3MMXA

Bacillus anthracis nadd (banadd) in complex with compound 1_02_3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
188
structure length
180
Chain Sequence
MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nicotinate-nucleotide adenylyltransferase
publication title Complexes of bacterial nicotinate mononucleotide adenylyltransferase with inhibitors: implication for structure-based drug design and improvement.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 53
structure length 180
sequence length 188
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3mmxA00
2HZ7A 1GTRA 4I6GA 3AKZA 4WSOA 3IDFA 4ND7A 4CDNA 3ZGZA 3H97A 4MWBA 4R2MA 2H29A 4BWVA 4NZPA 1M1ZA 3FHJA 3X1KA 1GPMA 4MVCA 3PRHA 3G5AA 1IHOA 5FO1A 3FIUA 3RJZA 4F3RA 4KPUA 3SEQA 1T9GS 1G8GA 1N77A 2DERA 1ZH0A 2WQ6A 4G5FA 4EG3A 4S1OA 1WZ2A 3HFJA 1IFXA 2GKSA 1BS2A 2YWCA 4MW2A 1TEZA 1M8GA 4MW7A 1O0CA 3MMXA 1O97D 3HGMA 1XJQA 1HYBA 3K9WA 2X3FA 1WY5A 3D6VA 4I6EA 4NAUA 1QRSA 1OWNA 1U0BB 3AFHA 2G36A 3P0HA 1PFYA 4MQ6A 3OP1A 1IQRA 5J5AA 3N8HA 3TS1A 4ZT4A 2A1TR 3P52A 4ZCSA 4KR7A 4ARCA 1N75A 3ND7A 4MVWA 1H3EA 3GMIA 2ZUEA 2IELA 2DEUA 1GZUA 1WJGA 2BTEA 2WSIA 2A88A 3TNJA 1EFVB 4U63A 3CLRD 2A1TS 1KQOA 1FYDA 4ZT2A 3CA8A 1T6ZA 2RD2A 2AZXA 4MUIA 1J1UA 2XRYA 4I6JA 1PFUA 1YUNA 3SZGA 4K0RA 4MW4A 1JEDA 4HPWA 1GN8A 1NURA 3SYTA 4A91A 1F4LA 3Q10A 1KH2A 3KT3A 4DJAA 3HV0A 1JIIA 3ZUGA 1I2DA 3CR8A 1Y42X 2DXIA 5H16A 3AIIA 1M8PA 4OJMX 2PXHA 4ZCPA 2CSXA 2YWBA 1LI7A 2CFOA 2AG6A 1EFPB 1N1DA 3IMCA 1TQ8A 3INNA 4MUNA 5JBNA 1ULHA 1KH1A 4MUGA 5K0TA 1U3DA 1H3FA 3RK1A 3VGJA 4XSVA 1IH8A 1U7XA 4JXZA 3VRHA 3JXEA 1RQGA 5LLTA 1PG2A 4HJXA 1KAMA 4YP6A 3NV7A 1EE1A 3QE4A 4MUFA 3DLAA 3KT8A 3IOEA 2PFSA 5K0SA 1QTQA 4R0NA 4QBTA 3PNBA 2PIDA 3TQOA 1OWLA 3K32A 1JGTA 2TS1A 3F3MA 1CT9A 1QNFA 4U7JA 4AS1A 3AL0C 1O95C 2Z3VA 4PBSA 2DR2A 1LW7A 4MW6A 2JAXA 4YP5A 1T9GR 1MRZA 4FZJA 1QU2A 3ZIUA 4PBTA 4ZCTA 2J09A 1K4MA 1COZA 1NUSA 4PY2A 4NATA 3G6KA 2X1LA 1MB9A 3FOCA 3FWKA 2A1UA 3CVWA 4EG8A 1QJCA 1GTSA 2E0IA 3H99A 3PXUA 1EFVA 2AKEA 3A04A 1ZUNA 3MXTA 1YIDA 1I6MA 3TZLA 4CDMA 2A86A 3HMQA 3RK0A 2ZUFA 4XFJA 1IQ0A 1R6XA 1I6KA 3BL5A 2GM3A 4EG7A 3X1JA 2CV1A 3IOCA 4MVYA 5IJXA 1YUMA 1O96A 5IHXA 1MAUA 4MW1A 1VLHA 1OWPA 3UY4A 1KH3A 3AG5A 3ZXSA 2JANA 2X1MA 4EG4A 5TEVA 1O94D 2DPLA 3Q12A 3CLUC 1TYDE 4J75A 3A2KA 2R5WA 1X6VA 3LCJA 1OWOA 2JA2A 3SP1A 1YIAA 2J4DA 1SURA 1Q11A 2D13A 3PNVA 1R6TA 4OUDB 1T6YA 2CT8A 3CLSC 4EG5A 3FH0A 4DDKA 2CV0A 2C5SA 3N05A 2BYTA 5DK4A 3VU8A 1NUQA 3UC5A 4EF6A 1G59A 3M5WA 4AQ7A 1NSYA 2NSYA 1JILA 1WOYA 4ZT6A 3COZA 2RE8A 5FNZA 1ZJWA 1J21A 4MWDA 4JZYA 3N2YA 4TS1A 5DEOA 1JIJA 1EUYA 4KPUB 1G8FA 4MVXA 1K97A 5TS2A 3CLTC 5TGTA 4P2BA 2E89A 5J58A 4MW9A 3IUBA 3D6UA 2J08A 1GLNA 3PNYA 3MLAA 2CYAA 1O5TA 2QJFA 2NZ2A 3G59A 4ZCQA 3RBAA 2OQ2A 3FNRA 2QUIA 2DETA 1J20A 3KFLA 4U8HA 4DDHA 4GRIA 4R2LA 2QUJA 1QRTA 3ELBA 4MW5A 3ZXIA 4DE5A 2IJGX 1I6LA 1V8FA 1MOPA 1OBHA 3FG9A 1M8KA 1J09A 1OD6A 1EJ2A 3CVVA 1PG0A 2WB2A 2YXNA 3DPIA 1FFYA 1H1TA 4EGAA 3IMGA 3A4IA 5HG0A 1OBCA 2D5BA 1S4MA 1NUTA 1TYCA 1G8HA 4MLPA 4G6ZA 1IQUA 3TZEA 1Q19A 1WKBA 1F7VA 1TYBE 1M8JA 3HL4A 5KCMA 4ZT7A 3MUEA 3IH5A 3CLUD 4RUKA 3SDBA 1MB2A 4KR9A 4KR6A 3LOQA 1ZH6A 1N2IA 3NBKA 4ZCRA 3E27A 4UZFA 2A4MA 3CLSD 1N2JA 5H7XA 4F4HA 1F9AA 3X1MA 4GU5A 4MULA 5EKDA 4KKVA 1JMVA 1R6UA 1V47A 2EL7A 2A7XA 2YY5A 3IUEA 4K03A 3NBAA 5FO0A 2Z08A 1DNPA 1N2GA 1XNHA 3H05A 4YP7A 1NZJA 3TQIA 2V0CA 4J76A 1EXDA 1NUPA 4OUDA 1WXEA 4YBRA 5LFAA 2CV2A 4EFKA 2OV4A 1M83A 3AG6A 3CLTD 3UOWA 1OWMA 1PFVA 4DNXA 2QJTA 5BNZA 1MBZA 4CT0A 5AHWA 1X8XA 2QTRA 4L2IB 1GAXA 1JIKA 3SZ3A 2HGZA 4EG6A 1WXHA 5F23A 2X0KA 4ND6A 2CUZA 2QUKA 1PFWA 1N2EA 1A8HA 3N9IA 4PBRA 1QQTA 2DUMA 5DASA 3IMEA 1MC1A 4ZT3A 4QRDA 1P7PA 1TYAE 1VBKA 5KHAA 1NYLA 1JZQA 3CVUA 3DO8A 3P0IA 4MUJA 3KT6A 1M8FA 2VTBB 2D54A 1IRXA 2O8VA 2H2AA 4DDMA 3ZJVA 4ARIA 2PZAA 1K4KA 1H3NA 1J70A 1JEEA 3H9CA 3A05A 3QTTA 1XNGA 1N2OA 3C8ZA 4Q16A 1WXGA 4Q93A 1EFPA 3DV2A 1KR2A 1U3CA 1YULA 3FDXA 4RPIA 1N3LA 4HK4A 1EUQA 3I05A 2QJOA 4MAFA 3ILVA 1KKUA 3CVYA 1B6TA 1UFVA 3LE8A 3U1VA 1U7DA 2A1UB 1QRUA 3RFFA 5KWVA 4MUEA 3UMVA 1IVSA 4CQNA 1VBMA 1O95D 3P0JA 2E18A 1KAQA 3IOBA 3IVGA 4UZEA 2EJCA 1NP7A 1ILEA 4HJRA 1LI5A 3FI0A 1JZSA 2DLCX 1O6BA 3COWA 3RHSA 1N2HA 1D2RA 4DLPA 5HUJA 1NUUA 3MLBA 3CVXA 2GOYA 3COVA 3GLVA 1O96B 2A84A 1JHDA 2CYCA 4QREA 3SEZA 4JFAA 2HMAA 2QUHA 4YMIA 3IODA 3KT0A 4MUKA 2IP1A 1VBNA 2I1LA 3IVCA 3ISJA 3ND5A 4NX2A 2WQ7A 1N78A 2J5BA 1KP3A 1O97C 1K92A 2E21A 5HUHA 1JECA 1XNJA 2J07A 3S3TA 1KQPA 4E1AA 2V0GA 1T6XA 2VXOA 3IVXA 1MAWA 1KORA 1Q77A 2QTNA 1WXFA 1Q15A 4EG1A 2ZP1A 1J1ZA 4MUHA 3H9BA 3OTWA 2O5RA 5LM3A 1O94C 4JXXA 3ZJTA 4NDAA 3UK2A 1KP2A 4G5YA 2PZ8A 3QTBA 5TEWA 3GUZA 1WQ4A 3L92A 3FETA 1WXIA 4NAHA 1F7UA 1YI8A 1WQ3A 2CYBA 4L2IA 2QTMA 2XRZA 1N2BA 2PG3A 1O0BA 1NI5A 3CLRC 3L93A 3Q4GA 3FY4A 1QU3A 4X0EA 4WNYA 4ZT5A 3ND6A 1KQNA 1MJHA 1VL2A 2B7LA 2PZBA 3ZJUA 4MWEA 1TFUA 4XFDA 4H3SA 3HZRA 5DB4A 4MWCA 4MW0A 2VTBA 5J59A 4JYZA 2Z09A 3COYA
chains in the Genus database with same CATH superfamily
3ZVLA 4H7FA 2WHEA 2JCYA 3ETJA 1D2HA 4R2HA 3PFBA 3DZ8A 4WOBA 3VPXA 1CUGA 1TAQA 5IPFA 1QFYA 1DBVO 4AWBA 3ZGZA 5CDHA 1O6GA 1ZJ6A 4DSOA 5LQDA 2H29A 3FHTA 5JJIA 1A4RA 3VPHA 3RTCA 3FLEA 3KAJA 4YGXB 3EEYA 5ALZA 2ODWA 1TADA 3F9IA 2GF2A 4RH1A 2AKYA 2O4CA 4HEQA 4OGKA 4BV3A 1N8NA 1E32A 2ZSUA 1A2QA 4RA6A 4LC9A 2O8NA 5AIAA 2PGJA 4DT1B 4YAJA 1FFAA 3H0CA 1S01A 2N75A 4IHJB 3FDJA 4B6PA 3IX7A 1RLTA 1DX9A 1UFRA 2EDAA 5FL3A 3TTYA 1E1CA 4RXUA 3RK4A 1VPTA 1SUFA 3EAQA 5KOHB 1XN4A 2BLNA 1TEZA 2GERA 3IEKA 1HYGA 3W04A 5JNSA 3UV7A 3GLIB 6GPBA 3ENQA 2NZ8A 2XAUA 4PHGA 4QDOA 4EYSA 4BGEA 4DZZA 2UVPB 2BIFA 4L9AA 3VZPA 2HYIC 3SZUA 2A14A 3IA2A 1CK4A 1AF7A 4LK3A 4NBSA 2CJFA 4O3MA 2WU3A 4P33A 2QIOA 5B1DA 5IDYA 2Y68A 1SCIA 4WACA 4I50A 1O5IA 2P79A 4O4HF 2ORYA 1JG2A 1O8BA 3AR9A 3DHEA 2AJCA 4K9MA 3PL1A 3TUIC 1RI2A 2JAPA 3QYJA 3GT3A 4Q4LA 3UATA 2HBQA 4YLGA 4C14A 4EGQA 3CINA 2C4VA 3PEFA 3N8KA 1LPNA 2VRCD 4ECAA 5G40A 5FNVF 721PA 4IG9A 1LC3A 3N76A 4ARCA 4R8VA 4WDRA 1F1BA 4GMGA 1YB4A 4PANA 4TRRA 2C3MA 1NX6A 1BAPA 3TLGB 3WNQA 4AECA 2VJMA 1SQ0A 1GYPA 5C7OO 2Q7OE 5EXPA 2B4QA 4GM1A 4N01A 1QMPA 1WDMA 3OZFA 1GSOA 3OF2A 5KTYA 3CA8A 4UASA 2BM0A 1QK4A 2BONA 4IZ6A 3JVIA 1ZGAA 4HAYA 3EWNA 4GYJA 5JEEA 3TVTA 3V2GA 2AEJA 4G86A 2YVUA 3SEFA 1VG9B 3OWHA 1JNYA 3PGLA 3CPSA 2P3QA 5E1BA 3NTRA 4AX8A 4M9RA 2Z5VA 3ABSB 4BO0A 1JEDA 2R6GA 2ZRHA 3BMQB 3WYBA 2WICA 1DADA 1NLFA 3IIMA 4EW2A 3LQFA 3HFSA 2SNIE 1UDXA 3LF1A 4KN9S 3UENA 2JIZA 2C5GA 3OT5A 4PRKA 5HBRA 4W5RA 2Q3HA 1OXBB 4MEJA 2Z1DA 3HEBA 1NVVR 2P2DA 2P9YA 1REQA 3F96A 3FCOA 5G0UA 2YR0A 2NO0A 4ZAVA 3ZQ4A 3AK4A 2Q5HA 3ITEA 4N82A 4OQEA 2PU5A 1T3TA 4PAWA 1LV7A 4BMPB 3AH8A 3KQHA 2OGZA 3UJ3X 2IEBA 3MTDA 4XRRA 4PIVA 1MB3A 2ODPA 1P19A 1U8TA 1C1DB 2IW1A 3EYWA 3RO7A 1N1DA 3HB1A 2CF6A 2IHVA 4NYJR 1GQYA 2DY1A 4G8BA 4JS0A 5JDCC 1VPLA 5JASA 2O0JA 5JHGB 3LUFA 5SV2A 1WXWA 4NCBA 3N53A 5TGDA 2CB0A 4YCMA 1SD2A 1KH1A 5HF6A 5JAUA 3SXUA 3FKSA 3T94A 4LFAB 3WL3A 5K9ZA 3AFGA 3TZ6A 3WDKA 1XTPA 1QS0B 1L5VA 3IJ5A 3E9YA 5JXGA 4MRVA 2F1JA 4P4NA 4MVJI 4ABTA 1JSXA 4A2QA 5F3WB 3H1GA 5PNTA 1IY1A 3N07A 3W1EA 5BVHB 3H1TA 1G2IA 5LLTA 5EERA 1IDN1 4I08A 4KE8A 4D8YA 1KAMA 2YS7A 3C5EA 1NWCA 2P9FA 3E9EA 3NV7A 2N46A 2W6IA 1RD4A 3E6AA 1QF7A 1OVGA 2G67A 4LYEA 4K05A 4O4IF 4NXMB 1ZVMA 1I24A 5CFMA 2I65A 4NZNA 1CF4A 1YNSA 2CMFA 3AVTA 1L5YA 1UDWA 4XJVA 2OXTA 2IS2A 4FNMA 4C6SA 4BY9E 3IA7A 2PH3A 3KDSE 5L3VA 3F3KA 4C22A 1HQDA 1BWPA 1T5TA 3DHWC 4UE3S 1SVWA 5T3UA 1FFXA 4TSRA 4PBSA 1U11A 3A9WA 5P21A 2QT9A 3V80A 4E51A 1LW7A 3FJYA 3FPEA 3ORFA 4LC1A 4QC2A 4PWZA 2YFYA 4RF3A 2ODBA 1GZ5A 2AC2A 4RE6A 1Z17A 1W2GA 2HREA 2SCUA 3JTEA 2JRCA 5DI3B 3MS7A 2PRSA 3N7AA 2FN7A 5EKXA 3W05A 2BEUB 3ZJ4A 3HJUA 3D4NA 2OO7A 3N39C 4O1IA 5DNDA 2OSBA 2AC7A 2QPOA 2ZRMA 1RQRA 5JTTA 1F06A 2DKNA 2E0IA 1Y3HA 4JKYA 4AYTA 4EDHA 1JU4A 4EFMA 2OE2A 3WGGA 3PXUA 5HIAA 3JQBC 5JALA 4HUQA 1XL1A 3NTOA 3VH4A 2OK8A 3KSUA 4MCAA 3H5VA 3RUDA 3MXTA 1W36B 4OXXA 1I6MA 2FWAA 2O05A 4CDMA 1BROA 5D1HA 3S2FA 2HV8A 5BR7A 5KYUB 4C2TA 2FWRA 2V8BA 1JFLA 2RBEA 2Y99A 5JMWA 3F3SA 4JLVA 4BX3A 3PCRB 2FXIA 1X7YB 2MHCA 3WK8A 2F3RA 5BSVA 3R8FA 5EEHA 3KTFA 4WERA 3PKIA 4FGWA 1JHPA 1U8FO 2RI1A 4AS2A 1E3QA 5IHXA 1YA4A 1E5XA 4PPGA 1HI9A 2PFGA 1NVFA 1X7ZB 2HU5A 4HAUA 4OHVA 3RRYA 4H31A 4I3FA 1TU4A 1JPVA 4WK0B 3TWOA 3WBBA 1GLGA 5EMLA 2IPNA 3KPVA 3BE4A 2GK4A 1F20A 4HDKB 1X6VA 3PGXA 2ID9A 4Y6SA 2KMLA 1AGYA 3FTPA 3O8QB 4XQGA 3B13B 1EEXB 2AOTA 3QVSA 4XD7D 4NYMQ 3TQCA 3VHQA 5TSDA 1BEZA 2HW8A 4TZKA 1BYIA 1L4LA 4UCXA 4NOJA 4OQMA 4BJ3A 3PQEA 4FHFA 1H6AA 2P6RA 1NUQA 1XD9A 1FUYB 2O7QA 1YASA 2OORA 4JUBA 4PTZA 1EG7A 4TN1A 2UUPA 4EW1A 1O0SA 4UU7A 1M67A 4Q6BA 4DC0A 1JA1A 4X7BA 3PPVA 3LT1A 2DKOA 4ZRMA 1RJGA 3SVTA 3AUTA 1Z6XA 4D5GA 4BUCA 1F14A 3COZA 5HGXA 2JD0A 3O7WA 4IOKA 5FNZA 1J21A 4RPJA 4ZOAA 5BMVF 5EE5B 2VP9A 1CERA 1J5PA 3BFJA 1AKWA 2A1IA 2PBZA 1C7EA 4KVFA 3CT6A 3ZNNA 3PHCA 4TLDA 4RY2A 4WNAB 1GPNA 2G09A 2XMDA 4PAQA 4JJKA 4QL3A 5A2QA 1GPKA 3D6UA 2NU7B 3LC2O 3FCYA 4K1LA 1Y5RA 1XU4A 1W9HA 2OG1A 2QPLA 3A6DA 4Y8VA 4ZEVA 1E1RA 2CYAA 4ZCQA 4QPZA 4HN4B 1ZN8A 2DP4E 5BNIA 2P5SA 3FAZA 1N5LA 1ML4A 1Q1BA 3FWHA 4YQYA 3HXOA 4EB8A 2CMGA 3PQDA 1PGNA 1GUZA 2P78A 2CXPA 3BC1A 3MELA 4LE2A 3FPAA 5EJ4A 5LR6A 5K2MA 4IIVA 3FMVA 1JU3A 1Y6QA 2AOXA 1ZEMA 1I33A 2H06A 3RTEA 1S1CA 1RJ9B 4NEQA 3H0KA 1ODTC 4DYHA 5D00A 1OD6A 3O4VA 2XDQA 1EJ2A 2PX3A 3OHPA 4Q1VA 5DYYA 5ADVA 3GOHA 3GZNB 4PLPA 4EMBA 2JJ2A 4AKHA 4ZWNA 1H1TA 4QPNA 4CM7A 1Z2DA 4WEQA 4WKOA 1I7DA 4Q1DA 3A4IA 4NABA 1ZGJA 3K05A 3SXJA 3ISVA 4TRMA 3WISA 2OBLA 1A2BA 4D9EA 2QVGA 4G9BA 3VJKA 1N0HA 5J3JA 2EG9A 1LTHR 3QU4A 3VR4A 2QOEA 4K87A 3DAPA 5FXMA 1MKYA 2X22A 2C2YA 4C03A 2VJOA 4FGKA 1QQ6A 2FSUA 4YDRA 5JC1A 3N6XA 1AQNA 1K3FA 2X6QA 3GWZA 2PMBA 3RANA 3ZWQA 1BJRE 2WSBA 3NGXA 1NR1A 3OCJA 4NR0A 3Q1KA 4L6IA 4ZT7A 3ZX5A 4ZHSA 5HSGA 3RUHA 4IMJB 4LHZA 4N8DA 1K6EA 5TF4A 4C04A 5JQGB 4DMRA 2HFJA 3VYWA 3CWCA 1JL3A 1ZH6A 4UHCA 5L7TA 2J46A 4M9CA 3OZTA 3ORYA 4G97A 4XWGA 3K0SA 4O29A 4EW6A 2O2HA 4RFSA 2IYNA 4UJ5A 1ODSA 4FC6A 3QWFA 2YDXA 5BQ5A 3HSSA 2RJ3A 1QP4A 1AV6A 1B0UA 1IK6A 4KKVA 2GTIA 4WXRA 5KVAA 1BSVA 1L5ZA 2YASA 3IUEA 5JO9A 3FWNA 2CVOA 3RIYA 4E5KA 2GA9A 2GBLA 4K9OA 3T41A 1A9XA 1V41E 3RFCA 2WLSA 3GLGB 3KWJA 1JDSA 2J9YB 4MA4A 4EABA 4PSDA 3MIZA 4G4SP 4MSUA 4IGAA 3U4GA 3LCMA 1HPLA 4FYHA 2UZ3A 1NBMA 4YBRA 1WG8A 3KSDO 1IN5A 1R6BX 3AG6A 1LK0A 2PA3A 5GV8A 4ARVA 5DHTA 3SS7X 3JYLA 4U2FA 5JVDF 4QDKA 4CR8A 5AHWA 1LCIA 2DKFA 2GPYA 4JVSB 2XOEA 3VH1A 5AJZA 1Z62A 1LLFA 3DS8A 4S24A 3ELWA 4FEEA 3CCBA 3TLJA 1TF5A 3TLZA 2VDKB 3PQ8A 4QUJA 2GR9A 3PTZA 2C97A 2EFEB 2YZGA 1USWA 3MJEA 4P4GA 1AGPA 3BK7A 4Y1GA 5HCIA 3W9YA 5HTKA 2G25A 2JARA 1PUJA 3GDHA 4L15A 1BO6A 5EXTA 4ZO9A 3E9DA 1U7WA 4WVLA 1DHRA 4JFRA 3TB6A 5ICCA 4K6KA 3KOXA 3VZQA 4LV6A 4C6HA 3WNCA 3GMDA 1KSGA 1US8B 5FT9A 4ZVTA 2VYND 5FBLB 3W6OA 2B4TO 3QEMA 1ZA2A 2AH5A 2EL9A 2AYZA 2PUHA 1MQ8B 2DR0A 1YQEA 4GOXA 1NV9A 3N58A 2OFOA 4I4NA 5GADl 1HEUA 4K1XA 3FR8A 2R5FA 1PQ4A 3PYXA 4JLAA 5EYPB 3H7AA 3CE9A 3F73A 2R97A 2C8JA 3ZHYA 1U2GA 2XDAA 4R1QA 3NEJA 1HRKA 2HA0A 4NZOA 1P2SA 1WSAA 3AFMA 1EFPA 3QYAA 1K2WA 4MKGA 5D5QA 5JISA 2FEKA 3W3AA 4XVCA 1Q0QA 2B20A 1W8IA 4R1PA 4H6WA 2VUTA 5AYVA 3STXA 4WMLA 3UO8B 2OO5C 1KKUA 1H6CA 2F62A 1NN5A 1VHQA 2DSNA 2Y9PB 5AKHA 3UHAA 3THWA 4CM8B 1M6YA 3SBEA 2E5FA 2J9FA 3UMVA 4BVBA 5JIBA 5KYXA 4ND2A 3B1ZA 1NL3A 4A7PA 4DLLA 2CL7X 4TRJA 1PK8A 1PT7A 1FIUA 2O54A 1PL8A 3IB6A 4N3AA 1JZSA 4G4SO 2DQZA 4XTCS 1JHAA 3S29A 1AHIA 3ONNA 1RQXA 3HKDB 5EOVA 2JIBA 4JWTA 3GEMA 2YHAA 2XQJA 4HEJA 4ZVUA 4P1ZA 2IHTA 5A7HA 5JARA 4YCNA 1E9EA 3K9BA 4RVGA 1AQUA 1K8ZB 2VHWA 3I9LA 4EQZA 3EW7A 3IODA 1TYZA 1ZH8A 4RGYA 1FLAA 4CGZA 1KTVA 4E2ZA 1N78A 5AVSA 2GPWA 4BMZA 5A5GA 1Z06A 5FOXA 4M4SA 4WW0A 3OD5A 3URMA 2FGKA 1JECA 4Y6LA 4X63A 5BRAA 5ADWA 2I3ZA 5KKNB 1DTWA 1KQPA 1I9GA 1V95A 1L5WA 1NA5A 2HA4A 1HTWA 3C1TA 2HRBA 4JJFA 4UM7A 3SZLA 4BFYA 1OC2A 3FNBA 3U3JA 4EFLA 4KV7A 5JNRA 5KNDA 2CUKA 3DW1X 1RKUA 2OR3A 4CCYA 1ZL2A 3ASYA 5LQRA 1QR2A 3OTQA 4IRUB 3SYMA 4EJSA 1YVDA 2D0IA 3PDIA 1QC5A 4TMKA 3SQOA 2J67A 3AEKB 4DPLA 1VMKA 1C41A 2VBGA 4GPAA 1I4TD 5AUOB 4X62B 1F0NA 4AJEA 4LY0A 4FI3C 2Z5FA 3CEAA 5C37A 4RHCA 5JSZB 4H2DA 1XD8A 3ZV3A 2OHGA 1DT3A 3QXCA 2Q2NA 2FLVA 1WQ3A 4IS2A 4DQKA 2G8NA 3Q8WA 3Q8LA 4LHWA 5E8RA 5AW4A 2VK4A 4ENWA 2GJAA 3D6JA 2XWBF 2KYRA 4CLOB 2J9ZB 4J7CA 1AGXA 4QTXA 5FUXA 4JBIA 4ASUA 4HO1X 1SCUA 2CXHA 3A6JA 1XHLA 1O1YA 4C88A 4EVQA 1QU3A 4ZT5A 3H42B 1FJHA 1UDCA 1KQNA 1SXJB 1T9ZA 1EIZA 5F12A 4TUYB 5ICEA 1TFUA 2RAVA 4KEAA 5GJVC 5LYJB 1PNRA 3EOZA 1XQYA 4H3SA 2XE7A 1RIIA 3C0KA 2E37A 4KMMA 3V4ZA 2GFQA 4DOMA 2V4UA 1R00A 3ACDA 3ICWA 3WWOA 4BNGA 3SWWA 4JUCA 5AJTA 1XDZA 5KJEA 3AMVA 4HDNA 3HKEA 3GELA 4QDZA 4O5OA 4CG2A 3IEVA 1BYUA 3PI7A 2ECOA 1UMBB 4S04A 2WWRA 1IB0A 5TMPA 5FUBA 3DBLA 3WWZA 4JHLA 1EVKA 2D2IA 3CGWA 4MWBA 3WL7A 4F1WA 4ZYVA 2RGNA 3ZDEA 1GPMA 3OETA 4OL9A 1M34E 2DFTA 5HPYB 4QPDA 2CE2X 4QOIA 3LGAA 4A0SA 3VNRA 3BX1A 1CRZA 5K45A 3GYGA 3I1JA 4UEKA 1WHTA 3BXPA 1J42A 1BE6A 1U3UA 4KE6A 4KB5A 4X3CA 3SEQA 2IHYA 3ZE0B 1GU0A 3WIEA 2XTZA 2BOVA 5HJ7A 2WQ6A 4MHTA 2EHJA 4G5OA 1UP6A 1DAGA 4XE5A 4V0NA 4C2BA 4L4YA 4E2YA 3F9CA 5AM1A 3WQSB 1AQIA 3TAXA 3F7TA 1KK1A 2GRJA 3FZYA 1HNZB 3PNMA 3HVJA 4OQNA 4UATA 2FSHA 2RG1A 2ZVJA 3OC0A 4TROA 1UBUS 3I4CA 1NT2A 5ERGB 3SICE 3NW9A 1RI3A 4CIYA 1YZKA 1K86A 3LW7A 4I6EA 2PX6A 1WB4A 4O8CA 1Z5OA 4G07A 1NTOA 4HGYA 4DMFA 5IVHA 4H6XA 1MENA 4XWKA 1NQ5A 2TYSB 2ZRPA 2F3QA 3QEKA 2UZ1A 1SNYA 2OD7A 2R48A 2OOSA 2WT9A 2YFQA 3I6BA 3IAEA 4QUAA 5JXWA 4E07A 3A1VA 3DUFB 4NZMA 5FI0B 4LF4B 3EJWA 1PT5A 3ENVA 1QYVA 4RWZA 1TW2A 1G41A 1U5BB 3SC6A 2ZUEA 3MG9A 1J0CA 1JKXA 1VHLA 3NKFA 4C1NA 1VA5A 2G9NA 3O21A 1IJKA 2FU5C 3AEXA 1EINA 1GUDA 2VCYA 3H3JA 4J3NA 1XR3A 4TKLA 4ABYA 3HVUA 1EPUA 1HE1C 1PUIA 1YL6A 4X85A 1JHRA 1NZDA 3NHBA 1EBFA 1ECCA 2XY4A 3CH6A 4HX9A 1N7GA 4AMGA 4C3VA 1B0AA 4FR5A 4KXNA 1XA4A 3UH0A 2IYWA 4H35A 2H59A 4X45A 3IXLA 4YCCA 4DDVA 4CKZA 1SAYA 3EPRA 3JYOA 1MO5A 1TLFA 1Y8CA 1PFUA 3U3MA 2G08A 3U31A 1T8UA 4RE5A 3EBLA 4EEZA 4H1HA 4RKEA 1ZZGA 3UHJA 3ZS9A 4C7MA 1SXQA 5KYVA 1XF9A 1RQPA 4HPWA 4XJSA 5CUQA 1GN8A 4D0LB 4JEIA 4QPJC 4M8LA 2X23A 5U4QA 3LP8A 3VBEA 3IILA 1EX9A 1P5ZB 2YX1A 3R23A 5DCLA 5FUWA 3BDVA 4R84A 4DMLA 1WZCA 4QECA 4KZPA 5A4IS 2OTCA 4DJAA 2RI6A 4JP5A 4YHBA 4MKFA 4NIMA 2AFHA 1FQWA 2C8VA 2CXNA 3KP1A 1CNFA 1OMOA 1I2DA 4HNSA 4LOIA 4JL5A 2ES4A 3PF9A 1Y42X 2W22A 4AVYA 2PYIA 2PZMA 1M8PA 4IIBA 3A4TA 1FFEA 3RBZA 4U6NA 3MFYA 3OIUA 4P34A 5JWHA 3G02A 3VYRB 4AZSA 5K0LA 3ESXA 3EVCA 5TNXA 3C7TA 4N5NA 4IQ0A 3WYNA 1ABEA 1V6SA 4BATA 4C0KA 1C29B 1TM2A 2FZEA 4UMVA 4QIHA 3K0FB 4D42A 9MHTA 4YRCA 3UW3A 2P7IA 5B7NA 4IJMA 3DV9A 2VWHA 4Y30A 1DIHA 1TGVA 2HWYA 4MINA 3VVMA 5JD6A 1VHDA 1YJXA 2D5LA 1UDAA 1KRHA 3CO5A 3Q15C 4WKBA 4YJHA 5T4EA 4WZAA 4PRYA 3AQ4A 3UHFA 4J1QA 4D4KA 1SVKA 3HO1A 1U1FA 2G9ZA 1E2LA 3DMFA 1RQGA 5CNKA 1PZXA 2A4KA 4IIDA 5JAHA 5HNKA 5IBRA 4KLAA 4PQYA 1DG9A 1RAFA 3NEYA 3L0PA 3LD9A 4X24A 4MVJF 4Y2GA 3WX0A 5K0SA 5AXBA 4QBTA 1KOFA 1CS0A 4G1UC 3DC7A 4BO6A 2HMTA 2QV0A 5F7OA 4NU8X 4JP8A 1QH1A 1JYSA 1U3FA 2FUG6 3BJZA 3Q7SA 2BN4A 5KVSA 3FPLA 3IIJA 1HG0A 3QEOA 1HDXA 4DMGA 4LTDA 1W9MA 3HNPA 3E35A 4INPA 1KAOA 3ZE6A 3RQSA 3M70A 2QTAA 3B7WA 3IUMA 3BMNB 4A4DA 5JUWA 1A7JA 1VSQA 2I1WA 4H6PA 5SY4A 5HBGA 1N5MA 3KQTA 1I51A 3TW8A 3G49A 3Q6NA 1O7JA 4X65B 4NATA 3ZQ6A 1EP2B 1M6VB 3AHDA 3M89A 4NG5A 4CIDA 5K0JA 1IEXA 1CEEA 4BV9A 1Y7IA 2LKCA 2QQFA 5D6OA 4D8UA 5I7UA 1GYRA 1ZN2A 3QVLA 4KQXA 1Z35A 1VGRA 2CFRA 5G1PA 4O4JF 1EFVA 3ENWA 3LVQE 2I8AA 5JXJA 4KL8S 4BNFA 1Q6ZA 4V1CA 4FYKA 3PHIA 4HGZA 3X2FA 2AN4A 4KAAA 1CUZA 4ODIA 4C20A 3VO8A 1M0TA 1JLMA 1KWGA 2GM3A 1LSOA 2I4LA 5DBHX 4EG7A 1EE2A 2BD0A 1UFOA 1TDJA 2ATVA 1OLXA 3D4OA 5JAQA 4JQZA 5DGHA 1A5ZA 5HDBB 1HY3A 2JI9A 2JS7A 4UBNA 2ERYA 4YK7A 2PUVA 3QOXA 1KH3A 5DYTA 3ZX4A 5B7QA 2VTVA 1A88A 5F4ZA 5LQSA 1C3VA 4DR5B 4DL9A 4EO7A 4H4EA 1O94D 1NLYA 4NMLA 1Y8QB 4M1QA 4UCFA 2Q2OA 5JHHB 3CLUC 4YASA 2BGKA 3SP1A 3D3JA 2VDNB 1U0JA 1PJAA 4KLNA 2J4DA 5DNCA 1HYHA 1F12A 1H69A 2H1VA 4ZYWA 2O3QA 2GYYA 3RVKA 5AXAA 1GNTA 2FP3A 2WTBA 3K2QA 3CLSC 1IE3A 5KYNA 2Q2VA 5KKAA 1KOGA 1A77A 1E5DA 1JDUA 3PQ3A 1HLDA 3HCDA 1O58A 2LDBA 5U9CA 1I0ZA 3Q7EA 4MAAA 5BNFA 1N2CB 1ZCJA 2A33A 4Z3DA 4Q4HA 1HURA 3ZHOA 1TM4E 4CW7A 5K8TA 3AWDA 5LQMA 4JJGA 2MSDB 2MYTA 2Z0MA 3UWPA 1AKNA 1JILA 1Y3CE 3GBPA 3C3MA 3N6VA 4H3KB 1AY0A 4Y9UA 4GZMA 5JYEA 1A9QA 1H6BA 4JZYA 4C05A 1ZD4A 5K3CA 1EUYA 1KO5A 3HVKA 4MRNA 5DYWA 5DMXA 3DMHA 2F8SA 2VP4A 3MIIA 4P2BA 5BWOA 5EJ5A 2YHBA 2P4HX 4KBYA 2EZTA 3RC9A 2ZXEA 4UUAA 5J58A 3IUBA 4AXBA 4DB4A 2R85A 1D4AA 3V4FA 3PS9A 4NBWA 3FCAA 4QULA 4BBJA 2PMEA 5FWYA 2V6MA 3K9NA 3TI7A 1QIEA 4P5EA 4R2KA 4FJ1A 5CJJA 5TMEA 1RXEA 2ZCUA 3TW6A 4M1OA 4HGPA 5L9AA 2HLNA 3ERCA 3N2KB 1J20A 5EIWA 4C0JA 4U8HA 2ZBVA 3D1LA 4PG7A 4IH4A 1B1CA 1ZMBA 2QUJA 2WK1A 3N8IA 4KRFA 2EBHX 2JRLA 1XXHE 4RGVA 3RS7A 1DG1G 1QRAA 2PWPA 3LPMA 4E31A 3DWIA 3AZOA 4GWGA 4N39A 4HLUC 3BEDA 1Z2OX 5ANRB 3ZY2A 2QT0A 1EXNA 3HE3A 1C1XB 3CW2A 3CVVA 3GT4A 3K70D 1C4OA 3NXSA 5L51A 4Z0PA 3ZDAA 2YXNA 3C3DA 5A04A 3BD7A 2OLEA 1X13A 2L82A 3GJRA 1Z2EA 2ISSD 3B51X 3QUCA 4OQYA 2HMVA 3LCUA 4IJ5A 5JNVA 4C0BA 3WQHA 1XDDA 3DOIA 4MGHA 4JMPA 2FPLA 4IHJA 2GDZA 2P6PA 1L7PA 4IFTA 4XDZA 2YV1A 4YRTA 1JDNA 3SQDA 4C4XA 1G8HA 1R8YA 3BIOA 4Y7DA 2GN6A 2G9RA 2V7WA 2WOJA 4NFHA 1LDEA 3TW4A 1JA9A 3GRPA 1F7VA 5M34A 3IEUA 1NE7A 4B75A 1QDLB 2DPYA 2QZPA 3GLIA 3K8QA 3EEIA 1MN6A 1SKUA 4IX9A 1YS4A 2HJRA 1V45E 2UVPA 2WVAA 2ZBDA 5CFOA 1QRTA 1P9NA 3PFCA 4IKPA 2QAGA 1MTZA 4YIKA 2I3AA 1P91A 5HE8A 2Q8NA 4FFRA 3H2IA 1CVRA 2RB4A 1DX4A 4NU5A 3WWYA 3FBTA 5EXSA 4M21A 4PVCA 4JNKA 4CM4A 4YO7A 1T2UA 2P8SA 2QSUA 1YDMA 3OHMA 1EK0A 1DKNA 2VXBA 4XSGA 1BMFD 2OB2A 2WYUA 5EE1A 4ZALA 1OLSA 2OCBA 5EE0A 5CB4F 3ZWKA 1SCAA 3IAS6 3FMGA 1SIBE 3ER8A 5BSGA 3KYDA 5DLPA 2FPPB 3FPKA 3WDLA 2R1ZA 4BOYA 1CIPA 2R8RA 3SHVA 5IT0A 3HBFA 1WF3A 1UP7A 3BWEA 3FTNA 2OV4A 4LY3A 3UOWA 1TYEB 4HSGA 4YRPA 1E0KA 4HRVA 3TD6A 5BNZA 2I1QA 4QQFA 4S05A 1Q3KA 3I39X 2O8FB 1ZPDA 4R3NA 3TFWA 4Q3EA 4P80A 3NDPA 3MS2A 4FD2A 5AW8A 2AS0A 1PQYA 3FF4A 3VR3A 1MRNA 4Y2XA 3FCCA 2BKLA 4NFLA 5JPIA 3BMQA 3BJIC 3D2CA 1NVXQ 4UOZA 1NU6A 2NT3A 4QRDA 3RYCA 1ORRA 1ZJZA 5LU9A 3NHPA 1W30A 3PD7A 3G3EA 2QD2A 3ROPA 4G2TA 3T7CA 4W5TA 1XNRB 5LZ8A 2OCYC 2PKCA 2VTBB 4RVNA 2VQDA 4O25A 3SAJA 5M2QA 3GLFB 2IYXA 3U17A 1OTXA 4FJ0A 4Q7EA 1KZHA 3RAPR 2BFFB 2GEFA 3NHZA 5ETJA 3LY7A 1QYWA 3HA2A 2QL7A 1Q0RA 1B15A 2GK6A 3DMDA 3IPLA 3ZWXA 2LP4Y 3ZS8A 4IKEA 3Q0TA 4PU0A 3SKXA 3GFQA 3HCOA 4BMSA 6YASA 1C1DA 3AETB 5K0CA 1BHSA 1Y1KE 2PXCA 3L0OA 1CPYA 1RM0A 1IOZA 2HADA 4KP7A 4PYQA 4YAGA 1YULA 3BH6A 3E8XA 3CB2A 5I9LA 2ECPA 3HO8A 1Z74A 4LPSA 2JI7A 2LNDA 4MMXB 4D3ZA 4PLWA 4LXQA 2D7DA 3Q6IA 1QRRA 3R4CA 3ILVA 3MJ4A 4N76A 3GUVA 3PHGA 2A1UB 3EH1A 2FMUA 1WY7A 3H4IA 4MUEA 4PO9A 1W35A 2X4GA 4CM9A 1VE5A 1CR6A 4I36A 2BELA 1YT5A 4LGCA 3SGLA 5BVHA 5EEGA 2IQIA 3FBGA 5ITVA 1FRNA 3GHHA 4RIEA 4DUPA 4K26A 5JDIA 1B74A 1Z5ZA 2QGZA 1YMUA 4UUNA 3ZLUA 4LZPA 3K6KA 5TT0A 4DCJA 2PAFA 1T2DA 3HJBA 1CWUA 1S3FA 4BEJA 1ZP6A 1KI1A 1L4UA 4L4UA 4HUJA 5HUJA 4L5AA 1SWVA 4ER0A 1Y3DE 4GHWA 1L5LA 1RU3A 3IAXA 3R41A 1LNSA 1Z07A 2FPRA 2HMAA 1NMEA 1CR4A 3JASA 4HG2A 2W6MA 3F3YA 3BF7A 4HS4A 5FWDA 4GVXA 4DLSA 2I1LA 4NX2A 3LC7O 1B42A 4V0SA 3AYZB 5JY6A 4J0GA 3CZ4A 3GEHA 1XNJA 4JLUA 3QLVC 1C7JA 3I0NA 3LQ2A 2O0HA 2LUOA 1CKEA 2J7KA 4HVTA 1J33A 1KORA 2GASA 1J7KA 5DI3A 3UW1A 3GJXC 2YHSA 2FEPA 1L7NA 2PH7A 2Y4NA 4XDGA 3DWGA 2AI1A 1GZSA 1B26A 1M2OB 2K7FA 4B4OA 4BE9A 1VB3A 1NV8A 3UEOA 2O5RA 4HQFA 4Q9NA 4E0BA 1O94C 1CE8B 4NBTA 1YIOA 4EPTA 5DLEA 3ZGXA 4M1EA 1JFVA 1QG6A 1LZLA 5TLSA 5E9AA 1Q0TA 1AS3A 5KCZA 2I2DA 3L92A 1RRKA 5KYUA 1BJKA 3BA6A 4RSHA 3S8MA 1H66A 2NXEA 4H7DA 1AQLA 2GD1O 3E7WA 4XR9A 4QGGA 5CA0A 3M3DA 2XRZA 4KIFA 3Q88A 4RVHA 3CLRC 3MOIA 3LUCA 4BVJA 2COKA 2ZS9A 1J2EA 1AHPA 3CQ9A 4GG1A 3NLLA 3V4OA 3WB1A 1JHXA 3JQ8B 3KSMA 4LDJA 2RHBA 4B76A 2OKGA 4QOJA 2G70A 3I5XA 1FMFA 3LK7A 2BGJA 1ZJJA 3EZ7A 3E9ZA 4C7XA 3ZJUA 2Q4TA 3AF2A 3PQFA 1LPBB 5IFKA 2X15A 2JFNA 3WZLA 2HQOA 1NP6A 2ZSJA 5I8WA 3UBTA 4WH0A 1ZA1A 5FADA 2JAQA 2WDPA 1A2OA 2X9LA 4FDVA 4O4LA 3L4BC 5DLYA 1DC3A 3D9QX 3ORRA 3WBKA 5F77A 4RAOA 2NZWA 3C8MA 3RD5A 2BGWA 3HLKA 4X6LA 5G3YA 1G5IA 1YZFA 1J5EB 3GAZA 1NYTA 4MV5A 1VKZA 4R01A 1BFUA 3IJPA 4I8DA 3VYSB 5BNTA 3AHCA 1MDBA 3OZSA 2FB9A 4AYWA 1EXWA 3B7PA 3G5UA 5BQPA 3V00A 3OQIB 3X1ZA 3KS9A 2OBNA 4HXEB 2O2EA 3REFA 1SELA 2NXWA 2QLMA 2V3CC 1NZFA 5CYGA 3PUZA 2WWXA 4DHEA 3M5PA 4WLUA 2E4ZA 4JJ6A 1GCOA 3HKCB 1Q50A 2BRUA 3PNLA 5B1HA 1ONPA 3I6IA 1Y3AA 4IPTA 2XJ9A 1E2PA 1K6IA 1LPAB 3H1PA 4OVKA 1NI3A 4WNAA 5BXYA 2M1XA 3HL0A 2C88A 2R84A 1F8XA 4W5JA 3ZD9A 4A26A 1BGXT 2DULA 1Z6PA 5DF1A 4NBRA 3RVLA 3S2SA 1LPPA 2ILVA 1J23A 4FEYA 1K75A 2EDCA 1Z6GA 3QUAA 3IKMB 4TKVB 3F8TA 2DYKA 3CT4A 5IDVA 4UXJA 4RLQA 1V2HE 5ESRA 3AFHA 3QX7A 4OOEA 3ZKAA 4U7DA 2XRMA 4KVGA 3LLVA 5AJHA 1JEQB 3CFYA 3PYLA 1OH7A 2IC5A 1Q2UA 5I5GA 3F6EX 3KR2A 2HJWA 1FL9A 1XHEA 1WV1A 4QOSA 3T99A 2A1TR 3STHA 3A37A 3T3PB 3V2IA 3LXXA 1BDIA 4KR7A 5EHNA 5TGZA 1VM6A 2CJWB 3D8UA 3IPCA 5G4LA 4C08A 3GZNA 4GMXA 4REQB 1T8RA 2CVPA 2H1LA 3G7NA 3UMCA 1E99A 1X7WA 1Y81A 1NJ5A 4WOKA 1HQCA 4FTWA 3ZR4B 4E5VA 1H9CA 3QVXA 1DVRA 2J59A 1ONSA 1EK6A 2WG0A 4QGSA 2ZSAA 3CVOA 4I1UA 3D5QA 3T7SA 4D43A 4O2AB 4JB0A 1JE0A 1RWNA 2WJGA 1H2YA 1OFUA 3ONVA 3LC0A 1KQOA 5CK4A 2PGLA 4WBSA 2I0FA 2CCKA 1I4EB 4WA8A 1TU0A 4QFMA 2BCGY 5D3MA 3IP1A 2HO5A 4OKIA 1JKMA 3J80A 1M2GA 2B34A 3DT9A 1LEHA 4WXMA 2DFKB 3U26A 3JWPA 3MBOA 3UFXA 1L6RA 5H59A 1XLTC 2A3NA 5JQGA 3AZPA 3R75A 3AJ8A 2VLBA 3MMNA 1GGEA 1Z37A 2XYQA 3NV9A 4LYYA 3VOSA 2Q49A 2XWQA 1NURA 3KB8A 3NG1A 3WKDA 4D0NA 1ORIA 3DLBA 1VSTA 3SHFA 4I0WB 4I1VA 4XJXA 4JT8A 1SKYB 3N7TA 3T5TA 1GZ4A 4IKOA 3TZHA 3MD0A 4M7OA 2P2SA 2P77A 3NT4A 3S1AB 1BQEA 3SBOA 3BXHA 4BU1A 3I0MA 2Z8XA 3KE8A 1A8PA 5AVRA 3OT4A 1FSGA 1F2TB 3SZOA 4LKRA 1WW2A 4Q1EA 1NSTA 2IDMA 1NNEA 3O8BA 5LQAA 1ULSA 4B6GA 2JGAA 1BFKA 3QBEA 1LI7A 4H0CA 3ZE9A 4BX2A 5H80A 1K6XA 2BHSA 3INNA 4FFMA 4RPHA 5LP6A 5M04A 4QVIA 1SMKA 2QTCA 4X91A 3DEJA 2Q0HA 1PN3A 3CZ5A 4CKBB 4F1JA 1BDJA 1LLQA 4EHBA 2JIZD 1NN0A 4FINA 4WOPA 2OV1A 5CCDA 3KUUA 1C2YA 5BOSB 4I5FA 3U7RA 3PFGA 1Y82A 3KL4A 2XCTB 2DE0X 2B4YA 1L9KA 3TO5A 3EZLA 3LBAA 3NEAA 3GCWA 1OXVA 2P90A 1T26A 3DVSX 3M1LA 2EX1A 4HRYA 4RL4A 4CE6A 4C4AA 4KWTA 3QE4A 5EIBC 4PV7A 4FNGA 3G8YA 2OBBA 4F3TA 4WOJA 3LY9A 3OJLA 1ZMXA 1TJ3A 5CXQA 4DWWA 1K7YA 4QUHA 1QTQA 5DM2A 4ENTA 2R87A 2O7SA 2XIJA 1O2DA 3DOHA 4PLHA 4KRXA 3DOJA 1C0EA 2RIRA 4GRAA 2Z98A 5ADHA 1Y6JA 4ZHQA 4TTPA 1L5QA 1Y4SA 1E4OA 1SKAA 1RW4A 3C98A 3FKSD 3ADDA 4FGJA 4Q4AB 1TM1E 3DZBA 3I01A 3EE6A 1ICEA 1LKZA 1JN0A 5EYPA 3RRMA 3BHMA 3OM8A 4HBGA 4K9DA 2BZGA 3LHFA 5K3AA 4MB0A 4JLBA 3P9IA 3RUCA 4FZJA 3R5JA 1DEOA 1PEAA 3G2PA 1GADO 5AOBA 4G41A 2W6ID 3IUQA 4PY2A 1KYVA 4KBGA 3PGVA 5ALDA 3INTA 3N2LA 5J9FA 5BR4A 4AG3A 1VG1A 1VI6A 1NVKA 1A7AA 2WMDA 3GLTA 3A9CA 2O07A 4ZI5A 2MSLA 4NEGA 3KR9A 2P4UA 3I9KA 3L84A 4BB5A 4JI5B 5T6MA 1LJUA 1PJLA 3KD2A 5EG5A 4HDOB 5KMGA 2DQSA 3FKJA 5C81A 3DOUA 2DAPA 2P5UA 2Z6AA 2ZJ5A 5F3DA 1PQUA 3KB2A 3BIFA 3AR4A 3RG8A 2PPVA 1FP1D 2V97A 5C1DA 1OROA 2B99A 1QO9A 3IQFA 4HNQA 3HKDA 1TMYA 4P36A 1T43A 2HJSA 1QHHA 3MMSA 2MSEB 1XB2A 2CV1A 1AUPA 4J7XA 2BVNA 3Q8KA 1ZDMA 4CKXA 1OFVA 2ZUWA 4YAEA 4GQAA 4AC9A 2NSHA 2HA2A 4B6JA 4CPDA 4EPWA 5M29A 3TX2A 1YJCA 4XIJA 2CB9A 2RH9B 1PD0A 4DKXA 4Z4FA 1KXZA 4J03A 2Q27A 3CX4A 3GH3A 1H1DA 3NJ4A 4MJXA 1RWWA 3VZBA 5EQJB 1QGUA 1OWOA 1WHSA 3T7TA 1E9AA 3DL0A 3MM4A 2HIGA 2IZ5A 3HSYA 4G9EA 3SOPA 1CV2A 1XZNA 1C50A 3AW8A 4DQLA 4ENRA 2QMEA 4JD5A 1UBEA 3I32A 3ZZTA 1JBEA 1E7SA 4MRRA 2A3RA 3QMVA 1U65A 3EOBI 1NMQA 3JR7A 1KKLA 4KRGA 5CJPA 1J5XA 3QVVA 1A7KA 2AXPA 3VU8A 3GN2A 1IYZA 3QKIA 4KXVA 4EMUA 4RCVA 2HLHA 3S8EA 2YZ7A 3DSRA 5LZ4A 1OSNA 2QS9A 2AN1A 4Z4HA 5I4CA 2IS4A 4R69A 1P75A 2EW8A 2FEMA 3A28A 1HH4A 2ZIUB 3EY9A 1SK8A 4K46A 3TVYA 3AR5A 3TLAA 5IUJC 4JB2A 5JJBA 4CLOA 2YXDA 3ZVMA 3SR4A 1N6LA 5CJ2A 4YMTA 5HFJA 4Q7JB 4MW9A 3QVUA 5K20A 1NKSA 3C3WA 4YGYA 4ARZA 2OV8A 2XYHA 5DNAA 1VLMA 2PR7A 4TUYA 3I37X 3F6PA 3AINA 4N0DA 5KHLB 1U4NA 2HHLA 1TO1E 1E94E 4BLWA 1P0FA 4EKYA 3U1TA 1WM1A 4BHTA 5FTWA 1U0OC 4JI1B 3Q11A 4GZ6A 1E3EA 1X1SA 3PUIA 3T3EA 1GGNA 1UKZA 5CVJA 3ZGNA 4MW5A 2Y0EA 1DCMA 3ILYA 4X1YB 3LBHA 1KEVA 1Q14A 2ZRJA 3QRWA 3VDNB 4E5PA 1MGPA 1T34A 3PLAE 3WWEA 3C6QA 3TR0A 1G3QA 5GIPE 3LDFA 3FRJA 3ZK7A 4COKA 4KRYA 2R66A 1CZRA 2WWWA 3GNLA 1B8OA 3P20A 2FN8A 3Q9LA 3WTCA 3CRW1 2R68A 1E1RD 2O2YA 1XAGA 4Z7QB 3F4BA 3FW1A 4CV0A 1CUUA 4WBNF 3HU5A 2CMHA 4QZVA 5KTTA 3CUTA 4KQ2A 1TYCA 3A2LA 1YWGO 4N7MA 2AX4A 1N9GA 4CR7A 2XVZA 2RAUA 4MLPA 2X0RA 5FOSA 1HF3A 1TYBE 4LWOA 4NAVA 1QE0A 1EX1A 3ZBPA 2PD6A 4WRRA 2NZUG 5A05A 1P1IA 3CONA 3VR1A 2CY0A 1XKLA 1SQFA 5DIZA 4YT4A 2P2GA 2JJ2D 1E7WA 1G5RA 2HFKA 2X7JA 3I62A 1LDMA 1PQWA 2PANA 4EKGA 1RPJA 2JLSA 1WZEA 4EBFA 1QVWA 5C8VA 4RC9A 4JR2A 4DXAA 1QE3A 1E6MA 3ANLA 3G1WA 3VR4D 2EL7A 1D6SA 3DUFA 4KV9A 5B30A 3FOZA 3A1FA 3FHCB 4I2VA 1TT7A 1AUOA 4CIVA 2G72A 4MGZR 5CA1B 2O1WA 2QW8A 1U5BA 4P7KA 5AWFC 1Y8RB 1UZAA 1OAAA 3PNKA 4AURA 2X3UA 4WADA 3I61A 5E7IA 5A06A 1KIAA 5CG1A 5KQRA 1GQRA 2R6AA 4II3A 4R9RA 3OPVA 2C0QA 2CVFA 5D3QA 2J0SA 3CX7A 2JIOA 2QYSA 3QUQA 5JAZA 3GGCA 2DM6A 2R7NA 3KUCA 4NICA 5GAJA 4PC3A 4DXHA 1FJXA 4JLKA 3QEJA 3KXIA 3GLHB 3T3GA 3E7DA 4FB4A 3LYLA 4LXHA 1ZMTA 1BQ3A 2H48A 1JYEA 2ZUTA 4E94A 4G0MA 1WXHA 3NDIA 5F23A 1DTSA 3PRKE 5FFNA 4EHKA 1SRRA 1RTTA 1ULTA 3DTYA 4I55A 2WHPA 4Z4CA 2D0OB 1PFWA 3JATA 3P94A 4ITRC 5KQSA 1OB5A 5TY0A 4I5EA 1G3RA 2NG1A 1UOOA 3L1JA 4ER5A 1NW6A 1YE5A 2Q1YA 2V7BA 3CZ9A 3EQ8A 2Q5LA 4O0LA 4PC7A 5DJ5A 2IE0A 5TPWB 3LWNA 3NCHA 4YTEA 1IK4A 2ZAGA 16PKA 1GG5A 1NBMD 1XFDA 4DSTA 2Q3MA 1Z8NA 2GO1A 4W7HA 1MX1A 4IDDA 2QUBA 3V8RA 3D3WB 2JBAA 2ZTVA 4NPHA 2IUFA 2IU3A 3LUPA 4RTQA 1AO3A 2BPOA 4ARIA 2BFPA 2I3DA 4GS5A 1C14A 3NCTA 4LBYA 3KKQA 1Z73A 2HO4A 5DE3A 4AU1A 2GXQA 3KZMA 4NFSA 4RJKA 5FD8A 3BMCB 3AY0A 3QXHA 2NU6B 5MDHA 2HPZA 1BGVA 5AI5A 2FCAA 2HHCA 2BUCA 2PCLA 1T2CA 1AU9A 4Q16A 3WLHA 2HRCA 3S2GA 1MO4A 1XRQA 3MYRA 5A9SB 1A9PA 4B40A 5FNVB 5P8WA 4TV9A 1G6HA 1ZD3A 5DNEA 1N92A 2Z2JA 2ORED 3MD9A 1XRLA 3K0FA 3QNUA 3QXSA 4QU0A 5HS6A 5HX7A 7MHTA 3KB1A 1II0A 1M2EA 2H57A 2QHXA 3AKDA 1Z0SA 4Q21A 1V5EA 2QA5A 5HXAA 2LV8A 3RVNA 4K9PA 4E88A 2YKGA 1FS6A 1V8PA 2FUG1 1AF4A 1JQDA 2I8CA 4MARA 4AJ4A 1NF3A 2JHPA 3D8SA 1XQ6A 1KAQA 1YZYA 2ZSEA 1T24A 4EO9A 3IVGA 4UZEA 3D3NA 3GG2A 3FZQA 3VDRA 2QXTA 5AW5A 1L7MA 3B6ZA 1U6IA 2A2ZA 1TU3A 4K6CA 2XB4A 3M8KA 4GOOD 4OP1A 4QBIA 3TLYA 3ICQB 3ZZUA 3W3AD 2O8BB 4BCDA 1ISFA 2H1WA 4ZOQI 1RLJA 1WBJB 1XWIA 3WLAA 3HCPA 1QGOA 2A84A 1GDTA 3BSSA 4QFDA 3M6MD 1GA1A 1J39A 4FNOA 1PKXA 4LFCB 1YGPA 4DCNA 2HUPA 3CNEA 4GEGA 2BMVA 1ZESA 4I19A 2OKCA 5JS7A 3WGZA 4RETA 5ITSA 1D0SA 4ENVA 1GVNB 3B38A 1KSHA 5EE9A 5IRCD 2H00A 3BMNA 1YR9A 2PGIA 1Z3IX 2O20A 1G5TA 4NBKA 5EWJA 4PG6A 1DQZA 5BURA 5IKEA 5FLYA 1OTYA 1VJ5A 1ZISA 2JFBA 1MAWA 1NT4A 4FCVA 3EZYA 1ISGA 3RVOA 4NCXA 1BZYA 3TRDA 4EG1A 2VJPA 2ZP1A 3OQMA 2PNJA 3STWA 5JROA 1I4WA 2BDUA 1YRQA 2F17A 3N2NA 4W5HA 1XRPA 3GLQA 1W29A 1XTIA 3EA0A 1QFSA 1NUHA 2RSLA 4PE5B 2JFYA 4OHXA 1G7SA 1A2KC 4W5NA 1I2CA 1NJGA 3MWLA 3ANNA 3C85A 3T0FA 1L7AA 1GO2A 5FBZA 2FPUA 3I6QA 3QTBA 5H83A 4NAHA 1WQ4A 2JLQA 4E5YA 1F7UA 2BHLA 4YCDA 2CKDA 4HKTA 3TKLA 3D6AA 2VVTA 5BUSA 1S2MA 1GSHA 2GCOB 4LSMA 3GRRA 1SBNE 4YRIA 1B14A 1MC4A 2P5TB 1DJLA 2PHZA 5KNDD 1BKSB 1HKUA 4N0MA 5A4KA 4JN6B 5HJ5A 4DYVA 2FQ1A 4PAOA 3MHTA 2GUGA 4IJ6A 2DF8A 1W4ZA 3L0DA 1L1FA 1Y8QA 3Q85A 2NPFA 1DXYA 3LBFA 4HDMA 4URVR 1Q95A 4U8GA 4RCZA 1ZNZA 4XARA 4F5DA 2F9LA 2Q6IA 4Z1MA 1PV2A 1QHNA 4QNRA 4R4JA 3LBNA 3NIGB 4D96A 4JYZA 3QELA 3QFHA 2I7XA 5J4KA 5LMUB 1ZITA 5BN4B 1N0UA 4GDMA 3ZN2A 3PK0A 5BQFA 3F98A 4PS1A 3OEWA 1P7ZA 4DBZA 4RTPA 4GDFA 2ZJ2A 3NPMA 2QTFA 4FGUA 3EUWA 2NTEA 1RWPA 1CVLA 2QQEA 4FOLA 3MWDA 2NYAA 3S40A 3C43A 2B7BA 3NAGA 4U1RA 1CY1A 1YR6A 3ONFA 4L4RA 4ASUD 1SFRA 3JZFA 1J7JA 1XRNA 2OORC 4KXQA 1QFXA 2WF8A 4HATA 1YZNA 2HPAA 4MVCA 2B7CA 2CNNA 5H9VA 2QY9A 1KYZA 2A9PA 4OMUA 4WGFA 1KNQA 5HQJA 3EPHA 2AMVA 3G5AA 1IHOA 2YTZA 3M2TA 3N2EA 3TXXA 3H1EA 3WV4A 3ROQA 4A3SA 3AP1A 1OU4A 4P5PA 4TTIA 3KZOA 4RABA 3PFNA 4RAQA 4M60A 1QWOA 1KBOA 2AJBA 2QMQA 3F49S 4GKVA 3V1UA 4BXOB 1C3LA 5JWOA 3ND8A 1MJGA 3C16C 2VH1A 3FPGA 1IFXA 1SUWA 4RLHA 4TN5A 1BS2A 2J6IA 2YWCA 1Z7GA 4JKOA 1EAYA 1V48A 3IYLW 4MW7A 2GH1A 3CSUA 4YJ2F 1MLDA 1IOWA 3DR3A 1ONBA 2HIMA 4F8JA 2YINC 2XTAA 4H17A 3KQUA 2C3UA 2PWYA 3JPWA 5GZ1A 2PR2A 4Z8YA 1VP9A 2WHRA 1FXWA 3N2KA 1C4WA 2I4MA 4H1VA 1XU7A 4JAVC 1SIWA 4L85A 2IYRA 5AVZA 1ZR2A 3IP3A 3FTEA 1WS6A 5LIPA 4MO9A 1SEVA 2ZE5A 5B2EA 1JTVA 3DJFA 3KYJB 5T57A 3GFVA 1QXSA 4AX4A 1ZL0A 4RYLA 3R7LA 3RWBA 1KFBB 2D3WA 5GMOA 3U61B 3L7AA 1YVUA 3H3XA 1IG3A 1MF7A 4N0QA 4AAYA 2HIHA 3KZXA 3MMPA 5LA6F 3R20A 4C0XA 3TLKA 3ZCSA 1VPEA 2WU1A 3GFSA 4UDXX 3IVMA 1HT3A 1ZO8A 2FVYA 2R8YA 3PRYA 2ARKA 2RC5A 4OQDA 1CDDA 2X8BA 3V4PB 5JZSA 3QEBZ 2E4VA 2CLFB 2XF8A 3GRZA 2WSIA 2AZMA 4MCHA 2OVFA 2QTWB 4Q66C 4WZZA 3D1JA 3I1YA 3A6GA 4RA9B 2DWUA 4HX5A 4EYGA 4H0FA 4FGZA 5CBPA 4DUZB 5AK4A 1LC0A 3ZWOA 1UK6A 1QONA 3IVRA 2BFEB 4EHDA 5CCBA 4LHYA 2VATA 3LUJA 2PUJA 1Q7BA 4XIIA 3AOGA 2SKDA 2VF7A 1EJ0A 2WAMA 3O82A 3SFZA 3IELA 3TM4A 2CNDA 5GZ3A 5J1TB 3UGTA 3HTXA 2FZWA 5ALHA 4HH0A 3RVJA 2Q1TA 3L40A 3SZGA 3IAS1 3VPAA 5BORA 3ZV6A 2W70A 5KBYA 4AUKA 3IO3A 2R8PA 1SGWA 1XPJA 1YNOA 1TZBA 4N12A 4ALNA 1BA2A 4H08A 1PL6A 4IFBA 1F4LA 1RKBA 1TZCA 1T2AA 1VFPA 4RGBA 5JS1A 2R6DA 4R51A 1IHPA 2ZYHA 3V4VB 4M9UA 4DZRA 3E7XA 5J23A 5AHRA 3BDAA 4IQ8A 4L51A 4XWYA 2BM8A 1TECE 2AF4C 1DC8A 1SEPA 3G0GA 3K9CA 2YJNA 3K1JA 1WVGA 2NNLD 3CKMA 3KLPX 4KHZA 4M8KA 4D9IA 3IE1A 3LAWA 2YV3A 3CR8A 3EHEA 3U3RA 6Q21A 3KOWA 4Z7JA 1FXUA 5JJLA 2PXHA 2FPPA 4ZQEA 4Q7QA 2DBYA 4C1BA 1Q6YA 4ZOLF 2KX7A 1EA7A 3KQMA 4PYNA 3VJLA 3WDSA 1HO3A 1FNDA 2GTPA 2ZI9A 4JR0A 3OCUA 4FEAA 3SZRA 3HJNA 3MBKA 4XLTA 4PPYA 3AY7A 3D4PA 4ERNA 1WDKA 1WEKA 3HI6A 1G60A 1X8JA 3I1FA 4ZQFA 1IIBA 4PRLA 1I3CA 3FUTA 2GX6A 3AVPA 3G5MA 5JYCA 4K9NA 4FSDA 2FK7A 4MI3A 2YH2A 1MB0A 1KJIA 1KI6B 2C5AA 1S2NA 5LWHA 1E59A 3H5NA 3NAMA 5CB6A 2NV2B 1G3IA 4G3XA 3GVCA 4K8RB 5BRJA 3L4EA 3QJ5A 4BU0A 2BUBA 4CQMB 2PFSA 1EGMB 3H0EA 4FW9A 3HABA 4Y2PA 2N47A 3A1WA 3G2LA 3G2HA 3M83A 3QIVA 4R0NA 1IG0A 5KNCH 5JO0A 5EAIA 4DV1B 1FSPA 1YJ8A 4HFNA 1G5PA 5CIWA 5HIJA 2G04A 3I34X 1K8RA 5C7IO 3WA7A 2DSTA 2PJUA 2BFFA 3L7KA 4IUDS 4Q15A 1G2PA 3SQLA 4FS8A 3VKGA 2P6UA 5ICGA 4MUMA 2Q28A 2CMDA 2B1RA 3FRHA 5IJAA 5EQFA 4BNHA 2QN9A 5BSWA 1WCXA 2DR2A 5LDDC 2ZIVB 2OB1A 4M8IA 4MW6A 3V48A 5ALPA 5HKKA 5C35A 5DDIP 2ZCJA 1R74A 4GKAA 5IVIA 2NYVA 2FLKA 3VC2A 4ESEA 1COZA 4QUEA 4XYBA 3KKOA 5DEIA 2OWDA 1D6JA 1I3OA 3DL2A 4O63O 5LPNA 2WABA 4KACA 3NIDB 3O1HB 1BWSA 5K3EA 4FUTA 4XGKA 1E1KA 2X5OA 4ND3A 1L8XA 2A1UA 1R1DA 4IW3B 4HB4A 4AJ1A 3CVWA 2C95A 2G9UA 2RK4A 3VUEA 4X6UA 1IONA 2GZHA 3FCEA 3QKUA 3RFXA 4B3JA 3LX4A 2XKJE 4MV4A 5JAPA 1RPAA 4EY4A 5F64A 4NJMB 5JVDB 3FOBA 1N9KA 4AG5A 4IXTA 1AB5A 5LXTF 1KDOA 3C6MA 4DDUA 1R6XA 1N34B 3KFVA 4HFRA 3ZK8A 4ZYTA 2CLDX 2CNBA 4AROA 3ESCA 1IN1A 4BTLA 4GOJA 4IIXA 1Z2AA 3FNIA 4MW1A 1DAMA 3KJHA 1KGSA 1TRHA 2FSGA 1BS1A 4YXFA 1ZEJA 5I3ZA 1I2AA 2O7NA 3BQMB 1BDHA 2QRZA 1R4MA 4EG4A 3MGAA 2QP3A 4MRSA 4BB0A 3FRIA 1I0LA 3Q12A 4KR0A 4BRWA 2A9OA 4Q19A 5ALQA 3RADC 4E4YA 2JFWA 4KTVE 1PEKE 2R6FA 2IZOA 3CX6A 2LGJA 4H60A 5DTEA 5BN1A 2IOYA 1XEXB 2R5NA 1QIHA 1TF7A 3ABRB 5CM8B 5LBIA 1WF6A 3NORA 1K98A 1XK7A 4TLMB 2C2WA 5IDWA 2B98A 2GWHA 2HD4A 3DBOB 2QDXA 1ZJ5A 1JHOA 1ND6A 3T1OA 3ZU6A 2BH2A 2HXSA 5T41A 3HWSA 4JLWA 1EDOA 4L9SA 2JLUA 1SY7A 3P9SA 3RHTA 5CAEB 4HZGA 5FWXA 1CUSA 3EC2A 1PW5A 5BPFA 1HNXB 2CDBA 1WOYA 2BJVA 4Q1CA 4BLTA 3LV8A 2EX0A 2O8DA 1G9SA 1ZJWA 2NUTB 4OI1A 2WPNA 4KVZA 5I6DA 2E4YA 5AICA 3TTXA 2ZYRA 3PUHA 2WOOA 4NFYA 4LV5B 3KPWA 1C8VB 4PCVA 2FUEA 3SHOA 5BUZA 2BJHA 5B53A 1YZVA 2PT5A 1UIRA 3LY5A 5JWRA 2GPBA 4AZWA 1JFSA 1R66A 2NU8B 1KO7A 1XCGB 1R4ZA 3LNTA 4U0JA 5DGCA 4DUYB 6NULA 3DV0B 1R18A 5EC8A 3EAFA 2XGJA 4PSVA 1NONA 1IOLA 2QJFA 4NYMR 4EA7A 1YL5A 2VT6A 4AZ0A 1RJDA 1J9GA 4TLEA 4ZIRA 5KHOC 3FX2A 4P92A 1O54A 4DV0B 3VNUA 4R2LA 2EW1A 3N1UA 3GR6A 3AF3A 3B1KA 3OQVA 2FMHA 3EN0A 1C7FA 3AM1A 1UP4A 3SI7A 1I7PA 2V74B 5TT1A 1T4BA 4OLFA 2G8LA 3IKLA 2AVDA 3R2JA 2X14A 4BNIA 1M8KA 4RTSA 3KELA 5IAAA 1Q16A 4IR7A 4X60A 1RC8A 2VPZA 2CDCA 3VPDA 2X86A 1GNVA 1Z7BA 1ORTA 2RGNC 1PT8A 1X8KA 1Z4NA 2O6LA 3EDMA 4WAUA 3UXYA 2XADA 2Q7XA 4NOKA 1EJ6A 4Y9TA 4GH5A 3NJRA 2QU7A 2SHKA 3EXEB 3RIGA 1K8YB 5F5LA 2N1MA 1XOIA 1PCXA 3HKCA 5IHPA 4ZDIA 5JRZA 3R5SA 1C9DB 2AFIA 4G6ZA 1IQUA 3CYFA 4Z8XA 1Q19A 3KQWA 4IDEA 4QU8A 4ZVLA 3ZW8A 2D3TA 2ID4A 1ADFA 4L5BA 2IKSA 3NRCA 3UK0A 1YZHA 3SDBA 2BCJQ 4CMEA 2V5VA 2NO5A 5EJ6A 3LOQA 3PPIA 2LPMA 2AD5A 4XJTA 3K53A 1T6NA 3ABIA 1N2IA 1N2SA 2F3SA 5BXQC 1BH6A 3OH8A 4PXSA 1JT2A 4UZFA 2BJWA 4LX0A 3G17A 1KZ7B 3FOAA 2D2VA 1VE1A 2JIRA 3GJQA 3P26A 4A8TA 1I4DD 4P81A 1RHQA 4CJXA 1JEQA 1Z28A 4JV5B 3UJPA 1I0IA 3P1JA 1VL1A 3OPYA 4QXPA 1KZ6A 3PFIA 1K8XB 1U5CA 3B9QA 1KDRA 5DGIA 3MQ4A 3TSZA 4N4AA 3G7UA 3LP5A 4UHDA 4PPFA 1G6OA 3RSSA 2F7SA 5DP2A 4RZXA 3B85A 1KBQA 2CJWA 3HBAA 5L6LB 2I76A 1X0XA 5GZ6A 2WWIA 1P1FA 3F97A 2Y66A 4REQA 2J3HA 2QM0A 1FYVA 2HKIA 1RWKA 4J76A 1EXDA 1D4OA 2EZUA 1TW3A 1TXGA 5UKDA 3WRWA 2R11A 3KDAA 1I1OA 3EXFA 3T7JA 3M5CA 1T8WA 4O2AA 2PUFA 3K0BA 3CLTD 2J5QA 3OUUA 5D51S 1KR5A 5GJWC 2O52A 3CJTA 4CTKA 1IUPA 1ZHHA 4YHHB 1NW3A 2C4MA 3RGGA 3PUWA 4C2AA 3CN7A 4AYXA 2JFUA 4H0NA 3GHYA 3LZ6A 1QG2A 4I4TA 3OZBA 4B3IA 4JP3A 1GPYA 4IBOA 3VR6H 3AHFA 4D3SA 5LDHA 1UH5A 3V46A 1QV9A 1P2DA 3BG5A 1A8HA 1MVOA 2VQFB 1WR8A 3GRVA 1X7HA 1EJBA 1HXHA 1UT8A 1M1YA 3BDIA 4P7GA 4ERXA 1NPTO 2CHQA 3AM3A 4IILA 3K7EA 5SYNA 3A8TA 3PLRA 4F84A 3FYHA 4AKIA 3DQPA 4GGOA 3VC1A 1NP3A 4L7VA 4NHEA 1FY2A 2PZAA 4GGPA 5J2TA 3EVNA 2Q4OA 4RMJA 5FHRA 4DJFC 2PKEA 4XB6B 2O50A 1NNSA 5JCPA 5AKJA 1S8OA 4LJLA 2EP8A 3RUAA 1CUCA 1XNGA 4OH1A 2JFHA 4CHTA 2IWRA 2C20A 3C8ZA 3QYPA 1WXGA 3RNLA 4HAZA 1O87A 2EC5A 1VJDA 5ELLA 1KR2A 3VR3D 1QIKA 3DNPA 5FA8A 1UXKA 3NMUF 3FNEA 2JLVA 3HLYA 2FF7A 2X13A 2Y1DA 3DDNA 4RBNA 4DY6A 3A3YA 1POWA 4INZA 1CZOA 1OLUB 4G8JA 3ZNOA 4TS9A 4CKBA 3U4CA 5KYGA 3QU5A 3QX8A 3O8CA 1X7XB 1OH5A 3I05A 4MAFA 1LRKA 1UQUA 1NMZA 10MHA 1VJ1A 4KDEA 1QRUA 3F5QA 1G4UR 5KWVA 2VHVA 3QVJA 4AF8A 1GNQA 3GVHA 1FDOA 3UZUA 4B34A 2PDAA 4R9VA 1AZWA 2CHVA 4M8NE 5AHXA 3HRHA 1FFSA 4PSKA 2AMYA 4EVIA 3IKTA 1U3WA 1UC5B 4WKPA 4LFBB 4WZ6A 1ODKA 2AR9A 4B3DA 3L3BA 3L8DA 2V45A 3R0XA 4N65A 1R50A 3ZCTA 3P0RA 4HB2A 3X43A 4AS3A 5KEIA 4DLYA 4GEKA 3EGOA 1L3BA 3HFRA 5EMHA 2VT2A 4NP6A 5D85A 3C1OA 4UHJA 5IKOA 4FX5A 4L6AA 3TDNA 2Q5FA 2ZI6A 3F5SA 3CS3A 4BMVA 1LVHA 4F46A 4D4MA 1KEZA 1EH5A 3A6LA 3H11A 1QH9A 4EIWA 4GKJB 5GOZA 4CM9D 5LJLA 3CG0A 1E1DA 5HUHA 2BEWB 3CEPB 4WFKA 3X0DA 2FAXA 3O83A 4IDAA 4MR8B 3IVXA 4QG7A 2V0GA 2P5YA 2NUPB 1Q15A 4MIYA 1QHEA 3V1LA 2PH5A 3RYHA 2O3TA 3OCZA 3HYSA 3OTWA 5HFAA 2VO1A 5AW0A 1GL6A 3PIDA 1YFJA 3SKYA 3M6XA 3OZRA 3SSMA 2VEDA 2C84A 4CNQA 3QJGA 4X7RA 5TQ0B 1UZMA 4Q18A 1PFKA 4GLLA 4LJKA 5CT6A 3SQMA 2ZKLA 2FCRA 1Y80A 2W7TA 1EUDB 3GPDG 1IXRC 4YDSA 1D0VA 2BY4A 2ZR0A 1MXHA 4ZVQA 3O6VA 1ZGBA 5ILOA 3L8MA 1QCZA 5ELXA 2X2EA 3GVXA 1GPLA 4PYOA 4WEOA 1RRCA 1SXHA 3ANXA 4Q7KA 1DE0A 3GGSA 4AKEA 4EYQA 5JSUA 3OECA 4BGUA 3NHSA 1GRNA 1U7TA 1VSVA 1Q83A 3BTSA 1KGDA 1UANA 2J0VA 3OJFA 4NENB 4QUDA 3KV1A 1T0IA 2GCNA 2PZGA 1S89A 2BP7B 1VL2A 1R6VA 2DTXA 3D31A 3LPCA 4UHKA 1P1HA 2PZBA 1XVAA 1PNTA 1U0RA 1U2QA 3ELDA 4G0ZA 4S35A 2IF2A 5H3HA 1IPHA 3T9CA 3WMFA 1HSZA 2GBFA 4N7BA 2DHEA 4QD3A 4IJWA 7AT1A 5BW6B 4BFTA 3CRVA 2ONZA 4BGVA 1SVLA 4OM7A 4BVLA 2YZNA 1QK3A 4K3UA 1W36D 2Z6UA 3TOZA 2QG6A 2AFVA 1G8JA 1NRJB 5LU8A 2HZ7A 3QE2A 1MAHA 3C3JA 4I6GA 3TW0A 1WCWA 2IV3A 1JSRA 4CG3A 4ZI7B 3Q7QA 3K72B 1J2UA 1TAGA 1MNQA 2ZBEA 1I3NA 4R2MA 1KAGA 3BD6A 4W6QA 2GYWA 2YMQA 3OZUA 2CXOA 1TCUA 4OLAA 2QF7A 5JZBA 2FZKA 2IOFA 5E1OA 3HV2A 3N0TA 3OWXA 1L0BA 1GPAA 1RFGE 4OXIA 3S8YA 4AKSA 1X3SA 2WIGA 4O4JB 5DBOA 2ZYVX 3IUNA 4Q4JA 4CMBA 1GGJA 3I9MA 1ZH0A 4HH1A 2QJWA 3C3CA 4F2GA 4S1OA 1H0RA 5D7NA 3ZOKA 4DR2B 1G3UA 1NMXA 2B8EA 1F2UA 4B47A 2GBPA 2QI9F 5KWSA 1R12A 3WAJA 2XBMA 2OO3A 1EA5A 2NQ8A 4YJGA 3DJYA 3GDFA 5CTJA 1UMDB 3MSXA 3UK1A 1HYBA 4LBZA 1I7SB 4O59O 1JDZA 1PVDA 2WDZA 4YPOA 3EYAA 3GU3A 5DTMA 3V8BA 1YCFA 4B45A 5L3SB 2GFHA 5E9JA 1KYWA 2P2CA 1C9JA 4UM5A 2YHIA 3DC2A 1Z6QA 2AIRA 2W98A 4L3OA 1MOQA 4LSZA 3U9LA 4DA4A 4JJAA 5EL0A 5C8YF 5KAPA 2Y92A 2ZYTX 3LKDA 3NHAA 3WGLA 3DPSA 4OSPA 2VIIA 3UCFA 1NXXA 2GFIA 4KXMA 4WE3A 3ZBQA 1W94A 4D79A 1QLHA 2PVCA 4LWZA 4EP1A 3DH0A 3MWEB 4MV3A 5KAMA 4MQLA 4G0QA 5EKSA 4R68A 2EP5A 2Z5GA 3TDMA 4O1HA 1T4DA 1NPYA 1NQXA 2WUEA 3CZAA 3HDQA 4R6XA 4Z86A 2I8LA 5EHIA 3TNJA 2VZ8A 1OBVA 2I4OA 2ZLBA 1T6ZA 3BTVA 4OMFG 4ZZ0A 4M3NA 1T9KA 2C2XA 2IY9A 1NVEA 3NC1C 4FQ8A 5L53A 3IESA 1DOAA 1L5MA 4TWZA 1UBGA 4P83A 4RQBA 3MERA 3SLKA 1UXHA 1LW6E 1OA0A 1W0KA 5EJIA 1NMSA 5LLDA 1MP0A 3U1BA 1IQPA 4MW4A 4L3VA 2PMKA 3B3GA 1U3TA 4R3UC 1NVAA 4E7OA 3T4PA 3TJRA 3DDWA 2P30A 1KSFX 2WINI 3P9RA 4MI9A 2H4HA 2QVXX 4TMTA 4EFDA 3W5SA 2XMPA 2D4AA 4BNLA 2YJGA 4CUJA 4DN6A 4DV6B 1H2EA 4P4LA 1YV9A 2G9VA 2PD4A 5JNLA 5KOIA 2D6FA 2EFJA 3OUZA 4N7RA 1AE1A 4WASA 3SQWA 4AZ3A 4KIUA 4Y3UA 3VSDA 5CA1A 2W71A 3T52A 1X1CA 1NATA 1UT6A 5SICE 4OU4A 2C1ZA 3C8HA 4CMIB 1S2GA 1TQ8A 4GZLA 3TNLA 5ERYA 4FFNA 4HZUB 4KE7A 4HNTA 2I6GA 2VJLA 3E48A 5FOQA 2QLLA 3K2BA 3AFOA 3JRWA 2CC2A 4N0PA 1HL7A 3Q7PA 3DLTA 2HL6A 2DWOA 4LYHA 4Q7LA 1TK3A 4WINA 4CIBA 3K0AB 1VCIA 3EEQA 4CG1A 3JXEA 3WYFA 4XEHA 4CQLB 1QDEA 1ZI8A 4DIDA 3I30X 2IXFA 4MOWA 5KI6A 1N4DA 2ZDGA 2I34A 1LSJA 4A5SA 1UBFA 3DWEX 4LGYA 5TPWA 4E30A 3IOEA 4D4LA 2ECFA 3W2EA 1DINA 3DFMA 1UBHS 1SCKA 3K0HA 2JAWA 2VJBA 4FWBA 1RCFA 1XAJA 3CUYA 3SM3A 1XPRA 1P4HA 2OBXA 3M1AA 1ZIXA 5C2JB 1LDGA 1Y8AA 5IARA 4TYYA 5JANA 4BNUA 1YB5A 5K0ZA 1TIKA 1QTNA 4E1BA 1L5KA 3E18A 5K5EA 3FOEC 3BMCA 1AC5A 2NU6A 3CIFA 4K81B 5REQA 3RU7A 2ZBUA 3IE2A 5IJ0B 2X9QA 3C74A 3L7LA 1J8DA 4EENA 2IZ7A 3AR2A 5A9SA 2VSOA 1K5HA 4IIGA 4UM9D 1BHO1 3W7VA 2CLEB 4DJEC 1YZ3A 4REOA 5CB4B 4M7RA 4CF6A 1T1RA 1ESEA 5KSYA 1P6XA 5JTUA 1NKTA 1E63A 1RKXA 2QZJA 1L7DA 2GZ1A 4UNQA 4YMHA 4U6QA 2ISQA 5JMPA 4PG5A 4GO1A 3EXIB 1OAKA 2FEWB 1T9BA 2HOQA 1EK5A 3P0FA 1ENOA 2DG2A 2I55A 1SPBS 3ASVA 5CW2A 5EE3A 2PTHA 4MA0A 4RK4A 1PSZA 1MFZA 1P18A 1QZZA 2ILTA 3H2SA 3I72A 3GG9A 2HSJA 4URUR 3OMXA 4R41A 4YT2A 4YRGA 4MGYR 2IBTA 2O8BA 5BSMA 1VHTA 4WZAE 4W5QA 2ZPUA 3BICA 3IOCA 3Q5EA 4MVYA 4ML3A 3SR0A 3VBCA 4A8JB 4V0OA 1LSSA 4DY4A 1Z8DA 4DLZA 3EGVA 1DU4A 5TF0A 1CQIB 2HA7A 3H1AA 2FMIA 3IUYA 4FLMA 4LQCA 1G21E 2C96A 2Z2YA 2HCRA 4XLLA 2Q7DA 3IL2A 2PX8A 4C7OB 1TYDE 1GOTA 2R5WA 5HTOA 2WMOB 1Y6ZA 1UIMA 3GD5A 3NI2A 3TBFA 5JCOA 2WF9A 4JJ4A 4LDAA 5AVQA 5HW0A 3BM5A 5C5CA 1HNWB 4LK2A 4LQDA 1LDBA 1BN6A 4RACA 3AEYA 3I2FA 1RQNA 3H9EO 3WJ2A 1O5OA 1RACA 1H93A 1KDPA 2PNFA 3B6KA 3D6NB 3HXMA 1TJ5A 8ADHA 1V8BA 1Y9JA 2W43A 3L06A 2E1PA 1Z13A 1KDYA 2CV0A 2C5SA 3NKLA 1VMAA 2ODAA 5KYWB 4FOPA 1GGMA 4EF6A 4B8WA 5D84A 4N5LA 5EWLB 5IAEA 1NQAO 1L4BA 2ZYGA 5FRDA 2I62A 2RGEA 3DLPX 2NSYA 2PBFA 4NS1A 5AK5A 2ZJOA 4TL9A 4C7KA 1W36C 1JMKC 2BI4A 3CUWA 3QIAA 4KO4S 3SIXA 4H3VA 4RX1A 2AG1A 3KOOA 1EMDA 2HN9A 4RFVA 4Q9IA 4YCBA 3GF4A 5K3BA 1EDEA 1M6NA 1ZQ1A 5LC1A 3ZHXA 1DQRA 4CV1A 2FFAA 1QM5A 3KBOA 1FA9A 3LVBA 4UPVA 5EP2A 3E84A 4Z1OA 1XMIA 4WGGA 3TIIA 2J08A 3H87A 1I32A 2PIAA 3HKBB 3C4VA 1QCCA 3JRNA 1X77A 3SIWA 3VAAA 1S1MA 3RBAA 3DKIA 2ZZNA 4RQAA 1RLIA 4MV6A 1NG9A 3PDJA 5DP1A 1SZDA 1HDZA 3KEMA 3P9PA 3CV3A 2ZTMA 4DDHA 2N0SA 4KKXB 2VDOB 3ZE8A 3PPYA 3RCBA 4I3GA 3G2NA 1X74A 4S3MA 2BCEA 1R7RA 4M83A 2D5AA 2PLNA 4JEMA 2Q41A 3N2GB 4RHFA 5AKKA 4DZTA 4XASA 2BR4A 1QPGA 4XYLA 4JITA 1G8AA 1XJ0A 3ORHA 1N3IA 2AMFA 1AHNA 2IOQA 2OECA 3FD8A 1W46A 4OJYA 3RREA 4IJVA 3GVIA 2OP1A 1NLMA 3E9CA 3OFNA 4CTJA 2V55B 3ZDXB 2SBTA 1SHJA 1S2IA 3E7FA 4GM0A 4HR7A 6ADHA 1G0OA 2BEVA 1LF5A 2G5PA 4IH9A 4DG5A 3UG6A 1F0PA 4BXOA 2GT1A 2BRUC 2XNKA 4NK4A 1TTHA 1TEVA 2ZSHA 4MZXA 3ZLBA 3DVLA 5I7FA 1PX0A 2J0QA 3QQ5A 3KEQA 1Y9AA 5IMBA 4YCAA 4L0CA 3IKJA 5LN1A 2VQSA 3FMIA 1V9LA 1CY0A 3RYTC 3ZGYA 4ZYZA 3AB3A 4UDOA 3KJEA 2ONJA 1E5TA 3E27A 4A16A 1X42A 4YMUA 1DKPA 1QO0A 1YTLA 1FP7A 2B2XA 2PLFA 1F6DA 2G5CA 4LISA 4W8HA 1Z5PA 1PSDA 3PJFA 1FUEA 3X1MA 1Y9ZA 3L1KA 5HKOA 1L1EA 4O33A 1FQKA 1KEWA 1R6UA 3P32A 3OZEA 3TOSA 3Q7TA 2ZETA 4G8DA 4MTLA 4BNJA 4AUMA 2O2ZA 1V4BA 1KO4A 2VUHB 3HB7A 4MR9B 4LHEA 2YN2A 3AUSA 3T4XA 4Z2AA 1RI5A 3GZ4A 1DC6A 1ZM3A 5LMZA 3L6DA 1DIOB 4G84A 5IP5A 3FMOB 4C07A 4J91A 5DCYA 1UJCA 2EKPA 2QRQA 3KTDA 4EFKA 3BB1A 3C7AA 4RA9A 3OFSA 4AJHA 2KWIA 1PFVA 2W2TA 4KODA 4NMWA 3BFVA 2QTTA 2CLKB 2OZLB 4YRDA 2H9IA 1XHFA 4FKBA 4TV8A 4UTOA 4XPIA 1FDSA 1T4CB 1RM5A 2JJ1A 4L2IB 4QT0A 4YRKA 2G4VA 5GM1A 2XUHA 3NC4A 1ZUIA 4RM2A 5I7HA 1U90A 4HQRA 5JJ5A 4B80A