2IFTA

Crystal structure of putative methylase hi0767 from haemophilus influenzae. nesg target ir102.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
176
Chain Sequence
GEVRIIAGLWRGRKLPVLDRVKETLFNWLMPYIHQSECLDGFAGSGSLGFEALSRQAKKVTFLELDKTVANQLKKNLQTLKCSSEQAEVINQSSLDFLKQPQNQPHFDVVFLDPPFHFNLAEQAISLLCENNWLKPNALIYVETEKDKPLITPENWTLLKEKTTGIVSYRLYQNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative methylase HI0767
publication title Crystal structure of the putative methylase HI0767 from Haemophilus influenzae.
rcsb
source organism Haemophilus influenzae
total genus 49
structure length 176
sequence length 185
chains with identical sequence B
ec nomenclature ec 2.1.1.171: 16S rRNA (guanine(966)-N(2))-methyltransferase.
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2iftA00
2CMGA 5G02A 4PWYA 2YXEA 2G72A 4RSRA 1JSZA 3RW9A 4DA4A 3DH0A 3AXTA 5K05A 4PIPA 1HMYA 4F85A 3KR9A 2BR5A 3SVZA 4P7KA 1EG2A 4KRGA 1WY7A 2IBSA 5K01A 2UYOA 1KHHA 5FULA 3KPWA 5E1BA 3OE4A 5LQRA 5HFJA 1R8YA 2Z6UA 1NT2A 3UJ9A 2Y1WA 3VSEA 3A26A 4Y30A 2GAFA 3E7PA 4CKEA 3AY0A 3FPHA 1XJ5A 2P41A 1TPYA 3KPJA 2ORED 3K6RA 2H00A 4R8SA 3HCBA 1Z3CA 3EVEA 2EG5A 2I7CA 2PT6A 3THSA 4LG1A 4QTUB 5CD1A 3KHKA 3CGGA 5CM2Z 4Z2YA 2QYOA 3DOUA 3Q87B 4DM3A 1RJDA 3KR1A 4QPPA 4WXHA 4AZTA 9MHTA 3I5UA 1D2HA 1JSXA 2IIPA 3EVZA 3LBYA 4LWOA 5K0LA 4C06A 4E2ZA 3A4TA 4EQZA 1H1DA 5K0BA 4YUZA 5CCXA 3E23A 4PINA 2C7RA 5HOQA 1P91A 4E31A 3FTEA 1G60A 1VP9A 5DLYA 5GM1A 3ELYA 4ZTBA 4ER7A 3GNLA 4LWPA 1NW8A 1R00A 2B2CA 2H1RA 2OYRA 3KKZA 1Y8CA 1VE3A 2AN3A 2NXEA 2YR0A 3DXYA 3FUUA 3PX2A 4PONA 3EVBA 5EQJB 3S68A 3EVCA 3KU1A 2BR4A 3FPJA 1M6EX 3DLIA 2YVLA 3HP7A 3CVOA 4AZSA 3CKKA 3MGGA 5EKUA 5HZMA 4FT4A 1FP2A 5JUWA 4C07A 1T43A 4RTOA 2QY6A 1RJGA 4NECA 1YFJA 4F84A 5FQOA 3FRHA 2XBMA 2HTEA 2PX2A 3MQ2A 1RI1A 3IV6A 3JWHA 3KQVA 5HIIA 4C08A 4F86A 2YX1A 3HVJA 3AJDA 5ICEA 1X1CA 3BXOA 3THRA 1NV8A 3TM4A 1P1BA 4RTMA 2ESRA 2Z6QA 1QAMA 3DR5A 3P2KA 3ERCA 1B42A 5EHGA 1R6AA 4RTSA 2B78A 3OCJA 2PLWA 3QOXA 4OQEA 4IV0A 1AF7A 3HA3A 1EJ0A 3TQSA 2XVAA 3BGIA 2XVMA 4C03A 1ZGJA 3MERA 4V0QA 3KQPA 2ZBRA 2LD4A 4HTFB 1EQAA 1R18A 3JWIA 1XXLA 5E1OA 1XTPA 4DF3A 2EJTA 2NYUA 2ZIFA 1I4WA 1ZKDA 1IXKA 1QAOA 1RJEA 1I9GA 2EX4A 3JWJA 4DKJA 3R24A 3LX6A 4XUEA 5IH3A 1TW3A 1VBFA 3PTAA 3UA4A 3K0BA 3NDJA 3O7WA 3KQWA 3UA3A 2PJDA 3HVKA 4YV2A 2ZIGA 3GU3A 5C9ZA 5M5BA 3MHTA 2O0LA 1KYWA 1RI5A 1SUIA 5DM1A 1XDSA 4OX9Y 2NXJA 3ER8A 2JH9A 4OQDA 4XCXA 4YUVA 4QDJA 5KQRA 1AQJA 3P2IA 5DTMA 4QVGA 5E9QA 3BWMA 4HH4A 5LQUA 3UBTA 2GA9A 1VLMA 2B3TA 1JR4A 2ZWAA 3KPYA 2GPYA 3MTIA 4GEKA 2PX8A 2IGTA 5HILA 2E5WA 3G2QA 5DPMA 5EMJA 4HG2A 5E1DA 2JHCA 2C7QA 1D2CA 4YUYA 1QZZA 3NMUF 5DT2A 3G8BA 4MQ4A 3IEIA 2NNWB 2FK7A 3FTDA 1SQGA 3HNRA 3HVHA 5B1SA 2PWYA 4PCLA 3SSMA 4U7TB 4DQ0A 4CXMA 5T67A 3TMAA 5CCBA 2YTZA 2GLUA 2P7HA 3A7EA 4XUDA 3UZUA 1EIZA 1L3IA 3DMGA 2FPOA 4O29A 3NTVA 4L7VA 5DTRA 3ELUA 5DM2A 2AOVA 3G5TA 3BKWA 3UWPA 3X0DA 3LKDA 4PYKA 3PB3A 4IKPA 5DSXA 4AUKA 4MIKA 3BZBA 3MCTA 4AZWA 3TPZA 3V8VA 3HVIA 4GQBA 3V97A 4FSDA 2I6GA 2OB1A 3VYWA 1SUSA 1VIDA 2C7PA 1RI4A 4PYQA 4X60A 1D2GA 3ELWA 1INLA 3E8SA 1G6Q1 4A6DA 2IDJA 4E2WA 2C7OA 2K4MA 4GC5A 4FP9A 5DRYA 3RIEA 1X19A 1BKYA 1KR5A 3P2EA 1G8AA 5EMMA 4RX1A 3NVKI 4KIFA 1TW2A 1L3CA 3NWEA 3B3FA 2DULA 5KVAA 4RTJA 1KYZA 4OA8A 5EMLA 2P40A 3AXSA 3SX0A 3ELDA 4ER3A 2PXAA 2ZCJA 3TOSA 3OZRA 5EKXA 3T0IA 1NW5A 3HCFA 4PCAA 2P35A 2IH2A 1M6YA 2OB2A 2VS1A 1XVAA 3G2OA 3G88A 3M4XA 3B7PA 4CWAA 3G8AA 5EG5A 4P7GA 3CBGA 3HCDA 5FHQA 1JG4A 4YMGA 4RTQA 1DUSA 3FUVA 2O07A 3CJRA 4HRAA 3GCZA 3WSTA 2JG3A 1U2ZA 2ADMA 1BC5A 3FTCA 5EIWA 3OFJA 1G55A 2ZSUA 5E9WA 4FSXA 4B17A 2I9KA 2VDUE 3QOWA 3DMHA 1NW6A 2G70A 3P9KA 5K09A 4K6MA 2P7IA 2WA2A 3SM3A 2AVDA 3SR4A 4P58A 1Q0TA 2PGXA 1F38A 3GRZA 7MHTA 4HC4A 3BGDA 3TLJA 3REOA 2AOXA 3QV2A 4EKGA 1VL5A 2JHAA 2BM9A 3B89A 2YXLA 5EEHA 4QQKA 5DX8A 3KQYA 3KR2A 3R0QA 2PX4A 4FZVA 5K0GA 4V0RA 5E8RA 1IM8A 2CKDA 3G7UA 4AZVA 5ICCA 5KYGA 2FHPA 2AVNA 2VDWA 1JQ3A 1MHTA 5F2NA 1OR8A 3M6VA 2PV0A 4BLUA 1KP9A 2ZVJA 1SKMA 5K0JA 3HTXA 3B3GA 3VC1A 5DM4A 5CVDA 5ICFA 3LCVB 3SGLA 2PSSA 1V39A 3OU2A 3LDFA 4QTTB 2OO3A 1RI2A 5CUQA 4OA5A 4ER5A 2AZTA 2R6ZA 1AV6A 2EFJA 1XDZA 1UIRA 3PVCA 1KPGA 2IBTA 1EJ6A 3GRUA 3OU7A 1NKVA 3UJCA 4M38A 1PRYA 3LGAA 2V7EA 3UFBA 2OZVA 4M36A 3DUWA 2CL5A 1N7IA 2BZGA 3NJRA 2IFTA 5EGSA 5EZSA 4AX8A 5IKMA 4C4AA 3O4FA 3MCZA 5GWXA 2IDKA 3CCFA 3I64A 3DXXA 1NBIA 1X1DA 2YXDA 3P97A 4R8RA 4CKBA 2WA1A 5D1HA 2ERCA 2G71A 3SSOA 4CTJA 5K0CA 4EVIA 3GXOA 3ANXA 5E8JA 3G89A 10MHA 5F2KA 3EPPA 3C6KA 3RODA 5BW4A 2IPXA 2PVCA 3OFKA 2O06A 3KPUA 4RVHA 3AWIA 3DP7A 3BWCA 1JG3A 3FRIA 4C05A 5EVJA 5BP7A 5FQNA 1JG1A 1ZQ9A 2O05A 4ATNA 3OE5A 3VC2A 3PX3A 5DXAA 1NW7A 3PFHA 3M6UA 3SXJA 3EGEA 4EKIA 2OBFA 3R9XB 5K03A 1X1BA 8MHTA 5K8VA 4M37A 4R05A 2O57A 3LBFA 5CVUA 2P3OA 3L8DA 3EGVA 3GDHA 1MJFA 5EOVA 2KW5A 2R3SA 3GIWA 3MAGA 3M33A 5C1IA 1YB2A 5P8WA 1VPTA 1BHJA 3G2PA 3OZTA 3PS9A 2DPMA 3FUWA 2HWKA 4XUCA 2PXCA 5E9JA 3H2BA 4HGZA 2AOTA 5CIYA 4RTLA 1L1EA 1L9KA 4RWZA 3JWGA 5DSTA 5GM2A 1ZG3A 3HCCA 3UJAA 4EMSA 3C6MA 2PY6A 3FYCA 3LSTA 3M6XA 1Q0SA 1O54A 2UYCA 3HA5A 4RTNA 1RI3A 4YUXA 1KXZA 1NW3A 2HMYB 2ZULA 3KR0A 4IWNA 4KVZA 5LR6A 5GIPE 4R6WA 2IH5A 2IP2A 2EJUA 4FR0A 5FWAA 5EMKA 3BKXA 2OY0A 3ORHA 2UYQA 4GOMD 1JTFA 4PIMA 4QVKA 4CKCA 3GRVA 2AOUA 3GWZA 3I9FA 4POOA 5CVJA 2Y1XA 3A27A 2UYHA 1UWVA 3FPGA 3DLCA 1X1AA 3HEMA 3KPVA 2H11A 3TRKA 2IH4A 2N47A 3OU6A 2CMHA 4HGYA 5E2BA 4LECA 4GOND 4RTPA 2NP7A 4PNEA 3F4KA 1G8SA 3EEYA 4GBED 4E33A 2AR0A 3PLAE 4OBWA 2NXCA 1NBHA 1JQEA 4M7RA 3E05A 2QRVA 2A14A 3DMFA 2FK8A 3HA7A 3HM2A 3I53A 4U7PB 2PXXA 3NVMB 5E2AA 2BH2A 3TKAA 2BM8A 4MWZA 3GRRA 4ER0A 3TR6A 3DXZA 4R6XA 2P1DA 5BXYA 1KPIA 1SVUA 3CC8A 3FZGA 5DXJA 1XCJA 5EC8A 3GO4A 4X63A 1F3LA 3BWYA 4P7JA 3B3JA 4KDCA 4BP3A 2PBFA 5DRTA 2FRXA 1L3BA 3EGIA 4KDRA 3UJ7A 2V74B 4DZRA 4PYIA 2HNKA 1BOOA 2B25A 4EK9A 2I62A 1XDUA 4BY9E 3M70A 4G56A 3MTEA 1DCTA 2CWWA 2AN4A 5ERGB 5LSAA 3KQMA 3KQOA 3IYLW 3FUXA 3LDUA 5HIMA 3T7SA 1HNNA 1YF3A 1SQFA 2OPBA 3LCCA 4IV8A 1ZGAA 2PWPA 1FP1D 5FCDA 4GC9A 4DCMA 3R6TA 2ONYA 2P8JA 1EAMA 1YFLA 3NW9A 2GB4A 3FUTA 3PT9A 5LQNA 4GF5A 5LQJA 3I58A 3KQSA 4E2YA 3GJYA 4PYOA 4QPNA 4OBXA 5HIJA 1I1NA 1JTEA 1FPQA 4RVDA 2BR3A 5K0NA 3EVGA 3EMBA 4RVGA 3IHTA 4KW7A 4BP1A 3EVDA 2XYRA 3LDGA 1QAQA 2YQZA 3A7DA 2JHPA 3G2MA 2VP3A 5LQKA 1RJFA 3T7RA 5GP1A 5EEGA 4YMHA 1KIAA 2JJQA 3FPEA 1PJZA 2Z6AA 4GUAA 3HCEA 3HCAA 3NWBA 3P71T 5D1NA 3OPNA 4HSGA 3D2LA 2ZBPA 2PX5A 3Q7EA 5FA8A 4RTKA 1KPHA 1N2XA 3P9NA 3BWBA 5K0EA 2AS0A 4E30A 4PYLA 4P7FA 1YZ3A 5U4XA 5K0FA 3TFWA 2ZZMA 3FPFA 3ER9A 1WZNA 1NE2A 2AOTB 1JG2A 1P39A 2OKCA 3R3HA 2HR1A 2GH1A 3UJDA 5DTQA 3SMQA 3LPMA 4X1OA 4E32A 3BGVA 3GGDA 3ME5A 1FJXA 3CJQA 2HV9A 1N7JA 2NXNA 3CJTA 3MB5A 3P9CA 2ZZNA 5H02A 1NV9A 1WXXA 4WVLA 5FTWA 3P8ZA 2NP6A 1VQ1A 2ZLBA 5EHIA 3UJ6A 3LL7A 5DX1A 1G38A 5MHTA 3G5LA 3LCUA 2GS9A 1ORHA 2PT9A 5F2OA 3TKYA 2FCAA 1QANA 5DM0A 1YZHA 3TM5A 4QQNA 3UJ8A 4X41A 3SSNA 2AOUB 4ISCA 1DL5A 1R74A 3O31A 4KWCA 5BW5A 4X61A 4E2XA 5GINE 1M0EA 3EMDA 1SG9A 1QYRA 1WS6A 3C3PA 4PYJA 4YV0A 1VP3A 1ORIA 5EPEA 3P9IA 1IY9A 3OZSA 2VDVE 2WK1A 2B9EA 2ZBQA 3BT7A 2QM3A 2VZ9A 3M6WA 1XCLA 4GOLD 3PFGA 4H0NA 2ZZKA 5FADA 4ER6A 3DULA 5LQAA 1FBNA 4RVFA 1WG8A 4PYMA 1P1CA 5GIOE 4YUWA 2QRVB 5E1MA 1O9GA 2XYVA 4QDKA 2P3QA 2UZ4A 2ZFUA 3BUSA 3NDIA 5EZQA 3UJBA 4FS8A 5DX0A 3LECA 3FYDA 3LKZA 3A25A 2G8NA 4PYNA 4C04A 1AQIA 1JQDA 3EVAA 4PGHA 5FA5A 4DCGA 4UOEA 4YV1A 2G1PA 3C3YA 1YUBA 3ID6C 3KQTA 3EVFA 5CVEA 4HTFA 2JH8A 4RYLA 5FWDA 5HEKA 5C0OE 1WXWA 2Q41A 5KQSA 3LHDA 3FTFA 1UFKA 2XYQA 5EIFA 4KIGA 4FGZA 2P3LA 3T7TA 5KS2A 2AN5A 4PGGA 4RTRA 5LQCA 5GOZA 4E70A 2ZW9A 4RV9A 2ONZA 5DWQA 4BLWA 4CTKA 2PKWA 5HIKA 5ICGA 4Y2HA 4MHTA 5FUBA 3DTNA 2F8LA 1ZHFA 3C0KA 4A6EA 2ZWVA 3KQQA 2YUIA 3U81A 1O9HA 5FHRA 3B5IA 1R8XA 2FYTA 4MTLA 5T6BA 2ZIEA 4JXJA 2ZTHA 5T64A 2AOWA 5JR3A 2QE6A 4DMGA 3GRYA 4GOOD 5CVVA 4BLVA 4FT2A 2OXTA 3EEOA
chains in the Genus database with same CATH superfamily
2ZSJA 2B35A 4TS4A 3VGPA 1YZNA 3JU3A 3TW0A 1E79A 1G8PA 1CQXA 1WKVA 1D7OA 1EFHA 2PZJA 2QL9A 3JQ8B 4NONA 5K05A 2IEDA 3TIFA 4PIPA 1WDLA 1DRJA 1KFCB 3S70A 1QG4A 1XDDA 1ISSA 3WLNA 4K9PA 4P7KA 2WHRA 1ZUHA 5AHKA 5EESA 1T9KA 5SICE 2KMLA 4FX5A 1QRTA 1U3WA 2G82A 5FPHA 1IM5A 3LVFO 5ARDA 3DSRA 4RL4A 4TUYF 4HOYA 3SIRA 4IDNA 4JXZA 4GDFA 1UK6A 2QYTA 1DAMA 2QORA 3Q8KA 3IPLA 3GV0A 4DLVA 4BMDA 3FNEA 4I14A 2P41A 2HQOA 4RY8A 3QMPA 1E2QA 3VR6D 5E3HA 3WXBA 5A71A 4TQGA 2FPRA 3T9DA 3T1HB 3K6RA 5BV7A 4LFBB 1FS4A 1UKAA 4P3KA 2I7CA 4I1PA 2V4ZA 1L0BA 2OXIA 1DV2A 2O8VA 1GAQA 3NYQA 5TY0A 1G8FA 3S2UA 2RHMA 5DSZA 1K66A 4Z9BA 3K8YA 2QRQA 3MUOA 4N0EA 4ZT3A 1UODA 1CBUA 3HGQA 3MTGA 5ERYA 4HNVA 1A9SA 4EECA 5DLYA 3MQFA 2IY7A 3G3EA 2WJ6A 4AO7A 2AKEA 1UFVA 2JCGA 2PD6A 1R00A 2QENA 1Y7IA 4OAOA 1J2YA 4P92A 1TJ5A 3PKJA 2X5OA 5H70A 2C4MA 1G16A 1YZVA 3V1LA 3HP7A 5BVGB 3HKEA 2CMDA 2GCEA 1FXUA 2JVJA 3VO9A 4MPJA 2OCAA 4BWYA 3S1AA 4B34A 4TKUA 4PO1A 3MLAA 2L69A 2WPDA 4BFVA 2H5IA 1RI1A 2W4MA 3GROA 4CMKA 3NKFA 4FWIB 1P0CA 3AJDA 3PXUA 4X1YA 4MW0A 3EDOA 4RGYA 3M4NA 3WLEA 4LJRA 2WVJA 4B8WA 4DABA 4ZAVA 1SG6A 2GO1A 1U8XX 2Q21A 2NU8B 3F6CA 2A8YA 4BAUA 4W82A 3MT0A 3SQMA 2GM3A 3P9YA 3U44B 1AF7A 3BGIA 4WKBA 4YRGA 2W42A 2B34A 5EMNA 1F7VA 1JFLA 1NUTA 2RHTA 2ONJA 2LD4A 3D6FA 4M88A 1A5TA 3ENNA 1JHQA 3BGSA 2PIDA 1H2ZA 1ZN9A 2FWAA 1R18A 4L9AA 1QOZA 5TPZA 2I3ZA 2X0DA 2HFJA 1MAAA 5CYGA 1W49A 2OM2A 4UTNA 3C3BA 5IS2A 1CDOA 4LZLA 5JJLA 3R24A 1XBTA 5I7AA 2NU7B 3PFBA 1V45E 4JJEA 1E4EB 1KYWA 3KOXA 4Y2XA 1WOYA 3LTEA 1USIA 4BB5A 1Y1PA 3ISTA 3DF7A 5DTMA 2E9SA 4OD0A 2ZIXB 4HDQB 4XVHA 1CY1A 4DY6A 3WLTA 3DOEA 1Z63A 2ZWAA 2ZGVA 4QXOA 2O1EA 3W9YA 2PX8A 1UP7A 5A0VA 4I9GA 2X6TA 3EDCA 5K3CA 3AEKA 4KSCA 4D1YA 3FJYA 2MSEB 1L5SA 1X7XA 4LNUA 2NNWB 5A6SB 2VPIA 3BRWA 5E7QA 4LYJA 2BE7A 1E7SA 3B13B 4RGBA 3T5CA 2CEKA 3QKTA 2J8ZA 5T67A 1J0BA 4CR6A 5CDSA 4OX9B 2P7HA 2QQ0A 3F74A 3LY8A 2VP9A 5FTJA 5JD6A 3MOSA 1IJBA 1NXWA 1ZCJA 3F8WA 4WCFB 1CPYA 3LXRA 4O29A 4RPCA 3ZDBA 5EJ9A 2PKQO 5DM2A 4CV3A 5EHQA 2D7JA 1Y9JA 2AFHE 1DWPA 1RWVA 4YRMA 3VOTA 1ZJYA 4DUGD 1QTIA 1X14A 3U39A 1J07A 3BZBA 5EE3A 3WL6A 4OKNA 4CM9A 3CRRA 2WSBA 3HVIA 4PQYA 3ZHVA 9GPBA 5L4LA 1TM2A 1I6WA 1F2DA 2GJAA 1MFZA 4RADA 1R4ZA 3P7MA 3JZIA 2PQMA 3GT3A 2IDJA 5CJJA 3W77A 4F0JA 2VYND 4FNMA 1HORA 2ANBA 2AUMA 3QEKA 4MWOA 5E6RA 4R7GA 2LE0A 2DFVA 1ZDMA 5KX5A 4X84A 3BN3A 5FNVB 5HF9A 1UR5A 4BV8A 3DC2A 3ROGA 4FI3C 4JJZA 4EBBA 5JLAA 1TQHA 4OA8A 1SBIA 3E3NA 3OF5A 2C3MA 2VHVA 1R3UA 1BE8A 3U7QB 5DM70 3HBNA 4QXQA 1JEEA 1FK8A 4HAWA 1RU3A 3HGTA 4MVJI 4REQA 4EI2A 5TMDA 4MQEB 2BFEB 2X0NA 3WNQA 4NZMA 2SCUB 3ILXA 3WLMA 2Q8QA 3OI7A 4C0BA 1L5HA 2OYSA 2ZS8A 1FFCA 3ANSA 4JKIA 2L2QA 2GZ2A 3CJRA 4Q3OA 3GJSA 1AKYA 5GAJA 1S3IA 5K4AA 1E1LA 4D41A 3EH2A 3LHFA 3N8KA 4F45A 1OX4A 2R4UA 4JP8A 3HJGA 1U6JA 4RM2A 3DMHA 1NMXA 2WU3A 3PJFA 3PXXA 4RM3A 4WK6A 1QM5A 2R96A 1J1IA 2OHXA 3K8QA 4URHA 2D2XA 2FPSA 2XCSB 2A30A 4C1NA 1P7YA 2V7VA 1WHSA 3WIDA 2VNIA 2CNLA 3V46A 2PUJA 3O8DA 3NT5A 4U7HA 5C4GB 4CM1A 4DA8A 2W2NA 4K81B 2BHRA 1U8EA 1VA4A 5LL6P 1N0IA 4PN7A 3N0VA 4BJ1A 1DFGA 3CVUA 1QVWA 3RYIB 5KOHB 4X8LA 2GAIA 3R1IA 3DF9A 2HWWA 4HPWA 4FPXA 5JAQA 5TNXA 3U80A 4FILA 4UNSA 4NV0A 4LQCA 1W5AA 2JI9A 5EMHA 1QYCA 4PM4A 4Q1FA 1U2GA 2J59A 3BF8A 3T4UA 1BYIA 2CF5A 1VXOA 4A8JC 3L49A 2DUNA 3A4NA 3TLEA 1XHEA 1NJFA 4NTZA 2EF1A 1E1MA 2R6ZA 3E81A 3SS8A 5J58A 4DW8A 1XDZA 1U2GC 4QECA 5DYNA 1GCOA 1TLTA 1GPJA 4NESA 4LZWA 5FO1A 3MWKA 3Q3VA 3TD2A 1SVOA 1EJ6A 3HYCA 1NVXQ 3R09A 4IEFB 5KNDD 3LGAA 3PEYA 2VF2A 4DDTA 1L8XA 1NZJA 3L02A 4NS4A 3TNLA 2FG5A 2F8MA 2HN9A 1YBAA 3MQ4A 1CF2O 2HDOA 3TZ6A 4TRRA 2PMFA 1AHHA 2OBLA 2OHJA 4FKBA 4IH9A 3QFTA 2JAOA 2Z1MA 3EQ7A 1QRRA 5TGDA 1UKBA 3CE9A 1PVOA 1U0NA 2Q3JA 4BOYA 1UJ6A 1YV9A 3OFND 4MJLA 5JQGB 1GNLA 5C5IA 3AC0A 4YV7A 2FP4B 3DMPA 1N5OX 1F17A 2R97A 2XRYA 3MJHA 1JG1A 4LCBA 2YWCA 1Z4LA 2PJUA 3CLRC 3A6DA 1UOOA 1SIWA 3KUDA 5TGTA 4ALKA 4BWGA 1PG5A 5LXTF 4E4YA 1BFDA 1JDUA 4JA2A 1IFXA 5DEOA 1TVCA 4OQNA 3E6AA 4KBGA 4FHZA 2GNAA 4R54A 5I7EA 2HBYA 2IZ5A 4EKIA 1SUWA 1LSUA 2UVQA 4NOJA 5K5EA 4PCUA 1Y7HA 4DDWA 1FFGA 3ZE7A 3LBFA 4CDMA 3OQ6A 1E66A 1GKKA 3GDHA 1EVJA 3L6RA 1LDEA 3EDYA 3HLYA 3VVLA 5AKKA 1G64A 1O3YA 1GM5A 1DOAA 2PLRA 5C1IA 2KB0A 1GN9A 1GU0A 2WU0A 4BO7A 1AURA 1VPTA 3CPJB 3E1GA 3WB1A 5C7LO 2DRIA 2G77B 2FW0A 3KXLA 4JJGA 3VR5H 4OLBA 2OVFA 2NZWA 3A32A 4RTLA 1NVTA 1TMKA 2OCPA 1OYWA 5NLLA 4CL2A 2FPPA 1UZAA 4TMYA 2XOKA 2D0OB 1RPJA 2J4FA 1R0YA 3BEDA 3HACA 1VA5A 1V3QE 4JI1B 1R5JA 4XPIA 5FAKA 1XMOB 1V5GA 1K3FA 2CCGA 3ELBA 3HUFA 3SVLA 1JDNA 1RNLA 5JZVA 3H2GA 2Q1XA 1QGAA 1RKUA 2WOOA 3OZGA 2WT4A 4ZAGA 1KSJA 3RT7A 1E9EA 5FX2A 1BKSB 3GVPA 1NLZA 2NPFA 4WERA 1NP7A 5JCZA 2YVAA 1Q21A 1LX7A 1R6XA 1X1AA 1V2GA 2PD4A 1OXUA 5JYBA 3ENVA 1LJUA 3A6JA 1SEVA 1M75A 1HT2E 4IRXA 2NUBA 4Z1OA 2GR9A 3QIVA 5E2BA 2C42A 3K4QA 5JVDA 1DJLA 3LT2A 4HDSB 2DWOA 3NHPA 4CQMA 3UBMA 3CRZA 2PTGA 2JK1A 1VPEA 4C7MA 3G5AA 2VQDA 4U2FA 5JS2A 5KMGB 4UW9A 2Q28A 5DVZA 3KQNA 3LWBA 4M7RA 3FB1A 3BGOS 3I53A 1XC7A 1GQ2A 3OLCX 3R7WB 1S2NA 2W6PA 3TKAA 5EJ7A 5F3WB 4KP7A 3EQ8A 4NJEA 4U3JB 2DPXA 4ND1A 3UXYA 3BD7A 3K6KA 4P7JA 3RV4A 4ZVNA 2IHZA 1FC0A 5BT8A 3VU1A 1T1EA 1QWOA 2QS9A 3KKPA 3LT1A 3OZFA 1DMRA 1PCXA 2G63A 3MRVA 4TN1A 2CV0A 2D1QA 4LEIA 1X9GA 3TRFA 1XDUA 5JH7B 3NOVA 1Z37A 2A9RA 1M6VB 4CTMA 3IKJA 4HH1A 1K4MA 5ENZA 5H59A 5GPBA 4M0MA 5JNSA 3R3UA 3AF4A 2OO5A 5J40A 4LGYA 4HADA 4GC9A 4PWZA 1CDZA 1O1YA 3B3QA 4KWHA 2YYZA 1SULA 2QZSA 4DDVA 2VQFB 5ALUA 2PAAA 4IY1A 1K7YA 3HKDB 3I58A 2OO5C 2WWRA 3IQXA 5ECGC 5ES3A 2FEKA 4RVDA 4OREX 1SNYA 1HURA 4YC7A 3U4QB 1U4NA 1ZH6A 3K70C 1AKWA 4I4TF 2IZOA 3U26A 2O59A 4KMRA 3H97A 1EWRA 2JHPA 2VAVA 2XB9A 3ES9A 1HG0A 4NI5A 3IVCA 3ZU2A 4DCNA 1ONBA 2HGZA 3IESA 2PO7A 1KO1A 1YZUA 3GRKA 3ILSA 5FLEX 6NULA 2XE7A 3HCEA 2F55A 5JS6A 3JQAA 3N2YA 3NEJA 4F3TA 3L7MA 2JC3A 2PX5A 7GPBA 3Q7EA 4YAUA 2XUKA 1IE3A 4PSVA 5G1PA 1LZLA 2YIVX 4MQ6A 2AS0A 1TEVA 5FWXA 3BVPA 2PSFA 3QENA 4CF6A 2C8KA 2P78A 3M5WA 4GI5A 1A9XA 4ARUA 1XXHE 5HRCA 4P4NA 3DPUA 1JG2A 2HAEA 7MDHA 1W44A 5L7TA 4DV3B 3KLBA 2HR1A 4Q7KA 3D4NA 4EG5A 4JLMA 1PAUA 3MWEA 4UMDA 1SXJE 4LFCB 4GMKA 4JMPA 4M98A 3MELA 2XTMA 1NV9A 3TBFA 2VJDA 4F1WA 4G3XA 2D13A 1OYOA 3AEUB 2AE1A 3I5XA 1JYEA 2PT9A 3SF8B 1XEXA 2E89A 2EBFX 1NMZA 1U9CA 2QRMA 3C3WA 3TKYA 4KR3A 2QNIA 1B7GO 2QVZX 5IWCA 3E1KA 3QE2A 3RO7A 1P2UA 2Z6VA 4P3PA 1EUCA 3UCFA 2HSDA 2YZ7A 1W35A 2B99A 4NYMR 2R6JA 4R9VA 3OQNA 5DHUA 5JPIA 5LOVF 2X3FA 2G4VA 3WMEA 5A4FS 1BMFD 5A7HA 1DBRA 3HCNA 1AQUA 3CIFA 2QMUA 3VZQA 3DT8A 5BN4B 4RLSA 2O8EA 4IIYA 1K92A 1I6KA 3V00A 5GZ3A 4JITA 4UULA 5LD2B 3ET5A 5DISB 5LN1A 2RI0A 1DDOA 2BN4A 1ECLA 2QUKA 3CNQS 1E1YA 5AYVA 4C4PA 5EE9A 4A16A 2IPLA 4JJIA 2UZ4A 4FFMA 3MBKA 4NV3A 2F9LA 1ZO8A 1UKYA 2A1IA 2X2OA 2E7ZA 3FYDA 1GU7A 3H17A 3JQ7A 4L73A 4IH4A 2AK3A 4EZEA 5F7ZA 5FWDA 1I4OA 5CVEA 3PNOA 5D3MB 3Q98A 2H85A 1DX6A 1QZXA 1IB0A 4EFNA 2PM8A 2ASVA 3IP6A 4FGZA 3WGIA 2PUHA 5KZMB 1L7RA 5D3QA 3H2JA 3W3ZB 2H1OA 3L7AA 4I4LA 2ONZA 2N1BA 3A06A 2PKWA 3HSKA 5U1PA 1ZLYA 4AF8A 1B2LA 2IX3A 1K3TA 4H7HA 1RRPA 2LCQA 1CUVA 5K8LA 4HK4A 2ZWVA 2KLBA 2YUIA 3IT2A 4KPYA 3TW4A 3WYGA 1S2DA 1CQJB 1JA0A 4F3NA 1B8VA 1CR1A 1GD1O 1PFQA 1SWWA 1XFDA 4DLWA 1O0BA 3OIUA 2IF0A 1HYEA 1Y8RB 1EK5A 2WKQA 3IUJA 1E0DA 2IYQA 4OGLA 3OFVA 1VJRA 4Q9AA 5JSYA 4CIWA 1UBEA 3I05A 3PRYA 5G02A 5JPCA 4XIGS 2YWFA 1ZN2A 4KQJA 2WHPA 3RVLA 1VLZA 3E1SA 3OIVA 2FLKA 4YH1A 1QIEA 4RHUA 1FW6A 1RMTA 3IDQA 4JHXA 2RGXA 3KR9A 1U80A 3GL9A 1SIOA 1ZJWA 3KOOA 3OJOA 1QFSA 5KTNA 4AJ4A 1N9ZA 3PHJA 2EVWX 4PO9A 3RRNA 2C9CA 1FNCA 1J33A 1NBME 1J49A 1LD3A 2Y1WA 4MRAA 4BAZA 1A9QA 1MQ8B 2C5HA 2FUNB 1QIHA 4ZALA 5JY1A 2BKVA 2QMHA 4JI5B 4GR5A 5FDFA 3PIDA 1F06A 4OH1A 1XZGA 4TLMB 3AI7A 3UAVA 3RJTA 2QPOA 4WN9B 1C1DA 1WXHA 1GA1A 3N2IA 1LKZA 3JR7A 4X94A 2H00A 5FPSA 3ZR4B 4NATA 1R6UA 1V43A 1XEWX 2V7GA 3MPUA 3CLSC 5CD1A 1I4TD 1IOVA 4A0FA 1Y1QA 2GBFA 1E2JA 1A9ZA 2JCYA 3KUUA 2Q1TA 1SB8A 3W3AD 4ZHQF 5IYZB 3I5UA 3EVZA 5I9MA 5H4GA 5K3OA 3L8ZA 2XD9A 4J0HA 4NJMA 1C0PA 1ENYA 3NEYA 1S7CA 1NUAA 1YU6A 5HOQA 1TLLA 2ZSDA 4C88A 4QBFA 4E31A 5IAAA 3EIHA 3CQ9A 1OX6A 4KE8A 4OHBA 3RK1A 5KJCA 3LYHA 3FUUA 3ZIUA 4CM8B 2C84A 3I37X 2YVLA 2ZBVA 3JARB 3K53A 2YRWA 4H7DA 3WGZA 3U1VA 5EKUA 4EGCB 4TMFA 2E6UX 4C07A 4D45A 2G40A 4JI7B 3TDNA 2IDZA 5CK4A 3S27A 1BW9B 3HR7A 2WY2D 3KQVA 2CZGA 2JCVA 3I62A 5ICEA 1MEJA 3IVMA 1X1CA 3CNEA 2DUMA 4BLPA 1L4KA 3KEFA 4RWEA 3CZPA 3O4HA 1XZCA 3P2KA 3PNVA 1VLLA 3PWTA 4RKWA 1KEUA 2HF8A 4B84A 5IG2A 1ACJA 2ZAOA 4FHDA 3WMWA 5BSWA 2B78A 3HBAA 3KO8A 3PR2B 5CT4A 1E3MA 5FPQA 1HTBA 3HHPA 3TIXB 4Z54A 1E1CB 1EDEA 1J0DA 3PPVA 2ZAGA 1ENPA 3QVSA 3FWNA 4IIJA 3CLTC 4JQOA 1DEOA 4IUCS 1IXZA 4ROTA 3V4OA 1XQXA 4WBSA 4DV7B 1ZA1A 5ECYA 3H1GA 3RTBA 5JI2E 1IXKA 5KCZA 1OLSB 3I04A 1Z83A 1EDBA 4ZVOA 4G4GA 2WNHA 2BMFA 2G0NA 3NDJA 3CRW1 3W7BA 5F77A 5BRJA 3ZXYA 3GU3A 4KFCA 1JDJA 4EY6A 3MPOA 1YS6A 2JFNA 4BUJA 1UZMA 4BMSA 1JFSA 1E0SA 5KDOA 1SIBE 1AQJA 1B8PA 2XBLA 1IHOA 1WLSA 4ONEA 1Z2CA 3M81A 2W6JA 3BWMA 4JL8A 5IFKA 4PLWA 2IEAA 3SLGA 5HRUA 3EN0A 1G20E 5ESRA 2PLFA 1L8AA 1BFUA 3OO1A 1JAIA 2JF0A 4OK6A 2X8WA 5HILA 1Z4IA 4V39A 3G79A 2D0DA 1I01A 2GN2A 5FBZA 1EFDN 1QKKA 2W71A 3PQ8A 4J0JA 1BXZA 1OWOA 3K20A 1XKQA 2Q4RA 4MZXA 2P2NA 2F1HA 2ZEJA 2RHBA 4ZMSA 4KHZA 3JWPA 4ZOLB 1NKSA 4ZREA 5CA0A 3ZY6A 4EB3A 4MW7A 1YB7A 4WA7A 5KPJA 4DZTA 2RGCA 1T0JB 2QDXA 4J03A 2C58A 3UKDA 4WE3A 2Y1EA 4CT5A 1ZAYA 2ZYWX 1AS0A 1DGQA 5F1PA 4BVFA 2BKEA 2J33A 3BKWA 4EW6A 4FEYA 3GD7A 5KNCA 2ZBDA 5ARCA 1F8UA 1E2IA 2GDZA 1HY3A 2WYWA 4V24A 4AZWA 4MEBA 1FDRA 4PNZA 4D6YA 2G06A 2G1AA 5LMZA 1KIMA 1Y4SA 2RJ3A 4Q1VA 4RCZA 3SJBA 1BH2A 1E9SA 5EZYA 4C89A 1W5FA 4PYQA 4IEIA 1PJ4A 5IJWA 3KJFA 2XWSA 2GZMA 3D1LA 3MD9A 5EXPA 3PUHA 1YRBA 3AI3A 3C5VA 4WNYA 5CH8A 2PLAA 3SIPA 5IJ9B 5L3VA 1AH2A 3OT4A 2O50A 2V3WA 1JKJB 4V2UA 3K0AA 2Z08A 1DFHA 3HQ4O 3NQ41 5DRYA 3V7WA 3FGZA 4BRSA 1ZESA 2QLMA 5LZ2A 1THTA 3WGLA 4P31A 1J0AA 4Q1CA 3FWPA 3COJA 1HDRA 3AUFA 1EE9A 3M3PA 2LW7A 3FSRA 4CM5A 1L5OA 1JU9A 2QUAA 3C43A 1KYZA 2ZSEA 5G0UA 1M1NA 3HUDA 4URFA 3WKBA 2PXAA 4J75A 2C8LA 4J3JA 1I6LA 1DP4A 1DEHA 1LK7A 1OIVA 3PFNA 5DLQC 4IJVA 2EDCA 1P3Y1 2IH2A 5A06A 1YKGA 5KVVA 1ESCA 3JQGA 1SD5A 5L53A 3EGXA 1PWZA 4KMMA 1XVLA 3SJZA 4C3UA 5JZBA 3C4JA 4TYWA 1USVA 2BGMA 3A9WA 1BC5A 4PTLA 5ECWA 4BMOB 5LP6A 2F64A 2Q2WA 2VI5A 4K6GA 3S29A 4FWBA 4MXDA 4YJKA 2PGNA 2W2KB 4I50A 2X2FA 4MJ7A 3RUPA 3VMMA 4G0NA 4TXNA 3G49A 1N2HA 4PU0A 4IZOA 3U7IA 4AO6A 5LP6C 3F96A 4K6MA 6PFKA 5JBNA 4EEXA 4RS4A 2CNBA 2AVDA 1Z7YA 4P58A 4V2IA 2YIDA 4AZ3A 4JJ8A 1B93A 4HC4A 4NU8X 1H8ED 4XCVA 4ZI2A 2HIMA 3QV2A 3W1WA 4OY3A 1EFRA 1PX2A 1HDOA 3WLPA 3R0QA 4NY1A 3AH8A 1B0UA 1ZD3A 3MC1A 3AUXA 1HE3A 1QTNA 2FG7C 2A0FA 2H5LA 2VTBA 1HDYA 3OSUA 4C2BA 4DUZB 5FXMA 1QK3A 1OXSC 3GW8A 3MXOA 5KYXA 5BV0A 1SKMA 2W22A 1G4HA 2J0UB 4LOIA 1QRDA 4G63A 4CG0A 3DPIA 5ICFA 1SY7A 2G9RA 4C3ZA 3EIWA 4GX2A 1SA0B 2R47A 4I9HA 2NYRA 5CB6A 4XEUA 2JGLA 1U0OC 4QWWA 2EFJA 5FYDA 2W4QA 3IE1A 4TSRA 4WDRA 5JZ9A 5LBUA 3H0EA 1AIPA 1TCAA 1LBHA 2PCLA 4R2JA 2ZRGA 5BT9A 5EHZA 1EI9A 4MUNA 3RUIA 4OUDB 3T7IA 5J2UA 3PVSA 2BGRA 3Q2KA 3RVOA 1JALA 3MOIA 2ID9A 1S9DA 2O3QA 2PWBA 2FPXA 4L9RA 3KJXA 2C5BA 4UAVA 5GWXA 4Z9AA 3WK4A 1YVPA 2M2IA 4R8RA 2GNPA 4FNAA 3S40A 5SY9A 1BG6A 2JFZA 3HUUA 3LQQA 4QREA 5IUJC 1JJIA 1A69A 3IP7A 4IIDA 3FYSA 1RWOA 3PQ4A 3LPCA 3VISA 2FN4A 5DGCA 2O0KA 5INTA 3GBSA 4JNKA 3JVEA 2ZUEA 4V1CA 1ZM2A 1EHYA 2HU2A 5JZMA 3GQVA 3CLKA 3ZWCA 2TMDA 4CFZA 4TWZA 1OU0A 2R60A 3GN2A 4CIXA 2QP3A 3L2OB 1BQ4A 1B0PA 2ISSD 4NMWA 4Z1MA 5JCOA 3TQTA 2AG1A 2YJ4A 4MHSA 1YTLA 2ABWA 5K8UA 2GFIA 3MLEA 3QKSB 1JDBC 5JXWA 2QQ5A 3I9MA 3SNHA 3ZXUB 2H6EA 3ZIAD 2OOSA 2JFFA 1E2BA 3KSRA 3VTFA 2H4YA 3ECAA 4WNCA 4IEEA 4KXLA 2V54A 4G8JA 3DZBA 4CF5A 3GIWA 1OPRA 4GX1A 5ER9A 2RHRA 5ALVA 5P8WA 4RIHA 1GR0A 2FWMX 5A3JA 5HJ2A 2HWKA 2XKKA 4N0DA 2H1WA 3JATB 1NR5A 1QDUA 5E9JA 1PJ2A 2J7KA 3CSUA 2D6FA 2QTVA 4HQKA 2W83A 3CYFA 5JXJA 2IUTA 3AJ8A 2EX1A 2ZJ1A 3EOAI 4DWJA 3CLHA 1ETUA 2A1UB 5GM2A 3IVGA 4Y1FA 2QXUA 2CK3A 3GBPA 3DAPA 4P4SA 2D8MA 1C9DB 1P7PA 1TU3A 3U4IA 4LDAA 4TV9A 3CTMA 3RVNA 3FYCA 5AVVA 2BGLA 1C1XB 5ALMA 1KXZA 1CUXA 1NW3A 3AM4A 1CZLA 3AUTA 2D5AA 3WWZA 4I9UA 3BWVA 4EKDA 5FWAA 1LLFA 2G7ZA 4YMLA 3EEBA 4JLPA 3DO8A 4BNDA 3SZUA 1YD7A 2YOFA 4PRLA 4TYYA 3ANNA 2CNWD 4N48A 4LUCA 1ULBA 1W19A 4ZVVA 5KWJA 2ZANA 2C2MA 3KKLA 4K1LA 3LXXA 1AU9A 4Y9DA 4ARSA 2FI1A 2XYPA 5JV5A 3M3HA 1VXRA 2I2WA 2OV8A 2G4LA 1A50B 3A2LA 2GZHA 3NG1A 3RFVA 2QTAA 4BQSA 2HA6A 2JGAA 1QMPA 3WFJA 1OBCA 1UJ4A 4GOND 3SP1A 5M7EA 3S1SA 1J5EB 3G13A 1Y3BE 2NO0A 3TLZA 2XIQA 4E33A 5JWHA 1QV7A 2PUTA 4TM7A 1KH3A 4RA9A 1JHPA 1JQEA 2Q0SA 1D0VA 3EZ6A 2XRMA 1ATIA 3CSSA 3K8OE 4MMXB 1SVSA 3JYPA 1CKEA 3LW7A 4L5IA 4Y9SA 3ZOZA 1CUWA 4MV1A 4CGYA 3KXKA 4HAUA 4DCTA 4XB6B 1IBKB 2EBHX 1CR0A 1GSHA 5KNBD 3DXZA 2LGJA 1ACLA 2CBXA 3FJ1A 5DK6A 4D2IA 5KYKA 1MAUA 1XCJA 5HF5A 1X7ZB 4KAXA 1GZ6A 2DF8A 3BJRA 3FF4A 4CM4B 4PC7A 4KXYA 2GPSA 3U7GA 4NBVA 5I5GA 2X0RA 3PC8C 2VRCA 1YHZA 4NULA 4BVJA 3ZCTA 2DOKA 3QX7A 3UV3A 2FRXA 3A31A 3CR7A 3AB7A 3C1OA 4KQIA 4S0XA 1JYFA 4ZOAA 4BFXA 4DLNA 5GTDA 4BGUA 2EP5A 2PX3A 1GTZA 4X3PA 3VR4A 3KYBA 1LPMA 2AN4A 2P4UA 5H83A 3ZY2A 1KI6A 3A9RA 3L7DA 4EGQA 3OA2A 2AI3A 2JIOA 3FUXA 1YF3A 3ZIDA 4A26A 1ICEA 1RXIA 1ZGAA 1I51A 1VMKA 2YBEA 5KJ6A 1CQIB 4V0LA 3GLQA 3CZRA 4JP5A 5FJJA 4TKVA 1XMIA 2IW3A 1G42A 3PT9A 4K9KA 4TVSA 1X3SA 4U6NA 1C8KA 3J81k 2W2OA 1FPQA 2CXOA 1B8NA 1VJ1A 3NJ4A 4GMFA 1V4NA 2NW6A 3KJHA 3QPDA 2QRUA 2V7QD 4DLKA 4FMBB 4G2TA 4LDZA 3I4LA 4TQ9A 3W8RA 2BGWA 4N6GA 1OILA 4MNTA 4NBTA 1BCSA 1KOJA 4UD6A 2RKBA 2JJQA 2NQ2C 3IO5A 4LMPA 4XW2A 2WWWA 1RLTA 4ACBA 2GPJA 4C6TA 2CHUA 2DECA 2MINB 3IXQA 3R7DA 2X7HA 1O94A 1SURA 2ODPA 4GYJA 3TZCA 4UTVA 1KP3A 1L7NA 1ORVA 1R4NA 3ICVA 3BWBA 3WVNA 4L4XA 1E0KA 4CMJA 1J9EA 4LX8A 1O94C 3TFWA 4Q9DA 2RCYA 4QUIA 3VU3A 4IMIB 1GARA 1GTG1 2AOTB 5JY6A 4HFRA 1HNXB 5ADUS 4AG3A 4C0LA 5I9TA 3NNNA 1KAOA 3BGVA 2FN8A 2PQ6A 4U2KA 4C0SA 1W46A 1MP0A 4YJGB 4N7RA 1Q22A 1XWWA 2ZWOA 3CJTA 3N8IA 3P9CA 3OEWA 4YROA 3ZGVA 2RK3A 2YHIB 1ZR2A 1KEWA 2XXAA 1Y9EA 1CG6A 4CDNA 1MXFA 2QN3A 3NUGA 4CMCA 3H3XA 3AHFA 4NIMA 2BCEA 1UF9A 2NZ2A 3QEMA 5C1PA 3HY4A 1S8NA 1MIOB 3A11A 1OH6A 2AG0A 3KS9A 3MMSA 3NOOA 5IJ0B 1N6HA 1QORA 1KF0A 1KAQA 4KPUB 4QQNA 4C7BA 3OKCA 1R8QA 3M49A 2GM4A 4LDNA 2WT9A 4BQPA 3FCOA 3T3IA 5KTYA 2FF5A 3W8DA 2XPCA 4J29A 2DTEA 4JEIA 1P31A 3WZMA 4AYWA 4NAUA 4EGAA 4JZYA 2DHQA 4DT1B 2IUFA 1C3XA 5HDQA 3V8QA 3GLHB 5DGXA 5DFAA 1E3SA 3WGYA 1G9SA 1Q3HA 2CNKA 2W6IA 3NH6A 4PAOA 3NBQA 5C8YA 1A2KC 2HQSA 2NO9A 2QTCA 4G24A 3BJMA 1GGFA 4ARCA 3TH5A 2EAUA 4ZI3A 3ORQA 3VNBA 2XTJA 3RC2A 4C29A 4FX2A 3RJ5A 4EPYA 4BNFA 2DQYA 5BO5A 1JAHA 3T35A 3C7DB 1NYTA 5JJBA 5LM3A 1IC6A 3D3EA 4QNNA 5TQ2B 3K2EA 3RLFA 3N2EA 3IFSA 5BN3B 1JI0A 2I3DA 3QVKA 3QKIA 3WDLA 3QIAA 2VAXA 2XYQA 3MG9A 3PHGA 4Q4HA 2FHSA 5TC4A 2CT8A 2OT3B 3ZZUA 4EYEA 2PL9A 4MKGA 4QYIA 1RIIA 5AK3A 4B3IA 2Q4DA 3GPLA 2ZJ2A 3UB2A 1ADGA 4MYUA 2MYPA 2IYNA 4IIBA 1GGMA 3OLWA 1VB3A 1XB2A 3LHIA 3ISJA 1GDHA 2ATXA 3TW6A 5JQGF 1AMUA 4FMPA 2OSVA 2BAGA 5T64A 2QE6A 1TKRA 3LVBA 5IWAB 2OXTA 1G59A 4R8VA 3BILA 5A5FA 1YI1A 1R4MA 1A76A 2IY8A 2JEZA 1JR3D 2D3WA 4KXWA 1Z3IX 3RS7A 3UT6A 2WWXA 5JAMA 2OUKA 4H31A 4NE2A 4WLFA 2J9RA 1KQGA 4RFSA 4XIYA 3DH0A 4ZJYA 4NBUA 1GUFA 4XGIA 4D44A 1K9SA 1VE5A 2MJLA 2Q5QA 3FFWA 3AHGA 4R3NA 1R8JA 1BMTA 4BNNA 1Q20A 2Q4TA 2Y0PA 1QKJA 2QRJA 4R16A 1MG5A 2V6BA 2H0QA 1RJ9B 2F1KA 2HV8A 3VR2D 2EBWA 4IINA 4B7CA 4AO8A 1QBKC 4KRFA 2BELA 2ORWA 4EDFA 3T5TA 5BN5A 1SRRA 2HWXA 2P9TA 4XR9A 2I7XA 1LS6A 2FW6A 2QMZA 3T7DA 3ZCSA 1HPLA 4IGKA 1G2QA 3ZXXA 4BV2A 2GKOA 1I3MA 2ILTA 3O38A 4H08A 2J3QA 1SXJD 5A6VA 4GI1A 4R01A 5HS6A 1NNEA 4JLUA 4MV8A 3CW9A 1RSZA 4JU8A 4IJ6A 4F3CA 3A6LA 4R2LA 1ZOIA 3A1FA 5EJ4A 1HYHA 3UMBA 4JFRA 3RSQA 1G21E 1J22A 1VPLA 2RD2A 3DOUA 4FW8A 1Q91A 1WVGA 4PS0A 3OQOA 1I3CA 3COVA 4K5QA 4O2AA 1JSXA 1YFZA 2P5YA 1H1DA 1Y7LA 3J7TA 4DQKA 1F4VA 3HDTA 4PINA 5FIUA 1E1NA 4AJLA 4LTMA 1CIJA 2C4NA 2B9VA 3MD0A 1LU9A 3K4HA 3ZD7A 3UC9A 4XWAA 2CVHA 2YYYA 2WICA 3RBZA 2PS0A 3EVBA 3L6EA 3NVAA 4H6VA 4BS9A 2TYSB 2C2ZA 3VPCA 1M6EX 3GFRA 3IUMA 3R77A 5GVSA 3D59A 4OHZA 2P9CA 1WW2A 1RYYA 3MGGA 4CN8A 1YIAA 3AP1A 2VDPB 4I8XA 4M0EA 4TXMA 4YAFA 4JYAB 3DWIA 1DOHA 4F84A 1G4UR 1YRWA 1N92A 3BM5A 3QFCA 5ALHA 4F86A 4PG8A 4XYLA 5JANA 2YX1A 4LOHA 5FUQA 2NNLD 3PDUA 2G9NA 5JFOA 3TM4A 2A5JA 2X0IA 3PZBA 3UUWA 4Y3UA 5FTLA 3KWFA 3OCJA 1QZTA 5T3UA 5A4MS 3ZK7A 5B6IA 2UXBB 3ZPXA 5KOIA 1JILA 1WKBA 1ZGJA 2Q8NA 1UM9B 2Q6LA 1HDCA 3CY6A 2RFLA 4R0VA 5J5VA 5SZKB 3ZHUA 5C5DA 3B6MA 1XWFA 4XAQA 1MLDA 1TM7E 4HAOA 1QE0A 4PZAA 3VDQA 2DFPA 2IRWA 2XUZA 1JHDA 3VZDA 2I6XA 4W5NA 1R64A 1SU7A 1UT6A 1W0JA 1PWEA 2Y76A 2RHWA 3JVDA 3AUUA 5JH7F 2EJWA 4QVIA 2W00A 3T3PB 2GDJA 4YLEA 5C9ZA 4ECEA 5IW8A 2OR3A 5H9VA 1M6WA 2XVXA 2ZI4A 1WUTA 3KEQA 1JEAA 2XHZA 3VNVA 1UJMA 4B9AA 3BXZA 4X3OA 2V9CA 2IYXA 1P74A 2FSIA 5I48A 1YGYA 1MJHA 5E3JA 1U8AA 2C7BA 4WLEA 5LQUA 1NNUA 2IS4A 4ME6A 2FFBA 1KBQA 1JNXX 2ISCA 2F2TA 4BKUA 3DLHA 1VG1A 1TFUA 6CHYA 2XA2A 5TGZA 1U0TA 5LFAA 4IZIA 4U7FA 3C6ZA 3LJKA 2F1RA 1QGUA 2M1XA 5ICMA 1PWHA 1E2GA 1ZD1A 2WD8A 3FTDA 2O52A 1FBTA 1MOQA 1N2BA 2WIGA 4JR1A 5DYTA 3D2AA 3TXAA 4BTLA 1RYDA 1LBQA 1U0LA 4CUZA 2PWYA 4DHWA 3KRTA 3MYRA 4O59O 4TTRA 3WWPA 2W2QA 4A92A 5ITZB 3BQ9A 2H31A 5BN1A 4L50A 1EIZA 1NSFA 2PKXA 2E4WA 3ZK9A 1L7AA 3AU8A 2B8WA 3BRSA 1NE7A 1OXTA 3EY4A 4DJTA 3HJHA 1UP4A 2IXDA 4IF6A 4I19A 3G0OA 3SFTA 5YASA 3LKDA 4JSRA 5DSXA 5M3BA 2WJZB 4FONA 1JSLA 2L17A 1VI5A 3B78A 3DLBA 2B4KA 3CLUD 4FGSA 3TIVA 4TQUS 3A2KA 3RASA 3V97A 1QQ6A 3P4YA 3P9XA 4MIYA 1OASA 2KI5A 1PSDA 1JFFA 1JX6A 1V7PC 1VIDA 1Y3AA 3A4LA 3EOBI 3EZ9A 3GGCA 4G09A 3WMRA 4XJVA 1D2GA 3F9IA 2GCOB 4S2UA 3SQLA 4MS1A 4Y2PA 5HJ5A 3IODA 4MVJM 1K63A 3FR7A 1NBOA 1T5LA 4MLZA 3DE5X 3IUBA 4DHEA 1W88A 4INZA 1P9NA 4P82A 4WXEA 3VYSB 5KQPA 3WLKX 3F5MA 4N1AA 1KZ4A 5HGXA 1W75A 5EMMA 1JZTA 2HRBA 2E4XA 4YQEA 1G20A 1JBKA 4FYYA 2JANA 1E2KA 1MH9A 1R0SA 1YA4A 4PNHA 1K08A 3A1TA 3NAZA 3A6HA 1LB1B 3EFHA 3TK1A 4EQ6A 2WJIA 3H84A 4BXOA 3ELDA 4ER3A 2O48X 2I7TA 4IV5A 2RMKA 5HQ3B 1TAHA 2E4YA 2YWJA 2QT9A 3T7KA 4B3DA 4YCDA 4DUYB 4PGFA 3ZW9A 4CNQA 2VS1A 4ER6A 1DBVO 1VL0A 4CWAA 3I42A 1MGOA 1PR2A 3LE8A 1SG0A 4YMGA 3UMMA 4QNMA 5GJBA 4NWIA 2CWDA 2O07A 3QTLA 4YB8A 2ZUUA 2YRXA 1H9BA 4DG5A 4HGQA 4YRQA 2VNHA 3BE6A 3OFJA 1E3LA 5E9WA 4B17A 2R1ZA 3N2GA 4Y0VA 1Q77A 4WBNB 1UL1X 3C7AA 4W9MC 2DR3A 2RHJA 4GP7A 4Q1BA 4UBNA 5BSGA 5CB4F 3EXAA 3OTOB 1PUJA 5DULA 1KY2A 1KE1A 4X62B 3ZH9B 4DRXA 4IIFA 3NXKA 5EERA 3ZNQA 5LDGA 4DLPA 2EFGA 4GKAA 2ZJ3A 4KNWA 3EPHA 2VH2A 2KYRA 2PX4A 1WQ4A 3LKBA 4C21A 1QU2A 4YDRA 2Q8PA 4DARA 1KWKA 2AVNA 1JQ3A 4D26A 3JTEA 1BDBA 1JU3A 1XYVA 1SC9A 4L0MA 4MWCA 5EWJB 3ORYA 3W34A 2BHTA 2GXSA 1GNVA 3HFJA 3I6ZA 5EE1A 4QO8A 3U7HB 2JGKA 1L4MA 1Z35A 4WUVA 1ULTA 3L8CA 4RK1A 2MTBA 3ENQA 2WF9A 5AUNB 4L4RA 1XTJA 3R0XA 5FL7D 1KDYA 3HXMA 2AG5A 1KU6A 4CU5A 1IY2A 3CZAA 5CT6A 1QJCA 3EW7A 4QU5A 4WXPA 5DWDA 5TS3A 4K9NA 1V8PA 3D4IA 2Y9MB 1YDWA 1WEHA 2XKBA 4IXWA 4M38A 1FCJA 4Q9JA 2XZDA 3H1TA 5EWMB 2D74A 4MWEA 4CN9A 3BK2A 4MSUA 4YCAA 4WH0A 3DCYA 4G8DA 4Y0NA 2QD3A 2XE6A 1M8KA 3BL5A 5AKXA 2C54A 5ANRB 3IERA 3OCUA 3WJ7A 2Y27A 3WGVA 1DRWA 1C5KA 1DINA 1X1SA 4EJSB 1R4AA 5E7MA 4GM4A 5EWLA 5K0CA 5FBKA 3RS2A 4CMIA 1QFYA 2NVWA 5IVHA 1ZXBA 1EFCA 3EH1A 3G89A 4ND2A 2CJFA 3C6KA 4IJUA 5F2KA 4DIOA 5BORA 5JO0A 1SXIA 3OFKA 4ALMA 1O08A 2R8OA 3PV0A 3RV3A 4GQAA 4S2EA 3WL4A 5BP7A 1E6LA 3ITKA 1T4CB 4BQNA 1OTYA 2FOIA 2W8ZA 3G0IA 1XVUA 1QLWA 2ST1A 1MEOA 2XMBA 1HL3A 1OXMA 1RXYA 3F6EX 3NR2A 3PX3A 4KI0A 4GKVA 3B12A 1RKVA 1VE1A 4D5GA 4Q9LA 4QC2A 4A5SA 4RPHA 5DCUA 2IOYA 3PR1A 1SVMA 4XFDA 2HBRA 3N05A 1U2EA 1K7EB 4X7RA 5FLYA 4LHEA 5K03A 4DR3B 2Q46A 3QXGA 3MOGA 4UBJA 4E6EA 2QT0A 4URVR 3L0BA 1NJ6A 2WFLB 2HWUA 3CX6A 3OKFA 2JAWA 3TZLA 2PN1A 5CDFE 1OFTA 5C52B 2BC9A 5ALWA 5CAEB 3ZCPA 1RDFA 3C6QA 3E4DA 4QFDA 1I94B 4XUCA 3M2PA 1MX9A 4MV5A 5A5DA 3OPQA 4KH0A 3FMPB 4URWR 1XJCA 4YP0A 5DSTA 2XMQA 3DBRA 4MI1A 1VJDA 1XQ9A 2GEVA 4I8IA 5A9RA 2ZXUA 1A04A 2Q49A 2ZETA 1TIBA 3BULA 4WGGA 1V5IA 2I1WA 4AAYA 5C2JB 1E62A 4Q4CA 4F91B 1L5GB 3SZLA 3DW3X 1VTKA 4S1OA 3NATA 1NVEA 2VYFA 4HFNA 2EJUA 2YVUA 4FR0A 1IJEA 1N2EA 5EAIA 1LTKA 4R1PA 1YS1X 2XGJA 2OY0A 3GP8A 4KQCA 4HAXA 3L7IA 1J42A 3BMQB 3O2SB 4NU5A 3ZCRA 4ZPXA 3JVUA 4HRVA 4KJXA 1WZ2A 3K92A 1NJ5A 3K5PA 1SKAA 2QJFA 4ICIA 4JBLA 1ZVJA 2BFFB 1T10A 3WHKA 2AL7A 1XQ6A 4X7MA 4HVLA 2AJ8A 1QOPB 3EBOA 4HEHA 3UK2A 2CMHA 1Z2AA 2JGEA 4ZAFA 3DNFA 5MGBA 5JG7A 2YN0A 3F4KA 4O4HB 3EEYA 4GBED 2F8SA 1C81A 3A1UA 2V59A 1PS9A 5DHQA 4XDZA 4RZHA 3SFVA 4UUMA 1UC4B 3LA8A 4E94A 2A14A 3FDZA 2Z3WA 4U7PB 4KXQA 4IIXA 1V16A 5CLHA 2BM8A 2DBRA 3UKJA 3GGOA 3RRXA 4B87A 1U4OA 2OZKA 1C7IA 2FJPA 4ER0A 5BXYA 1RTKA 3SLKA 2QZZA 2GHQA 4XQ0A 3CC8A 3FZGA 4E12A 3PWSA 1N2CA 1Y89A 3IMCA 1KWGA 2IJGX 1WMDA 1QHHB 1YOVA 2PGLA 4K6FA 1TUBB 5LKAA 4DIKA 1W1WA 2IE0A 3TIGA 2VNSA 3TZQA 3IOCA 2UUOA 1WUKS 2V74B 2I7DA 1DC7A 1FJGB 3A36A 3QPAA 2FX2A 1C0LA 3GNSA 3HWSA 3WJAA 2XDQB 2BY4A 4GZMA 1QB7A 3DZ8A 2R87A 3PGKA 4Y2RA 3ROKA 5LIRA 2A1TS 4OHYA 4GAEA 4JI3B 4MIEA 4OUKX 1IHDA 5JCJD 4RK4A 1PEDA 5DI3A 4YXWD 2AQ8A 2OV1A 1VFPA 2FRDA 2QSUA 2YNMA 3B1FA 4HS9A 1ZJ4A 3L7NA 4ZQBA 1PBNA 5IXSA 1DEAA 1XE3A 2VCEA 2ZIVB 2A5LA 4IMRA 4KW7A 3AIMA 1JHRA 3QYFA 4DLYA 4OJMX 1JDZA 2C5LA 3STHA 2FRDC 5AW7A 3G0HA 2YNMC 3R5TA 1V8BA 3NM5A 3B6ZA 2VJBA 4RD2A 4YMHA 1V96A 4NARA 3EXEB 2PT5A 4I1RA 1DC6A 2Y9PB 1FSZA 3NGMA 4R98A 4CT0A 1RTTA 4QDTA 5BQ3A 1R5NA 1N36B 4IMPA 1G5HA 5LC1A 3DTVA 1GGJA 3ZQUA 2VTKA 5MFPA 1NQVA 1XKTA 2VNKA 4MV9A 5FA8A 3IMKA 4LCEA 1GQSA 2LNDA 1Y6FA 2BYTA 4COOA 5B58C 2EATA 3N0TA 3UUGA 1USKA 1Q7GA 3R3HA 1B14A 2OKCA 1MRNA 2XXJA 2GH1A 2Q5JA 1NRXA 2VYNA 5DTQA 2PMEA 4AKGA 1KDZA 1EVEA 1MEEA 2WV9A 4H6XA 4KFRA 1IDN1 2X5KO 1FJXA 3AEYA 4L8FA 2H16A 4ZIRA 3E58A 3I9KA 3TLKA 4F2PA 4JYZA 3FDJA 2OMEA 5LXTA 1LJ8A 3EQ9A 1AHIA 3DOFA 4B6PA 3QXXA 4ZOQI 4CKWA 3EXG1 5AIBA 3ABIA 1CTQA 1KK1A 3R44A 2SKEA 4O5AA 1EIWA 2QM8A 2LIPA 4LK3A 4ZYXA 3DBHA 1XZAA 4P08A 3TINA 2FSUA 4B45A 1YDEA 2OAQ1 5ELLA 7REQB 4AJ2A 4IJMA 2YW2A 4Q3NA 4HN9A 4WMLA 4WTOA 5JQWA 3X44A 1XHLA 4K26A 4MYHA 5HMLA 2R44A 1IY9A 1N8TA 1PDVA 5GZ6A 2FZVA 4ZHSA 5AW0A 4Z3DA 4CFYA 2VDOB 3T38A 1HT1E 5U9CA 1SMKA 1MO6A 3QU9A 4TXLA 1WW8A 3GLFA 1QF7A 3G8YA 2XRFA 3B8HA 3NVDA 4LY3A 2PL5A 1DG3A 1T8RA 1H6DA 2WJGA 4YUWA 3GVCA 2EJCA 4Q18A 4DV1B 4LE2A 2WJHA 4TV8A 4Y9RA 3A05A 3UAWA 4DM4A 3NDBB 1HEIA 3D3WB 4KMOA 2NUAB 3JAKA 3ED1A 5AVZA 1D8AA 1GKLA 1BFKA 1ILEA 1XKLA 1YE3A 4MCAA 1JQDA 1A9OA 3M4ZA 3O47A 4UEQA 3ID6C 4E15A 5B5SA 4UHHA 4F1KA 3DEZA 1M7HA 2C8JA 2I65A 1D6NA 4X93A 1KMHA 1NJ2A 3OCWA 4BFCA 3HO8A 3PUKA 1KAGA 1GNTA 3HPQA 3F3KA 4Z4CA 1ZMXA 5A3VA 3BDVA 4CKWB 2CMFA 5DNUA 4UREA 4NQRA 3E9MA 1KGDA 3PL1A 1H42A 5J23A 3P0EA 3R74A 4S24A 1ZONA 5F9MA 4YPFA 1DAKA 1QZ3A 5IDQA 1YVRA 4W1SA 2X58A 1QO0A 3EGOA 4LE1A 3LLCA 4C5AA 4A8HA 4EO7A 4JX9A 2BJVA 2I9PA 4ILKA 2IP1A 4BLVA 2IV7A 3ZHZA 4OHMA 1X86B 3TLBA 1EGVB 3C6BA 1EUZA 1CUGA 1PJAA 1PUXA 4HFJA 4ADSG 4AROA 3VSBA 4AULA 5SYNA 1P1KA 2PFSA 2YINC 3EG9B 3K0FA 3TVDA 4XEHA 4LMAA 4F85A 3N2KB 3P5BA 4NDNE 3SSAA 1EG2A 5DMHA 3NV7A 5KC9A 1GKYA 4MYCA 5E1BA 2PPLA 1N6KA 4QPJC 4YONB 3OFNA 3SYKA 1Q11A 1NJGA 1P19A 2R8XA 5DEIA 3AY0A 3S8YA 2QNBA 3TL2A 1CUBA 1OSNA 5TMPA 4R41A 4MV3A 4PIVA 3ROPA 2PANA 1DPGA 3MTBA 3D4OA 4EUNA 1ISHA 1Y6QA 3CKLA 1ZK1A 2X8JB 4KITB 5IHXA 3ZGOA 3K5WA 3FTNA 5KUTA 3JYQA 2EIHA 2DU8A 3E9ZA 1TI7A 3WLAA 4E07A 1QPZA 1ID8A 3RU9A 1GWNA 3R6DA 5K0LA 3BFKA 1ZRHA 4D42A 3A4TA 2B5WA 1FFHA 4KPGA 3RUFA 1P91A 2Q3DA 3EVTA 3IR6A 4J3FA 4JC8A 5E0KB 1G60A 5KNLA 5CVTA 1TRHA 1TB4A 2NO1A 5GM1A 1NPYA 3JD3A 5KOJB 1F2UA 3LOUA 4WOBA 3W8EA 4YJ2B 2YHUA 1N3YA 4W1QA 3I5AA 1SC1A 1SOWA 4U39A 1C14A 3ICWA 3KU1A 2R7NA 4UXIA 4E1AA 5I8PA 3SYRA 4TSKA 4JELA 3IJEB 1U8TA 3PG5A 1NULA 1OROA 3KT6A 5I47A 4ZXPA 1PG0A 1TEZA 3O26A 1R0XA 1NFQA 1MN6A 1XLUA 2VJKA 2RONA 1UT5A 3K5HA 4J4BA 4FFSA 4W7SA 4EG8A 2CD9A 2CMKA 5KO2A 1JMKC 1G6KA 4LOLA 4MEJA 1IRIA 3JWEA 3THRA 3OKAA 5B4TA 1F6WA 2QWXA 3CE6A 4F1JA 2XGOA 1BSVA 1GV0A 2F8TA 3OQBA 3DE3X 3LL4A 3A1DA 1M7GA 3EXHB 1A9TA 3QOXA 4J4TA 3IDFA 1CY6A 4OM7A 3K0SA 4YDSA 4Q16A 2XVYA 3CNBA 4NCJA 5B6PA 1A7AA 4LRWA 3W5SA 1VIAA 1P18A 1SC6A 2EZ8A 4FE3A 1C0KA 3V9AA 3AF0A 4JGGA 1RCUA 2DTXA 1TQ2A 4KGVA 4LTDA 2Q5EA 2VDKB 1P1JA 1TQDA 3UF0A 2RB5A 1ZKDA 1CUZA 2BFWA 1P2TA 1R15A 1RJEA 4KVAA 3U60B 1Z8DA 1DNPA 2HLHA 4D9CA 4ZYUA 1EH5A 3RYHA 2IYTA 4RVSA 5HCIA 4OG2A 5LOVA 2A0KA 1DBPA 5IC5A 3GB9A 5G0SA 4Q4AA 5AVUA 3VO8A 1QIGA 1WF6A 2NSHA 3HZRA 4ZGGA 3V32A 1AXRA 1J5PA 1VRVA 3E53A 4QVGA 4O0LA 1W93A 2GM9A 1VG0B 4ZA2A 2HLNA 4PR0A 4OYHA 3PA8A 1QPBA 2XUDA 3NPMA 4ZCLA 3VC7A 4KREA 3SR3A 4E4RA 4UVEA 5E1DA 3T9FA 3H6HA 3L1HA 1D2CA 3UPUA 1VMIA 2D5BA 4IGAA 1RRVA 1JIVA 4IXMA 4MV7A 1ZK3A 1J2EA 4ZJZA 5A1JA 1QV6A 5EXXA 3CSDA 2HO5A 3DVLA 4XI9A 3VZRA 3UHAA 1IHXA 5C31A 1KYYA 2DKNA 1NLFA 4HXEB 1PZFA 4IS3A 3TMAA 1OB5A 3DFKA 1L3IA 2AI1A 4G36A 4C30A 1RQXA 2Q9BA 1IK6A 4GMXA 4IBOA 4BO0A 1JWAB 2GGSA 5FRDA 4I1UA 3EZXA 1ZCZA 4KV9A 5HVNA 4HY3A 5FFMA 2H9AA 4KK3A 1TZBA 4FDLA 1C7ZA 3VQTA 2ZRBA 1U9JA 1XO1A 3FIUA 2I3AA 3TTWA 4HNAA 1MTZA 3BE4A 3R8XA 1O97C 2B83A 521PA 2RHLA 4YJFA 1A9YA 4M4SA 3N74A 4PQGA 4R81A 2IKQA 2C98A 2AWOA 3FKSD 3S8EA 2JGIA 1T4GA 4KPFC 2DM6A 4BB0A 4TXJA 4I3FA 3W5VA 3R7NA 2X22A 4MR8A 4F4DA 3ASZA 3NM6B 4AP6A 3DZHA 3PDJA 4KNVA 4KQGA 5EJMA 4EA9A 2VPPA 4A7PA 1K9VF 2X3YA 4MVWA 2PUDA 1YHNA 5EMLA 4QASA 5CBKA 3RAJA 2EWMA 5JHHB 4A8JB 1VG9B 1RS0A 4DGSA 3LH5A 2NADA 3HCFA 1F9EA 1H0HA 3DUFA 4LF9B 1UBFA 4C7OA 4JP2A 4QJBA 1E9CA 1WPRA 2NAPA 5EI5A 2AYZA 2NU9A 1GPDG 3HJFA 1E61A 3F7OA 3WSTA 5BSVA 3NBMA 5I6DA 5I9BA 3V1YA 2JG3A 3F6PA 3L4KA 4BEJA 3OUZA 4KUGA 3H4IA 4DL9A 1KMMA 4DJJA 4ZHQA 2O3TA 5M2QA 2I9KA 3R8CA 2WUEA 4TL6A 3HCOA 3KT3A 4CLEA 4JDPA 4BCBA 4HLDA 2ZG6A 4PNPA 5LQMA 4UOZA 1W0KA 1XA0A 1XDWA 1QG0A 3LLUA 3UGTA 2K5UA 5FT9A 2J5XA 1A4UA 1I1HA 1KDPA 1O95A 1GZSA 4P1ZA 2Y6UA 4CDGA 1T3ZA 1YJBA 1W25A 1U2QA 4R2WA 1JJBA 3CUSA 4QQKA 1QGOA 4YRNA 4EA6A 5G0VA 4V0RA 1X1EA 4FDAA 4QUEA 2JIZD 1O95C 4B3GA 1H69A 2VYVD 4YT2A 4GXQA 2QD1A 2VDWA 3QJ5A 2KE5A 2O3UA 4XUGB 1XMSA 2PUAA 1B73A 2V6MA 4UDXX 1XP5A 4MVXA 5JXGA 3HTXA 3LF2A 4OATA 4E46A 1EP3B 1P1IA 3DV0B 5K3BA 3VR3D 2CLMB 2J5QA 4FZ3A 1M2VB 1K7CA 1HTTA 3CIOA 2IXFA 3RM3A 4HT3B 1E69A 2X1VA 3NTRA 1IZ0A 1UIRA 2FN3A 2XJ4A 4MITA 4YWJA 2MHCA 5LLTA 4LVOA 4C3VA 4UMEA 2CLEB 1UZNA 4ENQA 5BPHA 2QVCA 3I2FA 2J0QA 1YE5A 2FAXA 3GRUA 2Q29A 1Z29A 3I76A 3OQPA 4YMIA 4IYJA 1YJQA 2WFZA 3BWXA 4EITA 4IDDA 1XG5A 4ZO6A 1ADFA 4Y9TA 1K6IA 3PIRA 5F73A 2SHKA 2BHSA 3WA7A 1EB9A 3DKVA 1JIJA 2FR0A 2HA0A 4ZQGA 1ODFA 3SHOA 1NOIA 2BEUA 4Y0AA 5DYGA 3DZGA 3FB4A 1QRUA 3OIFA 4I2NA 1ZJJA 2WPNA 4RHFA 3N0WA 2Q2NA 4RMJA 2I80A 1EWYA 1ZK2A 4FFBA 4Q7LA 1F8XA 2HADA 1GPH1 2O06A 4RVHA 4D9IA 2X1MA 1UADA 3B1WA 3O0DA 4NOLA 4P54A 4U63A 4W6QA 1NFRA 1Y0BA 4WZZA 1B76A 4K6CA 5CFMA 2XYGA 3GUYA 1GUBA 1GPWB 1WL8A 2C9OA 3OZ7A 3MWYW 1JQKA 4R3WA 4ZAYA 3VC2A 1UZUA 3VNQA 3DEIA 2P91A 3ZOKA 4NG4A 3HB9A 4HDMA 4TTQA 5CG1A 3FRJA 1HDGO 4ZI7B 2YJ6A 4MINA 1G8GA 2C29D 3IBSA 4E5PA 2FRVA 2ZCVA 4M9CA 1GUYA 1AGRA 2QD2A 1Q12A 1P81A 3ACBA 4G23A 4PW0A 4EOGA 4XRGA 5HYVA 3TLXA 4YRTA 5BUQA 2G36A 2QXYA 4BATA 3D3QA 4QD3A 2DPMA 1FTYA 2IHJA 1WABA 3C3JA 5EGNA 1P5HA 4ASUD 1SHUX 4FW9A 4B7ZA 1PDWA 1AHNA 2BWJA 2X7JA 3KZXA 3R41A 5JAPA 5CIYA 4GKJB 3W3AA 5DMXA 1IXSB 2ZRPA 5SYAA 4S1VA 4OKIA 4L6AA 3RUCA 5MFZA 2ZQYA 3HYTA 2OM6A 1DUIA 2F43B 4PGMA 4UTPA 3FSJX 2AHOA 1I33A 3DHEA 5T3YA 4U7DA 1CS0A 2JPDA 4OSOA 4ZVPA 4BBPA 5JARA 5JHGB 1Z15A 3PGXA 3DFZA 3PF9A 4BLOA 1BEZA 3ZBQA 3K1ZA 4RS3A 2WMYA 5KTPA 3INYA 3SBDA 5IZCA 3OHPA 5I4CA 3CVVA 5HG0A 3VU0A 4PC3A 3FZYA 5IK2A 1IPEA 4GX0A 1NVKA 2UYHA 1CWUA 2RGNA 1AK9A 1CVLA 3TPFA 5IZCC 2BOVA 3FPBA 4QUGA 4DV4B 1OBHA 4UJ3A 4MQFA 4N3AA 4FGWA 2KPOA 3VC3A 2IX9A 1C4KA 1FDIA 1O57A 1S89A 2QUJA 1HT3A 2RGNC 2GXUA 1T9AA 2CL7X 3AERB 1FSSA 4XA8A 3PLAE 3DVSX 5DBIA 2JLSA 4Z86A 4HAYA 3L9XA 4IHQA 5JW6A 3NHMA 4R69A 2NM0A 4LBZA 1K97A 4ZXFA 5CDFA 4H1WA 3PJRA 1ZD9A 4PZLA 5DU2A 3HDYA 1M2OA 3T12A 5DIZA 2BFNA 5GONB 2DFTA 4N6NA 2VRNA 4UZEA 2X9NA 2ZR9A 4X63A 3W05A 5D3ZA 4HGPA 4CF7A 2P90A 4G01B 1IEXA 3IDOA 4CIBA 4OHRA 5AKIA 1NBAA 1XEWY 5AJHA 4RORA 1KEEA 3CR8A 3E5NA 1SHTX 1AQNA 4P80A 2D2FA 2H59A 1EGMB 2OD7A 2ZI5A 1HFKA 2FPIA 4QE3A 1E4YA 1Y9AA 3WP0A 3OWOA 4B76A 2Q1SA 2IQIA 3E9RA 2RH8A 1G1AA 2ENWA 2H4JA 4MYTA 5B53A 1GZ5A 3JYLA 1XWIA 4ANFA 2WJJA 3FPCA 3RS4A 4FFDA 4AJPA 2G1UA 2Z04A 3U2QA 4BMVA 2QPLA 3IOYA 1H65A 4RA6B 1EVIA 1B4DA 2P0EA 5LQJA 3RSFA 3KQSA 2P9ZA 1SHKA 3BA6A 5AKYA 2GVZC 2G4CA 3GIDA 1GDTA 2PUWA 5K0NA 1DKLA 1P7WA 3GJ6A 5DHAA 4ZT7A 3RC1A 3COZA 3EVDA 1Y82A 3GLKA 1PS0A 2YIMA 4N6OA 4PBTA 4IKOA 4TS3A 4WOCA 2FXIA 4DANA 4YAKA 3KJEA 1RJFA 3F6SA 3PHLA 1P0QA 1QVRA 3BBLA 3JQ8A 1YKSA 4KYIB 4RD1A 2R7AA 1PQYA 2AC2A 4R9UC 2ZOSA 5JWRA 4FFNA 2F9FA 3QE0A 1FNBA 1N5DA 2GARA 4LI0A 1EZ1A 2OQIA 3D2LA 3TZBA 1HSZA 1KZ7B 2BBTA 2C7GA 2EWVA 5P21A 3HSYA 1CZUA 5K0EA 1V5EA 1C7EA 2GEUA 5B2FA 3ADPA 1E8DA 4DG9A 4W4TA 2HU7A 2AC4A 4G9GA 4EY5A 3U7EB 1THGA 4EVQA 1B00A 5B7GA 3HB7A 5DE3A 2WTBA 3GGDA 1JHAA 3Q12A 4KQHA 1X42A 3NM4A 1JBEA 4EL5A 3NC0C 1JXAA 1QYDA 4IIUA 5EUCA 3D8NA 1C9NA 4K0RA 4BQFA 4PZEA 1ZHHA 4FVTA 1Y7TA 3F6RA 1NOKA 3L05A 2HJRA 2VFAA 3RKSA 4BNWA 2N42A 2IY9A 1GPKA 1ZIOA 3NHYA 2VP5A 4MWSA 3ZVNA 4HNRA 2GS9A 2JAHA 1ORHA 5FEMA 5CFOA 2EFHB 2FCAA 4PV7A 2ACEA 4MW4A 1P9RA 3BZWA 4K9QA 1QHFA 3SU8A 5IVDA 1WMFA 2R7LA 3ZC3A 2AXPA 4E13A 3EMDA 1DO0A 4FE7A 3ZTTA 4RZ2A 4US1R 1W76A 3FMVA 5EQFA 2A92A 4BE9A 1TT7A 1NMSA 3PHBE 1CNMA 4KQXA 5BVGA 3N2LA 2WK1A 2E49A 4URXR 4L0DA 4P4UA 1THZA 5K6AA 2HRRA 3NKVA 4GOLD 1Z4OA 4HR7A 1IY0A 1KEKA 1Z06A 3FVWA 5K6AC 5ED4A 4RIIA 1UFRA 3BH7A 4P33A 2WAAA 2IHUA 2NU8A 4UU0A 3GLUA 1E77A 4J90A 3WNDA 2ZJ8A 3NHUA 3A70A 2RBGA 3U44A 4DJ5X 4P8RA 4NG5A 3K6SB 3C3YA 1EUYA 2HCBA 4WDQA 3AT1A 2QMYA 3IVAA 3QEJA 4G1UC 2WTAA 4NE7A 4RYLA 3ZQ4A 4G6ZA 1UM8A 1YS7A 2D0PB 3DHWC 4V3BA 4UDNA 5E3IA 3PDHA 2JI8A 2UYYA 3LA6A 5HBGA 4IILA 4OHKA 5CURA 2X1HA 2H08A 2YOGA 1UDAA 2NU7A 1OAOC 3KEMA 4FC6A 4BNJA 5B3AA 3PFIA 4Y2HA 1ODCA 3OETA 3VNUA 2PKCA 5D86A 1LW7A 2DHCA 1QIDA 3ZZTA 3FHCB 4K28A 1THMA 2VJQA 3IAUA 1O9HA 3EPRA 4EY4A 3AJEA 3MJFA 2CJXA 2DY1A 2VJYA 2ZIXA 4UPEA 2ZTHA 2XE4A 4P3XA 2PH5A 1MV8A 1REQB 1M2NA 1VGVA 4IDPA 4QGSA 1KORA 4AUNA 1XL0A 4DNQA 5KWSA 2QOEA 5JROA 4IQ4A 2MR6A 4NSNA 5JZSA 2G72A 1G2PA 3EISA 1N2SA 1ZSVA 3NXSA 3A9UA 4NCAA 5A6SA 3N70A 2HZ7A 4HEQA 4TL9A 4QO7A 1ACMA 3U7FB 3VTZA 3ZY4A 4BVKA 1WY7A 1YA8A 5B55A 4FMCB 2Q3MA 4LBWA 5CNKA 4HDOB 2DX7A 1KA9H 1BWRA 3KPWA 2V5AA 1P6QA 4G1VA 4WCFA 1T29A 5HFJA 1R8YA 4I0WB 2PUCA 1CUCA 4I55B 4L51A 4CIYA 1U2RA 1Q7RA 4WCFC 4K3VA 3PSHA 2H4FA 4XB2A 3TVYA 421PA 2NTYC 1I8TA 4DCCA 4ZC1A 1Z39A 3ZWQA 2EW8A 3BRQA 1UCFA 2PXHA 3GELA 9LDBA 4Q5IA 3A3NA 1NHGA 1ZM9A 1QFXA 2ATCA 2B3DA 3SE7A 5CM2Z 1MW9X 4FFRA 4LJAA 2XNKA 3KFLA 2WIKA 4QGHA 5EJGA 2WSIA 3VMFA 4BEBA 9MHTA 1Z75A 1T5TA 5IC4A 3BTUA 5E4TA 4U7WA 2H1LA 5FOTA 3EZYA 4QHYA 1IMJA 3IQDB 3ELYA 2CE7A 1H3NA 2Y1KA 4IO0A 4YYZA 2Q27A 2F62A 4LV8B 1YA6A 3MK31 5FNVA 4R8MA 1C8LA 1XAJA 4AKHA 1U8ZA 4ZFNA 3LI2A 5AI4A 3MS7A 4UUOA 3U7QA 3WO1A 3ZGNA 2I7VA 1T4DA 1OPXA 3LQYA 4KODA 3MUFA 3I6BA 3P20A 2BFEA 4MQEA 4O4HF 1K86A 3ST7A 2SCUA 2GETA 2VDMB 4LJLA 4PXYA 2PK3A 2L82A 4LGMA 2EHJA 4OPMA 1TO2E 1SZCA 4RY9A 3O8BA 3MGKA 5C34B 4BZWA 1OU4A 1QAMA 3GUHA 4O08A 3VR5D 3W78A 2BFOA 2CNWA 4ARZB 3ICEA 1P9WA 1JR2A 1CUSA 2ZYSA 1UMKA 2BFMA 1V7QA 1PJCA 1K88A 3AF2A 3LV8A 3N6RA 5BWOA 3DAGA 4RZSA 1PR0A 4HTFB 2BMEA 1HQDA 3IDSA 3OD5A 1G5QA 4IHJB 4EB6B 5CLFA 1ZSYA 1P2VA 1T35A 5L7WA 3VTKA 2CZQA 2ARKA 3L43A 3IMGA 1PL8A 2DT8A 2ZRDA 4YMWA 1ESZA 1I9GA 4MRVA 3M1IA 4HYQA 2PX6A 3WHIA 4DB2A 2GZDA 5TQ0B 3PTAA 2XAUA 3PICA 3PR3A 2WIAA 4MUEA 2P69A 1ZM3A 5DHFA 2VNAA 3RYIA 4B4OA 4BKPA 1VLQA 5KOHA 1XDSA 1G6HA 4XVQA 5BSFA 4E7OA 4LFAB 4YUVA 4BASA 3R3YA 2GLXA 5E9QA 4Z4IA 4HH4A 2IOFA 2J32A 4RO0A 1U0GA 2RDMA 2PKRA 2PYIA 1MB9A 2P2DA 3KPYA 3MTIA 4KE6A 4B3JA 3DB2A 2BUBA 1ST3A 4F9GA 2AW3A 2VUIB 3AP3A 1D4OA 3AL0C 4IDFA 5IBRA 3NBKA 1PZXA 3E03A 3HADA 1U11A 2FOLA 5H16A 2RJOA 4AY2A 4MPTA 2HSWA 5KSOA 1VJ5A 3BBPA 3PXCX 1E1RA 3JALB 4FOOA 2EGGA 4JB2A 2YHSA 4XUDA 2E0IA 3A7EA 3CUTA 4K9DA 4Y6LA 3WL5A 3QPBA 3QWHA 1OX5A 2FPOA 5HA5A 4QLAA 2ZUBA 2IHTA 4WZBB 3EIUA 5AW9A 2EV9A 4P81A 4JKOA 4U2CA 1T9ZA 4P4LA 3UHFA 3H5VA 1LDBA 1RCFA 4BO8A 1BN7A 1MQAA 3C3MA 4ALJA 3SC6A 1AGYA 3Q7PA 4GX5A 4PAQA 2V7QA 5JQGA 1GTSA 2XHEA 3THYB 5DYWA 2FP4A 1DKMA 4GZ3A 2JA2A 2Y0BA 2IVFA 4RVCA 4D02A 3TL6A 1L6RA 3QYJA 1WOMA 3EAGA 1PGNA 3X1JA 1L4GA 1PS8A 3MA0A 2F6RA 4POAA 3ZLVA 1M2WA 4MA0A 3BFJA 3HJRA 1Y63A 5FUXA 1COWA 1EINA 4YQFA 4K6KA 3IA7A 2C2HA 3PQEA 1QUFA 1YQQA 4RX1A 1Z0UA 1EVQA 3F5FA 3OIGA 2RG7A 5HOEA 3COPA 2Q5LA 5B7PA 3C3CA 1X8KA 2W6CX 1E5QA 3O9ZA 3CWZA 3TCXB 1P7CA 1XI2A 2B1JA 3ZY3A 1CR6A 3AR7A 1HDEA 1BU8A 4BMXA 5JU6A 2QRZA 5CT5A 2AFIB 1LXCA 3LT5A 1W1UA 3I6MA 2WJYA 4AURA 3EC7A 3ZHCA 4L75A 1YZLA 1TGYA 4X8MA 2P6OA 3SNKA 2F3PA 4D4MA 2OAP1 2WU1A 4G5OA 5IAGA 1R0RE 5FOXA 4K2HA 3Q3IA 5A02A 2CDAA 6REQB 3DD5A 5LJIA 2W11A