3MMXA

Bacillus anthracis nadd (banadd) in complex with compound 1_02_3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
188
structure length
180
Chain Sequence
MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of bacterial nicotinate mononucleotide adenylyltransferase with inhibitors: implication for structure-based drug design and improvement.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords nicotinate-nucleotide adenylyltransferase
total genus 53
structure length 180
sequence length 188
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3mmxA00
3TZLA 1WQ4A 3ZXSA 3AG6A 4PY2A 1NUQA 4U63A 1VBKA 3SEQA 1U0BB 2A1TR 4JZYA 2GKSA 3NBKA 3IDFA 4EFKA 3DLAA 5JBNA 2WQ6A 5BNZA 4A91A 3IMGA 4KPUA 3CVUA 3DO8A 1N2EA 2VTBA 4KPUB 4DE5A 2X3FA 2ZUEA 3A2KA 2HZ7A 4HJXA 1SURA 3KT8A 1TYBE 4MW7A 3ZIUA 5LFAA 1JGTA 3SZGA 1EUQA 4G5FA 1YI8A 1HYBA 1O6BA 1N2GA 4DDMA 4MWCA 4MW0A 3CLSD 3IODA 1WQ3A 3MLBA 3RBAA 2DLCX 3INNA 2E89A 3HFJA 1JHDA 3FETA 4DDKA 4H3SA 4DJAA 3ZJVA 1MAWA 4UZFA 3UC5A 3CLRC 2QUKA 2V0GA 4RUKA 3HMQA 3CVXA 2EJCA 4MVCA 1G8HA 4ZCRA 1LW7A 4MLPA 1WXHA 3CLTC 3L93A 4ARIA 2G36A 5IJXA 3FDXA 2J4DA 5TEVA 3ILVA 5J58A 2YY5A 3P52A 3H97A 4MWDA 1IHOA 1K92A 4EGAA 1COZA 1FYDA 2QUJA 3IOCA 4EG3A 1CT9A 3IVGA 3CVYA 2IJGX 1T6ZA 3KFLA 4AS1A 4MW6A 4S1OA 4MVXA 4MWBA 5HG0A 1YUNA 1IQRA 1O0CA 1NUSA 4YP5A 5KHAA 3BL5A 5HUJA 3AFHA 1M83A 1I6MA 3QTBA 1S4MA 5J59A 1TFUA 1IQ0A 4NAHA 1F9AA 3MLAA 1OWOA 4EF6A 1OBHA 1YULA 2XRZA 3LCJA 1IFXA 2DEUA 5TGTA 4ND7A 3OP1A 1BS2A 1K4KA 1KQNA 4ZT3A 5FO1A 1PFVA 1KKUA 3KT3A 3ZUGA 4CDNA 1VLHA 3Q10A 1K97A 3UK2A 4KR6A 2QTRA 1QRSA 3SYTA 1M8FA 1NUPA 4ZT7A 1J21A 3N8HA 1Q11A 1ZH6A 4ND6A 1MAUA 3FHJA 1OWNA 1P7PA 3MXTA 4XFDA 2XRYA 4GU5A 2IP1A 3Q4GA 2J5BA 1NYLA 3PRHA 2ZP1A 1A8HA 4DNXA 4ZCSA 1QNFA 1Q15A 1WY5A 4L2IA 1D2RA 4MUEA 2QTNA 1X8XA 2WSIA 2TS1A 3CLUC 4K0RA 1H1TA 1V47A 3K32A 3TQIA 3AL0C 2CYAA 2NSYA 3ELBA 1QTQA 1UFVA 3ND7A 2CYCA 4R2MA 3TZEA 4I6EA 5F23A 1EFPB 1KAQA 1M8JA 1WXEA 1J09A 4Q93A 1JECA 1G8GA 1ZH0A 2DUMA 2PG3A 2YWBA 4ZT6A 4DDHA 1KH2A 5LLTA 2ZUFA 1KQOA 3IH5A 4XSVA 3SP1A 3CA8A 4JXZA 4QRDA 4I6JA 3A05A 2PZ8A 1IH8A 2HMAA 1J70A 3P0IA 4MULA 2YXNA 3CLRD 3G59A 4MWEA 3CVWA 4ARCA 1M8GA 2PFSA 2RE8A 3P0HA 1OBCA 3X1MA 4UZEA 3QTTA 4MW2A 1J20A 2JAXA 1U3CA 4GRIA 1XNGA 1VBMA 1N2IA 2AG6A 2V0CA 3D6UA 3H05A 4HPWA 2Z09A 1G8FA 1KR2A 4MUKA 1Y42X 1JIJA 4PBTA 5TS2A 4OUDB 3JXEA 1M8PA 3PNVA 2CV1A 3FNRA 3X1KA 4ZCQA 1KAMA 1K4MA 4WNYA 1OWLA 3SDBA 1H3EA 3SEZA 1B6TA 3LE8A 4MW1A 3N2YA 2A86A 2QUIA 3K9WA 4YP6A 1GPMA 2Z08A 2EL7A 4NDAA 4FZJA 3HGMA 1H3NA 1O96B 4NAUA 4OJMX 1MC1A 5DK4A 3TQOA 4EG6A 1O94C 4F3RA 1QQTA 3ZJTA 2E18A 2CYBA 5H7XA 3QE4A 1MRZA 3UOWA 1I6LA 5TEWA 3ZGZA 2X1MA 3M5WA 4NX2A 3C8ZA 2RD2A 2HGZA 3HL4A 1ZJWA 2A88A 1NSYA 2E0IA 1ZUNA 1M1ZA 1NURA 3A04A 1R6UA 1KQPA 1F4LA 2OV4A 1O95C 2R5WA 2VXOA 3FIUA 5FNZA 2D13A 2VTBB 4NATA 2B7LA 1V8FA 4J75A 4CQNA 2AZXA 3RHSA 1RQGA 4ZT5A 1EUYA 3CLTD 3TNJA 2D54A 3OTWA 2BTEA 2JANA 3SZ3A 1N2BA 2J08A 1TYDE 2DR2A 1WKBA 1O94D 1N78A 5HUHA 3AG5A 3H9CA 1KORA 3IOEA 2A1UB 1WOYA 3CLSC 1JMVA 4R2LA 3PNBA 1WZ2A 4PBSA 4MUGA 4ZT4A 5KWVA 1T9GR 1GTSA 1U7DA 4YP7A 1I6KA 2H2AA 5KCMA 1GLNA 3COZA 3RK1A 4BWVA 1T9GS 3FY4A 3E27A 4DLPA 3U1VA 4MQ6A 1XJQA 1JZQA 1EE1A 1QRUA 1WXGA 2DXIA 3CR8A 1FFYA 1PFYA 2GOYA 3FH0A 1YUMA 2X1LA 4EG1A 1NP7A 2QJFA 4MUFA 3Q12A 3HV0A 3GUZA 4RPIA 1NI5A 3UMVA 3RK0A 3IMCA 1QU3A 4KKVA 1MJHA 2J07A 3ZJUA 3MUEA 2H29A 3X1JA 2CFOA 5AHWA 3AKZA 5DASA 1OD6A 1IRXA 1GN8A 1WXFA 3H99A 1JZSA 3GMIA 1N1DA 2I1LA 4L2IB 2CUZA 3IVCA 1G59A 1QJCA 1XNHA 4OUDA 1N2HA 1O5TA 4MW9A 1WXIA 1JILA 1LI5A 2C5SA 3N9IA 2A1UA 4ZT2A 4PBRA 1N77A 1IQUA 1QRTA 2BYTA 5K0TA 3IUEA 3COYA 3ZXIA 1DNPA 4EG4A 5LM3A 2J09A 2QJTA 1EFVA 1LI7A 4TS1A 4J76A 4P2BA 2QUHA 1F7VA 2D5BA 3KT6A 3RJZA 1JIKA 4EG8A 3A4IA 3PXUA 4U8HA 4MAFA 4CT0A 3HZRA 3LOQA 2PZAA 2X0KA 1N2OA 2PZBA 4JYZA 1VL2A 2CT8A 3MMXA 1PFWA 3UY4A 2E21A 3VRHA 4MUNA 3H9BA 3ND5A 1NZJA 1NUTA 3IVXA 1U7XA 1R6XA 5FO0A 1IVSA 3DV2A 1OWMA 5J5AA 1J1ZA 1KP2A 2A84A 2DETA 4MUJA 1PG2A 1R6TA 4MW5A 1O0BA 4MW4A 4EG5A 3FI0A 3P0JA 4MUIA 1Q19A 1Q77A 3IUBA 1M8KA 4NZPA 1JEEA 2PIDA 2IELA 3PNYA 1O96A 4QREA 2NZ2A 2JA2A 2YWCA 2DERA 4JFAA 2GM3A 1T6XA 3FG9A 1O97C 3GLVA 4YMIA 2Z3VA 1QU2A 1U3DA 4JXXA 1J1UA 4MVYA 1EFPA 1JIIA 2O5RA 3G6KA 1YIAA 1OWPA 1NUUA 3ISJA 4YBRA 4AQ7A 1O97D 1PFUA 1X6VA 5IHXA 1N3LA 1ILEA 2CV2A 1KP3A 4EG7A 1MB2A 1YIDA 1EJ2A 4Q16A 1T6YA 4G5YA 2CV0A 3D6VA 4U7JA 3AIIA 4HK4A 1MBZA 2A7XA 4KR9A 3CVVA 3L92A 2A1TS 4MVWA 1GTRA 3COWA 3S3TA 2O8VA 4MUHA 3IMEA 3IOBA 1TQ8A 4E1AA 1GZUA 3I05A 2PXHA 4QBTA 4ZCTA 1EXDA 5K0SA 1XNJA 2QTMA 4K03A 2WQ7A 3VGJA 3G5AA 3NBAA 1JEDA 1MB9A 2AKEA 2QJOA 4F4HA 1KH1A 3FOCA 5DB4A 1H3FA 1VBNA 2OQ2A 1EFVB 2CSXA 4I6GA 3KT0A 1KH3A 3TS1A 5DEOA 3N05A 5H16A 1PG0A 3F3MA 4KR7A 1N75A 1F7UA 3CLUD 4WSOA 1TYCA 3COVA 1I2DA 3ND6A 4HJRA 1TEZA 2DPLA 4X0EA 1N2JA 4G6ZA 3VU8A 3NV7A 4ZCPA 5EKDA 4XFJA 1ULHA 1MOPA 1WJGA 3RFFA 3DPIA 2WB2A 4CDMA 2A4MA 1O95D 4R0NA 1GAXA 1TYAE 3FWKA
chains in the Genus database with same CATH superfamily
5FR1A 3VOTA 3MT9A 1B8VA 2A7QA 1R8QA 3FBTA 2W8BA 2ZYAA 3IP8A 5DPMA 1MIOA 1ZRMA 5DM1A 2FSVC 1DFGA 1FTQA 1XEFA 2UZAA 5D85A 1NXXA 4X7RA 4D6XA 3UGTA 4Q00A 2PT7A 1Z3CA 1V7QA 4CYMA 2C0CA 4B4DA 1KMMA 1XEWY 2YS6A 3R0QA 4NVRA 2VQ3A 4FGJA 4ROSA 1VRWA 2PMEA 4CM8A 5ITVA 1RQNA 5DB4A 4W7SA 5BUQA 5EMMA 2OYRA 1GCOA 4EZBA 1J90A 1E0SA 1Y4ZA 2IZ5A 4UXHA 5CCEA 1HQKA 1M2HA 4DMRA 4FT4A 2FSGA 1LCIA 1N0WA 3FFXA 5JEDA 4N0PA 5H1YA 2H1CA 4KQ2A 3CGWA 1HZZC 1RR6A 3L0PA 5HEKA 2X2FA 1CUUA 2PUJA 4L5YA 2A2ZA 4ZK6A 3K1ZA 3WYBA 5DX1A 1OXVA 2WWWA 4BLQA 1QO7A 1T6NA 1DGQA 1ZC3A 2WUWE 3A3KA 4QYWA 5HMMA 2MSEB 4JP2A 3OFSA 4QJ4A 1YKGA 4R1UA 2RHHA 4RVSA 4ALKA 4I55F 3NRBA 4TVSA 1P1BA 2C0PA 1UZMA 2VAVA 3OZBA 4L4UA 5LIPA 4L5BA 2ZDHA 3F47A 4PS0A 4RGQA 3WRXC 3B3FA 1N0VC 4B3XA 4TQGA 2EJCA 3NH6A 1QVZA 5G0WA 2EP8A 4BQEA 1VPWA 3RWOA 1PW7A 4JVOA 1OLUB 2ZI4A 4MMZB 3S5JA 4XWYA 3ZY3A 5E3IA 4HBZA 4BO9A 5I9LA 2IVFA 3UATA 1ZUIA 1QFZA 2J4DA 1Y80A 3LC1O 4DYHA 2C5LA 2FSHA 3EJ6A 4PZCA 3RFUA 3ZHXA 1GO2A 1TMKA 1R16A 1RW4A 5CH5A 2VZ0A 1FPMA 2KHZA 3IDQA 3UEOA 3EXHB 3QOFA 1U2QA 3KOOA 3FCSB 1L5NA 5L3ZA 4DJFC 3ETLA 4O1MA 5JC1A 2LE0A 4CKBA 1SC4A 1TMGE 1PR5A 2J0QA 1N7JA 4GWKA 2YWXA 4P32A 3EPLA 1Y9ZA 2X4LA 3ELWA 3VDQA 4O4LF 4PRYA 1U4SA 3PXBA 1Q91A 3PVZA 1GV1A 4TVKA 4MIEA 3QPCA 4U6NA 3TSOA 5CDSA 2IHKA 3L4SO 4G85A 4RIFA 5JWRA 1O0CA 4DZTA 2ZWVA 2JGDB 3GQBA 3DPSA 1NSFA 1Z13A 3F5MA 3KU1A 5DULA 3M70A 2GM9A 3NHRA 3L7NA 4IJWA 4Q1VA 3L1HA 4GOJA 4FFDA 5LNK6 2LKCA 3DOFA 2Z2ZA 3EEFA 1WR8A 1BFUA 1RQ2A 2PLRA 4NAHA 2ZLBA 2OMEA 1ZMOA 1ZL2A 2OBNA 1DUVG 3TLYA 4P7BA 3W2GA 2ACEA 2QS9A 4AJ2A 3K53A 2PL9A 3V7UA 2WJWA 2QT9A 4PINA 3E3MA 4JQYA 1ZGJA 2Y6VA 4DT1A 2R87A 3DONA 4YLGA 1Z6PA 1K4KA 2JJ1A 2O48X 2PX2A 1Q44A 5K3FA 2Z3WA 4BQPA 3VNSA 4PRLA 1EDZA 5E9AA 1PW5A 3EXFB 4F5WA 5AD1A 5HS4A 5C1BA 3K8QA 3T6KA 3AERA 1KEZA 3P26A 1KETA 2QTRA 4PYNA 1QE3A 5CCBA 2ZUCA 3OTOB 2WHPB 3RHZA 4LI3X 2RK6A 1J21A 3KUCA 1KO8A 4BRUA 1PLJA 3NKVA 3LBFA 3LC7O 4D8UA 4AWAA 4ZIRA 5BR8B 4ND6A 4UFOA 2YVKA 1T5IA 2AE2A 3GCXA 1CHDA 4A0QA 5CDGA 3F3KA 3EDOA 4D9EA 1FFXA 2O2EA 3M1IA 4FEYA 3CZAA 1DQRA 1QQBA 4G8DA 2C61A 3CF4G 4JJAA 1SG9A 4ER0A 4DWJA 2RGYA 3AHGA 4DRZA 4AP5A 5JD3A 5KSOA 3PSHA 4NENA 2VSQA 1BDIA 1QNFA 3HFRA 5HNKA 1G8AA 4AS2A 1GNRA 2ORWA 2D7DA 2ZYSA 1K68A 3UBTA 2ZB3A 3AHIA 2M32A 1NIPA 3MLEA 1DIOB 1LKZA 1YDHA 3NHWA 1QTQA 5T67A 4K28A 4WVLA 1ZCJA 4UCQA 3W5JA 2WIGA 5FOTA 3WLQA 2I3BA 2ZTSA 4R1LA 1Z7WA 5CVEA 2Y6UA 3H0CA 5JNUA 2XODA 2J4FA 3PBKA 1L7MA 3W9SA 2NN3C 4HZIA 2ZUFA 1OXSC 1TUIA 4XB6B 5REQB 3O9VA 2Z98A 1H8HA 2JHGA 2YN0A 3GVCA 4MJ7A 3I5YA 5KSZA 2ZCJA 3OZGA 5B1HA 5HRCA 4MTCA 5FOSA 3LQYA 1VRVA 3G59A 3M6IA 4BFZA 1C0KA 2YMLA 3HCAA 1XL1A 1PS8A 4KE9A 1IPHA 3RJ5A 1G6HA 2JAXA 4IZOA 2IE8A 3ZHRA 4FDTA 4EKEA 2QAGB 4NBTA 1GAWA 4UCWA 1KE1A 1MU0A 2YKGA 3H3XA 1EA5A 2YIJA 1GJRA 3CU5A 4PQYA 1N6LA 4C5CA 1C9MA 2CK3A 2AG6A 2P3SA 4REQB 3ST7A 4OMUA 1OLXB 2XRMA 1HM5A 3FN4A 2BJHA 2Z09A 4HWKA 5JI3E 2VF2A 2GNPA 2OD2A 1TLLA 3HKDB 3C3YA 5JE8A 4YP9A 4Z4CA 5DYNA 1QCDA 3A4YA 4OUDB 3A6PC 2WYVA 4M98A 2O8EB 4V38A 1Z6GA 1KAGA 1LZKA 3VVMA 5D1NA 3QLVC 4BYGA 1W49A 3NOXA 4GXRA 1YA4A 2PEYA 4XA8A 2TYSB 3N2YA 4MZXA 3EWNA 1GGKA 3LK6A 1NN3A 1W8DA 3EZYA 4OGFA 3TNFA 4EY3A 2QTLA 3JRNA 3PL1A 2EL7A 5HGXA 1I7NA 2ODNA 4QOSA 5F2KA 1TAGA 3LXUX 4D26A 1U8UA 2BGKA 2DWQA 4PSVA 1GEEA 3LIPA 4EHLA 4I1OA 3E2MA 4X8MA 5LWHA 4D80A 2LWIA 2E18A 1QR6A 3QFSA 1OHHA 3PT9A 5FQOA 2J41A 3ZWKA 1Z2AA 3CZRA 1DAMA 2I2DA 3WB1A 2BFMA 3R6WA 1G3IA 2MT9A 4HSEA 2VSXA 3ZLBA 2EVWX 2QMEA 4MAMA 1AF7A 4O5OA 4W5HA 5TSDA 1ISSA 5BN3B 1SCDA 1E60A 2OGZA 4HNTA 1U0NA 4KGVA 1E89A 2CUNA 4WY8A 5DTQA 2O5CA 2G9ZA 3GEBA 5CITA 4B3FX 1TAUA 3U1BA 3FCEA 1POXA 3GX1A 5JDCC 3UCXA 2F8TA 3L0CA 2BFEA 3DEYX 4HHEA 4I19A 1QIIA 1X38A 1XEWX 4YRQA 5KWSA 4XSGA 2FLKA 3MWEB 5CW2A 1EWTA 4TLAA 4HYTA 3FOBA 1V4VA 3B6MA 1WB5A 1YZ3A 3UN1A 1K3TA 4F6LA 3WGHA 2AQHA 5EWLA 5FI3A 3MHTA 1D2HA 2EZUA 3MYRA 3NYWA 4WERA 3ZH9B 2QTVA 4HF7A 2VP2A 4LVOA 4X61A 1CK4A 1G5HA 4R9SA 4UEOA 4I1VA 2PK3A 2DKNA 1RAFA 2I6QA 2C88A 3EFOB 2GRUA 1YDMA 3F9IA 4FB4A 2EZ9A 4B35A 4MWGA 1JHUA 3UWDA 2X4IA 1G4AE 4BO4A 2ST1A 1VP3A 3NUQA 4PS1A 2LIVA 3QUBA 4MUXA 4X9XA 1WB9A 2HHCA 2ABWA 2HCTA 4JASB 1PO7A 4LF8B 2W71A 2HA0A 4CF3A 3PF9A 1XZHA 2H2AA 4MPPA 3WA6A 1U63A 1FXSA 1Z0ZA 2J0UB 2DTXA 1GPDG 4P1ZA 4EENA 4EPYA 5F1KA 4ZAGA 3DFUA 1BYIA 1BE1A 4D9KA 2AEMA 5IKMA 4YX9A 4S1VA 3AK4A 4K2HA 3RS0A 1G5QA 3C7TA 2PFKA 2PBZA 13PKA 1H23A 3A3OA 3R0ZA 3IESA 4U2CA 5E1OA 5IYZB 2XAAA 1M2OB 1UBGA 2XECA 4F84A 1DUSA 2AA3A 2J46A 4B4WA 4CL8A 4RTMA 2OLKA 2GHQA 1XAHA 3DL2A 1FFYA 3EGOA 4YWJA 4YAWA 1PFYA 1WDWB 2AI2A 2FMFA 2PLWA 1V6CA 3UUGA 4RAOA 4YAUA 4K0KB 3KV3O 5ERGB 2B6NA 4NNJA 2D1SA 3ANSA 1FLVA 4YMWA 3ZY2A 4ACBA 1SG0A 3ANXA 1P2UA 2XITA 4LV6A 1JAXA 4BQRA 1HQYE 3PGXA 3HTXA 1D0VA 1NI5A 3ANLA 1AS3A 2JBWA 3IMCA 3OPMA 5CLQA 4G0VA 2PGJA 1QU3A 1GUFA 2YHIB 2YC4C 1XMPA 3GFFA 5GPBA 3PFKA 5ISMA 4ZO8A 4V0RA 4HDOB 1ACLA 3UXMA 4TLBA 1RYDA 3D6TB 1W0KD 5T4EA 1DBVO 1P8JA 1A8UA 1IRXA 4MYSA 1PL7A 1TVEA 4B1FA 4L5CA 4HWTA 3ZWCA 5FWDA 3MPUA 4NE7A 1R88A 2R6AA 4L0CA 2Y9PB 5JRJA 3C70A 1XD2A 1I0ZA 4NJMB 4WOBA 2AGVA 1IB6A 3P7MA 3V48A 4EW3A 1SKYB 1LI5A 1MT3A 1AK9A 2VPXA 3EVZA 3W2TA 1RWXA 5DBOA 1QIJA 1QRTA 1P1IA 4LF4B 3AVWA 2CZCA 3COYA 3S28A 1UEIA 4FE3A 4EG4A 1B0UA 3I45A 1KAHA 1FK8A 3O31A 5FBLB 3X0DA 4CBVA 4F5ZA 3U31A 1RYBA 4LE2A 5CX1A 2NZ8A 2NTVA 3CCBA 3FMOB 5J1TB 2IYQA 4HRYA 1W46A 4K5QA 2Q27A 5DRTA 3RYIA 2HJGA 4I1IA 5EJ8A 2RHWA 4JJEA 1U3VA 3CW2A 4A5SA 3BULA 3OESA 3ESZA 1LFDB 3Q0IA 2WTUA 1KF0A 1E4EB 1W0JD 5FORA 4A2PA 4AZ3A 4XWWA 3OLWA 2O2DA 1UKVY 3U6KA 1E6UA 3QJ5A 4J9VA 3WWDA 1OLOA 2VP5A 2GPNA 3AKEA 5F7OA 1JJAA 2L69A 4MUNA 4Q4HB 4CQMA 4IV8A 2I8CA 3QVLA 4H3HB 1ZH8A 1NZJA 4KFCA 2BEWA 4I1SA 5HK9A 3DB1A 1JQJC 3G1TA 4HLDA 2OQVA 4Y6SA 1W6RA 3U4HA 2XUQA 4PV7A 4V0QA 3UUFA 5D3MA 5BSHA 3AF5A 3X1WA 1G1MA 1C8VB 1GA4A 2W6MA 3SX0A 4F72A 1R6TA 1O6CA 2DZDA 3B3JA 4EFNA 2YXBA 1XCOA 3E9EA 3ORFA 2VIIA 3DTVD 3LU1A 4KK4A 4WXHA 4B48A 2CBGA 3DW3X 3NM6B 2QVGA 4WXEA 2R6CA 3E6AA 3SC2B 6Q21A 1D1SA 4EVIA 1LVGA 3LYHA 1U0LA 3EISA 2NZ2A 2G63A 3Q0TA 4PNZA 3K30A 3GRFA 4YAOA 4DQ0A 1EM8B 3OZVA 1O0SA 4UM9B 5CYOA 5K8CA 4ZA2A 3ZR4B 3KZVA 1M3SA 1O2DA 1PJ4A 3AR8A 3IBFA 4HVLA 1X3SA 4ARSA 2E6KA 4GLOA 3OH8A 1GUAA 2EDCA 4F8EA 1MH9A 1NUUA 1OXKB 2D8AA 1I9CA 1GGFA 3I9MA 4BV2A 3T1OA 4B46A 2JGMA 3DC7A 3Q8XB 1T36B 3GA0A 2NV2B 5F64A 1TIKA 3ONWA 1EX6A 4XD2A 1NFRA 3WMFA 1GLVA 4BGVA 2C29D 4OKIA 2ZBUA 3VR2D 4X6UA 5DGHA 4XR9A 4CKCA 3BD8A 4CN9A 5CDFE 1BDHA 4G24A 2ZAGA 3LDFA 1NVEA 1Q20A 3D54D 3D6VA 2BKLA 2B83A 3VSEA 4DCVA 3WJ1A 1D6NA 5MF6A 1QHEA 3PDWA 2FX3A 2HO4A 1TTPB 2FEPA 3I23A 3M49A 4F97A 5DNCA 3KKPA 3DZHA 2FWRA 3BKXA 2L17A 2NVOA 3QQ5A 2H16A 3WLFA 3MCVA 1BWQA 3AM4A 4B4VA 4TV9B 2A3RA 2DX7A 3EVDA 5B7NA 5IEJA 3FCYA 4YP0A 1CF4A 1AHPA 2XBMA 2F55A 1BVRA 2ZW9A 2I2BA 1MJ5A 3UA4A 3ZI7A 5BSFA 1QLWA 1PQUA 3GGOA 1MB9A 3E7XA 3WGUA 4EVRA 1E3QA 2IYNA 1DB3A 4IS3A 2Q8QA 2NT3A 4OI4A 1GUZA 1RWNA 2FHPA 6LDHA 1AOXA 4KNWA 2IX9A 3GDWA 1FLDA 1K5GA 2LDXA 1XFDA 3A3PA 3FPCA 3BAFA 3DC2A 5DEOA 3WRWA 4C6RA 4DN6A 3INTA 2QRZA 5I7SA 2Q3BA 4ASUD 2V5UA 5EESA 3RSFA 5JC8A 1J4AA 4E5DA 3JQBA 4C88A 3COVA 4MLCA 2RFLA 3WK8A 4M0MA 4EY7A 4XFKA 1MA3A 3DDSA 1LJLA 3FTNA 4L0DA 2H9IA 1DXHA 1KPGA 1Z0DA 1W1UA 1XRSB 3LLVA 4HDKA 4NESA 3VAYA 1VSQA 2WB2A 3X1YA 2CLEB 3ZWXA 1RQRA 2AZ4A 3HKBB 2VUSA 1KYYA 1CE8A 3ROXA 1O9GA 2EJWA 2GAIA 1M72A 3C7DB 1WQ4A 4IWNA 4LJKA 1LEHA 3O3MB 5AW8A 3KUUA 3KWFA 1GILA 2QVCA 2X3UA 3RV3A 1IYZA 1U0BB 1P73A 1AXRA 2MDTA 1YR1A 3BPSA 2FAXA 4C43A 3MAAC 3IEXA 1N3YA 1SO8A 4KWHA 2ZRNA 3D7RA 4I2VA 4N65A 3DO8A 5IVIA 4HNQA 2ZJ3A 1SVKA 3CW8X 5J2TA 2I6FA 4GLLA 4MZDA 3ZWQA 1EWVA 2HQ1A 3VV2A 4A0FA 1U6IA 4CJXA 1JEOA 2JVIA 4BKRA 3DDNA 5FD8A 4M1SA 1N5DA 2VHYA 4ZHQF 1BCRA 1QB8A 2J32A 3HKBA 5D2CA 1OFTA 3DE3X 3VO1A 5KQLA 5T5QA 3R74A 3B20A 4EL0A 1QGAA 4DC9A 1XTQA 4IGAA 5BRNA 3C48A 3O83A 1N0IA 5ENVA 5AXDA 3SQDA 2P11A 2VATA 4DBLE 4POOA 2IXBA 1H5UA 1UBCA 2XMPA 3PDIB 1BSVA 4CODB 4U7GA 1FJ2A 1QK3A 1JP7A 4GRAA 4TWJA 4ZXPA 5C8YA 1SOMA 5IDWA 1NW3A 3R5JA 4C04A 4MLPA 4MQUA 1GPNA 1YZHA 3CLTC 3A3NA 3KYJB 5JJBA 1G1AA 4PLVA 2C7VA 3NGXA 1SD1A 2Y93A 2Q3MA 3AVPA 3H87A 5E1BA 1A9ZA 5EZYB 3TIXB 3OMLA 5BPFA 1HDOA 4QE3A 5NLLA 1BXKA 3TDMA 3P52A 2VTVA 3IDZA 2OHIA 3AILA 3WB0A 1D7AA 2ZQ5A 4PZLA 5IJAA 5HKKD 3WYCA 1QZ3A 4I2NA 3Q3JB 1XK6A 2ZUUA 3CM0A 1GFZA 1T4BA 1BRTA 3PHLA 3A2MA 4YFYA 1C9EA 1Z45A 3T5MA 3V4FA 4BVLA 2JI6A 5JW6A 1OQAA 2IJGX 4OQQA 1R0CA 3A06A 5DHAA 4AS1A 1L4FA 1T4GA 4KEAA 3I8XA 1XHEA 3NUZA 3PUIA 3IR6A 1XN1A 4M0EA 4EB6B 4NCJA 5BORA 1DZIA 5JJIA 4FB5A 3MIZA 4B3BA 2JFNA 2WU1A 3I6ZA 1PFGA 3BHIA 4N5MA 5LLDA 1TTTA 3DCJA 2EKZA 3EZ6A 2CLOB 5JS6A 4OK3A 4Q1CA 5JBIA 1EUDA 3RLFA 3G9UA 4GPBA 1BYUA 2VPZA 3GRUA 3OCUA 5D3MB 3VSDA 1XI2A 2D2VA 1JV2B 2VH2A 2PMBA 3IQZA 4LK2A 4C4RA 4D56A 1Q0PA 1S4QA 3QVMA 4TWAA 1E0AA 3OBIA 5DYIA 2QR5A 4WBNB 3KJQA 3ZLJA 3G2MA 1KRHA 5IC4A 2D62A 3QXXA 3B1WA 1LBIA 1EVKA 2QLFA 5D5HA 2Z1NA 3OE4A 4UFPA 3QEKA 2OK7A 2GA8A 2ZBDA 2BE9A 1KEWA 2PZFA 3NONA 4Z0NA 1N6RA 1PDVA 1X70A 2CLFB 2PRSA 3PJEA 4RY0A 5L8VA 3AI3A 2CFTA 2HDWA 4XE5A 2RKWA 5LZ4A 5I7EA 1IM5A 1WHSA 1RBYA 1RAAA 4URWR 1KJ9A 1Y82A 1LS6A 5BN5A 3N75A 1T91A 3HU2A 4R2WA 3PLRA 4HN4B 3TJMA 3I6IA 4L85A 1QWOA 5ALGA 2IU6A 3SLKA 4Q1BA 3KKNA 4CV3A 1MC8A 4XFDA 1CUVA 1GU0A 1WTCA 2WAAA 3IFSA 3MWEA 1JAYA 3PITA 1C41A 1H22A 3A37A 4QEZA 3O47A 3F6BX 3N53A 1NKVA 4R5HA 1KY5A 3B8HA 1LPBB 5E6SA 1J9GA 4RTJA 1UM9A 4GGPA 4O1IA 3A9SA 3LP8A 3D7LA 4MYRA 3SDZA 4F60A 3KD2A 2W43A 3A6JA 5EXSA 4F5DA 3VHLB 1QF6A 4V0ME 1ZCBA 3ESXA 1NJ5A 2I55A 4UBOA 4J1SA 3TQIA 3THOA 1PR2A 2MU1A 4KJXA 5FHQA 2VP9A 3A0UA 4N7BA 2QV7A 4ZCLA 3WISA 3F8TA 1V1JA 5IT0A 2FOIA 2VR1A 3CCFA 4G5GA 1JIUA 1HE8B 1UT5A 1SHJA 2CXPA 4G25A 2YV5A 2GF9A 5LOVB 5F23A 1RJWA 4HDRA 3N28A 1YZTA 1KAQA 2MJLA 1M8JA 2O7SA 3CTPA 5KREA 2B8NA 2B35A 4JBNA 2XGMA 2QW8A 5J2TB 1PWZA 4RA9A 1BMQA 1SHKA 1YFLA 1ML4A 2P8JA 1XV5A 3LJKA 3OA0A 4F4DA 5BWOA 4DRXB 1RHKA 3R3XA 2PCJA 4LF6B 4I6JA 4F46A 3JAMA 1GQRA 2BF7A 2J9XB 4M1QA 4Z2AA 1AN9A 3HZHA 4P36A 3N86A 2NTNA 2UZ1B 4IFEA 2P4HX 2VPIA 4Q15A 4WOJA 2RE8A 4RD4A 2ERCA 2I3GA 2F1IA 4R6WA 3DLBA 5C9ZA 1W29A 4BNIA 1YGYA 2R7MA 4HH3C 2P2ZA 4N01A 4TM8A 4G0XA 4LMBA 4Z8XA 4RIGA 4BB6A 1Y3FE 4E88A 4MOWA 1T0UA 3IIKA 1OH8A 3BMCB 1CJSA 2BKAA 4MVJI 1JIJA 1SXHA 4UDNA 1RCFA 4LRYA 1NYTA 2CC2A 2Y2VA 3O1JC 2ZBEA 4MUAA 4CHGA 4ENSA 3EEBA 2O57A 4HQFA 2IHTA 4AM8A 3SHVA 2VF7A 3REOA 4RKEA 1UBLS 2EFHB 5REQA 1W6UA 4NU8X 3UWPA 3LUFA 1M6VA 3BDAA 3RADC 1I7QB 1ADFA 4WPGA 3ZY4A 2G4VA 1RJGA 4BMZA 5A1TA 3EIEA 3SNKA 2A9FA 3LCCA 4JI3B 4C7OA 1NXQA 4EPWA 3P9XA 2CXOA 1OGJA 4DZRA 2J3MA 4H1UA 5KQPA 1CDEA 2XOKD 3JCZA 5I48A 3D6FA 4N7JA 1PL0A 4ZTUB 5LC1A 4LMRA 3EXFA 4FQ7A 5C1IA 2QK4A 5F76A 4GWGA 3QOXA 3RSLA 4BFYA 1J23A 5K3FB 1JS1X 5FUQA 3DO6A 4JQCA 2XV1A 5JY1A 1I6LA 1YS7A 3DFKA 1KDPA 4WTOA 5AK6A 4BVAA 1CZRA 2BFDA 3QF4A 4NARA 5L3RA 3FWNA 4FM9A 4ZV9A 3KOMA 1NWHA 4FWIB 1S2IA 1EFTA 1GU7A 1RHMA 2F2TA 3QELB 4ZZ1A 1L0BA 1U2SA 3R3JA 4OLHA 4UM5A 4DLXA 2XB8A 1L7NA 1Z7BA 2JJ1D 3ABRB 3P2IA 3X2SA 3AB8A 2W6JA 2WDZA 3FVVA 1NUAA 1NSYA 2KS6A 1WZCA 2NX2A 2GYWA 3UB3A 4Y1EA 1DT3A 4DAOA 4PXAA 4RDIA 1V35A 1V95A 2IOFA 2HHAA 5FOUA 1PGNA 3RYHB 3GLGA 3EX7C 3HXPA 3CJRA 3FUWA 1CDZA 1JQDA 2CK3D 1ESCA 1NBOA 3NBMA 3ZKWB 1S8FA 3IKTA 3AP2A 4DSOA 1VLJA 4AMZA 4J75A 4TWZA 3DBLB 1CKEA 1MB4A 1RQGA 3U4QA 2DFPA 1S2NA 4JI1B 4MP6A 1C3LA 3E9QA 2H2FA 3EDRA 3DZGA 4MPTA 4HVAA 4V0MA 3E84A 3FCOA 4ZEVA 3REFA 3MMSA 4NMXB 5FFNA 4CMBA 1JXOA 4G0NA 1PUXA 3K9LA 2UKDA 2OFWA 4G23A 4UVIA 5J23A 4P4SA 3LNTA 1HLGA 4C0KA 3AY0A 3DLTA 4LC1A 3HGQA 2ZSJA 1XR3A 4PSDA 1KSGA 5I45A 5KYWB 2A3NA 4PBSA 1DX6A 2EDAA 2VHWA 2LUOA 2J3DA 4ZRNA 3TM4A 3W2EA 4I0WB 2FSPA 3HEBA 4S1NA 3TLXA 1Z28A 2VG8A 1F2TB 2F3UA 4R1MA 4UHCA 4O0LA 2X7JA 1HH4A 1YB5A 4JLWA 3JD0A 3M6FA 1L1FA 4DCSA 2FPSA 1IY8A 3SKXA 3K2BA 3S1AB 2HRRA 4LJRA 1EXWA 1I13A 3AUSA 4IIEA 4V02A 2POCA 5DF1A 4R9UC 3NHMA 1EE1A 3SG0A 1F6WA 2Q29A 3T7AA 3VSBA 1BX0A 4YO7A 4YI3A 4CPDA 3FOFC 2A0XA 2ZT8A 2CJWA 4M46A 5THKA 2GVNA 5CJJA 1TF7A 1XZAA 3KQSA 1QFXA 2N0SA 3O2JA 4QOHA 3EDQA 3Q15C 3UKOA 2ZWPA 3JWJA 4Y98A 3HI6A 2R7LA 3ZWBA 3RYCA 3ZJUA 3Q3EA 1EHYA 3FOAA 1V1RB 2HQBA 2JCGA 2QTAA 2BM9A 4P4TA 2YDYA 2C7BA 1F06A 4EELA 3MWDA 4QAJA 3WRYA 1KJJA 1VG9B 1Z2PX 4XX0B 5FLYA 2W2TA 1QUFA 2G8LA 2GWRA 1SFRA 2GDJA 2PU7A 1UUFA 1FSGA 2I1LA 1C30A 3CO5A 3NYQA 1J9EA 3SXUB 1QJ4A 4PX2A 3SYMA 1KU0A 1WCIA 4PHHA 4UNPA 1ZAYA 4FFOA 3JQ8A 3WB2A 4LF7B 1T0IA 2C5SA 3H5TA 1GKLA 1HBJA 4ZT2A 1ZQ1A 2I6UA 3IUEA 1ZXLA 2B20A 2JI7A 2FUG6 3MFYA 4ZQBA 2P6NA 3C0KA 2WWYA 3VX4A 1I8TA 3EY4A 4CEJA 4IMIB 4UNSA 4KPFC 3A4IA 5I9SA 4J0GA 1D4FA 2GM4A 1NZDA 2N47A 2WKPA 1WBDA 3I1YA 1B6SA 4JLAA 3AP3A 1J33A 4DCCA 3U7FB 4R8RA 3PQEA 5FTLA 3MELA 3GRRA 4L5IA 3LOQA 1KJQA 3N8GA 3M6WA 4IXMA 4KV9A 5EKTA 1YVPA 2IV7A 2AR7A 2CT8A 1RPZA 4RF5A 1R0RE 4IDCA 3GLTA 1JSRA 4DSNA 5LR6A 2FXVA 1XTKA 5AM2A 3WO1A 2EWMA 4P7GA 4KN6A 3ZDBA 3R0VA 1FYFA 4C0JA 4KPYA 2GBCA 1QONA 2E37A 3PIRA 2CVZA 4S0XA 2I7CA 1RM0A 2ZWOA 10MHA 1XROA 4YRNA 2CNWA 3MINA 4MIOA 1HWYA 3HDVA 3CYFA 4DJEC 3IP7A 4LQDA 4TT3A 2WM2A 3AEUB 2ATVA 4DLWA 1EWQA 3Q8LA 5J3JA 2NO1A 1P45A 1BHQ1 3G6WA 1XZGA 5K4GA 1GAEO 2WHYA 2OHJA 3EZ9A 4AMUA 1Q3KA 2ZJ4A 2B4YA 3FI0A 4P22A 3LDAA 4K9LA 2OCAA 3R6GA 1L5YA 4E22A 4OJQA 3VPDA 5CNMA 2WVGA 3KKZA 1W9MA 4REOA 1C4OA 3BGOS 3CQ9A 2GAJA 2IELA 2PIDA 2I9PA 4BDSA 1FFXB 1EVLA 5J9FA 4OHZA 3NVKI 4QUDA 4NU5A 5ALEA 4JI2B 3CJQA 4FOSA 3S2YA 3ICOA 3GD7A 1ISPA 1L7AA 1G7SA 1FRQA 2AJCA 1U31A 1P74A 1RYZA 2D1YA 2PX0A 4DKJA 1Q0LA 5AM5A 5E9WA 5B1SA 2DFDA 4EJ0A 2WHPA 1P39A 1XF9A 3EIQA 3R75A 3TZCA 4WE3A 1BQ3A 3AERB 1SUDA 3OM0A 1CRZA 2CHFA 5JCJD 4KACA 1APBA 1I3LA 1SBZA 1GPH1 3H17A 1L5GB 2JLSA 1GXSB 5AO9A 3T4UA 2QP9X 1J39A 1UZUA 1Z12A 4FGSA 2CWWA 4I5GA 4M1YA 1TXGA 1MGOA 5E4JA 2P7HA 4AT1A 2VLIA 1SCUA 5HQTA 1E32A 1YA6A 2AW5A 4PLZA 4JDPA 2XCOA 4I5IA 3BVPA 5L7TA 5FNVF 4JXJA 4P6VF 3KSZO 1ZW1A 3IMEA 1WKVA 3C8UA 4HAZA 3IP6A 4K9QA 2R0QC 1DWQA 2CFCA 2JBHA 1GZUA 3QXSA 2JLUA 3C6XA 3KTOA 4A1OA 5B5SA 1SQ5A 1U0JA 2ADOA 2E9SA 2P1RA 4NJEA 4YJ2B 3MB8A 1WEHA 1X0VA 1C1YA 2WLSA 4IINA 2G7ZA 2HCJB 3HL0A 3I9NA 4MKGA 5AI5A 5TT1A 2UXDB 2A0YA 5JCXA 1L4GA 2FZ5A 1BFKA 1JEDA 1K3UB 2C8JA 4HNAB 1K5HA 2PE5A 5F1YA 3LD9A 4CM8B 3F2IA 1OOEA 4ML3A 4BZQA 2VS1A 4J3JA 1SVOA 2HRZA 2EG9A 1U1IA 3KT0A 3O74A 3AWDA 3LLSA 4KIGA 4Y2XA 4MKXA 4JL8A 2KSQA 1ZMXA 1RS0A 2X0NA 3U60B 3OX1A 5BSTA 2C20A 3TVTA 2VHTA 1SKMA 4JT9A 4R9VA 2GBIA 3SR3A 2GK3A 1TYCA 4BJ6A 1DG1G 3ZQUA 4IIJB 4RD2A 2BCJQ 2R4TA 3A11A 4E70A 3MAJA 4A15A 1W25A 4O4HF 4XX0A 4B2LA 3KQYA 3TQQA 3TD6A 5C3UA 1YCDA 2C54A 5TMDA 4AMVA 3M9XA 4QU8A 3U4GA 1SC3A 1UEXC 2HNBA 3U2QA 1WD7A 3R77A 4GI2A 4HZUA 3UG6A 3I9V6 4GPD1 2Z2KA 3KDSE 3LWNA 3E1SA 4OQPA 5E4FA 2EIHA 4S2UA 2G09A 5DNWA 4KN9S 1BE0A 2LGJA 4RWZA 7MDHA 3ID6C 3PVCA 4JH0A 4D0RA 1II9A 2B4QA 1IZ0A 1M0SA 2D7CA 2QD2A 3FE2A 1ISGA 2I1WA 5EEGA 4ZCMA 5JECA 1UL1X 1U81A 3KB6A 3MJEA 1W88B 1E1KA 3P71T 4RABA 3WLIA 3BA6A 3ILHA 3H04A 4CKXA 3UUWA 3LHFA 3IMGA 4Q37A 5LCXA 3FYUC 1YA8A 4FBMA 3WYFA 5CA0B 3M4JA 1Z25A 3VPAA 2AOVA 2B4AA 4HS9A 4WBNA 4H0FA 5D86A 4BX9A 5BQFA 421PA 4D3DA 4DR7B 2FMHA 3BMOA 2RJNA 1ZD1A 4QGBA 2OXFA 4OHUA 4G0YA 3L5OA 2LCFA 5ALIA 4IEIA 1DRVA 1JEQB 3E81A 1FDIA 3UYLA 4ZTBA 2OHGA 1SPBS 4XGNA 4QXOA 2VF5X 1U0TA 4IJKA 1U6JA 4IIDA 3CX7A 3NLLA 3RFXA 2QVLA 3A9UA 4FBGA 4RGVA 3A6EA 3T99A 2GWHA 3CLRC 1E1LA 1V4NA 5FFFA 1DHTA 3HMQA 1FW6A 3QLUC 3WDSA 4HRAA 3TRKA 4HNVA 2QORA 2PIAA 4PCAA 2GN6A 3ZWYA 1A50B 1O9BA 2I03A 2MINB 1J2UA 5EFOA 1BS1A 5H83A 4ARIA 3MG9A 2OBYA 5G3ZA 4OP2A 4D9HA 4F11A 1MR3F 5F1PA 3R7SA 2O2GA 4Z3KA 2YY5A 1PEDA 3NT4A 2ZXEA 1I9GA 2FPPA 1COZA 1DAIA 3JD1A 4MI3A 1H6DA 2IY8A 2JIQA 3BBPA 4MRMB 4RU1A 4DV4B 2WV9A 2BEVB 3RBVA 4ENPA 1Y8QA 2MMCA 3FCCA 9ATCA 2G1UA 4MO2A 3A4VA 1S02A 3OMXA 4B76A 1GCAA 4NH4A 4ESEA 4I1PA 3EDYA 1OFUA 1XP8A 3DDUA 2V6JA 2Y0BA 4MDHA 5FULA 1EE2A 4CN8A 2E48A 4V2IA 4B6GA 3EZNA 3JD3A 1FSSA 2O8BA 4MB0A 5BMVA 1JKJA 4QFMA 3FWPA 4ASUA 1L5SA 3KX2A 2C9OA 2EJUA 3L8CA 4A23A 3R5XA 2I91A 4A6DA 1TFUA 5BSUA 3RC3A 1PR3A 1QRRA 3IDAA 4JI8B 1Z5NA 1JMKC 3L6EA 4Y1FA 2OKGA 3C24A 3A2LA 4LSWA 3CC8A 4WECA 2HM7A 4C4SA 3ELDA 1R5OA 2NVBA 2GN8A 1EESA 3KCQA 2PLFA 1CYDA 4HUQB 2JK0A 3T0FA 1O95A 3LBIA 4B3DA 3FR7A 4NYIQ 3OICA 1FFBA 1ISFA 1LJ8A 4L3OA 3V32A 4ZT3A 1E66A 1IN5A 2R00C 3ZUGA 5A2QA 3H1GA 4EHJA 2EAUA 2HA5A 2H7CA 3ZUPA 4C4PA 7AT1A 2GEVA 2Z5LA 3EASA 3D7KA 3K20A 1JU3A 4HGPA 4Y2PA 5A3VA 2G71A 2DR3A 2Z2IA 4FYMA 1T5DX 2MSNA 4B8YA 4G1MB 1NUPA 4FYKA 3N8HA 4PLFA 4Q4JA 1MAUA 3EF1A 3ODPA 2QAIA 4OH7A 3TLGA 2VDMB 5DCUA 4X5OA 4I55B 2BJVA 1T2VA 1X9GA 3Q40A 4LMPA 4YCJA 1S2LA 2FWMX 3A1UA 4BO8A 2VDWA 2OILA 2ZM6B 5C7OO 1NYLA 2ZZKA 3AH8A 3BORA 3MTGA 3QVWA 5KOHB 1X86B 4MGHA 1GNQA 3VU9B 4RM2A 1GQ2A 1K5PA 2HY7A 3A70A 3E70C 3IUJA 4L2IA 3G7SA 4Q47A 4XPZA 1Q1BA 4YRBA 2DAPA 1X8XA 5FH9A 4U0JA 3UHAA 2OHVA 3C39A 5FA5A 2JAHA 4WUTA 5A3RA 3OQ1A 2ZRPA 2NSYA 3IURA 1V3VA 3L0SA 9MHTA 4ZYXA 2GCEA 9ABPA 5C37A 4YXFA 1NM5C 3FPFA 4JUIA 3LM8A 1BXZA 5LLSA 2B1QA 2QDXA 3LK7A 1YHYA 3NEJA 4XQCA 3GJ4A 5KX5F 2C2BA 5LZ8A 5IBRA 4NEGA 4PC2A 2R6GA 4KJZA 4Q93A 1EU1A 1VC2A 2CL7X 5CVVA 3NBYC 4Q19A 4ENVA 1UWCA 3GPCA 4WVFA 2FPUA 1I24A 3DNMA 3BSWA 3U3XA 5AESA 2HA6A 1QS0A 2UUPA 2XHEA 3QU7A 2P30A 4KVZA 3KV1A 4PYOA 5IJ0B 1X19A 4XI9A 1IWBB 2OO5A 1RZRA 1RM3A 1QP0A 5JZMA 1RYNA 1O87A 2PUFA 1XE3A 1CD5A 1SHUX 2XNKA 1U3CA 3KAJA 4M83A 3PGMA 2GD1O 2CUKA 3BWMA 1B0ZA 3SBOA 1V11B 3NHJA 2P78A 5CA1A 2VYQA 8ABPA 5JAOA 2MYNA 3ZIAA 3KP1A 4WUVA 1V8BA 2VL7A 3F7OA 1JI3A 1A69A 1GT91 1UBRS 3KDPA 3WBJA 3VH2A 2G8NA 3FLAA 2E4WA 3WKAA 3W7BA 5L7YA 2EHJA 2O7QA 3OOSA 5GGYA 3VJKA 3BQ9A 1T9DA 1WSWA 2HD4A 5FYQA 1ULZA 5KWIA 1M2KA 2ISCA 4R1QA 3G2LA 4JMPA 2Q7XA 1NRWA 2HBZA 3GH3A 3PFIA 5JANA 3H42B 4MCHA 1FRNA 4IWXA 1GZSA 2C97A 2R1VB 2Q6LA 3SC6A 2QG6A 4Q3AA 4M54A 2IC5A 3O5AA 3P9IA 4LNAA 1Q5PA 1IUNA 1SHTX 1Y48E 2R1VA 2ZSFA 4OJMX 3ZU2A 2GETA 1XTTA 3ZHOA 2HXGA 2GXUA 4WD3A 3AM1A 4GPEA 3RYFA 4F3RA 1YVUA 3P1JA 4I36A 3BH7A 2RH8A 4C0AC 2B21A 4C6TB 2ZJ8A 4QODA 3HEMA 4N0EA 4OHXA 1W2HA 4XOUA 5KKAA 5KNCH 3N5KA 4ZOAA 3TMKA 4AAYA 5LQKA 1IY9A 3G7UA 4HAIA 4JEMA 3UOWA 4P58A 1T9KA 1ISMA 4YR9A 4MEAA 2IW1A 3FOEC 2WYWA 4DABA 1HSZA 4QLAA 3D1VA 3EEYA 4QPDA 4AY3A 2X0JA 4D3FA 1OT3A 3S8YA 5F3WB 2HZBA 4XGKA 2V6IA 4KHPB 3PRKE 3H9EO 3GP8A 1X1EA 3NX4A 1ECPA 1TL7C 3CZ5A 2BP7B 3IJ5A 1K89A 3R9KA 4DGSA 5GVSA 3PGVA 1PVVA 2NO7A 1RXYA 5AK3A 3EPHA 2W70A 3K4HA 1Q0QA 1Y3DE 3C41J 3JQ9C 1BRMA 3BWVA 3SN6A 1JLHA 3H6GA 2VTBB 4JNCA 3HKEA 1AE1A 4N54A 1WW3A 1NR5A 1XZBA 1C3VA 3SR4A 5I9BA 4QQRA 2VWHA 3II6X 3LRTA 1MO2A 3TFWA 1YRLA 4JWTA 1PYGA 2FY8A 1M6HA 1SY7A 1J2TA 2DHDA 3OQNA 2ONCA 4MVJD 5EJMA 1NHGA 2OESA 1U7TA 5CYFA 5F33A 3ODGA 4GZ3A 3WY9A 3JZIA 4ZAZA 4CMIA 1H0KA 1KORA 3IOEA 2J6CA 3NXKA 4OQMA 4QVKA 2A1UB 4F96A 4UE3S 4ID9A 4CR6A 1L2TA 2DFVA 3K73O 4K9OA 1T9GR 3L07A 5JRZA 2ODEA 1ONPA 1ZI6A 2FFHA 3GB9A 3JALB 3JWHA 4N4AA 3ENVA 1RSZA 3OY2A 3RTCA 4Y67A 2NO9A 4ZVMA 3WKBA 4G5OA 5CHYA 4QYMA 4S1WA 1XD9A 3RK1A 1JDBC 2YY7A 1JDJA 3LKBA 2J3IA 4BWVA 3QVXA 2WFAA 4IRUB 3WMRA 2IEAA 3KKMA 2GAAA 3AESA 3CRNA 5K8LA 3UFXB 5HJEA 3BCUA 2MSKA 4MRSA 3FUVA 3GPIA 3PPVA 4JODA 4TYYA 2P8SA 2H0RA 1F3OA 4L22A 1PWHA 5I7AA 4H18A 5K3EA 4YRJA 1U4NA 4H77A 3E23A 2R96A 3FNEA 1ZQ9A 3O1IC 2EW8A 1ZUWA 1EP1B 3IRVA 1FUKA 3WGYA 1AGXA 3FTFA 3L4BA 1RM4A 2C57A 2ZBGA 4EZIA 2X8JA 3CN9A 5CX4A 3GFRA 4RF3A 1GG8A 2E4UA 1E2FA 3QXCA 2Q5HA 3MUEA 5DSXA 3IALA 1WUJS 3G5UA 4LV5B 4AICA 1OLSB 2I6GA 2WJAA 4B6PA 2QT1A 4ZN6A 2BN4A 2EYQA 1OD6A 3UPUA 4L72A 4QPJC 3MXOA 4U3JA 1PGPA 3QIVA 4CTJA 4HAXA 3T4XA 2D5AA 2VNIA 4X3PA 3PQCA 1T0HB 3BWXA 2H8GA 3ITDA 4B5LA 5KTTA 1CP3A 1TZJA 2OZPA 1ZN8A 3DL0A 5K09A 3O84A 1X74A 2X23A 4PC1A 3CUTA 5TT0A 4HDMA 1G2QA 2JFBA 1Y9JA 2WMYA 1YHZA 2XZDA 1ZG3A 2ZUSA 4WRRA 3RS4A 1NG1A 1YS9A 1CQJB 2Q41A 3ZK7A 4GQBA 4P3OA 4GWLA 2ESRA 2HH9A 2QUHA 4R1PA 4CETA 1HY3A 1BH6A 1NE2A 3B1KA 3EK2A 4M8IA 4JYPA 4RELA 4RMNA 4O4JF 3I4LA 5KYUB 3WLNA 4KQ1A 4NE2A 5F1OA 4ZGGA 2NU7A 2Z4TA 4MAFA 2NV0A 4Q0MA 4IICA 1A9YA 1HXHA 5DKFA 5JYEA 2WD7B 1QOQB 2VK4A 3ROPA 3MUNA 3P2KA 4UU8A 4PAOA 4QULA 4Q9JA 5K8UA 2A5JA 1OSNA 3PA6A 2JIZA 2E21A 3JQ9A 2CD7A 1DQZA 3KHSA 4KIWA 4YUZA 1JKFA 1QYWA 1TJYA 3AU8A 4FNGA 4L75A 1P72A 3AR6A 3B9BA 2WKSA 5CNJA 4IIGA 5EIOA 1GRNA 3GDGA 5FTJA 3P9PA 2D2EA 2XUFA 4DEYA 4ECEA 3U6BA 3TF5A 3T3IA 1CS0B 3TLCA 1Z38A 1U0SY 3DEHA 4CE6A 1SKAA 5FPKA 1N7GA 3DLIA 5JRDS 1AQJA 4MUJA 4W1PA 5ALSA 3DVLA 4JAVC 1MQAA 2AG8A 4EPXA 4BKQA 4JLMA 5LBIA 1FU7A 1E6MA 4GLFA 5FLEX 4I55A 2R8BA 2C8VA 3PFBA 4DDVA 4Z86A 4FLFA 4KXQA 3KYBA 3MD0A 1OREA 3FA2A 3M0EA 4FONA 2B4RO 4HGNA 1I7LA 3H19A 4N03A 1ADGA 4XQ9A 4BNNA 3AVVA 3AVYA 1GR0A 1DCTA 4YK7A 4TT8A 2WHQA 1ZVVA 1QIFA 4UNQA 5DV9A 1ZIPA 1RRFA 4U6SA 4NHOA 4DPKA 1P5HA 2Z3VA 2UUBB 1EFRD 4XYEA 4EB8A 2SKEA 1FVXA 3N2KA 5BN4A 4OOEA 3VR6D 4MV0A 1UBFA 2LP4Y 1KOLA 5KMGA 1WSBA 2Q2NA 5DHUA 3VKVA 4B81A 3TG8A 1G19A 2B9EA 3LNCA 1WSDA 4YBRA 1PZGA 4EJ2A 1FX1A 4UCFA 1H8EA 5KNCA 3IBGA 2QOEA 5CB4F 2VHEA 1ATIA 1YZUA 2C96A 4HZUB 3SHOA 5HUQA 2DKOA 3HN6A 3QNWA 2CV2A 1XRMA 3D5QA 5FL7D 3DWIA 5K0FA 1V43A 1HQCA 2QHXA 3JZDA 4P4NA 2JPDA 3KQVA 2RI1A 4Q3BA 2KW5A 2CV0A 4QBIA 4U7JA 1JA1A 3VJMA 3KQNA 4RH1A 2QGNA 4BNKA 5EHIA 1CR1A 2J9RA 2J48A 4FR0A 1OYVA 3HWSA 1RI5A 3OU6A 2YX1A 4FYYA 1TQHA 3I2JA 3KO8A 4IWYA 5FF9A 3S3TA 2O8VA 5KYGA 5JV5A 2I62A 1A7UA 1I14A 2AMVA 2W5UA 3I05A 4I5EA 1Z18A 1AC5A 2TRSB 1KFCB 4KE6A 3GLHE 5E7MA 1SCIA 1XNJA 3RS3A 3JYOA 3UAGA 5AVZA 4JUCA 3IX7A 3QENA 3ESYA 4RE5A 1KWGA 2J9YB 3ZD8A 2IZ1A 1GZ6A 2EJTA 3VYVA 2ZIFA 1C1HA 4MWSA 1TYZA 2G25A 1EH5A 1VI5A 2OQ2A 4M9CA 1W1IA 2AFHE 4OVKA 1YDEA 3EMDA 2QUBA 1FL9A 1UBMS 4R7TA 3JAWA 2BWJA 3EF3A 1XMOB 3AYXB 2G1AA 2XDAA 1N75A 1BX1A 3D3NA 5F35A 2VEOA 4NMHA 3CNQS 2Q50A 1JKIA 4XTCS 1I2DA 3RU3A 4QXMA 3V8PA 5AJUA 6GPBA 3CIFA 4J0KA 1N2JA 2IWHA 5J1SB 1UQRA 1X1DA 2RI6A 3FWZA 4WXYB 4A0HA 1OA1A 2HA4A 3MD9A 1OIXA 2BVNA 2Z43A 1U2GC 3UV7A 4B3MB 4QJIA 3OIWA 2JLVA 3NHSA 5K3AA 4PYQA 4WMLA 3L7OA 3K0FB 1JKMA 1Y1TA 3FWKA 4HDNB 1QGDA 3VC1A 4UTPA 2IH2A 2CSUA 4K3UA 4LX0A 4GXQA 4NR0A 1GN9A 2F1KA 3ZWPA 1D0IA 1M1UA 1SCBA 3BA1A 3NETA 2NSDA 3GN1A 4OI1A 3AIOA 4Z7QB 2AC2A 1LV8A 1VI6A 2A1TR 2XVZA 2Y68A 1W4AA 4FQ5A 2NNWB 4LRSB 3QQPA 3RT9A 5TMPA 3CRZA 3BEDA 5KS2A 2DUJA 2ZRAA 3P2JA 1TUBB 2FW6A 4Z99A 3ZZ1A 4EQ6B 1ORWA 2Q07A 4FLEA 4W6QA 2QEQA 3TSCA 4B6EA 4DE5A 4HB3A 5SYMA 4KIUA 4QHYA 4A36A 3Q8MA 1WPRA 2G0NA 2BHRA 2J9ZB 3CX6A 3LC2O 4MO9A 4N5DA 3IUQA 3GZ4A 4JLUA 4NDZA 3PTLA 1K1EA 1PX2A 1T5LA 2ZSBA 4G5FA 4TKLA 4W7IA 2CY0A 5CVJA 2HFKA 3RUIA 4RTSA 3I6MA 2XSZA 3IUYA 2REOA 3H11B 2HCBA 1QO0A 5GONF 4E6EA 3DLPX 1G5RA 3MLBA 4MPRA 1LSOA 4F9GA 3UWSA 3AW9A 1IIRA 2VFAA 4H3SA 3DGFC 4FEGA 3H3FA 1CETA 1RZRD 4FYPA 4ER5A 1QIGA 3HFSA 3HCFA 3MZ0A 4HDSB 4MYHA 3RKRA 3EGWA 2QZ9A 1DC7A 4GX5A 4ACAA 1DQYA 1G8HA 2HDOA 5H81A 5B7QA 4B7AA 2C42A 2VP4A 2EKLA 3ZOKA 2WF6A 4Z0TA 4D9IA 4PCUA 4Y9TA 4ZRMA 3BREA 2QU7A 1J24A 1H1LA 2JCXA 3HZOA 5CLHA 3ZZNA 2KB0A 4Q05A 4BJHB 5BYAA 1RPJA 3QFHA 4Y2TA 4X85A 2EKPA 4HGYA 4TTSA 2LR0A 5DM0A 1ONOA 3KU4A 4QNRA 3R9IA 4RNDB 1XHLA 2YFQA 3GRAA 4B3GA 4BN0A 4URFA 4KX5A 5KEIA 2OCXA 1FDVA 1QBGA 1U0HC 4IM7A 4C0BA 1O94A 2C82A 5SZHB 3RU7A 3SX4A 5IM4F 3JASB 2NU9A 3B6JA 4Q3CA 2A5FA 1NW6A 4RF2A 5EJ7A 4R83A 7YASA 1MQ8B 3LHIA 2P90A 5BSRA 5CB0A 2HPVA 1CW2B 2Z5GA 3AUJB 4TSKA 1DRKA 1FRFS 2EJBA 2QPOA 4ZAWA 3TL3A 5B30A 2O8EA 5FWAA 4DCUA 4G9BA 4ZMRA 4Q3EA 2H7VA 3NORA 4JT4A 2FPRA 4WA8A 2CL0X 3M81A 4MYTA 3EVNA 1TVKA 1RADA 3LKDA 4QL3A 1T8UA 4RPCA 1TW3A 1CUYA 1E6CA 1TKAA 2FG6C 2XXBA 3U39A 5JAIA 2QR3A 3LVBA 3DOJA 3DL7A 4ZHQA 4YJHB 1BGVA 1IFXA 2WF9A 4ZO7A 5KAMA 3ZTTA 1EMDA 3EWSA 1JDUA 4RV9A 2YQ5A 1B43A 3NHLA 1JA9A 1TQDA 2XE7A 5EJ6A 5D3KA 4PEVA 2XNDA 1SBQA 3IT1A 2QAGA 2JJQA 4BOYA 4HNUA 3O21A 1GR1A 1N2ZA 2FPOA 2OG1A 2ZB4A 1ODFA 1RWBA 1ZJZA 3S29A 3O93A 3WZMA 2LDBA 2QX8A 1QXSA 3H6HA 3IJEB 3OQIA 2CVFA 4G37A 4UM7A 2QX6A 1FB5A 3GYGA 1DHRA 1FSZA 1GZ7A 2JATA 3DVAB 2OT3B 3QI2A 1UANA 1P7CA 3VR0A 2PJDA 3MXTA 3Q7RA 4Q9DA 4IOJA 5IEBA 2XRYA 4IHQA 3V1UA 2PKWA 4NFLA 1UBJS 2G77B 4GU5A 2ON6A 3Q4GA 1M66A 3I0ZA 4O63O 3SE7A 4B85A 1V9CA 3GOHA 4C03A 4CG0A 5HOEA 3NYRA 5EMHA 1H1DA 2CXTA 3R24A 3A6FA 4G2TA 4JBXA 4TVOA 1C1DB 3WC4A 2XXJA 2WFZA 4JBIA 5H3HA 1QCCA 2MHCA 2QMOA 1ZJ6A 4PAGA 1L4NA 1D2RA 4GG1A 4N39A 3R8FA 2J5XA 4UBNA 5L3SA 3HRIA 1K6IA 1TT7A 1K0UA 2V7QA 4IIXA 3CWZA 5EZYF 4AULA 3S8EA 4JYMA 1F2VA 5P21A 2G82A 1EZZA 1XMIA 3PDUA 3TYXA 3PRYA 3IV9A 4LVNA 5EJIA 1XQ6A 2ZVQX 4Z4QA 1WXEA 3PVSA 1SIWA 1VL8A 5IDVA 1YMQA 4EECA 3RT7A 1GG2A 1JECA 5LDDC 4KU4A 3RVBA 2OGUA 4PTZA 4QM7A 3Q7EA 2RI0A 4LJ4A 4CV2A 1PQ4A 2WJZB 3THSA 4C5BA 1DCMA 1DDOA 1UDCA 2VDLB 1ZU4A 3K0HA 1BEZA 1T5SA 4F93B 4CLHA 2XB2A 2QP3A 5LUAA 2WF7A 1KHHA 4JELA 1WXXA 3P0HA 1HDEA 2AKYA 2HB6A 4W9MC 1TCUA 1F0NA 4DT1B 1G5TA 3AV0B 4CFZA 5JHHB 1RXVA 2JLRA 3KEGA 3QG1A 5L3SB 1XA4A 4FZRA 3SX2A 2Q0SA 3TZ6A 4KO3S 2O8CA 5DTMA 2IOHA 1TGVA 5CFLA 1P7YA 1EDBA 5IH3A 5FL3A 3LLUA 1KY4A 3QK7A 4MUKA 3ZV4A 1XB2A 3QELA 1CWUA 5F4BA 5FTKA 7GPBA 2TECE 1N2CB 2VBGA 3RIYA 4CMEA 2ZRDA 1QH1B 1UKYA 2OMKA 5BN1A 4KL8S 2XMBA 2VQFB 3PNVA 1LBEA 5BNWA 4ND3A 4X1OA 3NW9A 3IA7A 1H3EA 1K4MA 2JG3A 2DBZA 1FJGB 1RAEA 5IAKA 5BSGA 1ZIYA 2HIGA 3CKKA 1EIZA 1EVJA 1VYTA 1ZWLA 5T64A 3NHUA 2PV0A 3HVHA 1CIJA 1Q12A 2IGTA 2H1RA 2FV8A 4INZA 1A9SA 1KY3A 2Z4SA 3REQB 2R8PA 1C1XB 2JIDA 3HGMA 4DQDA 1E3WA 4JWKA 1R4NA 4C2UA 1R8SA 3QX3A 1LU9A 1PTJA 1NKTA 2X40A 1P5ZB 5E2BA 5EMJA 3IO3A 3G23A 4XSHA 3O3OB 1IHUA 1YRYE 2GESA 3OHMA 5JVDF 3PTAA 3C87A 2EF1A 2FX2A 1I4EB 4JJKA 3HKCB 3BWBA 2PANA 1G20B 4BNXA 3IPLA 2EU8A 3LT5A 3CWQA 4G5QA 3UC9A 5JMPA 3CLHA 3HYTA 1DBQA 3NTRA 4MV4A 5MFPA 3A9TA 1H4QA 5IM5A 3A1EA 5TEWA 3BF7A 3RUPA 2G5CA 2LCQA 1E7WA 1X1QA 2RBEA 1Z6YA 3NATA 1XMVA 5B58C 2Y1LA 1M7GA 1XK7A 2IZ7A 2HF9A 3B6KA 4CG3A 1NATA 2BI7A 3GQBB 1ZVKA 1JFFA 4O33A 4KIFA 3G02A 4AS3A 2FQQA 1ZN7A 3O8BA 1D2EA 2ZJ1A 3OSZA 4OHCA 4CEHB 5HFNA 3THWB 2YRFA 4GMKA 1ZA2A 3ZVRA 2FEWB 1JDSA 1ODKA 4UULA 4H7PA 5DWVA 3HVJA 1RXUA 2BFWA 5CJPA 3RD5A 4C22A 1SBYA 3C5CA 3AINA 3CNHA 3MYYA 3VFDA 2R2GA 1A5BB 2NYUA 1JA0A 1ZK2A 2P4EA 3DA8A 3R3ZA 4OMDA 4S3MA 3OO0A 3RHSA 5G02A 1A4UA 1GTJ1 1T0BA 2GYYA 3M4YA 1NMYA 5THXA 5C32A 5CVTA 1SEPA 7REQA 4X6YA 1A8PA 1RT9A 4I1UA 4IFTA 3RIHA 4U4AA 3SZ3A 3UQZA 4L9WA 3FROA 2BY4A 5EGNA 1G7TA 2C5GA 2J08A 4M89A 4JYAB 1XJ5A 1FYVA 1PL6A 1WV0A 4HEA1 2BMWA 4XUEA 3W4JA 4B0PA 5IF3A 4IG9A 1I30A 1MIOB 3C4JA 4EX6A 2PJUA 3PD1A 3TQTA 3WWCA 1H1LB 2VYFA 2HSGA 2VCYA 4Q34A 5KC9A 2YHUA 3KR0A 1IC6A 1M7BA 1MAAA 1NC1A 3CPSA 3RRNA 5DNVA 4B7ZA 1C81A 3KXDA 2FW0A 3JPWA 5C7IO 2PCLA 2QW0X 4L0MA 2F64A 2PKEA 1LVUA 2ES4A 3DCYA 1VCOA 6REQA 2H5LA 1GPJA 4R4JA 3C3EA 3ENKA 4NFSA 4P8RA 4N7RA 1URPA 1SQFA 3OCCA 4LBWA 2FZCA 4BO7A 3UBMA 2NU9B 1A77A 5CG2A 2WMNB 1DTWA 4GOOD 4E5KA 3UJ7A 1OIVA 1Z4LA 4V3BA 4RV4A 3IQWA 5CLIA 4B8WA 1BW9A 3STVA 2A30A 3QXGA 5GM2A 2BF4A 2G5GX 3FNBA 1CX9B 3QVGA 1XX6A 4CCWA 5F51A 5TGDA 2W6OA 2XUDA 2VTEA 3ISTA 3GLUA 3OCXA 3I0NA 1QVAA 1GPUA 1Z36A 2XY4A 4YRCA 5AW9A 2FPIA 4GX1A 4G67A 4W1RA 1WCYA 5EJ2A 5BSKA 4TYQA 4W5NA 4LG1A 4OBBA 5AKIA 1TPZA 1TMOA 1ZGBA 2CHQA 2M98A 4JUAA 1RP1A 1UJMA 4HQRA 3LG2A 2ZDGA 4Q9HA 5A5EA 2V7QD 3MJRA 3Q12A 5K0NA 3K5HA 1FFCA 4DA4A 4XWGA 3TTYA 1O4VA 3LTEA 2CNWD 1HETA 4RKFA 5B3KA 2H8KA 1UAAA 2V9PA 1N5JA 3I04M 4RIEA 4YH1A 1A71A 2EFCB 2JCSA 1OFGA 5H8WA 1WXFA 3NPAA 5TGZA 5E3HA 4LFCB 1VJ1A 2ZYUX 3ON5A 4Z3DA 2JFYA 5DHSA 1Z9BA 3T61A 4CV0A 3M3HA 2JFVA 3U7RA 1G59A 1X7DA 3B13B 3DMHA 3L1VA 2EFGA 4MQMA 3WYAA 1N2HA 3OZAA 2YQZA 4Q7MB 4A8TA 3GH1A 3TW8A 4IKOA 4RTRA 2MWMA 4PSUA 3TECE 5IT5A 3N9IA 5M2QA 5CYPA 1DO0A 1RC1A 5LQMA 3DP9A 3M9WA 4ZC8A 3HXOA 5CHEA 1PT6A 3KZKA 4AO7A 4RK4A 1JDVA 4QG3A 1JL3A 3HO6A 1GDDA 4C2BA 2JIOA 1BVHA 4E5UA 1PFQA 5B55A 4F7WA 3ZZUA 3RJZA 3A7DA 4LY3A 4FC7A 3H1BA 4AJHA 5I8ZA 4PX5A 1YL5A 5JCJA 1LK7A 1X7ZB 4LAFA 3ZU6A 4ZEMA 2DWPA 8ATCA 5JMOA 1J42A 3M1AA 3SQWA 1ZICA 1LPSA 2PS9A 3HZRA 1QE5A 3H4VA 4C20A 1MJGM 1D2AA 3RHTA 4LDRA 3I64A 2PZBA 5DGXA 1U7UA 2PVCA 2ZRMA 2F43B 4PLYA 5KTSA 3N74A 4QOFA 1FCJA 2RC6A 3E8XA 3EVAA 5ALPA 4P3PA 1MO4A 2HIAA 2VN8A 4FT2A 4Z9BA 4E5MA 1HX7A 3C3WA 1Y3AA 3P2OA 1G66A 4PCVA 4WFQA 2ZBVA 2QMHA 5D1HA 2OP0A 1OX4B 3UJ6A 5BUZA 1RFGE 4LJ9A 4LKRA 4KQHA 5J5AA 1JJBA 2NPFA 2GM5A 3PPIA 1D2MA 3EYWA 5JO9A 3ZCSA 2C31A 1LK0A 1WS6A 2FPKA 2RBGA 4WH0A 5BVHA 2XUJA 2B34A 2CL5A 2DECA 1B73A 2B8EA 3BMNA 5ECWA 1HC7A 5GJWC 4KOAA 4LX8A 3GA7A 1ZR4A 2EBFX 2QRLA 4C4OA 4XWAA 4CIXA 4PVDA 3VNVA 1GCIA 3UTDA 3WL5A 3IL2A 3EDMA 3QJYA 1SBNE 4LOIA 1CVLA 4WCFA 5EJFA 1UOPA 1SBCA 3NDIA 4DY4A 1KZYC 4EGFA 1USKA 3UANA 2ZSEA 1OKKD 2DERA 5CURA 4LCBA 1H5NA 4AMYA 4B87A 1F12A 5HIAA 2XNHA 1ZM9A 1Y5LA 1EFDN 1U3DA 1ZCFA 1XQ9A 3KD3A 4OOFA 4F92B 1EFPA 1XWWA 3FM9A 4LOKA 2UYOA 2IIVA 2XX3A 3QZUA 4JS0A 4BKOA 4V1CB 2XH8A 3E61A 2WTEA 3PRJA 3P5SA 4QBHA 1OV4A 3K92A 4AQ7A 1PFUA 3QPWA 4TTVA 2RIPA 3C74A 5BPHA 5IHXA 1NA5A 5LOVA 1Z39A 1CQXA 2Q1XA 5IWAB 2QRKA 3NVDA 2W6ZA 5CFNA 2HSWA 2A8YA 4EG7A 1KWKA 4DCGA 1A5SB 2OLEA 2PZGA 4A92A 1AXGA 1B1AA 1NBMA 1O8BA 1E2PA 4DRYA 4WHMA 4M7RA 2VDNB 3LBAA 5EC8A 3HHEA 3AHJA 4MVWA 2CEAA 2F9LA 4RY2A 3TXYA 1J5PA 1N34B 1Y81A 2AC7A 3UMMA 5FR2A 3D6AA 1UXKA 1TQ8A 4IMPA 2RB4A 4YRRA 1UXOA 1WXQA 4EGJA 3H9GA 3SOPA 1DEXA 2VDJA 3IIIA 2OM6A 2YWDA 1R3DA 3FUXA 4RTLA 4MDFA 1A3CA 1BROA 1J8DA 2H9YA 1NQ5A 4TMXA 2X8WA 3BSSA 4INOA 3U3OA 3E1GA 5LXTF 5A4MS 4KQWA 2CHEA 2RGXA 5AVOA 1CUJA 1LDGA 5IULC 3SK0A 1G7CA 3CXRA 1OTHA 3INYA 3BZWA 3GAZA 3U7QB 3MCAA 2Q8PA 2HUPA 2ANBA 3GJ6A 3ZE2B 1S6YA 1I1HA 3HBNA 2I67A 1SVLA 4FGLA 4AO8A 2JGJA 1Q50A 3X2FA 3TS1A 3RV4A 3W1EA 2HFJA 2R86A 3DHYA 2AN1A 4DANA 4G1BA 2ZANA 2LIPA 3HC7A 1PG0A 4DWVA 2WE8A 3CUYA 2CHVA 2FMUA 1TF2A 1G9XA 4RCZA 4X93A 4A16A 4H7DA 3EZLA 4IIHA 4PIVA 1UM8A 2JLQA 521PA 3H75A 4WINA 3U49A 1U8YA 3WB9A 1G8KA 1SXJB 2IXEA 4GHWA 4RL4A 4TSFD 2DH6A 1G3QA 1WJGA 1YSCA 3IAHA 1XFAA 4M0PA 4MR9A 4D57A 3SDSA 4EFDA 4LHSA 1QIDA 3IP5A 4JP1A 1WL8A 4RD6A 3T7TA 2NWQA 1V8ZA 3OUZA 3F9CA 4US2R 5CXSA 3ZBQA 1FFGA 4NBSA 3HEAA 1GG9A 4B79A 4Q4HA 2C92A 5AW3A 2GNOA 5A7HA 2BGJA 4DMHA 3AZPA 3GJ0A 4X3CA 1OI3A 2ZU6A 2A5GA 5B2FA 1RRVA 1YACA 2GJ9A 4Y0NA 4ZVVA 3UXHA 5AMXA 5L3VA 4F45A 1HEYA 2I4IA 3E35A 2AEEA 4UEKA 3ZDRA 5BNZA 5C3MA 2PX6A 4MQ5A 1HR0B 3JVDA 1U8ZA 3OUUA 4GM1A 4LDJA 2VA9A 5ALOA 1FQKA 3O8QA 5ULLA 4AO6A 4CIDA 1A76A 1ZINA 2WM9B 3O0DA 2EIXA 3ANTA 1EZ4A 3CVUA 1O6FA 2J87A 1QP7A 2OFFA 3LQ1A 3MT8A 1XDSA 3K9GA 4J0EA 3U16A 1YH3A 2HXYA 2HLPA 3E7FA 4AU1A 6PFKA 2DWUA 3AOGA 2H9AA 1PYDA 4Q9NA 5AVJA 4N6NA 3RS7A 4CLOA 1Y9EA 4ALIA 5KHOC 1LS1A 3B9QA 4MWCA 3NDBB 3IODA 1A7KA 1H6CA 2VYVD 3HFJA 5HE9A 1RTKA 2R6ZA 2PQ2A 3RC7A 4OHRA 1SCJA 3PEFA 3K9BA 1EXMA 1E2JA 3N0WA 1KGDA 4NV3A 1PNOA 3RB8A 2GFHA 4J6EA 3T52A 3TSYA 4JLBA 3KWMA 4LYYA 2O8FB 4ALLA 2IT1A 2GYUA 3IHTA 4W1QA 1Y1KE 2Q1UA 4PZEA 3B9RA 4F4CA 3A14A 4C6HA 5KWEA 1NLYA 1WHTA 1YAJA 2BMVA 1EFHA 4NZMA 4OD0A 2DLNA 2OV8A 1DJOA 4QFBA 5TEVA 1F20A 3R6TA 1PHRA 4LSGA 1QIEA 4QU0A 5DDIP 2GB4A 4C6TA 4FOTA 1K92A 1RAHA 1U1EA 4FR2A 5IDQA 2WJYA 3MUOA 1QG2A 4PZ9A 3BCHA 3WFJA 3IOCA 3NT2A 1TE2A 3B1VA 4L3WA 2OQIA 1UPXA 3VZSA 2Y1GA 4XGIA 3UMCA 4G5XA 3KFLA 4MGEA 4TV9A 3PJFA 4S1OA 4C05A 4BEBA 4QFCA 4J49A 4PCLA 2PSEA 3HP4A 1CRPA 2YXPX 4YP5A 3WKCA 2BW0A 5FDFA 3SQNA 5HUJA 3OLZA 4W5JA 1XZCA 4X6XA 2O8FA 4FXOA 5JZOA 2RAVA 4ZO4A 1E96A 1S4MA 4AZVA 3G2HA 4YAJA 3L7YA 2X0FA 3HJHA 2WWIA 1J56A 1GSOA 4X3OA 1A96A 1O4WA 2I5PO 1A9TA 4EUKA 4XGRA 5E38A 3DF7A 1DOHA 2HMVA 3EQ7A 1X7WA 3FJOA 1T6BY 3SJCA 3BSFA 4HB4A 1WULS 3LS2A 5ADWA 3IT3A 1XRLA 2P40A 4HXYA 1LPMA 1CRWG 4BC0A 2F3RA 3BJMA 1KKUA 3EB9A 3MGKA 1I80A 4P38A 5DNEA 2FUG1 3WRYC 1JT2A 2H85A 5B58T 3OD1A 3WSTA 1FVFA 1OXXK 1YNSA 1N5RA 3I42A 3H7IA 1TC1A 2HJWA 3LQ2A 4TTRA 4C4TA 4XD7A 4A10A 3C16C 2QM0A 2H1LA 2YZMA 3FHJA 3GT0A 3WQQA 3FVTA 5T4FA 2FPXA 3C7KA 1TKRA 2X5KO 1XQ1A 2PUDA 3ZQJA 1ZIXA 4N0DA 4MPDA 2OUIA 5AR1A 1P0FA 2Y1WA 2BT4A 2C9DA 3BD6A 5A4AA 4I50F 2XMZA 1G6Q1 5IJWA 3GFPA 4F7DA 4ZOBA 4L7QA 5AJXA 2ZR8A 3WZLA 1R0BA 4AD8A 2RGWA 4MRVA 1DC3A 4BLWA 1VL0A 5FPSA 1FBNA 3IE1A 4C30A 4MR9B 3C7AA 3B7PA 4FYVA 3PHBE 5CA1B 1H65A 2WSIA 4BO5A 4YJ3F 1V47A 1KSFX 3CRRA 1KK1A 5HDBB 3KR1A 2D6FA 1FUYB 3F7NA 2CXXA 5AJYA 5HZGA 4MR8A 3PCTA 3STWA 2D5IA 2PXXA 5LQSA 2VJAA 4CQMB 5IANA 3T5AA 4EYKA 2WNHA 1KJNA 5G1PA 5C1OA 1ZH0A 5LPNA 5C1PA 4U7FA 4WK0B 5ALHA 5AVSA 4AUNA 2IUTA 3DFMA 3ACDA 2QSUA 3M1LA 1NVAA 4L9SA 4NSNA 3RDPA 1E3EA 1P60A 2OZEA 1P9OA 2V9CA 5TDHA 3OO1A 3WDKA 1TO6A 3B78A 3FZGA 4Y1RB 1AS0A 5I7RA 1NI3A 1WMDA 2JI9A 3TTTA 5IVHA 7ADHA 1PX0A 3L79A 1T2UA 1PBTA 1T0PA 2WJ4A 4JIMA 4X6LA 2O4UX 2PUEA 3S0JA 4JA0A 1R12A 4RQUA 5EGSA 3N2IA 5K03A 1LGYA 3HKDA 1NMQA 2C9BA 1KYXA 2B8TA 1DIBA 3C1TA 4IV5A 2VXYA 4EI8A 3JXEA 4IDNA 4ZOLA 5H5JA 4EB3A 5J2TF 5JJCA 1UC4B 3FNRA 1AUOA 4BL5A 4US1R 1E0JA 1NPTO 3BOSA 4EMBA 1F0PA 3LPDA 1D9ZA 2OCBA 3P32A 3VKHA 2YXEA 5A9TA 3B5JA 1GPLA 1V6AA 5DI3A 2HT1A 1SD5A 3V2HA 2OV1A 5B1IA 4R54A 4DQXA 3HUEA 4YP6A 5IN4A 2Z2XA 4TS9A 4A8JC 4CIAA 1YJ8A 4RZ3A 1HF3A 4NDAA 3X1ZA 2H52A 2EGUA 5I7OA 4KTVE 2F67A 4IDQA 4TYWA 1D8AA 3BN3A 1DJLA 4I9FA 5CP8A 2XD9A 3ZG6A 2OAEA 1PKXA 4A6EA 3LWZA 2AOTA 1NI4B 4MIKA 5ARBA 1WABA 2UU9B 1H2YA 2OZVA 2QENA 1VFPA 3FPSA 3I72A 2QT0A 4XJVA 1RI4A 2ZUVA 4EY4A 2P9CA 2R48A 2VCHA 4Y2JA 3PEVA 2ILTA 3ENWA 3QMVA 1TI7A 5CU7A 1P33A 3W06A 5C80A 1R8YA 2WJHA 4LE0A 4B33A 2EP5A 2VJNA 4FS3A 1AKWA 4LTMA 2E1RA 3W6OA 2RD2A 4IFBA 1NVBA 1QNLA 3C3BA 5ETJA 3ACCA 1WP9A 2GASA 4I7EA 2O7RA 1O54A 2RGBA 3TCXB 3VGPA 4DM7A 3EH2A 2O3QA 1IXKA 1NQVA 1P4RA 2P4UA 1BWRA 1I0LA 1D8TA 2OV4A 5AJZA 5E95A 1N6IA 4L1KA 2PKXA 5SYAA 1TZ2A 4DCNA 2FRDA 2VA8A 2BBOA 3F90A 4QG7A 2CW5A 3EC2A 1EWKA 2CLLB 4F8JA 2OHFA 1ND6A 3ZZ0A 4JJFA 3I3OA 2D59A 1RQ7A 4UPEA 2P1DA 4UREA 1EUYA 2IKQA 1QP4A 2FMKA 5ERYA 4F3YA 4IHJB 4IXDA 1X7GA 4D96A 5I47A 2PH3A 1Z56C 2Y77A 1MO3A 4IQ4A 5CAEB 1ZC4A 3AHDA 3B6ZA 1JDPA 3QKUA 2AG0A 5CVUA 3P4YA 5KJEA 1KI1A 2PWAA 3M33A 2DU8A 4IDBA 2OYSA 3T5PA 2ZGVA 3WIVA 2WG0A 3IJRA 1DKQA 1B3BA 3H5AA 1YU6A 4FIZA 4FK8A 1ZI8A 1QYCA 1S5PA 2P3QA 2YH2A 1E2IA 1UXHA 1XEXB 3E3AA 3JRWA 3CLSC 2XD4A 4AKGA 1JQ3A 1JG3A 1T1EA 2P0YA 2XVYA 4A6PA 4Z4EA 4DV1B 1QV6A 3CH6A 2LCIA 1T2EA 3DNFA 5BW6B 5KDDA 3GFBA 3G8DA 5LZ2A 4WZAA 3R8CA 1ZYUA 1KYIA 5FBZA 3W2HA 5GZ3A 3PE3A 4GO1A 5LXTB 4ZVOA 2V7GA 2WU3A 3LXXA 3HJRA 4LRTB 5E4YA 3HG7A 3I8OA 4KMSA 5TQJA 2IEZA 2QP4A 1EINA 5EPOA 1L7BA 3I2IA 3NC1C 1XJQA 3QRWA 2D00A 1XJWA 4I9HA 4QYXA 1TKBA 1N5KA 3QBDA 4AYTA 1ONSA 4EW6A 4D3YA 2GTIA 4GYWA 4F6CA 2D0OB 2AK3A 3P4UA 4FFVA 5ALJA 1FPQA 3PWTA 1BX3A 1YRQA 5T4BA 3RTGA 3WGTA 2QX9A 3KQHA 4B43A 4IAOA 2H31A 2R65A 1OC2A 1P2FA 2GLXA 4C4YA 3I9JA 4DLLA 3GAFA 3C5HA 3FX2A 3I9KA 1KPHA 1J0DA 1NXSA 1W93A 3ZTWA 1UT6A 3E9NA 3HLKA 1Y5MA 2J3LA 2P77A 2W2PA 4BKMA 1P2BA 4MRRA 2PNJA 5IUJC 1BZYA 3QI7A 4LPSA 1KJIA 4EFMA 3GCGA 2H29A 3KYCA 2CFOA 4AJEA 2C8KA 3DFIA 5DSZA 2NU6A 2BMFA 2RHCA 3GGSA 4QATA 2O14A 4BEJA 3BM5A 2R751 4DDWA 4L2IB 1ADCA 2QRVB 1SUSA 2C9CA 3OJXA 5EG5A 2C4TA 4CGYA 4KITB 3MTQA 4R2HA 3BICA 2QA5A 1L7DA 3FNQA 3GW8A 4MYCA 5G4LA 5MDHA 1YBMA 3KPJA 1SELA 1OLXA 4UTZA 4RHFA 2YZ2A 3H65A 3DZDA 4WESA 5A4DA 3QE2A 4WW0A 5A2GA 4ZYYA 4P3NA 3VYSB 3DKVA 2C3PA 4WT7A 3H5IA 5DX8A 1IBMB 3V4VB 5HX7A 4U1RA 4ZYTA 3KJHA 5FT9A 4IP0A 1VJ5A 4UTXA 2I29A 3DFFA 3NBFA 3Q5GA 5ICEA 2AX3A 1AHIA 4F06A 5IDXA 4DL9A 1NNI1 4YHHB 3E4CA 3EPPA 4ADSG 5JQGA 4Q12A 3X43A 1C7QA 3OJLA 1KZHA 2F3PA 1YAHA 1UINA 1C50A 3KOWA 5ADUS 1QK4A 4YJ2A 1SA0B 1NV9A 3N5CA 3KOUA 4NZZA 2EZ8A 3B1JA 3CLKA 2OYCA 3T1VA 1TO1E 2PR7A 4S24A 2IS1A 1JNYA 1U7XA 3G8CA 4Y18A 1UPAA 1W5AA 3DDWA 5TX7A 1YMUA 3IP3A 1Z3IX 3RSHA 1KP2A 2ZSUA 4OGWA 2A9VA 1JVBA 1G8YA 1R7RA 4HQOA 1I1QB 2FFJA 5DW3A 5KYWA 4YRPA 4YCLA 1FX0B 3ECAA 4QYIB 4YRZA 3CZQA 1NQTA 3LH5A 3MQ2A 4CI0B 4Q4CA 1OYOA 3GD5A 4OQEA 1Y1RA