4GPEA 3FLMA 1YHZA 2JI9A 2PANA 4KXYA 1OLSA 2NXWA 5ERXA 3ZHRA 4KXVA 1UPCA 5FEMA 1POWA 3ZHVA 4MPJA 3UPTA 1V1RB 1TKCA 1PVDA 4ZP1A 2PGNA 5ESDA 1W85A 3M34A 1PYDA 2BFFA 2Y0PA 5EXEA 1PO7A 2UZAA 2XT9A 2W93A 2C3YA 1AY0A 4C7VA 2EZTA 2QTCA 2PGOA 3EA4A 1W88A 1OZFA 2UZ1B 5IMSA 2G67A 2XT6A 3EY9A 2Q29A 1V1MB 1ZPDA 5EXDA 2E6KA 3HWX1 1BFDA 1U5BB 4GP9A 4RJJA 2C3OA 3EXFB 4D5EA 2BFDB 3LQ2A 3EXIA 2JI6A 2R8OA 2OZLA 2BFEB 1W85B 4MPPA 2R8PA 2FN3A 3DUFA 5EJ8A 1PI3A 3EXG1 5DGTA 2BFFB 5C4IA 1OZHA 2PDAA 2IHUA 2VBFA
chains in the Genus database with same CATH superfamily
4J3NA 3R8CA 2V7GA 5JCJA 5IVPA 4IXMA 4TYWA 1GPAA 3V97A 1AMNA 3WJ1A 1V0JA 1H4QA 2GR9A 1ZSVA 3GB9A 1WOYA 5EERA 4ZEOA 1ECFA 4K8RB 1QIFA 1XZIA 2IEGA 4AW9A 1M3SA 4IMJB 3IUSA 4LDZA 1FB5A 1U0NA 2NO4A 2Y1DA 2A58A 3D4NA 1PP4A 1SBCA 1NNI1 4BGDA 2Q5HA 1Z2EA 1CY8A 3C2QA 3RF6A 1Y98A 1NE7A 4DIOA 3PD1A 5I7UA 4MUIA 1PK7A 3GRCA 5LOVA 2OXEA 1U7ZA 2VJLA 4M53A 5F7JA 2LV8A 2XCLA 1WZEA 2X15A 1YA6A 1XZNA 3B13B 4I3FA 2G25A 2DP4E 3O94A 1OFIA 2NOAA 2O8EB 3AWIA 4IVPA 4LV5B 4W7HA 2VXOA 4MPTA 3E82A 4JUBA 1ISJA 1NMEA 5IKMA 4DT1B 1JIIA 4OUKX 1PD1A 5HEKA 5EP1A 5KQSA 4YVFA 4IFEA 4LJKA 1CJCA 1CY4A 4YPOA 1R6BX 4OK6A 4GWKA 1B1AA 1JAZA 3RHTA 1XVIA 1C9KA 3T7KA 5A9SB 2YVQA 1HSZA 2RJNA 4M86A 5HUJA 4KK4A 4RMHA 4YR9A 2HBRA 5CA1B 3CPEA 4E5SA 3AEUA 3WZ2A 4I1PA 1K8RA 4OI0A 1LW6E 2HBZA 1RM5A 3KSMA 4LBZA 5MGNA 5I51A 3HO8A 4X93A 3VZRA 4AUMA 1Y7PA 3FJYA 1DRVA 1RAGA 1NW3A 3HRIA 1ZVKA 4Y9DA 1WU7A 4TZ0A 3X0DA 3VMMA 5KAMA 1QYCA 1XK7A 2R68A 2B2CA 3NHLA 1M2GA 4ENVA 3I3OA 4DA9A 3JQ8B 3HBJA 2BFCB 1D3AA 2MSKA 2QMUA 2KPOA 5TS2A 5FTMA 4ZXFA 2MU1A 1L4MA 3A1VA 3ENNA 2TYSB 3IPXA 2VDUE 4YDRA 1SXQA 5BW6B 5CW2A 4CKEB 5KSWB 4YWHA 2H7VA 4Q1BA 3TEJA 5AQEA 1P7ZA 1AT1A 1XMJA 4RQBA 5C1PA 4RK0A 1MU0A 4UNSA 2C2KA 1OWMA 2J33A 4P0TA 4QGBA 5EOVA 3JZMA 3RRBA 3Q0EA 2CL5A 5KUTA 2FYTA 4OFXA 2F3PA 2H8KA 4CFYA 5JZ9A 1WETA 4TTTS 4W63A 3SXUB 5LQKA 1CP3A 2Z8XA 2FSFA 1KDTA 1VRVA 3KKMA 3R6GA 4DC1A 1YIDA 1KEPA 3DXXA 5AK6A 4BQIA 1LLFA 2ZI6A 5EE0A 2FPUA 1F6DA 4BKUA 5FDFA 1ZM4A 4UOQA 3VO8A 2ZLBA 2VEOA 3P9PA 2NUBA 3MQFA 4JLPA 3UUFA 3ZWQA 5BWCA 1VFNA 1Z5VA 4D9CA 3SLKA 3GGJA 3E61A 2WFLB 4IV8A 2RB4A 1FJ2A 2RGCA 3K70C 3C6BA 3UHPA 4M9CA 2HI0A 3AFGA 3PEEA 4C3OB 1D5CA 4F93B 3U7QB 2CD7A 1SCUA 4IJ5A 2PH1A 5ERGB 3RJZA 2IHKA 5CDGA 5IT0A 3SNHA 1SC1A 2YY5A 3N28A 1ZRHA 3N86A 4F9TA 3T5DA 1ODTC 3VKWA 2J8ZA 2F4NA 2CFCA 7REQA 1NUPA 1DEAA 4FDVA 3FWKA 4HQ0A 3NLLA 2JVJA 1NVUQ 1ZG3A 2CMDA 3FPCA 5BMVB 2H57A 4ILEA 4L0QA 2BFBA 3V55A 3NHWA 3A9RA 4PGAA 1YHYA 1A1VA 4FZ5A 1S5PA 3SLGA 2JFGA 2Z9CA 2XRYA 1E77A 4PYIA 2ICAA 1RQLA 3IVAA 4UHBA 3E8MA 3A14A 2HWWA 4BO4A 2BDTA 1ODIA 2NAFA 4N7BA 1G6HA 2IYWA 4EGCB 3P9CA 2JLAA 4ZHQA 1QF6A 5I5GA 1E60A 3OOYA 2H9IA 2NU8B 3SZRA 5JQWA 1PEDA 1DC3A 3FYDA 4LA4A 4XSGA 5JI2E 1TMGE 3IXMA 1PQPA 1XD2A 1ZQ1A 3ETLA 4V0QA 3ZY2A 5FI5A 3L02A 1E3DA 3PGVA 1X86B 2FR0A 1I6LA 4UMFA 2OHJA 4A23A 1UBFA 2OQVA 1IDN1 2PUGA 1GU7A 3T52A 3E27A 3HWRA 2NXCA 3N87A 5ARCA 2I8LA 1EFUA 4HDMA 4BE7B 4HFMA 3FCYA 3HL4A 3L7OA 4AJ9A 2NP7A 5SZIA 2GBLA 4EENA 4M87A 4FGSA 4CEIA 4GL4A 4PPYA 2OFPA 3N07A 3PD0A 1DXYA 1G8PA 2FPLA 3E3AA 4N49A 4UTVA 4FU0A 5KSPA 5AHKA 5AUOB 1H23A 3CBQA 3WQQA 2JPDA 5FNVA 1L5VA 1RQXA 1ZR2A 5JC8A 2HEGA 2I33A 3DO5A 3DO6A 2E89A 3VYRB 3X44A 3TBFA 3S40A 1CUHA 1ECPA 2UUPA 1IOLA 1B8UA 1P60A 1DAFA 1TQDA 2WPDD 4R01A 5IN5A 3UOWA 3TAHA 6GPBA 1PZGA 2DPGA 2NQ8A 1RYNA 2D7JA 3F2IA 3HZZA 3LDUA 5J2TF 2LKDA 1J1IA 3IQXA 4NENB 1E6WA 3AU8A 3S2GA 4A36A 5LJLA 1YE8A 2CYAA 1QXSA 4PQGA 3OBIA 4EMSA 2XE6A 3IJEB 1UKBA 1Q0TA 1BMFD 4W1QA 1JV2B 4MGIR 4TKLA 1J7KA 2KWIA 1B8NA 1QHFA 1CJUC 1YR9A 4X1YA 4Y67A 2VNJA 3O3MB 1P4AA 4R1LA 3L8MA 3TCNA 2QGZA 2X76A 4DV1B 4X9XA 3H2BA 2PXCA 2GARA 3L8GA 1GLVA 1DBWA 4XR9A 1MHTA 4G1CA 1L3BA 4AJ2A 4QWWA 1TM7E 1RHUA 3HA5A 2Q2NA 1BRTA 2PT9A 1XLTA 3C45A 5EMKA 4EJFA 3IMFA 4EHBA 1RLTA 1BQ3A 2GLXA 3HBAA 4WN9A 4DDUA 4IRMA 4OJQA 1NJ8A 4MQEB 5EE9A 1I1NA 4QYTA 5BQ3A 3IEVA 2YXPX 2F55A 5KNCD 2OFXA 2IYPA 2UVQA 1X7ZB 1PT5A 1UBGA 4L5CA 2FZKA 1JB9A 4MS1A 5CH3A 5T4BA 3TOVA 2C3MA 2E4XA 5JPDA 3T5PA 1UMDA 4QHSA 1NQUA 1J25A 2ODEA 2QN3A 4YJHA 3THOA 2E5LB 3VSAA 1CUZA 1LPMA 2MSCB 4ES6A 3MRVA 3T61A 4PRYA 5FBLB 1GQ2A 3PXBA 1NURA 3PFGA 1WF3A 2IYZA 3LW7A 3NDIA 4UEJA 1CZKA 1G5HA 4R0VA 2VJOA 4NCHA 1SUWA 4BO1A 1ZXXA 3RTEA 4CE6A 3RIMA 3JYOA 1LNSA 2D5IA 2IVZA 4YAOA 3PUHA 1CK4A 4OHMA 4FSHA 4NYJR 4DQXA 2O8CA 1B2RA 1FFHA 1MVLA 1X7DA 4O33A 3QPWA 4G63A 3K6SB 4TLAA 1BVYF 5E9JA 2V4MA 3IHWA 4ND6A 3T4UA 1K8QA 4ROSA 3TB6A 4K9QA 4C4OA 4KQ1A 3TLAA 1WCIB 3AJ8A 4WBNF 4Q1VA 2HIMA 4RYLA 3VBEA 4EX7A 3B9BA 3NBUA 1M10A 1S2GA 1YZYA 1A4XA 3DAOA 3EOBI 3KSUA 5EKUA 1R16A 3OOHA 4RKWA 5LPNA 2I1LA 1AK9A 1T9AA 1BMFA 1NX6A 2YYSA 4W5RA 3X43A 2ZJOA 1EFPA 3BH0A 4NXMB 1QO7A 1TJPB 4IOLA 2GN1A 1PDOA 4NYIQ 4PAMA 3UMRA 3UANA 2ACVA 2VQ3A 1R0WA 4YT2A 1U0HC 1QIMA 2JS7A 3W3AD 1ZI6A 2AVNA 4PC2A 5B7QA 5JS8A 3SF8B 4D98A 3TW0A 1EUDA 1U4NA 3BL8A 3DH0A 4OQEA 1IZYA 1SQFA 4TM8A 1UM9B 1E3WA 1RAFA 2JFYA 2JJ8A 4IJMA 2QR5A 2D54A 3HLKA 3T7CA 3UW1A 4PZZA 4WLUA 4OQFA 4HZUB 3I76A 1IG0A 1LV7A 1YVDA 3W4JA 5KNCA 1ZAYA 4AJEA 4DQDA 2FP3A 5C53B 2PXAA 3GFRA 3LLUA 1L7AA 1EAMA 1FDOA 4RHFA 1U0OC 4CM6A 4YAUA 1VFPA 4GQBA 4LDRA 4CIXA 3E5RA 1C29B 4ZKEA 4AURA 3FCAA 4FJ1A 1QQBA 4G36A 1N5MA 4E11A 2CXPA 4K3VA 3QYPA 1C2YA 2ZWAA 3DLAA 3UMFA 4OCZA 4OM7A 2JH9A 3TZ6A 4FIZA 1WKBA 2C88A 4YFVA 1GRNA 3AP3A 4DDTA 4ZDJA 2TMYA 1EX7A 1O7JA 4IZIA 5FTNA 4BKRA 4B46A 4HXYA 4B35A 2BEUB 4P5EA 3TLCA 1TE2A 3CS3A 5JH7F 5K2MA 3QMWA 1A5SB 5ABPA 1N6NA 2FWIA 1SC4A 2PT5A 4FDTA 4ZVQA 2HPAA 5AW9A 5T4FA 3PQ3A 3WGZA 5B7NA 3ULKA 1O4WA 2FZGA 4LRSB 2DH6A 1Y48E 1L4UA 3E0XA 1UAAA 2HJVA 2WV7A 4KR2A 1G2PA 1T1IA 2PS3A 1E98A 3SDBA 1PSZA 5DM4A 1G8AA 2YHSA 4IDCA 1I24A 5ANRB 2JFXA 5DH9A 3U37A 4ERNA 4DV3B 4ER3A 4E5NA 5F2EA 3W6UA 4JLWA 1C4KA 2EFCB 2DQSA 1YHZA 2YL2A 3DLTA 5FPSA 5A5EA 3A0UA 4Y1RA 1YZLA 3NS7A 5J1TB 3QHAA 1BWSA 5CFRA 1GD1O 3Q9NA 4GBGA 3UEOA 3IQZA 2FZLA 3DBRB 2JZNA 4KG7A 1E2MA 4LRTB 4UBJA 3CRW1 3K9WA 4Z8YA 3V2UA 3U6KA 5KJFA 3FHJA 4KXVA 4RF2A 2REBA 4J7AA 1RQ7A 2V3VA 2YN0A 4IGIA 4BYMA 1L4HA 4A0GA 4YCNA 3ZWNA 2YKGA 4TZ6A 1E1KA 3KQSA 2R1UA 3OZBA 3P0HA 3W3AA 3GRVA 3UKDA 2F9FA 3DEKA 4BLSA 3SSNA 1NKVA 3C6ZA 3EXAA 4FLEA 2WUVA 9LDBA 3HU5A 2BBTA 1UOEA 4MI9A 5ALIA 5KC8A 4AQ7A 5EXSA 3P9YA 2QTWB 5JQGB 1N3YA 4RY9A 1QWOA 1KC3A 2V74B 1KAQA 1NUTA 4NOLA 5CLHA 1EFVA 2F4VB 2FDXA 3ZV7A 4TROA 1TYDE 2BM0A 4GAEA 3PC4A 4IZ6A 3K4HA 3UOAB 4BLPA 3VR6D 4CIVA 3O4FA 1TAUA 4UHEA 2WG0A 4R8VA 1P17A 3GJ8A 5FPYA 4C4SA 2FXIA 1ENOA 3NXSA 5P21A 4CKBB 2FMFA 5KYUB 5FKJA 4BZWA 2JAHA 1TLLA 2O50A 3CRNA 3QXHA 2XBMA 3T7IA 2Y1LA 5JAHA 3C24A 3I0NA 1AS0A 3D4PA 3A37A 2FPXA 4PLHA 2EU8A 3V9AA 1JL3A 1KK1A 2XMPA 4JL8A 4KMMA 3MZ0A 1C4XA 1BXGA 4G24A 1YZ3A 2V54A 1Z0SA 4QG7A 1WIWA 1IY9A 1XYGA 2DBVO 4IG9A 4KH0A 2IYSA 4CVNA 4EI2A 1CSEE 1PGJA 3LAWA 2OC9A 3CEPB 3K15A 3WGMA 2CVOA 2XI4A 1L0BA 3VSDA 1NMYA 1KY3A 1SCAA 4C1NA 2FWPA 2ZJAA 5AVUA 3DE6X 3D6JA 4LOLA 1X13A 2YV3A 2WHQA 5E2IA 5H1YA 1DAGA 1I3NA 3CIOA 2V9CA 1QFZA 1Z38A 4QBKA 1Z3IX 3VZCA 1PK8A 3M6MD 3N5KA 4U4AA 2C9OA 2H8GA 2VPZA 4PFQA 1JG6A 1SPBS 1U9ZA 1VL8A 2AT1A 2B3DA 5DGIA 4HQ6A 2AFRA 1NRWA 1GA4A 4OJTA 3U6BA 2XUOA 1G5TA 4FYKA 3EXFB 3LUGA 4MMZB 3W78A 1L4GA 4DLBA 4Q66C 1MIOB 3V2HA 3WA7A 4C5AA 3ITNA 2J5XA 3OAAD 1OTYA 5D6OA 2H2HA 4JK3A 5EJFA 1A77A 4OQPA 3RABA 2G63A 1XRSB 1O0CA 3DLHA 2F8SA 2Y6UA 2RGXA 3GBSA 1YCGA 2V7XA 1KFBB 3R8FA 2WZCA 2YWHA 4F0JA 3ESAA 2MINA 4X1IB 1QBKC 3BHMA 2B8NA 1L4BA 2QJWA 3PDJA 4KRGA 5B5SA 4UEOA 1AV7A 2MMGA 5EJEA 1SU6A 1P19A 4BP9A 4LMRA 5CVTA 1V2HE 2JD2A 4F9EA 4AD8A 5KWEA 2C84A 2IEBA 3NZEA 4DAOA 4DC0A 4ZTZB 3PITA 2XBLA 3VR6A 1EJ2A 5C4IA 3A26A 1FFDA 1W5BA 2W2NA 3F7TA 1KYYA 4FW8A 1EVLA 1ZNZA 4GMXA 3PE6A 4YCAA 1DNPA 3MERA 5HUHA 4XGQA 3ZLVA 4FXOA 4HXEB 5LBIA 3UCEA 1RQNA 5BSMA 4RTKA 5EWLA 5K9ZA 1P9LA 3QBVA 3EGXB 3NBFA 5CJPA 1MO5A 3OJLA 2R8YA 1ZFNA 5LJIA 1PR5A 5IVIA 4CUZA 4Q9JA 2RHTA 3KZVA 1JEJA 1QTIA 1C0EA 1YDHA 4H6VA 3ZOKA 1HTBA 3VNBA 3EGWA 4CV1A 2HZBA 3JYQA 4LE1A 3GEDA 1TK9A 4QGFA 3WZMA 4C1BA 2QXYA 2NUTA 3VSCA 5LL6P 1THTA 2SECE 4BN5A 4DKXA 4U7TB 5JARA 4OX9Y 1VLZA 1NLYA 3LUPA 4YJ3B 2IUUA 3TWOA 2OCKA 3W7BA 2GPJA 5E1BA 3Q3IA 3FDZB 4PX9A 3ER6A 2Q2WA 2W2XA 3DQZA 3JQPA 1KMNA 3NNDA 3OZVA 2W9XA 4JBLA 5IAEA 1BN7A 3VKGA 1J0DA 3RJMA 1ZGZA 3SC4A 3B1ZA 2QXUA 3P2IA 3V00A 1REQA 1UP6A 3L6BA 1VGRA 4ND8A 4Q4JA 2DLNA 1J33A 2WHPB 2C61A 3GA5A 5CIQA 3O93A 5DTQA 3RREA 2NO7A 2CFOA 4AG5A 3A1SA 2CGEA 1U2ZA 2QD4A 3MF4A 3EG9A 3OLXA 1T2FA 2ZAIA 3TOSA 3W8EA 3ZWCA 2PMDA 5A4IS 4I5DA 1RKBA 4RHTA 2VNAA 3JWPA 5CCXA 3AUAA 4MGKR 2WYIA 3AFHA 3D54D 4EBFA 2HQSA 4D81A 3QQ5A 4EGQA 1F06A 1H9AA 1YNSA 1OXXK 2FJ0A 2JAPA 2V7EA 3OAAA 1V45E 4R2LA 5C3MA 5A71A 1Q14A 4UC0A 3F46A 3DC7A 4FFSA 1W8IA 4M8NE 2BYTA 1DAIA 4LJSA 3I4CA 3QTTA 3ANSA 4M0UA 3B5EA 3R5FA 1Z16A 5JDCC 3EGVA 3ZKWA 1ZBQA 4ODIA 4JJAA 1J09A 5JO0A 2ZZMA 4XVQA 2JATA 2VJBA 2HRBA 3MBKA 4PC6A 3DDNA 3ED1A 3QMPA 1DADA 4QATA 1WXXA 1Z5ZA 1XZAA 1Z2OX 3JTMA 4P3KA 3RS7A 4AKIA 3V8QA 1OXKB 1FTSA 3HDGA 2WIDA 4C21A 2HJHA 1R4NA 3V80A 2G8LA 3GRKA 2JJ1A 3O4JA 3CE9A 1G42A 3CU5A 3AUJB 5ADVA 5F52A 3W5AA 3A3PA 1ORDA 4MEBA 3TNYA 1S8AA 3FTQA 2C97A 2QA5A 4DWOA 3CLSC 1F0YA 3F97A 4DLKA 3N6RA 3ROGA 4NU5A 1AKRA 1OREA 4EHKA 2CCKA 1T9GR 2C83A 4JI6B 3QFTA 4DVJA 3KQNA 5HCIA 2UYYA 4DJAA 4N76A 2IYEA 2ZWMA 2XHZA 4IIEA 2B92A 2W83A 3UXEA 3C5VA 1K1EA 2D5LA 5ILQA 4ZI7F 3CEMA 1FLVA 2FLWA 4DY4A 4F6LA 1G98A 1O5TA 4IAOA 2Y77A 1CIVA 1YQ9A 4OXYA 3ZK9A 4ZQHA 5E8JA 3SY8A 1X14A 2H4XA 1GPLA 1P18A 1MR3F 3BMCB 2WVGA 3PF8A 4ZCTA 4PR0A 4BVJA 4ZMRA 2PMCA 3LKVA 4PHFA 4MVJG 1X3SA 3C7KA 4LK2A 4LVCA 2ZUTA 1H65A 1K5PA 3AMVA 5DE3A 1FSFA 1I36A 4BFSA 1FCJA 1NL3A 1AXGA 2G09A 3TRIA 5BPHA 3GFSA 3P9RA 3KJFA 4PYNA 3HJFA 4EMBA 1PX2A 1TGYA 4MRSA 2ZGVA 4BUZA 3WMRA 4ZCMA 1O1YA 2B1IA 1Z74A 2E85A 4NV3A 1D2RA 4HD8A 3EPJA 2I7XA 5LYJF 4P38A 1R8JA 1ULSA 2JIPA 2Z2ZA 4GR4A 5JBNA 1GNVA 1ZMTA 2XGGA 2ZJFA 3NBYC 3ZGYA 5JFOA 2IH5A 1E96A 1SUDA 3IKVA 4RZIA 3T9BA 4BNDB 2C9DA 4CI9A 2XUJA 3I1FA 4IDEA 3W9YA 4GR9A 1EWRA 1V9SA 3GRAA 4X20A 1CYDA 4JWTA 1ZGBA 1Y37A 3GUHA 1RYEA 4DQUA 5KNDD 1TYEB 2NSDA 1DZ3A 1MOQA 4LQCA 1NBMD 1J0BA 4KQ2A 2PGXA 4K9RA 1KRWA 3DBOB 1ZNYA 1TCAA 3OD1A 3T3OA 5DWVA 4DLSA 1A95A 4WMLA 1WQ3A 2YOFA 3A1DA 2BP7B 2P6PA 2P3OA 3DM5A 5FA8A 3UJ9A 3DV0B 1TU3A 5DVZA 4HNRA 1F9EA 3NHMA 3H9UA 4MA0A 4LRQA 1VL2A 1NNSA 2EZ9A 2V55B 3CUUA 4RCZA 1TIBA 1NBME 3GPDG 4RZUA 5CB4A 3T1TA 1LQTA 4O5OA 3VR4D 1DIAA 5KYGA 3SR0A 4MR7A 2ZJZA 4QGSA 5JMPA 1YRQA 2D5AA 4P93A 2UUOA 2QJTA 2JB9A 4URYR 2JF0A 3W79A 3G0IA 1H2FA 2WDPA 1OF1A 4G1VA 4TMFA 2XUAA 3MILA 2A6PA 2B6NA 1O97D 1WLSA 1EJBA 1CETA 3U48A 1PS0A 1E0KA 4TS4A 1I2MA 1CQJA 4UTXA 4E4RA 2ZSFA 1IQRA 3OZRA 2NU7B 3IAEA 1KI2A 3MXTA 1E2LA 4URWR 5A0FA 1ZU5A 5EEHA 1T0PA 1JJBA 4YUWA 3O0TA 1U2GC 3NDRA 3AUKA 1T4DA 1JHOA 3KFXA 1PJTA 3B1KA 1VZ2A 4CCAA 1Y89A 4UDYX 4F2DA 2UVPB 2VP6A 4D5GA 1Y5RA 3UA4A 221PA 4TYYA 1Z5UA 3FMFA 5BT9A 2MHCA 4JLKA 5KTMA 1VQ1A 4EEXA 1ZCJA 2ZROA 4JQYA 1OLXA 2UYOA 4Q7EA 4QUDA 5IJXA 3NX4A 2J32A 3VR5D 1RYBA 4DSOA 3FVQA 5JBQA 2O52A 3HFGA 4QU5A 3G2IA 1Q3KA 2QXTA 5KYNA 1SRRA 3Q7RA 2R6R1 4C43A 2Z30A 3AERA 2RKOA 4FN4A 4NZYA 3S2EA 2ZTUA 2GK6A 1VIDA 2BFEA 2C9CA 4CF5A 4OBBA 3MB8A 4RGVA 1MX9A 2VHTA 1KEWA 3G0HA 1QIDA 3AF4A 3DMHA 1T25A 3JQBA 3PQ8A 3QIAA 4NESA 4MUKA 4OGFA 4CLOB 2EW2A 2OPBA 4L27A 5AJYA 1NBMA 2YS7A 4BS9A 4WZBE 1WSWA 2B2XA 3OKAA 4RKQA 3ZCXA 3LOUA 2ZUCA 2BZGA 3FD8A 3QLVC 4KXXA 3IC5A 4C30A 4BNIA 1SVMA 1JILA 2VWQA 2YN2A 4H7DA 3CW9A 4BWGA 1P1KA 1GNRA 2GPWA 4HYEA 4EABA 2O0KA 3L18A 4EB6B 1NUQA 1VKNA 3FLAA 3PE3A 1G5IA 4Q4CA 1Z6YA 2B3TA 5C8YF 2R4TA 3F3KA 4F96A 3EC2A 2I78A 2J9ZB 4B3IA 5CDTA 3DONA 3G6KA 4OFZA 5DM0A 3VR4A 4WJLA 2QRHA 1LPAB 4F3YA 5CPBA 2GCOA 2BF7A 5KSOA 3FWPA 5D5HA 3T5BA 5JE8A 1VGQA 3TNLA 1PR2A 3C15C 3KYDA 3KDPA 1PT8A 4DDKA 4FS3A 4HNHA 4BGVA 4W8OA 1DFIA 3DOCA 5HX7A 3I6ZA 3SX4A 4NBSA 4AZ3B 1KBZA 3GNQA 3R9IA 1E6CA 2BHRA 2QUZA 3D3KA 4IICA 4AQYB 1RJEA 3OTWA 5B7GA 2D1SA 2B1QA 3DDOA 4J7XA 3RH0A 1MRZA 2FW0A 4FUQA 3VZQA 4JEMA 1YI0A 3TW6A 2VTKA 1ZM2A 3UJAA 4RULA 4C89A 4PWZA 1VLQA 3V1YA 2XNJA 3WNQA 1JS1X 1V4NA 1YKGA 1ZEMA 3BSSA 2QIOA 5LIPA 3V7YA 4TVSA 5ESWA 4MZXA 1YOVA 5DN9A 4E33A 1L5OA 3BRWD 3Q7IA 2PMWB 2P2CA 4NQRA 4WFQA 4XD7D 3TQSA 2D6FA 2J85A 3CUWA 4LBWA 1L8XA 3D8HA 3OIVA 1T9KA 4PBTA 2ZYSA 4FOOA 4RCVA 2LW7A 4JROA 2WTEA 3VR5A 4BQQA 3OCUA 2B5VA 3BCUA 2FPRA 3OQHA 3QQPA 4M88A 4UQOA 3M6XA 3AHFA 1XCJA 3R23A 4WZBA 2QAJA 3T4EA 3D6FA 2G04A 2IVFA 3EOAI 3RGGA 1GLNA 2DT8A 3BGDA 2O2JA 4TV9B 3GUVA 3KT8A 4RPJA 3TFQA 4EQ6A 1FJGB 4QGHA 4GU5A 1MVNA 4IO1A 4D3DA 4QPNA 2CNKA 4TUYB 4C7MA 2C29D 2G8NA 2W2QA 2Y2VA 4UE3S 5CA1F 3VXKA 2FR8A 2H1HA 4XUDA 3VGPA 1FZTA 1OPRA 3O4RA 3FROA 4MV8A 3STXA 3UMMA 1PQYA 3CUVA 2HNKA 3A6EA 1A9YA 4OREX 1PFYA 1M5RA 1NVVR 1SKUA 2ORED 2I2BA 4BO5A 1H0KA 2RCNA 3DW1X 3W6PA 1HNXB 1Z0ZA 1R5OA 4X3PA 3AQIA 1ILWA 2QAIA 3JZAA 5GONB 4CIWA 2EP8A 4TN5A 4FJ0A 1YDWA 1GPBA 1L5MA 3E18A 4MUFA 4ARIA 4MKHA 1QK3A 1Y6GA 4LVUA 2QGNA 1E3IA 3FJ1A 1I1OA 2P90A 2XUKA 3HVRA 1NN5A 4HGNA 3OPYI 3K9FC 3T15A 2C5GA 3ZD7A 1LW7A 5HM8A 5TF0A 3AVPA 4UPVA 1LB1B 4EEKA 4DBLE 2P3SA 5FL7D 2QDXA 3G9TA 3DG9A 1U28A 4Z1OA 1IM5A 2V6FA 3E4DA 4HN9A 2DULA 1CLUA 3MEQA 3UWDA 2OCGA 2ZYRA 3NPMA 2FUEA 4DG5A 2PRKA 4AYXA 2JFPA 5ALSA 1C8VB 3GLUA 1EUCA 1DQRA 2AR7A 1EGQA 2O3SA 2JAXA 1WHTB 4H6XA 4ZU6X 2P2SA 3CVOA 5T67A 4LNUA 1C7IA 5BQPA 4A15A 1C1HA 4Q4HA 3TUIC 3U17A 3USCS 1U8AA 3AVYA 2O2DA 4QUKA 2ES4A 3BRWA 4C5BA 4DIMA 1D09A 3F74A 3WBFA 1FU4A 3CSUA 1JEDA 5KAPA 3SYNA 5AJXA 4MRRA 4DV6B 3O7WA 4REQB 2BSQA 5FEMA 1S6YA 3GRPA 3NGXA 5LMZA 1GTRA 3BFXA 3MWEB 5G0VA 2Z2IA 3UPTA 4HWPA 4LMPA 2AOXA 2QX7A 3NP9A 5ESDA 3AJRA 2W00A 4WNCA 4PG7A 4CKCA 1JXAA 3AESA 1PYDA 3SSMA 3UJ8A 1Z7YA 4W5WA 2ACWA 3U81A 1V3VA 2Z5GA 4X0EA 3SXPA 1P39A 4CUJA 3ZY4A 2FJPA 1KYIA 1KAEA 4KXFB 2NU6B 3R7DA 1Z47A 2R44A 4IWXA 5AXBA 4AWAA 1XZMA 5HZHA 2IITA 4MWSA 1Q0QA 3AY0A 2YJGA 2QX4A 4Q93A 4FBLA 1GCOA 2QVYX 4OXKA 3LTNC 3A1CA 2C5BA 1D7OA 1YOBA 4IMPA 4MRMB 4R98A 3D2LA 3T3PB 2ZSKA 3K0FA 4X85A 2X14A 5LLDA 1Y1LA 4NIMA 1GQYA 1Y9AA 5C9ZA 2P9FA 1DHRA 4L8FA 4QT0A 2YFYA 5HIMA 4C4TA 5I3CA 5KU1A 2E4ZA 1G59A 3BWXA 3MGBA 2Q99A 4BPRA 3WRVA 1XTZA 3M33A 4FBGA 4QODA 3DDCA 5KX5F 3H8VA 4F7DA 3CNQS 3EYWA 2A67A 3I9FA 4HSGA 3KIPA 3VJMA 1IVYA 1G4HA 2IEDA 2FEXA 3PVCA 3SEZA 3TAUA 3M9WA 4TKZA 4LS3A 1RKXA 2QW1A 1JIXA 4GVPA 3C16C 3EAGA 5GAJA 5IKPA 3IP3A 4BXOA 1OD6A 3QUQA 3RCBA 4BRUA 2OO3A 2VSFA 1BGWA 3L1VA 1UC4B 3HEMA 3PFFA 5DW0A 5EPEA 5LSAA 1R50A 4E2FA 3R9XA 1J49A 1DQYA 1M8PA 4HR7A 2D59A 4PQRA 4PO3X 3UYKA 3A2NA 3KZNA 2BR3A 3AG5A 1RXCA 2PRSA 3SZLA 3U7JA 5KJCA 4AO6A 3L0OA 4ABTA 2RK6A 3CZCA 5ES3A 2JGJA 4Q48A 1EQUA 2VF7A 5L51A 4N82A 2VUSA 3MA0A 3LQYA 1XEFA 1AKEA 1CQZA 2C07A 3RHFA 2D2VA 3AVQA 1LTQA 4CIAA 1P3DA 5E4JA 1G63A 2XGSA 5THKA 5CEJA 1QVAA 4Q12A 2W2KB 2W6ZA 5F4ZA 5LXTF 4GR5A 4B3BA 2R66A 4FFBA 3CYFA 5GINE 2JASA 1VCHA 3ASVA 4ZGWA 3GGGA 2WSLA 4A0RA 2UZ0A 5AW8A 4PLPA 5KPDA 1N57A 2A0FA 2AN3A 1G20B 3NOOA 1IY1A 2ZRAA 2EFGA 3MN1A 4D3SA 2WNIA 4FNOA 4G5FA 4IUYA 3OVMA 3PKJA 4Q3LA 4ZT6A 3ZTTA 3WWPA 1CUXA 1JZTA 3JYLA 4KXMA 9GPBA 3CMMA 4L95C 2QT0A 1O8BA 2Q3MA 3E3NA 2I2WA 2QSZA 1S2NA 2X8AA 1EX1A 1AXRA 4KO1S 1DIGA 2BIFA 3O3CA 4GZ6A 2PKQP 3THSA 4MO9A 2CFIA 4Q24A 3UTDA 3ICEA 4IDDA 4DXHA 2CBGA 2EYUA 3FE2A 4EG1A 1JIUA 5B4TA 2GLTA 3ETDA 3LQRA 1SKAA 1DL5A 2FN9A 3ZGNA 1T2NA 1Q3HA 4Q4AB 3BHIA 3RAFC 4YONB 3SKVA 4P7BA 2YOGA 2XKJE 4URHA 3T95A 5IBCA 1QPGA 2NO9A 1QAOA 5FOTA 1R10A 1M2KA 1RQGA 3JQAD 2WLSA 4BZPA 3ZQJA 3W05A 2HHHB 4B3GA 4ZFNA 1ADYA 1EUQA 3RBZA 4F5DA 2P6RA 3I34X 3FYTA 3ND5A 1SUPA 4CKWB 4PQFA 4TXLA 4DILA 3K9LA 4M2LA 1HKUA 3OA2A 4DAEA 1WMAA 1L4NA 4OVKA 3WWDA 4NZMA 1XQ6A 2AC4A 3NKLA 1RCUA 2CXXA 2H18A 1OIXA 4DS3A 4HEQA 1XTQA 1NIJA 2G9UA 1WCYA 2P77A 3QVMA 4RE5A 4ZOLA 1M2NA 2R5NA 4DCVA 4DN6A 3M3PA 4PZDA 1OBCA 1WM1A 2WSMA 4WIAA 1TIPA 2HTEA 2X8JA 3RT1A 3WB9A 5CCEA 3MJVA 3KKNA 3R7WA 2CL7X 4KSBA 4K9KA 3A28A 4OLFA 3TQCA 1C0IA 1F17A 2GBLC 2CUZA 2QG4A 4XIFA 4IIJF 1TTHA 2X0RA 4DLWA 4RTQA 4LF9B 4RMGA 3QVKA 4OLBA 1DQZA 4BU0A 2CJFA 1XNGA 4I55A 4WVFA 4G56A 2QTGA 4E2YA 2QMQA 1OCEA 2WU1A 4K9NA 3H0CA 1EFDN 3PU6A 4N18A 4HJRA 1QS0A 2HD4A 2X0KA 1XK6A 1C0PA 3MFQA 4LWQA 5E6RB 2BLLA 3IUJA 3LCMA 3QVGA 1RHQA 5EIHA 4L9SA 3OZWA 1O6GA 1AQUA 1RPTA 1UAYA 1MQ8B 3DVAA 4JJFA 5K03A 1Z0AA 2CWDA 2YDYA 2OSBA 3IQEA 1Z63A 1UDCA 2BMWA 2H00A 2AZMA 3QVSA 4RQAA 4HB4A 2BAGA 2GWHA 3FRHA 4NOMA 5EESA 4DQKA 1FP2A 1POXA 3AFIA 3EXIB 4BQFA 1YBMA 2I29A 3OSZA 1MOPA 1XHEA 2MWMA 4EKDA 4MVWA 4D8TA 4OB7A 3TLMA 4I5GA 2XMDA 1UZAA 4LGCA 2HIAA 3TKAA 1OB2A 3KPWA 4GRIA 5EAIA 1YIAA 3K5WA 4BLRA 3I2KA 3CURA 2R3SA 1X92A 4II7A 4TWAA 3PFBA 1DTEA 1SVSA 1RQ2A 1WKVA 1K5HA 1G3RA 2ZS9A 4G07A 4UVIA 3KALA 3K9GA 4CMBA 3U13A 1XLTC 3IT2A 5AD1A 1NVWQ 1QMPA 1IM2A 2AOVA 3A1FA 5CM2Z 3BMQA 3RI3A 2G06A 4NPHA 1AA9A 2C2ZA 3KJQA 4OH7A 4K0KB 4QBIA 2D2XA 3H8SA 1I7PA 4QXQA 3GFGA 1CR6A 3F47A 3V8NA 4J6FA 4C4PA 3QE3A 1M2OA 5KYYB 3U40A 3EXHA 4D9EA 1L7DA 5I4BA 1Q1NA 4MPDA 2B4QA 1LDEA 3GARA 4MB0A 1LBEA 4K40A 2VTVA 4W4TA 5JNLA 4CIBA 4QHTA 2PYDA 1ZO8A 3C1AA 1UPAA 3GQBB 4YJ2B 4Y2XA 3ZD9A 1EP3B 3IPRA 3NGMA 3TG8A 3QOXA 2NZXA 2WTMA 1GGNA 4RJTA 1KAHA 1CNFA 4ZQGA 4KZKA 2INGX 1HRDA 1XCBA 4H6PA 2HSZA 4XFKA 1QF9A 4BUCA 4C4AA 1ISSA 1U0SY 4EO7A 3OD5A 4DRXA 4YP0A 5ALYA 2IOFA 5JALA 4BP1A 1TVKA 3CV3A 3EZLA 4G9GA 2EP5A 3NC1C 1V1RA 3ANLA 1F5SA 5LWQA 3X2EA 2GKOA 4ACAA 3C3BA 3HC7A 3CX4A 3ENKA 1U7DA 5LLSA 3MRXA 4YRRA 1RZRA 5CB8A 2W2PA 1HFKA 1RCTE 1PG2A 3P45A 2PMKA 2OENG 4FHEA 1YS2X 5JCPA 1IBLB 5FUXA 3A32A 1UXKA 3TNDA 4MX8A 2I0FA 1LPBB 3WAGA 1RWMA 3TS1A 2R4QA 1ZCFA 4M1EA 1WDWB 2RIRA 3O8BA 1QQ6A 1RWXA 1JU4A 1XDDA 1WNTA 1A2OA 1DKNA 4ITVA 1P1FA 3BC1A 4Q21A 3D7SA 5EWJA 4ER0A 2VQDA 3EIEA 4RX1A 4A4DA 4OMFG 3IEUA 2QYHA 4YRPA 3TW8A 5K3FB 5HWSA 2QTZA 1Z0FA 1FSGA 5CBKA 1IVSA 1Y1QA 1BCSA 5BRNA 2GN6A 2FRXA 1O77A 5KYVA 3WOVA 5ILOA 2NZYA 2BD0A 3AHDA 1U1EA 3ZU2A 4DHEA 4URXR 1D6NA 3BZBA 4NCBA 4KBFA 3WHLA 4W5QA 1EE2A 4G8BA 2IXDA 1JFRA 3COZA 3GDOA 3P0IA 2ZB4A 3R3YA 4LSMA 4DMUB 2RGRA 4WI1A 4H35A 5AKYA 3REOA 1O5IA 4ZOQI 1GCIA 2GZMA 4INPA 3RAEC 4YCSA 5IU6A 4HPWA 1Y6FA 2E4YA 3A06A 4WKGA 1WDMA 5IAGA 3U7RA 1JEQA 4AG3A 1JHQA 4UXHA 3GLVA 1MIHA 3LT5A 4F1JA 2R6FA 4YGYA 3KPJA 1DCMA 1CR4A 2HJSA 3BMOB 3UICA 5AHRA 4O2BB 3JYPA 4PYKA 1PE0A 2J4FA 3CKYA 4O5AA 2CXUA 5HGJA 1XA4A 2AK3A 3PGKA 1F2TA 1A9SA 1KH1A 5J2UB 4KPGA 4GICA 4DBVO 1ZNXA 3LYLA 2P9YA 2CF6A 3P8ZA 4M0DA 1KMHB 3BD6A 3OQJA 4IDAA 5F33A 5BWLA 1J97A 4EZBA 2Y8EA 4V0ME 3Q9LA 4YV0A 3F6CA 2GYYA 3CH6A 2G36A 4JUCA 4IIHA 3I5YA 4QXMA 3I5AA 4HWGA 4A73A 1ZU4A 2WW8A 1RXSA 2Q6LA 1TDJA 3AJ9A 3QJYA 2B20A 4WXMA 3KTFA 4IS3A 4JQZA 1YUNA 4FONA 2CV2A 1WUTA 3EUWA 4ZGGA 2BH2A 2NXNA 1X7WA 4WNYA 4RZXA 5BNTA 2YYYA 5K3EA 2LZ0A 3HZRA 4Y0NA 1JEEA 2QUAA 2YS6A 1OC4A 3PQ4A 2Q1YA 3LLSA 4ACBA 2G28A 4GWLA 4ETWA 1RRGA 2NNWB 1YF3A 1VA4A 2Y2UA 3NAZA 1BX1A 1I10A 3FLEA 3HA3A 3K0EA 1GQOA 1Q5PA 2VZEA 4B2IA 4NJEB 2QZZA 3B6KA 3HKDA 4IUBS 3HBLA 5CM9C 4EJSA 3GAMA 1M1YB 3OKFA 1NP6A 1JAHA 4Q3BA 1ARZA 1JHPA 2V5UA 2YTZA 1TCUA 1IB0A 4M60A 5G40A 1ETUA 4F84A 1GZ4A 3HACA 2E7ZA 3IOCA 1TMOA 5FQNA 1PWHA 3G9ZA 4J29A 4YRGA 1NAHA 1HLDA 1AE1A 1UWLA 2JHFA 5L6LB 1P31A 3QELA 4LHYA 2R9VA 2I4MA 3HR7A 1YS9A 4TWRA 3GJQA 2Z9DA 3UMCA 2UZ3A 2IPLA 1I8TA 3SBEA 2V7PA 1LC3A 4B6GA 4NS4A 3MTEA 4GM4A 5BRJA 1MAWA 3DYVA 2MTBA 4KITB 3AFMA 4UFNA 4OK3A 2GF0A 3IVCA 2PV0A 4COKA 2I7VA 5EYPA 1UR5A 4QDKA 3PLNA 1U7PA 4ZCPA 1G2QA 2IHZA 3KUKA 2HOQA 5CVJA 3VU9B 4JXZA 1TD1A 2HJRA 1OTXA 4LXXA 1LY1A 1ZSNA 2AL7A 2M1ZA 4JC4A 1QFXA 4J2TA 1B6GA 1CRWG 1SELA 2R1TA 4DDHA 6REQB 1I3KA 3G02A 5JPIA 1X15A 3R7NA 1T35A 4QUAA 4RMNA 2ZIWB 3HBFA 1M5UA 4C0HA 4D8VA 5KJ6A 2XB4A 2JKYA 5DGXA 2VTBB 3DGFC 5DF1A 1BGXT 2G1AA 2I4RA 3REQA 4L4YA 3AM4A 3HFRA 2CMKA 4MPRA 2SKDA 3MWDB 4DNFA 3CCFA 5IM5A 2ZYWX 3W1VA 4ARVA 1FMFA 4W82A 2Q1XA 1AKNA 1GTJ1 4Y7DA 3BICA 1SVOA 3PSHA 4ZVOA 5A4DA 3MC1A 4BE4A 3OU2A 1YQEA 2CXQA 4EW2A 4HPXB 5A3RA 4M7OA 5CCBA 2N9UA 4ALNA 4MW9A 3EX7C 1T15A 2AEFA 5ALOA 1T3ZA 4U2FA 2ATVA 4HRVA 1CEQA 1BDBA 3ZS8A 3LXMA 4V0NA 2HV9A 4BNWA 3DNMA 1TZ2A 1U8XX 3B3QA 1LSUA 2ASEA 1TU4A 3OJEA 1I80A 5KCZA 1IPHA 5IM4F 2C5LA 3INTA 3ZDQA 3L0BA 3GEMA 1GNTA 2NAPA 2ZSEA 3PSAA 3UT6A 2X0IA 5I4KA 1ECCA 1PNTA 2NUAB 3P71T 2WABA 1PVVA 2AX3A 1WNFA 1JKJB 2LPMA 4KDCA 4LZZA 5C35A 1Z8DA 3ENVA 5JVDF 3IILA 5JRDS 1NGSA 1HDZA 3UV3A 2WU8A 2XKKA 2I1VB 4KLZA 1M0SA 1NVFA 3NIFB 2PX3A 1V8OA 4C05A 2JGNA 5HXAA 5KVAA 4WXHA 1M76A 3DTVB 2OKCA 1WD7A 4HAIA 2GK3A 1L5FA 3ZN2A 5BNWA 4YXFA 3WX0A 2XB6A 3KE9A 4MCAA 3BGOS 1LTKA 2ZB8A 1TB4A 3LHFA 3UT5B 4DZZA 1FF9A 1JALA 4JU8A 4GI5A 5H9VA 3U3OA 4WUTA 3OLYA 1UZMA 1FW8A 3WSTA 1XCOA 1WL8A 2BEWB 3ETCA 4I4NA 1ZJ5A 2D0IA 1A8QA 3O31A 4Q9LA 4BP3A 4LC1A 5DTJA 3GZNB 3PQ5A 4GLOA 4GPEA 3M89A 4RA6B 1IHPA 4QLAA 3ORYA 3PUJA 5FPQA 1ODCA 5D7NA 2FQ1A 1GSAA 5DTEA 1N92A 5CFPA 5U9CA 3NIBA 2A9OA 1XPJA 3F8TA 3K53A 3OUZA 2FU5C 4YRLA 2EWVA 5CFMA 3QJ5A 1J7JA 1FYDA 2QL5A 3EIFA 1J06A 4AC9A 2HXGA 2N1MA 3LE8A 1J90A 2E49A 3O1LA 1UPCA 4GYWA 1X38A 1WE2A 3TSZA 4RMIA 1ILEA 1W1IA 2VDMB 4CMIA 3PF9A 5MN4A 3UFXA 3G7UA 3KE8A 1R64A 1X8LA 4A16A 3L5KA 1KPHA 2X7XA 1VP9A 1UJBA 4P4NA 2H4JA 4KAXA 4WDQA 3V1LA 3MW8A 2V7WA 1LK7A 2MOKA 1WQ4A 2ZIEA 3GR6A 3F5QA 5YASA 3HYCA 4Y9UA 3FHTA 1ADJA 2P9EA 3K31A 4QBHA 1HX7A 3L7IA 3ZZUA 4D8UA 2R85A 3LBNA 1OWLA 3HCCA 5CK4A 4EYGA 4HNTA 2O7NA 1F2VA 1MB2A 4AUNA 4W5OA 1K4MA 3JY6A 1DHTA 2J3DA 1FFAA 4DIBA 2AK2A 3FOWA 3EZYA 1AGYA 2C3YA 4U2BA 4Q39A 4ZD6A 4BNLA 1J5XA 2C4KA 2P62A 3UPDA 4HLDA 5J58A 1S01A 7MHTA 4PG8A 1PVOA 5IVKA 3LBFA 4PLFA 5GIOE 1QTRA 4FCWA 1N5JA 3KELA 1WMEA 4NV0A 4QUEA 1SBHA 4J0QA 3VI4B 1WOMA 4XQEA 3LFUA 1QNLA 3TTTA 4WDRA 2VPYA 4ZVSA 1W94A 4L7VA 1SXHA 2HHCA 3AEQB 4OD0A 1BC5A 3LDHA 1GG2A 4NOKA 4XJXA 4AJJA 2LDBA 5HF9A 1Z88A 5DXAA 1ISGA 1QRSA 1U8YA 5CXSA 1S8FA 3BTSA 2C9YA 1YHNA 3GLSA 2PX8A 3ZBTA 5FUQA 3CPSA 3D59A 3NM5A 1ST2A 2GM5A 3TLEA 1YC5A 3D1JA 5DHUA 2FUCA 5DXFA 4HFRA 4K6MA 3UC5A 4H1TA 2EEZA 3E2MA 4I50B 2J6HA 1T5HX 2CMFA 5FA5A 1MA0A 4MUJA 5A9SA 4XRRA 2PR7A 4H4DA 2AKYA 3I9JA 4D6YA 3RVKA 3ZXUB 1DBVO 2LKCA 2P9CA 2C3OA 2DHRA 4H2DA 1PJ8A 3RRNA 3RTBA 5LZ9A 2ZUSA 2ZREA 4LVNA 3H2HA 2AR0A 2HPHA 4B4DA 2ZS7A 4LN1A 1NFQA 1RYMA 3NEJA 4H60A 4TRNA 1KOLA 3TOXA 2GZAA 4V1CB 5F2NA 1FXWF 3MMZA 4B43A 1MDBA 3A4LA 3KD3A 4OM8A 3TR5A 3NDBB 1DBIA 3I09A 5AI0A 1Q7RA 2WD9A 3HXLA 2HGZA 1R4ZA 2RGNA 2ZZKA 4E32A 1JH9A 5B6PA 2EQAA 5AVTA 1HXHA 2HYDA 1JJ7A 1YAJA 2EF0A 3ENZA 2DTEA 3GLQA 5TY0A 3WLKX 1GPMA 4G4GA 4XH9B 4QG3A 3DVLA 2FW7A 4QFCA 5BURA 1IONA 1QHGA 1P1IA 2X2EA 3WO1A 4EUHA 1OH6A 4TQUS 3TE6A 2CLOB 2QT1A 4EHLA 3EDQA 4P33A 1KMCA 2XYGA 3RSFA 1JWLA 4PYMA 5I4CA 1G9TA 1R0YA 1BDMA 2J9FA 5JWRA 2YW2A 1T26A 2C5SA 5EZYA 1XDSA 1QP0A 1GEGA 2PVPA 4QPJC 3NT4A 5B2FA 3NIDB 3NYIA 3GP8A 2AN1A 3GLTA 3K92A 4HNQA 1PJRA 1UBMS 3SQMA 4NXNB 1MZPA 4C6HA 5TEVA 3FI0A 3VKFA 1OZAA 3PENA 1LLDA 1WVMA 3BYZA 4KIGA 3ZVLA 3ILYA 1EYZA 3LF1A 3KJEA 4HUJA 3JV7A 1AQLA 1YV9A 3NHSA 4RVOA 5EVJA 4BBZA 3OIWA 4G9BA 3GI1A 2ODAA 4MKZA 2QSYA 4EGSA 4ZT3A 4KRFA 3EXEB 4MKRA 2XXAA 2QN7A 1TT5B 3LY5A 4OSPA 4LDAA 3W9BA 3OWOA 3EGEA 5K6AA 3TOCA 4B4KA 4TSKA 3JALB 3WLPA 3M6LA 4RXUA 2D13A 1QIEA 3QUTA 4Q7MB 5C18A 2NZWA 3AL3A 3F6RA 2QP3A 1UMBA 4I08A 4JEIA 4PZLA 3U7QA 1TAQA 4MOWA 2IJGX 5ERYA 5A2QA 2ERYA 421PA 3MBOA 3RYTC 2PUWA 2WJ6A 1OT3A 3UCXA 2Y67A 4PCVA 2H51A 5FFNA 3PQ6A 2WNHA 4Y0VA 3FPEA 1H0RA 4PG6A 3IOEA 1L8AA 1E4EB 1T2EA 3MCZA 3D6HA 4HBGA 4CTJA 5BMVA 2D1QA 1PNRA 2YASA 1RJFA 3TJRA 3VNAA 1Z6QA 1UXGA 2GHQA 2DB3A 2Y0EA 2AYXA 1RRFA 5K3AA 4MWOA 2R2GA 4BZZA 1P7YA 4HRYA 1S2MA 4PICA 4OATA 2JJQA 1DJPA 2P7IA 2V6GA 4HVTA 2WHRA 4P8RA 5D84A 2JG3A 4JIMA 3AHHA 4MP8A 3AEZA 3NONA 4GMFA 4QJBA 4H18A 4ZYXA 4YAJA 2BGJA 4IDHA 1CUSA 1H6DA 1ABFA 3GXOA 2NU8A 3DJYA 4NY1A 2JAOA 2Z57A 1G5PA 4Z0NA 3U3ZA 5HKKD 4Q7QA 3HZHA 3JX9A 2ETVA 5ARDA 1C14A 3ZGVA 1JDPA 2AS0A 1PR4A 1JEYB 3G3EA 1K6MA 3JWJA 1YA4A 1U0RA 3IBTA 1IHOA 4N6NA 4BVKA 1O96A 1S3GA 2VHJA 1VB5A 2IEIA 1XDBA 3PNBA 4PXSA 1XU7A 2F3TA 3DVQX 5FWXA 4BWYA 2XE8A 2VN8A 3R5HA 4HX2A 4JLUA 4HGOA 5B1IA 5BVGA 2D5BA 3QNWA 1QCDA 5KYKA 3X1DA 5L40A 3PIRA 3JQBC 4NDNE 4Q19A 4CMEA 5GTDA 3HUFA 1G17A 1MJNA 2HWUA 2O8NA 2X2FA 1TJ5A 2EEPA 3OM9A 4MUGA 3OT4A 3L3BA 3OOJA 4WE3A 1QZ3A 2LCIA 4C0AC 4FEGA 1YS6A 2ZJ2A 4NEHB 7YASA 1FLDA 2YBEA 1DEHA 2PZLA 3H5WA 2Q9UA 2OM2A 3OT1B 4N8EA 4YJKA 4EYEA 3OZAA 5FYQA 5JECA 2OV3A 3VOTA 2FWNA 3COPA 3F0TA 3UK0A 4UUBA 5LQAA 2SCUB 3UTCA 1QORA 2XJ4A 1JMKC 4NENA 4RM3A 1FQJA 1S9DA 1FYFA 1TW2A 3DE5X 3FMVA 3V7WA 1XPOA 2WM3A 1H93A 4TLEA 3CT6A 3ZLTA 2ZG6A 3FOEC 4R1TA 3FMOB 5D85A 2X9VA 1G41A 1BH6A 2ONYA 1E6LA 1ORTA 4RV5A 5EZSA 2DMRA 3FHCB 2LIVA 2ZRGA 2FOIA 1O97C 3DZJA 4MYUA 3GYGA 1M67A 1TO2E 1NW9B 3R5JA 1X9IA 2ZAOA 3PFNA 1GY8A 5TLSA 4DEVA 4J1QA 4ERXA 3SIXA 4G41A 5B1YA 4AX8A 4KVAA 1YXMA 3PICA 3UNXA 3AVTA 3NTVA 2IY9A 3FPBA 4IGEA 4II3A 1FP7A 1XRPA 1E66A 1ZBDA 1ZN9A 4UNQA 4QZVA 5ALMA 3QU2A 2Z6UA 2XMBA 3ADOA 4BCCA 5KO2A 3BMXA 5CMLA 2IXFA 1CB0A 3PHGA 4YRTA 5T57A 4D9FA 1BWPA 1CNMA 4DLVA 3KAPA 3T5AA 4PZYA 4LOAA 4U7GA 5ITVA 1M6EX 1X7ZA 3H5AA 4OGGA 1MA3A 4XQ9A 5DFAA 4MKIA 4CHGA 1MN6A 1KOGA 2Q6IA 3QKRA 1Z28A 2BM8A 2J7KA 3MJEA 1GVNB 4J43A 4X91A 3U0VA 1FDIA 1PR3A 2O19A 1DGQA 2IYOA 2ZJ1A 1NA5A 4QDUA 2Q62A 2IL1A 1VM6A 1E5LA 5LFAA 3PC8A 2GBGA 3BE6A 2XTZA 2WWRA 4LXIA 1KR5A 4CKYA 1A9RA 1RI5A 2E82A 4GM0A 5D1HA 1L5HA 5CHYA 6NULA 3TUZC 4H7JA 3BBLA 3HADA 3MJCA 1B8OA 2WKSA 4EUFA 2FEPA 3H19A 3TGLA 4MUAA 1L5YA 4TM7A 5REQA 3WBBA 3A6LA 1DQNA 5TNXA 2FR8C 4TWBA 2PD6A 2YQZA 2Z0MA 3FNEA 3HU1A 2I4OA 1E2DA 1MO2A 1MD9A 3B89A 3FDXA 3RUAA 3BWCA 3A2KA 1A98A 1WPRA 3AJEA 1Q1EA 3FTNA 3HCRA 3HV2A 1AZSC 1CP2A 1D2EA 4Y6QA 4E08A 3BDIA 2W6PA 3L05A 2CZGA 2PSDA 4TLCA 1E32A 1MP0A 1VCNA 4J0FA 1BQ4A 3EDOA 4OA5A 2CXNA 2VBGA 2V7TA 4OHPA 2JLQA 3ACDA 1FX0B 1WCIA 2WWTA 3KS9A 5IDQA 5IZ4A 1YVRA 2X77A 1TUEA 3R6WA 2OZPA 3D6AA 3ZI7A 2PUJA 4UOZA 2AG5A 3D64A 1EDDA 1C50A 1VP3A 2BKVA 1NIPA 4ZYLA 2QTFA 5J4LA 4F5ZA 2NWQA 4BNXA 3BIWA 1GZVA 2DWPA 1U7HA 2IU3A 2QM7A 2D06A 4X90A 3EULA 2X5NA 2B8WA 1TKBA 1U28C 2MSEB 2O2IA 1JG4A 3FB1A 4KHZA 1RWQA 4JLMA 4URUR 4MVJH 621PA 2Q3LA 3E5NA 4RNCA 2O6HA 4O4IB 3TRJA 2R1ZA 4CU5A 1FNBA 2XQIA 1B7GO 4J03A 3AZOA 3SF8A 1IHXA 4QU8A 4A6PA 4Z49A 1ZICA 2H4ZA 2QRMA 1ZOSA 2GYVA 3RRJA 3S1LA 2HUNA 2EYQA 3K5IA 5D3MA 2J4DA 1U3GA 3IB3A 4GECA 3VDQA 3WL3A 4CW7A 1T36B 2ZEJA 2JAQA 1ULTA 2WLTA 1UT6A 4YACA 4Z7QB 5BYKA 2ORWA 3DDUA 5K5EA 4O4JF 1Y34E 1D0IA 3D6TB 3BFVA 2B0JA 3TQTA 1JNYA 5HK9A 4DR2B 1MX5A 1KZ4A 3J81A 2QN8A 5DIFA 1CUCA 2XW6A 4JITA 4XOIA 5DHSA 4CQLB 1OSNA 4UMVA 3CVVA 2WDZA 2V65A 3OZXA 2Y9PB 2ZUUA 3MOSA 4JI5B 2ORVA 2QRQA 2XV1A 1CLEA 5IT4A 2IU4A 4YAGA 1VKHA 1XBTA 5CYGA 4GH5A 1C8BA 2DUMA 2YWXA 2QM8A 1COWD 1O3YA 1T0HB 1Z2DA 1E4VA 1O57A 2VL7A 3P4UA 3RFUA 4EYKA 4Z3KA 5ELXA 4GKKB 4RY0A 1J24A 1AQIA 1OROA 2C3PA 2ZIAA 3ZCTA 3TF5A 2HHAA 4JLSA 1DQSA 4ASUA 1C7JA 2MMCA 1BS9A 1SKQA 4WRRA 1QG4A 1D2HA 1QQAA 4W8HA 4LGMA 5FOUA 2O8DB 3BCSA 3NHPA 3QXCA 4K9OA 3T1VA 1YACA 4LUCA 5JZVA 4BMNA 4EF4A 1U8CB 4LYGA 1EHCA 2QQ0A 4EY4A 5LR6A 2Q0QA 1S1MA 4DBLC 2GTPA 3IDSA 5KVSA 3PRYA 1N2HA 1SGWA 3ED5A 3GA7A 1XLVA 4Z86A 4TTPA 3IQGX 2F48A 5AOCA 1CD5A 2C7QA 2EDAA 1CRPA 3TFWA 3ZH9B 1Y1PA 2XNHA 2P67A 2GSDA 4IIVA 5TQ2A 3ZVKA 1L7PA 3DBRA 2JVIA 1DELA 4A9AA 5BYBA 2WWGA 3ILXA 4FEEA 5EE1A 3FNFA 2CYBA 4GZLA 5BUSA 3IKTA 1XLUA 5ENVA 5E9AA 4Q9KA 3ILVA 2YZGA 3W5IA 4OIMA 1WDLA 2YV1A 2HWXA 2DCMA 3WGUA 4X63A 1TNDA 2JKZA 5T41A 1U6IA 5J4VA 3NKVA 3IOBA 5K3DA 4C3VA 4XM1A 1EWYA 1OE0A 3TD9A 3CZPA 3MMSA 4C0LA 5DNEA 3E7XA 4JB2A 1EGMB 3HA2A 1SKYB 3HSYA 1NLFA 5G4KB 1LA2A 1ML3A 3IGFA 4EFMA 4J75A 5JJ5A 3O0DA 5KKNB 4IMRA 4G0UA 3OPXA 5AWFC 1T4CA 4MO2A 3S4YA 2P9QA 1DMRA 1H0HA 1UFVA 1SQSA 5AW2A 4G5QA 4D9BA 5FI0B 2ZB7A 3KWFA 3FR7A 5ELMA 3RC2A 2VNHA 4JVOA 2OD9A 4EJ0A 2W90A 2XODA 5KYUA 4JI0B 3KU1A 3FDJA 5HQJA 3FFXA 4F4DA 1R1DA 4BCBA 4DSNA 5M2QA 3CLRD 1W5FA 2ZBUA 3I2GA 3KQYA 3SHOA 2JCXA 3T1OA 3AF1A 4I1YA 5HIIA 9ABPA 5GZ3A 5H4GA 1ZK2A 4J4BA 3AHIA 3Q5GA 5TQ0B 1M6VB 4B0OA 3KFVA 3IR5A 3B3GA 1J39A 1COWA 5G1OA 5KMGB 4RWEA 3TTYA 4YEDA 3KZCA 4DSAA 3GFQA 1E6EA 5DHRA 2WZQA 3K5PA 3NCTA 4RSMA 3GCWA 4F21A 3VO1A 1OXVA 4IO0A 4OHXA 2H5IA 5BSGA 4GF5A 2WMNB 2X0NA 2PKCA 1UEIA 1LPNA 3TSCA 1TYBE 2EQBA 2WYOA 1N0UA 4HZGA 1BAPA 4G1BA 4ZOBA 4MW5A 1SUAA 2GFIA 2D7CA 1KJJA 2KSQA 4JKOA 3U4GA 5K0GA 1ZOOA 3PDHA 5THQA 2WRZA 3NM4A 3GFTA 1XG5A 1I2DA 1AUXA 1TAHA 4X7RA 2B78A 1DC4A 1VBKA 2GYWA 2I80A 2M1XA 4MS4A 4DCSA 1U4OA 1ISRA 2QZ9A 5BSUA 3S1SA 2E5WA 3LGAA 3KT0A 4R16A 5A7HA 1FYXA 2QPLA 2P3LA 2ZRPA 3OH8A 3PXCX 3B20A 2GD2A 4PYQA 1NPYA 3CEAA 5JU6A 1ORRA 2IYFA 1XVLA 3M4YA 2DWOA 2NU9A 1YR6A 2WUWE 5U4XA 4ZQCB 4BNHA 1SD1A 2XOXA 3LHIA 1YFJA 2P27A 3K8ZA 4G85A 3UMVA 1JDVA 4ZAYA 1QYRA 3BHNA 3IA2A 1Q16A 1E1RD 1Q0LA 1AF7A 1BEZA 3QA3E 4ZAZA 4KHPB 2J45A 3OURA 1TKCA 5CRIA 1XC7A 4RH3A 4NI5A 3QF4A 4X1IA 5E8RA 2BFMA 4KWEA 2GN4A 2H5EA 4ARSA 5H4HA 4KE8A 1JHVA 1O89A 2OHFA 3ESQA 5CFOA 2WD7B 3VKHA 1YRWA 5DTMA 1FFXB 1GDHA 3TZBA 1XZCA 2ILTA 1CUAA 4RHCA 4Y2HA 3TIXB 4EPYA 2HSJA 4PCUA 4W5HA 1TCBA 4JASB 1R3UA 1DG9A 2FX3A 1ZMOA 3BORA 3I04M 4FWIB 3ZNNA 2DPHA 2EWWA 2QZSA 3EGXA 3JVDA 3AR2A 2CLMB 3CNBA 4KAJA 4Q7KA 3NHJA 4B6SA 1HURA 1SG9A 1C1DB 3CLVA 5CXXA 3MAAC 2BOVA 1M2VB 3F7NA 4JJ4A 1D1TA 4XKJA 1AK2A 1D4ZA 2YWDA 3HUUA 3C8MA 5AUPB 2F9LA 1JIJA 3B6JA 5E7QA 5B3AA 1EK5A 1U99A 3KM0A 4CLEA 5EC8A 3U7EB 1W88A 2HF9A 3LPCA 4WTOA 4XWAA 4DM4A 3IL2A 2EQ5A 2FEOA 4NNOA 2ECPA 1ES9A 4YJ3A 1W34A 2C2OA 1D2MA 3SIRA 1QG2A 3OLCX 5CYPA 3JWIA 2C7PA 2ECOA 1B6SA 3FDZA 3K0SA 4J07A 3E58A 4BRZA 1KYXA 2R47A 4B82A 1G7CA 5IRCD 1Y7TA 1P2GA 3MTDA 4OUDA 1RADA 5JNTA 1GWNA 1VPDA 2OM6A 3USES 3UWSA 1D5WA 4F8EA 4U5XA 2R7AA 2WHPA 4BQOA 1ZH2A 2C95A 1YB6A 3C85A 4JJ6A 4AJLA 4G5XA 2ROQA 4XGNA 4B2PA 2JFVA 1QP8A 4RTPA 1B6TA 1MEJA 1XO1A 3EEOA 2J3MA 2WSIA 3FZYA 1TTPB 4WESA 1BFDA 4ZREA 4JAVC 1O5OA 2M98A 3CLTD 3RGWS 2FE1A 4AU1A 4O2BF 1RE1A 1WG8A 1ZW6A 2AD5A 2OG1A 2PLAA 2ZIVB 2JK0A 2ZSJA 2YWRA 2PZMA 2YFQA 2GPSA 2IX3A 4D5EA 2NSJA 3BERA 3T06B 2GKSA 3U3JA 3BD8A 5ESXA 3ZLUA 2WTUA 4JVMA 1U0GA 1BZYA 5KDOA 1IPEA 2GA9A 1RPAA 1YBAA 3ZS9A 2J67A 1PJ2A 2I5PO 3IKLA 4UQLA 3SM3A 1QB8A 2QJOA 1AF4A 4O0LA 3PPYA 2HMYB 4TN1A 4RY2A 1UWVA 4FFWA 2CN1A 1XAHA 1FRQA 5EHXA 3U3XA 3V8MA 1D8AA 1GTVA 3FFTA 2BMEA 1EXMA 3WLEA 1NFRA 1JKFA 4KWTA 5DT2A 3CF6R 2AFHB 1V4VA 3FHLA 4RD3A 1NXWA 1OZHA 4B3JA 3VU8A 1VRCA 4C6TA 2NG1A 2VBFA 4MTLA 5K0JA 4BFLA 2BISA 3Q3EA 2OTCA 4D4KA 1TF5A 4WKPA 2PYIA 4D57A 3TNJA 3QU5A 3K0CA 1P61B 4MIYA 1BHSA 2J6CA 1JLMA 3B2QA 3INYA 4HXGA 4PINA 4F5EA 2UYHA 4QJ3A 2CLFB 3MMPA 4EPTA 1UJMA 1H9BA 1NNUA 4TLDA 2HF2A 2X3FA 3VSEA 4F97A 3UK6A 3CG4A 2AMLA 4B84A 3NHBA 1RLJA 2VP9A 1TTQB 3CSSA 3MNFA 1OIVA 1M72A 5F1OA 8AT1A 5HKBA 1YULA 1YZQA 4PSCA 4QHYA 4XCXA 4BO9A 1SC6A 1N7IA 5CG1A 4HL6A 5PNTA 1UBTS 2ZDGA 2J3KA 2VZLA 2WHYA 1C1YA 2CHQA 5EKSA 1B26A 1EA7A 2IXGA 5M04A 2MYUA 4NWIA 1LPPA 1X74A 1ADCA 1NU8A 4JDUA 4MNTA 1BO6A 1YONA 3GCGA 4KE9A 3U3RA 1L1FA 3W5JA 4UCQA 4B7AA 1J9EA 3I53A 2I8CA 3TTVA 4IXDA 4XJTA 5EJ2A 5EJ9A 2ZRFA 4B40A 1BE6A 2VHCA 1DARA 4IDPA 3I4FA 4N0QA 3AB7A 1R0ZA 4IWYA 2XUZA 1GDTA 2ABWA 3NOQA 1OFUA 1GPDG 3N75A 2E21A 4ZT2A 2VS1A 4CT5A 1NTRA 3DZIA 3P9XA 3KFLA 1PQWA 1N2ZA 2QNRA 1X6VA 3FRJA 4I9GA 4RANA 2OESA 3VX4A 3G0OA 4OK5A 4D42A 5IDXA 1U0TA 4UBIA 3PHLA 4DB4A 3CEJA 4WFJA 4QOJA 1LUAA 2FX2A 3IKMB 2E4AA 5ADUS 3NTLA 1AKTA 4U7JA 5JNVA 2VPWA 2EXXA 1ZXBA 4V0SA 3V42A 3JRNA 4AY6A 1R4MB 1IJFA 4AG6A 1PZXA 3UW3A 4FILA 2BP7A 3EDMA 4TQGA 1TC1A 2XADA 1U11A 3DV0A 3MXOA 1ZIYA 3OPQA 3Q5DA 4RV4A 5FQOA 4BKOA 3HKBB 1IXSB 1DU4A 5ELLA 2Q5JA 1Y7HA 2I22A 3QENA 5I8PA 5FLKA 4IY1A 2RJ3A 2ZJ3A 3O90A 1EUZA 1QKJA 4E07A 2HZ7A 1U80A 4Z9BA 1EWTA 4QNMA 3GLIE 1B93A 3B78A 3JQGA 5C32A 5KNCH 2F9MA 2JIZD 1GQFA 2ADOA 2DY0A 4DLUA 2BN4A 4BB6A 1Z6XA 4US1R 1XPUA 4EJSC 5J4HA 2W6OA 2CLSA 1RACA 1VKOA 2MT9A 2NQ2C 2P2NA 5FT9A 5KPJA 2E1PA 1WZCA 1DTWB 2QAGB 4YP7A 4Y3UA 4CNBA 5CA0F 1ZLXA 5H68A 2BGIA 2EGGA 5ENDA 2GASA 1DEKA 1U94A 2VSOA 4E5MA 3O74A 4GE3A 2W6JD 1S8OA 4LRWA 3PNYA 4FD2A 4JGIA 4Z2YA 2OWDA 4BIMA 4D8XA 4RF5A 4BMPB 5B58C 5CITA 3SZOA 1YH3A 4EF6A 1OLUA 1UK8A 1T6BY 2Z43A 1SBNE 3EQ2A 2HL6A 3G8DA 1NZJA 3O8DA 4LKOA 5EIBC 1XMQB 2O2EA 2ZYAA 3QX7A 4UQPA 4I9FA 2LDXA 1Z2NX 1HO3A 3ETHA 3I6MA 3UIEA 2PSJA 4Y2VA 3Q9SA 4JBIA 4MWEA 4IW3B 1ZRMA 3RVDA 3P4XA 1Z07A 1T5BA 1XU9A 3R7AA 1Y3BE 5IZCA 3ZCVA 3NVDA 1YJCA 3HY6A 3F5SA 1OLSB 3LWDA 3DMGA 1QGUA 3FPJA 3ND7A 2EFJA 4GOLD 2XA9A 1ML4A 4IDOA 4IWNA 4GG1A 1Y1TA 2XMCA 1HRKA 1QJCA 1G21B 2JCVA 4Y1EA 4Q7LA 4X66B 2O6LA 2UZ4A 1NULA 3JXEA 1Z37A 1H2HA 2B21A 4MUYA 5CLQA 1K8XB 1QVRA 4OI4A 1U9IC 4DR6B 3G8YA 4CLOA 2XMRA 4ZJPA 2DQKA 2NM0A 2R79A 1UT5A 3FZNA 3IJRA 1VMDA 3CUKA 5GOTA 3RAGA 2F1JA 2HRRA 1YSCA 2ZJYA 4FFRA 4CMAA 1NFFA 2G08A 1IMJA 2P6OA 2Z5FA 3OHMA 4JYMA 1BJTA 4IIBA 4CLRB 2GO1A 2RHDA 4Z4QA 3W3AH 4N01A 1E61A 1W5SA 2X2PA 1YL7A 2X8BA 1W5EA 3NRJA 2QL6A 3LJKA 1CZUA 2Z3ZA 1R8SA 1LU9A 2AG1A 3BXOA 3PXAA 1PR6A 1PZMA 3A3OA 3QSGA 5LQNA 5BOVA 6LDHA 3URMA 3GEPA 3KYBA 2IHTA 3NYRA 4R3WA 4CM4B 2V0GA 1WVGA 2VPQA 1GKLA 4NU0A 2EJBA 1FYWA 4JLOA 5BSEA 5JSUA 4ML3A 4RE6A 1UPUA 4GBJA 2JIZA 1HL3A 3HR8A 4J3FA 4QL3A 1GIAA 2JI8A 3KPVA 3GMIA 4ISCA 4RZSA 1HDRA 2X4DA 4I66A 4HWKA 1X7HA 3LT2A 2W2LD 3B7WA 3F4BA 5DOVA 5EQJB 3B3JA 3BREA 3HFSA 2IV2X 4AT1A 1ZUNB 3W7AA 1YR7A 3GLHB 2AUTA 2CXOA 4MYRA 1ZN8A 3M1IA 4BECA 3BFKA 4UTRA 1V5EA 2HMVA 2ZBDA 2NVOA 3T1NA 2JHCA 4TQ9A 1HDCA 1GXSA 3Q3GE 1MG0A 4M1OA 4XGKA 2OCBA 5AKJA 2XCRB 1EK2A 3SEQA 3P2YA 2APJA 3QKUA 5LZ8A 3V8RA 4Z0TA 1RZUA 1QWSA 1ZGCA 3W2HA 2NZ2A 3HMQA 2W6NA 4LOHA 4QASA 3GEBA 4ZODA 3ZK7A 2I9PA 4YV1A 1WBBA 4FCTA 4K9MA 3HXQA 4ZQIA 1EX9A 1QAMA 2HK8A 1E9FA 2VT3A 2ATXA 1RM4A 2R6ZA 1TZBA 1BMQA 1T3GA 1ZMRA 2A5GA 2AUNA 2E4WA 4X6YA 5E3JA 2QPAA 4D9NA 2A0XA 3SZGA 1G8HA 1VG1A 3IFSA 3JYHA 4ZVNA 3OQMA 3Q6IA 3QOYA 1F2UA 3GRZA 4DEXA 4OFBA 2CV1A 2DFTA 4GW3A 3ZWMA 5A4KA 4QA9A 4GSLA 4ZIRB 2BFDA 3UJPA 3HGTA 4I50F 3CCBA 3KDAA 5B3KA 1IULA 4C0XA 3H97A 2O7QA 1L7RA 1TEXA 3QV1A 6YASA 1H1DA 4BATA 2XUFA 4E12A 5IASA 2RKWA 4B3CA 1XZ8A 4P6VF 2GD1O 1IXZA 5KNBD 3F73A 3HJUA 2Y1GA 5F78A 4QDZA 1L5RA 5B2EA 3KK0A 1TUGA 2NW6A 1JLKA 4BZXA 3C3CA 1DKPA 1WX1A 2H11A 2AG8A 2V7QD 3DKKA 1NG1A 4IV5A 4LTDA 4B80A 4HAVA 4O2RA 4E4YA 2G72A 3KKPA 1O8CA 3JASA 5GGYA 4YIHA 1VDMA 1L1EA 4AKEA 4AMGA 3HCBA 4CG2A 1KVTA 3HL0A 2JEOA 4HQLA 4QOEA 1P2DA 3K8YA 2HN9A 4WD3A 2W6QA 2OHHA 4KLAA 1YL6A 3WQBA 1ZW1A 1LD3A 2PBFA 2H2IA 2PEZA 1V48A 1Y3HA 2GPAA 3INRA 4XDYA 5DP1A 1N8SA 4OI1A 1TA0A 3RS2A 4C0JA 4S04A 2H29A 1ONBA 2IKSA 5HW0A 3MRSA 1DFGA 3D2AA 4JT2A 4CU2A 1GKKA 3IDQA 1W2GA 3LK7A 1V37A 1NDUA 3AHCA 1ACMA 3MINB 4ARAA 2OFWA 2WU3A 3FPAA 1F0NA 2G0NA 3H1AA 5U1PA 4E22A 2W2LA 2ZS8A 1UKYA 4OP1A 4ZPXA 4RVFA 2H85A 5K45A 1FVOA 2GA8A 4XLZA 4GEGA 2P4EA 1WHTA 4TV8F 1J2YA 1L7BA 1NQ5A 2XZDA 3S28A 4EG6A 1ZD5A 2WJIA 1FIUA 1IL0A 2GD6A 1F1BA 2O2ZA 2C5HA 1PGNA 2WT4A 1P5JA 1QK5A 3CUEF 3R3SA 4GC9A 5EP3A 3VPFA 1RZRD 1DKRA 4FQ8A 4IFBA 4RZQA 1P62B 4F46A 3MCVA 1XPRA 1ZS9A 2GX6A 2QDKA 3CZMA 4YJFB 3W5BA 4KREA 2B82A 2CY0A 1X1DA 1ENYA 1LCIA 1TM4E 4PSKA 4REQA 4G01B 2IDZA 2V1XA 4TVKA 1XMIA 3NJRA 4JUDX 3MWEA 3UHOA 2GUWA 4RNDB 5THXA 3DZKA 2X5OA 4P4SB 4U8HA 2RHWA 3EGIA 4X61A 5KTRA 3GPCA 3LNTA 3Q1LA 5JDIA 4BY9E 5L8VA 1VSQA 4F60A 5JANA 3E6AA 2DWUA 2JEZA 3N58A 5DZSA 5G0UA 4BJ1A 5J23A 5A1TA 2C4VA 2QD5A 1K5GA 3GVIA 1FDWA 3UKJA 5FLEX 5HJEA 2A35A 2NU6A 2BHSA 4JU9A 4E2WA 3HPRA 4IJUA 4PBRA 2JANA 1M6YA 2RHHA 1VE7A 1CUGA 5SY9A 1BDHA 2EX4A 1F4VA 1GPKA 2J59A 2V7QA 1W6RA 4J8PA 3C0KA 5K2OA 1UDXA 2FAXA 4CFSA 3G5MA 1MO4A 1OVGA 1JEOA 2I2XB 5C8DA 1V11B 1ECLA 5JAOA 1N5DA 1NVBA 4QYIB 5EIOA 1X19A 3ROQA 2QRZA 1EVIA 1P7PA 3DD1A 1XRJA 3JWEA 1QVWA 4KO3S 3SJ7A 4CEJB 3TGWA 1QIKA 3H5IA 3O83A 2RGNC 3KV3O 1K3UB 1A1SA 1ZLYA 2BEKA 4IHQA 4KUHA 1E59A 2ZCVA 3K96A 4LXTA 2I2FA 4WECA 4JJ7A 2YJNA 4RF3A 2WIGA 4WEQA 5C3UA 1T4MA 4CKXA 5IF9A 5F51A 1MTZA 5IJAA 5MFPA 3HA7A 5IEBA 3DNPA 1N2EA 3FNHA 3KT3A 3VO9A 4AZ0B 4P9NA 2V6MA 2ATEA 1EGHA 2Q5EA 2FG7C 4M1MA 2GKGA 1NLMA 3B6MA 4R8SA 4OH1A 4MUEA 5TXGA 1UBOS 4HO1X 1P1HA 2A33A 4GPBA 3IV9A 1DQPA 4K28A 1NW7A 1OBOA 1PR0A 2MJLA 3E7DA 4HDOB 1K66A 4UBMA 1U8TA 3STYA 1R4AA 3C70A 3H6GA 4FX5A 4RADA 1FBNA 4RTRA 3KHUA 2O4CA 3MPUA 1Y0BA 4KUEA 2Z1MA 1MLDA 1QBGA 3BKXA 1YDFA 3D7MA 4HFJA 2ID4A 1F60A 2EHJA 4FWBA 1YQQA 4G0OA 1K88A 2AW5A 5DYTA 3RSSA 4PVCA 1J22A 4EA9A 3TN7A 4JZYA 3DHWC 4BEVA 1N77A 2PBRA 3FFWA 1R2QA 5K6AC 1GUDA 2N0SA 3SHFA 3DR5A 1Z7BA 3E1KA 1AV6A 4NBUA 3HNPA 2O23A 4JA2A 4A8JB 1QV7A 2XB9A 1O58A 3H7AA 3GJ6A 3I5XA 5A3JA 4EKNB 1IUKA 4JYAB 2ZXEA 5D2CA 3RVPA 3BSYA 4PTYA 3I2JA 5K0EA 1QIGA 3KT6A 5LZ2A 5KYWB 3QBEA 2J7PA 3NIWA 5ECWA 2YYZA 3P2KA 2V03A 2VO1A 1A9ZA 1Q7EA 2GMWA 4A10A 3INGA 2Y4OA 2J5QA 3L6UA 4YLYA 2QLMA 5HMLA 2D8AA 3COYA 1JDNA 3P27A 1LDYA 1NUUA 4YTEA 4E03A 1YVEI 2OQ2A 4WERA 4A8TA 5IEJA 4CXMA 2JLBA 1M2WA 5F35A 2A88A 3R74A 3WIOA 2P8SA 4XUGB 3DFFA 4XX0B 4RQTA 1NVGA 2GEVA 3H4TA 2IGTA 1RRCA 3ML1A 3NAQA 2P2ZA 2O9JA 4I4TF 4OBXA 1U98A 4C7VA 1GNSA 3E22B 1YQWA 1YRHA 1KEVA 3QVVA 4B3RB 2JLZA 1MT3A 3DE1X 3HCFA 4RTJA 4ID9A 3KEOA 1W4LA 1SUCA 3RHZA 4XB6B 4NC9A 3HXOA 4FGUA 1V7QA 3BH6A 4ZCLA 1K89A 1EJ0A 3CW8X 3KHKA 1E0AA 1XRQA 2VPXA 3IRVA 1NSYA 3I83A 3L7DA 4Q9IA 4YBZA 3OY7A 3IE0A 4NF2A 4CMEC 2UDPA 1KDVA 2QTRA 2OZVA 4NYJQ 3OZGA 2BT4A 2D3TA 2FMHA 2ANCA 3G8CA 3A6FA 3G0CA 4GO1A 3FBWA 4M8LA 3V46A 4OMUA 1R0SA 2WC1A 2B8JA 3M70A 3RD5A 3MTJA 1AURA 1RXIA 2EBHX 3Q88A 1OH7A 3QWHA 1F4LA 4XDGA 3WWCA 3V2IA 3WGGA 4V39A 1RMYA 1ST3A 2ZRLA 2WM8A 2ZU0C 3CJTA 3EBPA 4WACA 2P79A 1SEVA 2ZYUX 5CAEB 4RA9B 5H7XA 4M83A 2YIJA 1A2KC 4WLNA 1U2RA 2ZT5A 1G18A 4GMDA 3CUTA 3CC8A 4FCCA 2J9GA 1QLHA 3MS4A 1K7CA 4R9SA 2FF7A 3NHKA 2C7OA 3R8XA 4HUQB 4E70A 1CJSA 3EXIA 3R9KA 4M9ZA 4JP8A 1Y7IA 3K6KA 3QU9A 1Z0IA 1HTTA 1CZNA 4ZO9A 3ORHA 2CT8A 4M1QA 2J6BA 1YB5A 3TQQA 4C2AA 3I8SA 3OMLA 1INLA 5DHQA 3O03A 2YVAA 3HGQA 4I6EA 4LYJA 4MCHA 3KQHA 4KSCA 5HQ3A 1RXWA 4B0PA 4L6AA 1NR7A 3LLVA 1Q17A 1T6YA 1QHYA 4YB8A 1PJCA 4B7CA 4B6FA 1C3LA 5KHOC 3G5AA 1X9GA 3G89A 5HILA 4RK5A 1RLMA 2X4IA 1DEXA 4CTKA 1UOQA 2CDBA 2R2AA 5EUBA 1TUBA 2ZI3A 3QXGA 3RS4A 1YQXA 1VPEA 5HS4A 3EQ8A 1FFGA 1MOZA 3D4BA 2XKAA 4UNRA 2PPVA 3RG8A 4G0YA 2ASVA 2D5CA 1N2SA 3EBOA 2A84A 1OAKA 1SZJG 3VC3A 3N2GB 3U49A 4KV9A 5BN1A 1O0BA 4DJEC 3WZLA 1JMVA 1HZZA 2KB0A 1F0KA 3KUXA 1TM5E 4U2GA 4WGGA 3VVBA 5D5PA 4UUQA 3FGNA 1I0ZA 4BJ6A 3K70B 2QE7D 3DMNA 3U7GA 3D31A 5FJJA 4IP0A 1Y5LA 3PC8C 2EZ4A 4NH0A 5IMBA 5LUBA 5JSZB 2C7RA 4GDMA 4HDNA 1OWOA 1CX9B 1V3QE 2RC6A 1PKEA 2Z8YM 3C3WA 3C5WP 3ROEA 5KI6A 3VR4H