2IFTA

Crystal structure of putative methylase hi0767 from haemophilus influenzae. nesg target ir102.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
176
Chain Sequence
GEVRIIAGLWRGRKLPVLDRVKETLFNWLMPYIHQSECLDGFAGSGSLGFEALSRQAKKVTFLELDKTVANQLKKNLQTLKCSSEQAEVINQSSLDFLKQPQNQPHFDVVFLDPPFHFNLAEQAISLLCENNWLKPNALIYVETEKDKPLITPENWTLLKEKTTGIVSYRLYQNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the putative methylase HI0767 from Haemophilus influenzae.
rcsb
source organism Haemophilus influenzae
molecule tags Transferase
molecule keywords Putative methylase HI0767
total genus 49
structure length 176
sequence length 185
chains with identical sequence B
ec nomenclature ec 2.1.1.171: 16S rRNA (guanine(966)-N(2))-methyltransferase.
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03602 Cons_hypoth95 Conserved hypothetical protein 95
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2iftA00
1B42A 2QRVA 3HA5A 3HCEA 4FP9A 4KW7A 5LQKA 3V97A 1L3IA 1U2ZA 3BZBA 3R24A 3X0DA 3M33A 2AR0A 2JH8A 5ERGB 2FYTA 5E8RA 4C06A 1XJ5A 7MHTA 3M6UA 2ZVJA 5K09A 2ORED 4ER0A 4HTFA 3UJ8A 3BXOA 4IV8A 5GIPE 1DCTA 1AV6A 4C04A 4Z2YA 2ZULA 3B3GA 2IBSA 3FRIA 4BLVA 4RSRA 5LQUA 5FQNA 3ORHA 4R6WA 4YMGA 3O31A 4KDCA 3Q7EA 5CCXA 2GH1A 2PXAA 3KPJA 3VC1A 2HR1A 3A7EA 3VC2A 5E2AA 3V8VA 5KYGA 2UYQA 5FA8A 5FQOA 1NW6A 4IKPA 5LSAA 5LQCA 4KIFA 4RTOA 3UJ9A 3UBTA 4PGGA 4E32A 3BWCA 3MERA 1NE2A 4NECA 4OBXA 5FHQA 5HIKA 4DKJA 3K6RA 4GOLD 1X1BA 4FSDA 5FWDA 2XBMA 3BWMA 4PYJA 3C6MA 3ID6C 5E9JA 5GWXA 5BW5A 5K0BA 2XVAA 3TMAA 2O0LA 3ELYA 1NBIA 2YXEA 3TM4A 4C05A 2R6ZA 4AZTA 4ER5A 4MIKA 1XDSA 3C6KA 5T6BA 5K03A 1AQJA 2Z6QA 2ZFUA 2CKDA 1V39A 2IH5A 3HVKA 5C1IA 2ZWVA 4B17A 4DCMA 1R18A 1QANA 4O29A 5LQRA 5GIOE 5K0EA 5GINE 2AOTB 2NP7A 3EVFA 3VYWA 2O06A 5BP7A 1RI1A 2P3LA 1X1AA 2ZWAA 3JWHA 2Z6UA 1O9HA 1ORHA 2P7IA 3ER9A 5FA5A 4X60A 5GM2A 4GEKA 4M36A 4EKGA 5CCBA 4ISCA 2ZLBA 3B3FA 4YMHA 4RTSA 2ZCJA 3KQWA 3FTEA 3P9CA 3E8SA 4P7JA 3ELUA 4A6EA 2ZZNA 1JSXA 3EGEA 3PTAA 2NNWB 1WZNA 5LQAA 2UZ4A 3ANXA 2YTZA 2E5WA 1JG2A 1NT2A 2YX1A 3B89A 4OA8A 1N7JA 3HNRA 4QDKA 2NP6A 1HMYA 3A25A 3DMFA 4P7GA 4PYLA 2Z6AA 3GNLA 3HCAA 4RTQA 3HEMA 2OO3A 1FPQA 1XCJA 2O07A 3I64A 4KRGA 5EQJB 3NW9A 3G2QA 2XYVA 3ME5A 4YUZA 5KS2A 2AVDA 3BGDA 5DRTA 3FUWA 5E1OA 3KQVA 4FR0A 1QAQA 1KIAA 5C9ZA 3IEIA 5EKUA 2A14A 5F2KA 1O9GA 1R8XA 5U4XA 4RTLA 5E9WA 4E33A 3KPWA 2Y1XA 4IWNA 2ONYA 2Y1WA 3I9FA 3QV2A 1KYZA 5T67A 5JUWA 3NVKI 4E70A 5CVJA 3KQMA 1D2GA 3QOWA 2FK8A 3G7UA 4GC5A 5B1SA 3ELWA 2AS0A 4GBED 4P58A 2PX5A 4FGZA 5CM2Z 2B78A 5EIWA 1FP2A 3SGLA 4MWZA 1BOOA 2AN4A 2PT6A 4DMGA 4E2ZA 9MHTA 4CTJA 3G88A 1FP1D 4ZTBA 3A4TA 1ORIA 3EVGA 3GRVA 5K05A 3GRZA 3OZTA 4QTUB 1JTFA 4M38A 5K8VA 5CD1A 1T43A 1JQEA 1XVAA 2PX2A 2OB1A 2AOUA 4ER7A 2JH9A 1BHJA 4PYMA 5HIJA 1XDUA 3CVOA 5D1NA 1I1NA 3M70A 4HGZA 1SUIA 2EJTA 3EEYA 4QPPA 5EPEA 3NWBA 1VP3A 2GAFA 1YFLA 1KHHA 2OKCA 2PSSA 4LWPA 1VL5A 3KU1A 5EGSA 4XUCA 5M5BA 5EEGA 2YQZA 4PINA 4AZWA 4M37A 5DTQA 4AZSA 5GM1A 3KQTA 3TM5A 3GRUA 2HNKA 3EGVA 5DWQA 4A6DA 1RJFA 3I53A 4DF3A 4RTPA 4MHTA 3UJCA 4HC4A 1G8AA 3ER8A 1R6AA 4C03A 4CWAA 4PNEA 1NW8A 3R3HA 2GA9A 4MQ4A 5E2BA 3GDHA 1X1CA 3JWGA 5EIFA 2AZTA 2ZBQA 3GIWA 2O57A 3SSMA 5IKMA 1L1EA 3EVBA 3NTVA 4RVGA 2B2CA 2XVMA 2BR5A 4GUAA 2XYQA 3RODA 4C07A 2NXCA 3LKDA 3UWPA 1TW3A 5EMMA 4HSGA 3GU3A 1IY9A 1KPHA 3BGIA 4MTLA 1JG3A 5DT2A 3LDFA 5KQRA 2IGTA 2KW5A 4BP3A 2PBFA 2FHPA 4RTNA 1ZHFA 1Y8CA 4WVLA 5CVUA 5LQNA 2EFJA 2PVCA 2QYOA 4QPNA 3DXYA 3SR4A 2I6GA 3E23A 3T7SA 3OE5A 5EHIA 3G8AA 5EKXA 2AOUB 5GOZA 3T0IA 4DA4A 3DP7A 4X1OA 3TOSA 2PXXA 3KPUA 1VPTA 2QRVB 3RW9A 4K6MA 1SVUA 2B3TA 3UJ6A 3E7PA 3PFHA 5H02A 1NV9A 5K0NA 5LR6A 3A26A 3KPVA 4OQEA 3TR6A 2G71A 2IDJA 4CKEA 5ICGA 1YF3A 2OZVA 2P41A 3K0BA 1DL5A 2WK1A 2PX4A 4X61A 5ICEA 3TQSA 3FPJA 2IP2A 3LHDA 5FCDA 3C0KA 1N7IA 1L3CA 4PYNA 2AN3A 1KPIA 2ADMA 2IH4A 2H11A 3FUXA 4R8RA 5DX8A 2CMGA 1RI3A 3G5LA 5E1MA 3FTFA 4PYKA 3D2LA 5EG5A 3CJTA 1R8YA 2JHCA 2IBTA 1NBHA 3EVEA 1SQGA 4PYQA 2R3SA 3OU6A 1XTPA 4R6XA 3JWIA 3DMHA 2IIPA 2O05A 5DM1A 1R74A 3DLCA 1ZG3A 3I58A 1YZHA 3LPMA 2C7PA 3FYDA 2AVNA 5GP1A 2C7QA 2P40A 1I9GA 2G72A 4FZVA 1H1DA 1JTEA 2IFTA 4DM3A 3FTDA 3PS9A 4U7PB 1JG1A 3BGVA 3UZUA 3SMQA 1HNNA 3HM2A 5DM4A 2ZZKA 2OXTA 5DXJA 5F2OA 4OA5A 5DRYA 2WA1A 3MB5A 1P1CA 1DUSA 3FPFA 4E31A 3OFJA 2HTEA 3E05A 3GWZA 3DMGA 2OB2A 4YV0A 1VIDA 1TPYA 3C3PA 4PIPA 4EMSA 4DCGA 2C7OA 3ERCA 3G2OA 1XDZA 3SM3A 8MHTA 3PB3A 3G2MA 5DTMA 4BP1A 5ICCA 3DUWA 2I62A 4GC9A 4RV9A 1XCLA 5EMJA 2AN5A 5DSTA 3EPPA 3LL7A 5P8WA 5EHGA 1SKMA 3MCZA 4AZVA 1PJZA 1RJDA 4M7RA 1YZ3A 3UFBA 3TKYA 3EMDA 4GOMD 2PJDA 5DTRA 4DQ0A 1L3BA 3ELDA 4FSXA 3AWIA 5HFJA 1IXKA 4BLWA 4RVFA 3SX0A 4E30A 5LQJA 1M6EX 1PRYA 4V0RA 5G02A 4F85A 2VZ9A 4EVIA 1RI2A 1QAMA 3GXOA 1D2CA 1Q0TA 1IM8A 1VQ1A 1JG4A 3PFGA 3OU7A 4XUDA 3P8ZA 3HTXA 3DR5A 5DPMA 1VE3A 2YUIA 2ZBRA 2B25A 3IV6A 4FS8A 1R00A 3L8DA 2VDUE 2P35A 2GB4A 3S68A 3MQ2A 3OE4A 5E1DA 3HP7A 1INLA 4RWZA 4ER6A 1RI5A 5K0LA 3EMBA 3UA3A 3MAGA 2YXLA 5K0JA 1EIZA 2F8LA 3B7PA 3EGIA 2Q41A 4P7FA 5CVDA 1KPGA 5FUBA 3HCDA 2VDWA 3NDJA 3A27A 4YUYA 2ZBPA 3PX2A 5FWAA 3P2IA 4GQBA 3OU2A 3SSOA 4LG1A 3GRRA 1JQDA 2BM9A 3LSTA 3M6VA 5D1HA 1WXWA 1YFJA 1KYWA 2FK7A 4XUEA 1ZGJA 3SSNA 2DULA 4EKIA 4YUXA 1ZKDA 4Y30A 1FJXA 3FRHA 3G89A 4YV2A 3FUTA 5MHTA 1M0EA 1KR5A 4X63A 2DPMA 4WXHA 1X19A 2GLUA 3LDGA 2UYHA 1EAMA 1NKVA 3TKAA 3WSTA 1Z3CA 4CKCA 2JG3A 2BM8A 3UA4A 3LX6A 5HILA 3P2EA 3MTIA 3O4FA 4DZRA 5BXYA 5ICFA 2OYRA 3GJYA 3PVCA 2UYCA 2BR3A 1P1BA 4KIGA 3OFKA 2PX8A 2EX4A 5EOVA 3TFWA 2AOXA 2ONZA 5CUQA 3HVJA 1G8SA 3LBFA 1WY7A 4F84A 3FPEA 5HIIA 3FPGA 3HVHA 1AF7A 1O54A 2V74B 3DULA 2BZGA 5K0FA 3CGGA 4L7VA 2ZW9A 2PV0A 1P39A 3FTCA 3I5UA 3BKWA 3IHTA 4PGHA 2GS9A 2WA2A 3CJRA 3DXXA 3OCJA 4X41A 4YUVA 4YV1A 1F38A 3KKZA 3TLJA 1WXXA 4R8SA 2NXNA 3HCBA 2YVLA 3H2BA 1I4WA 3P9KA 5E8JA 4HTFB 1G38A 2OY0A 1G6Q1 3KHKA 4EK9A 1EJ0A 1VLMA 5KQSA 1NW7A 2UYOA 1JQ3A 3BWYA 4QVGA 1F3LA 3Q87B 4CXMA 10MHA 1G55A 1NW3A 4GOOD 1QYRA 1SG9A 2YXDA 1BC5A 3M4XA 5CVEA 2ZIFA 5EMLA 5IH3A 4C08A 5HOQA 4QQNA 3JWJA 3DTNA 2K4MA 2CWWA 1UFKA 5DSXA 1L9KA 2ZSUA 5DM0A 4BLUA 4RTMA 2PWPA 3NWEA 2ZIEA 3PX3A 4RTKA 1QAOA 4PONA 2C7RA 2JHAA 2FPOA 4PIMA 3F4KA 3LBYA 1FBNA 2G8NA 3OZRA 5HZMA 5EC8A 3HA3A 2IDKA 2P3OA 5DXAA 4EQZA 2IPXA 5K0GA 1G60A 1KXZA 4ER3A 5EEHA 2PLWA 2PKWA 3LECA 3LCVB 3FZGA 3UJ7A 2EG5A 4RTJA 2G70A 1ZQ9A 1JSZA 3BUSA 2PWYA 4PWYA 4QQKA 3P9IA 5DX0A 4LECA 3GO4A 4QDJA 4E2WA 1MHTA 2H1RA 2AOTA 2P1DA 3A7DA 2LD4A 4GOND 4YUWA 3T7RA 2AOVA 2CL5A 1OR8A 3UJAA 3O7WA 5F2NA 1NV8A 1WS6A 3LKZA 1N2XA 2HMYB 2QM3A 3MHTA 1D2HA 5EMKA 3CC8A 3KQPA 2ZZMA 2GPYA 2NXEA 3RIEA 4AX8A 3GGDA 3OPNA 1WG8A 3EVCA 4HGYA 4QTTB 2V7EA 3AXTA 2AOWA 3AY0A 3G8BA 4HG2A 2IH2A 1JR4A 4OX9Y 3LCCA 2HWKA 2ZIGA 2NYUA 3FUUA 4G56A 4GF5A 4PYOA 3TRKA 3FUVA 4C4AA 3CJQA 3KPYA 2B9EA 2ZTHA 3EVZA 3QOXA 3EVDA 1ZGAA 1QZZA 1XXLA 4HRAA 3VSEA 4UOEA 4QVKA 5E1BA 5FTWA 2QE6A 5FULA 5CIYA 2QY6A 4PYIA 4R05A 3R0QA 5DX1A 3EVAA 2FCAA 3BT7A 2PT9A 1X1DA 2FRXA 2OBFA 2PGXA 3DOUA 3P9NA 4OBWA 3PLAE 3BKXA 3MCTA 4PCAA 3R6TA 4RVDA 3DH0A 3AXSA 2NXJA 3M6WA 1RJEA 3OZSA 5K0CA 4HH4A 2VS1A 3KR1A 3P2KA 4XCXA 5EZSA 5K01A 2I9KA 2BR4A 3THRA 3MGGA 3P71T 4BY9E 5HIMA 5EVJA 3G2PA 3KQOA 5DLYA 3TPZA 2PXCA 5HEKA 3CCFA 1UIRA 3CKKA 3B5IA 3U81A 3GCZA 1RI4A 2ESRA 4Y2HA 3UJDA 2P7HA 1RJGA 4P7KA 5E9QA 2EJUA 1YUBA 5CVVA 1SUSA 3CBGA 4RX1A 3NMUF 3DLIA 4FT4A 2I7CA 2YR0A 3REOA 3PT9A 5JR3A 2P8JA 3KR0A 5KVAA 2BH2A 3BWBA 4CKBA 1Q0SA 1UWVA 4KVZA 5FADA 1EG2A 4ATNA 4CTKA 5BW4A 4F86A 3HCCA 1VBFA 3NVMB 1TW2A 3NDIA 4OQDA 2JJQA 3B3JA 3HCFA 3SXJA 4POOA 4E2XA 2CMHA 1P91A 1SQFA 2N47A 3C3YA 3GRYA 1VP9A 3SVZA 1AQIA 3IYLW 5T64A 4KWCA 4RTRA 5C0OE 3KQYA 4U7TB 3KR2A 4PCLA 3HA7A 3NJRA 4JXJA 4RVHA 1M6YA 2P3QA 1EJ6A 4RYLA 3LCUA 2VDVE 2JHPA 3KQSA 1EQAA 4LWOA 3G5TA 3THSA 3FYCA 5EZQA 3FPHA 4IV0A 4V0QA 1KP9A 1BKYA 1MJFA 3LGAA 5FHRA 3UJBA 1YB2A 3M6XA 3KQQA 4AUKA 2ERCA 3P97A 3EEOA 3LDUA 4E2YA 3R9XB 4KDRA 2H00A 4FT2A 4H0NA 3HVIA 3KR9A 3MTEA 3AJDA 2VP3A 2XYRA 5DM2A 2OPBA 3T7TA 3DXZA 1NW5A 2G1PA 2HV9A 2PY6A
chains in the Genus database with same CATH superfamily
5JISA 1T0BA 3Q5GA 2QL5A 4PAGA 3PJFA 2I29A 4DDWA 1U2ZA 4LRXA 2GT1A 5LLTA 5LZ2A 3EIXA 4PIVA 4RENA 4C06A 3GOQA 1XALA 3OSZA 2E2WA 4ZICA 1RQ7A 1WULS 2VSNA 4WLOA 1ZJYA 4Q18A 1QCZA 3TQQA 4Z9BA 1ZUNB 1S8FA 3NM6B 4QBTA 4YBRA 3NBMA 2CFIA 2Y27A 2CBXA 5LQUA 1TTTA 1H05A 2W2OA 2WILA 2QVGA 5FQNA 1P31A 1Z68A 2O3TA 4N47A 3T38A 3WWDA 1PIWA 1WF3A 3A4YA 2PUGA 4F3TA 2OXRA 4IICA 1XMIA 2QX6A 1BOFA 1BH2A 1M54A 3N59A 2Q6KA 1SIUA 3NCTA 1I36A 4I19A 4CMJA 1GPKA 1TIKA 3QHPA 4X7BA 3VSAA 1PR9A 4KR9A 3CLSC 3BWCA 4PR3A 2HBQA 4JX9A 4B45A 3PWZA 4ZEWA 2VUTA 3ANTA 1Z2PX 3R4VA 1CQWA 5ALUA 1OBCA 4MQFA 4EGFA 3WAGA 2XBMA 2BFEA 3PRHA 3SAJA 4EHAA 3TW8A 5KKNB 4HNAB 5SZIA 4NL4H 1Z6PA 1R0XA 5C34B 2O0LA 2F7SA 2O6HA 2FG7C 2NQ2C 5EERA 1PDOA 1W4ZA 4DC1A 3RGWS 1Y8RA 1CY4A 2H7YA 4INZA 4OP1A 4JI4B 3RG2A 3IKLA 2AXPA 4KQJA 1PVDA 2ZAOA 1ULAA 3JATB 5C3MA 3KWMA 1QANA 4C6HA 3TVYA 2ZRLA 1GGKA 2PWBA 5SYNA 1YR2A 1M8FA 3EBPA 4RLQA 3PL5A 5G0WA 2K5UA 5I45A 2NP7A 2FN3A 1VJDA 4FGKA 2OOSA 3MWYW 4IIJB 5FIUA 4EW3A 3EIHA 5BW6B 1J2EA 2YHIB 3O2QB 5FA5A 5IUKC 3L7CA 1SZDA 3VYSB 2W00A 1OLSA 1YONA 4ISCA 1KKLA 3P4YA 2PAFA 4ILEA 4LWZA 4HWRA 4DGQA 4R1OA 5J2UF 3NNDA 3WFJA 3O8CA 1K06A 4ZI7A 1TJ4A 4FJ1A 3ADDA 4OI1A 3RR2A 4EHKA 1A04A 1O95D 3ANXA 5AKIA 4CM9A 1N7JA 2PQ2A 4EPXA 2ZI9A 3AVPA 5DW3A 1TA9A 3GFGA 4N5HX 3HWRA 1CP3A 4Z9XA 4A8JB 4EI7A 3ME5A 2RHJA 4IEIA 4OYHA 3K73O 3ANYB 4CV3A 3BM5A 2GQ0A 1M0WA 3PKJA 3IQIX 1E7YA 4YMLA 2Y2VA 5C9ZA 5AM1A 1XP5A 4C30A 4QKQA 2O8DA 1L5NA 1O9GA 4QYMA 1A1VA 4G9BA 4DBLE 5EZ6B 1CIPA 5LXTB 4DQUA 3ORRA 2ONYA 1BDIA 3NVKI 3HBFA 1KYZA 3KXKA 3H9JA 1O0BA 1G20E 2VK4A 3FLMA 4HVCA 4FD3A 3GFPA 1EHCA 2FW6A 3AO0B 5EMHA 4GBED 4FGZA 3TJMA 2B78A 2OD9A 4PZ0A 4NABA 4UHKA 3EOAI 3LA8A 3UPDA 3V4LA 3IXMA 2AL7A 4IS3A 1VPDA 3IRVA 4QJBA 4KCGA 2XE8A 4BLTA 4MSUA 1X1TA 2CFTA 2RAVA 4B7ZA 2O4UX 5ED4A 1TYZA 3I9V1 5ULLA 1YRWA 4LXQA 2QBYA 4HLDA 1P33A 2C54A 2FPRA 2E4WA 3JR3A 1JQEA 2BKVA 4TVOA 1GFWA 1IFXA 1KZGB 4CKZA 1PLLA 3VPGA 4ER7A 5JAQA 2LDBA 3GELA 1K6EA 1DTWB 1IZ8A 2I9PA 2VPIA 1F2VA 1SAYA 3GQBB 4O4HF 1XCPA 4GPTA 4ASUD 3LC7O 1LB1B 1FP4A 5AVYA 4BO1A 4AZSA 2BRUA 2QXUA 4PINA 5JV5A 4AQYB 3ROTA 2XGMA 5AKKA 5DWQA 3PQ8A 2IKSA 3ZIAA 3T61A 2EZ8A 4KQ2A 2DKNA 3OQOA 1E6UA 5BNZA 1HC7A 3L18A 1R6AA 2R25B 2ZVQX 3RVQA 1YU6A 5TQJA 1VYUA 5C7OO 3IE1A 5A6SB 2VTBA 3GIWA 3VU9A 2GN1A 4YAUA 1ICIA 5LA6A 1AE1A 3GF4A 4M1KA 3ZEAA 1M2FA 5ARBA 4KXXA 4Q3OA 1WLSA 2HD4A 1DBSA 2VJOA 2CZQA 2F48A 4K2HA 5TMEA 2ES4A 4HXGA 4RH0A 5JTUA 1W36B 1J1ZA 2BMAA 2FHPA 2RIPA 1XCMA 2BWJA 2ZEJA 3D3EA 3EOBI 3OHSX 4Y2UA 2V1XA 2A4KA 2Y6VA 5DVZA 5JZVA 3KZOA 4IJVA 3PDIA 3DOJA 1BVHA 2YUTA 3AUKA 3B36A 1E9AA 1JEDA 1TIBA 2DLNA 1AKWA 1UMCB 2JA2A 1G8JA 3G8AA 3QVUA 4HDAA 4NE2A 3RASA 1MQ8B 3IOEA 5GOZA 3T1NA 3ZS8A 2VEOA 3AEQA 5CDFA 4E6EA 1RPTA 1SB9A 1LD3A 1W30A 3NTXA 2HSJA 4EARA 2X4DA 2XEXA 1Z5GA 2ZJZA 5LIRA 1DAPA 5AJUA 4V2UA 1KEPA 1U0JA 5A7HA 2GN0A 3C3XA 5KNDH 3UHJA 2YFHA 4RD6A 4HLQB 4X61A 3ZDZB 2YINC 3QKSB 2ZSIA 4YP6A 2HXSA 2AZ4A 2IP2A 1IG0A 2I6QA 2P4HX 1Z08A 5ABPA 4U7DA 2FUNB 1EU1A 2B8JA 1LK5A 1QH1B 4XM2A 2D13A 2HX1A 1OI7A 3TLBA 4HS9A 4AD8A 1BE0A 2M9MA 5TF0A 1N3BA 2YV4A 3PXBA 4RL6A 4US1R 2BLLA 1PG5A 1NN0A 1NSTA 3GRPA 4TM8A 5E0KB 3OEWA 2FOXA 2WMNB 3PDWA 2QQEA 1HGXA 4YAIA 1E6MA 1V5WA 4TTSA 4AYTA 4BO6A 3PVSA 1TKCA 4OQFA 3L82B 2EP5A 4FGWA 1PK7A 1NBMD 2P2NA 3K72B 3NC0C 3A1UA 4YRAA 1WCYA 5CDUA 1AMNA 3FLEA 3L43A 3NTUA 1SCJA 1UFQA 3EC2A 2X0NA 3WHIA 1E1KA 2VFAA 5DKFA 4CN8A 2UZ1B 4OA5A 2BGJA 3EPKA 3NEYA 1K27A 4KQ1A 3BTSA 5JCZA 4DQVA 1L5WA 3QXSA 3ZCQA 2PLNA 2XUGA 1GUFA 1XTVA 2JIBA 1D6MA 2Z95A 1XZ8A 3CF0A 3QPUA 4G9GA 3U7QB 4DIBA 2QRMA 1SBZA 2IU4A 1G7CA 4F4DA 5F7ZA 2QTGA 3HXLA 1S8NA 4C89A 4YCNA 1DX4A 2IHNA 2AN5A 3C4VA 2V58A 5JALA 4F12A 5EUBA 4ZC1A 1EM8B 3N8NA 5EJFA 1NI4A 1F9AA 5BOSA 1GRNA 4JBYA 5LU9A 1X8LA 2Q07A 2C96A 2WIBA 3ZJ4A 2Q62A 4INAA 1QMGA 3THWB 3RGGA 1U11A 1WXFA 2F9MA 4K6FA 3K96A 1H2WA 5FL7D 5SV2A 3PKZA 3AESB 3KUUA 5G0UA 5J2TA 4K6KA 4B7XA 2XIJA 2NUTB 3KD3A 5G02A 1D03A 2Q9AA 4I9UA 5HK8A 4N5MA 2FAXA 1UFVA 2B94A 13PKA 1BO6A 3DZ8A 3FCAA 3N1UA 3QQ5A 1D2CA 2V55B 3P9XA 4HNQA 4IQ8A 4X90A 2ZYTX 4URYR 3TB4A 2Q6VA 4PLWA 1FVFA 2APJA 4KQKA 2TS1A 4WXMA 1WPXA 2GBPA 4F5EA 4ENVA 3KKMA 3ADCA 2P9ZA 4CMEC 4QDZA 2QSJA 4P5PA 1M75A 2XYGA 4LTMA 1R00A 4ND4A 4D9FA 1JIIA 3D2BA 1NXVA 5FOXA 1E58A 3PDHA 2V7QD 4RWZA 3O82A 3AB7A 3EMBA 4MUHA 3BERA 2YS7A 2YXLA 3COWA 3RHTA 5C7LO 3EAQA 5KO2A 2Q41A 2X2OA 2IUSA 4E1VA 4GIBA 3EASA 1LTKA 4NYMQ 3NDJA 2PL1A 4KLCA 3CT4A 2NO7A 5JQGA 1GA6A 4CQMA 1PGPA 1EK6A 3UK0A 1CW2B 5E7IA 7ADHA 4R69A 5HJ7A 3L4JA 1L7OA 2EW1A 3SEZA 2AKYA 1ZXLA 5I9TA 2KYRA 2QP3A 1A8UA 4MJXA 1E6WA 1M8KA 3RFTA 4I6GA 3I2GA 5KB3A 4HFMA 3LNTA 3DF9A 3INYA 3M1LA 3S2EA 1MPXA 1P80A 3CT6A 3TKAA 1QK3A 3U44B 5CD9A 1BXGA 4W8HA 4CMHA 1YQQA 4O1IA 3HE3A 3KELA 4IVPA 4ZDKA 4BQSA 4YR7A 8OHMA 1VPWA 4DZRA 3F8TA 3UJHA 1T2DA 5ALDA 4P33A 3ROKA 4LJRA 4I81A 4X6XA 2P4UA 2QTBA 2ZRQA 1QQ7A 2NTEA 3LBFA 4L78A 2OCBA 4UPVA 2WM2A 5EE3A 5L4NA 3NZEA 2BE9A 2FRDA 3HJBA 4QDTA 5DP2A 3N9IA 3Q6NA 1HQDA 4DCNA 1KWGA 4B3GA 2YXPX 3VI4B 1Y34E 4BO0A 4EW2A 5C8XA 5JSYA 2JH3A 2NAFA 3D5EA 4HNGA 5AI8A 4CV1A 5BVGB 1T6NA 2G82A 1JMYA 1I4WA 3H2BA 4GS5A 2AI2A 3OCXA 4PQFA 4COKA 2WWHA 5DYGA 3TLGA 2C5GA 1U7OA 4WBSA 4XDGA 5F1OA 5CFOA 1P8AA 4M89A 4O5AA 1XCOA 1X0XA 3ND8A 1KBZA 3FN4A 3GHHA 4OI4A 5DNAA 1SC1A 1Z4IA 5JYEA 1OAOC 5DMHA 5G4KB 2J0UA 3N87A 1N2IA 4TWRA 2VKTA 3JVUA 1NN3A 2OTCA 5JCOC 1W7AA 4LBVA 1L9KA 4B3TB 3ND7A 3WK8A 3TSAA 3GRFA 4GBMA 4JEMA 4OP2A 4MI6A 5JYBA 5A7GA 4IX1A 4ZPJA 2GWHA 2O2CA 4ZVKA 2OBBA 5J2UA 3TW8B 4JFRA 2X42A 4R2WA 1V9SA 1YSCA 1R0ZA 2FI1A 1SVWA 4S1NA 4EQZA 3COZA 5FEUA 5JFGA 3OAAA 2C95A 3LCVB 5AW4A 3QKRA 1R12A 5I5GA 1XC7A 2PIDA 3ROFA 4GPIB 1J5PA 1FF9A 2I7VA 4HDRA 4W5JA 1JSCA 4W7HA 1PWZA 1U6IA 3EMVA 4GX5A 4EY4A 2AC7A 2RGAA 3BRSA 1RR6A 3DYVA 1CQZA 2CHGA 4HNSA 3ZHZA 5JVDF 1BN6A 3TRDA 3Q8MA 2F8SA 5L6LB 4A9AA 1QUFA 1NV8A 1PS9A 1JLLB 4MR7A 2V7TA 2CWDA 3LKZA 1VFPA 2OV2A 3O6VA 4RWEA 3DKRA 4B31A 4FMPA 1OXVA 4DBZA 1V9LA 4PV7A 4E11A 2WKQA 1WNFA 2GPYA 3BXZA 1R3UA 3DV0A 1M6HA 1NJSA 1Q0RA 3KQLA 1SK8A 3L49A 5TV2A 1JIUA 2YJZA 2FFBA 2J46A 2J0UB 2RGGA 2RHTA 4KPUB 3VZDA 3E1SA 4NCIA 1F8YA 5FYDA 2O3UA 3FUUA 3D0RA 2WHXA 5KSZA 4GF5A 4G81A 3FNQA 1TL7C 3EVZA 2JRCA 1GQ2A 1LI4A 4M1WA 4DB2A 3DFZA 2AFHB 4U00A 4MR8A 3OY7A 2X4LA 3DDZX 1K3FA 2QY6A 3HKCB 3L7AA 1NUSA 2XDQA 2EZTA 2ODTX 4I4CA 3DAGA 3FYSA 4D4JA 3RI3A 3CZMA 4PCAA 1VLHA 4M9UA 2AQKA 3RNOA 2O3JA 4RDHA 4JYCA 4G8BA 3NKLA 3U4CA 4PFKA 3O3NB 3IPYA 2H1HA 1X6VA 4RK4A 4JL8A 3BH0A 5GADl 3KR1A 1ZD2P 2KX7A 1ZC3A 3D4IA 3T5GA 2OWDA 3E9ZA 5KOYA 4KTTE 4PSCA 4MUGA 3E03A 3VJKA 2QLLA 3S8MA 2WJPA 4NV0A 5H16A 5IDQA 1MNQA 1MC1A 1LDNA 4ZARA 4ZD6A 4YQYA 1WTAA 4D6PA 1O4VA 2QBYB 1LSOA 2EJUA 4W4TA 2FUG1 5F5XA 2H65A 3GN1A 4LF7B 4B5KA 3NASA 1P1JA 1IN5A 4V1CI 4YRMA 3PT9A 4MW7A 4MKHA 1LFDB 1L7RA 1SHKA 2V9ZA 3KKEA 4MCIA 5KVAA 1IZZA 2KHZA 5LC1A 3N7TA 4LDAA 4D8TA 4Q3NA 1OYWA 1F9EA 4GI3A 3AR9A 4EECA 2P6OA 4CTKA 1ECFA 3DDCA 1EP1B 2V5AA 2B1JA 1NQUA 4BN0A 4BDTA 1OFTA 1CQIB 1GRVA 3FYHA 4WNAA 1ST3A 2CMHA 3SXJA 2WB2A 4I3FA 3EG9A 1AGNA 5ERXA 3VBEA 2OG2A 4D0GA 2GJKA 5BVHA 1ZIXA 3DDWA 4YJKA 1QKIA 3UAGA 4EW6A 3FPBA 4EA8A 3PXUA 5A6SA 5ECWA 1XF9A 5CNJA 2JFWA 5BR8B 1TYDE 3V32A 3PGXA 3NHUA 1CULC 3AQIA 1V3UA 1NJFA 3B52X 3NETA 1IBCA 5EZQA 3TTTA 4TKMA 4XX0A 4HMOA 3UQYS 1ORWA 2A5GA 2XSZA 4V0ME 3KT0A 3LGAA 3V8NA 2VT3A 3V4RA 4MW9A 2IHTA 3KQQA 3TRJA 1NC1A 1A9RA 1P3DA 3R9XB 5IRCD 1A5ZA 4M7OA 3AJDA 4B83A 4UM9B 1L8XA 1NW5A 2JFZA 2J41A 2PY6A 5AK0A 5CDYA 1EK2A 3MEQA 2QRVA 5I7EA 1U8UA 3V97A 4LMPA 5K99A 5JEDA 1QSGA 4J7XA 3A0UA 2AR0A 2OCGA 3A11A 2C92A 3O95A 3L46A 4KI7A 3VOBA 5IT9A 4AT1A 1M1UA 1O5OA 4G1EB 4HUQA 3ZBPA 3ZBTA 4P0QB 4EBFA 2P90A 5JZ9A 3ROXA 4C4XA 2VK1A 3GH3A 2I3DA 1OFUA 4Z2YA 4I0WB 3B3QA 5EJAA 4BQQA 3LQYA 3JRWA 4KXLA 3RK0A 2FR0A 4X62B 3GJ7A 3FNEA 4MRRA 3C39A 2VEDA 3V8VA 5KNLA 2UYQA 5EHNA 3CPEA 1P19A 2ZYGA 2CJYA 4UBKA 2EL9A 1FY2A 3LC1O 5I9BA 3DB2A 3I1JA 2BFFB 2QI9F 4L4YA 4YXFA 4BOYA 2Q3EA 3KQUA 4D6XA 1XN1A 1FXSA 5A05A 2LP4Y 2PO5A 5AXDA 3MTBA 3BSWA 1R27A 2WSBA 2X2EA 4PZYA 1K7FB 4DL9A 4LSMA 1I3OA 1U1GA 4MYHA 4RY8A 4JL6A 1JA0A 4CLEA 1UKVY 4LF8B 1E7MA 5CLGA 1H0SA 1KAQA 1V8FA 1P6XA 4MIKA 3OP1A 1LLUA 4PO1A 4UOQA 2NOAA 1J0EA 2ZFUA 1TF2A 5AVWA 2W6PA 2WTMA 1YGPA 1UJNA 1KHTA 2QE7D 5GJBA 1QHXA 4IINA 4MQUA 4N54A 5K0EA 1T26A 1P1RA 4J4BA 1EUQA 3HDJA 1AOXA 3D5TA 3AEYA 2ZWAA 2P3LA 4XYEA 5DBOA 4YBZA 1A5AB 1HTBA 1ZMOA 2PKEA 3C3WA 4BIMA 5C7IO 4REQB 4CNBA 2DFLA 2HOQA 2Q1SA 2WT4A 4GEKA 4ZT6A 4YMHA 4IRMA 3HBMA 3WDKA 4RJJA 4BASA 3RARA 1A5TA 1T0HB 2GX6A 2R6JA 3HWWA 4GXNA 4LHWA 5EZ5A 2I3GA 1DDIA 2JI7A 1OWMA 4XLZA 1NAHA 1VLQA 3TCXB 4UHCA 3UB4A 4C6SA 1LCIA 3FMFA 1HYGA 1E3WB 5J2TB 2ZYHA 3DMFA 5KOJA 3U4HA 2O8EB 4URUR 4BO2A 2OO3A 1VOTA 5ICEA 3S1AB 5AUQA 1IUKA 2H7XA 1T3SA 1VKOA 3G2QA 4YUZA 3DOIA 1REQA 1Y3CE 3BZUA 5F4ZA 4BP8A 1QS0B 1V96A 1WDWB 2GJAA 1XZDA 3L4SO 3E35A 3UUFA 4LHVA 2FP4B 5EKUA 3WNCA 5INTA 4FZRA 5KTKA 3RS5A 2IZ0A 3F0TA 3RG8A 4AI6A 2X13A 1RLTA 3ESDA 1IVSA 1HE2A 1VA4A 1IK6A 2Y1WA 3K09A 4J16C 3F7OA 5H0IA 3KQMA 4MI1A 1JKJB 1FDIA 1C81A 4F3YA 1SD5A 4C4SA 4P58A 3NI2A 1A9TA 1J8MF 1FP2A 2NUPA 5KWEA 1QGUA 5HG0A 2G9UA 5G0TA 4U6QA 1SIWA 4DMCA 1WB6A 2QTVA 2YYZA 4DMGA 4ZV4A 9MHTA 3DAHA 2P91A 3URKA 1JKXA 1GHTA 2D7CA 2OV4A 2QZJA 3ONWA 4ARUA 1NJ2A 3QMMA 2AHOA 3VPDA 4DJ5X 3ECAA 3GRVA 5CG1A 5K05A 4Q4AA 2I78A 3GRZA 3TZEA 1CUJA 2W37A 5D3KA 1OIWA 4JITA 3KUCA 3ODGA 4QXPA 2ZIUB 3K32A 4WJZA 1T4DA 3H5RA 2Q4EA 2ATEA 4PE5B 5JARA 2ZIAA 4G2NA 1ZNQO 9LDBA 2QIOA 1U2DA 2VIIA 1X1RA 3PXEA 4W6QA 3LWBA 4BFTA 2PSSA 3LC0A 5EGSA 3D3WA 3LXMA 4ZI2A 5JNTA 4AO6A 1YCGA 2UUPA 4PLYA 3U7RA 4A6DA 2DBVO 5DIZA 1W36D 1W76A 4D1YA 3E9RA 5HF9A 1QRRA 5LUBA 5EWLB 3WHKA 1RWMA 1USUA 4MV6A 2HV8A 4QU5A 5WRFA 3WRXC 4E5YA 1S2IA 3JWGA 4QXMA 1JAIA 2VJAA 3OIUA 3KK0A 3OCCA 3ZW9A 3RODA 4IGIA 4I1IA 2NXCA 3ZU4A 5BVGA 2R6HA 1WHSB 3LT0A 4HSGA 4L4ZA 5JZMA 1SFRA 2NUPB 1DKUA 3CR7A 4PAOA 3TQTA 3VHRA 1OBVA 5JH7F 2BE7A 2PZMA 3HJHA 1YZGA 1ZNYA 3EUEA 4II2A 4B0PA 3RVDA 3I9V6 3MINA 3LAWA 5K3SA 1Y8CA 3I61A 4TTRA 1DT5A 2W7TA 4PG8A 5LU8A 2OAEA 1OZGA 1X9IA 4D9HA 1O9BA 1KO1A 3T4UA 1PJ4A 3GZNB 3ZDDA 3QTTA 5D84A 5DXFA 4PPGA 2NTYC 1AKRA 2VWPA 4DA4A 1KU6A 3C3BA 2FEOA 2PXXA 1W52X 3U3XA 3H5IA 5HSGA 2EQBA 5KTOA 1I1HA 1GSHA 1M1YA 2B3TA 5K6AC 1ISHA 4GE0A 3R20A 1PUIA 4JNKA 4LJSA 3VU0A 3BMCA 3CVXA 1JA9A 4NHOA 5KAMA 3UJNA 2LWIA 3MJRA 1QDUA 2JA1A 2PX4A 1I3NA 1CRLA 1U9ZA 2WK1A 3E0QA 3IIIA 3PFCA 1F8XA 2DUJA 4IGEA 3ZWYA 5CB0A 2X58A 5KVSA 2O0HA 3WYGA 1ZZEA 2R751 1IY8A 2OHOA 1V41E 1N0IA 3N2KB 3Q8XB 4LHYA 2VLBA 4WZ6A 5EIAA 2PMEA 3ZG6A 5B3JA 2CMGA 3ZHRA 1RJ9B 1SG0A 2KQUA 3RYIA 4B2LA 3VI3B 4C3OB 2CK3A 3AI3A 4E5PA 2DB3A 4UEKA 1NUQA 4JLJA 4NMXB 3S6JA 2H2GA 3RAPR 4JROA 5K9ZA 2HK9A 2BFDB 4Q3CA 3WKDA 3DEKA 2H54A 1X0VA 2A0YA 2FUEA 2JEZA 2Z58A 3CRMA 3L0SA 5D87A 4EGSA 1P7YA 3R09A 4EUSA 5TVGA 4JVSB 3TOVA 1WMBA 3N8HA 3W4IA 2IC5A 2C7QA 2FEMA 1D7AA 3UYLA 5CM8B 1QPZA 2QW8A 4Z51A 1CUSA 2XTNA 3F46A 3TO5A 4O2AF 1XSEA 5FWXB 3DWGA 2NO1A 1NBOA 2QGZA 3KCQA 4EG3A 5DXJA 5L7WA 1H2XA 1NQ5A 3PG5A 5DU2A 2VHXA 4D41A 1F7VA 4FQ7A 2JFFA 4XYLA 4DE5A 2B8TA 4TS3A 2HZBA 2HTEA 5K1ZA 4D02A 4XOUA 3BT7A 4F11A 1BIFA 2D5BA 1UBGA 1MA3A 4MWDA 3HYTA 1YK1A 1NSFA 2AH5A 4KNWA 1MV8A 1ULZA 4EEXA 1ECLA 2VYCA 1LK0A 3G2MA 3EA5A 1OWNA 3JQCA 1ISRA 2OL4A 2GN2A 4DIMA 1XTJA 1OBHA 1YIOA 1QKKA 1UBNA 2UU9B 3FUCA 4MUBA 5EJMA 3IVAA 4A27A 1DO2A 3N2KA 1AH2A 3UFBA 5MGNA 3IJEB 3KYIB 1GA1A 2QXTA 4W5WA 4DG5A 4WCFB 1XTRA 2XKAA 3V2GA 1JE1A 4YY3B 2GUGA 2AF3C 8ABPA 3QUQA 1CVIA 1E2KA 2CXOA 4ZOAA 1D5CA 4K81B 5CYPA 5KJEA 1YS4A 2G08A 2JGJA 2VTDA 1TM3E 4RD0A 2RCNA 5CP8A 3UQZA 1QM5A 1VA5A 2OBXA 4LZNA 4XFKA 4LRUA 2VBGA 3RVOA 3TOXA 3ZDFA 4YJ2A 2DH5A 1ACLA 2I33A 3OU7A 5AM3A 5K4HA 3VH4A 1Q1GA 1XDDA 2YUIA 2BC9A 4YGYA 3GUUA 4Q3AA 1JHMA 1RYNA 2BI4A 3JYOA 1IBRA 5D6OA 5E1DA 2WG1A 4N6OA 2OO5C 5AR1A 3R7FA 4OM8A 1T5SA 4PGFA 2HI0A 1JDVA 4AXXA 2XWJI 4LY0A 1M2OA 2J07A 4RPHA 2GZRA 5DNWA 5C4MA 4FU0A 4IDNA 4Z2AA 2JCBA 4BVKA 2OXEA 4ZO9A 3D02A 4FE3A 5I9NA 3GC6A 3TQHA 3NBQA 1RWNA 2YN2A 5FUBA 4CLOA 2FJPA 1UZUA 1OV6A 2H8GA 1SCBA 1UPFA 2Q5IA 3DBOB 1QPBA 1WEHA 3FHCB 3QENA 2Q8QA 4TXHA 1I3KA 3AVQA 5CR9A 4BRUA 4RVUA 2P2YA 3G0GA 1HE1C 3CVWA 1SKQA 1P5ZB 2E6KA 2QJFA 3ZHBA 1RHMA 1DTSA 3WTCA 1U4NA 1QOZA 2JANA 4R9RA 4TL9A 3EXAA 4TRNA 2JJ2D 2QDKA 4RULA 2F43B 3WSTA 3FTPA 5CB4B 2HFJA 4LYFA 4R4JA 3STVA 1USWA 3GCXA 1FDSA 2FNAA 2ZVDA 1UXKA 3GG2A 4LI0A 3P2EA 1DB3A 5E6SB 1P0PA 3PFBA 5KCMA 3UOWA 4ACBA 4UQLA 2UYCA 1MO6A 3QU2A 2DRIA 4I66A 4F3CA 1ZR4A 4UHDA 1W36C 3LWDA 4WHMA 1Z2AA 1A2KC 4R1LA 4B7AA 1DEXA 1QV6A 1WY7A 4FK8A 4B4UA 3HB7A 2HRBA 2M98A 1CJSA 3UUEA 4J0DA 3VNAA 1L7EA 4EHBA 4CMGA 1DBQA 4L6CA 2VWHA 3CJRA 4XQ0A 4UTOA 2V5VA 4ITRC 1FDRA 1YMQA 1C9EA 2JVKA 4F21A 4D43A 2A4MA 1SHLA 2IZ6A 2GLXA 3TINA 5A6VA 2HXYA 2VDWB 2OY0A 2ZJ2A 2AJ8A 1G6Q1 2VJBA 1L5MA 3MWGA 3C6ZA 4FONA 5TMPA 1YBVA 3S2GA 4LXGA 1PN3A 4MXDA 3WI7A 1E0AA 3QU7A 2PYZA 1JW9B 3PXXA 3ABSB 3ZWQA 4MW5A 4YRQA 1LTQA 1NMXA 5EQTA 2ZIFA 1GEEA 5FRDA 1M76A 1LW6E 1SRQA 4TYNA 1Z0FA 4ESVA 3LY8A 4U4AA 1WU8A 3FCSB 4GKVA 5I4BA 5K2MA 1Y4SA 4BWFB 2B2NA 4W7SA 4B46A 4EPRA 2ZSUA 5G1OA 1EP3B 4QYXA 1W85A 1GFSA 1A9OA 1QVZA 2GCNA 5B30A 1Z2OX 3P0EA 4UMDA 2VYNA 1IXSB 1T0PA 3K9NA 4H1UA 4OGWA 3TZ6A 4A6XA 2QMZA 4BN5A 1S7GA 2ZXEA 3NEAA 1FBNA 3QKUA 1KVTA 2AIRA 4JCCA 3RFCA 1JQJC 3ASZA 4IIUA 3NUZA 3OF2A 5G3YA 1A4UA 1TMYA 4OXRA 2CNWD 1FSSA 1SOMA 1WKCA 3LECA 3FY4A 3M5CA 3SF8B 4NJMB 1TAGA 2C0CA 2QPOA 2YFYA 3F6YA 3BUSA 2HBYA 4XWGA 4F46A 2EIXA 3KZMA 4TMZA 1X7WA 4U2FA 2P5UA 3CEPB 4R71A 2HHLA 4GOND 3T99A 3JYHA 3E3AA 5CDGA 1QF6A 5KYVA 3AI1A 4LF6B 1I0ZA 1Z9BA 1XU9A 1TC1A 1PJCA 1P4SA 2Q0XA 5CU7A 1LDBA 5DLDA 5IAEA 1RXWA 2B21A 2MSNA 1SUWA 1ZWKA 4I1PA 1AGYA 3NXKA 2YYYA 4G0NA 1JHZA 1NUAA 4A0HA 1O6CA 2Z2IA 2JFUA 4RZHA 2A94A 3GQVA 2PS0A 3QWBA 4MUMA 1AN9A 16PKA 2EDCA 2VYFA 1KDZA 1WY5A 3SSAA 3DZHA 1C9JA 4JQOA 3RRJA 2NYUA 3BMNA 1HE8B 4BTLA 5F78A 4LQLA 1M6NA 1J0AA 3DS8A 1QZZA 4IR7A 1W85B 2HJHA 2CL6X 3HR7A 4WVFA 3UK7A 4UOEA 4RPLA 2FW9A 1PDVA 1AVTA 3MHPA 1FDVA 4PYIA 2PS9A 1CE8A 2WG0A 3R0QA 5DX1A 1R6DA 4BCCA 1Z18A 2PT9A 2PGXA 4NCJA 3G2JA 4HAOA 5AT1A 1WZUA 2WMYA 2GNAA 3NKVA 3OURA 5EN4A 4GYJA 2YWFA 1O6BA 3BICA 2Q1XA 5ELLA 1YZFA 4DWWA 1QR2A 3OZSA 1C4OA 4KRXA 1Y1LA 2EWVA 1CEYA 3FYUA 5DP1A 5EZSA 4C5BA 4GXTA 3HFJA 1PD0A 1T9DA 2I9KA 3S1LA 1QV7A 1PV1A 4EHDA 5JC1A 5PNTA 3F90A 1ONPA 1LSUA 1XL1A 2FMKA 1VL0A 4MS1A 4TS1A 1DO8A 5JNRA 4G67A 3GVCA 3WBBA 3LBHA 4BC1A 2XB8A 4KQXA 1PR1A 4V0SA 1YUBA 3MXOA 1MIOA 4POAA 4H7HA 3CBGA 4KPYA 2X77A 2ID4A 3MF4A 4F5WA 1C1HA 1K7CA 4LSZA 2GO7A 3LPDA 1UEJA 2VYND 1GZDA 2CVQA 2EDAA 4LVNA 5KYYA 1V4VA 2ECOA 2WUEA 1RYEA 4GKAA 4KVZA 4MYUA 4A0QA 5IFKA 1EG7A 1FMTA 5LL6P 1N0WA 2QZZA 4YJ3F 3WSVA 2DUWA 2NACA 2P79A 4JQSA 1N33B 3NDIA 3LLUA 3OICA 2WSSA 1EFKA 1G8HA 1XR3A 3NRCA 2EXXA 1PZGA 1UDAA 1G291 4K87A 1VP9A 3HV2A 1J07A 1GPJA 1PT5A 3LY9A 4JXZA 3KSDO 1J20A 1TJ3A 2X4GA 2PVPA 3DZBA 4Z0HO 1P7CA 4AULA 1UBOS 4NYJQ 4NK5A 3A2NA 4BUJA 1A98A 3OJFA 4RMJA 3EPLA 4FILA 4EEKA 4Q9NA 2YW2A 3OWXA 3SEQA 1R8QA 1EJ6A 1V7ZA 4P83A 1OAKA 2RH5A 2PRIA 3UGQA 1EQAA 2W6IA 3QOFA 3R7AA 1VTKA 4Q3KA 1YKGA 2OCLA 5HA5A 3KHUA 1PNRA 1SELA 2FMUA 2XUIA 1OIXA 1YI0A 3IA2A 3LQ4A 2G9QA 4Z0NA 5EIBD 4E2YA 2RI0A 4WA7A 3CNOA 3MFQA 1LU9A 3M9WA 2XYRA 1Y8RB 1L0BA 4J2TA 4WZZA 3C7DB 1Y8QB 1GTSA 4GKJB 2WWIA 3GIDA 3U4DA 2X5XA 5LQKA 1EUDB 2AMVA 5CA1F 4CM3A 2E1RA 2CLMB 5CT6A 1V5FA 1VKNA 1W25A 1Y1QA 2FLVA 3DLAA 3I6IA 1L5LA 1N77A 5DBFA 3VO1A 4JX8A 3FWYA 5JXGA 1E4EB 5HNKA 1WVGA 2A92A 3MGBA 1YKFA 4JP3A 7ABPA 2QRKA 4NG4A 4X5OA 5KTNA 4Q3EA 3TH5A 3H5NA 4M0EA 2VJNA 3L3BA 1HDCA 1I1OA 2HHHB 4GWKA 3LQQA 4W1QA 121PA 4B6EA 2J3JA 3ONEA 2HIHA 2EWWA 5CCXA 3C7TA 3KE8A 3E9DA 2JBHA 2ZAGA 1QNFA 4HQRA 1ZFNA 4I99A 4JUDX 3HRIA 3TXAA 2O5EA 4LOLA 5AVZA 1SXJB 5DI3B 3UWKA 3MD0A 1SZJG 4XGRA 3G7SA 1XCGB 1U5BB 1QCCA 3ANNA 3ENKA 1M5UA 5J1SB 4U7HA 2FQ1A 4PX2A 1VM6A 1DG1G 3DTTA 4KAJA 4ZO8A 3WDMA 4X6UA 1GPWB 3CX4A 2C4HA 1OZFA 1WDMA 3TRHA 3TM4A 1BGXT 3ELYA 5FUQA 1ZMBA 5EJIA 2ZQ5A 1T5HX 1NVTA 1AQJA 3I0NA 3KIPA 3VPSA 2IHYA 4NOJA 5AW3A 1J39A 1U7PA 3MJEA 1U7UA 1L6IA 4OLFA 3ZV6A 4MRMA 4WXRA 2E4VA 1RBYA 4MVJG 4Q5IA 2AOTB 5KTYA 4MVJM 1I7PA 1RMTA 1BXRB 2RGCA 2ZUUA 4Q66C 2AYXA 1HT0A 2B20A 2ZPTX 1NMQA 3JQFA 3KYDB 4ZT4A 2W6JD 4LGMA 4QO8A 4EDFA 3Q11A 2VDOB 3FYUC 3GUHA 1FLAA 1QIFA 2BEKA 3N6RA 4XIFA 2RHBA 3VR4A 4ZI5A 4KXVA 1M2NA 3I2JA 4WCVA 3HGMA 1LRJA 1M66A 2XTZA 3VYRB 2H92A 4P2GA 1ZH8A 1OREA 2W8BA 1T0IA 4ETWA 5LPNA 1R4NB 3I6BA 2QTAA 2YX1A 3R7DA 3T0FA 4QJ3A 4JWKA 4H17A 1HMYA 1FU7A 4BRWA 3EUFA 1EWVA 1Y1PA 2N46A 5CA0B 4F4IA 5LN1A 5DI3A 2GK6A 3ZZNA 3FJYA 3O4RA 3KJGA 1BFKA 1D2EA 5KS2A 1E9DA 2I2XB 4BU0A 1T3HA 3L06A 4BKMA 4AJOA 1ZAKA 2QW1A 2C04A 2NZUG 3E3NA 4CIVA 1YUNA 2BH9A 1FTSA 2J3EA 3LGSA 2HPZA 3PPWA 4R0VA 3MILA 1MR3F 3E9EA 4OHUA 2BYTA 1RAGA 2O1WA 3NHYA 1SBHA 3MOSA 3P9ZA 2XDWA 5CH3A 3SXUA 3K1YA 4CLHA 3IBSA 2E7ZA 2WMOB 1M5RA 5BNFA 4PZZA 2OHVA 1VJRA 5JE8A 2NG1A 4NCXA 4JVMA 3VHQA 4BB5A 1RPZA 1DXYA 4WIAA 4JY7A 3K2QA 1W1UA 2XQKA 3OJEA 4X6LA 2H06A 4MPDA 4XR4A 5BWLA 3LLMA 4CM8A 2DWQA 2QUBA 1RHRA 1IXYA 3X1DA 2JAHA 1P0CA 1U3CA 3G2IA 5JTTA 2XMBA 3EDYA 1EP2B 1ZR2A 3UY4A 1YVUA 1LX7A 5T4BA 1BDMA 2HWWA 2GFQA 4S1VA 4ZEVA 4GVLA 2H1VA 2HT1A 4LHEA 2HJSA 1CJUC 4QXRA 3TIXB 5HKOA 4U1RA 2MSLA 2CVOA 4YRRA 5KVQA 3C8ZA 4C7MA 3U61B 2F1IA 1THMA 2A5YB 3FF4A 4NESA 3LVFO 4HMQA 2BKXA 1WUJS 3LTNC 2H0AA 3HEAA 1DSSG 1G7RA 3O92A 4DANA 2J3MA 1IEWA 3JS5A 3DWIA 1EFPB 2Y1KA 3SX4A 2PPVA 4G84A 4LDZA 4I5EA 1SCIA 3I2FA 3OE7A 1UT8A 4RK1A 4H1WA 1YRYE 3UJCA 1JDTA 3TBHA 3C41J 2JARA 3DW1X 4K3VA 1G18A 2RAUA 1ZCJA 5E2BA 3SJCA 4BV9A 2JB9A 3ILYA 5HFAA 3W5BA 1WB4A 4KI0A 4XGKA 4YRCA 3CONA 2XYQA 4OI2A 2Q46A 2ISQA 3NANA 4GFDA 1GZ5A 1NR1A 3PI6A 4KH0A 5DBGA 4DARA 2IYAA 1GT91 4FDLA 4IO0A 3A1TA 3ZV7A 4RXTA 3C70A 5KTMA 1U8AA 1XU7A 3IEMA 3G49A 1CX9B 4O2BF 1ARZA 5TS2A 4D0RA 1QP4A 4RESA 2JAQA 1IUPA 4G2TA 3THXB 3AR8A 5KOIA 2C3UA 3BHIA 3WGLA 5JMOA 4WLFA 1LXCA 3MJTA 4MO2A 3IKTA 1X7XB 4MR9B 1C8VB 3UFXA 2A9OA 5L3VA 1M2VA 1QQBA 4J0EA 1U65A 5ALRA 1IHOA 5CX4A 5AWFC 1RMYA 4GHWA 3E82A 2H16A 4HJXA 4WKPA 3OUTA 5KYWB 3R74A 5D8DA 2CV1A 1TZKA 2VDMB 2D0PB 1JB9A 4Y6PA 2XMSA 3VUFA 1N25A 2H18A 1L5HA 2VI5A 2IL1A 3B6MA 2IXFA 4KLRA 2XQFA 4V1CB 4TYWA 4QBHA 3OX3A 5K6TA 5E1MA 2BDEA 1EVLA 1EFTA 2RB5A 1Z6AA 3Q4GA 1X7WB 3SQNA 2IPLA 4PLCA 4AF6A 3VNRA 5EJ2A 1KOLA 3WQQA 3MBKA 3IR6A 2ZIXA 4NYMR 4OXYA 1R74A 1M2GA 2XUZA 3I9JA 1J6UA 4RBNA 1RWPA 5ALFA 4DABA 4MVWA 3A8TA 1WUHS 2IXBA 3CURA 3ZWCA 3GLGB 3CSSA 2K2WA 1QO0A 3OEHA 1BVRA 1KVUA 4K9LA 3A9RA 2ZB3A 4X92A 4YRTA 3UZUA 2C57A 1G3UA 5A06A 1YK0A 3QFSA 5JD4A 1Y4AE 4D26A 4J49A 1YCDA 4OOEA 1GAXA 2FSVA 5HM6A 3PD0A 3OM8A 1TPYA 2NVOA 5TF4A 3IVRA 2CUTA 2HLPA 3JVIA 2R79A 2QQGA 4GR4A 1P2FA 5IZCA 2I62A 3KKQA 2Y0BA 3N74A 2QSYA 3ZZUA 4ZOLF 4AJ9A 4AZVA 2SNIE 1TU0A 2HHCA 2E85A 3KVYA 3WGNA 2AXNA 5JC8A 1Z0SA 3H9BA 4LHXA 1DEAA 4FDAA 1AZWA 3OKCA 5E4TA 3LBNA 4GOMD 3TKYA 1H3FA 3EDCA 3NHAA 1U6KA 4L73A 1TZBA 3WLNA 3HO1A 2JIDA 2UVPB 1LI5A 4GPD1 5E6RA 3U1BA 1L2TA 1LC0A 5BWMA 3C1AA 3VTKA 2WYOA 2WJWA 5I7RA 2QP9X 2FN4A 4C3UA 3B6ZA 1PR3A 1B00A 1QVAA 1II9A 2VG8A 1V37A 3GBVA 4IL5A 4QREA 5H80A 3U4AA 3KJHA 4Y8VA 4DLAA 4LK2A 2D5LA 3DL2A 3VPHA 2MYUA 3HZZA 3PICA 4TWAA 4I50F 2CMKA 5ETJA 4OGFA 4CI9A 5HK9A 3GNTA 1S2GA 3PXCX 3D6TB 5JD3A 5DPMA 2IVFA 1XLTA 3K09C 2HJVA 4CQLB 1VE3A 3QLTA 5GM1A 1JEQB 2C1ZA 4K0RA 3TUIC 2VDUE 1PR2A 2IYZA 3GUVA 1GFZA 2WHYA 2ZUWA 4UCFA 1KZ1A 4MPRA 3EGDA 1C1DA 2NNLD 1UFOA 1RABA 2XYPA 1N5OX 1BX3A 2J59A 4FR5A 1TCAA 2Q3JA 4M1YA 4KKVA 4ABYA 2F8LA 3LX4A 4DLYA 1AA6A 4P92A 1TQHA 3W04A 5C4GB 1XGKA 5DLEA 3D6FA 1XVIA 2V7XA 1HM5A 3KE9A 2W6OA 4XCQA 4ZVSA 2HY7A 3HI4A 5AXAA 4JJZA 1XL0A 2NSJA 5IAJA 3KOXA 5ER9A 4RVCA 4FS3A 4DRXB 3RADC 1HO3A 1YU9A 1A71A 2QA5A 1XKQA 2CJFA 3ASUA 2HA4A 3HYLA 1FJXA 1VLVA 2AI3A 3M1IA 3OZ7A 1WXGA 3E2PA 1OILA 4I46A 5E6UB 1WHTB 2ASEA 5ELMA 2B5OA 3NYQA 3U3KA 5IC5A 1NKVA 4HVLA 5C5EA 1IL0A 3IP3A 3W2IA 4CKCA 3GQBA 5MN5A 4EZIA 1XXHE 5EWJA 3I0MA 5EPUA 1LWNA 4K9QA 4PRLA 3QH4A 1N8TA 3EMKA 2J5QA 1H5UA 1XAGA 2ZJ5A 5ER6A 3RFFA 3RHSA 5LMNB 4YASA 1YL6A 3E18A 5AXCA 3RYFB 2AOXA 3SHFA 3HVJA 1G8SA 5CEJA 4B3BA 3PUKA 1EQUA 2H2WA 4W5NA 3QV1A 5C8YB 1KSHA 4KXWA 1J42A 2EEZA 4JLPA 4ODIA 5A3QA 5FL3A 3X1ZA 2DCMA 4C2AA 3KKZA 2KM1A 3I39X 1L5OA 1P9WA 1FYFA 2V9PA 4C7KA 1P8JA 3D6JA 4X1YA 3WFZA 3DHYA 4MMXB 3HCBA 4GYYA 2ARKA 4PFQA 4YDQA 2O2SA 2C58A 4RPIA 2HIAA 5ALIA 3R77A 3Q7IA 4NKRA 3I2KA 1C9NA 1GU7A 3CS3A 1NW7A 1RYYA 1YE8A 2UYOA 1KA9H 4YMVA 1Z0IA 2BDUA 2RHGB 3IQXA 1O7JA 2AN9A 3RK4A 4UVGA 1IPHA 1T5LA 3WXBA 2J5KA 1IQUA 1DRUA 5EMLA 3V4SA 3ZPXA 5HOQA 1E4YA 4M0LA 3JWJA 2ZYUX 4H4EA 2WYWA 5IARA 3L7LA 5EESA 4ESEA 1EEHA 2F55A 5DSXA 3VTAA 3COPA 4Z49A 4NXMB 1U1FA 3UAVA 1WQ4A 1CUAA 3A05A 3U6KA 1L4BA 4PONA 2C9DA 2VRCA 4JBGA 2PWZA 2YWJA 3WADA 4F8YA 3S5JA 2WVAA 1PZXA 4ROTA 1M83A 4DV2B 1IULA 4AZ0B 1K68A 2WD9A 2IOHA 2V9CA 4OSPA 2I80A 2DGDA 3DXFA 4HQFA 2G1KA 1KJ8A 4TLCA 2ZT6A 3Q9NA 2BKLA 4A6PA 2D1RA 3NHKA 3RLIA 4ZQEA 2EKLA 2PFGA 4EDHA 2HXGA 2FZEA 2H1RA 1XI2A 3D5QA 3UB2A 3A7DA 5A5FA 5EJ7A 4YK7A 3DZGA 2CHFA 4EYEA 1LDEA 3IBCA 4LPKA 4N3NA 1L5KA 1VJ1A 3AJAA 5ESWA 5I3CA 4CI0B 2F17A 4QQRA 1YVEI 3ETDA 2QM3A 4R51A 3SNHA 4EKEA 2GYUA 5EMKA 2VDPB 2OCIA 2HKIA 1M6VB 1JIXA 1DBPA 1D3AA 1UKCA 2O7NA 1RWWA 3F8SA 1EFRD 2J6IA 5IM4F 5ESRA 1HLPA 4N3GA 1XNHA 1HSZA 3F9CA 3ORFA 1UOQA 2IF2A 2BONA 2FQXA 1AZTA 2B3DA 2GK7A 4N49A 3WIEA 5H8WA 4KWIA 4Q93A 3D7RA 3PXGA 1PBNA 2OE2A 4DMKA 3CRW1 1EZ4A 2R8YA 4Q7JB 4YP7A 3RJ9A 5KNCA 4FKZA 2J48A 1XTUA 5IM4A 1BMFA 2IYNA 4PAMA 3ON5A 4JMPA 3RVRA 2FRXA 3N76A 3RS9A 3BRWA 1IE3A 2ZSFA 1LA2A 3Q10A 4LSGA 1LPOA 1JECA 1BA2A 2J9GA 4RJLA 5L7YA 1B6TA 1MG0A 3DH0A 1WA5A 3RIGA 3TGLA 2H1FA 3BMQB 3S2UA 2P78A 4LJYA 4X64B 3MW8A 2OBMA 4S2EA 4YR9A 1BRTA 3K5PA 4HUJA 3E7DA 2EATA 2BR4A 1N0UA 1Z88A 3LPLA 2BFCB 1NQVA 3L8ZA 5ALTA 3THRA 3G23A 3JAWA 4UAJA 3FAZA 1BVUA 3HYCA 4QNMA 5CAEB 3G2PA 5KINB 1TUEA 2CF5A 4J8PA 3F2IA 4RKQA 4L9AA 4X93A 2C5AA 2QL9A 3C5WP 2AZDA 2V0CA 3CKKA 1C0IA 3GCZA 2WICA 5IT5A 3DBIA 5E9QA 3P94A 2GARA 4HDQB 1EWKA 3SXUB 4CG2A 1SUSA 4ITUA 1BDHA 1W93A 1KIFA 3VPXA 4W9NA 3W6PA 3W3ZB 1B16A 2ISSD 4OD0A 1KQNA 5IT0A 1AGPA 2OK8A 2WAAA 1U5AA 2ZM5A 3RF6A 2Q5QA 3JYPA 3OLVA 4RVSA 1NE7A 1GKLA 3EIUA 5FI5A 1E3LA 3EEIA 1JALA 6REQA 2P65A 4XVRA 4YWHA 2WJVA 3DLTA 1VGRA 3HCFA 1NBAA 2F6RA 3WL8A 4IZ6A 5K4GA 4YRPA 5MN6A 2QLJA 3FMOB 5CXXA 1OF1A 1J5EB 3IQZA 4LNAA 5HIAA 3QGMA 2GERA 1I94B 2V59A 3N2LA 1NVXQ 3IIKA 1EVZA 5TQ2B 4ZCTA 4HMPA 1JF8A 3M4YA 5EE9A 1TVKB 2ZDGA 3JQ8B 3ICCA 2C4WA 1CYEA 5FUWA 1OX5A 3DC2A 1JEJA 1L7BA 2VDVE 4P36A 4PHTA 2CMDA 1QP7A 5HCUA 4EPYA 4C2TA 4KQWA 4M4SA 4YJHA 4JSTA 1F0YA 3ND6A 1A27A 4MKXA 2WD7A 4JJIA 2GCOB 2OV3A 2WFLA 3G2NA 4KO4S 2YN4A 4N4AA 1PNQA 3IXLA 5BSFA 3A6DA 4AX4A 1OFGA 1P81A 2FH5B 2Y6UA 4H0NA 3HVIA 3VU8A 9ATCA 3TSOA 1MFPA 1O6GA 4J9UE 1D09A 5AW7A 2XUFA 2G25A 3HA5A 2VP4A 3H8VA 4LOAA 4OQNA 3ZHYA 1SJ9A 3QUTA 2YY5A 3JQBC 1OJLA 4I6EA 2VJMA 3R6GA 1RC8A 3QEJA 3CWQA 1ETHA 1C4KA 1YGYA 4IQGA 2DTEA 4B2PA 1JS1X 4Z5XA 5C81A 1ZJ5A 3HWSA 1T4CB 3W3AA 4LC0A 2AMYA 3JXEA 4TXLA 4ZU3A 1BJTA 3OLYA 4TMFA 4NXNB 1HT2E 1POWA 1N8SA 3FRIA 4BLVA 5C8YA 5CNKA 1K86A 2BFBB 1OI2A 1S0UA 1GQQA 3VC1A 1WO8A 3RSFA 2F3QA 2GJSA 5FQOA 5K8LA 3TTWA 4MYCA 4ECEA 3ZGXA 1I14A 5EXXA 1U3UA 3V34A 4HYTA 3CNLA 2HCFA 3AJ8A 2ZE8A 3CEAA 3M9LA 1YB6A 2LV8A 3MERA 1DFGA 4DHEA 1Y4UA 3PUHA 4FSDA 4B6JA 1CUVA 3SICE 4TQGA 2FQYA 2C8KA 1JGTA 2FWRA 2ZKLA 2WLTA 5FOQA 2ID7A 4FGSA 4WESB 5KWSA 2FP4A 2XNDD 4XFDA 2YQ4A 2XVAA 4YCAA 2YXEA 2FSFA 3P19A 1YH3A 4NV1A 3MWDA 3S5UA 1TECE 3PCXA 1LPMA 3UT6A 4A2QA 5KOHB 5EIHA 1E99A 1VL8A 1YZTA 3FOFC 1AKEA 4OOFA 4A2WA 1CEQA 3ZCVA 4CCYA 5JU6A 5KC8A 2C7BA 1XAJA 1RRGA 1PFQA 4OXIA 3SS8A 4EA7A 4UDOA 1IRIA 2C9YA 1Q1ZA 2W90A 3V33A 2UZAA 3ZTWA 2JFQA 4KQCA 3GCWA 1AHPA 2E5LB 4PO8A 4O3MA 2HWYA 4XWKA 4RTSA 2A0WA 4QG3A 2J0EA 5E7QA 1SA0B 3P9CA 4MUKA 3HRKA 4QATA 2ZI6A 1NLMA 2BFBA 2JASA 4FYWA 4FW8A 1TGYA 3DMTA 4I50B 2UVPA 4RK7A 5E6RB 1G7TA 2QL6A 2IUTA 3SY8A 1C0LA 1E8DA 1BZYA 2HPHA 3NT4A 4TV9A 4CL0A 1CNEA 5J4VA 5DBIA 4BE4A 4MMYB 2WZCA 4GQIA 4Q4JB 2PRKA 4OBEA 3BCSA 2PS1A 3I64A 4KRGA 4N01A 1WDTA 2YZ2A 3TVDA 3KOWA 4OFXA 2OXCA 4FMCB 1UOPA 2JJ2A 3EZGA 3A4IA 2XUOA 5KU1A 1TRKA 4CQLA 1KJIA 1U1CA 3R75A 2GXUA 1UC4B 4R1TA 1CUUA 3ZE8A 1GZSA 2DECA 1DKPA 2VDKB 3MWDB 3AVYA 3NM5A 4IWNA 2OQVA 1GAEO 3ISVA 1SVMA 4GR5A 2PFKA 1USKA 4CCYB 2DFPA 2QS9A 4QYWA 3ZX4A 3TR5A 2QU8A 4MW2A 1NNI1 1JNXX 2QVXX 3E1GA 3BXXA 4QAJA 3AHCA 1BOOA 3DE6X 1SXQA 2PUDA 3PNBA 2EFYA 1GARA 3AUTA 3PDUA 5JH7A 5KSWB 4FCCA 2BGTA 4FBLA 1KERA 2PGLA 1FP1D 2BUAA 1CZKA 1IHPA 1PQUA 3MMZA 1P1KA 4OUDA 4UKDA 3VKUA 3K5IA 2WJ4A 1XTSA 3OZTA 4IIJF 3VR2D 4CL8A 1FLVA 5DW0A 2WTUA 2JH9A 1JIVA 3BA1A 4N0QA 1Y6RA 3BDIA 4ZYXA 4TV8F 5LM3A 5CNIA 2DFVA 2CXTA 3BMXA 3LMKA 4DYVA 4BVEA 3ETEA 2IQIA 3D7MA 1HLFA 2OSVA 2BEWB 3WKAA 3KU1A 4GWGA 4IS2A 2PRZA 4JUAA 2JCSA 4ND6A 4CMIA 5JNUA 1MOZA 1HT1E 5D5QA 2PLRA 4OXQA 5A9RA 3DUFA 2HUNA 2EIHA 2GASA 4LOHA 3L01A 5FWYB 3VM6A 4Z1MD 3SVTA 1ZBQA 4HC4A 3B2EA 3VNQA 5BVHB 1VB5A 4YROA 3F8WA 3MVEA 1OT3A 4C7XA 4HLUC 2JDIA 1G17A 2GAOA 2WJZB 2ZYDA 4MQ4A 2QX9A 5I9MA 4EI8A 1X1CA 2NTJA 2AUMA 1C7QA 3IDZA 1JBEA 3OC6A 4OF4A 4PAQA 1GKIA 2ZE5A 3DEZA 2CNDA 2FY8A 1HDEA 3PFIA 3F49S 5DT2A 1G4HA 1X3LA 4GOKA 2VATA 1M33A 1DX6A 2PBFA 3BHNA 3H5WA 5CNMA 3TN7A 3WLTA 4YCLA 1DZIA 1QYIA 3BORA 3GJQA 2IYPA 3FFBA 1A1SA 2PVSA 2YL2A 3OH8A 2BLNA 4Q03A 5U4QA 5LJLA 3OEED 5DNEA 4QPNA 5LDHA 4E2FA 3SQWA 2BGGA 2OQIA 4WECA 1LBHA 4KXUA 3REQA 2WI8A 5KEIA 1L5RA 3G79A 1TB4A 4ZVPA 2QHXA 3G0BA 1GP2A 1VPTA 1W5SA 2GMWA 1CF2O 3R5KA 4FXPA 4P93A 3U2QA 1XTQA 1C7IA 5DGTA 3UJ6A 1Y82A 3F71A 4M8IA 5TQ0B 4UAUA 3WHPA 1VXRA 3TLZA 4AJ2A 4CMEA 1WBJB 2W4IA 5ELXA 1RQGA 2X1MA 1RAAA 2PLFA 2BGIA 3D4LA 4JJGA 1E5TA 2C20A 3HJTA 3W4KA 1ZI9A 2XNHA 3ABIA 3BCHA 4Q7EA 3UUWA 1ZD9A 5DX8A 5AOAA 1LZLA 3G5LA 5JYDA 4ZMRA 3ZHUA 3D2LA 2PXHA 4ZZ3A 4KRFA 1DKNA 1WQ3A 1SQGA 1W4BA 3NV9A 3U13A 3FVRA 3U1TA 3C48A 2F1RA 2IIPA 1TA0A 3GPIA 4EG4A 3U5ZB 5HMLA 3TNDA 2AEJA 3C98A 4Q7LA 4CCSA 4HADA 4V0KA 4NZZA 3C15C 5IC6A 3L7KA 1WETA 2ORIA 2HL6A 3OLXA 3OESA 1U02A 2WDPA 3FTDA 3NOOA 1VJCA 2XOKA 1Q3KA 1HNNA 1GPMA 3ECCA 2QR5A 2ZZKA 5LYJB 1LQTA 2NU9A 1TRHA 1DJLA 5C8YF 5EJ4A 5IEJA 5DRYA 2P9YA 2XVXA 3CLRC 3TZQA 4LVCA 5CX1A 4E46A 3PHGA 1VCHA 1MZPA 2DQKA 1CWUA 3C8DA 3Q3JB 4A26A 5TQ0A 3CZQA 5CMLA 1FSFA 3UG6A 2R0QC 3OZFA 5DV9A 4K6GA 1K8YB 1MRNA 1U0NA 4U3JB 3Q8LA 3BAZA 1ESNA 1GILA 1SCKA 5F23A 1NT4A 1H2AS 3H18A 1J9ZA 1WCXA 3IB3A 3RVMA 1OXKB 4GAEA 2ONJA 3QU9A 3R44A 2ZYWX 4UBNA 1E94E 1DX9A 1YOVA 4GMXA 4IFBA 5LZ5A 1QF9A 2DSNA 3M4JA 3P52A 2RBEA 1HTTA 1OLOA 1V47A 2GEBA 4JP1A 4MVYA 1XZEA 3EA4A 1WWKA 1PJ2A 3CXRA 5F3DA 5AXBA 5LZ7A 3FNFA 2F1HA 4BFUA 4F4FA 2AWNA 5FFNA 3LUGA 2X9VA 3AL3A 3IBGA 3ZE1B 1M9NA 4GDFA 1T5OA 1KMIY 3IKVA 4XYGA 1PKXA 3RC7A 4L07A 4YB8A 1TAHA 1J0XO 1JG7A 1GT6A 3OZDA 1WXHA 3I05A 3Q7RA 4NIMA 5GJWC 4YYEA 1UMKA 4NATA 4YRIA 1BXKA 1PP4A 4U2KA 1X1QA 1KMMA 1NNUA 4OMDA 3DOFA 1KF0A 2VUHB 4ENQA 4QFBA 1X86B 3H8WA 2G7MC 4MULA 2GEJA 3C5CA 4L0MA 1QH8B 2A0FA 4GQBA 1WABA 1VE5A 2HHJA 2VCYA 4DZZA 3M6VA 4FDUA 4YNBA 4CQMD 3RJTA 2NV2B 1VG9B 3DLPX 4DJFC 4KNYA 4EKIA 5DT9A 1YA4A 4KYUA 2WFAA 3R0VA 5GMOA 2A9FA 3CYFA 1M0EA 4WXHA 3QF7A 2OGUA 3LDGA 1J49A 4CM6A 4MQ5A 5KJFA 3A6LA 1SHUX 4TUYA 1I7DA 2IY7A 1ORTA 3RTBA 3HBAA 1C0PA 5FFFA 5ISMA 1UBEA 2H08A 4BX8A 4DCCA 4ZYWA 3EWIA 4PO9A 3IELA 1AHHA 3LCMA 1K6MA 2OD2A 2K7FA 2BR3A 2VRBA 2WU8A 3MCVA 4KYVA 4BNKA 3GAFA 4Z7NB 2XZTA 5HRCA 3ICOA 2MSCB 1QJCA 1JVSA 4V38A 3V3TA 4UZSA 3HVHA 3K0EA 2GJ4A 4RDCA 1W5AA 4X9XA 1WJGA 2PAAA 4MX8A 4YT8A 4M55A 1GG5A 1PDWA 3OCJA 4G26A 4Y2QA 3RU2A 1JEOA 4YV1A 3VX4A 4B09A 2WJHA 4BNIA 1Q91A 4ZP1A 1LW7A 4D57A 2AJDA 4QYSA 4DTIA 1N6PA 1KY5A 1YQTA 2C2HA 2XCOA 3I9LA 3QPAA 4FMBB 2F64A 4HEQA 3LF1A 2DLCX 4GEGA 1VRVA 1O0SA 1T0JB 4EENA 1ECGA 3FSGA 2RC5A 1MJGM 4BO3A 4AJHA 4LYYA 1E7SA 1JEYB 2YJ4A 3V7FA 4F1WA 1QCYA 2OENG 2E9SA 1AV7A 1HL7A 3MPUA 4GZLA 4PNHA 3QW4B 1U04A 4R1SA 1Y9EA 2Z3WA 1DAEA 1NTRA 2CXQA 4JEHA 5F51A 4OBBA 3RS8A 3EZ2A 1Z0DA 4MA5A 1N2CB 1V8OA 4M8KA 3HFSA 5JSZB 1H66A 3HQ4O 2K2QB 3ZN2A 5LBTA 3ZC3A 1A9SA 2E48A 3ZWWA 3DE5X 4EUNA 4EI9A 2ZIEA 4IEFB 1YQGA 3OO1A 3PNLA 3ZQJA 2JHAA 1XQ1A 3AUUA 3IHWA 2H4JA 4YQEA 4B32A 4CEHB 4YQZA 2F1JA 2IDKA 1AO3A 4V0LA 5DXAA 3KM0A 2C42A 5EGNA 2XCUA 4NICA 4HXYA 1D1QA 1CUEA 1TQ2A 2X6RA 4NZMA 2XRZA 1M5TA 3KQNA 2I2CA 3IIEA 1TD9A 4BJ5A 2G70A 3E9QA 2RGWA 3HRHA 3PGMA 3PR3A 4Q16A 1DQRA 4K9NA 4R81A 3DKKA 3TS1A 2QTFA 4EUFA 4NJEA 2G0AA 2Z2JA 1IN8A 3QYPA 4B0OA 1E6EA 2VZ8A 3QSYA 5EHZA 3HH8A 2XRYA 3L8GA 1ICEA 2MSKA 2XJ4A 1Y3BE 3BB3A 4RIGA 2Z5GA 3QPBA 1Y9ZA 3TLGB 1U5CA 2ACVA 1TU3A 5TEVA 4FZ5A 4I3HA 3PFNA 4DV7B 1BJKA 1ISMA 4ARZB 4LXYA 3ZI4A 4WJLA 1S02A 1RHKA 4ZI7B 1TTHA 2A3NA 1SY7A 3LHSA 5SY6A 1GGHA 1G98A 3UC9A 2C1EA 2D5AA 4MKRA 4QHTA 4HH0A 3WYCA 3FUVA 5KYYB 1BQ3A 3LHFA 2SKCA 2ZTHA 2ZBVA 3PUYA 3IA7A 4HFJA 1X38A 2X8WA 3QBTA 3RPEA 2CVZA 4BFCA 3W9UA 1N1MA 4TVSA 4ALMA 2AQIA 3EZYA 4W5QA 3RUIA 1SVOA 4FUTA 5LD2C 3FOAA 2ZREA 1N2OA 1PKEA 1XHEA 4CDRA 1ZZGA 2R1ZA 3OCUA 2NSLA 4UVEA 4XYBA 1WW8A 3EXIA 1T8SA 4F2DA 5HUJA 4OAQA 1O4WA 4Q47A 3VZPA 3GEDA 5AJHA 1J33A 3AHJA 2IYQA 4GSKA 4NJEB 2EYUA 5KI6A 1CUXA 1QF7A 3IAS1 4H08A 2PRSA 2RKOA 1ATIA 2X22A 3HUTA 3G2KA 4MVCA 4XCXA 4CIYA 1UKZA 5FUXA 4H6PA 4BY9E 3A4LA 4WLNA 1EVQA 2VPQA 3BXFA 3UXEA 4MIEA 2G88A 5IJ9B 3UCXA 3URMA 1KARA 4KN5A 3R9XA 1WX1A 3QYJA 4BX2A 1CEEA 3ADPA 1FFHA 1X7YA 4Q4AB 3SFTA 4AAYA 1ITZA 1T8PA 4ASUA 3I37X 1W34A 1UZAA 5IASA 4O4IF 4E21A 3DLIA 4DCTA 5HS4A 3GJTA 1J90A 3DFIA 3TNJA 4ENRA 3JW8A 3GEEA 4W1PA 1JQKA 1P44A 2FFQA 2RGDA 2V6IA 2ZI5A 3IP8A 5IW8A 5CG2A 5GZ3A 4O4HA 2O2ZA 1XZHA 2AFHA 3CX3A 4B8ZA 4CCWA 3L2OB 2RK6A 4EM6A 4JYPA 4RA9A 3IUBA 2IPAB 4R5MA 1U0EA 2FDXA 3CKLA 4J9VA 1JU9A 4ND2A 4Z8XA 2WAOA 3EXFA 3QF4B 4BMOB 3N6XA 4L28A 5TLSA 4XD7A 5HZHA 3BWEA 3EXIB 4DQLA 3KQYA 4O02B 3QX3A 2W2NA 4R1UA 2BMDA 1BNCA 1BYIA 2HLDD 2O7SA 4QG7A 1E77A 4G5RA 1SXHA 3ZGYA 1E5QA 2Z5VA 4FGUA 2REOA 3RANA 3V8QA 1IM5A 1Z16A 1PJRA 1ZIPA 2RK3A 4TLBA 4YP1A 4CF7A 4O2AA 4D4GA 4IOKA 1R1DA 4P4SA 1W5BA 2W4QA 1E0KA 2EP8A 2G09A 2OOKA 2XE4A 4Y6OA 1ZJZA 3CMMA 2DFNA 4BEVA 3UHFA 2HF7A 2VZ0A 5IM5A 1NVBA 4EGAA 2JI8A 4AP6A 2ZR8A 4N39A 1CS4C 3H9GA 2DQ4A 1AUVA 5JCJA 4OQMA 4UZEA 3H84A 1G21A 2NADA 5C8DA 1IEQA 2Y77A 3FZQA 3QM1A 3RSQA 1TZCA 5C46F 3NXSA 2ILTA 4BTEA 2C7VA 3IEUA 3TEFA 2ZSDA 3O4VA 2G40A 3X1YA 3GLGE 4QPCA 4Y67A 4KSYA 3VO9A 2AUTA 5EUCA 3CLVA 3IHLA 5HQ3A 3W1VA 3V2UA 3L84A 1EDBA 4H4DA 2FW1A 3H4TA 3B3GA 3SHVA 2IBSA 1U3WA 4Z4IA 4M1ZA 3ORHA 5HBGA 1RJ9A 3RYIB 1EWRA 3MM4A 2GXQA 2GH1A 1CEXA 3CEHA 4J75A 3ETNA 1EFHA 3N70A 2NU8A 4BNXA 1WL8A 2C2YA 5LSAA 3FKJA 3ZWKA 4R9VA 3BWVA 4EJ6A 1U0GA 4LHSA 1E9RA 3A4VA 1KOFA 5BQFA 2FWMX 4L22A 3GDGA 2QDXA 3SKVA 1XLUA 1QWSA 2DBZA 3GFFA 4EMBA 421PA 3BSFA 3D31A 4YJFB 4DKJA 1A76A 3I73A 4JUIA 3V4OA 4ER5A 1Z83A 1KDRA 1THZA 1EGQA 1QCDA 1U3FA 1G5QA 2RGYA 2ZSJA 3GFQA 3H1EA 3IDQA 3R4CA 2ALJA 5JCPA 4CMBA 3U9SA 4FMCF 5IC4A 3AJEA 2UKDA 3V9PA 3EZ9A 4EUKA 1HDXA 4K9KA 1BE8A 1AC5A 1Z5OA 2X6QA 3AM4A 3DAPA 3OO0A 4J0KA 4RJ2A 4U8GA 3RUAA 1VZ3A 2EFEB 5DHTA 4E07A 4EMUA 4RMNA 4EOGA 4FFMA 3U39A 5BOSB 2G83A 2ZCJA 4AB1A 2CJPA 2X41A 2QTCA 2W5UA 4H7EA 5DNVA 4AW9A 3AY3A 5I6DA 3GFTA 1UKAA 4RE6A 1BMQA 4FLEA 2QD1A 5ED0A 1T1JA 2UZ4A 1NT2A 2R44A 1IVYA 3PJDA 2NU8B 3UWDA 3UB3A 2NP6A 2HFKA 2ERYA 3BMNB 4C5AA 2X3FA 5IYZF 2NVUB 1IBKB 2OP0A 1HZZA 3VR5D 4N0MA 3DNFA 4MV0A 5LZ9A 4CBVA 1HDGO 2WSSD 4V0OA 1GPH1 3LPAA 4Q3LA 2PBZA 1ZJJA 4QFCA 3ZNQA 4PG5A 4F60A 3VOSA 3AF6A 2GF9A 1RXIA 4BO9A 2JVJA 4DPLA 1XPJA 5AUNB 4D3YA 5BRAA 1J97A 2YOHA 2RHLA 3MWEB 2GF0A 1P17A 2VQ3A 4KRYA 1D7OA 2BGRA 2X9NA 3YASA 3X2EA 3DZFA 2TMGA 3HHEA 3RBAA 4PRKA 5BOVA 1BTOA 1NVUQ 1A0OA 4MP3A 2AS0A 2WHPB 1Z4OA 1CY7A 4LJ9A 2YWXA 1EDDA 1C3LA 2OC9A 4E2ZA 4LJLA 2CV0A 1WTCA 2J5BA 2GNOA 2J4CA 1K6XA 3STXA 1KO7A 3EVGA 3M1YA 4P32A 3K1AA 4B34A 2I8LA 4XSHA 3MTGA 3CEJA 2VXYA 3I6MA 3O38A 3AR6A 4UUBA 1M0SA 4IOLA 1DV1A 1COZA 1TKBA 4LZLA 4EHIA 4NMLA 2P6MA 3CWCA 5CB4A 4FSHA 1SUIA 2NZ2A 2X5NA 5EXTA 4QPPA 1EE9A 4KVAA 2NZVG 3DKIA 5H5JA 3RU9A 3T15A 3DJFA 1KHHA 2HYDA 3UENA 4FI3C 3GBPA 1XV5A 4ID3A 2OXFA 4P31A 4M9CA 4BWGA 4YRJA 4UU1A 3RVPA 4RGVA 5EYPB 1ZVMA 4F4JA 5JDCC 4GLLA 3U80A 1G8AA 3SE7A 1ST2A 3G7NA 2M6KA 5JYCA 1FSPA 4GT1A 1MDBA 4EF6A 2II6A 2FZCA 4TS4A 4ZU1X 1VKRA 2MYPA 3UK1A 4DA0A 1YC5A 5F3WB 4BUZA 1DDGA 1DC4A 1U8EA 2RDMA 5G4LA 2BR5A 4A0RA 2M6LA 2E18A 2GAJA 2NU7A 4YRLA 1IY9A 4XWWA 1Q7TA 3KTDA 5C80A 2IZ5A 3L6OO 1X7DA 2UZ3A 3LDFA 4QXQA 1NOIA 4N0EA 4LJ8A 4MRSA 5CW1A 5TIIA 3RAGA 2ZRGA 2FSUA 1AUQA 2JGDB 2DHRA 4Z4HA 2VP0A 5TGDA 3E23A 4WADA 1QC5B 4D44A 3T7SA 3M2PA 3WK5A 3WLKX 4B2IA 1OH6A 2SBTA 1J25A 1Y8QA 3NHLA 4HY3A 3W05A 4NQRA 4WSOA 5BSKA 3TQRA 1FZTA 4YWJA 4EZBA 2FWAA 4O4JF 4OB7A 2FSIA 4G4SO 3E9CA 1C5KA 2AG1A 3IEKA 4RZQA 3ASYA 1XZBA 3GH1A 3TR6A 1EXMA 1N1EA 1HE5A 1SD1A 1I5EA 4IG9A 2CLOB 3WB1A 3VYVA 4Z4CA 4KWEA 3LLSA 4KR0A 1PNTA 1XYVA 2AGVA 2ZBUA