1X7XB

Crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
329
structure length
329
Chain Sequence
EYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-oxoisovalerate dehydrogenase alpha subunit
publication title Molecular mechanism for regulation of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase complex by phosphorylation
pubmed doi rcsb
source organism Homo sapiens
total genus 124
structure length 329
sequence length 329
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1x7xB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1x7xB01
2G25A 2JI9A 2BFBA 1DTWA 3F6EX 3AHFA 1Z8NA 2XT9A 4K9MA 3AHHA 2C42A 1NI4A 2BFEA 3ZHVA 4FEEA 2C3YA 2WVHA 4WBXC 3AHJA 1U5BB 5I5GA 4K9PA 4XEUA 1UMDB 4GM1A 4RJIA 1POWA 2BEUB 3M34A 1W85B 4JUAA 1QS0B 2XT6A 1OVMA 4JUFA 2JI7A 3AHGA 3M7IA 2DJIA 2JGDB 1YNOA 1WCIA 2VK4A 3ZHQA 2VBFA 2O1SA 2IEAA 3HWX1 2VJYA 3IAFA 1KEKA 2WVGA 3E9YA 5DEIA 3DUFB 4RJKA 3F6BX 1UPAA 1PI3A 3EXHA 3FSJX 2IHTA 4JUBA 4D5EA 5ERXA 2FWNA 1MCZA 2Q5OA 2R8PA 1TKCA 3RIMA 4QPZA 1GPUA 1X7XB 2Q28A 2BFBB 2C31A 2IHVA 3DV0B 1DTWB 3AHEA 4MZXA 2BFDA 1Y9DA 4K9OA 2BFEB 3AHDA 2UZAA 5HYVA 3ZHTA 3EYAA 2BFCA 2BEWA 3EXFA 4JD5A 1ZPDA 5DGDA 1RP7A 1UMBA 4C7XA 1OLXA 3FLMA 1T9DA 5DGTA 1IK6A 5K2OA 1WCIB 1NGSA 2C3UA 3UPTA 5EJ6A 2VK1A 3HYLA 1OLSA 3DVAA 2O1XA 3EXEA 1V1MA 1V1RA 1T9AA 3EXHB 4QELA 3FZNA 1X80B 3EXG2 2W93A 2EZTA 3EXIA 1W88B 4KXVA 2EZ9A 2QTAA 2E6KA 1UPCA 1V16A 5I4IA 4GG1A 1PVDA 4RJJA 2JLAA 2BFDB 4K9KA 2VBIA 4K9NA 2C3MA 1QGDA 2VBGA 2BFCB 2NXWA 5I51A 5ERYA 3EXFB 1OLUA 1YI1A 1AY0A 3LQ4A 1UMBB 1V11A 2AG1A 1OLXB 3EA4A 5EJ8A 4JU8A 4MPPA 2G28A 4KXXA 2YIDA 1POXA 3ZHSA 2PDAA 3EXHC 5HJEA 1UMCA 2R5NA 4MQ5A 1OLSB 4JUDX 3EXEB 3KOMA 2X7JA 1V1MB 5EJMA 1V1RB 1QS0A 1NI4B 1OZFA 1X7WA 3EXIB 1V5EA 5EXDA 1V5GA 5HGXA 1X7ZA 2C3PA 2OZLA 1UM9A 2BFFA 2V3WA 4QQ8A 3EY9A 1V16B 2EZ8A 1OZHA 2WVAA 4GPEA 2BEVA 4K9QA 2Q27A 4GM0A 2QTCA 3ZHRA 4COKA 1X7YA 2YICA 4Q9DA 1OLUB 3HWWA 5K6RA 2JIBA 1ITZA 3L84A 1V11B 5EXEA 2R8OA 1X7XA 5K6TA 5C4IA 5K3SA 4MPJA 4KXWA 1YI0A 2UZ1A 2JI6A 3DV0A 3D7KA 2JI8A 5I5EA 1R9JA 2PANA 2XTAA 3IAEA 4JUCA 1UMCB 2FN3A 5EJ4A 1PO7A 2BP7A 4C7VA 1YBHA 3LPLA 3OOYA 5HHTA 2EZUA 2Y0PA 1YHYA 3MOSA 3EXG1 1Q6ZA 5FEMA 1X7WB 2Q29A 1N0HA 2BEWB 1T9CA 1T9BA 2J9FA 1PYDA 1X7ZB 2VK8A 2OZLB 1UM9B 3OE1A 2BFFB 2AG0A 1L8AA 2C3OA 4KXUA 4JU9A 4K9LA 1JSCA 1QPBA 1YHZA 2BEVB 1TRKA 4KXYA 1X80A 1B0PA 1U5BA 3DVAB 4KGDA 3LQ1A 4GM4A 1W88A 1UMDA 4D5GA 1X7YB 3AHIA 2BEUA 2G67A 1W85A 5EJAA 4GP9A 5AHKA 1OZGA 2JGDA 2UZ1B 1TKBA 2EZ4A 5EJ9A 5ESDA 5EJ5A 1V5FA 2PGNA 2Q5JA 5EJ7A 3UK1A 2Q5QA 3DUFA 2BP7B 1TKAA 3ZHUA 1YD7A 2JLCA 4ZP1A 3AI7A 4MPRA 2PGOA 4FEGA 1UPBA 3LQ2A 5IMSA 2IHUA 3M6LA 3AHCA 2Q5LA 1BFDA 2J9FB 3M49A 3JU3A
chains in the Genus database with same CATH superfamily
2NOAA 3OPQA 2GR9A 1M8FA 2G25A 3U7RA 3IPYA 4UULA 1IHYA 1SOAA 1VMKA 3DZHA 3N75A 5IVIA 3ADDA 4BFWA 1JVNA 5DYIA 2Z2JA 2OCGA 3HRKA 2JFNA 4GH5A 4IHJF 4TYNA 4YIHA 5AK4A 2ZRHA 1DFGA 1E6WA 3HSSA 3L7KA 4R9VA 3T9EA 5CD9A 4K9MA 3ZYZA 4KQHA 4UHBA 4EA7A 4BDTA 5JDIA 2QSJA 3LIPA 1E98A 4LYAA 4AW9A 2AT1A 5KWSA 4WT7A 4FU0A 3W5HA 1THMA 4WTOA 2ZRMA 3TMAA 1M6YA 4I55F 2RGYA 3A1DA 1PJ3A 1RWKA 3GX1A 1LX7A 4MQ4A 4O2BB 1SKMA 4QUBA 3U16A 3N9IA 4WUVA 4B4OA 4AFNA 2QG4A 1F4PA 2JLQA 1NR7A 2FW0A 2JIDA 5LC1A 4AICA 4JUAA 1RRFA 4N76A 4C7BA 3JYOA 3RGGA 4B09A 1FNDA 3R4VA 2PH7A 3K6KA 4BNVA 1HLDA 3RTBA 2X8JA 4HN2A 5FJIA 4B5LA 5IPFA 5CIYA 4YHHB 4M1TA 5KHAA 2PUGA 1ENOA 1IOLA 1JB9A 3ASYA 2CNBA 2I6GA 3OO1A 3KYBA 4URUR 1VJ0A 2H85A 1CZHA 2D7DA 4C7MA 1A2BA 2P9TA 1EK2A 2QAIA 2R751 4G1VA 1JSXA 1P1IA 2IYWA 4KGVA 3WK7A 1QRUA 1B2RA 3AFIA 1VFNA 2EVWX 2YMMA 2CHUA 3L6OO 1A50B 3KT0A 4PLWA 2BMEA 4Q21A 5F2OA 3TSWA 3U48A 5TB5A 1U0RA 3ZGXA 4PN7A 4ZTUB 1RXYA 2OCYC 1EHCA 1V5IA 2ZT7A 3H5TA 4HUQA 4QJIA 3QKTA 3RPEA 1Z8FA 1YQ9A 4MCIA 3WHPA 1AGYA 1YK1A 2NIPA 1T1JA 3DC7A 3DXXA 1YQWA 3LHIA 2D0OB 3NIGB 4RPLA 5H4GA 3T61A 4AZTA 4DLAA 3T5BA 5FBQB 2Q1XA 2PEZA 1NXWA 5JWOA 2YX1A 3OF3A 3DFKA 2VHWA 1EP3B 4NR0A 4EHAA 2ZIWB 4JJ8A 5AW0A 5I3ZA 5AW6A 3F7NA 5CLFA 5JFOA 4XIJA 1U2QA 4AJOA 4C78A 4DCJA 4QTYA 4DR4B 1MD9A 3SZOA 1E5VA 4OIMA 3RIMA 1ANKA 2HLHA 2RB4A 3ZW7A 5HM6A 3RBXA 3KPVA 3UKOA 4QIHA 4D4HA 4YMHA 4XWWA 1X3LA 2NPFA 4FP9A 1Y1KE 5GQSA 5I4CA 1DWPA 4IMIB 1ZJZA 3QVVA 1WHTA 3TUZC 3EASA 1RM0A 1GGKA 4URFA 1Z5GA 4OLHA 2IWHA 4DUZB 1ZAKA 1EGQA 2PL5A 3DKRA 2OSVA 3HA2A 5JR3A 1D2GA 2YWBA 4FIZA 1I7DA 1J21A 4EYQA 3RSSA 2CUTA 4DDWA 3OOJA 2J87A 3HJGA 2XITA 5TF4A 1BDJA 3S29A 1CRWG 4EWLA 5IKOA 1P5RA 3VKUA 2HSGA 2PNFA 4G97A 2G3YA 2OG1A 3IAAA 3CEHA 4KDCA 4L3WA 3ZJTA 2C9ZA 1MFPA 3B5JA 4QWWA 4GECA 4TM8A 3TM4A 2GBFA 3UOGA 4DSAA 4YJ3A 1QCYA 3RUEA 2EATA 1JALA 2WG1A 1YL7A 5COAA 5WRFA 1GNLA 3M6XA 3G6KA 1IY9A 1JPUA 2OZVA 4RKQA 3MELA 3M6AA 4QKQA 2WWYA 2B5OA 1V8DA 1JKXA 3DGFC 3LXRA 3MGGA 3OF2A 1II9A 4ENUA 1OH8A 5I45A 1UMBA 5BUZA 4EG5A 2X5NA 4ZDIA 2I0FA 2IZ7A 4H77A 3BVPA 1EK1A 4NCKA 1GPKA 3BGVA 4OHRA 3UWKA 2QBYA 4LRQA 1IL0A 5KYWB 4AULA 4R7GA 2OKCA 1Z0KA 1AXGA 1P62B 4LE1A 5CTJA 2X8JB 3L6UA 4JMLA 5DNEA 2F8MA 3FW1A 5BN3A 1NXQA 1IXYA 1XPUA 3D8HA 2X2PA 1RSZA 5L45A 3KSZO 4C3UA 2OV3A 3SHQA 1MA0A 2RKBA 1KRXA 3ZGLA 5FUWA 1NY5A 3AL2A 3PITA 2AR9A 3AIMA 2QIPA 4DV7B 3ZXXA 4IMRA 5JBNA 3H2KA 4LFBB 2X0FA 4Q3BA 3V5NA 1T5LA 2ABWA 1OUMA 1GL6A 2V7PA 4XCVA 4IFEA 3RR2A 3CTMA 1ZU4A 1GZ7A 2WBLC 3GEIA 3NOOA 3KQVA 3ST7A 4CIAA 3GGSA 2F62A 4BZWA 1OXUA 4HUQB 5KOYA 3E15A 1GO2A 1PJCA 2PBRA 3CMMA 3C1AA 3CJTA 1ETUA 5EE9A 4UVIA 1PWZA 3AR6A 1M67A 3LG2A 2IGTA 3LHDA 1Z4NA 3H42B 3Q0EA 3OQMA 1R0LA 1ZVKA 1R12A 2B2NA 3GL9A 4N03A 1L5ZA 4PQGA 5CDUA 1LF5A 1M73E 2W93A 3QENA 3DR5A 1PHPA 1EU1A 2CLSA 4HHEA 4B3FX 5BV2P 1IN1A 3WDKA 4EYOA 4PFQA 5CM9C 3SSNA 4PVCA 1ZGBA 2UZ0A 3HCCA 3N7UA 4GSKA 4R1LA 5C46F 3N58A 4Q9HA 2IBTA 1LRKA 1G8FA 3O0DA 3V8QA 3F96A 2R1VA 3SVLA 3AKCA 5BMOA 1B73A 1XRPA 2OO7A 4DCGA 1O58A 1C7JA 4LI3X 2FHSA 2RHTA 4KXVA 1LW6E 1WHTB 2X4GA 3AY3A 4MEJA 2DPMA 4Q1VA 4CMIA 4CN8A 3TIGA 2XVYA 2PSJA 3VUEA 1SUWA 4NIMA 4QECA 4X93A 1J8DA 1W94A 1B16A 3C45A 4YV7A 3RVJA 4L3OA 4YRBA 1Z17A 3UB4A 4LYJA 1GUZA 3U7GA 2XDQA 1PNVA 1R4MA 1H2EA 5I47A 3IH5A 2Y1EA 4XQGA 3GHHA 4KH1A 1SUDA 4WKPA 4KQXA 1YS9A 2OCDA 1H4TA 2W2KA 1RD4A 3ASUA 1TK3A 4UW9A 3D3QA 4YJ3B 1M1NA 5T67A 5TEWA 1M3SA 4AJEA 4CNBA 2HEIA 1TM4E 2FEAA 4BKOA 1CQIA 5JECA 2R6GA 3QU7A 4OQLA 1QK4A 2PBZA 4V0RA 3TIFA 1K66A 5ERYA 5GZ1A 4HS9A 4N1AA 5JAIA 3Q9LA 4BYGA 2HSDA 1KQGA 3UICA 3PFCA 4L73A 4MRPA 3SEFA 1J22A 3R0QA 3GARA 4OBEA 3GMSA 5IT5A 1UMBB 1L6RA 3C0KA 1E1DA 4TTRA 4MI3A 5J3JA 5ESWA 4DSNA 3JV7A 3IQWA 1VXOA 2QBYB 2UUPA 2OUKA 1O97D 4R3NA 3I4LA 4B7UA 1J7JA 4JA0A 2DBYA 1IFXA 3CX8A 2IZOA 1KPIA 4N5DA 2O2IA 4AJNA 4EKIA 5BN3B 3UGJA 3L40A 2I1LA 3MD0A 3GGJA 1U8ZA 4Q7MB 3KL2A 4DDUA 2G8NA 4Q9AA 5DSZA 4IOKA 4QXOA 3DLIA 2B6HA 2CFOA 1ZRNA 4HATA 1PJQA 4LUCA 5HJEA 1QMPA 5LMCA 2FEPA 4CGZA 3SBDA 3SSMA 5FAXA 1FYDA 2E1PA 2HSWA 3C4QA 2A1TR 3DHVA 5LQJA 2J32A 3CBGA 1HT2E 1FMFA 2ZUUA 1YF3A 1FTQA 1RJ9A 4JBWA 3MUNA 3WKDA 5KZMB 2OY0A 2DWOA 3DBHA 3PTAA 4AIRA 4PTLA 1CIJA 4MUYA 1RQ7A 2Q7OE 2QSYA 4QQFA 5FI0B 4AX4A 2CNWD 1IJEA 4B47A 4EATA 1V96A 1PLLA 2EWWA 1E2UA 3BRQA 4PU0A 2AOXA 1SNYA 1X7WA 3U3JA 4CL2A 3GAMA 2QB5A 4PSUA 4IIXA 1EX1A 4UOQA 1V8FA 3L6EA 3QKIA 2HNBA 5AJYA 1V5EA 1XVTA 4B74A 1RVDA 4ZI5A 1HRKA 3PC6A 1QORA 1YC2A 3BM5A 3DAGA 3H9UA 2R1VB 4XJSA 1YRWA 5C1DA 3QBJA 5CA0F 3ZTTA 2V0CA 3V00A 4PYNA 1LBSA 2WRZA 5LBIA 2BUBA 2HMWA 2EWMA 1JB1A 3WIDA 1LPNA 3DFMA 3LY9A 4CMIB 1AHNA 3JAKA 1ZW1A 3EG9A 2XMQA 3DCJA 3GD7A 4WBNA 3LAWA 1F6BA 1K3UB 3A9WA 3Q15C 4C76A 3EY9A 1GG2A 2H3HA 1K27A 2XA2A 1KI7A 2CNWA 2XDQB 2RGXA 2XNDD 4GKAA 1R4MB 2XGMA 4OA8A 5J4KA 1L3IA 1H2YA 2FCAA 3I72A 4JB0A 5I7OA 4MJ3A 2H5EA 3PGMA 5IW8A 1KP2A 3AL0C 4RSGA 2H2HA 4BECA 1IQ0A 2W2KB 1X94A 3ETJA 4MVJD 4PAMA 3WO0A 3ZNPA 1A4IA 1M1NB 4NCNA 1AB5A 1E1MA 3JQ9C 4H6XA 4ALMA 1CQIB 1VLJA 1N7IA 4MKXA 1ZP6A 1YZGA 2YICA 2P30A 2QDKA 3OJXA 4X63A 1EFKA 1MC5A 4QICA 1VP3A 3LO8A 3CNQS 1G8GA 2HH9A 3LA6A 2G63A 4FILA 3IVXA 4WFQA 4FC7A 1ZXXA 1MFZA 1K7XB 2DF8A 1Y48E 1FPMA 3EC2A 1DAFA 1RYEA 2OLKA 4QO8A 4DNFA 3WGGA 4F5DA 2GPTA 2Z56A 4N9WA 5JMWA 1XO1A 4HKTA 3WIOA 3CUWA 3ICCA 3WLPA 1ID8A 2XNDA 1YI0A 3Q9UA 4YIKA 4HFMA 4FQ7A 1E8MA 2AB0A 7ABPA 1GAXA 3PYMA 2HDNB 4EDFA 2AC7A 4A73A 4S35A 4LOLA 2VWPA 2BMVA 4O1MA 4O33A 1LI5A 4RFSA 5D7NA 4MVJA 5KB3A 4IRXA 4ZMBA 1DJLA 4ZVKA 4POOA 2AI2A 4YMGA 4XPZA 3QSGA 5C5IA 1EVJA 3ACBA 3M89A 3SQNA 3V7YA 1ULAA 2IZ0A 1EK5A 4C0BA 4LPSA 2HSJA 3N0WA 1P74A 4UE3S 1FFWA 1YBHA 1L4BA 2MMCA 2XWJI 3IS3A 1RJ9B 4GR5A 4V03A 1NYTA 1QF7A 1QVWA 2H7VA 3ISVA 2WU1A 3LC2O 4XJVA 3ZIUA 4EKNB 1BFUA 1JN0A 1GQFA 5J63A 5JI3E 3DBHB 4IKEA 3RRJA 3ZOZA 4YAEA 1Z6GA 2FW6A 4J1TA 3VNBA 3ZY5A 4J43A 5JCJD 3P2MA 3IHLA 4C2AA 1ZVMA 1YDFA 3GJTA 3OJLA 4R0MA 3UPUA 1GGJA 1HYQA 2WD9A 3IDZA 3RJ5A 1U7OA 1U3VA 1V25A 1X7WB 1Y7TA 1K7EB 4ZOQI 2OBYA 1CUBA 4P4SA 4X20A 4Q9KA 2FPWA 4TLAA 2QYTA 1H4QA 1CU1A 4MP8A 1BJKA 2J9GA 3FDZA 5CVEA 4E5VA 4CLDA 4YR9A 3HL4A 1IIRA 1D04A 4NECA 3AV3A 4J0EA 3GW8A 3TQSA 2ZI3A 1AQUA 5TPWB 5EUCA 4CUZA 1USUA 2J3EA 5EJFA 3JAKB 4W5JA 3EG9B 4YCAA 3H0KA 1VHTA 2G04A 2NYAA 3HYTA 3RABA 2PJZA 1V35A 4UJ5A 4WBNB 1JQEA 1RXCA 1UKZA 3KUKA 2WWTA 5LCXA 3ZU5A 1JSCA 3KK0A 2GZ3A 2SKEA 1QRRA 4XX0A 3D6MA 4OX9Y 4DR2B 1MENA 4Q7LA 4F11A 1A5AB 2ONJA 1PSZA 2N42A 3PYXA 5FBKA 4RTPA 1L4GA 1WW8A 3I64A 1ZJ6A 4KCGA 4CM9D 1A1VA 4OB7A 3A4MA 2H6EA 4HJXA 1O5TA 1W6UA 1DKMA 4LXXA 4Q7EA 3QBEA 4KLZA 3QP9A 1UMDA 4G8DA 4FMDB 1E89A 1Z6YA 1EX9A 1FTYA 4TYYA 3VZQA 3E8MA 4RE6A 3OJOA 4KQEA 5C31A 5ALKA 2QS9A 1P2TA 3TPFA 2WSBA 4GIBA 3RRYA 2BSAA 3UFBA 1FCJA 3D64A 1U02A 5AHKA 1F8UA 1QGED 2A14A 2P41A 3RO7A 3E5MA 5IX8A 2P6RA 1YQGA 3KLPX 3LFTA 4YH1A 1JECA 1A71A 2QVBA 2YC2C 3SQDA 5ITWA 2H07A 4H7FA 3U7EB 4C87A 3Q10A 3A4VA 3OM8A 2NPOA 2GCNA 3U4CA 2C94A 3U9LA 2IF0A 4RFSB 3T6KA 4CM9A 5KYXB 3GJ4A 2Q41A 1VTKA 1P5ZB 3CF4G 4L27A 5JLJA 2V97A 3ZCSA 5EJ5A 1SUSA 2B82A 5DSXA 4FYPA 5AKIA 4H4CA 2ARKA 2FX2A 4UUNA 4KXFB 1PTKA 1JKJA 3AEQA 4DXHA 4REOA 2GVZC 3DOIA 1EJBA 2GM5A 1T5DX 3D2CA 2IEYA 2VDKB 5DIFA 5ICEA 1C3XA 1U3TA 2E4XA 1IY1A 3ESZA 4KQ9A 4L8WB 5MN5A 1AQIA 1EMDA 3O2SB 3T8YA 1OQAA 2FNAA 2PM8A 4ZODA 5H81A 1U9IA 4GBED 3IQIX 3WFJA 2B1RA 1K6XA 3DTVB 3AVOA 3U4IA 4PPGA 1P0IA 4L4SA 4HNRA 5A4MS 1E3TA 2NU6A 4P35A 4UVHA 3U7JA 1NX6A 2QDXA 3WSWA 5IMSA 2CDAA 3U3KA 2ZRQA 4P4SB 2IHUA 4X20B 5HF6A 1USIA 1VI6A 3F7OA 3JQFC 5JPDA 4TMFA 4J91A 3HBLA 1T0UA 1RWOA 2ZPAA 3HEMA 3B1VA 3AUTA 3FDZB 3NOXA 2IW1A 1OIVA 3QKSA 4NYIQ 5JWHA 4KN9S 5IMBA 1YK0A 5CLHA 4YRSA 3BTVA 3BCUA 4F6LA 3CIOA 5E9JA 1XYYA 3E9ZA 1ZGZA 2X13A 2XADA 2OK7A 2YYZA 3LRTA 1MUUA 5ALQA 3D3JA 2PMCA 3K3PA 2Z9DA 3T38A 4CXMA 3P94A 1M83A 2UYOA 5ES3A 3EVGA 5EL0A 2G71A 4JQYA 3E4CA 3WE7A 4MUBA 3T3EA 1PCXA 1N57A 2VXBA 3M33A 3GLGB 3FYUC 3I9KA 4DIOA 2COUA 2BFEA 3TSAA 4BQNA 1S2OA 2JJYA 2VP4A 3QXSA 3Q85A 4NHEA 2Y1XA 5EZ6B 4CDGA 5EIXA 5HJ5A 1QXSA 3CW2A 3KQOA 4JY7A 4BV8A 1H2RS 3QE4A 1I0ZA 3DAYA 3E7FA 4I19A 5T3UA 1UMDB 3KOOA 4E5PA 1VJ1A 2FUG1 2YWGA 3FMPB 5DEOA 2DLCX 1VSVA 2OPBA 3MWYW 3CCFA 4HLQB 4BPBA 2WZDA 3N76A 1KJWA 1KYWA 3NTOA 3CV3A 3P9SA 1E0DA 3ZZ1A 4DCPA 5BNTA 1W5BA 4MS4A 3VOBA 4WNYA 1XPOA 1UZNA 1BH6A 3LUCA 3SFTA 4DQKA 4DV0B 1DG3A 1PJLA 4R2MA 2O7SA 2CNDA 5A71A 1B6GA 1Z83A 3D1JA 4MYDA 1I7SB 1AH2A 1VIVA 1P6QA 4DLXA 4XR4A 1SUBA 1RAGA 3MT7A 1M6WA 1SIBE 2ZBDA 3H11A 4BMNA 4BOYA 1HE8B 1DJMA 4RDCA 2VHUA 3CKMA 4HZIA 1K6IA 1FE8A 4CHGA 4FDTA 5E0KB 1QE5A 2QN8A 3BT7A 2IEAA 2C2OA 5FHQA 2QROA 5CFPA 2E89A 1I3MA 4ZVOA 2CLOB 2VHZA 3BWVA 4HXFB 2HQRA 4WBSA 4EPWA 1JVBA 1D4OA 1UZMA 1YUMA 2LZ0A 1SQFA 4I99A 4BNZA 1JKJB 1LSUA 3AEQB 4NP6A 3CZ4A 4NBVA 3RUPA 3CSSA 4XQEA 2WMOB 5DT2A 1DOZA 2HJRA 2HIAA 4OQZA 2M9MA 4P08A 4UAUA 4TV8F 1N6LA 2ATIA 4WACA 1RBYA 3WLKX 1W7AA 2AFHE 4C4TA 4RNDB 3G02A 5CD1A 1XI2A 3IPXA 3R0VA 1YZYA 5F5LA 3DOUA 4FYJA 4EQ6B 5M34A 2ZUDA 4GMKA 4YT8A 1J56A 2DLDA 4RS4A 4DMKA 2CD9A 2NU6B 2JHFA 4DRZA 4LC9A 3U0VA 3O83A 2EGUA 3I30X 3KJFA 4I1SA 1D1SA 3RFXA 1I24A 2IUYA 4ZOBA 4ZHQF 3VNUA 2W37A 1I80A 4R9SA 3C5CA 3SJCA 4BMXA 2YASA 2GT1A 4R8SA 5M7EA 1ZUHA 3D8SA 2D3WA 2N3ZA 3QKSB 5DH9A 4JSTA 4EY6A 3IVGA 4ENSA 2B9VA 5DLDA 5K01A 1R0CA 3ILHA 4RVFA 4ZT7A 3I8OA 1I6MA 2I4MA 5U4XA 1NVAA 4U7HA 5AK5A 3ND7A 3TD6A 4K87A 3ICPA 1SVOA 4KMOA 2BBWA 3LKBA 4Q1AA 3VHQA 5LN1A 3AHEA 1ZWKA 3MXTA 4PYRA 3EDYA 2PH3A 2ZB7A 2BEKA 4O59O 2C99A 2ZPTX 3V7WA 4UM5A 1XJWA 4RMJA 4IV0A 4FTWA 1AG9A 4GXTA 3DA8A 4I3FA 2AG5A 4BAUA 2BFEB 3GFRA 4H7DA 1NQAO 5KKAA 2G7ZA 1V47A 2G17A 4L2IB 2CZGA 5EWLA 5JANA 4BX2A 1XCOA 3M9WA 4PLPA 3GUHA 3I9MA 4HGOA 2PA0A 3ISTA 4RHFA 4LQCA 3L7LA 4PG6A 3ZDDA 2QVXX 3C8UA 1KNXA 5AKLA 3IVAA 3WYFA 1TZCA 3SJUA 3DDOA 1W75A 1AM4D 2JIZD 1KEVA 1PGOA 3H6GA 3TSYA 2B37A 4WZZA 4MS4B 2NV6A 2WUGA 4HH1A 3H84A 1I30A 4UFNA 4J4TA 2ANBA 2I3ZA 4E11A 2N47A 3LK7A 4AKEA 1SRRA 5L7WA 5BUCA 1V95A 1C14A 3Q7RA 5FBWB 4DLZA 3J80A 1UF9A 1KIFA 1KZ9A 1NIJA 1YDWA 3H11B 4IXMA 4XZ3A 3LY8A 5A4IS 5H9WA 3H83A 3KETA 4EKGA 3BIXA 1QGZA 4PCLA 5DI9A 5TC4A 1EVQA 1W9MA 3PZRA 4M0PA 3SPXA 1W4CA 1IAVA 3Q7TA 5SY9A 4DGQA 2ZSAA 2R25B 3KB6A 3OCVA 2FPXA 3NASA 2ZG6A 5G3YA 3V2GA 4AZWA 1Z35A 2QW0X 2VTDA 4RV9A 4R2LA 5CUQA 1C8LA 1PFGA 2ENUA 3F6RA 1YQTA 2BY4A 2JIZA 4MI9A 4KSBA 3RT1A 4KK3A 4H1TA 4JVNA 3S7TA 3TSOA 2WF5A 3PNVA 2H9IA 4KN6A 3E0XA 4P36A 2IOFK 3CO0S 3OQIA 3QE3A 2NU8A 3ZCVA 4EVRA 1W35A 1ULTA 4FYIA 4GEKA 1K8YB 1QV6A 1S9HA 5KTNA 2JEZA 3ZGVA 1UFVA 1BVRA 3I28A 4L5AA 3V1TC 1VECA 5JO0A 3ISJA 4DWJA 1P1FA 1HDOA 2PG3A 1ECBA 3W2FA 5KVVA 1UJBA 1WULS 3ZGOA 2OD2A 4MI6A 3TTUA 4DM7A 3KXDA 1V7PC 1L7PA 1UQRA 2C00A 4P3NA 3WRXC 2DH6A 4DWOA 1KEEA 1UBRS 2BAGA 2VJCA 5JD4A 4QVGA 4FOSA 3B1ZA 5FFFA 5CLJA 1GN8A 2BEJA 3KDAA 2XLBA 3Q6IA 4TXNA 5F51A 5JTTA 2QPOA 3K6SA 1P7PA 1PZEA 4X3PA 1BFKA 1JNYA 2XD4A 2O0MA 4HB3A 2IYQA 3ABZA 2FZ5A 4PS1A 3WL3A 3KZCA 3RK1A 5I4IA 4PGAA 4JDUA 3SICE 3QG1A 4RETA 3F2IA 1SC6A 1L5OA 1TJPB 1WUKS 1XD8A 4W7HA 4AJ9A 4C0SA 2FAXA 4I9HA 3T7JA 3FIUA 2FN4A 2FK8A 3WGQA 4IQFA 1UIMA 3ZNNA 4ZVPA 1RQ2A 1FA9A 4IHJA 1DKUA 4WLOA 1FDRA 1OAOA 4G37A 4XGRA 4LJKA 5EWLB 7ADHA 3C41J 5TR9A 2PWAA 2WF8A 2WWGA 3KALA 4C9BA 1QDEA 3NPMA 2ZUTA 1NBME 4Z6KA 1XL0A 1H1LA 1WCWA 3UC9A 1RABA 3PX3A 2CXRA 2V3CC 2RONA 3FUCA 3LPAA 1NLUA 1RT9A 3F97A 3T0IA 3RIYA 1NW6A 1AVTA 4OJYA 4CM6A 3OICA 2ZRGA 2NP6A 5FTMA 1E9FA 1IDOA 1SRQA 2MSNA 4KMRA 2ZB8A 3DW3X 1POXA 3KEOA 4R0VA 4PZAA 1RLMA 2C2GA 1N4AA 2Q6TA 2MU1A 1JG4A 2ZB4A 2C4KA 2X7XA 5EHIA 1Y80A 2PS0A 4JLWA 3UHOA 2WMYA 5IK2D 1SCUA 2QD3A 4BBPA 4Y1EA 2BSXA 2JARA 2OILA 5CW2A 3FNFA 5LJLA 3GUYA 3MB8A 1VE9A 1UJ2A 3MCTA 5MGBA 2VJQA 2OVFA 1C41A 1T2UA 1R0BA 3KCQA 4YB8A 3AKYA 1HXHA 1TAUA 2D54A 1M6HA 4OYRA 2GRUA 3UAZA 2FZCA 3GLFA 4OYYA 2CXNA 1EVIA 2R7MA 3ZYCA 4EGQA 1YR8A 2GN0A 3OQIB 4IW3B 4Z9AA 4ZEXA 2NU8B 3VX4A 3WLSA 4AP5A 1LC3A 2D1QA 4B6RA 2I03A 1G5TA 3N2EA 1NFFA 4UAGA 3ZJUA 3WGZA 2K7FA 4OYHA 6Q21A 2QZ9A 3HN2A 5IFKA 1PZFA 1I0LA 2PX2A 2QN6A 5E9AA 3KT6A 5IK2A 4D6YA 1I7PA 5BWLA 4KPUA 1LU9A 5K09A 5JS6A 3EAGA 1OX5A 2QZSA 5KTRA 1JA9A 1AXEA 2GAFA 2RGNA 3SDBA 1Y5MA 1KEEB 1Y1QA 4JLMA 1Z29A 2R48A 2D0PB 5BRJA 3IP3A 4OLFA 4CIDA 1QTQA 2EF1A 3GCWA 1KZ7B 4A2CA 3K6SB 3KKKA 2WFMA 3KYIB 3NS7A 2Q9BA 1GGEA 1ZYUA 4RD6A 3Q5EA 4AQYB 5KNCH 1SD5A 3ON5A 2V55B 4FS8A 5JAUA 4JNCA 3PA6A 2VHJA 4KVAA 4RD3A 1YOVA 2AVNA 1DQNA 3U3MA 2VHVA 3UNXA 1SXGA 5LQAA 2PXXA 2E82A 1SXIA 1UBTS 1Y4SA 4Q1CA 4IHJB 4Q15A 2E4AA 4RYLA 1IPHA 2CUKA 3AUJB 3CONA 3FJOA 5DLPA 1NMYA 3SZMA 4YP0A 1RQXA 1YS6A 2PKXA 2XQGA 1ZNXA 4IIJA 4HAOA 2VJPA 3EQ2A 3SBEA 4EGAA 1VBKA 1K9SA 3TOZA 2J0EA 2YN4A 2FK7A 3EF0A 4QDKA 5GVRA 5AW9A 2Y9MB 1H1LB 3VSEA 1R10A 2TYSB 1NUHA 4ZCPA 3K1JA 3CS3A 1PZMA 2JIMA 2E4YA 2TMYA 3ASZA 4QWMA 1GQ2A 1EPUA 4UATA 5EXPA 5T4FA 1FQJA 1KSHA 3GNTA 1YL5A 4WVLA 2PMDA 5AXAA 3T1HB 4L5JA 3CLVA 4HD8A 1W73A 4QYTA 1E60A 1ZBQA 3Q8MA 3DBVO 2H57A 3MTJA 3ZJVA 1MX5A 1NM5A 2MSLA 1VJGA 1OXTA 2WY2D 3W8DA 4K86A 1GLNA 2IZZA 3IKLA 4KVZA 3KVYA 1FDOA 5EMMA 3RUDA 3PBKA 5FUXA 4UCQA 4MV8A 1CQPA 2VEOA 3URMA 2YVLA 5HIIA 1R9JA 3DMTA 5ANRB 4B44A 1P31A 2XE6A 1S8OA 2Q49A 3WQQA 1L1QA 2WWRA 2ZYSA 1SCUB 5DX0A 5IAJA 2G9UA 1ZK2A 3R3HA 4LTDA 3EMBA 5IT9A 3BXPA 3HV2A 3R7SA 2R6AA 1FMTA 2HGZA 3P9QA 8ABPA 4B35A 2ATEA 2KLBA 1P0CA 2QT9A 3OPYB 4M4SA 4LYGA 4C7VA 5GIOE 4QOEA 3LPLA 3GFSA 4R8MA 2CYCA 2AMLA 4JLBA 3RTCA 3ZNQA 1FOEB 3PWZA 1GGNA 4CQLA 4UEQA 2B30A 2GYUA 2P69A 1H4SA 5BWBA 2D59A 3GLFB 3W2TA 2OOKA 4B2LA 5LQNA 2GJ9A 2VLBA 1L7VC 4GYWA 4J49A 4CTMA 3NB0A 3SKVA 5FL3A 1JAYA 3QPWA 2VTKA 1P2SA 3OHMA 2Z98A 4Q4DA 5DFAA 3AILA 1DIOB 3U37A 4HUTA 3ADBA 2AX3A 2NTJA 2WTBA 1LH0A 3TI9A 1TL7C 4Q7KA 3RROA 4PNEA 1CDDA 3W79A 1M0SA 4KPUB 1OXBB 1QIMA 1W25A 2J4CA 5FDFA 4X00A 1KETA 1W93A 4LWZA 4D4GA 1NMXA 2CE7A 1B93A 2RAPA 3O82A 3PX2A 5AVZA 5I7SA 3EVEA 4ACBA 2DSNA 4QODA 4V2UA 3OE1A 5E3JA 1M6EX 3GFVA 5TSDA 4EABA 3MCAA 4NBRA 5K9ZA 4BLOA 1ENZA 3OETA 3N3AC 4JZKA 4LWQA 3SD7A 4D44A 4QARA 4UUMA 3S70A 1A4RA 2Z57A 2X23A 1SQ5A 3ORHA 1W9HA 16PKA 1OBCA 3KWLA 4MW9A 1GQOA 2JAQA 2HGSA 1FP1D 3UUWA 1KXZA 4D4IA 2A2ZA 1ADGA 2VDMB 2I1VB 1I14A 3I9JA 2VDWA 3FWPA 4YUZA 1ORRA 2FMIA 1TT5A 5B64A 5M5BA 5LKRA 2D2IA 2VZ8A 1W0JD 3ERCA 3H75A 3NTUA 1P4JA 3WLQA 1T2AA 1SCKA 4WY8A 4R7TA 3UAWA 3KAQA 5A0VA 3KUXA 1NP7A 3QPBA 3E82A 4NFLA 4UTOA 1XRLA 1YAJA 4E7PA 1JDBB 4HVCA 3GAZA 1V3QE 1XDDA 4Z2YA 1G8MA 3JSAA 3H2YA 4YA6A 3RFVA 1EESA 1KI3A 4TLCA 3TIXB 4B45A 1U0OC 2WU8A 3X1MA 2V9CA 2LKDA 3VI4B 2X40A 4ZMRA 4NCXA 1IM8A 2CFRA 3FROA 1TW3A 4BTVA 3FPHA 3TJZA 1ZMXA 4ZYTA 4URWR 5L3ZA 1PKEA 4LTNA 1QVVA 3TO5A 1QZ3A 1M1ZA 2WILA 1W0JA 1Q44A 4HCJA 1GL3A 5HK9A 1U0NA 3Q5DA 4BX3A 4E2FA 4FDMA 4B76A 1V5FA 1D0VA 3RKSA 4JLJA 4CE6A 2X41A 3M6MD 1C4OA 4V1CA 1V2HE 1N0WA 2D7CA 2F4NA 1BD3A 1IBSA 1SIUA 3ER6A 4JVMA 3SOZA 4C1BA 4YLGA 4G1FA 3ECAA 1QG0A 3AZOA 3QLUA 3QTLA 2DZDA 1E4OA 2H5JA 3WGKA 4EOGA 3P4XA 3IESA 2HK7A 4Y2SA 4X7RA 2GPSA 2LP4Y 5FKJA 3NGMA 3FBWA 4CQLB 2NSLA 1IAQA 1NJ8A 1NVTA 3QHAA 2H06A 5THQA 4QYIA 3A2LA 4F92B 4IIDA 1DWQA 3AP1A 5ALFA 1F0KA 2F3TA 2IELA 3DP7A 5IULC 4HFNA 3B89A 3QOFA 3ELUA 4CTOA 1E64A 3IEMA 5T7BA 3G3EA 3D8UA 4GFDA 3U6BA 2X6QA 4UDYX 5ES4B 4FX5A 5L4NA 3FUUA 2CCJA 3WLHA 2PZKA 1Q7EA 4DLUA 1E6CA 1IVSA 4QNNA 3FM9A 4XW2A 3MERA 5JHGB 3BIOA 3DMHA 1DEOA 2VNHA 1Z7BA 1R18A 3GDOA 2DWCA 4IDPA 4UMFA 2O8VA 5B58T 3ZDFA 4DWWA 3I39X 4JI4B 1ORHA 1S8AA 3DWGA 3INGA 3PNLA 2Z2XA 3AIKA 1RE1A 1P39A 3DVSX 1MNAA 4G36A 4QGSA 2L2QA 1DRUA 2F1KA 3BULA 4DLRA 3LUJA 5EHGA 1W8DA 5CA0A 4WN9B 5H59A 5DXFA 1Q0RA 2BE9A 1VI5A 2Q45A 4W7IA 2BW0A 1G42A 4DCVA 1UBSB 4F12A 3V42A 1Z5NA 4QYWA 1SQSA 4GF5A 5HP4A 2VDWB 3C8MA 3DAHA 2I8CA 4QU5A 1TT5B 3C1UA 3PD7A 4NYIR 4RKWA 4U9IS 5JASA 2D3TA 2Q3EA 4RENA 4QOFA 5DB4A 3QVJA 3U3ZA 2WNHA 2DJ5A 4EJ0A 5C35A 4XA8A 1YJ8A 2IT1A 3MLAA 5EMNA 1U3WA 4M0FA 1JDTA 1YB7A 1I6LA 2DFPA 2FDRA 4CBVA 3OY7A 1P5HA 3BREA 3O1JC 2PFKA 4B48A 1VJDA 4RY0A 2CDBA 4U6NA 2JBHA 3PCXA 1Q91A 1PZXA 3VZCA 2IYLD 1HURA 3KE9A 3PC4A 3PPVA 1YUBA 4EAQA 1NDUA 2H1FA 1EHIA 4QDTA 4NNPA 1KH3A 2R2GA 3BEOA 1WV0A 3F49S 4JXZA 1XRSB 4KE8A 3OT1A 4HX5A 4TMZA 5IYZF 1CUAA 3H5OA 1P4GA 4IO0A 4QL3A 5A62A 1JJVA 1FFCA 1MRZA 1QFZA 2I2CA 3C2QA 3KOZA 1SBTA 2ZT8A 2ATCA 2ZU6A 2IIQA 3DH0A 1DRKA 3B1FA 1YJBA 2XEXA 4M21A 3E70C 3IDQA 4RVCA 4UPVA 5E4JA 2FEMA 4FGZA 4V1CB 2P3OA 2W48A 2RH9B 2NWQA 4Q93A 1B74A 3V4VB 4EA6A 4RDIA 3VZBA 5I7UA 3HI4A 2ZWIA 2X6RA 4OCZA 1S3GA 4CQNA 5EZSA 1T2VA 1UPAA 2CMKA 3AM1A 1TJNA 5FUBA 4GQAA 2PAFA 4B31A 1COWD 3TRIA 2NTEA 2C7GA 5J1SB 1PHRA 3ROXA 3AZQA 4R8KA 4QYIB 2CLMB 3PNYA 4L5CA 3FLBA 4LISA 4MKFA 3TL3A 1OA0A 3HXOA 1KZ4A 4ND4A 3DBRA 5B2EA 1GUFA 1ZR4A 1BD4A 3JARA 4EMUA 1VJRA 3OZDA 5LDHA 1FTGA 1RYNA 1SMKA 3VH3A 4H1WA 2X9VA 1UAYA 3OEHA 9LDBA 2FR8C 1F38A 3TQTA 1SOUA 1UAGA 5KIAA 4IQGA 3V1YA 1O6ZA 4H7JA 1UJNA 2HO5A 3KHTA 5EE5B 3PIIA 1YQXA 3U4MA 1A69A 2M6SA 2NSDA 1XLTA 4FEYA 1H4VB 4L95C 4U7PB 5EYPB 3RT7A 2Y1OA 2G9RA 3V1NA 3DV0B 2J3QA 4GI2A 3E8XA 2VF4X 1QB7A 1L8OA 2Y1WA 5E2AA 5CA0B 5FI1B 1ISRA 2ZJ8A 3DKIA 3KPYA 4BNKA 1UXOA 4K9OA 5FCDA 1K3FA 3ZD8A 5D2CA 4RM3A 2G72A 3EDQA 5AP9A 4GQIA 4DR3B 1G9TA 4WECA 4WCVA 3CR7A 2ILTA 1MJHA 3ZDCA 2NV2B 1I5OA 3IL2A 2JRCA 1IOVA 3JD3A 2WD8A 1GM5A 3ER8A 1N0IA 3QGMA 2C54A 2B4YA 5CJ2A 1UXIA 2YZMA 2FUNB 1RJGA 1IUPA 1RP7A 3DC2A 1V2GA 4TL6A 2JANA 2QRUA 3KLNA 5IM5A 3UMMA 4EUNA 1YR7A 3C3PA 1VG1A 3TCXB 5DULA 1R5OA 5AQEA 4RTMA 3O03A 3R0IA 4HAYA 1JX6A 2DPXA 1AQJA 3DE3X 3SEZA 3S2UA 4IJKA 1Q0PA 1QANA 3JWEA 3AF1A 3HDTA 4N39A 4TTQA 4CIWA 2E48A 4OXXA 1CUVA 4F93B 1A9QA 2MT9A 4K03A 4W8GA 3KAPA 4AN0A 1KZHA 3OT1B 1NGSA 4TTVA 3G6WA 3PWTA 1XKLA 4MKGA 4XSHA 4FZ3A 4RLFA 3CLTC 4LSGA 1U90A 2GN9A 1KSGA 4J4BA 5ALRA 4H3HB 2EL7A 3FNRA 4WEOA 5ED0A 2P35A 3S5JA 4EKDA 2ZUFA 4FD3A 3ENQA 1WW2A 3KZVA 5E9WA 4EJSC 3IC5A 3MCVA 3NJ8A 5AJVB 1QR6A 1WLSA 2B83A 3E03A 1I2AA 1SVLA 5LP6F 3PWSA 3HJBA 4KLRA 2MSEB 3UBTA 4NXMB 1T0JB 1A8QA 1K5HA 3BSSA 4YAOA 3BMCA 1WXEA 5KQPA 4PNHA 4BIMA 1T9AA 1D09A 4HLNA 3OJEA 4BP9A 3TEJA 1KK2A 5EIBD 1KK3A 4I81A 2JLWA 1R6TA 1ZI9A 3KUCA 4G81A 1G7SA 2ORYA 1TA9A 1NFQA 4Z1MA 3F8WA 2HRBA 3AVYA 3FPGA 3WJ7A 3GFQA 5AW1A 1TZMA 2WUEA 3DBRB 3LC0A 3MUFA 1CUIA 2BC9A 3JARB 3QVTA 3VX3A 5EZYA 4F45A 3IVMA 1JHDA 1R0YA 5AOAA 5EFZA 3T7EA 3WHIA 2IH4A 3BS4A 3TL6A 2C5EA 2EP8A 1PR5A 2ZRLA 2YUIA 4HDKA 1PK9A 3OP1A 3P4YA 4F3TA 6CHYA 2VAPA 4FR2A 1TQDA 1Y7PA 2L42A 3FPJA 1O7JA 2J7KA 2QUAA 3NCTA 4I5FA 4CCSA 5BORA 1Y9AA 1VCOA 2CVPA 3OU2A 4BMPB 4XYMA 2HA3A 3HJNA 4QDOA 2MR5A 3RUIA 5BSWA 3P9YA 1IRIA 3IP1A 4OP3A 5J47A 2AJTA 3LH5A 4IAOA 5EIOA 1YDHA 3AJ8A 2OD9A 2NU7A 3B2QA 4E1AA 2Z5FA 4KSCA 1F20A 5KWIA 1V6AA 5FOVA 1OFUA 1W1IA 3L8EA 4WKGA 1GPAA 4BP3A 4F38A 5JAZA 2ZRCA 2SICE 1LRLA 2AXEA 4L16A 4MGKR 4ZU3A 1AQNA 4QM7A 2P1ZA 3A0RB 3B1JA 2VBGA 4D1YA 4E1VA 1H3EA 4JGIA 3W5UA 4YRZA 1DP4A 1YI1A 4ISCA 3PE6A 3ZVNA 521PA 1HNWB 4B17A 5K3EA 3C4VA 1ECGA 1F0NA 3ZI4A 3NATA 5LQRA 1X86B 4GDFA 4EO4A 1O95C 4MJLA 2DHRA 4PFSA 3GGGA 3W8EA 4B84A 2DCUA 1DB3A 4V0ME 5KNCD 2O2CA 1L5VA 1SH7A 2BGJA 3FNEA 1XZNA 2ZAMA 3CF2A 4FR0A 5CJJA 5I4BA 2OT3B 2VYND 3EC1A 3F9CA 4XIIA 1MC1A 1H3NA 4EHIA 1N5DA 4WY5A 1SK8A 5P21A 1MOQA 3REOA 1CDEA 1U3DA 4P4GA 2I7VA 4BY9E 4JEHA 1XEAA 3GR6A 3HJRA 2ZIGA 4PHGA 4KAJA 2BBOA 3ND6A 4HLDA 1B23P 2XCQA 4HNSA 3VJRA 2QSZA 3HNRA 3NHPA 3LXUX 4I8IA 2CMGA 2BELA 3RFTA 2ODNA 4CJXA 3THYB 5AK3A 3W8FA 4ZGGA 1T1EA 3ROQA 1PUJA 4HBGA 3C7AA 2OUIA 3AI1A 4RH1A 1MOZA 5HKLA 1QP4A 1FJGB 1NATA 1NL3A 3PJRA 4R8RA 1JKIA 4LZLA 3PRYA 4I6GA 4KOEC 3BMCB 3N0XA 1JPVA 3K09C 5KNCA 3QPAA 4OQXA 2J33A 5TVGA 5TARA 3VDMA 1G8YA 4BNNA 4DC9A 4EG4A 1HKUA 1PLKA 2M6RA 2R1ZA 2VYNA 1G7RA 4GOKA 3VO8A 4CWAA 2DYKA 2VKTA 2PZFA 4XB2A 5C5CA 1FFAA 4TUYA 5HVNA 1S1MA 3FKJA 2KQUA 5D86A 2EU8A 1N1GA 4HRXA 3CNLA 1NQVA 1H5UA 2J67A 1OXSC 2X5XA 3BB3A 4NU6A 1SCIA 5DHRA 3FMIA 4PQEA 1D9ZA 2P9YA 4ZEMA 4D9MA 3P0FA 4JCOA 3W9YA 5AHWA 1X7ZA 1L4MA 5CDGA 4RTOA 3L77A 1P6UA 3WLTA 3N8IA 1BOOA 2XRYA 4I1UA 3EVDA 1N4DA 4XVUA 4CKZA 1H5QA 1U6JA 3DSRA 4PZCA 3KFLA 2JIRA 1E9SA 1NZJA 1HH4A 2F1HA 2OEPA 1U2RA 5CFRA 3K0SA 1YA8A 1ADCA 4QBFA 1U2SA 1IVNA 3W4IA 2NU7B 5I6DA 2EFHB 3SLGA 3LWZA 3D31A 5ULLA 3VTZA 1O1YA 1FY2A 4WFKA 2SBTA 1EM8A 4X8HA 1H9BA 5FD8A 3VJMA 4D9CA 2ZUSA 4O4IF 5K4HA 2XXAA 1R8JA 2X0EA 2IS6A 3WRWA 4YJDA 3EWIA 1UFOA 1HGXA 4FFWA 4B3XA 4NE7A 2FSVA 4GWGA 4V24A 2BT4A 1SA0A 3II6X 1QE3A 3G8CA 3OKAA 5L8VA 2J3DA 3KEGA 4PRYA 4DCUA 1FRFS 2PWZA 1HMPA 3H1BA 3JW8A 5AI0A 4CV1A 4XFDA 4H35A 2QR5A 3HU3A 4D9HA 2KBEA 5DBHX 4BQEA 2F67A 3BWBA 2MINA 4IEIA 3RS4A 4WCFA 3ZLUA 2YW2A 1PS9A 1IZYA 2F3SA 3N2ZB 1CVRA 4GMGA 3VSBA 1FXWA 4GOXA 4G65A 5L9AA 1SCDA 1HL7A 1XCMA 1KI6A 3DL7A 3QFSA 1WMBA 3ZWWA 1NT4A 4MDFA 1Q3TA 1CUZA 4DQLA 3UUGA 1GA6A 2UYGA 2R66A 1T0PA 3BKXA 1BA2A 1P7VA 2CXTA 4DV2B 2ZVDA 3D7NA 4X6YA 3PENA 1R0SA 3UJHA 4KDRA 1Y1TA 3NI2A 4RA6A 4HYQA 5IEJA 4OAPA 2Q0HA 3EFEA 4PQRA 5MN6A 1UZUA 5JSQA 2P79A 3A9UA 3ANNA 1Z6PA 2PU7A 5CFMA 1N78A 1BEEA 4LAFA 5DWVA 4BNWA 1MO3A 2E4VA 2YCBA 3MGKA 3DL2A 4JB8A 4UJ3A 4TUYB 1W36D 2HCBA 3UJDA 3HKDB 4ARZA 3VKGA 1WO8A 2N75A 2OHGA 3CZPA 3H1EA 1YDGA 4JL5A 2BJWA 4Q1DA 1JFVA 2NYVA 1JZQA 4G1UC 1RRMA 1YB5A 5A1TA 3FNGA 5EERA 1V4BA 5LWQA 2HBZA 1XE3A 3OQPA 4J7XA 1JI3A 1X7ZB 2WTMA 3INYA 1ZL0A 2HPZA 1US8B 3LKVA 2O9JA 3VDQA 3VU9B 4LHVA 4CUJA 1ZD4A 2NVBA 3BN3A 2Q3BA 4ZHQB 5G41A 3FTFA 3AVWA 1QGYA 1KJIA 1ODIA 3WQBA 4G2NA 1C8KA 5CXXA 3OOEA 1GARA 2OQVA 2AFVA 3HFGA 4MV1A 3T5PA 1DL5A 4LBYA 4N3CA 1P0FA 1GVHA 4JNKA 2PVPA 4BIIA 2IX9A 2CSXA 4CLHA 4EFDA 3AVUA 4ZPJA 1QVZA 1E9BA 2AOVA 3DO6A 4GM4A 1EM8B 2IUEA 3D0RA 3KKLA 4XR9A 3DBIA 4E0BA 2J9YB 2I99A 5HE9A 5AM3A 5HUJA 5E9QA 2CLLB 2QRKA 4KODA 3NNSA 1IM2A 4LCBA 4ZAGA 1FXSA 2AEFA 1XSEA 3KYCA 3E5NA 4AF8A 1AB6A 5CFQA 4U3JB 3PC3A 4HEA1 1S6YA 1TPYA 1ZVQA 4QLAA 3G9ZA 4RVUA 3R8FA 3DLCA 1P73A 4FNOA 4HZUA 2FEKA 5SV2A 3PEWA 4PWZA 3PXCX 4MHOA 5BXQC 1AKNA 1H66A 2MINB 3NHMA 3FAZA 4KYUA 3EF3A 3L04A 3IDAA 4N3NA 4TLBA 4WCFB 3SVZA 1DHTA 1KZ6A 3G85A 1E58A 4CU5A 2GK6A 3C5HA 4F6RA 4FFNA 4UCWA 4D8XA 5IRCD 1T36A 4Z4HA 2HEGA 3DFZA 1H05A 1KI6B 2VVTA 4NU0A 4PYJA 3MUEA 4DR6B 3VH2A 1TMKA 1CW2B 2DTXA 1NXSA 2P6UA 1MABA 2ZUCA 3B5EA 3MWLA 3MTAA 3ZQKA 4E5MA 4EGSA 4XYBA 4FHDA 2JIQA 2ZSKA 2JATA 4CLEA 1YD7A 3HACA 3EYWA 3HU1A 2OL4A 3P9KA 4JYPA 1D03A 4BJ5A 2D62A 3OJFA 2EYQA 1RJFA 1XRJA 2YNMD 1BO6A 3M5PA 1VJ5A 1YQUA 5SY6A 2EOAA 2J30A 1Q1QA 3IJRA 4FYKA 5TRTA 1E1RD 2YC4C 4Q0MA 5SYMA 3U9SA 1G6Q1 2HQBA 3C14C 2JG3A 5C5DA 4AG6A 4ZZ2A 4Q5IA 4GX0A 1EUQA 3O95A 1XVLA 2WPDA 4IJ6A 2L82A 4G41A 4DBVO 2EKDA 4ARZB 3A06A 2ES4A 2XIJA 4KBYA 4LOAA 3O74A 4NKRA 4DEYA 3FHLA 3WRVA 5KCMA 3V4SA 2BR4A 2BBTA 3ZCPA 2OKGA 3ECSA 3R5SA 1OWMA 2FG7C 2FN8A 1DUIA 1IE3A 2WIAA 3E3MA 4G9BA 5DCUA 2ZIXB 2WEKA 2QGNA 2VJLA 4C43A 1SAYA 4D57A 4I4IA 3RRZA 1J5XA 1MVOA 2AN4A 2FZKA 3OIUA 5DHQA 1WOMA 2AFHA 2YNMA 5F76A 2NM0A 1H1TA 1XTKA 4KXNA 3PUKA 2YOGA 5E7QA 4KUEA 2CNOA 3L8ZA 1MH1A 4QFBA 2XT9A 4JI3B 3DAPA 1M2EA 1E1RA 1R64A 3HK2A 3AHHA 1PL6A 4OMDA 5E6UA 3TAUA 3WNZA 3EN0A 4CR8A 5HKKD 1P9WA 2Z2YA 1YZUA 2V0NA 5H82A 4AT1A 2X0RA 1C8VB 1XJQA 2FP3A 2H51A 2KJQA 4WBXC 3BX1A 4D56A 2XRMA 3Q8LA 4HAIA 1W36B 2B1GA 1SIOA 2VF2A 1CJUC 4K9RA 1VPTA 2JK1A 4MR7A 3NJ4A 4XWYA 1W34A 5BVHA 1Y34E 5G53C 2B36A 6LDHA 2H29A 2IK8A 3GPBA 3AT1A 4G0VA 5ALIA 4ILKA 5IS2A 2A9JA 1F7VA 1CVIA 2H11A 1BE8A 1Y89A 4C2BA 5LDDC 1GRNA 1L7EA 4QPCA 4YUVA 2H7YA 4DIDA 4JI0B 1G2PA 4Z0NA 4Y6QA 1IWOA 2PHZA 3FWYA 4HSEA 5FBLB 5TT0A 2Y0BA 2RH4A 3A10A 3TLZA 5DIZA 1NDHA 2Z08A 4L3VA 2FSFA 1WB6A 5H8WA 3LI2A 1T3SA 3O7MA 4I5EA 1L3CA 2GLTA 1E7MA 1PQYA 1WCIA 5HKKA 2XCRB 4C14A 1T4BA 1ZBDA 3S7ZA 1YL6A 5K05A 2IHNA 1TU0A 2WSYB 3OG9A 1F6DA 4F6RB 2W11A 1T36B 1YR3A 1WW3A 3ZZUA 3CZMA 2DHEA 3KSRA 4OGKA 3OCUA 1UDCA 2VXYA 4G0NA 1IWBB 1JXAA 1MABB 2G83A 4ARVA 4GKJB 1BS9A 3QHQA 1DSSG 2QRMA 3HI6A 1ZUWA 3EBOA 2VCHA 3L82B 1C1XB 1KGSA 2F43B 3KB1A 1SBIA 5LIPA 2QNRA 2KPOA 3OZEA 4J8PA 3GLSA 3GGDA 4MH0R 3AX6A 4O02B 4PLYA 4X1IA 5F1YA 2PFGA 2QI9F 1ICIA 1WBBA 3FBGA 1NUTA 4TMXA 1BJTA 4V3CA 4A92A 3PIRA 2JFWA 4RMGA 1JG6A 1HO3A 4XB6B 4F8EA 1UCFA 3C24A 1K8RA 3K72B 4QQKA 3MSCA 1XDWA 1E92A 5DLEA 4FSHA 2XGGA 3BXEA 5F9MA 3WADA 3FJ1A 3CYFA 1QM5A 1C29B 3EMKA 1A5SB 1P2VA 1IXKA 1A27A 3GG2A 3O84A 2QG6A 4YAJA 3SX2A 3K8ZA 4NMXB 4Q3OA 4WOBA 1U0FA 3DTTA 3VR5H 1OA1A 4C0LA 3AM4A 4EO9A 2VUIB 5B7PA 2OLEA 2BIFA 1KJ9A 1OHHD 2IHVA 1U4NA 2ZBPA 2HSEA 2HMYB 1RCTE 2QRLA 3EIXA 3M1LA 4LQDA 4NJMA 4MV5A 1XAJA 1OFHA 2AFHB 3BD8A 4GE0A 4KTVE 5FPPA 3WMRA 5KREA 5HE8A 2OG2A 2JKYA 3C5VA 2VNJA 2WTXA 4IILA 2OXTA 3SLKA 4FUQA 3EAQA 4LFCB 5ADHA 5DSTA 3WGLA 2ZYGA 1ZN2A 1L4HA 1UP4A 5E6UB 4PLTA 2RHOA 4J16C 2UZAA 1B14A 4OL9A 5ILGA 3T4UA 2E55A 3RW9A 5HYVA 3PRKE 4NRDA 4EJMA 3VKHA 2W6IA 2IHBA 2I2BA 3KL4A 4PO9A 3WGUA 4ID9A 2C92A 4XIFA 4D97A 1GG9A 2DUUA 3KHKA 1U7HA 3OZIA 1AX9A 4BAZA 1NBMD 3HN6A 1JAIA 1BC5A 3TRKA 4MRSA 1GA1A 3TECE 3MBKA 1W4LA 3OCJA 5H02A 3E35A 4PINA 3CUYA 4F9GA 2O8FA 4IZHA 4QNMA 3M6UA 3THSA 1HUQA 4NBNA 3AIOA 3RFUA 1AZLA 1OHHA 5HR5A 4JROA 1UXGA 1I3LA 2OMKA 2Q5FA 3LWNA 2RKOA 5B1DA 1SCAA 3EJ6A 4JELA 1DC3A 1XX6A 1XC7A 4U02A 2ENWA 1LTHR 1MTZA 1ZM4A 1MGPA 2NZ2A 4CIYA 5JW6A 1C9NA 4EMSA 2GRAA 1WCIB 3KAKA 3UENA 3PGXA 4EPVA 2CT8A 2R3SA 1PDOA 2P4HX 1SKAA 2CF6A 3EVNA 3HJUA 4HEHA 5EJ6A 3SWWA 5KOHA 5T64A 1T4CA 1GL9B 3BDAA 1NBMA 2QN1A 1YFKA 5AVJA 1VL2A 4HQOA 4N5HX 4IDQA 2Z04A 3TDMA 4D8TA 2Y3IA 2W2PA 2J08A 2FF7A 1HRDA 3OQOA 3QPUA 4EHKA 4S1NA 1UBKS 5C7YA 1FYWA 1J00A 4JBYA 2VQ3A 4J75A 3IOMA 4MV3A 3PUWA 1JFFA 4D41A 1UPXA 1BVHA 1GZ5A 1V1RA 3E18A 3STXA 5LDGA 4YAUA 4NZNA 3G2NA 1Z4KA 3BJEA 2BVNA 3MGBA 1R6BX 3U09A 1PV2A 1B00A 2NSJA 2HLDD 4K88A 2FFRA 3KBBA 4BFCA 5ERGB 4WNCA 1HT0A 1QH1A 1WPQA 4D79A 3UPDA 3ICEA 1KEPA 1LBEA 4RY8A 2BZSA 1GFZA 4GEGA 3CPSA 3TNFA 4K6OA 4WHMA 5DTRA 5L40A 2PIDA 1BGVA 3CA8A 1NVMB 1M10A 3NR2A 4WJKB 2OFWA 5EPEA 1TM5E 3OKCA 1N7GA 1JYSA 1LC0A 2O5CA 3DHNA 4PAWA 2G76A 2EZ9A 5TV2A 3B20A 1HQDA 1QHNA 1UBCA 3A1SA 4LBWA 2CVHA 1TFUA 1ZFNA 5TEVA 4NJMB 4C04A 3RC1A 1E77A 4CMBA 3ABIA 3T95A 3A58B 3N2YA 4NMMA 2B7CA 1AKMA 2PX0A 3RHSA 2XZTA 2EC5A 3W5JA 4ND8A 2HLDA 3OFND 4YV1A 7YASA 3KKNA 2DERA 3OUZA 3ZS9A 1O0CA 3V33A 4ZOLF 3VYSB 1ADJA 5J1TB 4FR5A 1P4AA 1YONA 4WVFA 3PUYA 3T7CA 1E0SA 2ZBGA 1N6PA 5GWXA 3N2GA 2L18A 4IWXA 5FBZA 5HF8A 3FUWA 4PN3A 4Z7JA 5A6VA 5A0FA 1PUXA 5DBFA 3IAM1 4RS3A 3B9PA 1XPJA 3R3ZA 4BNFA 4UDXX 3K31A 5I01A 5BSTA 5CYGA 2TSYB 3LBIA 1ACLA 2GK3A 4RYDA 4K2HA 4D25A 3FMVA 3M6IA 2GQ0A 5GJVC 1ULUA 4D3SA 1FSPA 3P2KA 4RH0A 2HZ7A 5DXJA 4YJ2F 2ZWPA 2HT1A 4I8DA 1P17A 2I34A 2Q3FA 3FDJA 3DZIA 4UCFA 1NBWB 4WZ6A 2OBBA 5LQSA 4ZJUA 1H3FA 1PZNA 1VRCA 2ACWA 1N5KA 2X6TA 3RVMA 1Y4UA 3OFNA 1DIBA 2UUAB 4UREA 3CKLA 4R6XA 3RSHA 1G3RA 1OBHA 1R8YA 3GV0A 4MA5A 2PUEA 1C9JA 2VHEA 5J4VA 5KOHB 1JXQA 2XUHA 1T4CB 1ZDMA 2I1QA 3GDGA 3MW8A 5AT1A 5GVSA 2PU5A 2LD4A 4RQUA 2FMXA 1C3OA 1K7FB 2BH2A 1BTOA 5DTJA 4JJFA 3OJCA 1T4GA 2W2NA 1DRJA 2JRLA 1JFFB 1RHUA 4FFLA 2YDXA 1ONNA 4JJ4A 4LCJA 3QMVA 1V1RB 1SVIA 4IG4A 1YVEI 4FSDA 1VHLA 5F77A 1H69A 4HF7A 4U4AA 1WDMA 1P29A 5ALDA 3TIVA 1EP2B 4KNWA 1NOJA 2JLYA 1RXUA 1HLPA 1W8IA 5C5EA 4WY2A 2C96A 2Y0CA 2OAQ1 2ZFUA 4XB1A 1TZKA 4GNRA 1RACA 3MTQA 3A6PC 3ZWOA 3DBOB 1QH1B 1D7AA 3OQBA 4HPWA 2OFXA 2W2QA 2WYVA 4ETWA 4XI9A 2ZJOA 2AEMA 4MV0A 5ICMA 5B6IA 4B3RB 1ML4A 1NMSA 2IF2A 2VHCA 4POAA 3AMVA 3WMWA 2JGAA 2OORC 4DILA 1THTA 4NSNA 2NXEA 5CU7A 3ZU4A 1DAKA 3L5OA 1PR6A 4DA8A 3E7WA 1EFLA 2XQIA 2BFFA 1SB8A 1Z8HA 2HJSA 5CDFE 1NW9B 1NX9A 3C3CA 3I6IA 4OQFA 2FDXA 4QQ8A 2QX8A 3ITNA 1MC8A 4OXNA 3DQQA 2OCXA 4PRKA 1E2HA 4GX1A 2XEDA 4DHEA 5BW8A 4M1SA 3SQMA 3S8YA 2QI9C 5DMHA 1T0IA 2GN2A 3EE6A 4F5ZA 2FKAA 4RFVA 4ND8B 1RC1A 3SR3A 4JKOA 1TVCA 5DM0A 3CRRA 4LSWA 3B51X 4WK4B 4BFTA 4L7VA 2VJKA 3BF7A 3JQ6A 3N2GB 4UHFA 3VSDA 2W7TA 3BHNA 4GZLA 2CJFA 3U5ZB 3ZXUB 4BZXA 1RCFA 2EBFX 5EGNA 2ZR0A 3H18A 3LFUA 4NH4A 4ZALA 2WJYA 4ZVMA 2AMFA 2FMKA 1AQLA 1FFYA 2P9JA 1HY3A 1VHQA 2Z95A 4MWSA 2PUVA 4KFTA 1JV2B 2I22A 2PPVA 4OXKA 4M9ZA 2BRUC 5AKGA 3ZV6A 4J7CA 1ZIXA 3QVLA 4NBWA 4R2HA 4KVGA 4NL4H 4QPJC 1VRVA 3OH8A 5ALJA 4EW6A 5K0CA 4FGWA 2HF8A 1ORTA 1FL9A 3GROA 2XTNA 2VWHA 4UBIA 3KJXA 1XYVA 2WUWE 3F5MA 3O1IC 5H70A 5BV1A 1U6KA 1UBJS 4BLPA 2I9KA 1Y3CE 1KOFA 1QZZA 1EFTA 1USGA 2V7QA 4QTTB 3B3QA 3U3DA 2L69A 1FYFA 1USKA 3BE5A 5ALOA 1OIWA 3SC4A 1MHTA 4IFIA 4Q48A 3K15A 3ZIDA 2G0NA 2WW8A 4GS5A 4YASA 3T52A 5LMZA 2EJTA 3W4JA 3UAXA 4CKXA 4R1QA 1H8ED 1T6XA 2PV7A 2X4IA 1KU0A 3ZNOA 3CNBA 1PJ2A 2WHYA 4NV1A 2R97A 1Q1ZA 1C3OB 3R4CA 5E8JA 2DPHA 5B5SA 5IF3A 4EPXA 3Q3JB 4LE0A 5F98A 3WYGA 2BUCA 1SWVA 2GO1A 3IE0A 5CPBA 2XWBF 3M4NA 1X38A 1UC8A 1BXGA 4YP9A 3PUVA 4HX2A 3U1VA 3KZKA 2OP1A 3MOSA 5CR9A 1WL8A 4DCOA 2Z5LA 3FJYA 1U3UA 5LP6A 1Q6ZA 4L8FA 3ZI0A 2R8RA 2JHPA 1KAHA 2E6UX 1Z4LA 2XMCA 3MGAA 1PNQA 2AKAB 1H6AA 4KQ1A 1IU9A 4WOPA 3IUEA 3HXTA 5A5VA 4F85A 2VDNB 3LBNA 2A5JA 1GTRA 1KY2A 3NAZA 3H4IA 3MAAC 3ZWMA 2J0SA 3OLQA 3UGTA 2CV2A 3SHWA 4F5YA 1P18A 2P4UA 3QV2A 4E14A 1E9RA 1S8NA 4ENQA 1H8EA 1UXJA 2O3UA 1LDYA 1QQ7A 4IVQA 4X7BA 3CKYA 2HIHA 3FSRA 5E1DA 3ZLVA 2O8CA 3EODA 3EFOB 3PA8A 4HTFA 1PZHA 1V3VA 2BFFB 3IUBA 5F5XA 3W3AH 4BKRA 1PNOA 4NMHA 1YACA 2B4QA 1LSOA 2GYYA 2PMKA 3F8SA 1GKKA 1I3CA 1QB8A 1E79D 1BGWA 3M3PA 2QJTA 4LVCA 4WPGA 4UZFA 1M5TA 1W581 4BEWA 4KLNA 1KO5A 4N65A 1CCWA 1NOKA 2CWWA 2PV0A 1CUUA 1MAAA 1W52X 2QRQA 3PLAE 2FEOA 1N6RA 1VC2A 2B94A 2HU7A 1NSTA 3LO5A 3AFGA 1GQYA 1KKLA 4PAQA 4LF7B 3JQBC 3DVAB 3WLRA 4F4JA 4EB8A 4DN6A 7REQA 3H16A 4M87A 3NJRA 2OGZA 1PUIA 3OVMA 3I23A 3AHIA 3WYAA 2VQ6A 5CEJA 2YWHA 1W85A 3JWJA 1MPTA 5KDLA 4A82A 4Z7QB 1NZDA 5CCXA 4MQBA 2GVNA 4S2EA 3L0SA 5AVKA 4R68A 4M53A 2C5SA 2W6PA 3BJMA 2I7XA 4A2WA 3S55A 3QTBA 1VIYA 1A76A 3WV5A 1E2JA 3UMJA 5AUNB 2GUGA 3AEKA 3F3YA 3KKOA 4R01A 2WHRA 5A7FA 1E79A 3MINA 3ROFA 3UW3A 3DYBA 4MWOA 3H2HA 1ODLA 2QXYA 3PQ4A 3T15A 1GDDA 1J9EA 1NY6A 3FETA 4UU8A 5BYJA 3WFZA 1C9KA 4MRNA 1KO4A 4ADSG 2FN9A 2Z58A 1OFGA 4B79A 1KZ1A 1OOEA 2PR2A 3NLLA 4P3KA 5U9CA 1X1QA 4HEQA 2IU3A 2J3LA 5DTQA 1T0HB 1UDXA 2CL7X 2BMFA 2FP4A 5BWCA 2MSCB 1DAOA 2VJDA 1YB6A 3TWOA 2QMYA 3GLVA 3D7RA 5B37A 3KQHA 1TF7A 3TMKA 3ID6C 3DFUA 2DBZA 1U2PA 3PNBA 4Q82A 5BQ3A 2DFNA 2YJNA 2P0EA 4WXEA 5JCPA 1SXPA 3EUAA 2N46A 1JAZA 2OZPA 3PGKA 4FFPA 2QRGA 4HGNA 4BVEA 2QR3A 4Z1MD 1KBQA 5G1NA 1CNMA 1I1HA 1NF3A 2ISSD 5LP6B 1ZMTA 2CV0A 2VTVA 2WB4A 4ZXPA 5COBA 1T9GR 3OA0A 4HR7A 4CETA 4I4LA 1FRNA 3E9CA 3AR5A 1MW8X 1M2VA 3SNHA 1UBFA 4O4JA 2XE8A 1ISGA 3VHLB 4JS0A 2JAUA 2Q07A 1CY1A 1VLQA 4URZR 4HLCA 4F91B 2GASA 1UMKA 3COPA 1NF8A 3G2PA 1FIUA 3QX9A 1N3YA 4OJMX 1CG6A 4Q00A 5AOVA 3UC5A 3VTFA 3WFIA 3RIHA 2XYGA 5H7XA 2O8CB 3VPXA 4EY7A 2G1JA 1XV5A 3VISA 2IPXA 1GCOA 4II3A 5JATA 3F6EX 2Z8YA 3AHFA 3H1PA 4I4CA 4QTXA 5FTNA 3HDGA 4UCXA 1JR4A 3RYFA 4ZXFA 5L7YA 3KV1A 3O3OB 1IQUA 2AOUA 3JYNA 1J0EA 2HCJB 3WTBA 5T5QA 2IP1A 4MIYA 3WICA 3DS8A 1J8YF 4ZU1X 3U7QA 2BM8A 2WVHA 3WIVA 1KI1A 5DLYA 3B6ZA 1BWRA 3UV6A 1I4DD 1V6SA 2GJSA 7REQB 1UQTA 3N74A 1AIPA 4YJFA 4EHJA 5LBTA 4OGWA 3IO5A 3QLVA 3LP6A 4HNHA 1VE3A 1ADBA 4E5DA 3M34A 4QPDA 1VL0A 2FY8A 1W85B 2GKSA 2P2CA 2G07A 3B1WA 4AB1A 4AMVA 4EJFA 2X3FA 2WNIA 2XCIA 3AW9A 2H4YA 4BC0A 1SWWA 1JJFA 4ETNA 2BGRA 3BJRA 4P31A 4BQIA 3OPNA 1C7EA 2PSFA 2COKA 3R5KA 3UGKA 3CF0A 3AEKB 4TT8A 2JEYA 2WM3A 3DL0A 1MB3A 3KRTA 3MINB 4KRGA 4F96A 3ZWBA 2ZIEA 1L7XA 2GEDA 4IKPA 1T3TA 3QE2A 4RLQA 3WB1A 4HH0A 4DKXA 3HM9A 1Z34A 3A0UA 3HR8A 1HQCA 1BKYA 3ZR4B 4MRRA 2JFQA 5IDYA 4I1VA 4M8LA 4CDMA 1KEKA 1JHXA 2D4HA 2FP4B 4Q3EA 4ZU6X 1JIVA 1Z4MA 5KVCA 1YUNA 3NT2A 5CBKA 1MW9X 1WB4A 2PD3A 1BWPA 2MMGA 7MDHA 1KDPA 2C9DA 1JUDA 3G82C 3ZCRA 3CLRC 2JFXA 3FVVA 2QKYA 5K0BA 3EXHA 3WL7A 2AR0A 3OLZA 3TUJC 1H22A 1EFCA 4YRJA 2PBFA 4E2XA 1UH5A 4EH1A 2JGFA 3VR6D 2Q6OA 3ETEA 5DM4A 1ZHHA 5JOQA 1U63A 1KDRA 3RD5A 2W83A 4X1OA 1AKRA 3EDCA 4IEFB 2YOFA 2Q5OA 1G8HA 1YCDA 3KKMA 3GCZA 5TXGA 3T4EA 1WZNA 2RCNA 4ARCA 1M2VB 3W2EA 1J0DA 1YV9A 4GLBA 3R3XA 3RS0A 4EGFA 1HA3A 3O4VA 1JWLA 4LKRA 4GX2A 3A6EA 1JG2A 1S0UA 4QUIA 1D0SA 1M74A 1XQYA 2HUPA 2QLMA 3I2IA 4ZCLA 5HGJA 3V3KA 2UKDA 3LT5A 2IFTA 3RVBA 3W4KA 1AS0A 4L50A 1NVDA 2H1VA 4Y6RA 3ZK8A 3ZLBA 3W5AA 3LOPA 3T0FA 5JPIA 4J0IA 3A6LA 4LX0A 3EZYA 3U3RA 2YQ5A 1UBGA 1ZH0A 1YNSA 2EL9A 2A8YA 2VF5X 3CQ9A 3RYFB 5ALZA 2IEIA 3JZFA 3MAGA 4GGOA 3VR6A 1VSUA 2V7GA 5BYAA 2QUIA 4UEKA 1XQ1A 2AOUB 2FFAA 2ZBEA 3DE6X 1VL5A 1X1EA 2ZJ1A 3TLCA 3U7QB 4EYKA 1YS2X 3BMOA 4BPRA 4NBSA 1E9CA 3EXFA 3OE4A 3KJGA 4HRAA 4BKMA 3KOYA 5IAAA 2FQWA 4R5HA 4YJFB 2X0KA 4GW3A 4AVYA 3BFJA 1FLAA 1ZGGA 4TN5A 1Z75A 2V8BA 3E9QA 3KQWA 3WC4A 5A1JA 1T5OA 4C7XA 6ADHA 1CY7A 4G85A 2P4SA 4NOJA 3FLMA 5C34B 1OV6A 1ZMRA 1E18A 3JSXA 4MWCA 1WKCA 3OHPA 4JX8A 1CJSA 3ZDEA 5FJJA 1EX7A 1H85A 1GKUB 3STVA 2FDCA 1QU3A 5B30A 1C1YA 3H6HA 3J7AC 2ODTX 2I6TA 3UANA 2JJQA 3NM5A 4D82A 2G4CA 1GLGA 5HDQA 1E3SA 4BVKA 3TLYA 3A9TA 1RPAA 3HY6A 1BKSB 3D43A 4O4LA 1RXWA 2WR8A 5LFAA 4OQEA 2G1UA 5EP4A 5G1PA 4B8WA 4DMHA 4XGQA 4HEA6 3ZW9A 3JD1A 2QVLA 5JXWA 1FLNA 1PW7A 3HYLA 3L0ZA 1K89A 3RIEA 1SC3A 3UMVA 3GIWA 3WWDA 2YJ6A 1EGAA 3P1JA 1K68A 1QHFA 2QUHA 4M38A 4MUXA 3L8MA 5FNVF 5TJ9A 4BO3A 4IDCA 1M2JA 5LZ7A 2B3DA 5C7OO 3HCWA 2IYRA 3QEBZ 1HG1A 4BP8A 4V0MA 3L1KA 4Q3DA 5BSRA 3I73A 4UMVA 3EGDA 1RBZA 3KKEA 1A9ZA 3GLRA 3EXHB 2QPLA 4I0WB 2EP7A 3WBFA 1A77A 1ZGAA 2B99A 2G70A 1HYEA 3TJRA 3HB7A 3ZDQA 2EJBA 3S2EA 1G3QA 3REFA 4WJZA 3FAKA 4GKVA 4P54A 1VZ2A 2TMDA 2OGUA 2WNSA 3JZDA 4JJEA 4PE5B 3GG9A 2VTBA 2IY7A 1Z15A 4OA5A 1DMRA 1ZC3A 2Q3MA 3C3JA 4Q01A 2ZR8A 4ZV4A 1TEZA 2HMSA 5B3KA 1UT8A 2ZRJA 3FH0A 3NYRA 3V4OA 5ISMA 1NP3A 3H5RA 5EUQB 5ARDA 3ETHA 4EHHA 1YBFA 2VHXA 1Z45A 3OZWA 1RLJA 3WHLA 3B85A 4EVIA 4ARIA 1S8FA 4QAQA 1S2GA 2BKVA 2A92A 1X77A 1F9AA 4LV5B 2MYNA 3L46A 4BXOA 1YAHA 2WSLA 3COWA 4L08A 4PV7A 5E6SA 4IYJA 3RSQA 4P8RA 3WJ1A 4Z3OA 5BQPA 5KJ6A 3UOWA 5KQLA 2JJ1D 3LOQA 1RQPA 4WH0A 5EE0A 3CLHA 2ZM5A 2R6ZA 1UODA 1ZCBA 1CHDA 2ZYTX 3D0KA 4DR1B 1NWCA 1QPGA 1BE0A 1RAIA 2HYDA 2W0MA 4K9KA 4UTXA 1X1TA 4CIXA 2BMWA 2F3QA 1KO7A 4X92A 2HX1A 1L1RA 3MN1A 4WWHA 3SYMA 6REQA 2BM0A 3H5AA 1U8AA 1X1DA 1TIBA 3BMOB 5KHOC 2ZS7A 2HJWA 3X0DA 3EXFB 4F7DA 2DQYA 4ZZ1A 3GFGA 1N1MA 4LF4B 4NQRA 2ROQA 2J9RA 3C43A 1Y3AA 2OO5C 2Q1WA 3AGQA 4PPYA 3THWA 1EJ2A 3IOYA 2MTBA 4HAZA 1M8KA 4KPYA 5KNDD 1USVA 3VV2A 5BMVA 3R9XA 1X1BA 2UVPA 1KQFA 3A8TA 2ID9A 3IA7A 3NBFA 5LD2B 2YRWA 3R8XA 3AJRA 1XA3A 3PNMA 1TCVA 2ISCA 2QIOA 3A6DA 4OHFA 5IWCA 3P9XA 2GZ2A 2A6PA 2XMGA 3HCBA 4MQLA 3C6XA 3MILA 2O5VA 1QFMA 4L9AA 1CF4A 3WZLA 4O4LB 4J0HA 1N2CE 3KWMA 4AY4A 4BNUA 1ZCAA 3K2EA 3B38A 4IRUB 2PKRA 5EHQA 2JAPA 1DTEA 2H1CA 5EWMB 3RF6A 4C0WA 5K0JA 1W76A 1UMCA 2HA6A 2HZBA 4JI1B 2W6JD 1QSGA 2UXBB 3HGMA 1PV4A 4R16A 1MJGA 1LQUA 3EIEA 5EKDA 5TMDA 2ETVA 5KYYA 4BJ6A 1Y6JA 2WJPA 4YV0A 1LGYA 3KB2A 3AB3A 3P5SA 3G89A 4JWTA 4D2IA 3GLHE 1GD1O 1ZOPA 1W6RA 4FT2A 5KNDA 4PZZA 1NPTO 1DLJA 1KYZA 3AZPA 1L5NA 2Q62A 3V7NA 2QAGC 5KBYA 5DHAA 4PXAA 3EGDB 3N2LA 3I61A 4ZVNA 3ZHYA 2O2XA 4OM8A 3T1YB 3TW0A 3TZQA 1SPBS 4PC6A 1CRPA 1TQ8A 5DN9A 1MKYA 1D2CA 5BYBA 1JJIA 4URYR 3RAEC 2B1IA 3UUFA 2RARA 3IBCA 4IV5A 4PCAA 4CLOA 3WHKA 2VTBB 3ZV5A 4V38A 2YHBA 3N2NA 4WDRA 3SDZA 2AKYA 2PKYX 2W6JA 3E3LA 3U4QB 4LY3A 3O38A 3O3MB 2XYHA 5HA5A 3A37A 3CHYA 4BGIA 1L5WA 3T41A 2ET6A 1RIFA 2PXAA 2RHWA 3FTCA 3FYHA 3PKIA 4NOLA 5JSHA 3V1UA 1IY0A 5JH7A 3HO1A 3SZLA 1XYGA 1Z0DA 1E69A 3GN1A 4BXOB 2CCKA 5E6SB 5IXSA 1N8TA 1X0XA 3MB5A 3UFXA 1VMIA 3D3EA 3VGJA 3FPCA 4JWKA 3K6JA 1AQYA 2HJ9A 1PT5A 5IAEA 1QC5A 2QYSA 1SVKA 2O2EA 3ROPA 1SBCA 2EKPA 3ENWA 3I2KA 4QEDA 6REQB 1J06A 2VT2A 3CUVA 4MQFA 1YB1A 3BAFA 5I9IA 1RYDA 3KWFA 2ORWA 5FL7D 5AIAA 3SJBA 3ZCTA 1EA7A 1CFJA 3SMQA 1V8ZA 2PGLA 1SEVA 1W59A 2ONYA 2Y27A 3OX2A 4NJEA 4PLFA 3WK9A 1H8HD 3THWB 3LMKA 3VI3B 3GRZA 4CFYA 3NMUF 2LWIA 5KQSA 1SFRA 1Q15A 4ME6A 3K2BA 5L4SA 5K3SA 3D6FA 3U61B 4L8VA 3QOXA 3R9XB 2UVPB 1A98A 3JD4A 4FGKA 1DCKA 4GPAA 1X1CA 5IVKA 4DYVA 5BSMA 3NIWA 1LWOA 4C07A 1N7HA 2JL1A 4ZKEA 1NUUA 2W6OA 2ODWA 3UHJA 3I37X 2IU0A 5JWRA 3A2MA 1Y3BE 2ONCA 2Q99A 1XJ5A 2J9ZB 2F8LA 2PANA 2QRVB 3KJZA 3OLYA 5H68A 2EX4A 4BE7B 5K0SA 5IT0A 4F6CA 3E7PA 4HP8A 1OSNA 3OKFA 4X60A 1G5FA 1QIJA 1UMCB 2CK3D 4KHZA 2XUIA 5FL7A 1CS0A 1UKYA 1VE7A 2W2OA 3NX4A 3S27A 2M6KA 3SJAA 3WSVA 1SKQA 3OT5A 3ONDA 4NJOA 3OIGA 2FPMA 1H8HA 3FRJA 4D0LB 5KYYB 1VZ3A 1SPXA 3N05A 5A5DA 5HHTA 4XAQA 1YBMA 1IOZA 1R6VA 3FCCA 3Q9NA 4AQ7A 4FFDA 3QE9Y 3FPSA 3VKWA 1OYWA 3ZWVA 1YIAA 2B25A 2D0IA 3IO3A 3NHRA 4MB2A 4A0GA 5BVGA 2XT0A 3PGA1 1LPBB 1OFVA 3RC8A 2FWMX 1T2EA 2WIKA 3I04M 1N0HA 2HCRA 4R2WA 3JWHA 2X4DA 3O6VA 2J31A 3QH4A 4ZAXA 4B7CA 4LOIA 1GQSA 4GT1A 2FU5C 4XYGA 4M7RA 1UBHS 3BK7A 2K87A 3T3GA 1JWAB 2QN7A 3RWOA 2V65A 1UDWA 3QELB 4JJ6A 3L4EA 1NG9A 2CK3A 2YJTD 3L4BC 5J23A 2YDYA 4LSMA 4GI1A 4OSOA 1V4NA 2E1RA 5ALNA 3ZKAA 4FM9A 3QXXA 2A0WA 2P2LA 4W5HA 2P27A 3NBMA 2AD5A 2WIJA 5G40A 5IDWA 2BR5A 3PRJA 4EI7A 2FE1A 1N6IA 4QPNA 3G2MA 3GZ4A 4KXUA 3A2KA 3L8CA 4YQYA 1WQ3A 3VMFA 1O87A 8OHMA 3DFFA 2RHBA 3MM4A 3TPCA 4FDAA 3UFXB 4DSUA 2P77A 2NZ8A 3NO4A 3NC1C 1NW5A 2V9PA 1X80A 4URVR 1B6SA 1QC5B 3H99A 3DXZA 1FMJA 3L1VA 1A7UA 1LNQA 3MCZA 1BEZA 4G8BA 4M7WA 4YWJA 4MQFB 4O2LA 2FPGA 3VZSA 2OHVA 2VT3A 2GEVA 3VPSA 2GJ8A 4B3TB 3MCUA 3TJMA 1MTOA 1EAYA 4UU0A 2G67A 4OQNA 2FPPB 3A6GA 2C77A 1TC1A 2JCSA 2DQZA 1XCLA 3DPUA 3N07A 4GDMA 4NJEB 2WYWA 1BVYF 1R2QA 4HJRA 3AVVA 2GPYA 2NT4A 3OQJA 3CEPB 1AUPA 4NG5A 1CYDA 1XZAA 4JITA 3KAJA 1M34E 3RJ9A 1T1GA 4KBFA 5LZ5A 3R9KA 3TYXA 5ICSA 5JQGF 2UYYA 2XOEA 1DBVO 3FFXA 1RM3A 1V45E 3E9NA 4NZYA 4ZCRA 3IAM6 5DCYA 2QY6A 4YUAA 2BHTA 2O06A 1CQWA 2V7TA 1FU4A 2XAUA 4PX2A 3F3MA 4AAYA 4QBTA 1RWNA 1Q0HA 1Q95A 4XE5A 3WYCA 4KSYA 1VB5A 4B7AA 5EJ7A 1RQLA 2PIAA 4TQGA 1F5SA 3K05A 1L7RA 1NW4A 3ZHUA 2IOYA 2X5OA 1CUHA 1EQ2A 4QJ4A 4JLAA 2C5LA 3Q7EA 4HQFA 4R51A 3V46A 3AI7A 4G1MB 4RU1A 2V59A 2EJCA 4KR0A 3T9FA 2C4NA 5E1MA 1NKSA 4RACA 2AG8A 1LLFA 3PXGA 4C4RA 2ZBQA 4FEGA 3NRCA 5JC1A 4Q4JA 4GX5A 2IXGA 1WD7A 2BKXA 3EARA 4I6EA 1CWUA 5BVGB 4CT5A 2GCIA 4FOOA 2ZCVA 5C0OE 3T0GA 4BASA 1RNLA 5AM2A 1DCFA 2XCSB 1SBQA 4ZO4A 1N6KA 3DJFA 3FOWA 8ADHA 4AG5A 3UQYS