3MMXA

Bacillus anthracis nadd (banadd) in complex with compound 1_02_3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
188
structure length
180
Chain Sequence
MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of bacterial nicotinate mononucleotide adenylyltransferase with inhibitors: implication for structure-based drug design and improvement.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords nicotinate-nucleotide adenylyltransferase
total genus 53
structure length 180
sequence length 188
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3mmxA00
2I1LA 2A86A 1MB2A 3N05A 2A1UA 3VGJA 1TYCA 2J08A 2TS1A 3CVWA 3FETA 1O95D 3IMEA 1NUPA 3H97A 4MW1A 3AKZA 4G5FA 1R6TA 2CYAA 3JXEA 4ZCQA 1H1TA 2DETA 5FO0A 4RUKA 3LCJA 1I6MA 3CLTC 3CLRD 1NUSA 4MW6A 4NDAA 4ZCTA 1EXDA 1N2EA 3KT0A 2WQ6A 3P0HA 3TZLA 1EFPA 2RE8A 4G6ZA 4PBSA 5TEWA 1PFYA 3FWKA 2H29A 3SZGA 3MUEA 3RK1A 1QU3A 1KP2A 3COYA 1EFPB 1GLNA 4R2MA 1NUTA 3H05A 3ZJVA 3LE8A 2DUMA 3TQIA 1R6UA 4ARCA 4HJRA 3IMCA 1Q11A 1KP3A 2CT8A 3E27A 3COVA 3N2YA 2WQ7A 4MWDA 1N2OA 3CLSC 2E18A 5FO1A 1OBHA 4DDMA 1N2BA 2J5BA 3MMXA 2J09A 3FOCA 3GLVA 1WQ4A 4MW7A 3ILVA 1TYAE 3IUEA 1O0BA 2V0GA 5F23A 4MAFA 4L2IB 3GUZA 3RK0A 1U3DA 2HMAA 1ZJWA 2D54A 5J59A 1IQRA 2B7LA 3MLAA 3HL4A 1J1UA 3FHJA 4J76A 3CR8A 1I6KA 3G5AA 1GTRA 1GTSA 1OWMA 4HK4A 5IJXA 4FZJA 3ISJA 3PRHA 3AL0C 2E89A 4DNXA 4XFJA 1WXGA 1N3LA 4DLPA 3FNRA 5HUJA 2A1UB 3X1KA 3A2KA 3PNYA 4EF6A 4G5YA 1EJ2A 4I6GA 3NBKA 1PG0A 1JGTA 4QBTA 2CUZA 4QREA 3MXTA 4DJAA 1OD6A 4MWCA 1JHDA 1KH3A 3SZ3A 4PBRA 3P52A 3TS1A 1JMVA 4ZT6A 4ZT4A 4Q93A 1U3CA 5HUHA 1X8XA 1NSYA 2X1MA 2E0IA 4MULA 2PFSA 4PBTA 4MLPA 4CQNA 1WQ3A 2HGZA 1M8PA 1O5TA 1H3FA 1IQ0A 1TYDE 1WXHA 2CFOA 3AG6A 1O6BA 3IOBA 3KT3A 3PXUA 1OWPA 3SEQA 5J58A 3FI0A 4DE5A 1IH8A 3TZEA 5DK4A 3UOWA 2PZBA 3ZXSA 1QTQA 3PNVA 3K32A 4CT0A 1NP7A 2G36A 1O95C 1F7UA 5H7XA 4QRDA 4JZYA 3ZUGA 3Q4GA 3FDXA 3DPIA 4KPUB 1U0BB 2JA2A 2DEUA 4AQ7A 1KAQA 3SYTA 1UFVA 2XRZA 1N75A 1QRTA 1T9GS 3NBAA 3LOQA 4K0RA 2X0KA 1QQTA 3FIUA 3HFJA 1J20A 2JANA 3A04A 2EL7A 3KT8A 1OBCA 1KH1A 4S1OA 1BS2A 3UY4A 4WNYA 1N77A 4ZT2A 1FYDA 2VTBB 2OQ2A 1TEZA 4X0EA 2A88A 4XFDA 3IVCA 4MWEA 3F3MA 4UZFA 4UZEA 1YIDA 4ZCPA 5LLTA 3GMIA 4AS1A 1KR2A 4U8HA 2AG6A 2DERA 2X3FA 1M8KA 1M8JA 1WOYA 5KHAA 4ZCRA 1S4MA 3OTWA 3C8ZA 5DB4A 1NI5A 1ULHA 4MUGA 2DLCX 3FG9A 3RBAA 1PFWA 1OWOA 3DLAA 3CA8A 1MC1A 1H3NA 1K4MA 2X1LA 2VTBA 3CVVA 4YP6A 1NUQA 3TNJA 3L92A 1B6TA 4JXZA 4MW9A 4ND6A 3IUBA 3Q12A 2DPLA 3IODA 1ZH6A 3U1VA 2QJTA 1G8HA 4MUFA 4I6JA 3H9BA 2GM3A 4DDHA 2DXIA 1X6VA 1PFUA 1SURA 1YUMA 2NZ2A 1ZUNA 1V47A 2PIDA 1PFVA 4EFKA 2QUJA 3P0JA 1XNJA 2QUIA 3CVUA 2QJFA 3P0IA 2EJCA 5TGTA 5HG0A 2O5RA 2A1TR 5IHXA 1TYBE 3QTTA 1Q15A 3TQOA 2PXHA 1TFUA 2IP1A 1H3EA 4ZT5A 2Z3VA 3UMVA 1MJHA 4MW4A 3CLTD 3IVXA 5LFAA 2CV0A 4TS1A 3D6VA 3QE4A 1KH2A 1U7DA 2QTRA 2JAXA 2IELA 3NV7A 2A4MA 5DASA 4MVXA 3INNA 1O97C 3ELBA 5TS2A 1F9AA 1OWLA 2V0CA 3UC5A 3HV0A 4OUDB 4L2IA 3HGMA 1KQPA 3IDFA 2WB2A 3K9WA 1IQUA 3KFLA 4NZPA 3AIIA 4MUHA 1LI5A 1QRUA 4XSVA 3CLSD 4NX2A 1IHOA 5K0TA 1M1ZA 3CLUD 1CT9A 2HZ7A 1XJQA 1WXFA 2BTEA 4CDMA 3CLRC 1N78A 4GU5A 3IMGA 3RHSA 1J21A 4GRIA 1OWNA 1JZSA 3N8HA 4OUDA 4ZT3A 2ZUEA 1GPMA 1GAXA 4MUKA 1ILEA 1RQGA 1KAMA 4A91A 4EG3A 1QU2A 1VLHA 1JIJA 4EGAA 1F7VA 4ARIA 1O94C 3SDBA 4EG1A 1IFXA 3L93A 1I2DA 2A84A 3PNBA 1VBNA 1FFYA 2CYCA 2YWBA 1P7PA 4WSOA 4I6EA 1I6LA 4NATA 2E21A 3S3TA 4KKVA 1EUYA 4YMIA 2D5BA 1YUNA 1MAUA 4MW2A 1VL2A 1EFVB 1MBZA 4EG7A 1WXIA 1N2JA 3IOCA 3ZXIA 4MUJA 3CVXA 2BYTA 3AFHA 1MB9A 1NUUA 4ZT7A 4MUNA 4MQ6A 1EUQA 1Y42X 2YXNA 2Z08A 3BL5A 1WY5A 2O8VA 1K4KA 1MOPA 3H99A 1WKBA 3X1JA 1T6XA 4EG8A 4JFAA 1T6YA 1PG2A 2IJGX 4MW5A 2QTNA 3COWA 4BWVA 4MUIA 1COZA 1XNHA 3ZJTA 3QTBA 5EKDA 3FH0A 2RD2A 1JIKA 1F4LA 4U7JA 3FY4A 2YY5A 1WJGA 3ND5A 3ND7A 5AHWA 5LM3A 1IVSA 3HMQA 3AG5A 3IOEA 2CYBA 1Q19A 4NAHA 3ZGZA 1QNFA 2QJOA 2ZP1A 3I05A 5FNZA 1LW7A 2XRYA 3N9IA 2QTMA 3OP1A 1R6XA 4YP5A 4KR6A 1GN8A 1NZJA 1KQOA 3IH5A 1JECA 3RFFA 3M5WA 1NURA 1MAWA 1O94D 2C5SA 3G6KA 1O97D 2WSIA 2H2AA 5BNZA 2CV2A 3VRHA 3IVGA 1Q77A 1YULA 2A1TS 5K0SA 1KKUA 1JIIA 1N2IA 1M8FA 1G59A 2CV1A 4F3RA 3SEZA 4HJXA 3HZRA 4U63A 2ZUFA 1JEDA 4JYZA 2YWCA 1D2RA 1HYBA 1WXEA 4JXXA 1QJCA 3A05A 1O96A 3CLUC 4KR9A 4MVWA 1T6ZA 4CDNA 5H16A 3ZIUA 1U7XA 1K92A 3CVYA 5DEOA 4EG4A 1K97A 5KWVA 1WZ2A 4YP7A 1YI8A 1XNGA 1VBMA 1EE1A 3G59A 5TEVA 2A7XA 1VBKA 2DR2A 1ZH0A 2GOYA 2GKSA 4DDKA 4KR7A 3ZJUA 1YIAA 1N2HA 3H9CA 5KCMA 4MWBA 1JILA 1JEEA 4K03A 3X1MA 1O96B 1G8FA 1N1DA 2J07A 1M8GA 2PG3A 3MLBA 3D6UA 4ND7A 1IRXA 2J4DA 1J1ZA 4YBRA 1J09A 4R2LA 2PZ8A 4P2BA 3VU8A 4RPIA 4MUEA 4EG5A 1QRSA 5J5AA 1MRZA 4ZCSA 4KPUA 4MW0A 1DNPA 4PY2A 3A4IA 1M83A 4E1AA 2OV4A 3DV2A 3RJZA 1TQ8A 3DO8A 4Q16A 2Z09A 2VXOA 2R5WA 4J75A 1V8FA 2NSYA 2QUKA 1KORA 3ND6A 1LI7A 4R0NA 2D13A 4NAUA 4F4HA 2CSXA 3KT6A 1G8GA 1KQNA 4EG6A 1NYLA 3COZA 1N2GA 2PZAA 2AKEA 3SP1A 1O0CA 1J70A 4H3SA 4MVCA 4MVYA 2AZXA 3UK2A 1GZUA 4OJMX 2QUHA 3Q10A 1EFVA 5JBNA 1T9GR 1A8HA 4HPWA 1JZQA
chains in the Genus database with same CATH superfamily
1U28C 4XVUA 4HGOA 1KU0A 3QHAA 5H1YA 5I3ZA 3QW2A 1Y3CE 4JP8A 1OVMA 3PXCX 4AMUA 3UWPA 1FDRA 3C85A 2Y9MB 2HLDD 3Q0TA 1K08A 4MS4A 1RHUA 3WQHA 1II8B 1SQGA 1B14A 5B1HA 4C01A 4CMBA 1A2KC 1Y37A 4R1LA 3WICA 4DR2B 5AVXA 1QFSA 5JJLA 1XEAA 3HABA 4UEKA 5FBKA 2LDBA 3RS3A 3AKZA 4G5FA 4BRWA 2CYAA 2LDXA 1NN5A 4JLKA 5JJKA 2OCBA 1ES9A 5D5HA 2R8YA 4JR0A 3P26A 1UPAA 4NK5A 4QFDA 3SKVA 3OUZA 4W8GA 4F1WA 1QPGA 3IB6A 1XVUA 2FQYA 3VSDA 1YZ3A 5CJPA 5JADA 4DCSA 1EXDA 3UJ8A 1E9RA 3OU2A 4AJOA 5F98A 2O50A 5GVRA 1ZHFA 2WWGA 3VNBA 3AVOA 5BQXA 5IBRA 2K2WA 4L85A 2JJ1A 4NE7A 1E0SA 4ME6A 2EKLA 1T1IA 3PJDA 5HQ3A 3PQ5A 2IEZA 1EFPB 2R96A 3HA5A 1C7IA 3JQAD 4JYCA 3RHZA 2ZLBA 2Q99A 3ZJVA 5B2FA 5K3OA 4LRQA 2P41A 5GMOA 2OLJA 3PGMA 5G3ZA 2WV9A 3M83A 1PDVA 1GQSA 3EZGA 2RAPA 4RH3A 1PWXA 2JFXA 1DG1G 2NVUA 3A1CA 3EGXA 3B1XA 4XASA 4HX2A 2B98A 4X7MA 3DT6A 4DMUB 2J7PA 2VEDA 4V1CI 3B5IA 3HDHA 3SXUA 1I51A 1XD2A 2WEKA 3NH9A 1PHRA 4ZREA 3UKDA 2PHZA 2YYZA 3DJFA 2IRWA 2J09A 4JJ4A 1W52X 5B2ZA 4HNHA 1VL6A 3IV7A 2WILA 4MQ5A 4MW7A 5IAJA 4UUAA 1J0CA 1UEJA 1HFEL 2A59A 2IIVA 2X7HA 2XF8A 4KIGA 4FMCB 4ADSG 5AW0A 1O0BA 1HURA 2CVFA 4JI4B 4AXXA 1QK4A 4BB6A 2FP4B 2D2VA 4MLCA 4N41A 2HIHA 3KWLA 2OCAA 3G8CA 4YCSA 4J76A 4EI9A 1Z2EA 1KEEA 1MJGM 1Q0HA 2R2AA 3G79A 1SVNA 3LM8A 4GBMA 4M7OA 3ZWKA 4MMXB 2HK8A 4II3A 2GN6A 3EUAA 4GKAA 1QZ3A 4OFBA 1OI7A 5L53A 2ZSBA 1J8FA 1GDHA 3G2OA 4ZVLA 4ZGGA 2O07A 3LQFA 3OO0A 1H6CA 4EKGA 1LTQA 2A1UB 4O1HA 3UJHA 4YONB 3GDOA 2DBZA 4I5GA 3J80A 2QAGB 5ED0A 2R7NA 1DI0A 3F1KA 2QE7A 3MS2A 5A9TA 2XT9A 1ND5A 1U99A 3MXTA 4GM0A 3SVLA 1M6YA 3L8FA 3SIPA 1JHDA 4ARSA 4FTWA 2XCQA 4QTYA 3S6JA 3TS1A 2EF1A 4E5UA 1Z5UA 2VNJA 3GAFA 3K2BA 1JMYA 4JB3A 5FKJA 1UKEA 2V7TA 5FUVA 3EGIA 4CG1A 4MDFA 3C24A 1N4DA 5AXAA 4XOIA 5K9ZA 4IILA 5CHYA 3CNOA 3GDGA 2B4YA 4OBXA 4A2CA 4FM9A 2ZSDA 5JQWA 4LNUA 4P4NA 1PYDA 2PZBA 3QLUC 2JASA 3NHUA 4WKGA 4ODIA 4EMBA 3THXA 2AN3A 4E5KA 2O57A 3RSGA 3LAWA 2QN6A 3ZUGA 4HTFA 2IYLD 3OA0A 3FVRA 1Z0IA 3AWDA 3F1LA 1SUBA 3HCFA 1NN0A 3CJTA 2A14A 4J4BA 4I55A 1LRLA 2HSZA 1L4EA 4O4HA 3QFTA 3KKEA 2JGDB 1BQ3A 1U9ZA 1Z5NA 1FYVA 2VBFA 3IUPA 1ZAKA 5TSDA 3NVDA 4NYJR 2BV3A 1T10A 3IOMA 4AY3A 4D97A 2BGUA 3MQ4A 5H4GA 5JYCA 3C6QA 4B3CA 3HFJA 3LA8A 3LFTA 3IPCA 5CW2A 2P9YA 5FQOA 5DBFA 4CV2A 3H5AA 1KH1A 1ADJA 2O2GA 4RYLA 1S3FA 2I6QA 2QN3A 4J16A 4TQAA 3UY4A 5JLJA 2GPBA 4M1SA 1QH0A 2HEIA 4QG7A 3WBFA 4U7FA 2QNRA 4XFDA 4K9SA 4E11A 4RC9A 1XTTA 4N7JA 4C2UA 1KI6B 2UUPA 3ADPA 2QVLA 1D0IA 1MEJA 4NF2A 4LF7B 1C1DA 1YI0A 4YALA 2G06A 4A8JA 8ADHA 3QU7A 4ZQBA 4KR2A 4US1R 4KP7A 1FBNA 5HZHA 1IB0A 2BW0A 1X77A 3P45A 4RD4A 5DM70 2PUDA 3QHPA 4GOLD 1LPSA 1XN1A 2NU6A 4OLJA 2VSNA 1SK8A 2H1IA 2F9LA 2W48A 4MMYB 4R51A 4Y6QA 3KAJA 1GKLA 4BLVA 5IBPA 3GZNB 1T0UA 1EZ4A 4NFLA 3OLVA 1HL3A 3PR2B 2X1LA 4II2A 3A1WA 3W5BA 2MSNA 5H9WA 3O03A 3IAXA 3UQYS 7ABPA 3SJUA 1Q1QA 1D9XA 2FCRA 4G0PA 4NIMA 5G2OA 4ER0A 1R9NA 4EY7A 5CIQA 2XB6A 2AOTB 5JRZA 2HHJA 2JH8A 1L5NA 4JZKA 3L04A 4LHWA 3TLXA 2AJTA 1U2ZA 1SBQA 1ZCAA 1GG9A 3A0RB 3LPLA 4J1TA 5EWLA 2H08A 1R8SA 1QTNA 5EE5B 1JEAA 1FW8A 2ZYSA 3H9BA 4URWR 4WLOA 5JAPA 5KKNB 1XZLA 1SBZA 3WK4A 4BL5A 2HF8A 3NU1A 3PPVA 2F6RA 1KI8A 4ZEMA 3E9EA 2MINB 4RADA 4RSMA 1G64A 4BLOA 3A36A 4PZEA 2PGDA 4X84A 1RKVA 1R50A 3FYTA 1AMNA 2VXYA 4IEIA 1U9IA 2IEDA 2WT9A 3CWQA 3L8ZA 3AF4A 3TMYA 4UFNA 4B7AA 1JB9A 1NM5A 4UPEA 3TECE 1SCIA 2DSTA 3IX7A 4FHGA 3KX2A 5FWXB 2BHTA 3DBHB 2PUGA 4GICA 3QKRA 4K81B 2NACA 4AO7A 4AF8A 5U1PA 1PFGA 2ODBA 2PXHA 3D0RA 3OT5A 4YJDA 1M7BA 5K8LA 1TFUA 3UAZA 4W7HA 2R48A 3I1IA 3FDIA 1Z16A 3L8GA 4J94A 3IP1A 1W0CA 4DIOA 3ENNA 3ROFA 1J0EA 3F5SA 3NJ8A 3WRWA 5CIYA 3U4AA 3SFTA 3EWSA 3NC0C 4FFOA 5AJVB 4JHXA 1LDMA 4C7JA 5EPUA 2Q9AA 3GMSA 1VXOA 3ZDAA 1D7AA 1SBTA 3FYUA 3WGVA 1LH0A 3NPAA 3OESA 1H22A 4CMCA 1SA0A 3E3AA 2GVZC 3OZAA 3HCAA 1XJCA 2ZT8A 4RSRA 3VR4D 4B4UA 3INNA 3BJRA 4HWTA 3VR2A 2IPNA 2C1ZA 4AWXA 4X60A 2XRFA 4DV6B 4FIDA 5CA1A 3ZWDA 3KKLA 2PU7A 5A5GA 1S6YA 4JI6B 1YTUA 5F4BA 1VBFA 3BXFA 4GG1A 4PO9A 2QGNA 1IHYA 3CISA 3MOSA 4NV3A 3S1AB 3DTVA 3WOVA 4CWAA 4NTZA 4WUTA 1V1JA 3B12A 4I2NA 4PIPA 1K3TA 3IURA 4LVCA 3C3AA 4XPIB 1GRRA 4OHVA 1Y0BA 1ZMRA 4ZIRA 2ATEA 2BC9A 4CM7A 3QZUA 3KZOA 2ZIFA 4NG4A 4I1UA 5LBTA 2R8ZA 5BRAA 3OPYB 2OZVA 2WJIA 1TF7A 9ABPA 4TWJA 5JDIA 1WSWA 4UM5A 5AD1A 4A91A 4FT2A 4PLHA 4BB9A 1KTIA 1JIXA 1Q7CA 1RAFA 1Y98A 4KXMA 3U39A 1C7ZA 5TX7A 4W1QA 3UMRA 4MDEA 4XWAA 3RU7A 1SC6A 4NEQA 1VSTA 1UL1X 2YH2A 2Q3HA 1EK0A 3AR2A 3H13A 1IVNA 3L93A 1R0WA 2Y77A 5CTJA 5BSFA 1I94B 1XYVA 4S1VA 1UDBA 5JFTA 2O5VA 5INTA 2WWYA 1I6LA 4RGYA 4XDHA 4YXWD 2CE2X 5LIRA 1ZGGA 2OT3B 4E07A 1KJQA 2EGGA 5DHSA 1SMKA 2PBZA 4F86A 2ID9A 1U1GA 8ABPA 1T29A 5H8WA 4KK4A 4DR4B 2WFMA 2JFPA 1OFIA 4MUJA 1YONA 4MKZA 4FKZA 5ULLA 3ZTYA 3UPTA 1U31A 1UWKA 2D1RA 1R0LA 2MJLA 3GFQA 4Z99A 3VH4A 4I3FA 2BKEA 1UBLS 1EUCA 4R0VA 4BFUA 5IMBA 3U19A 3BKXA 4URFA 2HDOA 3ZWXA 4JFAA 1LZKA 1P2GA 1WTAA 4HB4A 1U98A 2NXEA 1NW6A 2PX3A 1U7PA 1QONA 2L2QA 2IUYA 4PX5A 3IVMA 5AVOA 5KYXA 2GAJA 1M5UA 4A6PA 3QYJA 4RVNA 3E58A 1T5HX 4E5PA 3RV3A 3OQJA 1JJBA 1EP9A 4N0DA 4RMHA 4OKSA 3ND7A 4R40A 2NZXA 4ZWNA 3HMQA 1UXIA 4K5QA 1RLTA 1TVCA 3G9TA 1Z34A 1AM4D 4PWYA 4JV5B 3QKRB 3IOEA 4B6EA 4PYIA 2C4VA 3GLKA 1X1AA 1DP4A 4HWRA 3QPVA 4F6LA 1E63A 3WJ1A 5CDSA 3PQ7A 1QP4A 4GE3A 5JCJD 2IYYA 3HLKA 1L3BA 4H4CA 1M2KA 1ZA2A 4JUFA 3W5IA 2I9KA 3LCVB 3OP1A 3DE1X 4MVJP 4E5MA 4JYBA 4TWZA 1EXNA 3P9NA 4RE6A 3BXZA 4ETNA 5KWEA 4HN4B 5AKIA 2RBGA 3MJ4A 4I0WB 2BGRA 2XSZD 2C3OA 5CLIA 4IV8A 3CNBA 3I04M 1ZCFA 4HDRA 4IIXA 5G1NA 4AJKA 2R0QC 4Y2HA 2RI1A 5AHRA 4LYGA 4CF6A 3KQHA 1VIDA 1N2IA 1SUWA 3C3PA 5EZYF 3GPCA 5BO5A 1IEWA 1CUXA 3ZQ4A 4Y9RA 1B6GA 4TN1A 4YA6A 4AQYB 4RD2A 3IP9A 4UTVA 1WCIB 3S55A 3BILA 4MZDA 4YQYA 3K9FC 1D2RA 1GPH1 2ILVA 5EJAA 4B3TB 5DWDA 2VCYA 4JVNA 4B3BA 1QJCA 1N6PA 3D0OA 3MAAC 1EJ6A 1KAHA 2XWJI 2PX5A 1FSGA 1JG3A 1GVNB 1V5GA 2GYVA 4CDNA 1A1VA 5KC9A 4BUCA 3PNMA 1W88A 1M7HA 4G0QA 3CVYA 1TEHA 4F4UA 2G7MC 3S99A 3KR0A 3MT9A 4LIPD 4Q3EA 4UTOA 2ZVDA 1OXBB 2HKIA 2OAP1 2R1ZA 2I3AA 3UG6A 4BKMA 1WVIA 4OKNA 3LYLA 1TKBA 1JLRA 2P2GA 4DB2A 5TEVA 1E7SA 2WLTA 3RC7A 3BGIA 3OLCX 3PUIA 3S8MA 3WX0A 2P5UA 5IAEA 1Z6XA 2EATA 2J9FB 3Q98A 2N0SA 1ZN9A 4OGGA 4D4LA 4YACA 4C7OA 3RC2A 2IS1A 2AVNA 3EGVA 3GEBA 1YASA 2HSEA 1AHNA 5ANRB 2FWBA 4P8RA 5KCMA 4BVEA 3OX1A 2GBPA 2HL6A 2CXUA 2JKZA 5TT0A 3SKXA 1U3UA 3H75A 3JAWB 2P4HX 3GELA 4ZANA 3IERA 4GQIA 2ODNA 3KQTA 4IRXA 1G6KA 3AMVA 4X95A 3U61B 5KTKA 1Z35A 2ZCJA 3I37X 4DIMA 2FDCA 4ENSA 5E7IA 3SICE 3EWAA 3MJTA 3UBTA 3W3AA 4EKEA 4Q3NA 5BT9A 3P9PA 4ZQCB 4JLNA 5H5JA 2VJBA 2WKWA 3JALA 4XWYA 2J7PD 2IUSA 4FEEA 3WC4A 5BMOA 2O4UX 2A92A 1MRZA 3EF3A 2J5KA 2I6SA 2YHAA 1CC1S 4NG5A 3ZE2B 4CL2A 2JLYA 1AU9A 1DNPA 1H2YA 2I6FA 2XB9A 4AYXA 1CNMA 5EC8A 4QEDA 1HX7A 2NSLA 1QKKA 1RKQA 5EXSA 1N6HA 3IT2A 4D6XA 3VU9A 2UZ1B 4KACA 5E2IA 1XUOA 2PKRA 2NV0A 3OFND 4O4JB 5CYOA 2OAQ1 3PP8A 3R5KA 1GGVA 2BHNA 2AX4A 1I14A 4EW6A 2J3HA 1AUVA 1KYYA 3D7RA 4X6YA 1JL3A 1D8AA 4R0NA 1G2IA 2XWSA 2CSXA 1LNZA 3IXLA 2C77A 4GZ5A 2XKJE 4B7XA 5K0JA 3ADDA 2GPYA 1N6IA 1P75A 4LDPA 3T61A 4EB6B 3TKLA 1JNXX 2PS0A 3RLIA 4CQLA 4WA8A 1K88A 2PZAA 4CMEA 2G88A 3OZSA 1M67A 3QKIA 2VF4X 4ESEA 4R98A 1L1EA 5AVSA 3EHDA 4H3SA 4Q7MB 4YUZA 2AC7A 1B00A 1C2TA 3LNTA 5FBQB 2DUUA 3EW7A 4BN5A 3C7DB 3V8QA 4PQGA 2PM8A 5IABA 5HKKD 1A8IA 5CDFE 4EMUA 2AKAB 1K8XB 221PA 3MHPA 1ZVQA 1X7YB 2YS6A 3GDFA 3ZKWB 2GD6A 2AT1A 2JS7A 4NYMQ 3RARA 3WTBA 4UXJA 1SCKA 2E5FA 1KK3A 1MU0A 2D8AA 3A3KA 4OI1A 1ZGAA 4BMCA 1QLWA 4C88A 4D02A 1R16A 2YWJA 1TYCA 1I1QB 2J08A 4YPVA 3DAYA 1UMKA 2JFGA 1E2PA 3HQ4O 3RAPR 2PYDA 4Z7OB 3GUVA 3ZCUA 5FO0A 1KJWA 1Y7TA 2Z4SA 3IXMA 4RUKA 5DXJA 2G4VA 3GGGA 4IHAA 3EQ9A 2CLFB 2FP4A 4GMHA 3Q7PA 3PCRB 3TIXB 5CB4B 1TFRA 5EJ6A 1XZPA 3N0TA 2NTJA 4XYEA 2O6LA 3LK6A 2VJDA 5EHZA 3FYDA 3CF0A 2RE8A 2R85A 1SXQA 3L9XA 1TMKA 3E7WA 1N32B 4WXPA 1VCIA 3A4TA 1GNVA 2PVPA 2ZU6A 4ZAGA 1ZJYA 2DUWA 3G5LA 1XD2B 2RGCA 5IWAB 3GMTA 1NXSA 1W2GA 3OMWA 4I5FA 4KYUA 4QVGA 2WVHA 4QNRA 3R76A 1K27A 1GLNA 2P1DA 3ZWBA 1NUTA 1UPBA 4W9NC 2X0DA 5C53B 2GSWA 1E8MA 3A1TA 3WIVA 1UZMA 1VMKA 4N8EA 2Z9BA 5GONB 3ZV3A 5KVCA 1QK5A 1R2QA 1VG9B 5CUQA 4FMCF 5GTDA 4ENPA 4QARA 1B6RA 1EFHA 2CT8A 2GK7A 4YGYA 1YJAA 1CR6A 4UM7A 2UXCB 3N2YA 3FX2A 2OQVA 4L4ZA 1Z38A 3FJOA 3PXBA 4MWDA 4PGHA 2GI4A 2X0NA 1N2BA 1PJAA 3VR5D 3A1SA 3O9VA 3ROMA 2TSYB 4P33A 4Y3UA 1ITZA 4UU7A 4NXMB 1JTFA 3PU6A 4TSFA 5J1TB 4EJSB 4EUSA 4Y2TA 3RROA 1EWKA 3IIEA 3MOGA 4MAFA 4AU1A 5LQRA 1X1DA 2IIPA 3AVQA 5JROA 2E4YA 2VF5X 2OV1A 2B7CA 4AUKA 4QU0A 4D3YA 2VPTA 1QIIA 1NSFA 3BWVA 2EXXA 3UJAA 2PCLA 3LUJA 2QTVA 2LUOA 1P44A 5FHRA 2PH3A 2PL3A 3FJYA 1XZGA 3BWBA 3L6CA 3RTDA 1ZA1A 1XTUA 1UAAA 1I4OA 1MB0A 4OUKX 1NVAA 2GDZA 3GJQA 3IUNA 4QKQA 1N5IA 5ALGA 1JDPA 5D3QA 4AP5A 1GZHB 2GHQA 2VYVD 3EFBA 2AZDA 1WBJB 1PGPA 4NESA 3Q8LA 4DG8A 3RUPA 5JQGA 4QQRA 3DBIA 2CUZA 1Q22A 2ATCA 5L3SB 2I8CA 4KGVA 2CZCA 3ZV4A 1YQEA 3JX9A 3O93A 4Y18A 5I4BA 3TSWA 4P58A 1C0KA 3SZ3A 2QRZA 3T7EA 3W0LB 1WMFA 3IEPA 4C4PA 5B53A 3A1UA 1HNNA 5A2QA 1HNZB 3PL5A 1C3LA 1TPZA 2BFEA 2BCGY 1V37A 1ESZA 1IM2A 1XVAA 2ARKA 3Q7TA 1UXHA 4HPJB 5ALZA 3I4CA 4QJ3A 1LLQA 4PNHA 2I2FA 4XM0A 3TZ6A 3DEAA 2NPIA 3TNYA 1WQ3A 1JT2A 3AX6A 3UICA 4DYDA 3KT3A 1CRQA 1JDZA 1M66A 2Z5LA 2J7KA 3Q11A 4LI3X 4IDQA 1R3DA 4MIKA 4K6FA 2QI9F 3R8FA 3H2KA 4LJ4A 3V1TC 5FAKA 5TLSA 4F3TA 3DBLB 3STWA 3UVEA 2QLLA 1JTEA 3JAWA 3CH4B 5ADHA 3OJFA 2IDJA 2YVKA 3WSWA 4O4JF 1PNTA 4KMSA 3AB7A 3HYNA 2IHTA 1WNTA 3KXLA 1SUAA 2VF7A 2BR4A 3LY9A 4MWSA 3VKVA 2QGZA 2BR3A 3PZRA 1DXQA 1EA5A 4OB6A 2J9FA 5LR6A 1DC7A 2O2SA 1EM6A 3B9BA 4YK7A 1MC5A 1U02A 2DHCA 2VYNA 2A0FA 3REFA 3WLEA 5KJ6A 2WNSA 3WB1A 4Q3OA 2FW8A 1XTIA 2JANA 1NZDA 3QKUA 3W34A 3R24A 5F78A 3AJAA 3B1JA 3I1YA 1TYZA 5EKTA 3HM9A 1UAYA 1D8TA 3U81A 3LWBA 2WHEA 1RT9A 3LUCA 2Y4OA 2OKGA 4O8ZA 5ALRA 1A0OA 2CBZA 3SMVA 3PQFA 4OHCA 4CKXA 5AUNB 1P7YA 4OPMA 4CLOA 3NDRA 5FOTA 4AKTA 1KR2A 1ICIA 4AZ3B 3OHSX 2A4KA 5H3LA 4I9NA 5FA6A 3AK4A 2GFQA 1E6MA 3K6KA 4M1QA 4NCJA 5IULC 1ISJA 2VK1A 4WBXC 4WK0B 2XDQA 2HCRA 5DB4A 3RC9A 3FCCA 4UOEA 4V3CA 4KX3A 3JQ8B 4URVR 1GGHA 5K0GA 5MN6A 3BDAA 3PUWA 4NBUA 4EO7A 1C81A 3F49S 2VTBA 1AQYA 3MMNA 1KVTA 3CFYA 2WJ6A 2IXGA 3EUFA 5ADVA 2PUFA 2AUMA 1PJ4A 3OWXA 3Q12A 4V1CB 4QJ4A 3F6PA 1D2CA 2PYZA 2QZPA 3LUFA 4J7UA 3D4IA 2JIZA 2P9CA 3LYAA 1ST3A 2BFCB 4ZDKA 3NUGA 4EJ2A 1P0IA 2ZTMA 3NHMA 2H4FA 2JGKA 4HGQA 1G8HA 1DZIA 1T8SA 3R09A 1XWIA 4QPCA 4PRZA 3N7UA 4KLRA 2C3MA 2BMWA 2YOHA 3Q40A 4GPEA 1DAPA 2MSKA 4LGMA 1XLVA 5LQAA 1WVMA 3H5NA 3I2GA 3SG0A 1FRFS 2FN7A 4B3IA 3NZEA 4OHZA 2OOSA 5TNXA 1O08A 3UM9A 1J9ZA 1FP6A 2NUAB 1XPRA 1SNYA 3FFXA 3U0BA 4OHMA 1HE3A 1PS0A 3M3PA 3ANYB 4MJLA 4XUEA 5BUSA 3KXDA 4ND8B 5AT1A 1YJ5A 1RXUA 3DMPA 2IK8A 3KC2A 3HGTA 1DG9A 3QMPA 4IFTA 1GVHA 4NARA 5DGTA 5C1OA 5LU8A 4QJIA 2UZ3A 1NVDA 4OLFA 4RZXA 3HCWA 3LQRA 4QRHA 1YQUA 1G1AA 3WQSB 3Q85A 3DYVA 4RZQA 4IGEA 3RBZA 2FUKA 4ISBA 5KO2A 4X94A 3KHSA 4FDAA 4PTZA 2C58A 3AHFA 3TIVA 3VYVA 3OTIA 3FROA 1XMVA 3FHTA 1ZBQA 4PONA 1G21E 1BDHA 5EL0A 2FN8A 1SVMA 4MRMA 5JE8A 3HN2A 3THWA 1GTG1 3VDMA 2R4QA 2RHTA 3NVKI 3QE4A 1EK2A 3AUJB 4BTVA 2JAOA 4RZIA 4WN3A 2ORYA 3FYCA 2A67A 3QEBZ 2ID4A 2WFLA 3C6YA 4MUXA 4F0JA 4FGJA 1GPKA 4RAOA 3HYRA 5IVPA 1WXXA 3A31A 4YS6A 3UWOA 3NJ4A 4GOND 5EUBA 3STTA 3WO1A 5EQDA 3OZUA 1FPQA 4C03A 4X62B 3FTQA 1F9AA 1ZM2A 5F64A 2AG8A 2NPFA 1B8PA 4KIJA 3VPBA 1JALA 4X00A 1VIVA 1MGOA 3OFKA 4YRQA 4B46A 3PC4A 1GOTA 5HK8A 4HQKA 4IMIB 3NHAA 4EY5A 1GUBA 4LQCA 2FXIA 1X80B 3AIIA 1QRUA 2H4JA 1NT4A 2JZOA 4E70A 4Z4IA 3A9TA 5KYUB 3HCEA 4AJLA 3W9BA 4Q19A 3W3AH 3KTAA 4GOXA 5B7PA 3HPRA 1OXSC 4JJ6A 4AWAA 3CKKA 3KM0A 2BH2A 3UHAA 2YIVX 2PT7A 3U37A 2QX4A 5LP6A 4RKQA 1J21A 2VI5A 4CMHA 4AJNA 1ZWKA 4NYJQ 1NVTA 3IEMA 4CTKA 3ZW7A 3QGMA 5IU6A 3RAFC 4E1VA 4RS4A 2Q50A 1U8ZA 1OFHA 2F3TA 5AVUA 2CL5A 4XSHA 3CEJA 3HBMA 5JISA 1XMOB 2FOLA 4AZ0B 4I4TB 4O3MA 1RM5A 2JAPA 4GLBA 5ELLA 1XV5A 2AUTA 1PYOA 1G0OA 3PFKA 1VHJA 3MYRA 4BX2A 1SA0B 2OFPA 2IEIA 3CSDA 3GPDG 2OYSA 1Z0KA 2YWBA 3JQQA 4MPJA 4O3FA 5EG5A 4MS1A 1VE5A 1M54A 3G2HA 4P0TA 4ETMA 3DP7A 1CXZA 5LQSA 4JEHA 3TL2A 2NLOA 1KPHA 3I9NA 3O0DA 3SJAA 4KKVA 1ADFA 1I1NA 1X7WA 2UYYA 3DUWA 1O3YA 3FB1A 4EA8A 2JFOA 2X5NA 3MM4A 3WHPA 2APJA 3QEOA 1SC3A 4RLFA 4UAVA 1XCOA 5EQTA 3UHPA 2INGX 3ZXIA 1NF2A 1ULUA 2Q4OA 3KEMA 1QYDA 1G4AE 4MUNA 4PGAA 4MQ6A 3VVCA 2Y1XA 5IT0A 2HXSA 2J5XA 5EZYB 3WLPA 2HQOA 2YXNA 2Z08A 3FGPA 3PBKA 4PAQA 1PNRA 5LJLA 1WY5A 1XA3A 2O8VA 3C5VA 2FPXA 3DBHA 3F5QA 3JD1A 4YRRA 5FBHA 4X20B 4H1TA 4DG5A 3A9RA 2ECOA 1VHLA 1CHDA 1D4ZA 2YXBA 3GJZA 4GBED 5KNDD 4LOJA 4MUIA 3SS8A 3ZBUA 4DAOA 4ZO4A 3CUUA 2WSMA 4RLSA 4FNOA 4YO7A 2FX3A 5JCOA 3PQ3A 4P3OA 5E4FA 5B4TA 3WGQA 3L5KA 1WJGA 3OTQA 1JDBB 2QDXA 4PNEA 5KQLA 1JDVA 1ZOOA 4IHKA 2F8TA 3ROPA 1N6LA 3QYAA 4OJNA 2AI3A 3W2TA 3FBWA 4JODA 3CX6A 5DE3A 5EE3A 3VU0A 4G09A 3L02A 5JBIA 2O7SA 3ZDQA 1XXLA 3A11A 4XWWA 1NG9A 1LC0A 3HDQA 3OPVA 1B6SA 1T1EA 5K1ZA 4CQMD 4R9RA 1UJ5A 4PZCA 4Y6RA 2BN4A 3JD0A 5AJHA 4PFSA 4UHKA 5TQ0B 3UAOA 4DC9A 1F3OA 1RYZA 2L17A 5BSEA 2QLMA 4DBZA 2NVOA 5IAAA 2OGWA 2HLPA 2WVGA 2XQGA 3QXCA 2BFFA 1KSFX 4RA6A 5BQ5A 1OR8A 4D8TA 4RTPA 1F4VA 3C98A 2GZAA 1JH9A 4FPXA 3M1YA 1IMJA 3VMFA 2FWRA 1PZXA 1WKCA 1UQTA 2NU6B 1EP3B 2VPXA 3P71T 4I66A 1JV2B 4J0IA 3GJXC 4LZWA 4LTDA 4WFIA 3VNRA 4F2WA 2CV1A 4NCBA 4DIEA 2J67A 4U63A 3RTEA 3LXXA 4FGKA 3D2AA 1HWYA 1T35A 4JASB 1CQZA 4FONA 4K46A 4HWKA 3D7KA 1KAEA 4MV9A 1IM5A 4Z9FA 5LMUB 1TAUA 4PYOA 2WAOA 5ESWA 2ZRFA 3CBGA 5AYVA 3N58A 1F8FA 2K7ZA 4O4IF 3EJ6A 2FZVA 4QYWA 4JHLA 3SSMA 4UVHA 2VA9A 3TFQA 4A9AA 4N6OA 4UEWA 2X9GA 1AUOA 1T2FA 3CUWA 3KQPA 5TGZA 4LYDA 4W63A 1P4AA 3IAHA 2W71A 2H8KA 2ZVPX 3UB2A 3IIIA 4WCVA 4Q3CA 3RSCA 3A1FA 1FA9A 1P2BA 2E82A 3A9CA 1UBNA 3NHZA 1Z75A 2FFAA 1CUEA 4R8RA 4YRAA 2HBZA 2HK7A 3LW8A 1Y9JA 4OLBA 1JG6A 2R79A 2TECE 3BPSA 4O4HB 1ONSA 4PQYA 4V0KA 4CMJA 2ETVA 2HH9A 4GLFA 2QBYA 2RH5A 4DUGD 2W2XA 2ZQZA 4M8KA 1RE1A 3C3XA 1S2DA 5HMLA 4RDXA 4DV0B 4WTOA 1VSQA 5HKLA 2XNDA 3OZ7A 1MB3A 3S0JA 1QRAA 4EABA 4KYIB 4MV7A 3THXB 1EWYA 1OKKA 4RVUA 3LVQE 1N0IA 2GB4A 3HJTA 3P20A 1EHYA 2LVBA 2ZIXA 3QVXA 4O5OA 3RFUA 4BOYA 1IG0A 2V65A 3GRUA 4QQKA 2RJOA 1ZK3A 2P2NA 1LF5A 4G24A 3OD5A 3TAHA 4FYIA 2GILA 3UUFA 4L6AA 3ER9A 4CN9A 1E9AA 5E3JA 1SZCA 1MQ9A 2JI4A 2IQIA 3MPUA 4M46A 3TLZA 3DO8A 3UENA 4CKWB 4RV4A 4B79A 2XB2A 4PNZA 4Z49A 3PWTA 2DPMA 3KFXA 3DSRA 3O8LA 4KBGA 2PGIA 2R97A 3QXHA 4JIMA 4TVSA 4TV8A 1ADBA 1XSEA 4EAAA 1JR3D 1VCMA 4RYDA 3W05A 3Q87B 2FSGA 1TUBA 4EG0A 1QLJA 1GPUA 3GAMA 1NONA 4BV2A 1NYLA 4JVOA 2H1VA 1DRWA 1YNSA 2JBHA 2OM2A 2CB9A 3FKSD 3IKJA 4US0R 4IICA 1EZZA 4XYLA 4AL4A 4CCAA 5I45A 3JQ9C 2X3YA 3L18A 3WSVA 2GXAA 4DABA 4YP1A 1B74A 1NJSA 1EWVA 4FFMA 4OJMX 4WEOA 4EAQA 4IDOA 5BURA 5F73A 3ESZA 3QU5A 3IFSA 1SR8A 2Q6IA 4Q3DA 1D07A 4RK0A 4CM9A 1X7WB 2JIOA 1SN7A 3VR6H 2EZUA 2WTAA 2Q5IA 2Y93A 3TW0A 2AMJA 4EPRA 1Z4OA 3IRVA 3LT4A 1E7WA 1Y3FE 4LF4B 2WUWE 2ECFA 5FLXA 1H69A 2P69A 2OV6A 3EG9B 4KNVA 2ZAMA 5DN9A 4ALMA 1AX9A 4GGOA 1N2CE 4QSHA 5JANA 1NVBA 5SZKB 1HDOA 3ZI7A 1RJFA 1FU7A 1FNNA 1QHIA 5CAEA 1CJBA 4X8OA 1MXHA 1RP1A 3F8SA 4PQEA 4XIIA 5DSTA 1H6DA 3OEWA 4IIHA 3B3JA 3OJEA 3S70A 5DBGA 1E1YA 3IKMB 3NBYC 3CLTC 2Z95A 4ER7A 1Q1EA 3QXGA 1QBKC 3QMVA 1AGXA 3DGEC 3PIDA 1B15A 4RNDB 4OHPA 5BQOA 5JPIA 2QG4A 4IDGA 5AXBA 4G89A 4R3WA 3RF6A 4IIYA 3ZJ5A 5JMWA 1J9EA 1ZOLA 3SHVA 3MBOA 2XXAA 3ZWAA 2XYHA 3IBSA 1BGXT 5DSZA 5C18A 3VAYA 1CJMA 1OIWA 4BLTA 4QQ8A 4MIYA 4URUR 3P9KA 3ORSA 4ENVA 3WISA 3VNAA 4JUAA 1A88A 4YPOA 4ES6A 4Z53A 1D6NA 3B1KA 4B45A 4YR7A 3U4QA 4JBIA 4NFHA 1QHSA 4TLDA 4DPKA 1X2EA 1XRLA 4XRRA 2QZ9A 3CRW1 4KZPA 2OCKA 3EQ7A 3CE9A 1JHPA 1G2OA 2AJBA 2JGRA 1B3RA 4Q9AA 3T54A 3TLCA 2VQFB 1Y6JA 4DVGA 2ZJAA 4K9KA 4TMFA 5IWCA 3F73A 1G3MA 3N07A 3WO0A 2V9ZA 4XDGA 3WA6A 3UWSA 1Y4UA 2CFCA 4NJOA 2PPVA 2PL1A 2Y0BA 2AFRA 4H6VA 2GZ1A 2HMAA 2R7AA 4BZWA 3ITNA 2OBXA 2D54A 4KQGA 3D3WA 4QUDA 5I3CA 3A32A 3VMMA 5DBOA 5DI3B 2CHGA 1X1CA 2Q1UA 5J4KA 1SK9A 1ZIOA 1R9GA 1U8AA 2IHBA 2WP0A 3DEIA 4GM4A 4QGGA 2DQKA 2PS3A 5FFNA 3NTOA 4DA0A 1CJSA 2DECA 3KWJA 2EIXA 3GU3A 3PRHA 1E3WA 1Z2NX 2F1RA 3HUTA 5AK6A 5DLDA 3UOGA 3ZDRA 2VHUA 1DQNA 5HUJA 3CKYA 5IKXA 1TEVA 2X3UA 2V1UA 3A2KA 1JYEA 1SQFA 2HT1A 3CNQS 3H2IA 1DPGA 2AYXA 4I6GA 4N7MA 3W2GA 4H16A 4MYDA 4QDJA 1YTLA 2G17A 5EJ4A 1AC5A 1XTQA 5FTJA 5DX1A 4AURA 4TM7A 4I55F 4H17A 4IMPA 1QP0A 2NPOA 3HSYA 3HKCA 5UKDA 2ZRQA 4YJFB 4LZZA 4BNJA 1SCBA 4MIEA 3K4PA 1GU7A 2ANBA 2G0TA 4N76A 1V6AA 5F76A 2VDMB 3LD9A 2I2WA 1PR3A 3ABOB 3TZCA 3WK5A 5DTEA 5SY4A 1WDTA 5L9AA 3UQZA 3HCBA 1TYDE 1QHEA 1X1BA 4HATA 4X1IB 2O8EA 5LZ2A 2Y1LA 1Q12A 2QRPA 4FXPA 4HGNA 1Q83A 3G7SA 1RLUA 3DEYX 5ALDA 3X1WA 5K7SA 3LX4A 1YAHA 4WFJA 4C7MA 2LE0A 1ACLA 1YS1X 2PZEA 3HNPA 5KOJB 4AQDA 5M3BA 2VSYA 1M76A 2VDQB 3DPIA 4H6PA 3CW9A 1JLMA 3L4BA 3L4EA 2Q1XA 4OQYA 4ARZB 3RTBA 4ZOCA 3H83A 1WSDA 3UXHA 5KYGA 3EE6A 4K26A 4GXTA 1AHHA 1XD8A 4XIFA 1JEOA 1XNQB 1XHLA 4IWNA 5AW6A 4I9UA 2P40A 4TRNA 2XECA 3N2LA 1ADGA 2Q3DA 2RCNA 2V7QA 3DOEA 3TTYA 3U6KA 4NMLA 4NOKA 3U60B 1I30A 4C20A 3QF4B 3UA3A 1RC0A 1VP3A 3ML1A 3DZCA 3GFRA 2A3NA 1X1SA 1FDIA 4TSRA 4AZWA 4D4MA 2QM8A 5DLEA 4LY0A 3RAJA 5HXAA 4D0SA 1Y1TA 1RJWA 3IP5A 3DFMA 3AM4A 1E2EA 5TF0A 3BMCB 3KKOA 1F48A 1KY2A 1ODTC 4P08A 4XVHA 3QU2A 4QU8A 2CLSA 5EKXA 4E30A 5LLSA 2GZMA 3OTWA 4WVLA 4ZEVA 2QP9X 3NBXX 1L5HA 4JDUA 4BCCA 5GJBA 1QTIA 1OGJA 1ZOPA 2WINI 4M9ZA 1A3CA 1WP4A 3H19A 5AW1A 3T0FA 5FB3A 4E4RA 1N7HA 5H68A 4CKEA 4BQFA 1JP7A 1U0EA 1WPQA 3DBLA 1NXPA 3K0AA 3L92A 1S2NA 4LNHA 3SK0A 5GVSA 3A9SA 3IUBA 2H54A 1CUBA 2XITA 4KLCA 1F3LA 1Y33E 2IHJA 1SM4A 1NL3A 2QD5A 4M0FA 1MZPA 2WDPA 1YJ8A 2D2XA 4M49A 3RRMA 5IUNC 4J03A 3AZOA 4M9RA 2AW3A 1TA9A 3I9KA 4GLLA 2R4TA 2E4WA 3W90A 1ZCBA 1C41A 2I4IA 4EKDA 1U7OA 1XTKA 2QP3A 1GYPA 2BFEB 2O20A 3HU2A 4F45A 1M6EX 1Q2UA 3OX3A 4G1UC 4GEKA 1Z74A 1FUUA 3L7NA 2XYRA 4HQ0A 4JR2A 4EI8A 4MV4A 3TBKA 4ZO8A 1E2DA 3UF0A 3FRIA 5DDIP 2NTNA 1TF5A 3OQOA 2ASEA 4LW8A 4NVRA 2EWWA 1RCUA 2A1TR 2QW0X 1Z8FA 1P9OA 4MCJA 4B35A 3ZZNA 4AY4A 4Y1RA 1D0SA 3AF2A 4ZOLA 1CB7A 1FB5A 2P0YA 3BFXA 1FJ2A 3SCZA 2JLRA 4EPYA 1UBGA 2YKGA 1ISSA 1CTQA 1WM1A 4V24A 3NHBA 3ZIAD 2C4WA 2XRMA 3LBFA 4PLPA 4M60A 4QYXA 2C31A 4P3XA 1O4VA 5U4XA 4U2BA 2JBWA 2IYWA 3HZOA 1RM4A 3DEZA 4D9IA 2AEJA 2CVOA 4RS3A 1DU4A 5CH3A 1H2RS 4RTRA 2X41A 4FN4A 4QUIA 5AW9A 1AH2A 3CX4A 2C7VA 4HUJA 5LFAA 2HBRA 1FDVA 2OENG 3F7NA 4YMVA 2X8BA 3TTUA 2AWOA 1RS0A 2ZFUA 3Q9NA 4UTRA 4N9WA 3KQKA 4LJ5A 1LU9A 4MV1A 1SC4A 2G82A 2FLKA 3DB1A 5THKA 1AXEA 4IZHA 4O6VA 3BFVA 3TLJA 5CT9A 1U8UA 2VP6A 5F1YA 1EP2B 1ZEJA 1W5FA 4XB6B 5ER9A 4COKA 3UPUA 2G83A 2POCA 1SWVA 4BE9A 2V0CA 4WOCA 1C7RA 3KOXA 3CTPA 2QD4A 1P60A 2H6EA 2RJNA 4L2IA 3HGMA 3LG2A 1FFEA 1JFFA 4IIUA 2H1SA 4LXGA 5CB4F 1DIRA 1CDZA 3IUQA 2W2QA 4AMGA 4NZPA 5E6SB 1ZOSA 1I5EA 4ZJZA 4LJYA 1KE1A 3FRJA 3M82A 4PN3A 1RYBA 3HADA 3K0KA 4DLWA 4IVQA 2VKTA 1ZD9A 5BP7A 1PNVA 2R68A 2GJAA 4PO1A 3BEDA 3RHSA 3VPGA 3IUYA 4BWFB 4FFRA 1YR9A 1QHFA 2C2MA 3I2YX 4ZDJA 4JB8A 4EYOA 1T26A 4N3AA 1TM5E 1KAMA 1XGKA 2B4RO 2NGRA 2QTLA 3DL0A 5FTNA 4EVIA 5JSQA 1JIJA 4XVCA 3EF1A 4BTLA 2QRNA 4RSGA 1VFNA 1BS9A 4HZIA 2I4LA 4TTIA 4N5HX 3TLYA 3RIMA 3VZCA 5CJJA 5JCOC 2PUAA 1XLTC 2VJNA 1MDFA 2I62A 4M36A 1BGVA 2GD2A 1HDRA 1KYQA 1MTOA 2W58A 2GCEA 5T8KC 4AJEA 2GN1A 4QWMA 3T0IA 4YV7A 3VC1A 3NHYA 5KTSA 3GD5A 1G38A 1TJ4A 1YVUA 4MV5A 3H6GA 3Q8KA 1AZTA 1U3TA 2PMWB 3DMFA 3AI3A 4MVJH 5G41A 3ZKWA 3ETLA 1AQNA 2QW1A 4EJ0A 1YZQA 4S1TA 2D5BA 4RPHA 1ECCA 2O4CA 3QE9Y 3N6VA 5CA0A 5JU6A 2DC1A 1KFKB 4DM4A 4FC7A 5KNCD 3PUYA 3R7FA 3V6MA 3S27A 2REQB 2H4HA 4Q1DA 4YJKA 4HMQA 2ZDQA 2DVMA 3EZ2A 3JU3A 3SZUA 1W25A 4JQOA 1MORA 4Z8XA 3DLIA 2OFXA 6REQA 4KQXA 5CT4A 5JZSA 2FX2A 1UEXC 4UUPA 1HA3A 3RSZA 5ICSA 4CQLB 3HP4A 2D4AA 3DHVA 4EB0A 4UAGA 1RJ9A 5CTAA 1PG2A 2AJ8A 5JNRA 1IN4A 2OQIA 5KYWB 2YYAA 3G5UA 3COWA 4LWPA 5BOSB 1MOZA 5HZGA 2ONZA 2GFIA 3ZJTA 1JKJA 4D82A 4MQ4A 4O4JA 5CDGA 4R6WA 3WL6A 4MAAA 5FBWB 5FUWA 5HJ7A 2BEKA 3BAZA 3IHTA 2YY5A 3O4VA 3TF5A 3K72B 1IVSA 3Q7QA 3BWDD 2W98A 5E9WA 5DZSA 1NBIA 4H9GA 5EFOA 1CRZA 3QPAA 3GJ6A 2QUBA 1QZTA 5FNZA 3UYLA 3JALB 4B3JA 5LJIA 2ZI9A 1GAEO 1TLFA 1RZRA 1C3OB 4CGZA 1XVTA 2IH2A 1H6BA 1LW7A 2XRYA 2FWIA 1RCFA 2ZITA 3I2KA 4A3SA 1HEIA 1V1MA 1ZICA 4WMLA 1FTQA 1GCOA 4J90A 5EZSA 2IU4A 2QZZA 3N2IA 3OCZA 2WT8A 2YICA 3N0XA 5JO0A 1E60A 2BDEA 3VJLA 3P27A 2QQ5A 4JVSB 4Q9NA 4TMZA 4A5OA 5TXGA 1DCMA 2C5SA 4ZDWA 4EB8A 3KOZA 3PQCA 1GAQA 3G88A 4KFTA 1NC3A 4RQTA 4A6EA 1J07A 4YROA 2D3WA 3ZHBA 4CCYA 2R8XA 3KE8A 1CQJA 2IOYA 2ETXA 4NP6A 3V8RA 4IDHA 2ZRBA 3I5UA 2PFGA 4C7OB 2C1XA 3JY6A 3GLFB 1U94A 3F6RA 1X92A 1NMXA 2BFMA 1HBJA 1RM3A 3CH5A 3G0OA 4FSDA 3RSOA 1VJGA 1KMIY 3C1UA 3SEAA 3EASA 1H9BA 5K03A 2C2YA 2LTAA 4NCKA 2P9GA 4OQMA 4BLQA 3HJAA 1YQTA 1BYIA 4WXMA 3K9GA 3RUEA 1FJXA 3A6EA 3OOYA 3QEMA 2O8FA 2X1VA 1I3NA 2W4QA 1E9CA 2WU0A 3FUTA 4P4SB 3KVOA 5KTPA 2WD9A 3O4HA 1AKNA 2IUEA 2N3ZA 2R751 5F5XA 3WMGA 3V9AA 1DJMA 3SIRA 1V16A 1QSGA 2YINC 4BMDA 1OVGA 1WSBA 2I6XA 3WGOA 3ZN2A 4CJXA 3HXMA 1USVA 3MERA 3TGLA 2HA7A 3UV3A 2H2IA 2DWQA 2JLUA 3IE1A 1ODFA 2E1PA 3MD0A 4ISCA 1VKNA 3RK4A 3KUXA 1QFMA 1XTZA 3NTVA 2I3ZA 3IR6A 1FCJA 3P5BA 2C0QA 3ZCXA 1UBSB 3HLYA 2A9PA 1NYTA 3H9CA 2B99A 5FULA 4G25A 2FPWA 2PMKA 4K03A 2MDTA 2QZJA 1O96B 3A4VA 1KETA 5TV2A 1WB5A 2I4MA 1K68A 1XZHA 2Q5LA 4G23A 2L19A 4ND7A 5FYDA 1YS4A 3HR4A 4NPHA 2X14A 5E3IA 5SY6A 1JLKA 2EKBA 2VRCD 3Q1KA 1ZVVA 2IF0A 3MPOA 5C4GB 4ROSA 2ATXA 2G9QA 3RIHA 4F2HA 1RFLA 5KIAA 2B3DA 1SU4A 1CLUA 1M2NA 2VDOB 4PC2A 4YRSA 1SVSA 2EKZA 5CDTA 5KYKA 1DZ3A 1YBVA 1QM5A 3R9IA 1Q1ZA 3P0FA 1VZ3A 2Q1YA 3JD4A 4EG5A 4LRSB 2HSWA 5GJCA 1DT3A 3NO4A 3O74A 2B69A 1PJTA 3WZLA 3KQUA 3VJMA 4KPUA 2CF5A 1GPBA 1NG1A 4YRLA 1ODSA 2EFHB 1C8KA 2BMDA 4TZ0A 3V7FA 3RU2A 3OLWA 5KQRA 1U8EA 1AKUA 2IPXA 2WFAA 4IFEA 1X14A 4WL0A 5AK5A 3V4OA 4TMTA 1J2JA 1GR1A 1V8FA 1V5IA 2CHQA 1Q7GA 2OO7A 4C0LA 2F90A 2IVZA 2ZI6A 5LDDC 3LHDA 5HF9A 4PLWA 4A15A 1H93A 3QLEA 3VSAA 4AP6A 2QTZA 3ROEA 1SXJE 2ZYVX 3TRHA 1XPJA 2Q8PA 2W2KA 3DHEA 3RRXA 1OH5A 4DC0A 4B4DA 1UOPA 5MFPA 4B34A 1JDTA 3DR5A 1FRNA 1WHSA 2COKA 2ODEA 3BD7A 5D00A 4EMTA 3ADKA 2GAFA 2Z8YM 3NYWA 3RASA 2KJQA 4PNPA 3F8TA 3USCS 4PG4A 3P2KA 3VDXA 4A03A 4B82A 1QHHB 4LJ7A 2EL9A 3R7NA 3D6MA 1M1YA 1TF2A 3O8QB 2EF0A 5IJ9A 3S81A 4HAWA 4YAFA 4L5YA 1YWGO 5BV8A 4E88A 5T4HA 3A58B 2CHUA 4DUZB 1TO1E 1XZQA 1RZUA 5AKEA 3DLHA 3MCAA 3IYLW 4G1MB 4Q4CA 3I76A 1YHZA 2I7CA 2PKQO 1LPMA 4B9EA 2PKWA 3DOIA 3KSUA 3TWOA 3G2LA 3H17A 5AKGA 2EVWX 1ZI8A 1O77A 1ZQ1A 3FUVA 3CLRD 4R2HA 1RMTA 2NXCA 2XQJA 4MW6A 4C5BA 2VNAA 4E2XA 4ZCTA 2C54A 4AROA 3FTEA 2DR0A 4O0LA 2HYDA 2ES4A 1TVKB 4UQPA 1SQ5A 1HE8B 2A6PA 1POWA 2OYRA 4B3HA 1M34A 2HMUA 1E2HA 1H5UA 1EU1A 4YRFA 1PFYA 1RQ7A 4N6NA 3CNHA 3B60A 4KOEC 3BGOS 3ZZTA 1DJOA 2L82A 3CPJB 4J7XA 1M2FA 1VHTA 2H2DA 3GZ4A 5G0TA 3IAEA 4Z3DA 5C8YB 4R9NA 2C8LA 1UXKA 1LWOA 4CTMA 2BFNA 3JZMA 3B6KA 1YRHA 2YZ2A 4O2BA 3UKJA 3TOVA 2ORED 1S8NA 1W1WA 3N86A 5BMVB 3TEJA 1G3QA 5KSWB 1A27A 5LA6A 1Z13A 2CXXA 5A03A 1GD1O 1H4TA 2GVNA 3LI2A 5A4FS 2OZLA 1KVUA 3K5WA 5KQMA 1TTTA 3GIDA 2QPTA 3NH6A 4XWTA 2BFWA 1S2IA 2WW8A 3O2JA 4UMFA 4BU1A 4I50A 3FPHA 4HDKA 1C5KA 4K05A 2QT9A 2X2FA 2VXBA 4S2UA 1A95A 2PGNA 5HVNA 1AZSC 1FRQA 2YXLA 3M9XA 1A7JA 3D59A 4IDAA 2NUPA 4YCLA 1XA0A 1UWLA 2Q5HA 1G1MA 2GZRA 1XTJA 2QE6A 4PAWA 4U0KA 3SN6A 3EXIA 4EFLA 3NEAA 1SPBS 3UAVA 3F9CA 2Q2WA 1QIGA 4BAZA 5A7GA 3KPYA 3NVAA 1OY1A 1XROA 3UAXA 1XMJA 5IHPA 4Q66C 3JVEA 1AHPA 3H11B 3H18A 3AIKA 3O1JC 3JW8A 1KJZA 3AWIA 3QX3A 1P80A 1V3QE 4FWIB 4CQMA 2NAFA 5J1SB 4ND4A 4DLLA 1Z29A 4DA9A 1RBYA 3IHKA 4XE5A 5JYEA 4OHOA 7AT1A 1LBEA 4X3CA 4HNGA 4CNBA 3HUDA 4EF6A 2XXJA 2ET6A 1E98A 1RI2A 1GV0A 4XWOA 3ZJ4A 3COSA 4UAJA 1ZGBA 2WRZA 3PGJA 4KQMA 1HLGA 4MWCA 2OXCA 4XGQA 4C76A 3TFOA 1DBPA 4XWKA 1KH3A 4JBHA 3QV1A 5FA5A 1E1CA 2MINA 2ZI7A 4FR2A 1RHKA 5C1PA 3ESAA 3NT2A 3OTHA 5DMHA 2IXFA 2GNAA 1SGWA 4LSZA 1YBAA 3A9VA 4MZXA 1TJNA 3NP7A 2BE9A 4J2HA 4PBTA 4BFCA 3EC7A 1TCBA 1L5OA 2NQ2C 3QF7A 5L45A 1KHHA 1MF7A 2ZBQA 3SEQA 3VC2A 4DILA 5J2TB 2AS0A 1QO7A 2XB8A 3FI0A 4BX8A 1J5EB 2R1TA 4B6FA 4TT8A 1UQUA 4RMNA 2PV0A 4KXYA 3ZXSA 1XZDA 1ZONA 3GQBA 2G71A 3G0BA 4K7JA 4OP3A 5CJ2A 3QXSA 5IW8A 1VLJA 2FB9A 2VK4A 1LV7A 6Q21A 1FLAA 3H1GA 5DRTA 4D26A 4GC5A 4QLOA 3PI6A 4E4YA 1SRRA 3LSYA 1IEXA 5CG1A 4QUEA 2W5UA 5L40A 1NX6A 1TJ3A 1XP5A 2QD1A 5A0VA 2VHEA 2IBMA 2PUWA 1N75A 3NHKA 4XQGA 4EK9A 4PPYA 1QRTA 1DV1A 4MKIA 3NCHA 1H8HA 2RAFA 3AY0A 1YZLA 5DHPA 3I30X 4J0QA 1XIVA 4JB0A 4JT4A 2P4SA 4KAAA 2HDNB 1LVGA 3M9LA 4V0OA 2WA2A 2UVPB 1KRWA 1OBCA 2F64A 2PZGA 4IHJB 1TKRA 5AI8A 3TVTA 2QGFA 1QS0B 2JK0A 1E2UA 3KE9A 1CJTC 3VBCA 1KI6A 3WFZA 3EUEA 4UE3S 5GJWC 4UZEA 1L9XA 2CJWB 2P8SA 4IZ6A 2IX9A 2OVBA 4JYPA 1U11A 5LZ7A 1VCHA 5D51S 4YRZA 2QOEA 2NU8B 2ORVA 3ZWMA 3VPDA 1XKXA 5A5DA 5I7EA 3UJDA 2YJ6A 1T36A 2H52A 1INLA 1ZH8A 4KX5A 4M1KA 5JSZB 1WZCA 3O5AA 1QQ5A 3I9MA 4IXTA 4URHA 4EFMA 4C43A 3ZLVA 5DIZA 3EGCA 4UUOA 1ZRHA 2JGDA 4IKEA 4BWYA 4NK4A 1A5BB 2W4MA 3RRFA 5A02A 1NLUA 2OGSA 4M7RA 3OQ6A 3ZDZB 3CA8A 4JEUA 3UB3A 3P9RA 5K0FA 1GDTA 1Y7LA 5G4LA 3TRDA 3V48A 4U7DA 2ZROA 3CZQA 2VQEB 1OIVA 2QRGA 2XVZA 4A8HA 4CLRB 3LGXA 3ZU6A 1SXHA 1RBMA 3I9V1 1G5IA 4UUQA 2W2LA 2GPNA 5CGQB 1E6CA 3I12A 3TVDA 5K0BA 1QG0A 2ID8A 1GCIA 2CF6A 3Q8XB 4TKLA 3SE0A 4WACA 1ACJA 3P9IA 1J7JA 4MP3A 2YC4C 4XUCA 1NOJA 2JAWA 2X2PA 4O29A 1KDZA 3EH2A 4N0PA 3GLIE 1VJRA 2B1QA 3LXMA 2PD4A 1NI3A 3FMIA 1TPYA 1PFQA 1W0JD 2E5WA 4G67A 3T99A 2RBEA 2WWFA 1M9NA 4HDMA 2ZB4A 3ILHA 1QVWA 1XF1A 4N65A 1AV6A 4NCNA 1X74A 5G40A 1YC2A 2VPQA 1ODJA 2G72A 3FPFA 4HG2A 1PSZA 2R6R1 3RUDA 2ZAGA 3HVUA 5BUCA 3A6HA 5JMTA 2CL0X 3IESA 2XNDD 1HLPA 3VOAA 3DT9A 5F5LA 3O9MA 2KBEA 3U44A 3H2BA 5HF5A 1JXQA 1J99A 1OKKD 3E1GA 2HR1A 2DFKB 1US8A 1JJVA 2QJRA 4NDNE 4IF6A 2GERA 3BM5A 3M4NA 3DZGA 5A3QA 2GRJA 1PZNA 3OEHD 4J3FA 1A9RA 1XI2A 4JLSA 3VI4B 3WWDA 1RAAA 4G5HA 2ALJA 2PH1A 2V1XA 1MJHA 2ZB3A 1NWHA 4MW4A 4ARVA 4BV8A 1ZG3A 3ZD9A 3SSAA 3PQ4A 1MEEA 1WKVA 1Y1RA 2OCXA 4FQ5A 1Z0DA 4NL4H 4QJ5A 1R0ZA 4Y6GB 1J97A 1Y81A 3NBFA 1H2ZA 4IOLA 5FIUA 1KDRA 3I8OA 3D5TA 4CM5A 2QTRA 3U5TA 5BV2P 4JMLA 2GAIA 1FS5A 2PLRA 3CM0A 1YZYA 3E05A 4UJ3A 1SJ9A 3FOEC 4L51A 1IZ0A 1RIFA 4RNCA 2XMQA 4HV4A 2RAUA 4FGWA 4OK6A 2BT4A 4BO9A 1GZ6A 1XFDA 4KQHA 1XVVA 4GWGA 5IEJA 1DCKA 4PV7A 4M7WA 1ID1A 2BMEA 1PNQA 1SD5A 4Q4HA 4MV8A 3T5GA 2H31A 2XNKA 3QYFA 3F9RA 4D9FA 2E6KA 3DZBA 2VHJA 3RI3A 3L8HA 3GWGA 1V4NA 2QRKA 5HM6A 4IVRA 2IY8A 4JBNA 1NNSA 4M0MA 4RXMA 4FB4A 1J33A 2Q3LA 3F9IA 3LKZA 4ZAVA 5L6MB 2V7XA 1FFDA 4D6YA 4ZVQA 5JCJA 4DJTA 3A1VA 2VS1A 2J0SA 2CNWA 1FXUA 3ONFA 3PC6A 4OI2A 1GPAA 3EARA 3T1VA 3FZGA 2B8EA 4IRUB 4H7DA 1WXFA 4YX9A 4WESB 1MXFA 5B6PA 5CDHA 4EH1A 1S01A 1LLUA 1I7QB 2ZKIA 3VH2A 4E46A 2GYWA 1BS1A 1ZM9A 3BHNA 2WMDA 2CDCA 3GJTA 3MJRA 1TOAA 2C5GA 3PQ6A 1HKHA 3C4QA 3U4CA 1KDOA 4CUJA 1UM9A 4BXOA 2RFLA 3X1XA 3OKAA 4ROTA 3ZNOA 4S1WA 5FWNA 2GBCA 5KC8A 5AJUA 4C6TA 4NJEA 4ARIA 1BG6A 1STOA 3C5WP 4HNQA 4O1IA 1MVLA 2AFIA 2NO6A 1BCRB 3URKA 3MNFA 2FUEA 4XWGA 4UPDA 2D7DA 1FFBA 4CI0B 2PEZA 2CYCA 1AK9A 3MJVA 1T0PA 4BNHA 2AF4C 4KIWA 4NJMB 3A2MA 1N2CA 4NATA 5HMMA 3RS5A 5BR8B 2JA1A 3LLCA 4Q9JA 2KMLA 4AMYA 3M9WA 3P2IA 1QR6A 4LHYA 1LFDB 1SZPA 1XOIA 3C7TA 4LHSA 3ETGA 4JSRA 4D8VA 5CFZA 5LOVB 3T52A 1PQYA 3WYGA 4DCGA 4YJ2F 2AJLI 3HMKA 3V1LA 2WT4A 3EEIA 2AV6A 5FF9A 2Q6LA 3GH1A 4OQQA 2W6CX 4RL4A 4MKFA 3J7AC 1BMFD 1QXSA 2AQIA 4KYVA 2VNKA 4M0PA 2JEYA 2VRCA 3H99A 5KI6A 1TA4A 4CL0A 2R6FA 5G1PA 4NPAA 1SAYA 4BECA 3GOQA 2VWGA 3MOIA 2EBUA 4D8YA 5HGXA 3HVRA 2JFYA 4C5AA 2ZZNA 3PYMA 2JC3A 2YN0A 1DS6A 1XNHA 4ZZ3A 2UZ0A 2MYUA 3K9HA 5IKOA 2P30A 1PZGA 3ACBA 3KCNA 1H2BA 2VSOA 3F8WA 3QPWA 1QK3A 4JBWA 1DPFA 3KXPA 2ZSUA 2XNHA 4M0DA 4KQ1A 2PXCA 4O4LA 4KGDA 4GBGA 3T7RA 3DFUA 5LVAA 3F6BX 1CULC 2Z2JA 1YVDA 2KW5A 4MI1A 1UADA 1BVYF 2PKYX 1AKVA 2R86A 1QZXA 2B1JA 3AB3A 1KKMA 3A6KA 3X44A 2DRIA 4B3RB 1UKBA 4FD2A 3O8OB 4L15A 4BDTA 5BRJA 5BRNA 4RTMA 4YP5A 3MMPA 3SYKA 2Z1DA 1SPXA 3F96A 3TLGA 2PUBA 5GONF 3JASA 1GN8A 3JAKB 1FNMA 3JQDA 2JK1A 4PYKA 3T4UA 1U6IA 1FDOA 3TEFA 3V4PB 1QX3A 3G6KA 4C4YA 1OA1A 4BFLA 2WSIA 3DOHA 2H2AA 4ZI7F 3VRHA 5D8DA 4DOMA 3HVIA 2Z3WA 4GUDA 4JUCA 4K1XA 4IIJA 4Q47A 1KOLA 5KQPA 2O5CA 5CB0A 2DB3A 1RYEA 2J9YB 2IA5A 3FKJA 4TM8A 1VKZA 3OC0A 4EGFA 3V4LA 2RHBA 4RVSA 1OB2A 4MPTA 2AX3A 2CFRA 1TQHA 2Z6VA 1SG9A 4OK3A 4QL3A 3AHEA 4XQ9A 3FNQA 1SO8A 2WMYA 3SDZA 4WGFA 4W5JA 4OQ4A 4KRFA 3O75A 3JARA 4G65A 3PEUA 3GA5A 2H11A 3AR8A 1OBVA 2EP7A 3I73A 2GYUA 2N47A 3ZDXB 1SBIA 4AY2A 3MVEA 3FOAA 3PDIB 2BE7A 4OSPA 4BX3A 3LTNC 3FJ1A 3LDFA 4Z9BA 3UGJA 2IHZA 1Y5NA 2C78A 2QIOA 2QX6A 4AUMA 3X1ZA 3F2VA 5BSVA 4MP8A 4MOWA 2G63A 2ZSEA 2VLBA 1ABBA 3DFFA 1AY0A 3LUAA 2GOYA 2H1HA 4QOGA 1QGUA 3TXAA 3ZNPA 4QDUA 4LFAB 4OK5A 1KWKA 5IJ0A 2JJ1D 4LE2A 4NLLA 5AKJA 5CNMA 2OG1A 2P5TB 2Y1CA 3KYDB 4IUCS 2PLFA 2RHWA 3K5IA 4ZHQF 2JFWA 1C14A 1SXIA 1NW7A 2KYRA 3ANMA 1U5BA 3MCUA 1MVNA 2NOAA 4QTXA 4CEJA 1Z28A 1LDGA 4WKNA 3V55A 4D98A 2PKCA 2GPTA 2KM1A 4U2DA 1A5TA 5JBQA 1OUMA 5JAMA 3KAKA 1ZC3A 2OZPA 1E2GA 2DT5A 3AUYA 4QHTA 5EI5A 3W9SA 2HMSA 3CRVA 2O2XA 4IJMA 2VF2A 3DV2A 3HI4A 4YAKA 3DWEX 3C16C 4BC1A 1I7LA 1UT8A 4Y2QA 4WT7A 1WMSA 2AL7A 2O54A 1K6EA 5JRDS 3HSSA 2RSLA 4N7RA 3GRAA 3SOZA 3JAMA 2V8OA 4MR9A 1TM2A 1V4VA 2WWWA 3UGQA 2IU0A 1RI5A 2GT1A 2ZE5A 821PA 2Z43A 4IRMA 5KTOA 2OHIA 4YC7A 4PZLA 3EULA 5LCXA 3U9SA 4ZYLA 5MN5A 5CBPA 3NETA 4ZQGA 4NZMA 1Q1GA 2PVSA 1XELA 4HH0A 1ZD8A 3UGKA 5KTNA 1JDNA 4CVNA 4K2HA 3UZUA 1P19A 3UK2A 4FBMA 1EBBA 3EWNA 4L72A 5IFLA 4BRZA 1ADYA 1CUUA 4U3JA 1CD5A 4M3NA 2RHGB 3DDSA 3OSZA 3UJ9A 1T9GR 2FFJA 4EM6A 3RCBA 4HDNA 5C7OO 3HFSA 1FE8A 2GK4A 4NWIA 1W75A 3D3JA 3W6UA 4BLPA 2NN3C 4IINA 4PYMA 3AIOA 4B8YA 4V3BA 1TB4A 1VLVA 3M2PA 4Q7KA 5CFMA 3U2QA 1X94A 4R2IA 2RBKA 4V0LA 4WBNA 1CKEA 2VYVA 3ICVA 4X9XA 3NGXA 5G0SA 5M29A 4OX9B 3K1AB 1QGAA 1OZGA 3ETEA 1SUDA 3IMEA 2BZGA 1JPNA 1RAGA 4LBVA 3ZBQA 2W8BB 4BO6A 2G67A 2JL1A 1CBUA 5IZ4A 1MQSA 1UAGA 3GLHE 4YIKA 4UFOA 3QUCA 1REQA 2JVIA 4Y1FA 1LRJA 2JPDA 2VPYA 3IOYA 4EWLA 4Y0NA 3E3MA 4LHZA 3VKWA 2Q0XA 1W4BA 1NMSA 1SXGA 5B55A 1RADA 3P9ZA 5K6AA 3OIUA 4JIGA 4QPPA 5JALA 3NI2A 2P4UA 3ILXA 5B2EA 4RFSB 3JZAA 1MCZA 4P3YA 4R9SA 3SXJA 2QTFA 3O7MA 2ZI4A 4IVNA 1ZX1A 5JCPA 4BRSA 2XZPA 2Q9BA 1RU3A 3IJPA 2ZSHA 3ANXA 2E1RA 4FJ2A 4FU0A 1IY8A 3COYA 2WIKA 4IM7A 3S7TA 5FAXA 3NTLA 4REQB 2I55A 4JN6B 2NMVA 1BXGA 2JJYA 2O7VA 1J23A 3HE3A 4HGPA 4HQ6A 2V98A 5KKAA 4QBKA 3D5QA 2AG1A 2HWWA 4BYMA 1MPXA 4XIGS 2HA3A 4NU8X 2HPHA 4DSZA 1DG3A 3FCXA 2BCJQ 4YGXB 1N1EA 2X13A 4GMXA 2JJQA 3CLSC 4BNVA 4N49A 3B1YA 3HKEA 5TB5A 1ZIYA 2FGJA 2WE8A 2VYCA 3AHDA 3UEOA 1Q1NA 4J91A 5BWBA 3LQ4A 4Z0NA 1I7DA 1ULBA 3OJOA 1RPNA 4MRPA 3BMQA 3IUEA 4FP9A 2V0GA 1AV7A 1U3DA 3EOZA 1BVRA 4YJ3B 5TPWB 3WRYC 1H9CA 1RQPA 3GXOA 1Z47A 3ORYA 1Q6ZA 3OF5A 3RU3A 3HL4A 4FWBA 5E3HA 1MPTA 3KYIB 4ABTA 2QD2A 4ZOQI 3GN2A 4OFZA 4LFCB 4PLGA 3PE3A 3KAPA 5JD5A 1SH7A 2HXGA 2Z3ZA 4GC9A 1M1NB 1XK6A 3MMSA 5CFOA 4W5TA 3A3NA 1PLJA 3GEMA 3GUUA 4FZJA 2WSBA 1QMPA 4X91A 2V4ZA 3AEKA 4KE9A 1APBA 1Z63A 2C5BA 5DYGA 2BGTA 1LKZA 2XMCA 8MHTA 2WB4A 2F17A 5DNAA 1YBHA 5FFFA 1XEXA 2L18A 1EJ2A 1NQXA 1U8CB 3EPJA 2X7JA 4ZEXA 4LCJA 1KVSA 4F6RB 1IWOA 4DJAA 1Y89A 1JTVA 2K4MA 3H0CA 2CLHB 1JAYA 3UMGA 5EP2A 4YHBA 4KMOA 1NJ8A 2W93A 3MG9A 1UKCA 3DDOA 4Q4JB 1TK3A 2Z9DA 2AN4A 1Y6GA 1XQ1A 1R37A 1NSYA 3K0BA 3B52X 2X1MA 3LY7A 1ZNQO 8LDHA 2P6MA 1XZCA 1L0BA 2DPGA 2ZBDA 4YP9A 5E7JA 1BOFA 1O5TA 3PC2A 4LI0A 4RLQA 2CFOA 3F46A 3OU7A 1O6BA 5TC4A 3V7NA 4L0DA 3LDAA 3MGKA 4TYPA 2XCTB 2C3PA 2H2HA 2ZRPA 1OXXK 3CZAA 3V32A 4OATA 4FB5A 5JAOA 4HBGA 4HVAA 4ZVKA 2EWVA 4OX9Y 1QTQA 3U5ZB 5HRCA 4A0QA 3Q9SA 3T35A 3TR0A 2CVZA 2HQSA 1IN6A 1GV1A 3FDXA 4UC0A 3B2QA 4LHVA 2Q5JA 4ZVMA 3GNQA 4QXMA 3WV4A 4MX8A 2PAFA 1EAYA 2AK2A 4H27A 3RYHA 3T9EA 4U2FA 2DEUA 1OGYA 4LBYA 4EX6A 1GHTA 2KE5A 4ZAXA 3EEYA 2JFQA 2VNIA 4Y2JA 4E0BA 4PVCA 4RWEA 4IJVA 3FIUA 3A04A 1OXKB 1JW9B 4OCZA 4MMZB 4C2TA 3WZ2A 1LB1B 1SXPA 5DTIA 2GZ3A 2AZTA 1PQ4A 1J25A 4OGLA 5KOYA 3GRPA 3VX4A 2CMKA 5LQKA 5FOXA 1LF0A 3AL3A 3F3MA 1NRWA 5EEGA 4XX1A 5EHGA 5C5CA 1EDBA 1JVSA 3CUEF 1GUZA 2JNWA 2M98A 3ASZA 3K8OE 3Q41A 3RV4A 4P3NA 3S29A 3I2JA 1DKPA 1TQ6A 2R6JA 2A33A 3ZHUA 1WEKA 3CHYA 1KK2A 5JZ9A 2TMGA 4JGGA 5KHAA 1NI4A 1ZRNA 2KBFA 1XDBA 2CXHA 2UZAA 4PHHA 3SJCA 2CXRA 3D8UA 4WRRA 1EDZA 3GLRA 1I10A 4FBGA 2O3UA 1NHGA 4JJKA 2R6HA 2R11A 2WKQA 1H0KA 3COPA 4AI6A 4RMJA 10MHA 3Q0IA 1H3NA 1C8VB 5C35A 2IEAA 4EUKA 1Z25A 2VHQA 4M1OA 3W2IA 2XQIA 4GPAA 2P77A 2OMKA 4JU8A 3ZWNA 4EZIA 1EVEA 3RS7A 1CNEA 3SVZA 4M1MA 3WR5A 4ALKA 4KLAA 4LK3A 4XEHA 5B6JA 1ZH6A 1YMQA 2Y67A 1YK1A 1PAUA 1ZLYA 4ZDIA 3QBVA 4OA5A 3IXQA 3EA0A 4KHPB 3WHIA 3VHRA 4MUFA 3OHPA 4O4LF 1J42A 3BTSA 1E5VA 4HRXA 3SQDA 4YCDA 3REOA 1QG6A 2Z8ZA 3GROA 4DDHA 2XZLA 3G2KA 2QYHA 1FYXA 1TE2A 3NGMA 1TYEB 4NBNA 4IQ0A 1HQCA 3WYAA 1JXAA 4RMGA 1GADO 3INRA 4A5SA 3KEGA 2G1UA 2C7RA 1KMMA 2D2IA 2O2DA 1QZUA 2AFHA 1UMCB 2XMPA 4EFKA 1JS1X 4D9CA 1WL8A 3DG9A 4BNDB 5BPFA 1VSBA 2OR3A 3TQSA 3N74A 4F5YA 2PX8A 4I1VA 2O5RA 2WNHA 3UT5A 3WGHA 2O59A 2WDZA 3BOSA 3EXHA 2BOVA 2WHQA 3ZE0B 1PNOA 1YDMA 1Z6TA 5DRYA 5KTTA 3VYRB 1NJGA 2IODA 1H3EA 1LBQA 3K5HA 1UDCA 1F60A 2EFDB 2XHEA 1FOEB 4LAFA 1G60A 2JBAB 2Z3VA 3EVAA 4L3WA 3ZU5A 2I1VB 1Z45A 4GOOD 1CPYA 4UDNA 4DKJA 1SRQA 1PE0A 4X44A 2H18A 1SBCA 1AUXA 1E77A 3EIQA 4QPDA 4UHBA 3WG9A 3QVGB 3U80A 2Y99A 4M1WA 5EHIA 4AECA 4KSCA 2FFQA 1RQXA 3D6VA 2HRZA 5J9FA 2VRNA 3BK7A 1AURA 1YS7A 3WGKA 4B8WA 3G8BA 3PNKA 1NV8A 4G5RA 5AKYA 5E2BA 2IIBA 4BVAA 4WY8A 5L7YA 3TEMA 3C6BA 3ANTA 4MVXA 5JXHA 4QFMA 2JI8A 3L8YA 4G1BA 4ZQIA 3VDNB 3HKDA 1CIJA 4PX9A 4QQFA 2UYHA 1ZSYA 4YJ2A 4G0UA 3MTQA 2FE4A 3DE6X 4DR6B 1GPDG 2R1VA 4G4JA 4ZJUA 3P2MA 4JDPA 5LUAA 3BQMB 3LY5A 5DFAA 5BN5A 3QFFA 3S40A 2HF9A 2FR8C 3EA4A 3SHOA 3HHEA 2F8MA 3NAQA 4CL3A 5GZ3A 2EKPA 2O1WA 3R0QA 2O0KA 3E7FA 2GRAA 4Y98A 2FNAA 2CLDX 3IR7A 1PIWA 3IQEA 4GOKA 4REMA 4NX2A 3R9XA 1C7JA 2CVPA 2PGJA 2Q6OA 4OBEA 1GLVA 4WCDA 2QPAA 1Z6ZA 4ZJYA 3LBHA 4KO1S 3CINA 2VKQA 4OSEA 1E3SA 2B37A 2H5JA 2OK8A 2ORIA 3HJRA 4G26A 4RGBA 3L0PA 5IH7A 3TZQA 4Z0PA 2XLCA 1CDDA 1OWNA 3GT0A 2ZUEA 1RPAA 1TKCA 3BWEA 3CMMA 3N2GA 4C6SA 1XNRB 1DC3A 4RMIA 1ML3A 2FZ5A 2EFCB 5EWMA 5EN4A 1X13A 2JRCA 4EGAA 2UUAB 3ZWVA 1BRMA 1CJVC 3NWBA 2PKEA 3C7KA 3CVOA 5EEHA 5HBRA 4ZYXA 3MCWA 5EJ2A 5JMOA 1G6Q1 5IYZA 1NA5A 3D8SA 3DE7X 3ETDA 4L8VA 2I7VA 2F3PA 5G4KA 3T7JA 1YJBA 2Z1NA 4PQRA 4YBZA 5FWYA 2J0UA 1M72A 3G13A 1IZ9A 4GSKA 3EVCA 4W8HA 1KNQA 2EHDA 2PYIA 1A71A 2II6A 5KJEA 3V7UA 1YUNA 1L5KA 1VMDA 1DO8A 4FMPA 4O1MA 4ZAFA 1PT6A 4D3ZA 3JPYA 1V4BA 3C48A 1BXRB 1N2JA 4EG7A 1E69A 1GTZA 3G2MA 4ZT7A 1SKUA 3KOWA 1XB2A 1Q2XA 2FEAA 1SHUX 2EC5A 2QROA 1BW9A 3NPMA 5ALIA 1WNFA 4N3BA 4TRJA 1MENA 4N3CA 4TSFD 1GTJ1 1Z6AA 4OH1A 1NIPA 4K86A 5J4VA 3BF8A 2IZ0A 3KZMA 3QXJA 4RIFA 4DV7B 3JQAA 5AH0A 2I87A 1Y7PA 2AOVA 2P67A 3L1HA 3VVMA 2WIBA 2G40A 1PEKE 3K7EA 2AJDA 3KL2A 4G1CA 3IUSA 1L5FA 2PX2A 5ALHA 3S2IA 4CMIA 4UU1A 5HZMA 3KQLA 4EBBA 3AEUA 4W7SA 4CFYA 4WAUA 1N6NA 1XVIA 4FUTA 5ITWA 4QBFA 2ODWA 1W85A 3OZWA 1AD2A 4QNNA 5DGDA 3VR0A 2AXNA 1JHMA 1E1RD 4D6PA 1GT91 4UTPA 2YL2A 3TTSA 2BEVA 2TMKA 3RREA 2QMQA 2G5TA 2JIDA 3RS8A 3EPLA 1XRRA 2JGAA 3X2FA 4A26A 3CXUA 4QOEA 3AZQA 3HUEA 1Q20A 3F98A 5DT2A 3HXOA 1LDEA 2CVHA 5SZIA 1X7XB 2GCPA 4KXUA 4P81A 1ZXLA 4BO5A 5BW6B 1S9DA 2JIZD 3E9RA 2Y71A 3UCEA 1X39A 1JECA 2WAYA 3QA3E 4PSVA 3DGFC 4OMFG 4QOHA 2FF7A 4DAEA 1NR1A 1UFRA 4PVDA 4GE0A 1E3DA 3L4JA 3ZDFA 3HJBA 2L69A 3T1HB 2QSZA 4HWOA 1I2ZA 3PX2A 2CV2A 2NADA 3CRRA 4Q5IA 4GAEA 4C7KA 3L7MA 3C15C 2PNFA 1E6LA 3K73O 1JI3A 1KGSA 1U0SY 3LP6A 3NCTA 4X8HA 1G5HA 3AESA 2YY7A 3ND9A 4Z7JA 4CL8A 5ALEA 1R5BA 3F5DA 3DZKA 4DZZA 4XPZA 3MJDA 1CS0A 2YZMA 3WGIA 1RQ2A 1XRMA 4QUHA 4MSUA 1LBSA 1T4DA 1IPEA 1JG2A 1PGNA 3RYIA 2ZIGA 2VP0A 4OXNA 2JJMA 3BMNB 3DOJA 4Q1EA 3ENVA 4H4DA 2J6CA 4NPCA 4HDSA 5HIIA 2C95A 3F4LA 4S0XA 3WMEA