4Q00A

Crystal structure of an s150a mutant of the e. coli feob g-domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
255
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAERKEGQFSTTDHQVTLVDLPGTYSLTTISSQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVATRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Ferrous iron transport protein B
publication title Exploring the correlation between the sequence composition of the nucleotide binding G5 loop of the FeoB GTPase domain (NFeoB) and intrinsic rate of GDP release.
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 255
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q00A01
4C0SA 2ZE5A 5C46F 5FBQB 4E07A 4EJSB 5EZ6B 5E7IA 4FINA 3BB3A 1XJQA 4KFUA 3R20A 4IFEA 4TYNA 4DIDA 5J4HA 5C18A 1PLLA 3EZ7A 4Q1EA 4A0HA 1ZP6A 1P2UA 4KYIB 3LAWA 1EFRA 3SFVA 4A2WA 2RKOA 2BMDA 2ANBA 1N5JA 5LB2A 2IF2A 2V7QD 3T1OA 3AVQA 2VP2A 3CRW1 4B35A 5SZHB 3O8CA 2ZEJA 3EPJA 3WRXC 1VIYA 1ZW6A 4PO8A 1X8KA 5AUPB 2X2EA 3OF5A 4EPRA 1KSFX 4M22A 2J1LA 2J46A 5DSZA 3U3RA 1HTWA 4NYJQ 1QVAA 4AG5A 5E3HA 5E7JA 1Z6AA 3K1JA 4NPHA 2JDID 1FQKA 1HV8A 1TQ2A 5JJLA 2JIZD 4C0QC 1TPZA 4Q9HA 2C9OA 2NPFA 3K0CC 2ZYVX 3TBKA 1UAAA 1P9NA 2Z4SA 3ZVNA 2GJSA 4TSFA 1YU9A 1XMJA 3EZ6A 5G3ZA 5H70A 3DKVA 1N0VC 4LJ7A 3TW4A 1Q1BA 2KSQA 3LX5A 1OH8A 4DLVA 3K09A 1GZSA 3ZLJA 2GNOA 3GEHA 1N6OA 1RKBA 1SZPA 4Z51A 5LD2C 2KBEA 2I4IA 3B60A 1KJZA 4ZDKA 2IL1A 1DADA 3OIWA 1E4YA 2ZVQX 3IBYA 4HLCA 4ZKDA 3AVWA 3CPJB 3QXHA 4FN5A 4L16A 3TK1A 4D0LB 5IK2D 1TQDA 1WRBA 4IKEA 3LQQA 4Z8YA 1NN0A 3NEYA 1XTJA 1XJ0A 4LYJA 4B74A 4D2IA 4MQBA 2FEMA 4HI0E 4DT1A 4EKDA 2QAGB 5IRCD 4HSEA 5H8WA 2IYWA 4GOXA 4TMXA 5G41A 2VHCA 2F7SA 3AF4A 4C7OA 4A36A 4AKGA 1WB9A 5FL3A 5L3VA 3IILA 4PZLA 4QGGA 4R7ZA 2IWHA 1E9DA 4RD0A 1G7TA 4P31A 2EFCB 2W83A 3OE7A 1BMFD 4UNPA 3Q5DA 4JVLA 3MWJA 4L15A 1KSHA 2RB4A 2J7KA 4LYFA 1OFIA 3BJIC 5EP3A 3RS5A 4B3XA 1MABB 4TT3D 1QHSA 1ZBDA 2VF8A 4KAXA 5JFGA 2GETA 2XZOA 4QBIA 2NMVA 1WP9A 3KJGA 2GZDA 5JWOA 5LPNA 1EX6A 5CM8B 5HTKA 4GL2A 5JECA 4DLTA 1K5GA 1NLYA 5A4JA 4NTZA 2F43A 2WM9B 2IYXA 2MSDB 2EQBA 4Y0VA 4ERNA 2IXEA 2QPAA 3EPHA 1WMSA 4ZCLA 4RSGA 4TYYA 2WICA 2DY1A 4UKDA 1V5WA 2MSCB 3QQ5A 5J4KA 2PCJA 1IY0A 3GLHB 1BIFA 4JLVA 2WSSA 4LJYA 2D2EA 1HT2E 1Z0KA 3BB1A 2GK7A 5J5CA 4P4TA 2GJAA 1NBMA 1Z83A 1MO4A 2YOGA 3MWLA 2GEUA 3HDTA 4KLZA 1A5TA 2IA5A 1KGDA 5DLQC 2DR3A 3GCGA 3U6KA 3THOA 3K70B 5CYPA 2BM1A 3PEUA 4OJQA 4YLGA 4DC9A 3KKPA 4P4SB 2ZE6A 1KSJA 4XTCS 2ZRPA 1KK2A 2IHYA 3C7KA 1W2HA 3U7GA 4JLBA 2J0QA 1Z0IA 5LB4A 2VF7A 4B34A 2AK2A 2PZFA 3ZVRA 3KQHA 2WWXA 4CRWB 1NP6A 2UZ3A 2A78A 3FMPB 3QIAA 1M7BA 4P3YA 3H4MA 4EAQA 1A82A 1SXJB 1GL9B 2DWOA 3RC3A 4BFTA 2O8CB 2FH5B 1X8LA 2HXYA 3K0FB 4X8OA 1E9RA 2IYYA 4BFYA 5TDHA 3KJEA 1EFCA 1YZKA 3WYFA 3WRYC 1E69A 2CK3A 2F6RA 5K8LA 2VEDA 4DLWA 1ANKA 4C2UA 1UBFA 3QG5A 4Q4HB 4ACAA 1W4RA 2VIIA 1DELA 1Q1ZA 3IO5A 3WYAA 2IS6A 4GP7A 3GJ8A 3TAHA 4NE2A 1CP2A 1NSTA 1KO5A 4CIDA 1L7VC 1NN5A 4WZ6A 1KY3A 2FGJA 2IF0A 4F38A 2WJIA 4OYHA 3UWKA 1AN0A 1E99A 1WQ1R 4OI2A 1GRQA 3VNUA 2PLRA 3QBTA 2D7CA 3AH8A 1E1RA 4C0BA 5FPYA 3PENA 4HB4A 3LA6A 3SOPA 1S8FA 3G5UA 4Q1FA 4TQ9A 2FGKA 3QEOA 1T9HA 1EWRA 1E3MA 4MYUA 1XDBA 5K8TA 3IHWA 5EXXA 4FMCB 1II9A 2X2FA 3VKGA 2HLDD 4XH9B 5AR1A 5J40A 3CLVA 3CRRA 1G291 4B2LA 1G4UR 3GFOA 4GZLA 1OYWA 3N2IA 2ZRFA 1FP7A 4DVGA 5DH9A 1GP2A 1Y3AA 4IFBA 2GK6A 3CZQA 5KO2A 3DMNA 1G20E 3Q85A 4RY2A 2ERYA 1H8ED 2O8DB 1KK3A 3LBNA 2J7PA 4JS0A 5AUOB 2ZRBA 3SU8A 3ZS9A 4QKQA 4NCJA 2PT7A 4A82A 1JECA 3HYTA 1XTIA 4URZR 1N6LA 3K9GA 2G1JA 1F2TA 3KDSE 1KZGB 2Z5FA 5DIFA 2CCJA 3AV0B 2ZSBA 5H1YA 2ZREA 2WSMA 5BYKA 4B3CA 5JHGB 2G1KA 4JKYA 1M8PA 4DEYA 2AHOA 4A9AA 5L3SB 1G6OA 2GCOB 4KSCA 2JA1A 3P4XA 1JBKA 721PA 1KI7A 4ZDWA 1OIXA 1P60A 1HE1C 1E2NA 3EW9A 1DO0A 1JXOA 1G3UA 1NN3A 5DGXA 4M4SA 3GMTA 5D3MA 2ZRCA 1OLOA 4NYMR 3QKRB 3SFZA 3RS4A 1OF1A 1GRRA 4JVMA 5FOUA 4BEJA 5K8IA 2VH5R 2GRJA 2WOJA 3DZDA 4LC1A 3TQCA 2XSZD 2CL6X 3KXIA 5CIWA 3WYGA 4B3BA 4MA4A 3TH5A 2F3TA 1N6PA 1SXJD 2O8BA 1F48A 1VMAA 1N0UA 3K0CA 4HLDA 4R71A 2ZRHA 3ECCA 2PL3A 2CLSA 2QM7A 4BFXA 2WWHA 3AVPA 5FBWB 3CWZA 1EWQA 4AYTA 1GUAA 2NO6A 3QPWA 2OHFA 4F91B 3ZZTA 1PUJA 2A3RA 1ZM7A 3CH4B 5DE3A 4U7DA 2J0UA 4H9GA 1XTRA 1EESA 2GBLA 1SKYB 2XZPA 4QGAA 3NIBA 2FSFA 3RNLA 2C99A 3W9YA 2VQSA 3P20A 1SVMA 4Q4JA 5AWFC 1W7AA 1E94E 1GDDA 1S3SA 4ESVA 4IDNA 1Z0DA 5J4YA 1VYVA 4RZUA 5EP2A 4PX9A 1CLUA 4NCNA 2RGNC 3G82C 4ASUA 4JT2A 2W2VA 2XNDA 3X1XA 2OLKA 3OFNA 4D4KA 3DO6A 1Z6YA 1W36C 2VPPA 4NCHA 4M9ZA 3H86A 4UQOA 3GLFE 5FOWA 1Z07A 5B58C 3EARA 3EWSA 1KHTA 1RYHA 3KKMA 2VA8A 2V4ZA 1A4RA 3UMSA 4II7A 1CJKC 2ZAMA 3UWOA 1OT3A 4LBVA 3KFVA 4PAQA 3FB4A 3I5XA 5DHAA 3AVOA 1G7SA 1VCOA 3EIHA 5JEDA 3TIFA 1LY1A 2V8OA 1NVUQ 1ZD1A 2F1JA 1NVXQ 1XEWY 2LKDA 1EGAA 3SYNA 5DN6A 5FOVA 1OIVA 3EPLA 2YWGA 2QGNA 2VTKA 1UFQA 2A5YB 4QC2A 1M7GA 5C1BA 3OAAD 3V00A 1CJVC 2J9RA 1AS3A 3A8TA 1UM8A 3NVAA 4XJXA 3L0SA 3REGA 1KSGA 3UATA 4CEHA 3RVBA 2O8EB 2ZUCA 5EE9A 3QBVA 3RSLA 1G8GA 3K53A 3IUYA 3SYLA 1AM4D 3Q5EA 1G3IA 5KDDA 4JYBA 5FOXA 4RD2A 3U44B 4Z54A 5FPSA 1JPJA 2QGZA 4OK5A 3A4LA 2QE7D 4NYIQ 3SZRA 3W6PA 3GQBA 4CZ2A 4YMVA 1GG2A 2EU8A 5GVSA 1XJCA 4RZ2A 3I8XA 4KVAA 1E9SA 1G7RA 2WPDD 1JQJC 1ESMA 2OFOA 2I1VB 2P67A 3L82B 4M1OA 1FZQA 1E2QA 4G5RA 3KKOA 1JEDA 2HEIA 3TUJC 1G5RA 3OHMA 4FI3C 4HB0A 4PHTA 5AJVB 5FOSA 2V6IA 2F9LA 1DPFA 3TNFA 3WHKA 3ZS8A 1RYFA 3HPQA 4JBXA 2PCLA 1G4AE 3GJ0A 4Q01A 3LW7A 4DEXA 1Z0AA 3MWKA 4B47A 4C0HA 2QAJA 2RGDA 1KMHB 2GF0A 2QSZA 1KI1A 5IT5A 4MH0R 2VSOA 5KSPA 4XVUA 2P5SA 1E9CA 3TLXA 3TUIC 3JZMA 2UVQA 2GESA 1VECA 1WDTA 2F1HA 1GAJA 2Q9BA 2RGAA 2Q3FA 1H8HD 4MITA 3RWMB 2RGXA 4QJ5A 3SI7A 3ZZUA 4C0AC 1IOZA 3QG1A 5KYKA 1HQYE 4PHHA 4Q21A 5JRZA 3FMOB 1US8A 1KO1A 2NQ2C 4DIEA 4XTRA 1TAGA 1GNRA 1MO6A 1II8A 1KI6B 1COWA 1LF0A 1XD2B 2BBWA 4G01B 2WTUA 1DE0A 4OQNA 3TSWA 1FP6A 4P0TA 4PC1A 4KV9A 3TQFA 1FUKA 2GCNA 3WBJA 4LC0A 4RD3A 3BGWA 621PA 4HDOB 2FX3A 3EIEA 2Z6VA 1HA3A 5B64A 3V4RA 2H92A 3QXCA 1EFHA 2WV9A 2MMGA 4MYHA 1D2NA 2XX3A 4B2PA 2O8FB 4JJZA 3U7EB 2KBFA 4BRUA 3UK6A 3QNUA 3I92A 2D06A 1J70A 1KKLA 1E1QD 1HY3A 2FJUA 1JR3D 2GXSA 2JASA 2JJ2D 2XOKD 3BH6A 3DVLA 4ILEA 1ZC4A 2ZITA 1TQ4A 4A6XA 4B76A 2JLYA 4IOLA 3ZQ6A 2HT1A 2FU5C 1RZ3A 4URWR 3BH7A 2VRWA 1KOFA 3KKNA 4KFTA 2PMDA 3FWYA 3U2QA 4KLNA 2C9CA 4YXWA 3WMEA 4BFWA 4NZYA 3AUXA 1GL6A 1LB1B 1YHNA 2RHDA 1K5DA 3THYA 4Q00A 3WXMA 4UJ5A 1ZC3A 4TQUS 2PJRA 2XXAA 2VBCA 1LFDB 3W3ZB 1KZ7B 4Q7MB 2OUKA 1RRCA 1JJVA 5TV2A 1E9AA 1WCV1 3VR3A 2FSIA 2QT0A 2RH5A 1QHNA 3DOFA 1Q20A 4LGMA 2AX4A 1W48A 1Z28A 4I4LA 5FUWA 2K5UA 4BWYA 2CCGA 2ZI5A 1CTQA 3KQNA 2BJVA 2VP4A 3GJ3A 2DBYA 2IT1A 3TJZA 1XTQA 4FW9A 4F4JA 4UNSA 4C4PA 4WW0A 3PQCA 4EJSC 1KJYA 2O0KA 3REFA 2ZRNA 1JAHA 4PO1A 5P21A 1CKEA 2R6AA 2O52A 4YQFA 5FTJA 3ONWA 4N0EA 1U98A 1D8TA 1BKDR 5E95A 2WJJA 2YINC 4BLTA 1DS6A 1FW6A 4V03A 3K0EA 2EVWX 2B7BA 4JSYA 3CM0A 1AGRA 4NHOA 4JL8A 4OQLA 3QSYA 1EFUA 3IEUA 2AFHE 1CIPA 4JVNA 3ZIAD 1ZVQA 2QG6A 1Q1EA 1Q22A 4OJKA 2P3SA 4JYCA 5CK4A 3SR0A 2YKGA 4UXIA 2XEXA 3N5CA 2VSXA 2ODEA 4ZCIA 3ADBA 4TMTA 4Q02A 3W5IA 1W4BA 1B23P 2P2LA 4ABYA 1OKKD 1AZTA 3DKPA 4IVQA 1W36D 3NDPA 4G3XA 2XGJA 3BC1A 4BLOA 5HZKA 4X8HA 4D81A 4IEIA 2C95A 5KNBA 1CJTC 1LW7A 5J4LA 1S0UA 1D5CA 1FTSA 3EC1A 3THXA 4O0MA 1GTVA 2QP3A 3Q3JB 5EJEA 2BBOA 1ZM4A 4XOIA 1MR3F 1ZAKA 2WAYA 1CS4C 5F9HA 3GEEA 3TR0A 4DT1B 4V0NA 2JAQA 2MMCA 2H16A 4FD2A 2BCJQ 2AFIE 3AKCA 4HUTA 2REXB 4ZI2A 4ZI3A 5CDFE 4C7OB 1SHZA 3E1SA 4A0GA 5FTLA 5FTKA 2ZETA 4DLUA 3EAQA 1T4GA 4ON9A 3FOZA 3EZ2A 3AVVA 4M9XA 3EG5A 4PQFA 4WXPA 4DSUA 2QAGC 1OYYA 1QBKC 4LX0A 4JVSB 1VKJA 3V4FA 5CITA 1F3OA 4LBZA 1C1YA 1Z2AA 5JEEA 3LWNA 4Q9JA 3I62A 3NBXX 2ZRKA 2ZROA 2ZS8A 1XU4A 4RJLA 3SDZA 5EE3A 3C4JA 4PTLA 2QTFA 1KDOA 3THWB 2A7QA 4K81B 3T15A 4LV6A 3SHFA 1P75A 4NMMA 1ZYUA 1ZNZA 2XAUA 4RFSA 3BBPA 3VR4A 3D31A 3QVVA 3C8UA 4L5BA 1IY2A 4GOJA 5E7MA 1OH5A 2F43B 1W1WA 1XPOA 2W58A 1G17A 2GVZC 1ZCAA 2NZJA 4IOJA 3T5GA 3X1DA 2GA8A 1E2FA 2HCJB 4MUAA 2ZM5A 2O0JA 1CJUC 3CF2A 4RZ3A 2AXNA 4F92B 1X6VA 5AUQA 3U7HB 2CVHA 4GOKA 3F5FA 3SJZA 5DO9A 2XB4A 5BN4A 3U3OA 3I4LA 1UF9A 4PAMA 4LJ6A 3RWOA 1LNZA 2ZJAA 5FPKA 1TTTA 2ZXUA 1EFRD 3NXSA 1DO2A 1KI4A 2TMKA 4F4CA 2BM0A 1SVOA 1AKYA 2QTVB 3DPUA 1KNXA 2F55A 3FMFA 2UKDA 4HEJA 2PX3A 4C0JA 1IN4A 4JZKA 2EYQA 1G16A 1F6BA 1S9DA 2ZSEA 3SQWA 2OCYC 1VTKA 3W5JA 3QUSA 4XWOA 3ASZA 4E03A 4LRWA 2R6CA 1XNJA 5JSZA 1Z06A 2RAPA 4D0NA 2ZRJA 4EPTA 1XXHA 3NH9A 3K70C 3U4QB 4U02A 1XPUA 3LLUA 1E0AA 1P2TA 1KKMA 3SBDA 3EXAA 3KXLA 4M2LA 3GJ4A 2NIPA 2FZ4A 4JMPA 4NL4H 3SBEA 3OESA 2VP6A 4HAXA 3RHFA 2CLCX 2LKCA 2BKUA 1YE8A 3NEJA 4EQ6A 4IEEA 3ND8A 4ITRC 2R6FA 2JLXA 1GWNA 2IS1A 4AI6A 4HLQB 2FE4A 4YDHB 1QHHA 2ZE8A 4LCBA 1W4CA 1CXZA 4CEJA 4NP6A 4QL3A 5TY0A 2ZTSA 1EG7A 1W49A 4POAA 2JIZA 5C4GB 1SXJC 2GXAA 1HT1E 2KI5A 5JJIA 3P32A 3KXKA 4JLMA 4NH0A 4PR0A 2JATA 1Q3HA 3GPLA 2V1XA 1E4VA 5IHPA 1J8YF 4GMXA 3NBFA 5TMPA 3LD9A 3X1YA 3VR1A 1W0JA 4XWAA 4OQFA 4F4IA 1J2JA 2QMOA 3DHWC 5A5GA 4BZQA 2D4HA 4AYWA 1RE0A 1Q21A 1EX7A 1MKYA 4FMDF 4YDSA 4E22A 2QENA 2WWYA 4NCIA 5EP1A 3EASA 2VP0A 3BE4A 5CM9C 2RHMA 4I1OA 4Q4AB 5EE5B 4BASA 3OE7D 3H84A 1TF7A 3RANA 2G3YA 5FL7D 5IK2A 2ZI4A 1P6XA 3AP3A 4ZIRA 1SULA 3RRYA 1BS1A 2WVJA 1K8RA 3B7GA 1BYUA 4DXAA 2IYLD 3GLGA 2PLFA 3JZAA 2NO0A 4AYXA 4DKXA 1LVGA 2HF8A 4KBFA 4IXNA 1B0UA 1E9EA 1FTNA 1N6RA 4MDEA 1ZUNB 1WBDA 3NDBB 3CNNA 2GAAA 3E5HA 3LVQE 5ELXA 1RW4A 4BEBA 4DCSA 1NVWQ 1OIWA 3PUWA 2KB0A 4FWIB 3PR1A 1BMFA 4FIDA 821PA 2JLUA 3O8BA 1PV4A 5SZKB 1ZJ6A 1P3JA 1G8HA 3BK7A 3ND9A 3M1IA 1KI3A 3Q72A 2NG1A 2QQ0A 4JBYA 1IHUA 4MRVA 3K9HA 4TT3A 5JS7A 1XXHE 2P6NA 4TN1A 4GNKA 4XIGS 1Z08A 2GKSA 3RS3A 4R98A 2AKYA 2ZRDA 4EDHA 1CBUA 4QJ3A 2WSSD 3W8NA 1VDZA 3PEVA 4MRPA 4A8JA 1F2TB 3GLFB 3B85A 4JJKA 1GM5A 2IW3A 3CB4A 2ORWA 3EPKA 3A37A 2CHGA 1X1RA 1Z2CA 4EJSA 1F2UA 1TL7C 5JLJA 3D3QA 4GBMA 4DUGA 1BO6A 3E70C 1Q12A 1UDWA 3ZD6A 4XVQA 2IC5A 5L3QA 1NIJA 1OXXK 5AK0A 5D3MB 3IGFA 3F3YA 4XSHA 2F1RA 4D82A 4KJZA 3MG9A 3T34A 5DNYB 3AGPA 1NMXA 2AKAB 2CXXA 4B6EA 2AXPA 1P2VA 2ONKA 4IVPA 1YR9A 4Q1DA 3O8DA 1X86B 3B1XA 2JJ8A 1JXMA 3IPYA 3VKHA 4CYMA 1KTVA 1XD9A 4RCZA 4QM6A 2B7CA 1WBBA 3U61B 3GFTA 1G3RA 4AG6A 2A5FA 4G5QA 4UJ3A 3IIKA 3KB1A 1WE2A 5EZ5A 3LY5A 2IEYA 5G40A 4IW3B 2IEZA 1GKUB 1XZPA 4LBWA 2A30A 4LHVA 3MGCA 2DFLA 4C0LA 1VG0B 2V3CC 1NY5A 3GLGE 1DAIA 2QMUA 3HU3A 2G77B 3VU9A 1W4AA 4OKSA 2REBA 3FMIA 3GP8A 3QY0A 4ACBA 2QRZA 1Z6GA 1BOFA 4TMWA 1PLKA 2J0UB 2OLJA 5GADl 4HB3A 1E9BA 4CF7A 4DSTA 3A1VA 5FBRB 3O47A 2L0XA 4Q4JB 4URYR 1UKYA 4LZZA 1E1RD 3B8HA 4US0R 5HCIA 1HH4A 1XTSA 3UXMA 1H65A 2Q3MA 5AJXA 5CJ2A 1XMIA 1N5KA 1R5NA 4TZ6A 4UNRA 2NO1A 3OIYA 3QE0A 4UNNA 1NBME 1R0XA 4M1TA 1OSNA 4KITB 3S1AA 1T5LA 2B6HA 1E9FA 3MUFA 3NH6A 2P6UA 4GRAA 2ZPTX 4QGFA 3K0AA 1KI8A 1LF5A 4KHZA 1QF9A 4LOAA 2FV8A 4ZV4A 1Z47A 2ZS9A 2ZRIA 2C96A 3CRVA 4N0DA 1MABA 2J7PD 4Q47A 1QDEA 2OT3B 1G18A 1OHHD 3LO5A 2ZIAA 4V0LA 1CR1A 4M9QA 3U3KA 3KB2A 4JT4A 2PJZA 4B44A 3AF2A 3QXXA 4E5UA 3NHAA 4DSNA 2NOAA 1AK2A 3UANA 1IXRC 3L8YA 1RIFA 3EZ9A 4WAUA 2JLVA 4XWKA 4HUQA 4MRNA 4OK6A 2F3RA 2WJHA 2AD1A 3KQKA 1R5BA 4R2IA 1P9RA 3CZPA 1A2KC 4CEHB 3K70D 4M1MA 1G7CA 1G8PA 1LV7A 3TR5A 1FNNA 2GDJA 2DFKB 1S9HA 1WA5A 4KYUA 1TF2A 1VHLA 3T06B 4KODA 4D4JA 2BMFA 2WMNB 2GWHA 3CO5A 1FOEB 2CL7X 3AUYA 3TE6A 3ZJYA 5JBQA 2JLSA 5AJZA 2H57A 5FBLB 3PG5A 5CLQA 3VMFA 1M34E 3PUYA 1E2LA 1LS1A 2HDNB 4OHZA 4NDZA 2HYDA 1Z5ZA 5M04A 2X8AA 2CE7A 4JLPA 4YMTA 1HE8B 5KSYA 4EIWA 4NYJR 2OCAA 1IBRA 4PC7A 4A4DA 4YMUA 1N3BA 1CRQA 3M6AA 1N5LA 1QVRA 2ERXA 4TL8A 1ESNA 1SVKA 4L9SA 2EFGA 3SJBA 1OFUX 4IDQA 2VO1A 1NI3A 4TYQA 2QMEA 3FFBA 1Q0UA 2XSZA 5TB5A 3FYHA 1JAIA 3F8TA 4A92A 5JI3E 2WWWA 4AURA 1P2SA 2IYQA 4ZKEA 4QNMA 4C0KA 2AWOA 1FUUA 2LWIA 1N2CE 4JL5A 5KSZA 2Q9AA 3LDAA 2JGNA 1KAGA 1W46A 2E1RA 4TL7A 4ZDIA 2IYRA 4HDQB 1Z22A 1S96A 2FFQA 4Q9IA 1MT0A 3EA0A 4QM7A 2AR7A 4LHZA 2OILA 1US8B 4RVCA 3MAAC 1RJ9B 3OFND 1SGWA 1II8B 4LSGA 1E6CA 1P4SA 2J59A 4G0NA 3KTAA 1CULC 4MYTA 1VCMA 3WHLA 2FPLA 1DBSA 2EYUA 3TRFA 4WZBE 2P0EA 1IM2A 3ZVLA 1I4LD 4D4LA 5HE8A 3AF3A 3JVUA 4HAVA 1ZD9A 3W6NA 1R8SA 5J47A 5KSOA 1RRGA 2ZANA 3BFKA 3N2EA 4ESHA 4CGZA 5KU1A 1PZNA 4BQSA 4DDWA 2UZIR 4HAWA 1WF3A 2QP4A 3OEEA 2D74A 3X2SA 4D0GA 2X1VA 2RGBA 4X8LA 1O3YA 3SNHA 2ZU6A 4C2TA 2Q9CA 1EK0A 3QPVA 4PC3A 1RRPA 1U94A 4EFLA 3MSXA 4H1VA 4PPNA 1XF9A 5DN6D 2HV8A 4MKIA 3IIJA 1Z0JA 2HJGA 2E9SA 3MWYW 2DWPA 4U00A 2EFDB 3HR8A 4A1FA 1N0WA 221PA 5TARA 3THYB 1JQLB 2QMHA 3WNCA 2XXAB 2C8VA 4B6FA 1GRNA 4BUJA 2GF9A 3MJHA 5F98A 1AJEA 1AGPA 2WJGA 4PAOA 1AZSC 4CEIA 1G8YA 1YZGA 2A2ZA 3BIFA 4G5GA 2QUZA 2EFHB 3KL4A 4DCNA 1S1MA 4AD8A 4FMDB 3O8RA 2ZR9A 5KDOA 3AF1A 3NG1A 2OCPA 2Z83A 5FOTA 1MH1A 2Q3HA 1R0YA 4C9BA 4EPVA 5JZVA 3VTKA 4W9MC 1NY6A 2F1IA 2ZJOA 3U60B 2PEYA 4DLZA 4PO9A 3OAAA 2BHRA 4D25A 2A5DA 2JLZA 1PUIA 1W0KD 3QKSA 3EC2A 4HZUA 2J87A 2IX3A 4B3DA 3AVYA 4GP6A 3NBZC 3U6BA 3BXZA 1XCPA 2QI9C 2OFXA 1ZD8A 2IUUA 2DFTA 4L8GA 5KUTA 1AKEA 1UJ2A 2JJ1A 4JLNA 3B6EA 3PFIA 1R0WA 3PEYA 4P33A 5HCNA 3CF0A 3CW2A 3I73A 2QE7A 3B82A 1OH6A 3CIOA 5TVKA 1J99A 1DAKA 1R2QA 4J0QA 1OB5A 2BC9A 2BEKA 2AWNA 2ZR0A 3P26A 2C78A 4MRSA 1D6JA 1U8YA 3C14C 5JWHA 1NL3A 3RLFA 1VYTA 2FZLA 3VX3A 5AJWA 5AUNB 3AM1A 4ZDJA 1QHGA 4YMWA 1CU1A 1UEIA 1RFLA 1IY1A 2WKQA 5KTYA 2ZVPX 1OPXA 3PEWA 1YZNA 3THXB 5GJVC 3ETLA 1PVOA 1COWD 4DLYA 3L0OA 1LS6A 4I1UA 3D7MA 1UKZA 2DHRA 4JLJA 4IOKA 2WIAA 1KDTA 3IKJA 1D9XA 1MOZA 4DDTA 4UNQA 421PA 1XD8A 1E79D 2GEVA 4N3NA 5BW8A 3GLIA 3VR6A 2PH1A 4GPTA 2Z43A 2CL0X 4BRWA 2QT1A 2R2AA 4PSAA 3TUZC 4DWJA 1KJWA 4Q4LA 1TEVA 1KO8A 2PMKA 4D6PA 5CB8A 4TQAA 1VPLA 3R7WA 1DARA 4CT5A 4AKEA 4DLRA 5CB6A 2ZE7A 4DBLC 4KXFB 3KQLA 1OXVA 1YRBA 5JJKA 1GSIA 2CJWA 3T5DA 3V9PA 1XEXA 2QPTA 2GVDC 1R8QA 1G5TA 2AD5A 4X8MA 4YXWD 1QHYA 4OHYA 2YJTD 4ZPXA 5FR1A 2G88A 4GFDA 4RFSB 4HAYA 3LFUA 4HYYA 4ARZA 4EPYA 3RC8A 4GMDA 4QOSA 5FUVA 3G0HA 2ZJ5A 2YOFA 2RMKA 4ZO4A 2R44A 4Q1AA 2Q0HA 4M1SA 3IQXA 2IBMA 1TMKA 2JJ2A 3BFVA 1E1QA 4URXR 2XOKA 1U0LA 3QF4A 4Q9LA 4RKEA 2B8TA 2YWEA 1GIAA 1OFTA 3W34A 3KJHA 4XD7D 3W3AA 4RD6A 1YZQA 4LYHA 2RGCA 3MD0A 4TYPA 1TQ6A 2CE2X 1IN7A 2QSYA 4QJ4A 4JKIA 2QP9X 3QF7A 4JL6A 1ETUA 5HR5A 4BPBA 3WBKA 1GITA 2ATVA 1U81A 2YYZA 2OBNA 3U3JA 4MGYR 3B1ZA 3QENA 2ECKA 3PXGA 4A2QA 2ZI6A 4B32A 4Q7KA 5ANRB 3HJNA 1G9XA 1ZNYA 1P62B 2BOVA 4LJ5A 3L2OB 4G1UC 5K8UA 4KO8A 1IAQA 4BLRA 3U5ZB 2GZAA 1Q44A 2R6DA 2H8KA 3I1FA 3Q7QA 1IXSB 3W6OA 1FPMA 1NKTA 3CWQA 5JSZB 1U0HC 2PZEA 1XXHB 2P65A 4KVGA 3PUZA 3VQTA 1VCNA 2J5XA 1GFIA 2VLIA 1G8FA 4MKGA 1NG1A 1KYIA 3Q9LA 1SQ5A 5CYOA 5E4FA 3AGQA 1ZU4A 6Q21A 4TWZA 4EQ6B 1BYIA 1L4YA 2GXUA 4F7WA 2WWIA 3IIMA 2XITA 4PHFA 3AF0A 2BV3A 2W6IA 4TL6A 1QHHB 2WHXA 4BE7B 4I81A 3ZIAA 4O25A 3FHOA 3WP1B 3ASYA 3SYKA 4US1R 1Z63A 2F9MA 1M1YE 1R6BX 3BH0A 4IDOA 2YNMA 2ZS7A 2QROA 5DI3A 1KDPA 4OL0A 4W5JA 3N70A 5SZJA 5HKKD 1E2HA 4IDHA 1YR7A 2CNWA 4BLQA 3TMKA 1XEFA 2VHJA 1OKKA 2RGNA 4LDJA 5DI9A 5BWMA 2C9YA 3A58B 2XZLA 4D26A 1DAFA 3IDQA 3AB3A 2Y8EA 1N6KA 3QXSA 2W6JD 1IXZA 4LYAA 3RYTC 2G0NA 1HQCA 3UIEA 1UBGA 1TADA 1G21E 4MUBA 3UMFA 3DEFA 2YHSA 2FG5A 3OEHD 5KNDA 5CLLA 3Q8XB 4UXHA 1T8TA 3UPUA 2QBYA 2ZRMA 3LV8A 3C16C 3IO3A 2W0MA 2FWRA 2YWHA 4NKRA 3K9NA 2OSBA 1FMLA 3GLGB 1G19A 3FKSD 4DDUA 4O2RA 1HEIA 1Q1QA 3CUEF 1PJRA 3QXJA 3H1TA 3TSZA 3VAAA 5F9FA 1HUQA 2OFWA 2V55B 3CRQA 5JWRA 3VFDA 1XZQA 3AVUA 1HURA 1RC8A 2ZRLA 3PV0A 3OZXA 2DCUA 4CVNA 4Z1MA 5DYGA 4PSKA 1G3MA 5B2ZA 2J3EA 2OG2A 4B33A 1TF5A 1W47A 3GJ7A 1SVLA 5KHOC 1KIMA 3ADKA 1KI2A 2QORA 3ZDQA 2CHQA 2KJQA 1SHKA 3WNDA 2ZQ5A 4TYWA 3LBHA 4QFMA 1T0HB 5FR2A 5EXPA 4JLKA 5CJPA 3RS2A 5FFMA 2W2XA 3FTQA 1OW3B 4LPKA 4A8JB 2FPKA 1AA9A 1HYQA 5KOYA 4AC9A 4Q7LA 2B92A 2OBMA 2QM8A 4G5OA 4HAUA 2HCBA 4HATA 3CKLA 1F2UB 2CMKA 3SC3A 2FPMA 5KNCA 5KDLA 3MJRA 3EWAA 1NSFA 2J0VA 1FMJA 4Q1CA 4V0MA 1XX6A 3FE2A 4XSGA 4LWZA 3WNBA 4NYIR 2LCFA 1MO5A 3A1SA 5L3QB 4P4UA 2V54A 4JLOA 2HYIC 4NYMQ 4TMKA 1G6HA 3KX2A 1DG1G 4PPGA 2V7QA 4RFVA 5C4MA 1ZMXA 2R65A 4TSFD 3GJ6A 2GJKA 3CR7A 1R4AA 3H0KA 1YR8A 4TLDA 1U8ZA 1YRAA 4Q19A 2XTNA 1UEJA 1RRFA 2I1QA 2QTHA 4M21A 3HU2A 1G5PA 2H1LA 4M1YA 5DYIA 1Z3IX 2JDIA 4QHYA 2GJ8A 4GZMA 2PBRA 2QEQA 2OEPA 3L8ZA 2QZ4A 4EPWA 1JR6A 1J7KA 4LHYA 2IXGA 3RRMA 1YVDA 3TVTA 3VU9B 1SVSA 2CDNA 4TLCA 4KU4A 4BZPA 1ZRHA 5HZHA 1W0JD 5LDDC 3IBGA 2ZI7A 4WXRA 4OHWA 4DCUA 3KFXA 3NBYC 2FSGA 1DEKA 1MRNA 1QG4A 3L0PA 3FHCB 1YZTA 4AKHA 2ZRGA 3MMPA 4AIIA 5GVRA 1E32A 3LLMA 4V0OA 3WMFA 2GBLC 1T3SA 1S1CA 1I4TD 1AS0A 2QPOA 3GD7A 1FX0A 3BD9A 2WJVA 1SVWA 2BBTA 2YV5A 2ZSDA 3CONA 4R9UC 1M6NA 2C77A 2QU8A 4K8OA 4PSVA 2P6RA 1ZNWA 2NO7A 3KJIA 4Q7JB 1CF4A 3S1AB 2DYKA 1U9IC 2D3WA 4QNRA 3CPHA 2PX0A 4Q66C 4DSOA 1KY2A 3RRNA 3E2IA 4A0RA 3K0AB 1TX4B 4DCTA 1I2DA 5FL7A 4PXAA 5GJBA 2BMJA 4GI7A 4WZAE 4BFVA 4DB2A 1XEWX 4LHWA 2V1UA 5EXSA 1MV5A 4V0ME 2OXCA 1UKVY 3R8FA 1E2KA 2WWFA 4TTRA 3ADDA 1E2DA 1M74A 1P72A 2ZJ2A 2BCGY 4PPQA 3THWA 2BVNA 3AVTA 1FQJA 2P5TB 1XCMA 1TUIA 4BFZA 1AIPA 5LBIA 2IUTA 3CR8A 4OBEA 5JRJA 1L2TA 4MKFA 1NBMD 3RSOA 3MFYA 4H1UA 4HUQB 2BIFA 4O2LA 3CH5A 2JLRA 4W5WA 2GTPA 2FSHA 4B3GA 3DMDA 3CNLA 1ZU5A 4DUGD 5BN3A 4LPSA 1N6HA 3GEIA 4TLEA 2Q6TA 2IUSA 3PCRB 2CCKA 3IEVA 3UG7A 4PC2A 4TMVA 1E96A 3TKLA 1T5IA 1T8UA 2ZJZA 3GFPA 3LX8A 2V6JA 2BKEA 5L3RA 2FOLA 5FUYA 3TW8B 2IK8A 2NO9A 3AP2A 3PIRA 2R8RA 4Q18A 4M1WA 4FWTA 1X8JA 1UKEA 4IOMA 5IDVA 3SEAA 4EUNA 1Z0FA 2A9KA 2ZJBA 3HYRA 1CRPA 3VHLB 3U7FB 5JS8A 1ZINA 2O8BB 3JVVA 1TU4A 2AL7A 4JLAA 1NKSA 2OM2A 4HB2A 2N1BA 1OXSC 2R6GA 4DDVA 4BZXA 4QRHA 4WVFA 1Z29A 1Z6XA 3WP0A 4M1KA 2CK3D 1T91A 4OK3A 3A1UA 1S3GA 3C5CA 3U4QA 4KFSA 3BRWD 2C98A 2QN6A 1S2MA 1ZM2A 3WMGA 3I32A 5EQTA 4KCGA 5LD2B 1XMVA 4IXMA 1P9WA 1FNMA 1K6MA 3DDCA 2BJWA 1GL7A 2R9VA 3A4NA 1N5IA 2HT6A 3U3MA 4Z8XA 1JJ7A 4JIMA 2ASEA 3QI2A 3I5YA 2KE5A 3ZYCA 2HJVA 1RVDA 4C30A 3UG6A 3KUCA 2ZRAA 4Q1BA 5A0FA 2G0TA 1NN1A 2G83A 1OB2A 2OCBA 2CEAA 2KWIA 1E2EA 2WOOA 2XJ9A 4FCWA 3RDPA 3BOSA 4M0LA 4B71A 3BWDD 2YVUA 2ANCA 1DAHA 1KO7A 2FMXA 4FCTA 4YMSA 3QPUA 3PUVA 4BLSA 4QXAA 2GJ9A 1Q3TA 3KTAB 3MRSA 2CVFA 1YJ5A 2PZGA 2QAGA 1ZCBA 4PHGA 3SHWA 4Q03A 3K8YA 4PQYA 3RRZA 1D9ZA 4Q4AA 3EA5A 4NU0A 4TLBA 3ZD7A 3ICQB 2J45A 5FI1B 1NLFA 1OXUA 4PZYA 3CX8A 1D2EA 2NPIA 1T6NA 2XNSA 5EUMA 4I1SA 2XB2A 5HE9A 1VIAA 3C15C 3SS8A 2HLDA 3BS4A 2OE2A 4PANA 1UBEA 1E2JA 1CR2A 2YZ2A 3C5HA 2Z4RA 5JHHB 1NMZA 4QBFA 3DL0A 4EFNA 4EFMA 1W44A 2JLQA 4TZ0A 4P32A 1UPTA 3NHBA 1W5TA 2ZJ8A 1VYUA 1XRJA 4GDFA 1TNDA 3L0IB 3LXRA 2GILA 4DZZA 1N6NA 1E0SA 4IDPA 3OIVA 3HP1A 2QRNA 3A6PC 2A5GA 4IRUB 5FBVB 5FH9A 3AKYA 1H8EA 1T3LA 1AQUA 5JI2E 4S2EA 2GZHA 3TSOA 3TGPA 2IYSA 3SE0A 5DHFA 3ZQJA 3DZ8A 4CEIB 2IS4A 1IQPA 2G6BA 1DOAA 2BEJA 3NTUA 3AKDA 1OHHA 1IN8A 1G64A 2FNAA 4HLUC 4N1AA 5J4VA 3GLHA 5JMTA 3EIQA 1DTSA 121PA 1X3SA 3CF6R 1U2RA 5L8VA 3FGNA 3QVUA 2W00A 3GLFA 1KK1A 3I8SA 5SZIA 4Q48A 4CW7A 3FHTA 2G9NA 2R62A 1XTKA 4QBHA 5FPHA 2BWJA 1AS2A 1QHIA 1SKQA 3QKSB 2ORVA 3L43A 4HZUB 1QRAA 4LUCA 1ZM9A 4LJAA 3UKDA 2XTZA 2VL7A 2WIBA 4P4SA 3P1JA 5EE1A 3I3SR 1FL9A 1KNQA 2ZI9A 3NKVA 2IS2A 5TXGA 1I2MA 4YONB 1P61B 3T12A 3CNOA 4URUR 4TTQA 1NVVQ 4NCKA 5GJCA 4PC6A 2OO7A 3QKUA 4L4UA 3LXXA 4Q9KA 3A4MA 1JPNA 4OHVA 2OV2A 4LJ4A 4D80A 3A1WA 1CJMA 2O8CA 1SXJA 2X77A 2QQEA 4U5XA 5FPTA 5BYJA 3K0FA 4M8NE 5GJWC 1ZM3A 2H18A 5H68A 4XVRA 3B78A 4TTPA 3KQUA 1YZLA 3NC0C 3PJRA 2C2HA 3PVSA 3P4YA 5IF9A 5JCZA 1P73A 2GXQA 3A36A 2ZSAA 3DM5A 4Q4HA 4ASUD 1U8AA 2GEDA 2XNDD 3M4YA 4M53A 3LVRE 3FPAA 1NMYA 2YC2C 1JALA 1A2BA 1SVIA 2VP9A 4EPXA 4DLXA 1WXQA 3GLIB 521PA 1XCGB 1IN6A 3GJXC 1NNEA 1GNPA 2ZYTX 4MGIR 3QKTA 1R5OA 2ZYUX 4HZIA 4JBWA 3GLHE 1E98A 4I99A 5B30A 3OIUA 4B43A 2VYFA 1U9IA 1KK0A 3R7WB 2JLWA 3ZZ0A 3OEED 3RAPR 3QJYA 4OI4A 2V9PA 3PITA 2VSFA 2PEZA 3KKQA 1DVRA 2CJWB 3X1WA 1XEXB 1TEXA 2ZI3A 1E2PA 2DFNA 4GT1A 3R9IA 2FFHA 1LTQA 1AQYA 1U90A 4AKIA 1OV4A 1F5NA 5CK5A 4FCVA 1G41A 2IXFA 2FEOA 2WBLC 4PPFA 1ZUHA 1UADA 1QZXA 1NF3A 4ARZB 4BGDA 2OXRA 3B1VA 3MLEA 4B73A 2WZQA 2B8WA 2WAXA 4A2PA 5EUQB 3GJ5A 2O8DA 3CX6A 2CLDX 2A5JA 5JCPA 3AQ4A 3QF4B 1E0KA 2ZU0C 2GAOA 1E2GA 4LV8B 2AK3A 4UXJA 4B48A 1N25A 4B2IA 1VCIA 4DLSA 2HUPA 4YC7A 4OQMA 3ZH9B 2VHUA 4KBGA 1R7RA 2Z0MA 1CR4A 4RD1A 2FN4A 1DAEA 4LHXA 4URVR 3IPXA 2N46A 1SXJE 1OE0A 3B9PA 3A1TA 4TL9A 1CR0A 4DRZA 1T3HA 3BORA 3LQRA 4TLAA 1Z8FA 2E87A 4NBSA 2QY9A 5L3SA 4IHQA 2GCOA 4CDGA 5BN5A 3FVQA 4LJ8A 4HDCA 2EFEB 3HPRA 5C2JB 1C4OA 1TU3A 3R8CA 1G3QA 1Q57A 2JJ1D 3LBIA 1NJGA 2WKRA 2ORIA 1G1MA 4JSTA 4RKFA 2IHBA 1XB2A 3QKRA 4LI0A 4S35A 5F3WB 2HF9A 1XPRA 5FI0B 2QA5A 2C04A 1W0KA 3KUDA 3LH5A 5DISB 2JCSA 4OI1A 2WPDA 3W8RA 2C03A 4LJ9A 4B75A 4F93B 2RGEA 3M0EA 2N42A 1Z6TA 4B3FX 1A1VA 3RS7A 1W2GA 1NG9A 1L8QA 4RD4A 2IYVA 4BFUA 4QBGB 4KFRA 1VHTA 1ONBA 2RGGA 1A7JA 3NWJA 1X1SA 5F2EA 4W5HA 1FFHA 1YZUA 3PUXA 4AWXA 5DI3B 3CPEA 2CHVA 3BAFA 3K09C 2W0SA 4WBSA 2IYUA 5EE0A 4E09A 4O3MA 3B13B 2FFBA 3ZVMA 1QHXA 2IYZA 4JLDA 3RABA 1E2IA 3VNVA 1IN5A 3Q7PA 2JEOA 1H8HA 4QHSA 1W36B 4QHTA 5HPYB 2C5LA 1ZNXA 2VHTA 3K9LA 3LNCA 4US2R 1U0JA 2ZYWX 4A0FA 5FTMA 1W5SA 3QOFA 1VG9B 1RJ9A 2ODBA 4Q5IA 4BLPA 3T1TA 2NZ8A 2QBYB 1QG2A 4K46A 1OXTA 1XMSA 3D8BA 4PQRA 3TVDA 2H5EA 1YR6A 1I4DD 5KPDA 2OZEA 1V43A 1E79A 3B2EA 4PZZA 3EZFA 1D2MA 1N6IA 5G53C 1NRJB 4MGZR 2ZJYA 3NC1C 4IJMA 1P7CA 2IWRA 4RZXA 2BDTA 1BH2A 2GCPA 3AVXA 3K0SA 1ELOA 2D62A 1M7HA 1IJEA 2HXSA 1JR3A 4GSYA 4M9SA 4G5SA 3TAUA 2OAQ1 4WOPA 2FFAA 1NIPA 2YC4C 2NTYC 3CRMA 2FF7A 4RCYA 5D3QA 3BERA 4ZCMA 1GVNB 2IYTA 4MKHA 3B1YA 2O5VA 3BB4A 3I72A 3AEZA 2D7DA 4MDFA 3FFAA 1JEEA 2QL6A 1YQTA 1U99A 1MO3A 2BBSA 4HLUA 3AP1A 3VKWA 2I3BA 4IVRA 3T61A 1O87A 5BQ5A 5KPJA 1KAOA 3QEJA 5CDFA 1KMQA 2VP5A 4KI0A 3DOEA 2ONJA 1R0ZA 2D2FA 4C3ZA 1KO4A 3MCAA 2O8EA 3B9QA 1OFHA 2FA9A 2VHQA 4XD7A 3ZGXA 3T1VA 2BMEA 1E2MA 4A8JC 1GILA 1XWIA 2MSEB 4AK9A 4LY6A 4BFSA 2QNRA 3R9XA 3U44A 1C9KA 1T0JB 2YWFA 3CBQA 3DM9B 3RS0A 2J41A 4DJTA 2WJYA 1YKSA 1S4QA 2O0HA 3LRPA 2FDCA 4I1VA 1OJLA 4V0KA 4QG7A 2EW1A 3HWSA 4FMBB 3IHLA 1SKYE 3SJAA 4DHEA 4AY2A 1DG3A 1NJFA 1ZIPA 2PT5A 3B5JA 3GLIE 4OI0A 1KDRA 1PLJA 4FMCF 3P27A 2REOA 2OAP1 2B21A 1EXMA 1DAGA 1XFAA 2ZUBA 3T35A 4OQXA 2W6ID 2Q21A 4MYCA 3BFXA 4BECA 4CEJB 4MGKR 3HU1A 1NVVR 4R2HA 4W7SA 1GKIA 4V02A 3SN6A 5FTNA 4LK2A 1KMHA 1GOTA 2SHKA 1J90A 2H7VA 4TMZA 3I61A 2AN9A 3VR5A 8OHMA 5FUXA 2CNWD 2ATXA 1J8MF 1CEEA 2EWWA 1R10A 1P5ZB 2WMOB 4PFSA 5CIQA 4NONA 5G3YA 3VHXA 1OH7A 2XTMA 4WIAA 1JNYA 4L9WA 2OBLA 3SJCA 4WA7A 1TUEA 2DB3A 2NGRA 4A15A 4QGHA 3VX4A 5BXQC 2ZSFA 1JR3E 3EX7C 1E0JA 1M2OB 1DAMA 3B1WA 4CT4B 5UKDA 2EWVA 1VG8A 1XBTA 4LV5B 5HKKA 2XJ4A 1KI6A 1XD2A 1UDXA 1JB1A 3FKQA 4LBYA 1GNQA 2YOHA 3AKEA 3W90A 1KI9A 1FX0B 4ZIRB 4DB4A 2CBZA 1F60A 3D6TB 4Y0AA 1VG1A 2GHIA 1EFTA 1ODFA 1IJFA 4DCVA 2WWGA 3H2YA 4FXPA 3VR2A 1XP8A 2W6JA 3WY9A 1JI0A 1MRSA 4HAZA 2O8FA 2RCNA 3CX7A 2ODNA 2W2TA 2ZAOA 2DPXA 2H17A 3OEHA 3UMRA 3X1ZA 4KSBA 4Z1MD 3HR7A 1IONA 1Y63A 1UBCA 4MRRA 3SQXA 2DWQA 2ZR7A 2J0SA 1RPZA 2OESA 3LW8A 1GKYA 4A6PA 3F0TA 3ICEA 3R9WA 3FKSA 1NLZA 3FDIA 1ZUIA 5B57C 3C41J 2X19A 2ZUDA 5EP4A 1ZIOA 3ADCA 3KZ1E 1II0A 2ODWA 5AJYA 4OHXA 3T1QA 1L4UA 2WKPA 4D4MA 3IQWA 3J81k 5EXTA
chains in the Genus database with same CATH superfamily
1I6MA 4C0SA 2ZE5A 1LLDA 3KPUA 4HD8A 1AX9A 2PZ8A 5FBQB 5C46F 4E07A 3T9AA 1I6WA 1XQ9A 4WMLA 5EZ6B 4EJSB 3PHCA 4FINA 1Y1QA 3ZNOA 1XJQA 2WTEA 8AT1A 1UXGA 2MSLA 4LJLA 3MTIA 4ZC8A 4RBNA 3NNSA 5HQJA 4IFEA 3VM6A 1FTGA 3ZDXB 1PR3A 4FP9A 2WZCA 5EWLB 3D3KA 4I1IA 1A9TA 1MC5A 3EZ7A 2YQ5A 2J5KA 4YJHB 5A6SA 4PSCA 4LISA 2BMDA 3DBLB 2ANBA 3FN4A 2OHJA 1TIPA 4MLCA 1FPQA 2WW8A 3V4VB 5JY1A 1W85B 2IZ0A 1UOOA 5LYYA 5KTMA 1XKTA 2VP2A 3DE3X 4RIIA 2Q4TA 1PIWA 2IYAA 3VSCA 1WUIS 2PNFA 1ZW6A 1I9CA 2WRZA 4V3CA 5AUPB 5KYWB 2X2EA 4EPRA 3UCEA 4DUZB 2J1LA 2QR3A 3AUTA 4BNFA 4Y1EA 4X6UA 1QVAA 3B3GA 3F2VA 2GN4A 5IBPA 4FS8A 3E4DA 4NPHA 3OICA 4ZCTA 1FBNA 2NZVG 1TQ2A 1DQSA 5F4BA 5B7QA 1SUIA 1F8FA 4HSGA 3F5SA 1VHJA 3NIGB 3VPFA 2C4WA 2AGVA 3E35A 1ICEA 1P9NA 5IDWA 3G8AA 3QFHA 1IZYA 1NSYA 5J2UB 2DECA 3EJ6A 5JDCA 5G3ZA 4EY3A 3PDIB 1ORHA 4PVDA 2ZBEA 3F6YA 2KSQA 1KJ8A 5F7XA 1JIIA 4U3JB 4F3YA 3I6ZA 1P9LA 3ZLJA 4R2WA 2W98A 4W6ZA 5E1OA 4YP5A 2QS9A 4IWXA 5CD9A 1FJHA 1SZPA 5CA1B 3CBGA 1ZH4A 4CE6A 4Z51A 4G8CA 5BWOA 3EEIA 3KS9A 3KR9A 3B60A 5L7WA 3JYPA 2EP5A 3ISTA 3CVXA 4O4IB 3CT4A 2CFRA 1AKMA 3WKEA 4XR4A 2RGYA 5H3CA 4WCFA 2DKFA 3KIPA 3RIMA 1POWA 1TQDA 4TX1A 8ADHA 3IDSA 5JC8A 3KPWA 1P39A 5E4TA 2NNWB 1NHWA 2FX2A 3D8NA 3LQQA 1Y6QA 2A1TR 4O4LF 4PG5A 2BRUA 4I50A 4D2IA 3EVBA 4GMFA 3OI7A 2F90A 3SHTA 4YY3B 3BZWA 2P90A 1EXNA 1KYVA 1MIOA 1WW8A 4UQPA 1CERA 4NZ9A 3UICA 4JJEA 4C3OB 1P45A 1W93A 5ALWA 2ZUVA 3ER9A 3FWZA 3K92A 4R41A 5FL3A 1W52X 2AR0A 1QV6A 2W7TA 3IAAA 4Z9YA 3RUAA 4HWTA 5C5IA 2IUEA 2IX9A 3F6CA 3ODPA 1PJZA 4N8EA 1LEHA 1E3WA 4RD0A 4LFCB 4F8YA 2P2DA 3GGDA 3FDJA 4AZ0B 2ZUFA 4JITA 2H7CA 4GE3A 2AG5A 3G79A 1KSHA 3UB2A 2RB4A 2J7KA 2YXEA 3IEIA 3RS5A 3PQ8A 4TT3D 1QHSA 1I9GA 1QKJA 2AN1A 1YB2A 1H23A 2VF8A 3PJFA 1B4DA 2D1TA 3VI3B 3VR0A 5ETJA 5ITSA 1SKBA 4QBIA 1WY5A 2XZOA 2VF2A 3LDFA 4FCCA 4N4AA 3R75A 5JWOA 2P27A 4CIYA 2I6QA 3ROXA 5JO9A 2GVNA 1NLYA 2Y1FA 1XDZA 2ZIXA 4M46A 4WOJA 3FZEA 3TI9A 1YFLA 3G0DA 1EZ1A 3H4IA 3KVRA 4H7KA 1YS6A 2F43A 5TPWA 5A4JA 1T10A 2WYHA 2IYXA 1S3IA 1D07A 3HJFA 4Y0VA 3C74A 2IXEA 4Q1VA 3STHA 4RK7A 4WDQA 4ZCLA 2I7XA 5JT1A 4TYYA 4YXFA 2NU8A 3ER8A 2DY1A 3HJTA 3CH7A 4W7HA 3Q3VA 3DZBA 3GLHB 4GD3Q 1E1DA 1L9KA 1NYQA 2AMYA 2POQX 2WSSA 3IOCA 4R8MA 4LJYA 1NGSA 1E92A 3VOSA 1BGWA 4DUPA 1VC2A 1BE6A 2VA9A 2WAAA 1DUVG 4IICA 1ULTA 4TZTA 1RPJA 1DLIA 1X1DA 3O7MA 5KYTA 1CRLA 3NOOA 3EVCA 5F23A 2C5AA 2YMMA 2QTVA 3D8SA 3L07A 4MUKA 2J3HA 4PLZA 1F4LA 3DYIA 1CDEA 1K3UB 4B2YA 5DLQC 3FOEC 2W2OA 1G55A 1ISMA 5CFZA 3QFRA 3DBRB 3QMMA 2GSWA 4OJQA 4IIGA 1GGKA 2Q6VA 4G4IA 7GPBA 4RKYA 4YLGA 1UT5A 1ZICA 4X1IB 4ZGWA 4XTCS 2ZRPA 3H5IA 4DV7B 1QH0A 2WD7A 1JF8A 2QZPA 1TJNA 4JLBA 5I7HA 3GDFA 2C7OA 1L7DA 4M86A 2F00A 5I9BA 1O8BA 5LOVA 1XVLA 4RTLA 4EI8A 4X20B 2WWXA 1PNVA 4UDOA 4CRWB 5K0TA 1NP6A 2A78A 3LHSA 1F1BA 5AHWA 3H4MA 1ENYA 3RC3A 3HTXA 3VPCA 1RYDA 1U6JA 1B14A 1E7RA 3K0FB 2FPGA 1VE6A 3OCWA 2YYAA 5I5EA 5JXIA 2HZ7A 1TA9A 4BFYA 5CDUA 3VI4B 5FLXA 4Q34A 1GPAA 1DKQA 1SZCA 4ZVOA 5CJJA 4CLHA 4HH0A 4CPDA 2F6RA 2QD1A 4EKGA 3T5TA 1CHNA 3FPJA 4DLWA 1I10A 4MUGA 5J5AA 1UBFA 4OAQA 2PKXA 3WYAA 3IO5A 4R6XA 3LF2A 1UMCB 5FV4A 3R8XA 3PHLA 2Z1MA 3TAHA 1EP1B 1NSTA 4CLRB 1YUNA 1KO5A 4YUYA 4UUQA 4CIDA 1QNLA 4BNXA 2Y67A 2ZIEA 3CE9A 3WB0A 2YZ7A 1TDJA 1VPWA 1OBVA 1KY3A 2FGJA 2ZAGA 4F38A 6ABPA 2WJIA 3UWKA 1CP3A 1ZAYA 4JQZA 1GRQA 5T67A 3P9CA 2PJUA 3ASUA 3QBTA 3ZV4A 1CB0A 2ZKIA 3AY6A 3PRKE 4L5JA 2QI9F 4P7KA 4HB4A 2A1TS 2LNDA 4GOMD 4KO4S 4L9AA 1YB4A 2FRDC 1C3OA 1Z2OX 3E5RA 3ZCXA 5CAEA 3I64A 1C50A 4FMCB 3VKGA 1CVRA 1AMNA 2NSYA 1NRXA 1PAUA 3B5EA 3OZSA 3GVIA 1SIOA 1RJDA 2Y0DA 3GFOA 1IJKA 3TL6A 3O91A 3N2IA 5HKOA 3E03A 1BE1A 3KWMA 5LXTB 3P5SA 3L40A 2DLDA 3T7SA 3VMMA 1FRNA 3IAS1 3QUAA 4P2BA 2FW9A 3L1HA 3N1UA 5KINB 1Q77A 4EHKA 1G20E 2C2WA 4RE5A 1KHHA 2ZBPA 1TJ5A 1VE3A 5EKTA 1AE1A 1H8ED 3RADC 1OU0A 1X1TA 3CMCO 3LKDA 3M6MD 4KWEA 5EXDA 4JS0A 2KM1A 2P9CA 2R7KA 2HRZA 3RTEA 2RARA 1JYEA 2PANA 1P1RA 3S40A 4PIMA 1Y8AA 4QKQA 1XAIA 3TECE 4YJ2A 1PNQA 4NCJA 1JECA 2XNKA 1DDIA 2F48A 2HJSA 1NUAA 3H65A 2WIGA 1Z4JA 4DG5A 2P4EA 3K9GA 4RH0A 3A9CA 5EUBA 2YHBA 1YBHA 2QRLA 2CYCA 1O96A 1KARA 3ZZ1A 5HMMA 4QQNA 3KJZA 3HB1A 1Y3BE 1R16A 1RZRA 2P2SA 1QO0A 2VNKA 2WABA 1UC9A 2H1FA 2G1KA 3PR2B 4L75A 4ZO6A 4AULA 3N0VA 1G1AA 4A9AA 4BJHB 1G6OA 5L3SB 3VGJA 5FUQA 1PJTA 1R12A 3DHYA 3AIKA 2FHSA 3GGGA 1RKVA 4I50F 2RHTA 1E2NA 1L8XA 4EENA 1JXOA 3LC0A 5J59A 5BNIA 4CMHA 2H3EA 3HA2A 5DCYA 4URXR 2FP4B 4INJA 5DGXA 2UVDA 2QUHA 5D3MA 4GM4A 3BHNA 4FZ3A 1VKHA 4NYMR 3QKRB 3MD9A 2Z2JA 3RS4A 3BMNA 1TMGE 5K8IA 4BGVA 2GRJA 2WOJA 4H7JA 3B2QA 1DCFA 3NPMA 3OF3A 3TOZA 4L28A 5CIWA 3WYGA 4EYSA 1CD5A 3TH5A 1DJLA 1GZ3A 3PI7A 4OA5A 3WZ2A 5K3FB 2H5LA 2B30A 3N87A 4LZPA 1UAYA 2MJLA 2WB2A 1VMAA 4HLDA 4AXXA 4AECA 4BGUA 1JB9A 1TW3A 1PFUA 3RROA 2PPVA 4XWTA 1DIAA 1WTAA 4BFXA 2XVZA 4EO7A 2WWHA 3AVPA 1G66A 3CWZA 1R00A 1J1IA 1A2OA 1UK9A 2LV8A 4XJVA 4AYTA 4KFCA 3OZ7A 1EGMB 1D04A 1UBMS 2QZ9A 2ZKLA 2XGGA 4S0XA 2Q7XA 4S1WA 4Y2QA 5KAMA 4B4VA 2OCKA 3FSJX 4F91B 4ENVA 3ZCRA 2XKJE 5AESA 2I99A 2A3RA 4IL5A 4E51A 1OLSA 2BY4A 5DGCA 1BW9B 2QN3A 4KK3A 3ZDFA 2P9FA 5JE8A 2ZRQA 4YAOA 2J0UA 1V48A 3X1XA 3WO0A 2FPUA 4PN3A 5SV2A 2XZPA 3EGDB 3T7AA 2AQ8A 5T4EA 4PXYA 3RRFA 4EWLA 3QVGB 2VQSA 1SVMA 4Q4JA 4C21A 2OHXA 2WQZA 4R3UC 3GROA 4HQNA 4HMOA 4P9NA 3IBTA 2A0YA 3L05A 1NXQA 2XTJA 3DTVA 4PX9A 1KEVA 1V1MB 2RGNC 3G82C 3H9CA 3NHPA 4JUDX 4ASUA 5JYEA 5KOIA 1EM8A 3OFNA 3UJAA 1Z6YA 5JALA 2VPPA 2C82A 2G17A 3H5VA 1UQRA 5ALIA 1D2GA 4IDBA 5A3QA 2RHCA 2XWBF 4UQOA 3RSSA 4NR0A 3GLFE 4DNXA 2J5RA 3CLSD 1YR2A 2VTVA 1R66A 3OE1A 2W2MA 5EZSA 4PONA 4Y6SA 4C4YA 4D26A 3EWSA 4HWSA 2WP8J 4KQCA 1KHTA 3TZ6A 3KKMA 3TM4A 2VA8A 3C97A 1EB9A 1XN4A 4LQDA 2IFTA 1GZ5A 1A4RA 5D1HA 5BNTA 2ACVA 5I4BA 2BH2A 3DH0A 4BIMA 1N5OX 3DAFA 2VF4X 3GOQA 3MQ4A 4OQQA 4XGRA 1JHUA 1Z2NX 1OT3A 3SC6A 4WESB 4LBVA 3QE4A 5BMVB 1ZHOA 1G2QA 2D54A 2PKYX 1TTQB 1YXMA 5LOVF 4M54A 2VUSA 1L5YA 3FNQA 3AVOA 3LQYA 4BDTA 2BFDB 1EFLA 3DL4A 5JEDA 5FHQA 3U1TA 1C2TA 3EBPA 4AF6A 5MFPA 1XHFA 2XWJI 3PZBA 5JAOA 3Q9NA 2V7XA 4I4NA 2HDHA 1NVXQ 4B17A 4D4IA 2QVZX 4HS9A 3VZCA 1PL8A 3AERB 1PL6A 1J0BA 1LGYA 2OXIA 1M7GA 3Q1KA 1K92A 3QA9A 4MWCA 5C1BA 1L5ZA 1TKRA 4ZOBA 3TQSA 1YQDA 3M9XA 5FPPA 2GAFA 2PA3A 9LDTA 2WHRA 2X7XA 1QLWA 3NVAA 1W9HA 1LQ2A 1MB2A 3WLPA 5LU9A 3RVBA 2VRCA 3T6KA 3NT4A 1MXHA 1MAVA 3M4ZA 4BNUA 3JX9A 3WBFA 4DG8A 4NVRA 1Y6GA 2H8GA 1V7ZA 3K53A 2V0CA 1LPOA 1AM4D 1MVOA 4ARBA 1MUUA 1W36B 1YDWA 3DE7X 5GGYA 2DX7A 2JBHA 4RD2A 3BREA 4JYAB 5FPSA 5TQ0A 2GD6A 1WUHS 3GG2A 3LHDA 3P96A 2HBZA 1UXHA 4RLHA 1SRRA 3W6PA 3GQBA 5BSGA 3ZLVA 4JYZA 1OLXA 3A9WA 4G5HA 3KNZA 1XJCA 2H54A 1Z7YA 1F6WA 3H9JA 3ZK9A 1MBZA 1KBZA 1P4RA 1JQJC 2VDOB 3KT0A 3MVEA 2G1UA 4FHCA 4FOLA 3SKYA 3VDXA 3TX6A 3GGSA 3L82B 1YQEA 4M1OA 1P1BA 3E9QA 2HHAA 5LWHA 3ZWNA 4I6JA 2R86A 1ECJA 5FOSA 2V6IA 3WHKA 5U4XA 4YV1A 2EZUA 4R16A 4KN9S 3VAZA 4RH3A 1EEHA 4UTPA 3AIIA 5CXQA 3UT5B 4HX9A 4Q01A 3LW7A 3JWJA 5H16A 3KL2A 3SC2B 2WF7A 3TLKA 2IU3A 1OXBB 4NEGA 2JFUA 3CF4A 4UU0A 1QGOA 3BWBA 3BILA 3VH1A 2QSZA 2VJBA 3WRYA 1HI9A 3D6AA 3K0KA 4FQ5A 1WZEA 2VJQA 4MH0R 4QVGA 3UMBA 2QVXX 3N6VA 3W7BA 4AKSA 3TLXA 4E7OA 3FYDA 5FO1A 2ZYAA 2GESA 1JJAA 1GARA 2ADFA 4I5EA 1APBA 1VMEA 1B0PA 1WDTA 1X14A 1X7HA 2B9VA 4V2IA 3STTA 3ZBUA 3WE7A 5AVYA 5JXGA 4UEJA 4Z99A 4DWOA 2HK7A 1XNHA 4KQMA 2ZULA 2XCOA 3IEXA 4YJ2F 2Q27A 1IOZA 5LQUA 1YONA 1QYRA 5JZMA 1P7WA 1L3CA 4Q37A 3NYIA 3D7RA 2OR3A 4DIEA 4XTRA 3GEMA 4KVZA 4OBWA 1J5XA 3S2YA 2CEKA 5BOSB 1KI6B 1XD2B 1VFNA 2JCGA 1QQ6A 1JT9A 5T57A 2CXOA 2B35A 4Z7NB 2BL4A 2GHQA 5I01A 3KVVA 2ZTUA 2J0EA 4F8JA 3EVTA 2HA3A 4XUCA 1VP9A 4OO3A 4Y2YA 2ZYDA 3AU9A 2JGAA 1V16B 2B94A 3P9PA 4L3OA 621PA 4WOKA 5AKEA 4ZI5A 4EB8A 1HA3A 1L4GA 5B64A 4JA2A 2AFRA 3ER6A 4ALJA 3Q10A 3OTIA 5IS2A 3L4JA 1QR2A 4MP8A 4B2PA 1BEUB 4YUZA 1KFCB 1O89A 5ESWA 5FP0A 1IWPB 3RJ5A 2PR2A 1MB3A 3GRVA 4JP2A 3FRIA 4H7EA 4AWBA 2D06A 2JJ2D 2PRZA 3DMRA 1HY3A 2XOKD 1JR3D 1CY8A 1RLIA 4ILEA 3G9QA 4M0PA 3V2HA 3IJEB 3LIIA 4AJ4A 3PQFA 2BR5A 4B76A 1Q84A 3T7CA 1R15A 4GR5A 1TLFA 3OJEA 3O2QB 4URWR 2RKBA 4FHZA 2W2LA 1RP1A 2DTEA 2PMDA 1KMMA 3RU7A 1RXEA 4FM9A 4PLGA 4KLNA 3WMEA 1YUMA 4N3GA 4P83A 1MJGM 2XCSB 4YRLA 3EF1A 3Q9SA 2Y1OA 4W8OA 3L93A 4WEOA 2ISQA 5CDSA 2GASA 3A2LA 1GL6A 1ZA2A 4UUAA 1ISGA 3O7WA 4ZT7A 1V9SA 4YROA 4YMLA 2VBCA 1QRTA 1KZ7B 3LP6A 4G0WA 3IVRA 3NALA 3VR3A 3KYIB 1E9AA 5TV2A 4S1PA 1QHNA 1DRJA 1Q20A 4BWYA 1CZHA 1HWYA 1WUYA 1L6RA 1Z75A 1XU9A 2OGWA 3IQDB 4R9VA 1VJDA 4RNCA 4B82A 2VP4A 3E8MA 3IB6A 2F64A 3CUTA 3C5EA 2IT1A 1PDWA 3C3BA 1XTQA 4F4JA 5I47A 2O3QA 4C4PA 2C5FA 4J7XA 1KJYA 1DIHA 1RYBA 2ECFA 3DP7A 1Y1TA 3DWFA 1OILA 3HBFA 5DTMA 1YV9A 4PO1A 5FWAA 3REFA 5P21A 3IQIX 2V58A 1KXJA 1MHTA 1DCKA 2RG7A 4IS2A 4I14A 2WLSA 1MQ9A 1P44A 5DYWA 1BS9A 1U98A 2QL5A 3QW4B 1IQ0A 3F1LA 4BTLA 3MWFA 4DBVO 1DS6A 3SKVA 3WZMA 3PNSA 1FW6A 3K0EA 2Q8NA 1H22A 4OQLA 3ZDDA 1I7LA 1LA2A 1PS8A 2RSLA 4JL8A 1ETHA 3QSYA 2AFHE 2R8EA 1NXOA 2AEEA 5IG2A 3ZIAD 2QG6A 3GGCA 3P0HA 3A7EA 4CM5A 2YKGA 2P3SA 2CF6A 2TECE 1EQUA 4MDYA 1QOZA 2ZJ0A 3G59A 1YRLA 4MS3B 4FHDA 2C59A 3N5CA 4O4JA 3U1VA 3QFFA 2JVKA 3UKOA 1QCCA 2FY8A 2VK8A 4CM3A 3QWBA 4IKOA 1MOSA 1GU7A 3ADBA 5C4IA 2HSWA 4BNWA 1YQ9A 1M2FA 1ZJ5A 3AT1A 1RCUA 2YRWA 2P2LA 3OU2A 1TAHA 2E6KA 3EXFA 4KEAA 1OKKD 1AZTA 2X3FA 4EY8A 1J0AA 1KP3A 1GQYA 2HREA 2J3LA 2L19A 1BJRE 3BMQA 3I5MA 3ITKA 2OORC 4G3XA 5HZKA 1W36D 2ID4A 4D81A 3Q2KA 5JRDS 1SD5A 4G0YA 1ZOLA 3GNLA 3QELB 1ZJWA 3QVKA 4R7GA 4KXVA 2P9EA 3GWGA 1B3BA 4WOBA 4O0MA 3RSGA 4AJ2A 1R0BA 4XQ0A 4BX2A 3OX4A 1ZM4A 1KOLA 1O97C 1MR3F 3C3WA 3ORFA 3AEUA 2SCUB 3NT2A 2I3DA 4DIUA 2WWTA 3AUUA 4V0NA 3IA2A 2MMCA 3BT7A 4N6NA 4DCOA 4FD2A 2HQSA 3TMAA 2AFIE 4HUTA 2REXB 1QIJA 4NMHA 4CUZA 5A1TA 4C7OB 1SHZA 2ZGVA 3E1SA 1W94A 3C6KA 3I9FA 3KSZO 4DLUA 4X1KA 3K35A 4UE6A 4WPGA 5K4AA 4BP8A 3AVVA 3SVLA 4ZRNA 3T7DA 4DSUA 3EG5A 4DM7A 4WXPA 4DLPA 2NX2A 1OYYA 1V47A 1ADYA 2H11A 4DJEC 4UFNA 4N39A 2ATEA 2Q3BA 2YWXA 4LX8A 4CTKA 5CITA 5DLDA 3PDWA 3LWNA 1PYDA 2JHCA 4BJ5A 2HO4A 2YS6A 5AICA 4HUJA 2DBZA 1H4VB 2ZROA 2ZS8A 1NVBA 1TVKB 3A6KA 3KAKA 3D6JA 3C4JA 4NOKA 3LZCA 3OWXA 4GZ3A 5EE3A 3AFMA 2QTFA 4BCBA 1KDOA 5JNUA 3A70A 4XUGB 5CTJA 3THWB 4K81B 3RUHA 1VSVA 3TFWA 3ELBA 4LV6A 2Y27A 2OGUA 3F7TA 5EJAA 5KYXB 3BBPA 3V9AA 2CNOA 1ISHA 3K5IA 3ZVKA 4C05A 1YQXA 1W1WA 2DFDA 4D0SA 2QHXA 2HLPA 2W58A 3EDCA 4IOJA 4MTLA 3T5GA 1UPCA 1KVRA 2DMRA 2GA8A 4HN9A 2HCJB 2ARKA 2ONYA 5DW3A 4RZ3A 2B37A 4MIEA 2AXNA 3T7IA 1VIMA 3A3NA 4YUXA 4F92B 1PR4A 1XVIA 2VJKA 1PS0A 2YZKA 4MS4B 3AUFA 3TZHA 3SJZA 1J25A 2P0YA 4XGIA 4NXNB 3TPCA 5BN4A 2OK8A 2PLNA 2C31A 2FPWA 1YD7A 1LNZA 2ZJAA 1XTZA 3Q6NA 4WINA 5FPKA 2UXCB 4RXMA 1N2OA 2CHEA 3TLJA 5EJFA 1Y9AA 3EC7A 1DO2A 2FKAA 1IPHA 3G1TA 5DNDA 1CVLA 3ZWQA 1Z2PX 4BWFB 5JAIA 4Q3LA 2W42A 1L4HA 5J9FA 3PQ6A 1G98A 2F55A 2C7VA 4PXSA 3F9CA 3BMCB 4P98A 3R0IA 5A7HA 4B85A 4AP5A 4YCBA 4WUVA 2LW7A 1S02A 4MV0A 3UAXA 4MP3A 2PLAA 4ZI7B 4RY9A 2C1EA 4L85A 4E12A 1XZLA 4MCIA 4H0FA 1PEAA 4MW5A 4BQNA 5JCJA 5B58T 2ZTHA 3QX9A 4LWQA 1PSWA 1XNJA 3TKAA 1MTZA 2E7ZA 2NZ2A 4FFBA 1ZA1A 5LBTA 3DF7A 1HNXB 3Q0EA 3QX3A 3PC8C 3U4QB 4U02A 4KL8S 1LKZA 2W6MA 4L3WA 3SBDA 2BMWA 4JMPA 2FZ4A 1QCDA 3A1EA 2FUNB 4Q4DA 2O59A 3DO5A 3LA8A 3OESA 4HLNA 3BE6A 3UB4A 5I51A 3DMPA 4R7TA 3QNMA 1EUQA 2KS6A 3VDMA 4NV3A 4IEEA 4K6FA 2GF2A 3D64A 3K32A 4RESA 2IS1A 1X8XA 2P35A 2ZVJA 4U0JA 2FE4A 2P9BA 5CA0B 6PFKA 3I34X 3KSAC 3L7YA 4QUKA 2QZSA 4RGQA 4CV0A 4J9VA 4ZOEA 4L8WB 4E11A 1VCHA 1TFRA 2Q6OA 1V3QE 5D7NA 3EZYA 4QQ8A 1R9MA 3I58A 4MVJA 3FIJA 1JX6A 3P32A 1LRKA 3CLKA 4BVJA 3ZLTA 2V97A 4D98A 4QLAA 4GMXA 5E4JA 3TQIA 3X1YA 3VR1A 1W0JA 4XWAA 3TTSA 4DR2B 1HFKA 1GN8A 4L3VA 2QMOA 3TQHA 2IPAB 3DHWC 5KYUA 5EJ6A 2D4HA 3GP5A 1QZTA 2C0CA 4P8RA 4POOA 4Z86A 4JP1A 2C7GA 2I7DA 2PFKA 5JARA 4YDSA 2JJYA 2GRUA 1FRQA 4W63A 5B1HA 5EP1A 4CI0B 4E22A 2GM4A 1T13A 1R6AA 2IKSA 1KS2A 2VP0A 3BUSA 5CM9C 2Q6IA 4F72A 4HRXA 5AXBA 1C0KA 2J09A 2X2PA 5JJ5A 2C84A 3FETA 4CKEA 1JNXX 4QREA 1EAMA 2I6GA 5FXMA 2O4UX 3AWIA 3SZLA 1RAHA 2ZUEA 1X13A 4ZIRA 2AFVA 1NJ8A 4AMBA 5JCOC 1BS1A 1WSBA 2WVJA 3CRZA 3IAHA 1BYUA 1ZGGA 3O73A 2PLFA 3CTMA 2B8NA 4JCCA 4M1QA 2WV7A 4R01A 5P8WA 4DCMA 1Q1NA 1ZVKA 4Z2AA 1ZO8A 1E9EA 1DIGA 2QUBA 1N9GB 3HA3A 4TM8A 4X93A 3WV5A 4CM4A 3WLKX 1LBTA 2YWJA 1H2YA 3E5HA 4YCLA 5ELXA 3AL0C 4BEBA 2Y1WA 3PUWA 1KYXA 3ESBA 2AN3A 3PR1A 3MMNA 3GQVA 2PMBA 4ENUA 3JVIA 3JYQA 4YFYA 2E5FA 1BWRA 5E9QA 4O4JF 1P3JA 1PT8A 4ZK2A 3PXXA 2GPBA 3PCTA 5HJ5A 2QQ0A 1KYTA 5DRYA 5JS7A 5BV8A 4D1YA 4TN1A 2QJRA 3QPBA 4R98A 1KE1A 3U49A 4EDHA 3KEGA 3UJ9A 1I5RA 4KGDA 4MB0A 4O6VA 2NUTB 4FYWA 1HFEL 1SH7A 5ALDA 3X2FA 4L1KA 4MRMA 3UAVA 2W6CX 4DMRA 4EELA 2VSQA 2H7XA 2IW3A 3BXXA 3JQFA 4UU1A 2Y9MB 1DRVA 2CHGA 1V45E 3UJBA 1ZIDA 5ECWA 3EIWA 2ZYHA 3GRYA 1Z2CA 4N9QA 1SG0A 3UJCA 2WU0A 2JGJA 1F2UA 2LD4A 3I6BA 1E2BA 1IZZA 2M6RA 3UK2A 1H2BA 2QVGA 3DLBA 4DUGA 4N0QA 2VBGA 2OC4A 5KTTA 3U7JA 3U0BA 4V39A 1BO6A 1IATA 5AHOA 3E70C 1UDWA 4Y6PA 3ZD6A 1T9GR 1PP4A 3E61A 5C1DA 1NIJA 3FSGD 3HN6A 3GPBA 5AK0A 5F33A 3IGFA 3NBQA 3P19A 3OF2A 4D82A 1FFCA 1FQWA 2HZBA 1ZGAA 1ARZA 2X8BA 1NMXA 1WXIA 3JARA 2XRZA 2CN1A 2HSZA 5K3BA 2CXXA 1JDSA 3OTQA 4G97A 1A4UA 2AXPA 2B9EA 4RVOA 4B6EA 4BN4A 4F04A 2PTGA 1YR9A 3CQ9A 2UU9B 3IJRA 2IE0A 4BN0A 1FFXA 2AB0A 1K9VF 3E53A 2JJ8A 3QKWA 4GYYA 3SXUA 4C08A 4C5AA 4ZHSA 4RCZA 2B7CA 1WBBA 3GFTA 1G3RA 2DQZA 4JXXA 2Q46A 2DHEA 3IIKA 4FHFA 1YQWA 4AP9A 5K4HA 3PHHA 1I13A 1XZPA 3CGGA 4LHVA 2DFLA 1VG0B 1NY5A 3GLGE 1WHTB 1DAIA 3CC8A 3GUZA 5EKSA 3M70A 5EGNA 1DRKA 3VU9A 5HBRA 3FMIA 3GP8A 5HHTA 4ACBA 4ETNA 2G8LA 2ZTVA 1BOFA 3AR2A 4LCJA 1PLKA 4LY0A 1ZD3A 5JSYA 1E7SA 3ZTTA 2I8AA 4ZVNA 3TOVA 5CB4B 5IAOA 5IWCA 5GADl 3QJGA 3DCJA 5KAPA 1Y8RA 3M2TA 3IVCA 3UXHA 2Z3ZA 4NH4A 2XMCA 2Q28A 1M34A 2GO7A 3EXIB 3RYIB 4LZZA 4EUFA 2JLAA 1QP4A 3EIUA 1JDPA 1NUUA 4NEHB 4US0R 3UFXA 3PNYA 3N2GA 4B87A 2AG8A 2C57A 4HDMA 1GQ2A 3V7NA 1PVVA 1X7ZB 2H6EA 1XMIA 1Q7RA 1BZYA 1CFZA 4X6XA 4YJFA 5HILA 4MNTA 1Y80A 4BBJA 4UNRA 3STYA 2C2ZA 2QZJA 3RVSA 3U48A 3PNKA 2I8CA 1P3DA 4M88A 1WV1A 1PEKE 3G5TA 4KO3S 3GAMA 4XM2A 5DASA 3NH6A 3CZCA 4D44A 5ARBA 3RJZA 1DUSA 1A8UA 4IXTA 4QGFA 1A97A 1F4PA 5JPDA 2GPAA 3EZNA 1QF9A 3CKMA 3JWEA 3LCCA 4LOKA 4MV6A 4X63A 1BX0A 3LCMA 5EQDA 1T8YA 4N0DA 2Y3IA 1MJ5A 2AJ8A 4DA8A 2HB6A 3KSMA 3RVNA 1OHHD 1U8UA 3D0RA 3LO5A 2ZIAA 5ADUS 1HE5A 5FORA 1Y37A 1EQAA 3GEPA 4H60A 4HFJA 3TW6A 3VJMA 2BHNA 4B44A 3JALA 3SXJA 1ADBA 2UUAB 4E5UA 4E13A 1JYFA 5C35A 2C2BA 4JI1B 1MGOA 3ZD9A 3MWDB 1NW6A 3ND5A 2QDKA 4EA8A 3GU3A 1MMFB 4MVJF 3HZZA 3PQ4A 4ZT3A 4C07A 4R2IA 4DA9A 1A2KC 1OVMA 1LWNA 3K70D 1Y7IA 1G7CA 1ZI9A 5EMKA 1E6EA 3FXAA 1ZH6A 2E85A 1H9AA 1LV7A 3C7DB 3O4HA 1H3EA 2UXBB 5DHUA 2HA7A 4LOHA 4D46A 1S9HA 4RWZA 1SM4A 1WA5A 4M8KA 3GFBA 4GI1A 3T06B 2GBGA 2WMNB 2R5WA 3O3OB 1FOEB 2XDQA 1MB4A 1CUYA 4F3KA 2JLSA 2CJYA 5CUQA 2A84A 2B4YA 5AJZA 1JFSA 3AETB 3BWXA 3PG5A 4HXGA 3MBOA 1LSOA 4KIWA 3VNQA 3RK4A 3P0EA 1XCLA 1LRJA 1JDZA 2G5GX 3ETDA 3VMFA 2W37A 1X7YB 2HDNB 2QYOA 1T9GS 1ZD2P 2X8AA 2CE7A 4JLPA 3JCZA 5TNXA 2VOJA 4B6PA 5A06A 2ZWPA 2FLWA 1K68A 3N7UA 5IU6A 4KGVA 3UPTA 1OU4A 6AT1A 4JUFA 5FKJA 4C76A 1C7FA 3WB1A 1N2SA 3VZDA 2PRYA 1A8PA 5DCWA 3K15A 4X92A 4AJKA 5I8ZA 2X0IA 2ZUSA 2X5JO 4PWZA 1JE0A 4IDQA 1HYGA 2VO1A 1OTYA 2WDPA 2IH4A 4UBMA 3FFBA 2B61A 4MLPA 1LD3A 3AJDA 4OVKA 1JAIA 3ECSA 1P2SA 4KQ6A 1EDOA 3BX1A 3IR5A 3ZLBA 2GPJA 1WXFA 4QZVA 4GI5A 4QNMA 3K6SB 4C0KA 2AWOA 4DR3B 4YMHA 1U1CA 1ZJ4A 1E6WA 2VAPA 3UA3A 1N2CE 1U7UA 4IMIB 4R69A 3FFTA 4Z4CA 2E1RA 2ZCJA 4L8LA 3IQGX 3I3OA 4G8DA 4HDQB 1Z22A 2CB0A 1HORA 4Q9IA 5JDIA 5IYZB 3ETCA 1VKOA 3EA0A 1CIJA 2OILA 5D87A 3USZA 3AL2A 3JPYA 5JYBA 2H2IA 2Q2QA 4LSGA 1SGWA 3JRXA 4Y1FA 2Y1GA 3NNDA 2A88A 1NONA 2IOFK 4D9KA 4DCPA 1CULC 3IVMA 5I7UA 4H3KB 1QYIA 5EYPB 4IS3A 2R8BA 4GPD1 4EP1A 2BT4A 4LG1A 1JXAA 2EYUA 3ZC3A 3O8NA 2VJMB 5BRJA 1IHOA 1USWA 3ZVLA 1N2JA 3CJTA 4D4LA 3E7DA 3LPNA 1A71A 5DX1A 4YR7A 1GY8A 1RAIA 5J47A 2FZWA 1WF6A 3IMEA 4ESHA 4O02B 5KU1A 2M32A 3D6VA 1GTRA 5EHIA 4DDWA 3WK9A 3RJMA 2UZIR 4MW9A 4BNGA 5JASA 1WF3A 1DWUA 4PZCA 2D74A 4H2DA 4NPAA 5CURA 5DTEA 2NUAB 1WM1A 4X8LA 3ZE6A 2ZU6A 4AJJA 1NT4A 1EVQA 2Q3JA 3LFTA 1EK0A 4HNSA 4R1MA 4NDNE 3MLBA 3O6VA 2H1RA 2GKGA 2O2XA 4D8XA 2C5GA 2HWKA 3MSXA 2HY7A 4D9MA 5MN5A 2XE7A 3HUUA 4XIIA 5DN6D 3FJOA 3V97A 2NSHA 2Z3WA 1MXFA 1IBLB 2VYVA 4U00A 4G09A 3OUUA 4Q3DA 1KPHA 1U8XX 4YRAA 1JQLB 1T29A 3EF0A 3F9IA 4LSWA 4B6FA 1BMTA 1GRNA 2GF9A 3MJHA 3HFGA 4CEIA 4MQLA 4PAOA 5AOCA 2PO7A 5TMEA 2A1IA 3ZU4A 1UK8A 3WGNA 2AI1A 2WIFA 3LC1O 3QVWA 4OB6A 4K9PA 1ZGJA 4X65B 4DJJA 2M98A 4A03A 1SCIA 5K2OA 1SWWA 1AK1A 4R1LA 2JGDB 4BCDA 5LSAA 2O1WA 5FOTA 3RYCB 2Q3HA 1MA3A 1R0YA 3G2HA 4EPVA 3ZDBA 3VTKA 1XCJA 1SBQA 1GZUA 1FFEA 2PD6A 1ADJA 1U2DC 2BHRA 4FEEA 3DV0A 3IULA 3HKCA 1YL5A 1FMCA 1T9AA 2X5OA 4B7XA 2IX3A 3AI3A 1YJCA 4OIMA 3AVYA 1M2HA 3GL9A 3NUGA 2YBEA 1JJBA 1XYGA 1I1NA 1T0UA 2JHFA 1ZD8A 1RVV1 2OFXA 3EB9A 4G1EB 1JHPA 1X0VA 2DFTA 4EEKA 1R0KA 3DYVA 4GBED 3ROGA 5KUTA 1ORTA 1L7EA 5C31A 5EJ4A 4ECEA 3DTYA 4C7MA 1Z4MA 5HCNA 4CQJA 1QZ3A 2WFAA 4KQ9A 3HGMA 1JG2A 4R5HA 3B82A 1CUXA 1OGIA 3ICOA 2NUPB 3L7CA 4F6RB 3FYTA 5TVKA 3H1AA 4YFVA 2Q6LA 1HNWB 1G9SA 1KEPA 3DHNA 1R2QA 1OB5A 2AJCA 4HDRA 3VPXA 3FUTA 1MB0A 1XZNA 5CPBA 3C8DA 3I6YA 4YQZA 3HABA 1D6JA 3OZBA 2Q2WA 2W22A 2NSJA 3HA5A 1IIRA 4I2NA 4GBGA 1D2RA 3RLFA 2QT9A 4PV7A 2CXPA 2R96A 1XR3A 2ORED 4XB1A 2Z58A 5CXSA 3WADA 4EK9A 5IJ0A 4KQJA 1J2RA 2J32A 1PQPA 3I04A 4W9NA 2OOSA 3JAKB 2BFWA 4ES6A 3ZDCA 4YMWA 1CU1A 1BDBA 1Z12A 2FPRA 5HS4A 4HDNA 3L1UA 2ZPAA 1LBEA 4OV6B 3E82A 4UEWA 3FWPA 3B52X 3FDZA 3OBIA 2CB9A 3D4LA 3DWGA 5C7YA 3ETLA 1PVOA 1LS6A 4I1UA 4TXHA 2FSVA 5EPOA 1UKZA 3WSWA 3FFWA 4ZYXA 1B6GA 4LKRA 2OGSA 3BCUA 5TJHA 2FRDA 4ZV7A 2O3UA 1GXSA 1FDRA 1T4CB 1XD8A 3DMHA 4BTEA 4N3NA 2QRVB 3M6XA 9LDBA 3KZOA 3X1KA 2HL6A 3UJDA 4BAGA 4BRWA 2QT1A