2IFTA

Crystal structure of putative methylase hi0767 from haemophilus influenzae. nesg target ir102.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
176
Chain Sequence
GEVRIIAGLWRGRKLPVLDRVKETLFNWLMPYIHQSECLDGFAGSGSLGFEALSRQAKKVTFLELDKTVANQLKKNLQTLKCSSEQAEVINQSSLDFLKQPQNQPHFDVVFLDPPFHFNLAEQAISLLCENNWLKPNALIYVETEKDKPLITPENWTLLKEKTTGIVSYRLYQNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methylase HI0767
publication title Crystal structure of the putative methylase HI0767 from Haemophilus influenzae.
rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 49
structure length 176
sequence length 185
chains with identical sequence B
ec nomenclature ec 2.1.1.171: 16S rRNA (guanine(966)-N(2))-methyltransferase.
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2iftA00
5FUBA 1AF7A 1NKVA 3EVBA 3GJYA 4E2WA 3IHTA 5FQOA 4F86A 3UJDA 4RTPA 1NBIA 4GUAA 1G6Q1 2Y1XA 3RW9A 2GH1A 5EEGA 3HA7A 3PLAE 4DM3A 3CKKA 3P2KA 2IDJA 3FTDA 5LQUA 10MHA 5K05A 1YZ3A 3KQTA 4CXMA 4OA8A 3KHKA 4BLVA 3ANXA 5CVEA 4AZSA 1EAMA 2H1RA 5K0EA 3O4FA 5HILA 4PYKA 1YFJA 1X1BA 4FZVA 3TRKA 5EQJB 2E5WA 2PGXA 3LBFA 4X63A 4BLWA 1XVAA 1AQJA 4GOND 4C03A 5FWDA 4P7GA 4AX8A 2NNWB 3BWBA 3EVZA 3OU6A 5CCBA 2ZBRA 2A14A 4UOEA 4YUZA 4EMSA 2XVMA 3HCCA 3PFGA 5HIKA 4P7KA 4V0QA 5ICEA 4RVFA 4XUCA 5DWQA 2JG3A 3AY0A 1X1AA 4NECA 4R6WA 2ZFUA 1EG2A 4MIKA 2UYCA 3BXOA 1O9GA 3HCBA 4RTLA 1XCLA 1EIZA 3A26A 1L3IA 4H0NA 3P9IA 3EVDA 2ZBQA 2WK1A 2IIPA 4PYIA 4RYLA 1JQ3A 3SR4A 3DLCA 1RI5A 4GBED 5K0LA 5F2NA 2FCAA 3P9CA 3HVJA 2AOUB 5F2OA 5LQNA 1NW5A 3H2BA 1D2GA 1TPYA 2EG5A 5GM1A 3OZSA 5DM2A 3I64A 3G5LA 2WA1A 3LCUA 3LCCA 3M6XA 2I62A 3P97A 1VL5A 2PKWA 3OFJA 2IFTA 1I4WA 5C9ZA 4E31A 2C7QA 4E33A 2FPOA 4PNEA 2NP7A 4C08A 2AOXA 3DOUA 3P8ZA 3FPGA 2AOWA 2ZSUA 4WVLA 2HMYB 2P3QA 1XJ5A 3LDGA 3SXJA 4GOLD 1YFLA 1TW2A 2N47A 3ELWA 1X19A 5JUWA 1NW3A 5KVAA 2EFJA 2AN3A 1FP1D 2B3TA 3I53A 3PB3A 4HGYA 4P58A 3OZTA 3LKZA 3NMUF 2NP6A 4GF5A 3C3PA 3G5TA 3KR0A 3GGDA 4K6MA 3GDHA 3GO4A 5FA5A 4RTRA 1M0EA 3ERCA 2YXDA 1VP3A 3Q87B 4FP9A 1VP9A 2AOTA 2DPMA 4CKEA 3SSMA 4POOA 1Z3CA 2B25A 5IH3A 5KQSA 1RJEA 4ER5A 4KDRA 4RTSA 4PCAA 5DXAA 4PGHA 4PYOA 3HM2A 4IWNA 3JWGA 4MTLA 1JSZA 4EKIA 3FRIA 3E7PA 4KWCA 2NXJA 3A4TA 4OA5A 4Y2HA 5FULA 4C07A 2BM9A 3MHTA 3PFHA 5CVVA 1MJFA 4FSXA 2FYTA 2O57A 3MQ2A 5DSTA 3GRZA 5GOZA 2KW5A 4YV1A 1ZKDA 3M33A 2ZWVA 4XUEA 3G2OA 3JWHA 1EJ0A 3NJRA 2ERCA 4X1OA 2OY0A 3HVKA 5HFJA 3VC1A 1PRYA 3DXXA 2H11A 3G89A 3R3HA 3KR9A 5EVJA 5EMJA 4E70A 4EK9A 1RI4A 1G38A 5KQRA 2NYUA 1Y8CA 2XYRA 2LD4A 2YVLA 5G02A 1VE3A 2AOVA 4KDCA 5EEHA 5HZMA 4BP3A 2Z6QA 3EVEA 1QYRA 4ER6A 1WY7A 5E8RA 4FR0A 2PLWA 3FPHA 2ZW9A 2VDUE 1NV8A 2IPXA 1QAOA 3S68A 2QY6A 5EOVA 2ZLBA 4DMGA 3FUWA 3B3FA 2BH2A 5E1OA 2PXXA 1EQAA 5F2KA 5K01A 5DXJA 4JXJA 1L1EA 3PT9A 3GRYA 3V97A 3ER9A 2OO3A 4QDKA 3LKDA 3QV2A 3T7SA 5GIOE 2H00A 2IDKA 3CBGA 5U4XA 1IY9A 1KYWA 1L3BA 1NW6A 3HTXA 3FPEA 4EQZA 2FRXA 3BWYA 3HCDA 3KKZA 3VC2A 4YV2A 1KYZA 2I9KA 1NBHA 4RSRA 3TOSA 4ER3A 2IP2A 2PX8A 4BP1A 2HNKA 5HIJA 2PXAA 4PGGA 3T0IA 5LQRA 2ZTHA 2QRVB 5E8JA 3TLJA 3DMGA 3FPFA 1M6YA 2AS0A 2ZULA 3RODA 3T7TA 5K09A 3E8SA 1R74A 1RJGA 1F3LA 3EGIA 3R0QA 3DUWA 3GNLA 3NWBA 5EMMA 5H02A 3PS9A 3KR2A 4OBXA 4GC9A 2JH8A 2ZZNA 2G1PA 5E9WA 5EPEA 1QAQA 2AOUA 5EGSA 5FADA 1T43A 2OYRA 5E2BA 4FT4A 3K0BA 5K0BA 2P1DA 1KHHA 2OB1A 3JWIA 1NW7A 2JJQA 1RI1A 3LPMA 1NT2A 2EJTA 3LECA 2BR5A 3TR6A 1R6AA 3FTFA 3KPVA 5DPMA 5T6BA 3KQQA 2BM8A 3LDFA 4QPPA 5EIWA 3UJ7A 3A7EA 4YUVA 3EGVA 1ZQ9A 2ZIFA 3BGDA 2ZZKA 3EPPA 3NTVA 5E9QA 4RTQA 4F84A 2QE6A 1RI2A 5EKUA 2AVNA 2UYOA 5DM0A 2G8NA 3D2LA 3GRUA 4IV8A 2PJDA 2AN5A 2B9EA 4P7JA 3OFKA 4QPNA 4ZTBA 3SSNA 3UA4A 1R18A 2UZ4A 1G60A 2P7HA 5FWAA 5BW5A 3TM4A 5E1DA 3FTCA 3KR1A 3KPJA 3LGAA 5K0JA 3FPJA 3HA3A 5FTWA 1SQFA 2PSSA 3FYDA 3HA5A 4AZWA 2AVDA 4E32A 3C6KA 3HNRA 5ICFA 5K8VA 1P91A 3LBYA 3OU2A 2IGTA 2UYQA 3LSTA 3O7WA 5EC8A 1P1BA 1O54A 3KPYA 1ZHFA 2CMGA 2PWPA 5FHRA 4YUYA 3KQSA 3NWEA 1YZHA 3ELUA 2P7IA 3FRHA 4DCMA 5EHIA 4E30A 2UYHA 3ME5A 4PYMA 3MERA 5FQNA 1QAMA 1BKYA 1N7IA 3I9FA 2PX4A 3NVMB 3G7UA 2VS1A 5LQJA 3EVGA 1B42A 2VZ9A 3V8VA 4E2YA 1R00A 4KVZA 2AR0A 4Z2YA 1HMYA 3MCTA 3DXZA 4RTKA 3LCVB 1Q0TA 4R8RA 1SQGA 3M6VA 2OXTA 2FK8A 2VDVE 4RX1A 3G2PA 1EJ6A 3GWZA 3OU7A 1JG1A 2YUIA 4X41A 2G72A 3JWJA 3LHDA 3PX3A 1AV6A 1O9HA 3HP7A 4DA4A 2NXEA 3PTAA 2P8JA 1XDUA 4HH4A 4YUXA 5HOQA 3GRVA 5DTRA 1IM8A 3E05A 1KPGA 2OBFA 1ORIA 3BWMA 5EZQA 3OPNA 3P9NA 5C0OE 4BLUA 3B3GA 5K0FA 1ZGAA 4OBWA 4AZVA 1DCTA 4RWZA 2XBMA 5HEKA 2OKCA 5C1IA 1KPHA 4CKCA 4ISCA 1SKMA 3DULA 3C3YA 2ESRA 2PXCA 1I9GA 2XYVA 3C6MA 3ORHA 5CVJA 5LQAA 5T64A 4IKPA 5LSAA 1X1DA 5FCDA 5EIFA 3OE4A 3P9KA 3SSOA 5M5BA 2C7RA 3FTEA 3RIEA 2GA9A 3B3JA 3EMDA 1KP9A 2ZWAA 4PINA 3HVIA 1FJXA 3VSEA 4MHTA 3LX6A 3DTNA 9MHTA 5BW4A 4YMGA 2K4MA 4GOMD 2CL5A 3A25A 3M6UA 1JR4A 4Y30A 4QVKA 1FPQA 3CC8A 3EEYA 5EG5A 4RTOA 4MWZA 1YB2A 1ORHA 4HTFB 4LWPA 2QRVA 4HG2A 2NXNA 3THSA 3UJAA 3X0DA 2C7OA 2P35A 2YQZA 4CTKA 4QTTB 4O29A 1BOOA 4R05A 3SVZA 1XCJA 1JG3A 4GEKA 3WSTA 5K0NA 2P40A 4ER0A 2FHPA 2PT9A 3QOWA 3EVAA 3MAGA 3PX2A 4PIPA 5LR6A 2GAFA 2YX1A 5ICCA 4M7RA 4PCLA 4OQEA 4GC5A 4CKBA 3TMAA 2IBSA 2GPYA 3DP7A 3VYWA 3HEMA 5CVDA 3ID6C 3B5IA 3KQPA 4RVHA 1DL5A 1JSXA 3NW9A 2PT6A 5CUQA 2I6GA 3Q7EA 4KIGA 1BHJA 5DRTA 1BC5A 3FYCA 3M4XA 4QQKA 3TM5A 5FA8A 5P8WA 3TKAA 1I1NA 3GIWA 4M36A 2V7EA 5DX0A 1UWVA 1HNNA 4IV0A 1OR8A 4C06A 1L3CA 1NW8A 3DLIA 1R8YA 3G2QA 5EMKA 4U7PB 4FSDA 3B89A 3I5UA 4KW7A 4C05A 4YUWA 3U81A 2GS9A 3KQOA 2PWYA 3G8BA 2NXCA 2P3LA 2V74B 3EVFA 5HIMA 5T67A 1RI3A 3R6TA 3T7RA 4KIFA 4RTNA 5LQCA 4E2ZA 3SMQA 3TPZA 3DXYA 3MCZA 3P2EA 4HRAA 3BZBA 3GU3A 1JTFA 5KS2A 2O07A 5CIYA 2IH2A 2ONYA 3R24A 1DUSA 1R8XA 2G71A 3PVCA 4FT2A 4L7VA 4RTJA 1QZZA 3HCFA 1V39A 1YUBA 5D1NA 2G70A 3M6WA 5B1SA 2ZIGA 4PYJA 7MHTA 3HCEA 1G55A 2CKDA 3LDUA 2F8LA 3SGLA 2O0LA 2HWKA 5ERGB 2YXEA 4OX9Y 3MTIA 1U2ZA 1KXZA 3EMBA 1YF3A 4LECA 3SX0A 8MHTA 1PJZA 4RV9A 2IH5A 4X61A 5JR3A 1UIRA 3K6RA 2PY6A 3CCFA 4FS8A 1Q0SA 3BGVA 5DT2A 5EMLA 3KPWA 5DM1A 2JHPA 5FHQA 5D1HA 1IXKA 2VDWA 4EVIA 3C0KA 3MGGA 4DZRA 3FZGA 1KR5A 3UJ6A 4PYNA 2R3SA 4DF3A 3OZRA 5DTMA 3G8AA 2PBFA 3LL7A 2ZZMA 1JTEA 2CWWA 3P71T 2Q41A 4P7FA 3NDJA 3BGIA 2R6ZA 1N2XA 3KPUA 1VLMA 4PONA 5DRYA 4AZTA 3UFBA 1MHTA 2O05A 3KU1A 2P3OA 1WXXA 5CVUA 3UJ8A 1SVUA 1VBFA 2PX5A 2Y1WA 3ELYA 1G8SA 4LG1A 3DH0A 3NDIA 3UJBA 2FK7A 3KQMA 4DCGA 5E9JA 5LQKA 5CCXA 3EEOA 2GB4A 3BT7A 1H1DA 5GIPE 1WXWA 3AWIA 4WXHA 2P41A 3B7PA 3GCZA 4V0RA 3OCJA 2ZVJA 4M38A 4RVGA 3UA3A 3IV6A 4C04A 4CTJA 2BR3A 1VPTA 3AJDA 1ZG3A 4PYQA 4BY9E 4AUKA 5DX8A 2QM3A 4XCXA 5E2AA 2YXLA 3A7DA 4XUDA 5GP1A 2OPBA 4F85A 3TKYA 4X60A 3MB5A 4C4AA 1XTPA 2YTZA 1FBNA 4FGZA 4RTMA 2ADMA 2EX4A 3OE5A 5DLYA 2IH4A 1SG9A 1XXLA 5ICGA 3CJQA 1NE2A 1UFKA 3E23A 3MTEA 2Z6UA 3R9XB 4R8SA 1P1CA 1QANA 1RJDA 3BWCA 3M70A 4OQDA 4HTFA 5KYGA 4QVGA 4B17A 3P2IA 1WG8A 2JHAA 3EGEA 3G88A 5HIIA 1N7JA 2VP3A 3G2MA 5DX1A 4A6DA 5GWXA 2C7PA 4QTUB 2BR4A 2ZBPA 3DMHA 3SM3A 4YV0A 1KIAA 5BP7A 2O06A 1AQIA 3FUVA 2I7CA 5GM2A 4E2XA 3GXOA 4EKGA 2CMHA 2IBTA 4QQNA 2HV9A 2XVAA 3IYLW 3REOA 1SUSA 4G56A 5DM4A 4DQ0A 3THRA 4RVDA 2ZCJA 3CVOA 2YR0A 1P39A 3CGGA 5K03A 2PX2A 1NV9A 4HC4A 3CJRA 4U7TB 4YMHA 5MHTA 3UBTA 4R6XA 3FUTA 1SUIA 2QYOA 3DR5A 3KQVA 5K0GA 3ER8A 4ATNA 3KQWA 2Z6AA 3FUXA 3KQYA 2JHCA 3UZUA 1D2HA 3DMFA 5IKMA 1KPIA 4PYLA 5EZSA 4DKJA 3A27A 4GQBA 3HCAA 5K0CA 1F38A 1JQDA 2OZVA 2ZIEA 3AXTA 3IEIA 2DULA 5DTQA 5E1BA 1VIDA 1FP2A 3BUSA 2PVCA 3TQSA 1L9KA 5CD1A 5DSXA 2HTEA 3F4KA 4HGZA 3EVCA 4M37A 2BZGA 1ZGJA 2OB2A 1INLA 3GRRA 1D2CA 2ORED 4PIMA 1WS6A 2AZTA 2AOTB 3ELDA 1G8AA 3FUUA 5EHGA 1VQ1A 2PV0A 1X1CA 4LWOA 2AN4A 1JQEA 4GOOD 2B2CA 3O31A 1RJFA 2ONZA 3NVKI 4ER7A 3AXSA 1XDSA 2EJUA 3L8DA 3HVHA 1JG2A 5EKXA 2WA2A 4KRGA 3TFWA 2JH9A 5BXYA 2HR1A 3BKWA 2GLUA 5CM2Z 5E1MA 3BKXA 3CJTA 2B78A 4HSGA 4QDJA 4CWAA 5GINE 3UWPA 4A6EA 4PWYA 3UJ9A 1JG4A 4MQ4A 1WZNA 1XDZA 3QOXA 1M6EX 3UJCA 2XYQA 3I58A 1TW3A
chains in the Genus database with same CATH superfamily
3ZDQA 3JQBA 2AJDA 3OJXA 5FQOA 3AB7A 2P9ZA 3ZCUA 3QG5A 4QUAA 4B4VA 4HQLA 3L7KA 1SD2A 1S1CA 3AFNA 1G6OA 4DVGA 5F12A 1YZ3A 2GCOB 5GJBA 4JUBA 3OOYA 5JO9A 1P62B 4P4LA 1ZHOA 2VDRB 3ENKA 1T3TA 2WDPA 3CB2A 4UNQA 2YXPX 2KPOA 4CR7A 2EERA 3CR7A 1A2BA 4CKBB 1BX1A 1Q92A 4IDOA 3HADA 1H05A 4U2KA 4C03A 1R64A 1UP7A 1JBKA 1AN0A 2P5SA 4P7GA 4ASUA 1PNRA 4MEAA 1MDFA 1SU8A 3MJ4A 1G19A 4D3ZA 1I94B 2R44A 4M60A 3K9WA 4QNMA 4XQGA 1N5RA 4TX1A 1UPAA 1N6PA 1W5TA 2XVMA 3HCCA 4AKTA 4HLCA 3T9AA 1AA9A 1XAHA 2E18A 4LMRA 4N65A 3U39A 2IS4A 1NOJA 1T91A 5FL3A 3G0HA 2ZREA 3FBTA 4RK1A 4KMRA 3EXFA 3HE3A 3KV1A 1KVSA 4A16A 3EZLA 3R5SA 5AI0A 2ZK7A 3Q8LA 2FUNB 2HAEA 4DCJA 2PUTA 3H9BA 4RTLA 3L7DA 1I2MA 3P4YA 3SQNA 4NMWA 3WO1A 2VA8A 2IIPA 3M6MD 4AJNA 4EUNA 5GV7A 3V6LA 1JKJA 2BIFA 1GWNA 2VSNA 3UATA 5CB4F 3EXIB 5B3JA 2X0RA 1KJYA 4Q4JB 2VFAA 3E9CA 1ABBA 1TPYA 1MXFA 4BVBA 1F0YA 4TKUB 3BH7A 4ZARA 2H0AA 2ACWA 3UAVA 1Z0JA 5B55A 4OYLA 1SIWA 1B43A 2RC6A 3FOZA 1R5JA 1ZX1A 2B7CA 2DF8A 4HLDA 1U2EA 1NBWB 3KYDA 2DWQA 3Q3EA 5CDFE 4WKNA 3CVWA 1Y5IA 2IHTA 5CDTA 1NPDA 3MMSA 2AOWA 1JYFA 1PJSA 3EXG1 1VLHA 1XQ9A 1Z4MA 4OUKX 5TMDA 2VNAA 4EJFA 3PKZA 1XQVA 2AUNA 3OCZA 4K9NA 4PC7A 2DHRA 1CDDA 1OXVA 5LZ4A 4FK8A 1ZJZA 4N9WA 1ISGA 1Q21A 2D0OB 2QWXA 2W83A 2FN8A 1NW3A 4L5YA 1H9AA 5ED0A 4CLOB 5ESRA 2WKPA 4LF7B 3WKCA 1OIXA 2HSJA 1O0BA 3GO4A 4UDOA 3L7MA 1NYTA 2CEKA 3AF2A 2JHFA 1P2UA 1YD7A 2X0JA 3RRXA 1UKAA 1C2TA 2NVUB 1X9IA 1F7UA 4GX1A 4IOKA 5DIFA 4LXIA 3ETLA 4KYUA 3IILA 5KVSA 1ZBQA 2DCUA 2DLDA 2Z3ZA 4MJXA 4MUAA 1G38A 4Z7NB 5DNUA 1CS4C 4EO7A 5EJ5A 3CT4A 5L7TA 2CLOB 4F97A 4PF1A 3AR2A 4TT3A 4B2PA 2HCFA 1AC5A 2ZAGA 1EDBA 1Z3IX 2ZETA 1IBSA 3HUFA 3ILVA 4KXNA 4PY2A 4KQCA 2E4YA 3W8NA 2DVMA 2YW9A 4DY4A 1W9HA 4IQ0A 4EK9A 3LLCA 3NTXA 3II6X 1SC4A 4KOAA 2OFFA 5A9SA 4LTNA 1U2DA 5CW2A 3VNUA 1HE4A 2H2IA 5I9MA 1N4AA 2VLIA 3C87A 3ISJA 5ALKA 1Q1BA 3QLVA 4EO9A 1LBHA 4UPDA 1QIDA 1LFAA 3ANNA 3OMWA 3PCTA 3OC0A 4HN9A 1T4MA 4RA6B 1FNSA 4PZPA 2VJAA 1W93A 2O2XA 4WD3A 4WZAE 4XB2A 4BTVA 3DEKA 4V02A 2JDIA 2FUKA 3PA6A 1O8CA 5CG2A 4RK6A 1LZKA 5JNWA 4AQYB 1Z4QA 1EQAA 1U3FA 2PSEA 2X2FA 3CS3A 5C1OA 4KYTA 3V3TA 3V97A 3B1XA 4GECA 2NX2A 3TTYA 5C53B 1B4DA 1H6CA 5ARDA 3VR4H 5GIOE 1YMUA 2IDMA 1ENZA 1UC9A 5CEEA 1GQQA 3EOBI 2QI9F 4NU8X 2GPTA 3HTXA 3ZDAA 1TKRA 4MJLA 5HF8A 3I9OA 1Y7IA 3NHMA 4J2TA 3B1FA 1FPMA 1BCSA 2IP2A 3L0BA 3LLVA 4QXMA 1SIBE 5DLQC 2OXCA 2PXAA 1GU7A 1FTYA 5IJXA 2VNHA 2CHEA 3H5VA 1MC8A 3KRTA 4GZ6A 2JJ8A 4X3OA 5FBZA 4GR9A 4NXNB 3LPLA 1U7UA 1ZNYA 1Q3HA 2L17A 2REOA 1P7VA 2AK3A 3EXG2 4CG2A 1P74A 4Z4HA 1RHMA 1M1NB 2C2ZA 3GC6A 2NT4A 4OBXA 5DEIA 1PTJA 2I66A 1U28A 2EIXA 3H4VA 2G9ZA 1DOAA 1VYVA 4FFLA 2G6TA 3A2NA 3DAGA 1B8NA 3PX7A 2HADA 4FT4A 5DH9A 3K0BA 4L0DA 5K0BA 4TTVA 1NSTA 5A4FS 3FTFA 3LECA 1PW7A 4ZXFA 5JASA 5DE3A 4TLLB 4H3HB 1JHMA 2OCYC 2PGIA 1L7QA 1V16B 1D0SA 2VTBA 1P73A 4EJ2A 3K4PA 3KUCA 3R9XA 4QARA 5AQ1A 1TO2E 4Q9DA 5EKUA 4F91B 1N6OA 2HXSA 4ARZA 1GGHA 1N2GA 1W59A 1BAPA 2FWPA 4MV5A 3TLBA 5LQMA 4CQNA 3MUEA 4F9FA 1EXDA 2R7KA 3G2KA 2P7HA 3EVTA 4WJKB 5HJ2A 3TM4A 1E1KA 2PSDA 4RHFA 4UVDA 1YONA 5D5QA 2QTBA 1Y81A 2BL4A 1F6DA 1VGVA 4ENUA 1HKUA 1T0IA 2I2CA 2R6HA 5DHSA 2B6NA 3U7HB 1H2YA 4TKLA 5CH5A 2WF6A 3ZHSA 4EY4A 4YLEA 1PW5A 1CJBA 3UT5B 4XX0B 2BYTA 1RE1A 1KMIY 3CZPA 1FYXA 4G5OA 4N8EA 1T35A 3HSYA 4I5GA 1YZHA 2VKTA 3MJEA 1HQYE 1ZFNA 2XT6A 2W48A 1O97C 5DTIA 1FU8A 4IJ6A 1VMAA 2NPFA 1MJGM 3I61A 2PE5A 1L4NA 2NPIA 2OOSA 1OYWA 4YN3A 4ZT4A 3JZFA 4LZJA 1HEIA 1X3SA 4L4RA 2ZE6A 1ZGZA 2GPSA 2J08A 3K53A 3A2MA 4FDAA 4WADA 1CQIB 2W4IA 3TE6A 3UC9A 4D4KA 5HZGA 3GT0A 4ZIRB 5M29A 1L4EA 3MYRA 1VJGA 3M1YA 3G6WA 1EJ6A 3FOAA 4TMYA 5IAJA 5EYPB 4PZLA 3TUJC 1WUKS 1ID1A 1ISFA 2AMJA 3H9GA 1CDZA 1AIPA 2WJYA 4G67A 3ESZA 3IUEA 3ENZA 3O9ZA 1EWQA 3A1EA 4V0OA 4KV7A 4TYPA 1HQKA 2EZTA 1Z45A 1QVRA 4YP9A 1Q12A 1SKBA 5KWSA 3HJNA 5BWMA 3QK7A 4JENA 121PA 4H60A 1R3UA 4OBWA 1RM5A 1TCCA 2XWSA 2QN7A 3RK4A 1JDTA 1NBMA 2ERXA 3CLVA 2AJBA 2WP8J 1PSDA 4FIZA 5C1IA 4OHRA 4YRNA 3O6VA 2XYVA 3G1UA 1ETHA 5L3SB 3G82C 3L46A 2WNSA 1QHFA 3CKMA 3OVMA 3N59A 3UN1A 1ICEA 1XZJA 3T61A 1UJ6A 3L1IA 4KWEA 2ZWAA 4OQLA 3AW9A 3B9BA 1TQDA 2O0HA 4BE7B 2CN1A 3WJ7A 4MHTA 1NI4B 2R1TB 2K4MA 4IRMA 4EMTA 3EG9A 3KOUA 2PJRA 1XTKA 5DM60 1GY8A 4IVPA 3U4HA 4DDKA 3NKVA 2QLNA 4ZZ2A 4KPEC 3AR6A 3FWYA 1ZD1A 5JWHA 3K4HA 4REQA 3DZFA 5DN6A 2QD1A 3U13A 1V8OA 4WX2B 1KJIA 4R05A 2VJNA 4XGKA 5EE3A 1KS2A 3EUWA 4GEKA 3J81A 5K0NA 5JZBA 4OHCA 5DEOA 3WAGA 1JDJA 1SVIA 3WGQA 3KD3A 5EPUA 2DCMA 1G20B 4GC5A 4OQEA 1G5IA 4WSOA 3TEJA 3TW8A 5BYAA 2QS9A 3JW8A 4YXFA 3P26A 4RGVA 3ID6C 2C95A 3RJTA 2ACKA 1PL7A 3KQPA 1S2MA 5A4MS 2JAXA 1PT7A 2C5EA 3NW9A 3QW2A 4MQFB 4WRRA 1Q1AA 1K8YB 4GLFA 5DBFA 3CMCO 3M4XA 5JI3E 2VDOB 3R41A 3S5UA 1ZNQO 3COWA 1RYYA 2F64A 3GIWA 3COYA 2E4UA 2H4XA 3CEHA 1NJGA 2RGNA 4MLZA 3T35A 4CQMA 1QGUA 4KRYA 3I2GA 1T0PA 4DYVA 4DBLE 4POAA 1U0NA 1IY0A 4B1FA 1YK1A 4KW7A 1AHIA 2FSUA 3GEGA 2NXCA 2V74B 3HV0A 5ALYA 3VHXA 3OPYA 2YVKA 3KAJA 4E2ZA 5JALA 1NVEA 4ND8B 3IDOA 1E3DA 3R74A 4LZLA 4XYLA 5KS2A 4JC5A 1IN1A 1LA2A 2WKSA 4P32A 1H42A 3RYCB 1G64A 5FPQA 1WHTA 4HB3A 4BMPB 3G2IA 3BFXA 3BDAA 2Y1FA 3EXHB 1Z18A 2VBCA 4NZPA 1S2OA 4ZVLA 4B87A 2R0QC 4UREA 7MHTA 1G55A 2F43A 4HT3B 2IWRA 3IPAA 5KOHB 1KK0A 1Z4JA 2BBSA 3GEHA 2V1UA 1TFUA 4O25A 3JQGA 5AXBA 1ISHA 4LZZA 4W7SA 2BFFA 1TAGA 1YT5A 1QRUA 3ROEA 1QXSA 1I2BA 2Y05A 4HQRA 1KDPA 1RWBA 2AD1A 3TMYA 3I04M 1VSUA 1ZK0A 1OD6A 4WXYB 2KS6A 1QVVA 1X7HA 4AY6A 3PGLA 3ZCXA 4CMCA 2FWJA 3JSAA 4B6QA 1GG5A 1NPTO 3E3OA 3PQ4A 1Y3CE 3I37X 5KC8A 5DTMA 1ZUHA 1Z56C 3C5EA 1AB6A 2RMKA 4HDCA 5DNYB 2P6RA 3NZEA 1CQJB 2IUFA 1R12A 1DPFA 1KEZA 1SWVA 2JJYA 3WNZA 1FMJA 1I7DA 3PDIA 2JGJA 3JATB 2I1LA 2RFLA 4PONA 2Z5LA 3PQ2A 5H16A 2EOAA 5DF1A 5E6SA 5KJFA 4F0JA 3R5KA 2MYTA 3CF4A 4G25A 3DXFA 1WBJB 4P4TA 4EITA 2F3PA 2I67A 2CJWA 1PEAA 3HC7A 3RSGA 4MKGA 5LQKA 1GL6A 1MRNA 5ALNA 4BGUA 4DIUA 4YTEA 4YB8A 1H1DA 4ENVA 3DMPA 1P61B 1Y9AA 3GCZA 4NI5A 4UUBA 4R1TA 1USIA 2HJRA 3ZV4A 2JLQA 1BJRE 5DBOA 2M6KA 3ZCSA 2A7XA 1SBYA 2BTOA 2VCYA 3DC2A 1FFAA 2ZIXA 3JPWA 3DAHA 1NC3A 3ZVKA 1CYEA 4XUDA 4A3SA 4BFTA 1CEEA 1DMSA 2VPZA 2FUG1 2X9LA 2JVIA 2YVQA 1WUHS 4IL5A 1K3TA 3HDTA 1XTPA 3BMXA 4KFTA 3RTCA 4E5MA 3C3MA 5HQ3A 2EX4A 3E3LA 4BV3A 3G0IA 3CJQA 1MNQA 1NE2A 4I6EA 4NBNA 3MLEA 5HRCA 4FC7A 3WMWA 3FLBA 4BFLA 2QR5A 4IDAA 4IDCA 3DOJA 2B30A 2GK7A 1YE5A 4NYIR 2XCRB 4PX9A 2CT8A 4AO7A 3CN7A 3ZBUA 1ZZEA 4EMBA 2EEPA 4Q9KA 4NDAA 1Y6QA 3A9RA 1J49A 1KFJB 1V4VA 1FMTA 3FUVA 4L2IB 4O6VA 4EKGA 5K3SA 5F64A 2EV9A 5LNK1 2CLDX 3UV7A 3LZCA 4QXAA 1RTTA 1CKEA 2QQFA 5JQGA 3TFOA 4N6GA 3QYJA 1QP0A 4V0MA 3RHZA 2ZJOA 3WR5A 2JGAA 5KPJA 5IXJA 2W71A 2ZSJA 5CHYA 3QPBA 4MCAA 2GEUA 1CJVC 3CU5A 2AJCA 1N6KA 3ILHA 2DC1A 5IARA 1FYFA 1T34A 2XNKA 3U3DA 4QVIA 4CEHB 4PSKA 5AW9A 4QO7A 3C7KA 4WW0A 2QXTA 3LH5A 3MMPA 3W5CA 3WYFA 2VI5A 3OFVA 3A27A 1A9TA 2J3MA 4OGGA 4KWIA 3WLAA 1ZH0A 5J4YA 1BRTA 5CFOA 3RROA 3BUSA 3PR3A 4AMVA 1G6HA 5CD1A 1Z5ZA 3RVLA 5ABPA 5I48A 5KNBH 2FPGB 1NG1A 1OI3A 1X8KA 3HM9A 3S2SA 2WWHA 3L6UA 5BURA 3KKQA 4IAOA 2ZXUA 1R66A 1MTZA 3UAXA 2A1TS 4RVNA 4BZQA 3E1KA 4WIAA 1JFSA 1KGDA 3BHNA 4WA8A 4RM2A 2QRZA 4W1SA 3TCNA 1U8UA 2C9OA 2ID8A 5CB4B 4DCTA 3NVKI 5DK4A 1U5BA 5F5XA 5C51B 1T9AA 3LYUA 1NUAA 2PN1A 4LDRA 4Y9RA 2XZOA 2EJUA 1RZRD 2PRZA 2WA2A 3A37A 2JAQA 5K3FA 1XD2B 4TXHA 4OI1A 3K0HA 1D4AA 5AK5A 1DMRA 2GLUA 4JYMA 4PGFA 1RYEA 1XZIA 5HG0A 1ZIOA 4BFWA 4CM8A 1N6RA 3P0FA 1V47A 4RDIA 4GOXA 2Q2WA 3SBDA 1PEDA 2Z83A 3LQQA 3PGA1 1M6EX 1TJYA 5IBPA 5A0VA 1Y9JA 1EGMB 3FSGD 3N5CA 4CV3A 1DEXA 2XOXA 3PPVA 1F6WA 3EVBA 2O7QA 4G0QA 2ID9A 4IZIA 3EFOA 2FSFA 4F86A 4BATA 4NCHA 3TSAA 1QLJA 5J63A 3MBOA 2YHAA 3K0KA 1MVOA 1OZ0A 1I4OA 1NR7A 4GUAA 3SC2A 3TQHA 2QMHA 1J5EB 3CLTD 3PR2B 4O59O 4L0QA 1XQXA 5JHGB 4W1QA 5K05A 2MJLA 3ZDEA 1GPAA 3IODA 3R5JA 4PIVA 2W6ZA 2WFMA 4B46A 5HILA 3R7SA 1KHTA 3I1YA 1BO6A 2H0RA 3HL4A 5CLHA 3TRKA 4YP7A 4AJEA 4EDHA 5BWOA 3LFUA 1ISRA 5HRUA 4QG3A 1VJ1A 2HMVA 3BRQA 3PC8C 4RNDB 5DHPA 1P44A 2ACVA 2NU8B 1FW6A 2C1EA 1MAUA 2IF2A 2NZ2A 2FGKA 2WM3A 3HKBB 1JNXX 3HUTA 3K1ZA 2HA4A 3NO4A 2FXIA 3ZD8A 1WDLA 2ALJA 1YRAA 1V71A 3VR4A 4JBLA 4EW1A 2HIAA 1JEAA 1H3EA 3IFSA 5DSZA 1YMQA 2O1EA 2ONCA 2ZKLA 3O9MA 4M0KA 4B6PA 1IFXA 1IJEA 1GEEA 1KZ6A 3KT3A 2ZUWA 2I3GA 1P4GA 1GPMA 3FCEA 1ZJJA 1SEPA 2PLFA 4XWOA 2NYAA 4UD6A 1RI5A 3WRXA 5ALIA 3A6EA 1HT3A 3L93A 3P9CA 5AVYA 1OAKA 3OTWA 4HNUA 2IV3A 1KO8A 2PZBA 4UMFA 4B5KA 1ML4A 2WLTA 5IAAA 5LOVA 4WK2B 3L4JA 2FG5A 3O8BA 3WIDA 1KJ9A 2XWJI 4G84A 4P53A 1BIFA 1GPKA 3QFTA 3LCCA 4G0VA 1JI0A 3TKLA 1GZ7A 1BTOA 5EA2A 4EF4A 5F23A 1GO2A 1QH1B 3HO6A 2Q3DA 1JJAA 3PQ3A 2WE8A 3FZEA 3B51X 3OBBA 1XF1A 3MD0A 5CNMA 4XQ0A 3OAAD 2CXSA 1IXZA 1KI7A 3R2JA 3QNWA 1GCOA 4J2HA 5JLAA 1IHOA 2VPQA 4AZ3B 4EJSC 1BS1A 2J3QA 3MC1A 1VHDA 2X76A 4JR1A 4HH3C 2JJ1D 1TW2A 1DWOA 3PCXA 5AW2A 1OVMA 3PD0A 1OXTA 1CV2A 1E5TA 3HKDB 3OJOA 1VOTA 2GYUA 2IYZA 1SVKA 3SFZA 2XIQA 3DBRB 1N0UA 3DJYA 2Y1OA 5KCMA 2AMVA 3SOZA 1EH5A 5KTKA 4RTRA 1GUYA 3DBLB 3M5DA 2JL1A 1X7XB 5KREA 4ZVVA 3WLQA 1R37A 3QX8A 5K2OA 1B93A 1HEUA 1Q44A 1WXQA 2A9FA 1NVTA 3E18A 4KBGA 4A0FA 3V8EA 4CL8A 4KDRA 3BILA 1Y6RA 4HWSA 2P1RA 4NCJA 1I5OA 1MO5A 2XUJA 4M6WB 4QYIB 4BO5A 4BS9A 4DA8A 5A3JA 4HWPA 3L0PA 1L5GB 5B6PA 2GRJA 3PPXA 3NM4A 3DL0A 3HFJA 2UVDA 5E4JA 3THXA 4OA5A 1HOXA 1NW4A 1U7OA 2QGNA 4LOIA 4QFDA 3IOEA 1YNSA 2G1UA 4IBOA 4EJ0A 3BDVA 1C1DA 1QBGA 1YNOA 1DKQA 3N2YA 4QBIA 4D9HA 5BNWA 5AHXA 4YLGA 3KVVA 5DMHA 3FHTA 2H63A 2JFWA 1WEKA 4P3KA 2GVDC 2XW6A 1W581 3PNPA 3THYB 3HVKA 5KDDA 1GAXA 2FETA 2PAAA 1TYBE 2GZDA 2W00A 3BJEA 1SHKA 3I39X 1RI4A 5KQRA 1CUZA 1USUA 3MINA 1C9JA 3PWKA 3WLNA 1IPHA 1F4VA 1E20A 2P91A 1N8SA 1PLLA 1W2GA 4RKFA 4D4IA 2BPOA 1JDBC 2NPOA 4DQKA 1FQWA 2Z30A 4XOIA 1UOEA 2XCOA 3O4VA 3QHAA 1E3QA 4EI8A 2IL1A 3EAQA 1LJUA 3RVPA 1XTSA 2HU7A 3EZGA 4BVFA 1BE8A 5AUPB 5KOYA 3TUZC 5K20A 2OESA 2O3SA 3NOXA 3T15A 2Z5VA 3HXTA 4Q4LA 5CXQA 1O94A 2NT3A 2BRUC 1L8AA 2GAIA 2X86A 4KXXA 5B1IA 1E4EA 3Q3CA 3RS5A 3QU2A 3T7SA 2OV1A 4URUR 1MJHA 1N7GA 5ETJA 2CJPA 1XXHE 2DBVO 2ZUSA 3PICA 5FRDA 2J5BA 1TLFA 4FCTA 3WK4A 3ZDCA 4ZANA 1Y3BE 2OSVA 2XLCA 2Y1EA 2P9TA 4WZAB 5BOVA 2ZPAA 4WPGA 4DCSA 2BSXA 1YC2A 2ZGVA 4B9EA 4L9SA 1OFIA 3TG8A 3CUUA 1ZOOA 5LQRA 2QENA 4M99A 2EXXA 2XCTB 4OOFA 5AOCA 2R11A 3A4VA 5BN3B 2I2XB 1GITA 1F3LA 2L18A 3K15A 3UW3A 2EBFX 2H6EA 2EGUA 1JSCA 3K0FA 1KMCA 2VG8A 4DRZA 1XJWA 3VMMA 5BUQA 1DELA 1XEWX 3SJ7A 1B0ZA 1XF9A 2XCUA 4BEVA 4Q4AA 3LBAA 3LY9A 1N9GB 4KODA 4NBTA 5FADA 4C6HA 1P7CA 2C03A 5H7XA 3W9UA 1CZKA 1P80A 3BTUA 4KMSA 4EG4A 1JZQA 2CVFA 1EVYA 1T2VA 1ZIXA 4YFYA 4NMLA 2YC4C 1O5OA 1WCXA 2QX9A 1A1VA 2H2WA 3VRHA 2QMYA 3LHSA 3MZ0A 4TUYA 4LHZA 4ZC8A 1LK5A 2WJGA 5FDFA 5TSDA 5L3QB 3M4ZA 4G81A 4E03A 1EFTA 1JWAB 1OYVA 1V5FA 2G8NA 3IR5A 4RPLA 2GZAA 5BW6B 4BJ1A 2JAPA 3H11B 1PK8A 2AN5A 4NFSA 3H75A 3K09C 3SSNA 3V80A 3WLHA 3ZU2A 3T3IA 1OC4A 4HNHA 2R79A 4LPSA 4TWRA 4D92A 1VSBA 5E1DA 1PJRA 3KPJA 3HA3A 4KLZA 3VH2A 3ZWYA 4B74A 3EEQA 2CXPA 2P4QA 4E09A 2NYRA 3KE8A 1P4SA 3EHDA 1CVRA 1CTQA 4BFYA 1XA0A 4KK4A 3H3XA 1U9ZA 1OWNA 1MB3A 4R98A 2Q07A 3R6WA 3H5RA 4LF6B 1NBOA 3UTDA 4BO6A 3OQIB 5EJEA 1SZDA 4TMTA 2ODEA 2DHCA 3B20A 4H3SA 3NHWA 4UUQA 4WFJA 2HC9A 2WUVA 1KL7A 4HQNA 3NVMB 2D5LA 2PQ2A 4DDMA 3EVGA 2AWOA 5F7OA 1K6IA 1R00A 2ZB7A 2UZ1B 1A4UA 4RVCA 4YBRA 4EATA 1QYXA 1J2JA 3OIWA 3RS3A 3E03A 1VMDA 5KTYA 3M6VA 4UUAA 2ZRJA 5GONA 4C89A 5K6RA 3U7QA 4Q3NA 5LU8A 2G04A 3BE5A 1U90A 1T5BA 3C1OA 1FUYB 4PTYA 1WPQA 4DRXA 1MF7A 4ZOCA 1BHSA 4OXXA 4WI1A 4JBHA 4FJ0A 4HH4A 5HOQA 4BZXA 3DMYA 3FGOA 3GOQA 4Q3LA 1CRPA 1QYIA 4EFMA 2EWVA 1VYTA 2H8GA 3P0JA 2BFDB 2VQFB 5LVAA 2FSIA 2DM6A 4DBZA 1DJNA 1U99A 5AIBA 1ZMTA 3THOA 4OXNA 1PYDA 1V8ZA 1VC2A 3CR3C 2C2WA 1NMQA 2H2FA 2A4KA 3S2UA 4I5FA 4IJVA 4B44A 2RONA 5EIAA 1UBFA 4AK9A 1DXYA 5JS7A 1G3UA 1WDKA 4IMJB 3MVEA 3FH0A 3SSOA 4EY7A 4HKTA 7ADHA 3NHKA 5ALTA 5DMXA 2Q9AA 1OX6A 3HV2A 2V9ZA 1UDXA 1FJXA 3AEUA 1G5FA 4FEAA 1J7KA 4G1VA 3K70C 1WB4A 4KMMA 4NJMA 4Y30A 1M1ZA 3K6SA 2JGRA 1PR2A 3T12A 2QBYA 4MYRA 4MWZA 2I1QA 1EB9A 1KVTA 2IF0A 2HF8A 1SOAA 2VAVA 4R16A 4EHDA 1U2SA 4BRUA 1KJ8A 4EZEA 2HBQA 3I52A 2Q8PA 4HG2A 1T5OA 3THSA 4ND4A 2ZI5A 3DDOA 1QUEA 3IX7A 3LDAA 1VHQA 4OK5A 1OXMA 4O29A 4CI0B 2GN1A 3GJ0A 4O4JA 1SCBA 1UFOA 3IUBA 5JYBA 2RHCA 4QOGA 2ORWA 2B1RA 2V55B 1GR1A 4RD0A 4WCFC 4XVHA 5JO0A 4GPAA 2B1IA 4FGWA 4JBIA 4KLAA 2FP4B 2QTFA 5K5EA 5J2UA 3V6MA 3I0MA 1VE1A 1F51E 3ZU4A 4FM9A 3H8JA 1NJ1A 2TECE 5A02A 2PJUA 2R9VA 2JIZA 2BGUA 2O2ZA 4RVHA 3L07A 1XFAA 2HX1A 3AFMA 3FDZA 1EFVA 1FYVA 3I1JA 3QKTA 3R8CA 4G63A 3CVYA 5JC8A 3D2CA 5AKGA 3TKAA 4UCQA 4RPHA 3FW1A 4ZTZB 2XF2A 1SQSA 1M1YE 3Q40A 4JLPA 5EUMA 4K05A 1UWVA 5H3CA 4IV0A 1NVKA 2WD7A 4YJ2F 1E0KA 4GVXA 3TNFA 4Y1EA 1R0SA 4B43A 4CV2A 13PKA 3N2GB 2Y76A 3QE4A 2A58A 3COVA 3C43A 4H7FA 5IT9A 3ZEAA 2ZCJA 2XE6A 3R6TA 3KQKA 4CV1A 2QTLA 2YQ4A 1Z7EA 5BVGB 4JP3A 3PXXA 3ISTA 5CBPA 4RPCA 2Z08A 3DCIA 4AMYA 4CIWA 1OHHD 3QEMA 3QBDA 3NV7A 1XTRA 4HGRA 4EHNA 2GCIA 3CX7A 1J2YA 1E2JA 1U8ZA 4L7VA 1CNEA 3C5CA 4UQOA 2EWMA 4IHQA 4OKIA 4ZJYA 1G8FA 1LBQA 4URYR 2BFCB 4DMCA 5KNBA 1OLXB 1NIJA 2ILVA 2VEDA 1QIIA 1P9NA 4GT1A 3GH1A 4LVOA 4MI9A 4TTSA 1GUZA 2B98A 1E3JA 4GS5A 4RZ3A 1N34B 1YIAA 2A8YA 4O2AF 1GPDG 3USES 2G9NA 4D9NA 2GCGA 2OSBA 1AQLA 2XKJE 4QT0A 1SKAA 2JANA 2NO0A 1WP4A 3KP1A 4X61A 3IDSA 3CCFA 3DTVA 2AXQA 2FGJA 1OC2A 2P0EA 3F3YA 5B6JA 1SUBA 4DC0A 3LPAA 2XYPA 5D1HA 1S2IA 3W6OA 3JQBC 3E8MA 1M6VB 5J2TA 1V96A 3FNGA 3R0ZA 3U3JA 3STVA 4ENPA 4URVR 3GPBA 4KQGA 2FQYA 3FZQA 1TA9A 2QUAA 1T3HA 1YR2A 1E1QD 3D31A 3QYFA 1M34A 1L7OA 3M6FA 2P3OA 1WXXA 1NVDA 1YZYA 2G80A 1RYDA 3IR7A 5HMLA 3DFZA 3NDIA 3RYHB 1Q15A 2HA2A 3P32A 1XL1A 2WSSD 1OOEA 5AVRA 4ZOQI 4DDTA 1H0RA 3FVQA 2P2NA 1YFZA 4ZYXA 3LWBA 1V9SA 2BEJA 5LL6P 1VPTA 1PS8A 4PYQA 1QF6A 3VJMA 5JWOA 3H9QA 3W8EA 2VHXA 4XCXA 1OX5A 5E2AA 3MQFA 4UHFA 2IA5A 3D43A 1K63A 2FZKA 1NX6A 3NTOA 2JASA 3ED1A 3W2GA 3X1XA 1WF6A 4B6OA 9LDBA 3ZCTA 4IXTA 4B7XA 1WDMA 2YV4A 2IQIA 1XZAA 1KSFX 2V6JA 3VPHA 1W36D 3BCUA 2L69A 5F1KA 5EJMA 1GQYA 5JW6A 5FO0A 3H86A 4PAQA 1JZSA 2X4DA 2AF4C 4N3GA 2LCQA 4FN5A 1SAYA 2D06A 2ID7A 4M9UA 4LNUA 1PUJA 1J4AA 1VPLA 1BMFD 1W49A 2EP7A 3ZZ0A 1P1HA 4D4HA 4DCNA 4GXRA 4KHPB 2Q3JA 1X7WB 5BP7A 5KZMB 3LCJA 1GVNB 2I7CA 2TMKA 3GXOA 3PRJA 4J90A 1NJ2A 4K7JA 3LRTA 5EP2A 1LWOA 1LQUA 3IYLW 3LS2A 3BFVA 1SUSA 1EP1B 2FA9A 3Q98A 3VOTA 2CUZA 5DNEA 4B73A 2ZE5A 4U8HA 4JLOA 5DM4A 4JOSA 2VATA 1FRZA 1TT5B 2R00A 1BE1A 2XNJA 3I92A 3MCVA 5EXSA 5TE9A 4DMFA 3QE9Y 4GPZA 4GXQA 1OGJA 1BU8A 4UDNA 3S27A 4I55A 2RARA 1NUQA 4KZKA 3UG7A 4XQCA 3W77A 4F9EA 4HPJB 3ND5A 4OXKA 1EYZA 3S2EA 2JHCA 4BNMA 4DIOA 1ETUA 3VKUA 3ESDA 4P80A 5H4GA 3BRWA 3V1MA 4F4FA 4ICIA 4QAQA 1NXSA 4JLVA 5IS2A 4A8JB 3MJDA 4FI3F 2V03A 2VYVA 2OAGA 4BCDA 5IU6A 1DFHA 2I5PO 1NSFA 1SKQA 1KZ7B 4LOLA 3V34A 2JFUA 3HNOA 2HTEA 3G13A 4AIIA 1SUCA 3DE7X 1Y4UA 4Y98A 1ZISA 4S1TA 1KDTA 5I7AA 3AR3A 3U1TA 3W9SA 1EVZA 1W4BA 4ZCPA 3QENA 4AF6A 3NBMA 1BXRA 5TQVA 3WX0A 1E8MA 1NNUA 1C3JA 2FWNA 1QFYA 1PKEA 3BMQA 3CQ9A 3G2NA 4L57A 3FPAA 4LOJA 4X97A 4YS6A 2Q2VA 3IMFA 1X1CA 2AQIA 7MDHA 2AN4A 3OURA 3F73A 3IBYA 2GKOA 3LOUA 3OICA 4XRRA 4DA7A 2WM8A 4P8RA 1RXYA 1PU2A 2UVPA 1F4LA 4UPVA 2JFNA 4ER7A 1XDSA 3MILA 4COOA 1YJBA 5CU7A 5HF5A 4KVAA 2C7VA 2PUCA 1R5OA 2AEMA 2ECFA 4PG7A 3ABSB 4QJIA 5DXFA 1PAUA 3CNNA 5AW5A 4KFCA 2J3LA 2QAJA 1ZI8A 1XMXA 5FTNA 2DQSA 4URWR 4JVSB 4DIEA 4CETA 4KRFA 1FP4B 1X14A 2MIIA 4FKBA 3QNUA 4LF5B 2GAOA 2Q6LA 3JAWB 3PNMA 4U8GA 4ARBA 5JYEA 5KDLA 4AJIA 2IP4A 1MRZA 3DEYX 3BHMA 1ZH8A 4R8MA 4AJPA 4MRSA 5JISA 1VTKA 3QLVC 3GXBA 3QVTA 3LHKA 1YIDA 2VDQB 3IHTA 1SKUA 3TLAA 4FOLA 2VJYA 5A7FA 4CM6A 5KTRA 2GD1O 2O7NA 4ND5A 4C7VA 3HA7A 2CZQA 4HQOA 5ANRB 1E2MA 1T1IA 2CLKB 1ZONA 5CFQA 2X4IA 5B7PA 1N5DA 3GFVA 1P7PA 1CCWA 1K8QA 3VZDA 4C3OB 4PN7A 2ZSEA 1W6UA 4MIYA 1H85A 5JVDF 2ZM6B 1UM9A 4KHZA 1Y33E 2QV7A 4ON9A 4QDZA 1NY6A 1FUEA 5JY6A 5FWDA 2OZKA 4H1UA 2XXJA 1G7TA 3PHBE 3ECAA 3QKSB 3IKLA 4XJXA 4FYPA 2IYTA 4GQIA 1YZNA 1N0WA 4Q3KA 3GIDA 1CDOA 2ZU0C 3NHAA 3AY0A 3WDKA 1BH2A 1FFWA 4KSYA 4E1VA 4X7BA 4YJFB 3RREA 1JJFA 1O6BA 4F4UA 3COSA 4KSBA 1U28C 1T6XA 1L3IA 4KR0A 3P9IA 4NV3A 2ZBQA 4KFRA 4CU5A 3R0JA 2WLSA 5SZIA 4BE4A 1VG8A 3CF6R 4R1OA 4QOJA 4KR2A 4IG9A 2AOUB 4EW6A 1DDIA 2FF5A 4L9WA 1HR0B 1S96A 1L1QA 1Z6ZA 3I64A 1RPAA 3LLMA 6Q21A 2FPWA 2PKQO 2Y4OA 2PGDA 2VEOA 4UHEA 3EK2A 4BO1A 3I72A 3LP5A 1YDFA 2Z5FA 1RMYA 5E6UA 4OP3A 1JBQA 2ZR7A 2ZS8A 2P8SA 2ZUFA 3P8ZA 4MW5A 2GRAA 1GIAA 1WDTA 4FBLA 4G4JA 3N2LA 1SJ9A 4AWXA 1B2RA 3QEBZ 2P3QA 4K3VA 4OCZA 4LQDA 2QVLA 4AY3A 1NVUQ 1R8QA 3DWGA 1IB0A 3X1KA 5KVAA 2XGMA 3PHLA 4X3PA 3HFSA 1DZIA 2CZGA 2GYVA 4G4SO 3GDHA 3LUCA 4EF6A 3LUHA 3K9QO 4M49A 5CDGA 2NQ8A 4AUEA 3MM4A 4G4IA 4U7GA 1UM8A 1JHRA 3AJRA 2PYIA 3CRZA 1XPOA 3JWGA 3GZNA 1JSZA 4X7MA 2Q9UA 4HDMB 5A3QA 3A4TA 2ZIZA 2BEVB 3QJGA 3QUAA 1UWKA 3VJKA 5JAPA 3MHTA 4NZ9A 4YMUA 3L9XA 1RYFA 4UMEA 3TSZA 5I5EA 2VR1A 1MXHA 2BEWB 4QT4A 1AXGA 3CX6A 4K5QA 1SZJG 4HVLA 3H8VA 4ZOLF 3IQXA 2CEAA 1FYEA 1XEAA 1Z17A 2XT0A 2DBZA 3B78A 4G0NA 4JQZA 4JX8A 4L5CA 2IOFK 2VT6A 1Y37A 2FLWA 5K3BA 1UWCA 4L08A 3UJHA 4YRFA 2ORYA 1QIHA 2YVLA 1T0UA 3EJ6A 2J32A 3KKKA 3EG5A 5EI5A 4BP3A 2Z6QA 5J5CA 1PR4A 3EY4A 4G5SA 2PZKA 3RS0A 4IFBA 2O4UX 2PRKA 4MR8A 2HHCA 3VR5H 3GLIA 3A58B 1JIXA 2H1IA 3WZLA 1O58A 4B32A 1ODKA 2OG2A 3D7LA 1SBHA 4X94A 5B58C 2JAWA 2QY6A 5CX1A 5D85A 4LOKA 4QPZA 4B6EA 2FQWA 4KTVE 1IEVA 2XVZA 5LP6F 4TRJA 2V7XA 2C2YA 3FKJA 4NE7A 3R76A 2GBFA 5J4LA 2XEXA 3AJ9A 5KHLB 2XVYA 5JATA 4P4SA 4WEQA 1KEEA 5TMEA 3COPA 2PMDA 3OEEA 2VO1A 3KS9A 2QL7A 2XSZA 4H2DA 3RK0A 5EZYB 2QU8A 3HJCA 1E5DA 1NTRA 2CDCA 3FCXA 1VBNA 2EGHA 2GZHA 4N6NA 1WMSA 1Z5OA 4IZOA 4D79A 3MTAA 2HQSA 3I5MA 4DA9A 2IZ6A 2CV1A 4B2IA 3WY9A 1M6YA 3SNHA 1L4BA 2XIJA 5M04A 2J09A 4FBMA 4RKYA 4YRDA 1RJGA 1GN8A 3R0QA 1FUKA 1THZA 3KT0A 1X6VA 1XIVA 2P9GA 3B1YA 1LV8A 2YFYA 4UNPA 4Y7CA 1PNVA 5E38A 5H02A 3SX4A 4F38A 3DKVA 1M2NA 1MGPA 2WJ4A 1ZBDA 3CLSC 4QEDA 4C4ZA 5AQEA 3I9JA 1FFSA 1LPSA 2H59A 1YRWA 1E9EA 2EDCA 1QV9A 3PC6A 5KX5A 2QGZA 3K0EA 1PD1A 3ZGYA 1U0EA 2IPNA 1OLSB 4NK4A 4DWOA 4QICA 1X7GA 3ZI0A 3ZD6A 1RRPA 3HXOA 1XTUA 2RGNC 3OCWA 3GP5A 4J0IA 1II8A 2H1LA 2OZLB 2ZIFA 3BE8A 4BWYA 4C2UA 2IZZA 2RKBA 2QORA 4V3CA 1IN4A 3T7KA 1K88A 2FQXA 3GG2A 1XK6A 2AVNA 1YQDA 3D2LA 2CL7X 3GRUA 4Z2AA 3OJCA 4ZTBA 4P7JA 4YNBA 1XNJA 3M1IA 4I9NA 2UZ4A 1MB0A 5SYMA 4TKVA 1QJCA 5U1PA 1QLHA 1UMDA 2HUPA 3EYAA 5TARA 3N2NA 3UMRA 2ZOSA 2X8AA 4LJLA 1J7JA 4AZWA 3HZOA 5ICSA 3C8ZA 1NQAO 1PT5A 3CONA 1A9ZA 2Q3LA 4WE3A 4RD6A 1T2EA 2NZYA 5LWQA 2PX3A 2PA0A 2H57A 4K6KA 4D0GA 1Z2OX 4FKMA 4P9NA 3HCWA 3Q3GE 5E0OA 1SUPA 1MORA 2JVJA 1KE2A 3GL9A 4BNKA 3ICCA 4KUHA 4O8ZA 4QLAA 5LMUB 1OMOA 3MTBA 1BX3A 4WBNA 2F4VB 4DB2A 5KNCH 3G7UA 3RWMB 3IAUA 3B13B 5FBKA 3V8VA 4C0AC 5C5CA 3RU7A 4I4IA 1YOVB 3KQLA 4LBYA 4F6RB 3ENNA 3TSWA 4WKCA 2HOQA 3NBAA 3WWOA 2NO1A 5C7LO 4XGQA 4LRQA 4UFOA 1SB8A 3H13A 2O54A 2PM8A 3MTDA 4Z7JA 5KYUB 1KI6B 1NDUA 3D6TB 3IVRA 3ZCQA 4ZHQA 1KQFA 4YJ2B 4DABA 4OXRA 4XFJA 3FETA 4MV0A 4EKYA 2EKPA 1E3WA 1D7AA 1TFRA 5SY9A 1J39A 1UT5A 2QPLA 3N39C 4M86A 4RZIA 3H5WA 5AUOB 2BSQA 3VC7A 5F7XA 2OBFA 4H7HA 4KH0A 3K31A 3AT1A 4KC0A 5LC1A 1O95D 5BN5B 4U02A 3GNSA 1KRHA 3ZY2A 4D74A 1UBCA 4PZ0A 5L3ZA 1DCTA 2FR0A 5HEKA 3ZZMA 3H42B 4ID9A 4MB0A 1PL6A 3GZ4A 4UTNA 2OK7A 2R8XA 4JELA 2ZSIA 2XRFA 2ABWA 4JQOA 4KO4S 1GT6A 5DCLA 1CUXA 2O7SA 4NOMA 3FWZA 4RLSA 4XIIA 4GDFA 2I78A 2JAOA 2ZJ6A 3OQ1A 4LDNA 1UJ5A 2XA2A 1X1DA 4NEQA 3IQIX 1P6UA 4O2AB 3K0AB 3QYAA 2C7GA 1T0JB 1U2PA 3HXMA 4H7KA 3KEMA 3L8YA 3OZIA 3D6VA 2CNWD 3ELBA 2AE2A 2GM5A 2OWEA 2W2XA 3ZG6A 5HS4A 3BTSA 3CC8A 1D4FA 4LZOA 3DOHA 2JCSA 1XL0A 2CY0A 5F35A 4I81A 3IQZA 4IQ4A 3TECE 4BB5A 2O8VA 4D44A 2FY8A 3OZVA 1KDYA 2P35A 4LWQA 3TFQA 4NCBA 4QTTB 2HHAA 1EZZA 1TJ3A 2AI2A 3W0LB 1PYOA 1HL7A 2R1VA 3TQFA 3WKDA 2AKAB 1QUFA 2J5RA 5KHOC 1CR2A 2XZDA 4UUPA 3U1VA 5I4IA 5IVPA 3B6JA 1LPNA 1DJOA 4H35A 4BMNA 4BN4A 3AZQA 4TSFA 3NONA 2YWXA 3CXRA 3HEMA 1UIMA 3PRKE 4KDFA 4GDMA 4ZCSA 2CBXA 3WKEA 3FIJA 3PTZA 2FJPA 4H7PA 4ZU1X 1PGPA 1WF3A 3GLFE 1XJQA 2EF0A 3FYCA 1LLQA 1U1DA 5TRTA 4NNPA 5AK6A 4A7PA 1NF3A 4EBFA 1JIUA 3BMNA 4ZPXA 2FFAA 1UANA 3CLKA 3G17A 4MWSA 4N7RA 5AJZA 1PBNA 3AP2A 4QOFA 2HLPA 3LZ6A 3R44A 3ZVRA 1DO2A 4JVOA 2HJHA 4QFBA 3AR5A 4E21A 1P77A 5TNXA 7ABPA 2GM3A 2Q6TA 4I1IA 2C9DA 4KAAA 3TZKA 2VUSA 3D3WB 4BGVA 1QONA 4BASA 1OH7A 4YYEA 1NQWA 3U60B 4NABA 5KYVA 3R5HA 4A0RA 1AUVA 1RLOA 2XTZA 3O8QA 3R24A 4HRXA 3DE6X 2YIDA 5NULA 1KVQA 4Q7MB 1FYDA 2G6BA 1YE3A 4Q16A 3WV4A 3WMEA 2ZIGA 4L15A 3W3ZB 3MUFA 4D46A 2AIRA 2HNAA 2QTVB 3CLRD 2A0UA 2I22A 4BNGA 3QOFA 3WK5A 1OA0A 1QQTA 1KBZA 5ARBA 2ZRAA 1DEOA 1X8LA 3GA5A 3A6KA 3VBCA 1SVLA 3RSOA 3VUEA 1C1YA 8MHTA 4EGCB 1ULZA 2A9OA 2D54A 4KSCA 4ZOBA 1JHUA 5C5IA 3RIYA 2BUCA 3NEPX 2VRBA 4LXUA 4O1MA 4IDBA 2GJKA 3AM5A 4CF6A 4YJ3B 2KLBA 2OFPA 1KI1A 1HFJA 2WF9A 2L2QA 4OHWA 1GGNA 1KR5A 3HFGA 3NEJA 3QMVA 4OXIA 2A0FA 2V6FA 3NEYA 4JJAA 3U3XA 1RKVA 4CDGA 1QFSA 3G02A 2JCXA 1U8AA 4FDLA 3ZK9A 2NNLD 3P71T 1PHRA 3NIBA 3D3EA 3GFTA 3THXB 2BGGA 4X8LA 2HU8A 4TN5A 3V2UA 3ZBTA 5CVUA 4BMVA 4HDKA 3PJDA 1AHPA 4Y2VA 3WL8A 3I1FA 4KR3A 4ACAA 2ZJBA 4GMDA 1GGFA 4ZYUA 4FOTA 5AK0A 4RVSA 3JVIA 2VYND 1E1LA 4N0MA 4KUGA 3RVJA 3SKYA 1ZVMA 2PS0A 5EPOA 3WA6A 3IURA 5J59A 4DT1A 2XMZA 3IBCA 3CO5A 2IY9A 3TXYA 3F49S 1ZLYA 3NHPA 1RHRA 4Z4CA 3ZS8A 4WK0B 4FFDA 4M54A 4PQEA 4TT8A 3SEQA 5JTTA 1QRRA 4OSEA 4IIJF 3ZJYA 1JTVA 3ZY3A 5KTOA 3R9WA 3MTEA 1E7SA 1WVGA 4CGZA 3H87A 2IS2A 2RB4A 2D1TA 5JCOA 4JD5A 4EL5A 4B17A 3MSXA 1FSZA 5TVKA 2GPAA 5IK2D 4Q9IA 4YRSA 4E5DA 4GL4A 2JI7A 1XVIA 5BWNA 5K99A 2ZBPA 4IPTA 1KIAA 1WMEA 2OP1A 1IBLB 2BTQA 1W8DA 2CMHA 3MT8A 3Q4GA 1U4SA 2HV9A 5F51A 5BPFA 4UBOA 1F2TA 1YBMA 2BUBA 4MJ3A 3DZDA 3UOAB 3THRA 1G41A 4LHSA 3PD7A 3UXEA 1NSYA 1W7AA 3A6ZA 5CA0A 4YMHA 3MRSA 3HR4A 1HDOA 2JGDB 3JVEA 1D07A 1W30A 4NAUA 1PR5A 4R6XA 5JVDB 4EB8A 4CKZA 5KNLA 1KK2A 4X95A 4QUDA 4KN5A 1QHHA 2O9JA 3ZJ5A 2WFZA 3NKLA 3NHSA 4OHZA 5JZ9A 2J9FB 1HBJA 1JU9A 3HFRA 4GQBA 2MSDB 4LX8A 5DTQA 1YI1A 1Y48E 4KXVA 2PVCA 4P2BA 1XWIA 4ENTA 3FNEA 4J0JA 1TEXA 2JLYA 2XQVA 3ONFA 4AW9A 4Z53A 5KYYB 4QXOA 3DYBA 1RYNA 5DVZA 2Q7XA 2A5JA 1XMJA 1N2JA 1N3IA 1QIEA 1QS0A 1YL6A 2QN3A 3BVPA 3NDRA 1QTNA 3KLPX 1XZQA 1Z0ZA 3T3GA 2PZFA 3JD2A 5IAEA 4ABTA 1WU7A 3ZGVA 2HWUA 4ALKA 2BKXA 1NLZA 4MVJD 1Y63A 1ZICA 3AP1A 4JNKA 4EQ6A 2F3UA 2QTCA 3NHRA 4YC7A 5A1JA 1LRKA 2X1HA 3E9MA 3D0KA 2GHQA 4IO1A 3UO8B 3DT9A 3E7XA 1AQYA 1C7IA 2CFCA 3N8DA 4KQFA 3WMGA 5J43A 1EX6A 1OIVA 2JBAB 5JZOA 4MITA 1XG5A 3DKKA 4ISBA 3ISVA 3IC5A 3AF6A 1MH1A 2G67A 4FD2A 1OJLA 4WNAB 1ZH2A 3BERA 4KIJA 3UJ9A 1QK5A 3C3EA 3IQWA 3M83A 4I4LA 1DKUA 1WKVA 4TTRA 1RSZA 4HTAA 1R0LA 5FTMA 2H2AA 2Z9CA 1AF7A 1KC3A 5ALRA 5I47A 3LX8A 2VQEB 3VJLA 2HWYA 2XV1A 1THTA 3A3NA 1IY1A 1YRQA 1GRQA 2XMPA 3MT9A 4M0EA 1M73E 4O2BA 5CJ2A 4XVQA 4RM3A 3CW2A 4B6RA 2VUHB 1EUCA 4IX1A 4P35A 4OY3A 3GRAA 3OO1A 5IULC 5HKBA 3KQTA 2O3TA 5JD6A 1YQWA 3H1BA 3U3KA 2GVNA 3JD3A 1L6IA 3NPMA 1G5TA 5E0KB 2VK1A 2EFYA 3LPNA 4LOHA 2QNBA 4RSGA 2EBUA 4JITA 4KCGA 3GUCA 1QKJA 1VPDA 1X7YB 2O0KA 3VR5A 1P2FA 2V5AA 3JZDA 4UMDA 1O2DA 1FNMA 2Q2OA 4LKRA 3R7AA 4ANFA 5AKIA 1MNAA 1S3FA 2EJBA 3FJOA 1KY3A 4ENSA 2WWVD 3RSHA 1TB4A 4WVFA 2WSMA 2DECA 2YJGA 4LRXA 1IAVA 4V0QA 3FROA 2JG3A 3PQFA 3TRFA 3CRQA 3ABOB 5AHWA 3I0ZA 2WWXA 3CIOA 3WB1A 2BEUA 2YV3A 2ZFUA 1EB8A 2W22A 4N5HX 4D42A 5JSZB 3R3YA 3VR1A 3ND6A 2YICA 3BXOA 3WKBA 1KWKA 3HCBA 3K73O 1EIZA 1GFIA 1JR3E 4EL0A 2F8MA 1GZ6A 2W8ZA 4F06A 2WK1A 2Q3EA 2HDHA 1U9JA 3PGXA 1BDBA 2J7KA 2FOXA 1L8LA 2PPLA 3C4VA 3CWCA 1VIAA 3H9JA 4URFA 5LQNA 4IDPA 3D9QX 4XIJA 3QWFA 3C45A 3GVPA 4Q34A 4D9KA 5JFTA 2EG5A 4XD7A 3R8XA 3AV0B 3OZSA 4MUBA 4OMDA 1FXWF 4D8TA 3IDZA 1FNCA 4WLFA 5LP6B 2C9YA 3V1TC 2H4YA 1WPRA 4IGKA 2EFDB 2OUIA 2IFTA 5EWJA 1L7BA 3MXOA 3Q3HA 4M0FA 3T7EA 2FX5A 1IUKA 1CUGA 5H5JA 2JK1A 3DHNA 3UEOA 1DEAA 1UJBA 4LGVA 4IOLA 4LC0A 3VX4A 2UXDB 5FUXA 4IYRA 1Q0LA 3FKSD 4FE7A 1RHJA 2XD9A 2PX6A 3DDWA 2A5FA 2DLNA 2ODPA 2WBLC 2IIBA 2Z9BA 2CUKA 3E0XA 5CT9A 2AEFA 1A50B 1FS6A 4R81A 3FWHA 3QPWA 5I7UA 1IMOA 3DNMA 1E1CA 3QUBA 4OQ4A 4RL4A 1UBLS 3G5TA 5AXDA 4F7DA 2W5UA 3WLSA 1LD3A 4K6MA 4YIHA 1DRVA 5FFNA 3IEMA 1TCUA 1DB3A 1G9SA 2PWZA 3Q87B 1W52X 4HYTA 1P8JA 2DKOA 3OX4A 1Y8RB 2IZOA 4MROA 2IZ0A 5HRAA 1BA2A 2VTVA 2M9MA 4PYOA 3LQRA 2PVSA 1R7RA 4U7FA 4U3JB 5TIIA 4REMA 3AKZA 1JPJA 2HT1A 2Q5HA 1J2RA 2VQSA 4LHWA 1ZA1A 1W4RA 3E8XA 4PZZA 4YPOA 2IHNA 4H1HA 4KBYA 1XYGA 4J0QA 1C0PA 3FAZA 1JE0A 1UZNA 1QQ5A 1A9XA 2WMDA 2QMEA 4MRMB 3UWOA 2AN1A 2CBZA 2XR1A 2R2GA 5KNCA 3JWHA 2IYVA 4YH1A 3PENA 3R3HA 2XQFA 3KJIA 4PSAA 4F96A 3H6KA 4QBFA 1ZVQA 5K1ZA 5IP5A 3NQ41 4OHFA 4R5MA 4YQYA 5EEHA 4MS1B 2IOHA 4PLVA 4C0QC 2O8CA 4ALNA 2H9IA 3CRRA 1K5HA 4GFDA 4UBMA 2EZUA 2FFHA 3BD9A 2GCOA 3DNPA 3GBPA 4YA6A 2J3HA 2GZ3A 5D3QA 3HBNA 3M6AA 2QOEA 4RJKA 5H9VA 4CKCB 4IIBA 1OAOA 1Q1ZA 5BSUA 3D7MA 2C54A 1N0IA 2WWTA 4HX2A 4ESVA 1RR6A 5DXJA 3LU1A 3A6FA 5I7OA 2YRWA 3DF7A 2OO3A 4CDNA 3DB2A 3FMOB 3FA2A 1N2IA 1NZDA 3JVUA 1NW6A 2TS1A 1DBSA 1T4CB 2CXOA 3FHCB 1P3Y1 2Q49A 3NJ4A 3HCDA 3NOVA 5TJHA 3VC2A 1NBHA 1H4TA 1FUIA 1MVLA 3KSMA 4MVJG 4TLCA 2R68A 2IBMA 5JG7A 3NHLA 1BEEA 4WOBA 1NYQA 5JMTA 5ERYA 2Q5QA 3NBFA 5TXGA 4C4YA 3EIHA 1GNTA 1YCHA 4NDZA 2GJAA 3T7TA 2Q3FA 1R0ZA 3H2GA 3U7IA 2PO7A 1LLCA 2J4CA 3B48A 2NVOA 3OA2A 4CUJA 3U4IA 1FW8A 5G0WA 5AI4A 4YMTA 2FEOA 3EXEB 1F2UB 1WSBA 2ZUDA 3QF7A 4OHVA 1BDIA 4RKRA 4PCVA 5BRNA 5ALEA 5K3AA 1QAQA 3EXIA 2GAAA 4C4OA 1A69A 4WKGA 1T43A 4I8XA 4ILEA 1GNLA 2R7NA 3OF5A 4IINA 1P3DA 2ZJ5A 4RAQA 4XVRA 4TKUA 2O14A 2OB1A 2PUEA 1L5NA 3NOOA 3VOAA 6LDHA 4JMPA 2R65A 3RC1A 3JV7A 1O6FA 4CMGA 1O9BA 3V7YA 3NP9A 1A8QA 3G8DA 4KP7A 1H3NA 3TVDA 2YIMA 3DDUA 2SBTA 2ZYWX 2OECA 2UXBB 3KKLA 2VRCD 1JA0A 4KQIA 5F73A 5LB4A 4E7OA 1JKIA 1SQFA 3K8QA 2VLBA 5T4HA 2ZE8A 3RADC 3HA5A 4RIGA 2P9QA 3QF4A 3WHLA 1BJTA 3JQAD 5H70A 2I4LA 1LU9A 3FPBA 2V9PA 1CEQA 3OU2A 4XDZA 1JE1A 5D3KA 4C0SA 3FSJX 3HCRA 2B8TA 3VR6H 1CZRA 1Z2EA 3KQSA 3NWEA 4ECEA 1E89A 2ZRCA 3K8YA 3R6DA 4JT2A 5CFNA 2GR9A 4YMSA 1V6AA 2QTGA 3WI7A 3TTUA 2IX9A 2NVUA 1KMMA 4RE5A 2LIPA 2XGOA 4UEKA 1WXIA 1SUAA 1SUEA 3NHJA 4IS3A 4K2AA 3NB0A 4EECA 2V9CA 4N39A 5C80A 1KOGA 1A4XA 4P82A 3FD8A 1OTYA 4LDQA 2O50A 4JSYA 4WEOA 3Q8MA 2AR0A 2QTMA 2JI6A 1TYAE 4Z2YA 3VPGA 3DXZA 3CPHA 5B36A 2PZAA 4RU1A 4CIXA 1U7TA 2FK8A 2D7CA 2HMUA 4JJKA 1Q11A 4G5YA 3BE6A 4Y0VA 1Y42X 4U5QA 1GN9A 5AM4A 5H82A 4R2XA 3JWJA 4D96A 2PPVA 1CHNA 4MWOA 3H5IA 3PTAA 4QUIA 1FXSA 2H5EA 1XDUA 3PC7A 4HDSA 4MWCA 4Y2YA 5FORA 3WGVA 4YUXA 5CCEA 4R1UA 3LP6A 3NPAA 5HSGA 5CVCA 3UMSA 3BN3A 3BWMA 1LDYA 5FNZA 4KQWA 4DEXA 1SK9A 2JGKA 3V4FA 4RA6A 2XBMA 2GM9A 3PFBA 3SIPA 1CE8B 4HDOB 3K05A 3SY8A 2HB6A 1Y1KE 1LF0A 4PAOA 5LMNB 2JGEA 1TQ6A 5AJXA 3RF6A 4RHCA 2DWOA 3C6MA 4X7RA 1YB6A 1GG2A 4PRKA 1CUWA 3EXAA 1EDDA 1FLVA 1PEKE 1ZZGA 1ZIDA 1A9QA 2OLEA 3UB3A 4R9NA 4FYYA 3OE4A 3P9KA 4CTNA 3FTEA 4J0EA 2WPDA 3JX9A 4A5SA 2IYXA 4YAUA 2GK3A 2I9PA 2D1SA 4LXQA 2RH9B 4R2IA 5LU9A 4FVTA 5EWMB 1QP7A 4ZAWA 4BIMA 5BW4A 3JYPA 4Q00A 1JR4A 3RV3A 3DM9B 1V25A 3T5BA 2FW8A 4UEOA 2HO5A 4B3CA 2REQB 4RKWA 1LQ2A 4RTOA 4BFZA 4MKHA 3RRJA 1AGPA 2V7TA 2AH5A 4XCQA 2FW1A 5AXCA 1F14A 1IPEA 2YN0A 5JEDA 4ZDIA 4FWTA 2MYPA 2HWWA 1VHJA 4QASA 2GBIA 1QQAA 2OPHA 1RZ3A 1K8RA 3MSCA 1L7NA 1LVUA 3QHQA 4FGKA 1KRXA 1T5SA 3TZHA 5TPWB 1NLMA 1JIIA 5DBEX 3P4XA 5JPCA 1E9FA 4A23A 3UHOA 2PR2A 4HY3A 2R00C 2EEZA 1P4RA 3C4JA 4YT5A 5CCDA 4DZTA 3N0TA 1GSHA 3QEOA 1YJXA 4DSZA 4W5OA 1YS9A 1CT9A 5JAQA 1JSXA 1PE0A 4O1HA 3KAKA 4BRZA 3S7ZA 3GP8A 3JRWA 1YULA 1RWNA 2VBFA 2YZ7A 4GZLA 1CUDA 1AVTA 3V4RA 3GEIA 1F1JA 1V16A 3P0IA 1JVSA 1E6MA 2WIJA 4ZCIA 2WTXA 4TVOA 1HNNA 3DYIA 5FTLA 4C06A 3DE2X 1YDMA 1XQ1A 3HNPA 5BNFA 4OQXA 5E4FA 2F4NA 4L27A 2PAFA 2CL0X 3CRW1 4IIJB 1IZ0A 4QPCA 3PQ6A 4RH1A 4YUWA 3FMIA 5HZHA 1IBKB 3LT0A 1RWXA 5THQA 1E5QA 4GI1A 3QJ5A 1G8PA 1TPZA 1TTHA 2YOFA 4JI6B 3GT3A 1VLLA 3SMQA 4I1PA 1ZINA 3RSZA 1W75A 1GXSB 4N7JA 2PWBA 1E3IA 2ETXA 2AJLI 2WWRA 3PVCA 3Q7QA 4LVCA 4XX0A 3UT5A 5JAHA 3DCYA 3CW8X 3IQGX 1A9SA 1E4VA 2G9QA 1YTLA 2PMKA 2QAIA 3DE5X 3I76A 4LOAA 4AD8A 4BO2A 4BYMA 4DIMA 4B4DA 3GLVA 4MW6A 3F96A 1BMTA 2J45A 4QU9A 3F7TA 4NAVA 3BH6A 1KXZA 3WB9A 4YI5A 5FV7A 3VR2A 2ES4A 5JR3A 3HLKA 1CQIA 2D8MA 1H2BA 2E5FA 2YMLA 4ZIRA 4MV3A 4MX8A 5E3HA 4EVIA 2CHFA 4DZRA 2JI8A 2WSYB 1YBVA 2ZJ4A 4N7MA 5BSRA 3M9LA 2WM2A 1IC6A 1M66A 2FOIA 2NG1A 4TROA 2PBFA 3O95A 3N75A 3GVCA 2XNDA 1UKVY 4MA5A 2R7AA 2YWJA 3MOSA 2FZCA 4YJDA 3H97A 3CTMA 3LVQE 3QXCA 2GCPA 4FZRA 1L5SA 1SVUA 4RFSA 2OGZA 3QU5A 5KPDA 1DJLA 2GN2A 1G8SA 3T3NA 3DH0A 1PWYE 2C29D 3CUEF 2WT8A 3TPCA 1QGDA 2XNCA 2ZS7A 2FSVA 3PV0A 5TEWA 3HJGA 3Q3JB 1PWHA 2OGSA 1V41E 5L3SA 2VXCA 5D6OA 1K89A 5BY2A 1I32A 4YT8A 4PSVA 3WLPA 3IEPA 1B0UA 3A7DA 1W87A 3KJGA 3GQVA 1LUAA 1R10A 2BMFA 1KTVA 2WYIA 2HQOA 2WWIA 4I4TF 4HGPA 3TLKA 3DF9A 5HJ5A 4JI2B 1NI4A 1ZGGA 2R1TA 3ILXA 4PZ9A 5GZ6A 4KNWA 3BJIC 1NI5A 1E7WA 4EGFA 3R9XB 2I4RA 4L28A 1QANA 3STXA 2EFHB 1NAHA 1ZITA 3KJEA 3TX2A 1SU4A 3FF4A 5AUNB 3CE9A 2EBHX 2M1ZA 3W9BA 1NN5A 2MTBA 3OEYA 3VZQA 2FRDA 4ZI2A 3GZTB 1BG6A 3HUEA 3PITA 1S4QA 4G5XA 4UM9D 2BT4A 3QOYA 4YALA 1E66A 4KZPA 2FEXA 4GE0A 4GD3Q 3WBFA 4DWVA 3SVTA 1AQIA 5GM2A 3FWKA 4BO0A 1KEPA 1G20A 3QVOA 3E2IA 2OZEA 4I3FA 3NR2A 1P6XA 4B81A 5LMCA 3HS3A 2A9RA 4R40A 5KWIA 1J1UA 4RVDA 3W04A 3N8IA 1TIKA 2DQ4A 4MQFA 1EEXB 2VXOA 2Y77A 1FMCA 1JIVA 2FEWB 1GV1A 3OLYA 4YRRA 2DFLA 4GMKA 1CY7A 5DO9A 1TKCA 3S2ZA 2QYOA 3A6JA 3KQVA 4CN8A 4HGQA 2QX4A 4XVUA 1NQOA 5FBRB 5FX2A 1L5RA 1S9HA 4XKJA 1E1YA 1FTNA 2Z2ZA 4ACBA 4YFVA 1OPXA 1ZM4A 1XZDA 1Z2CA 4YRZA 3RSCA 1PJLA 3QIAA 3HCAA 1V37A 4TZTA 1DBRA 1AUXA 3VFDA 4RANA 1ZVKA 1EUDA 1T13A 4BC1A 3DZHA 1VG0B 1QZUA 1O77A 4XH9B 4D8XA 4ND8A 4TXJA 1NW9B 2ZYDA 1A98A 2EJCA 2YN2A 3H05A 1BYIA 5I51A 4LFBB 5BNZA 1G63A 2C5BA 3E82A 4JR0A 1IJFA 4Q9HA 3WDMA 3H1AA 3ELDA 3RYCA 4OEHA 4ZRNA 5U9CA 1GPJA 1I14A 3EXHA 4Y0AA 4OBEA 2CLLB 4JDPA 4PG5A 3KEQA 4UM7A 3WYGA 3WHPA 2HK9A 2QSJA 3RFFA 3WL3A 5KOHA 4EPXA 3LCRA 4HNSA 5BOSB 3TZLA 1SXJE 4GKVA 4NFLA 3HXPA 2VH1A 4YP0A 4A1FA 3NNSA 3JQ6A 3Q88A 4MDFA 1QDLB 3LC0A 1TIBA 2ZTVA 5A62A 3BULA 4XGRA 4BQIA 4A6EA 3EOZA 1W6RA 1C9EA 4KAFA 1RJWA 4Y2JA 1REQB 3I9MA 4D82A 5I4KA 1BGXT 1XTBA 2DH6A 4LJAA 2V7QA 4OB8A 5ICMA 1ZI9A 1IAQA 3U3ZA 4KQMA 1SCNE 1C3OB 1B2LA 1Z0FA 1Y8QB 4J0DA 3X43A 1XDBA 4NV0A 4R2KA 1CQJA 1NQVA 1IPFA 2VT3A 3EG9B 4G3XA 4WLVA 3ZWDA 3SHVA 3JATA 3DCNA 3TNYA 5J47A 4X85A 4RHXA 1XNHA 2M6SA 3GDOA 2V58A 4RMGA 5SV2A 3MXTA 1NE7A 1L2TA 1KAEA 1OI4A 3R9KA 1VRCA 4RF4A 4MZDA 10MHA 2RGCA 4IUBS 2BI8A 3AIKA 2CUNA 1K9SA 5GGYA 3OOEA 1AQ6A 1XRSB 3VPSA 4EOGA 5HJEA 4Q39A 3H6HA 4F6RA 2HREA 2CLHB 4LFAB 4U2FA 3GYBA 4D8VA 3TW8B 2PGXA 4BVHA 2AL7A 2MCFA 4NIMA 3CRVA 4CLRA 4I50F 1JAYA 221PA 4Z99A 5FT9A 1B00A 1NVXQ 2F67A 1S3IA 1GQSA 2OORA 2QG9A 3H4TA 3IB6A 3QMPA 4H6VA 1IMJA 4H77A 3RBXA 2OYSA 1QMGA 2B7LA 2Q3CA 1NU8A 2VP4A 3NWPA 4MW4A 4W6QA 3RGGA 3RIMA 4DXAA 3JARA 1EK2A 3MWFA 3DOFA 4GVPA 4KH1A 4LXXA 4UE6A 2P27A 1CIJA 1AQUA 1L5LA 2WMOB 1SUDA 3M82A 2NSYA 3OEHD 5REQB 3SQMA 3ZWMA 4B3FX 3E5MA 4R84A 2EJVA 1VZ2A 1RHKA 2ZWPA 5TLSA 2XGGA 4NAHA 2XTJA 1KYXA 3GEDA 1TUGA 3HVJA 4L2IA 1H1LB 1JFTA 2GPBA 5L51A 4WZZA 4BFCA 5GM1A 3DDSA 1WMFA 2XAUA 4KNYA 3CZ9A 1C3LA 1EBFA 4BDSA 2B8JA 3AVVA 2XZPA 4LRYA 3ESCA 1DIHA 1NMXA 2QD3A 5L3RA 4J1QA 3WAJA 3T9DA 3OMXA 3TD9A 4J75A 3IQFA 4NV1A 4CEHA 3TK1A 3JQGB 1E6LA 3D8BA 2NMVA 1KK1A 1NKSA 3GWGA 2FPSA 1SZPA 4DLWA 5L95A 3JZMA 3SF0A 2ZB3A 2XX3A 3PYMA 3AGPA 4RORA 3LDGA 2A3RA 1GKYA 3NGLA 3RQIA 3L0SA 3ESBA 4BNZA 1IOLA 6CHYA 1BGVA 2EFJA 3Q7IA 4B3GA 4K6FA 4JK3A 3THWB 2DT5A 2FPGA 3OZTA 4DFDA 4CHGA 3NMUF 3W8DA 4GF5A 3K9GA 4NU6A 5DBGA 1DEHA 1LPOA 3LKBA 5H68A 4B4UA 1NF2A 4RPKA 5AM5A 5A71A 4QOHA 1VP9A 1Z16A 2DPMA 3SSMA 5FR2A 1AKWA 1K3FA 1RCTE 1YB7A 2WJVA 3FFXA 4Q9LA 3V8RA 5CB4A 2XPCA 3B8EA 4MTLA 4BFXA 3KSRA 3VR6A 4OAPA 4GPEA 3WGYA 4HBZA 5A7GA 1BEUB 1XD2A 4JEUA 4QYTA 4GBGA 1P3JA 2DUNA 5J9FA 4CKYA 2GF0A 4W1PA 3ZJUA 1WZ2A 4O4LF 5AJTA 1VKRA 5DNWA 3MQ2A 2KW5A 3SYTA 1B6SA 3LWZA 3X1WA 3ZUPA 4F93B 3EQ6A 1Y7LA 3NM5A 3S3TA 2VRCA 4HS4A 4MW0A 1GTZA 2P62A 1VG9B 4WACA 3PUWA 3ZQ6A 3ZE0B 1M6WA 3WWCA 4HH0A 1YAHA 3RS7A 2Y1GA 1ZU4A 1P5RA 1V26A 1BROA 1ZCFA 4BTLA 1LLDA 2AOVA 4KDCA 2FLVA 1Q0RA 5ER9A 1KOJA 4HEQA 3G0CA 1GFWA 3L7IA 4V2UA 1KZYC 3O21A 1C5KA 1G98A 4LY3A 5E8RA 1CU1A 4Q1EA 2IYAA 3KOZA 2WY2D 1KIMA 1UDAA 1MDBA 3T4PA 2I4OA 2PLWA 4HO1X 5JBQA 1ZJYA 2OHVA 1NV8A 4I4NA 1TU4A 1XQ6A 4ZRMA 1FVFA 1G4UR 4RELA 3PGMA 5EOVA 3E5HA 1IUNA 2OAEA 4YMVA 4BV2A 3H0EA 2ZVQX 3OP1A 4U0JA 5ALVA 3S29A 5LIRA 2Q45A 1Y7PA 4ID3A 5AVXA 3Q10A 1ZMRA 3HJTA 3O0DA 3HXQA 3G8CA 1YZGA 3CGWA 5CXUA 3HJRA 1JV2B 3KXKA 3L4SO 3D8SA 4X71A 1XVUA 2IDKA 1O4VA 3OLXA 5KNDD 2VQ6A 1RLIA 5HFNA 2NU8A 2GLTA 5JJCA 1OPRA 4MWTA 3HKBA 3VOBA 4C2AA 3WQHA 3ZWOA 3ANSA 3KJQA 4Y9SA 4EH1A 4EUHA 5CB8A 1U9IA 1K06A 2D1QA 2HNKA 3IMKA 3JASB 2CDNA 4NULA 1BX0A 1GJRA 3Q12A 1GR0A 1L4GA 4ZHSA 4TPKA 3S40A 2BZSA 1GAJA 2IP1A 1E2PA 3MHPA 3F3SA 3UWSA 4UNNA 1EZ1A 3OJFA 5K09A 4MQLA 5HCNA 2JARA 3PTLA 3MK31 3IUSA 2RHMA 3TB6A 4UHCA 2DJ5A 1IN6A 5HDBB 1BA3A 1G3MA 2PHZA 5DYGA 1GVHA 4KQ6A 5B58T 3WYAA 4PXYA 3GNQA 3JQEA