4Q00A

Crystal structure of an s150a mutant of the e. coli feob g-domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
255
Chain Sequence
b'KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAERKEGQFSTTDHQVTLVDLPGTYSLTTISSQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVATRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Exploring the correlation between the sequence composition of the nucleotide binding G5 loop of the FeoB GTPase domain (NFeoB) and intrinsic rate of GDP release.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 85
structure length 255
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q00A01
5KYKA 3ECCA 1JJ7A 3P1JA 4TLAA 2FMXA 1HT2E 4IFEA 3BS4A 4TN1A 4ZIRA 5HR5A 1T5IA 2BHRA 5JECA 2C78A 3A4NA 2JLUA 4A0FA 4HSEA 2OO7A 2FF7A 2G9NA 2B7CA 4JLDA 2J7PA 4DLVA 4DDWA 5KOYA 4M9XA 1TPZA 2WBLC 1OPXA 4OK3A 5KPDA 4C0QC 3K0EA 3FFAA 4MYHA 1YZGA 3OIVA 1ZD8A 2GBLA 5FFMA 4TLBA 3TRFA 3AQ4A 1D5CA 3QXXA 1KO7A 4RY2A 1A82A 4HB2A 1X8LA 2HJGA 1E2QA 4JMPA 4UJ3A 1H65A 1ZM2A 4JBWA 1Z2AA 2A5DA 4X8OA 1E0KA 2WWGA 1SKYB 2Z4SA 2FGKA 4F93B 2JLVA 4CEJA 2WVJA 1KSHA 1Z6GA 1M2OB 2O52A 2OCYC 3MRSA 3PENA 4A2QA 1BMFA 3K1JA 3GJ4A 3QVUA 4PPNA 1Y63A 5J40A 4DIEA 3LW7A 1ZAKA 2ERYA 3IHWA 4A0RA 1IN6A 4OQLA 3QENA 3VNVA 5CITA 4LOAA 1TQDA 1A7JA 2OBLA 1IY0A 4TYYA 1COWD 4Q4JB 4LJAA 4XVQA 5K8UA 1ZNWA 4IEEA 3TIFA 2WWXA 3UIEA 1AIPA 3MFYA 3AKDA 1VG0B 1OH7A 4LV5B 3SFVA 4GP7A 5E4FA 2IYUA 3AP1A 1T6NA 4UJ5A 1G21E 3W8RA 3RS2A 2W6ID 3VHLB 1G7SA 1G18A 3LAWA 5A0FA 2BCGY 2F3TA 3W90A 2B6HA 1M7BA 2YC4C 3CM0A 4QGHA 3VMFA 5JWOA 3T1TA 4QBGB 3TUZC 1OB5A 4PHTA 1G5TA 1VG1A 4M21A 2Q3HA 3TK1A 3QKRB 5JCZA 2ODEA 1XJ0A 1AN0A 1RRCA 5E7IA 1KO1A 2VSXA 1LY1A 1RJ9A 3ZS9A 1OH5A 1P2UA 4Q5IA 4XH9B 2GAAA 1NJGA 3DMDA 1MR3F 5DYIA 2VHCA 1ZC3A 1GZSA 5BN5A 1N5IA 1LFDB 1E2HA 3O8BA 4NYJQ 3EZ7A 4Z54A 2V1UA 1C4OA 2XGJA 1T0HB 2I4IA 1QVAA 2JLSA 2YKGA 1AGPA 4TTQA 3WXMA 3P26A 2F9LA 5EP4A 4KVGA 1RC8A 1NBMA 4TTPA 3CRRA 2IUUA 3A4LA 4NHOA 4LHWA 3UG7A 3WBKA 4P4SB 4TYWA 1N6LA 2O8DA 1HH4A 3T5GA 3ZZTA 1VECA 1EX6A 1HV8A 1IHUA 1G7RA 3IO5A 5FUYA 3ASZA 3GJ5A 1SXJB 4NCHA 4B32A 1R0WA 4GZLA 4DKXA 4ON9A 2AFHE 2QT1A 2OCAA 4KO8A 4YXWD 4BZXA 4I1OA 4B2IA 4BLQA 1W36D 4DB4A 5LB2A 5FR2A 1F5NA 4PTLA 1J7KA 3MGCA 2IUSA 2ZANA 2JDID 2IYYA 3K09A 2VQSA 1G8GA 2D3WA 3AVWA 3NKVA 1CR0A 4AYXA 3P4XA 4CEIA 2ZJZA 3RVBA 4K46A 1LF0A 1W2GA 2W6JA 4AYTA 4LRWA 4IOKA 3QXCA 3LBNA 4Q1CA 1Z0AA 2NIPA 3AP2A 2IL1A 3BFVA 3X1DA 4B6EA 5J4YA 2IS2A 5EZ5A 1ZU4A 3ZLJA 2RGNC 2V54A 3PG5A 1KJWA 4URWR 3GP8A 4KVAA 2P5TB 3EASA 1OLOA 1W4BA 1XBTA 3L82B 3GLGE 3ZQJA 2ZI9A 2X77A 5FTJA 4BFWA 3QUSA 4QGAA 5G3ZA 2CLSA 4QOSA 1P2VA 4HLCA 4NCNA 3A4MA 1KGDA 1R0ZA 2D2FA 2E1RA 4UNPA 721PA 5AUNB 4IDNA 2WKPA 3DM5A 3TMKA 1F2UB 2BV3A 2V55B 2J7PD 2Q3MA 5CJ2A 3R7WB 2ZI6A 3NTUA 3K70B 1ZYUA 1AJEA 3KDSE 2ONKA 5DSZA 4O3MA 3X2SA 1XEFA 2A3RA 3RS0A 4D0GA 2X8AA 2CVFA 3C4JA 3G82C 1P4SA 4NCIA 4FWIB 4A36A 4A2WA 3KKOA 1D2NA 4ZKDA 3U6BA 1ANKA 1IQPA 1YZLA 1SVMA 4X8HA 5EE3A 1ZP6A 1Y3AA 3SQWA 3DZDA 5KNDA 3I32A 4RKEA 2EFEB 1WQ1R 3QNUA 2KBEA 5JWHA 4JBXA 4O2LA 4UQOA 4D2IA 1HURA 1MABB 4CEHA 3BAFA 5CIQA 4QGFA 1BMFD 1JQJC 1XFAA 1US8B 2N42A 3OE7D 1OYYA 1U94A 3I3SR 4KXFB 5ANRB 2D06A 4FIDA 3T5DA 5FOUA 4B35A 4O2RA 4I99A 1P7CA 3AKYA 3KKQA 4F4CA 2MSDB 4EJSB 1S8FA 2ORIA 3EZFA 1XNJA 3K0AB 1KJYA 3CIOA 4KSBA 2QAGC 3OFNA 4A0HA 1E2PA 5H68A 5A4JA 3GLFB 1VYVA 1BIFA 3AF1A 1VIYA 4N3NA 4PAMA 3T1OA 4R98A 2NO1A 4FMDF 4R71A 3K0CC 5KSZA 4PX9A 1R5NA 1UF9A 3AUYA 4M1WA 1TAGA 4PAOA 2REBA 3BE4A 1YZTA 3CX8A 4QJ4A 3U7FB 1SKYE 2G0NA 1IXRC 4WA7A 4URZR 1XEWX 1NIJA 3H84A 1R0XA 4IRUB 1YRAA 5GVRA 2J3EA 2WSSD 2XB2A 1JXMA 2WMOB 4E5UA 3C14C 1XP8A 4MKHA 3WMGA 3C15C 1JQLB 2WHXA 5AJXA 2X19A 5JJIA 4KITB 1U81A 2ZRBA 3CF2A 4D25A 1N6NA 1LW7A 2DHRA 5EXTA 1G19A 2W58A 4XSGA 1PZNA 2Z43A 3UMSA 2GXQA 3TNFA 2UZ3A 3UMFA 3BJIC 1M7HA 3VR6A 5JZVA 1ONBA 3TJZA 1UBCA 2V7QA 2FWRA 4TLEA 4I81A 1RPZA 3H1TA 4IW3B 2HEIA 3CB4A 2HF8A 1X1SA 4D6PA 4HAZA 4DSTA 1CF4A 1ZU5A 2O8BA 4NZYA 3SHFA 1Z47A 4IDPA 4WZ6A 2ZI7A 4JLMA 2JAQA 5HKKA 4QNMA 4DCUA 4TWZA 4MRVA 1IBRA 1GFIA 3C5HA 2HUPA 2QPOA 5EE0A 5TY0A 4NCJA 1W48A 4RFSB 1KZGB 2WWWA 4ILEA 1L2TA 2I1QA 1AZTA 1HUQA 4A8JC 1YE8A 1B0UA 4PXAA 4IVPA 3LVRE 4YONB 2ZIAA 1YZQA 1JJVA 2GAOA 4AG6A 1JAIA 4DUGA 1D8TA 2W6JD 1IJEA 4ARZA 5JBQA 1E9RA 2PZFA 4M4SA 1I4DD 1G3IA 3TW8B 3FDIA 5GADl 2VRWA 1CIPA 4FCTA 4MRSA 1W0KA 3CW2A 4IDOA 3THXA 1FX0B 1DBSA 4JVLA 4LBVA 3MG9A 1KK3A 1RRFA 1MO4A 3CNLA 2IXGA 4AG5A 3H2YA 3Q7QA 2OAP1 5JJLA 4DC9A 1QHHB 4ZDKA 4PZLA 3RYTC 4F38A 6Q21A 2OXCA 1ESNA 3IEVA 2ZSDA 1MKYA 2IT1A 5L3RA 2JLXA 2QM7A 4PAQA 5K8LA 2DR3A 5SZKB 3THOA 3KB1A 5EUQB 4HEJA 5EP3A 1CJUC 2WJGA 2W00A 1WE2A 4PHHA 4RZ2A 2OE2A 1PLLA 3AF0A 3IDQA 1A1VA 2C04A 1KI4A 3LX5A 5A5GA 3HPRA 1OIXA 3T06B 4W5WA 2VF7A 3BRWD 4EPVA 1HE8B 4KFTA 3QF4A 2BVNA 1A4RA 1MT0A 2GWHA 4QKQA 1U2RA 1G291 1II8B 1UEIA 2KWIA 4PZZA 2C96A 1E2LA 4Q19A 1MV5A 1NN1A 2B92A 2H1LA 3AKCA 1YR7A 2CHQA 5JRJA 3IO3A 1Q3TA 1WRBA 3CRVA 4JSTA 3WYAA 2QBYB 2IS1A 2XNDD 2YINC 1KMQA 2ASEA 2GJ9A 2QGZA 1E9DA 2YWHA 4C0BA 4DXAA 5JEEA 1N3BA 3SJZA 2NO0A 1G3UA 1UM8A 2R6FA 1S3GA 1YR6A 3EWAA 4L15A 2FZLA 2ZRGA 2PT7A 2ZI3A 4LJ4A 3I62A 2QE7A 2QROA 1JEDA 3AH8A 3AVYA 4EPWA 1A5TA 2IEZA 4BRWA 1HQCA 2J46A 5TVKA 3QKSA 1P75A 1E98A 4LJ8A 1VG8A 1AKYA 4Z1MA 3SDZA 3B1ZA 3AGQA 1U98A 2HLDA 4U5XA 1P9WA 1XZPA 2G1KA 4Q9KA 3KQNA 1SHKA 2UVQA 3DMNA 3LLUA 5GJVC 3P27A 5C46F 1KI6B 4YMWA 4GFDA 2BCJQ 2J41A 3VR5A 3KXLA 2BMFA 4PC2A 1JR3E 4ABYA 3L0IB 1NIPA 1N0VC 3GEEA 1CS4C 5TMPA 3ZVMA 2FH5B 4HDCA 3MD0A 5DH9A 2PH1A 3PEUA 4KBGA 3PUZA 5H8WA 1HEIA 2WOJA 4KYIB 1A2KC 5AJYA 2MSEB 4QC2A 1YVDA 2B7BA 4NE2A 1Q21A 1E96A 4YC7A 1TL7C 1RYFA 1CR1A 1NKTA 3MAAC 1N5LA 4DT1A 3W9YA 2A2ZA 1ZINA 3EA5A 5IT5A 3OAAA 3T61A 2B8TA 4WW0A 1O3YA 5IRCD 1G8HA 3K9GA 4Q7MB 3CX7A 3Q85A 4IDHA 4BFTA 4HUQB 4PHFA 2V7QD 1NY6A 1IOZA 3LWNA 5TXGA 3RRNA 1CBUA 4JVSB 1QHXA 2FE4A 1W4RA 1U0HC 5IK2A 5BYKA 5F9FA 4UNQA 3VTKA 3W5JA 3SBEA 3UPUA 4KI0A 3KQUA 1YZUA 2FDCA 2PX3A 1GIAA 2YHSA 2GVDC 1GL7A 1UBGA 3NC0C 1OFIA 5HKKD 4RD1A 1KDRA 2HJVA 1KNQA 4Q7JB 4CVNA 4OHWA 3MJRA 1KDPA 3EG5A 2P3SA 5CM9C 1J8YF 1GILA 2GETA 3KJIA 3KX2A 3B7GA 1DG1G 3R20A 2DBYA 2IA5A 4Q03A 2EFDB 5AUOB 3TH5A 3T15A 1N6PA 2ZAOA 2FFAA 2YC2C 2QAGB 4IOLA 3ICQB 2DFNA 3DOEA 4DUGD 4B33A 5KSPA 2WM9B 4MUBA 1UAAA 1XD9A 5CDFE 3F0TA 1U8AA 4P4TA 4XTRA 1OYWA 2V6IA 5EUMA 3KQHA 3RWOA 4BEJA 5JI3E 5DE3A 5FR1A 3VR3A 2OFWA 3Q8XB 4JIMA 2ODWA 3GLHE 4V0OA 4AKIA 1Z6TA 1UKZA 1AS0A 2RHMA 2ZXUA 2HT1A 3DKPA 4GMXA 4FCWA 5B64A 2AN9A 3B60A 5H1YA 2BOVA 2RMKA 3BD9A 3KKPA 1XTRA 3S1AB 3MJHA 2JATA 4IKEA 1SQ5A 3IQXA 1TF7A 1QHGA 5E7MA 1Z0IA 4HAXA 4DEXA 1Z2CA 1NG1A 1X86B 1FFHA 1DAHA 2AKYA 3KXKA 3EA0A 2ZQ5A 1LS6A 4D4KA 1E1QA 3HR8A 1E99A 2PBRA 4YMVA 2QGNA 1H8HA 1N6OA 4KBFA 4WAUA 5C1BA 3GEIA 5TARA 1GITA 3LX8A 3T35A 2O0HA 3AUXA 4L8GA 3CWQA 2ORWA 4NP6A 2EYQA 1DO0A 4QXAA 1P9RA 4BECA 4C7OB 3GCGA 3A1WA 3D31A 3R9IA 4JKYA 3IILA 1GOTA 2GA8A 1HA3A 2ZRLA 2KE5A 3BC1A 1C9KA 3L0OA 2F3RA 2RGDA 1OF1A 1NSFA 4AKEA 3LDAA 1NP6A 2IXFA 5J4HA 3N2IA 4JJKA 5FUVA 1XB2A 4B73A 3KB2A 4I1VA 4FWTA 1IN7A 4BEBA 2AXPA 5GJCA 1FQKA 1VDZA 2V1XA 3NIBA 1K5DA 1NRJB 1XEXA 3EPKA 3AF4A 4A8JB 4Q9IA 2QE7D 4TMZA 3NVAA 4B43A 1CJKC 4PC1A 2H8KA 1E9BA 1JECA 2FFQA 4UNSA 3SE0A 3SJAA 2QEQA 5KNCA 4U00A 3REGA 1FTNA 2CHGA 2W2XA 1SVKA 4OI2A 4US1R 3KTAB 2L0XA 5LPNA 4XJXA 4Z1MD 1C1YA 5KDDA 2YV5A 3CO5A 1FUUA 2HLDD 2IYVA 4M1OA 3WYFA 3A58B 1D6JA 4KLZA 2OCPA 1EG7A 1ZJ6A 2RAPA 4BQSA 5L3SA 1TU4A 4JT2A 3SJCA 1GTVA 1VCNA 2IYTA 2NO6A 2PJZA 2ZJ2A 4IJMA 5KUTA 3RC3A 5FOWA 1KHTA 4M9QA 2C03A 4NDZA 3GJ8A 3VU9A 3CRW1 2IK8A 3BFXA 2ZJBA 5DISB 1FW6A 5P21A 3I5XA 2OV2A 3RABA 2DB3A 1OV4A 3CNNA 4Q1BA 2GEUA 3ADCA 4M8NE 2ZYUX 2QORA 2OFXA 2ZU0C 2WMNB 2NTYC 4Q4AA 1T8TA 1XTQA 1QG4A 4Z8YA 4IXMA 1QDEA 3B1XA 4DDTA 4LBZA 2F7SA 4AWXA 2BMDA 4PO9A 2JASA 5FL7D 5D3QA 3CWZA 2C5LA 4PQRA 1E9AA 1O87A 4PSAA 2ZI5A 5FL3A 2F43A 1L8QA 1ESMA 2QP9X 3U6KA 4HB4A 1LB1B 2CHVA 2CK3A 2IYRA 3IPXA 4NYIR 5EZ6B 5FPYA 1OH8A 1OFTA 1W5TA 2Z5FA 5JRZA 1ZM3A 5BWMA 4HZUA 2WJIA 4RKFA 2OG2A 2ZRPA 5CIWA 2J0SA 4DLSA 3SC3A 4A6XA 2ZSFA 4JLOA 1XPOA 1XXHA 5KHOC 1AS2A 1RRGA 2GCOA 3THYB 1CKEA 2W2VA 2O8DB 1S2MA 5DHAA 4GI7A 4ASUD 4BFZA 2CLCX 2D2EA 1D9XA 1N2CE 1XTSA 2XNSA 2A5FA 4TL6A 5IDVA 4K8OA 5JJKA 2V6JA 2ZRKA 3H4MA 3V4RA 1KY3A 2P6NA 3OIYA 1N5KA 1E9FA 3NDPA 5GJBA 2CCJA 2IBMA 1DTSA 1RYHA 5FTMA 4C2TA 2J0VA 1KYIA 3KJHA 1HQYE 5J5CA 2GEDA 4AURA 1NJFA 3U44A 5DI9A 5LDDC 2MMCA 2FJUA 4HB3A 2IF2A 3FKSD 3DHWC 2ZEJA 1AM4D 2ZYTX 3ZD7A 1ZD1A 2PCLA 2VL7A 4OK5A 3IBYA 4G5OA 1G8YA 4Q47A 4MITA 2WJJA 1E1QD 2RGAA 4JT4A 1H8HD 3PR1A 4DLXA 3QEOA 4K81B 2ORVA 3ZYCA 1HY3A 1M74A 2ZR9A 3U4QA 1FL9A 1Q1QA 4OJKA 1KSJA 5JS7A 1GNRA 1OXTA 1QBKC 1PLKA 4V0ME 3I1FA 2J1LA 3AF2A 2BEKA 1NI3A 3WMEA 3GLGA 2VBCA 3K0FA 4OK6A 3SOPA 1GAJA 1ZCBA 2WZQA 3L43A 4F92B 2WWFA 3KJGA 1EFRD 1G5RA 2TMKA 1KSFX 5FUWA 1SVOA 3CF6R 4DHEA 2DCUA 3RHFA 5L3VA 2WIAA 2Q9BA 3FMOB 1KY2A 4V0LA 4C2UA 3T1QA 1ODFA 3FHCB 1ZCAA 2J7KA 4JKIA 3TQFA 4DLWA 2IYWA 4JLJA 3NBZC 4L9SA 5KSYA 4CGZA 5JHGB 2XXAB 3RC8A 3M1IA 2X2FA 3CPHA 2WIBA 4HLUC 1YKSA 2E87A 3E2IA 2QSZA 5AK0A 3U3RA 1WXQA 3EXAA 4AIIA 1NN3A 5CB6A 1YZKA 1OB2A 1NG9A 1U9IC 3NEJA 4AY2A 1E2IA 1ZUNB 3SBDA 4I4LA 4IEIA 1E2MA 2GDJA 2H57A 2XSZD 2DPXA 2VO1A 1ZIOA 1OHHA 4IVRA 2CL6X 1XJCA 3KQKA 1J8MF 5JCPA 2ODBA 4AK9A 5JFGA 2A5YB 1WBDA 2OUKA 1BH2A 1DG3A 1YZNA 1R8QA 2J0UB 4F91B 2D74A 5IHPA 5JSZA 3U5ZB 2VP4A 3I8SA 2C77A 2JJ1A 1P60A 1VKJA 3BH7A 4RCZA 1IN5A 3MMPA 4DLTA 1GKIA 1N5JA 3FHTA 3M0EA 3EIQA 2ZRMA 2KSQA 1G20E 1QVRA 3NBFA 1OKKA 4ZV4A 2O8EB 2WV9A 1IAQA 2HDNB 3I8XA 4LYFA 1II0A 2JLYA 3LY5A 2RCNA 3RRMA 3P32A 1FP6A 2D7CA 2IC5A 4MKIA 3TSZA 2DFTA 2FSIA 1U8YA 5CYOA 1WP9A 5G41A 3ADDA 1S3SA 2CE7A 2JCSA 2KB0A 1DPFA 4B47A 5DHFA 3WP1B 3P20A 4KSCA 3AP3A 5D3MB 5FBLB 2D7DA 4WBSA 4Q4HB 2G77B 4TL7A 2BIFA 1DO2A 4TMKA 1OT3A 1XMIA 4LK2A 2LCFA 3QG5A 4OKSA 3VX4A 2A9KA 3OIWA 2CK3D 1XTIA 1WCV1 3VFDA 2GNOA 1EWRA 4B3GA 5FH9A 1SULA 1NVXQ 1W0JA 3EIHA 3LRPA 3GJ0A 1T91A 3VKWA 1L4YA 4B3BA 4CW7A 1EFUA 2O0KA 4EQ6B 1G7TA 1FUKA 3W3AA 3RS5A 4JLKA 4TTRA 3K0SA 1U0JA 1CJVC 1FZQA 3TVDA 2AHOA 1T9HA 4Q9JA 1Z07A 3LLMA 4ERNA 4Q4JA 2GKSA 1JAHA 1Z0JA 1KI9A 4F4JA 3IEUA 1W4CA 3DL0A 2GRJA 1G17A 1XMVA 3NWJA 4RFVA 4W5JA 4DLYA 3GJ3A 3GPLA 1KK0A 2ZS9A 3RDPA 2ZJOA 4A4DA 3QSYA 1IXZA 5GJWC 3LXXA 1CJMA 2FPLA 2A5GA 1H8EA 3QIAA 3KFVA 5L3QA 3EPLA 1D2MA 4QHSA 1OH6A 621PA 3QKRA 3LQRA 1XEWY 1BO6A 4LHVA 4JYCA 1Z28A 2RGGA 4D80A 1ZM9A 4ARZB 4PO8A 3U3JA 2YWGA 4M1MA 3P4YA 1FNNA 3KUDA 4D0LB 3QXSA 4MRRA 1Z08A 2H7VA 2QMEA 1Q1ZA 1G3MA 3THXB 3WP0A 4RD4A 3FMIA 3RNLA 4W5HA 1W5SA 2PCJA 2C9CA 1Z06A 1XMSA 3BB1A 1IN8A 2IW3A 3RWMB 2OT3B 4MKFA 3SYNA 2ODNA 2H18A 1I4LD 4LJ6A 4P4SA 1XZQA 4V02A 1S4QA 2JJ8A 2UKDA 3DOFA 1PVOA 3JVVA 1AS3A 2AD1A 3TQCA 3QQ5A 1W36C 2PMKA 1XDBA 2J5XA 1SXJA 4OBEA 4WIAA 4EPRA 4NL4H 3A8TA 2QM8A 1SKQA 3LBIA 4P32A 4ZCMA 1DAKA 1TTTA 2QL6A 1VIAA 2ZITA 3QKTA 2NPIA 1QG2A 4HI0E 2C95A 1DE0A 4ESHA 2F55A 1I2MA 3GLIA 2QMHA 4LC0A 1D2EA 3EC2A 3PUWA 3HJNA 4BFSA 2QNRA 4KFUA 3VQTA 1M1YE 2PMDA 2ZYWX 4LWZA 2GJSA 3CUEF 4BFXA 1G4UR 1N6IA 1NBMD 3ASYA 3CBQA 2FPMA 1OHHD 4FXPA 3RRYA 3TE6A 3JZMA 2FZ4A 4BLRA 3GLHB 2Q9AA 1TUIA 3X1WA 1KNXA 3K9HA 1TX4B 5HZKA 3PUVA 2C99A 3IIKA 3FMFA 3N70A 2FSGA 1ZD9A 2P65A 4BRUA 2JJ1D 2ZUDA 4D26A 1F3OA 1XD2A 3WRYC 1WB9A 4GOKA 1KOFA 3LBHA 4B6FA 3WNDA 1KZ7B 2OFOA 1OKKD 3CF0A 4DCSA 1FPMA 1RZ3A 1QZXA 2JLQA 2XOKA 1F2UA 4ZDWA 4B3DA 4CT4B 5J4VA 2GHIA 3OF5A 1GG2A 2GBLC 5CLQA 3R7WA 1MO5A 2C98A 2VSFA 2WKRA 2G88A 2P67A 4O25A 3B6EA 4ZDJA 3Q5EA 3PQCA 2OHFA 5FPSA 4NH0A 1Q3HA 4M2LA 2CCGA 3EAQA 4URVR 1R4AA 3OESA 3KL4A 1BS1A 2B21A 4DCTA 2ZETA 5LB4A 1JR6A 4G5RA 2ZM5A 2EYUA 4FMBB 2VHQA 4OHXA 1W7AA 5G40A 2IS4A 2MMGA 4E09A 2Z83A 3AB3A 1LS1A 3U3MA 3BB3A 4RZUA 4D82A 5C2JB 1W0JD 5HTKA 3PEVA 5CB8A 1X1RA 1CULC 3LNCA 1G3RA 3MLEA 2Q3FA 2UZIR 2Q21A 3M4YA 1LVGA 1KMHB 2YVUA 1EESA 4EPXA 1FP7A 4LI0A 3T12A 1DS6A 1M6NA 5FUXA 4TMXA 1T4GA 1W1WA 2CDNA 2QP3A 2VIIA 2VA8A 4EJSA 5C18A 3F5FA 1DAIA 3K0AA 2FX3A 3HR7A 2GXAA 2A7QA 3RRZA 2OM2A 3GJ7A 2WJHA 5EXSA 1XWIA 3A1UA 1CR2A 3GLFA 3QF7A 1F2TB 4M0LA 1GL6A 1NVVR 1RVDA 2R6GA 1JNYA 3WHKA 2BMEA 4JVMA 1H8ED 5GVSA 4E22A 4PQYA 4C0HA 4UNRA 2G1JA 4Q01A 3PXGA 2EW1A 1R8SA 5AJVB 1GRNA 2AK2A 2OESA 2R65A 4X8LA 1Z6AA 3RS7A 2ZREA 3FGNA 3TSWA 1Z22A 3AEZA 4MUAA 1OE0A 3B78A 5E7JA 3DKVA 3B9PA 2K5UA 3GFPA 3TAUA 3KQLA 2IYLD 4QJ5A 1ZNZA 3AF3A 4B2LA 5DN6A 1IY2A 2HCJB 1V43A 3IIJA 4GRAA 2C9OA 3KKNA 3NHAA 1PJRA 1TADA 4TT3A 5FPTA 4A15A 2GTPA 2XITA 4XWKA 2WWHA 3WHLA 4MYUA 4D81A 4ZPXA 5F2EA 4BWYA 3T1VA 2ERXA 4I1UA 2AR7A 3O47A 1UEJA 3OFND 1QHYA 5F98A 2N46A 1R5OA 2SHKA 2CJWA 1OW3B 3QPUA 4KV9A 3CR8A 3LO5A 2QQ0A 3GMTA 2KJQA 4M22A 2REOA 1TQ4A 1KI1A 2V4ZA 3RS4A 3IQWA 4B74A 4A92A 1SXJD 2FG5A 3BGWA 5F9HA 3PCRB 4UXJA 4G5GA 4MYTA 4EFNA 1FQJA 3PV0A 1Z0DA 5EP1A 3K09C 1KI8A 1L4UA 1UKYA 3BIFA 2HYDA 1R7RA 4RFSA 1UDXA 2ZE7A 2WAYA 3LW8A 1UKVY 3B1WA 2XEXA 4UKDA 4C0KA 2GXUA 2WICA 4G0NA 3Q9LA 4YQFA 1KDTA 2R44A 1G16A 1E2EA 3WRXC 3G0HA 4GL2A 5BN3A 2R62A 4QNRA 2CMKA 2LKCA 5EQTA 4D4JA 3AGPA 2ECKA 2JEOA 4S35A 4IHQA 4LDJA 1FX0A 1VMAA 1X8KA 1JXOA 3C5CA 4PPGA 4MA4A 1OJLA 3NBYC 1CU1A 2IHYA 2RGXA 2ZS7A 4O0MA 2JGNA 5LD2C 1QHHA 1EWQA 4DCVA 3EIEA 1JI0A 5BN4A 1AQYA 2FGJA 3VR1A 3DVLA 4BLTA 2QPTA 2AWNA 2O8CB 2YZ2A 1XJQA 1E3MA 2ZYVX 2YOGA 4FD2A 3VAAA 3VR4A 5AJZA 2XOKD 5L3SB 5JI2E 2ZE5A 3CZPA 3DEFA 3BBPA 4LBYA 5FI1B 2LWIA 4R2HA 3C7KA 3V9PA 4IOJA 3K8YA 1E6CA 3AKEA 3K70D 1S9HA 1P9NA 1XTKA 2BDTA 1E69A 1G41A 2ZRHA 5EP2A 4U7DA 2IWHA 4JJZA 3W5IA 3I4LA 3VU9B 4YMTA 1II8A 2W2TA 1NLYA 2XZPA 5HPYB 2ZROA 1W0KD 1W36B 3O8RA 2VYFA 3A37A 3ICEA 4L9WA 4I1SA 3QEJA 1OXUA 3FKQA 3ND9A 1GVNB 3TSOA 2WTUA 2QBYA 3ADBA 4OHZA 4MDEA 3E70C 1UPTA 1W47A 2EU8A 3UATA 2R2AA 4FMDB 2CXXA 5L8VA 4Q66C 4WXRA 4BUJA 1Q22A 4MGIR 5G3YA 1OXSC 1DAFA 5B57C 2NMVA 1NMZA 1XD8A 2AXNA 5DI3B 2FFBA 4Q7LA 1X3SA 1GDDA 1TNDA 4IOMA 2O8FA 3VNUA 4OQFA 2BBOA 4AI6A 1P72A 4KLNA 2BBWA 5KTYA 3FE2A 4HAWA 2QMOA 3U2QA 4GNKA 4HZUB 4W9MC 3CH5A 4EFLA 4NKRA 5CYPA 4FI3C 4XD7A 3SYKA 5J4KA 3RSOA 3EPJA 2Q6TA 1KI6A 4ZIRB 1G3QA 1TEVA 5FTLA 4LYHA 3BERA 4WZBE 3N2EA 1EFHA 4MYCA 2HXYA 4B76A 2BKEA 5DNYB 2R8RA 2BM1A 5HCIA 821PA 3D8BA 1VHTA 1OXVA 2IYXA 5K8IA 5TB5A 2OBNA 4JS0A 1GP2A 5DLQC 1ZNXA 1TMKA 5HCNA 2W6IA 4URUR 2EVWX 3PJRA 2VEDA 2IUTA 1P2TA 1VYUA 3DO6A 4QHTA 2ATVA 5DN6D 4ESVA 4PFSA 1R2QA 4HUTA 1MO3A 4TT3D 4TSFA 5FBRB 4GP6A 4US0R 2ZPTX 3L2OB 3U44B 3NXSA 4LBWA 2WWYA 4CEJB 3M6AA 1M34E 4HUQA 3LVQE 1DARA 221PA 2H16A 2F1IA 1U99A 2QMUA 1T0JB 4V0KA 2P6RA 1MOZA 1DADA 2ZSBA 1R0YA 1UJ2A 3SFZA 3TLXA 3CR7A 1NY5A 2ZR7A 2CEAA 2WJVA 3GQBA 3ZQ6A 1JPNA 2F9MA 4OQXA 5SZHB 1CRPA 2DWQA 2HT6A 4QRHA 1J2JA 2QPAA 4DDVA 1NSTA 3ZD6A 2FU5C 4US2R 1AKEA 2GJ8A 3HU1A 4FMCB 1E79A 3T34A 3QXHA 2C9YA 3U7GA 1S1MA 1OSNA 4U02A 3NEYA 4TYPA 2VP6A 2WPDA 3TR0A 1GNPA 4QL3A 2ONJA 2P6UA 1N0WA 2QAGA 3K0FB 5KPJA 4C4PA 1TQ2A 1Q57A 2ZJ8A 2QAJA 3OAAD 4JSYA 3RS3A 1JEEA 1EX7A 4OI1A 3K0CA 1KI2A 4Q7KA 3KXIA 2JLWA 1Z6YA 1PLJA 1RJ9B 2FEMA 2ZRDA 3ND8A 2LKDA 4LGMA 5IK2D 1P73A 5TDHA 4HAUA 4C0AC 2JDIA 3QOFA 4B3CA 2ZRAA 2ZRNA 3LXRA 4PPQA 1GSIA 2VF8A 2VHTA 3U3KA 3E1SA 2O5VA 5FOXA 3S1AA 3W6OA 3ZZUA 4RZXA 2W0MA 4E07A 4G3XA 4QFMA 2YOFA 4JL5A 4LUCA 2X2EA 4YMUA 1AQUA 2NO9A 4KHZA 3UG6A 1Z0FA 3BXZA 2R9VA 4BGDA 3R9XA 4AKHA 1W44A 2FV8A 1MRNA 2BC9A 2OBMA 1KI7A 2BJWA 4M53A 3SQXA 5UKDA 4DSNA 1BYUA 3FPAA 3REFA 4HZIA 2ZRFA 4C7OA 3ZDQA 4A82A 1TF5A 4OI4A 4P4UA 1T3HA 2VP9A 1W2HA 2ZUBA 3DM9B 3UANA 1RRPA 5BW8A 3QXJA 4FW9A 1P62B 5FBVB 1OIVA 3IHLA 4H1UA 3JVUA 1AZSC 2R6DA 3W3ZB 5CK4A 1F60A 1NF3A 4Q9HA 2IHBA 2BJVA 1J99A 1ZUIA 2J59A 3OZXA 5J4LA 5LBIA 1AK2A 4NTZA 1IY1A 3JZAA 1Z8FA 4Q21A 1FMJA 4DB2A 4CEIB 1SZPA 3B9QA 4HAVA 2O0JA 2IYSA 3C16C 4NYMR 4LJ7A 4A8JA 5CK5A 5DGXA 4E03A 5G53C 1FNMA 4D0NA 5AJWA 2WWIA 4BE7B 5B2ZA 1P2SA 3Q72A 2ZSEA 2F1JA 1E9SA 1VTKA 3SI7A 4NYJR 2G0TA 3QI2A 4NYIQ 2AKAB 4OL0A 3R8FA 3KTAA 4KJZA 1E0SA 3KJEA 4JL6A 4BFUA 1CJTC 5CM8B 3MCAA 1T3LA 2V8OA 5DYGA 3H86A 2D4HA 1WBBA 1FOEB 2PT5A 5KU1A 2AWOA 3BFKA 1TUEA 2GJKA 4BLOA 4A6PA 4V03A 3THWA 1X8JA 2XZOA 4NU0A 4XD7D 2H92A 1R5BA 3NH6A 4Q1EA 1UADA 3EARA 1IN4A 3AVPA 3OE7A 5LD2B 1G6OA 3RANA 1GL9B 2BBSA 2WOOA 4TZ6A 2ZVQX 4RJLA 4MGYR 3HDTA 1WDTA 2YYZA 4TL8A 1VCIA 4A1FA 3GD7A 4JZKA 3FVQA 3HYRA 2OSBA 3QJYA 1KKLA 2GXSA 5CLLA 1QF9A 2XB4A 3E5HA 5KNBA 3FOZA 4JLVA 1KI3A 3IBGA 3QPVA 3CKLA 1E4YA 1HE1C 4UXHA 5E95A 3PVSA 2Q0HA 4GMDA 4LHYA 1IXSB 3W34A 4URYR 5KSOA 4Q1AA 3MUFA 5HE8A 4ZCIA 4ACAA 1E0JA 1TQ6A 2FPKA 8OHMA 5FPKA 2NOAA 4N1AA 4TSFD 5L3QB 2W83A 1IJFA 1WMSA 3LFUA 1XCGB 1E2GA 1SHZA 2MSCB 3B2EA 2PEYA 1KO8A 4L16A 1VPLA 2PZEA 4GBMA 3G5UA 4CEHB 4NYMQ 4BASA 1A2BA 4XOIA 2RHDA 2P5SA 5EXPA 2QP4A 3WYGA 4TZ0A 2WSSA 3X1XA 4ZI3A 1HYQA 4PSVA 2ZVPX 4JLBA 1OIWA 1ZM7A 3CONA 3MWJA 4B71A 5DIFA 2CE2X 4NMMA 4NPHA 1XXHE 3EWSA 1HTWA 1KIMA 3BOSA 1XPRA 2GK7A 2QENA 2YWEA 3NBXX 1RE0A 2A78A 3HWSA 3PIRA 2QTVB 1SVLA 1SVWA 2HV8A 4EIWA 4B34A 2N1BA 4LHZA 4C30A 3C41J 4DSUA 4F4IA 4YDSA 2RGBA 1E79D 2OLJA 2WJYA 2ZS8A 3THYA 1AA9A 2QZ4A 3D3QA 5JEDA 1GKYA 4TMTA 4QM6A 1YHNA 4EUNA 1LV7A 3B85A 2WPDD 4TMWA 4DSOA 4XVUA 1G5PA 1NL3A 4D4MA 3EZ9A 4TYQA 4M1SA 4CDGA 3EX7C 1ZVQA 2RGEA 5TV2A 3QY0A 2IX3A 5H70A 1DOAA 1KAOA 3KUCA 4LJYA 2NG1A 4J0QA 3F8TA 5KO2A 2EFCB 1E4VA 2F1RA 2QG6A 4FN5A 3SJBA 3Q3JB 3TGPA 4WOPA 4TYNA 5SZJA 1DELA 3GLIB 4W7SA 1GWNA 1SGWA 1X6VA 3NG1A 4POAA 5AWFC 1T3SA 2I3BA 1IONA 3DDCA 1TF2A 1P3JA 1W4AA 3PUXA 4P31A 1RW4A 1S0UA 3LD9A 5AUPB 2YWFA 4P0TA 3IKJA 4A9AA 3GFTA 4B2PA 3ZGXA 2OZEA 1BKDR 3B8HA 5EE5B 2CLDX 2VHUA 4PC3A 1N25A 3X1ZA 2O8BB 3U7HB 4B3XA 1M8PA 1VHLA 1MO6A 1QHIA 2VP2A 2YOHA 4GPTA 3U61B 1XD2B 2AFIE 2ZU6A 3FWYA 3EZ2A 3RLFA 1KK2A 3CLVA 4DLZA 4L5BA 2BEJA 4C0LA 3L0SA 1N6HA 1Z29A 2NZJA 4L4UA 2QRNA 1XCPA 2CVHA 4DVGA 3B5JA 1CEEA 1DAMA 1EXMA 4F7WA 4EFMA 3A36A 4XWAA 3VR2A 3BB4A 5M04A 4LPSA 1RFLA 3TBKA 5DO9A 5B30A 1GM5A 2Q9CA 4YLGA 2XXAA 2BMJA 3WBJA 2GZDA 1SVSA 2CL7X 2CNWA 2FNAA 1XRJA 3OEHA 4MRPA 2F6RA 5FBQB 1ELOA 3WNCA 4HLQB 521PA 2A30A 1NBME 2PL3A 4GOXA 3R8CA 1MRSA 1TEXA 3F3YA 5EE1A 5AUQA 3SEAA 3WY9A 3SZRA 1GKUB 1KO4A 3ETLA 2XNDA 5HZHA 2J87A 1NVWQ 1E2KA 3QVVA 3AM1A 1E1RA 1G8PA 4A2PA 3AVTA 4Q18A 1QHNA 3B82A 4V0NA 5F3WB 3UWKA 5B58C 1P61B 2JIZA 2J0UA 1KK1A 2XJ9A 4RZ3A 1XCMA 1II9A 2ZUCA 4KODA 2XZLA 2NGRA 3KFXA 4Q9LA 1KJZA 3SHWA 2VP0A 4LYAA 4M1KA 4PR0A 3FMPB 1HT1E 1G4AE 2Z4RA 5HE9A 2PLRA 1CRQA 3QF4B 2O8EA 4M1YA 4URXR 4S2EA 1Z0KA 5IF9A 1PUJA 2GEVA 4Q00A 1K8RA 2DFKB 2XTNA 3KZ1E 4IFBA 1UBEA 3FFBA 4XIGS 5FTKA 3UWOA 3VKGA 3QPWA 2FSFA 3AV0B 3ZVNA 1DVRA 2ANCA 1KDOA 3PUYA 2GK6A 3TR5A 4AC9A 5D3MA 2OXRA 2VH5R 4FINA 3SNHA 1N6KA 4C0SA 4JLPA 4Q4HA 4BLPA 4N0DA 1ZC4A 2P0EA 4G5SA 4GZMA 1S96A 2IEYA 1E32A 4H1VA 1EFCA 4GOJA 4TQAA 2IYQA 1LNZA 4KU4A 3X1YA 3QBTA 4BFVA 3QKUA 2OCBA 4LV8B 1Z3IX 3QKSB 2CL0X 1NLZA 1G9XA 2DWOA 3ZH9B 4EQ6A 5EXXA 1J90A 5FI0B 3WNBA 4HATA 4EDHA 1YR9A 1JALA 3EC1A 2CBZA 4QGGA 4BZPA 4MH0R 2CJWB 121PA 3OHMA 4AYWA 3OEEA 1KSGA 4MQBA 1S1CA 2IF0A 2KBFA 4XVRA 4JLNA 3K9LA 3Q7PA 3I5YA 5CJPA 1KO5A 2JLZA 2VLIA 2VPPA 1JR3A 4HAYA 4EKDA 4P33A 4BZQA 1RIFA 1W46A 1I4TD 2PZGA 2BBTA 4XWOA 3TUJC 1XMJA 3A1VA 4A0GA 4Q48A 1G6HA 1LTQA 4MGKR 1ZM4A 4DT1B 5SZIA 2ZJAA 1MABA 2VSOA 3CRMA 5ELXA 3UMRA 1E2JA 5FPHA 3NHBA 1T5LA 1US8A 1VG9B 2GCNA 4RCYA 2Z0MA 4D4LA 4Q1FA 5JHHB 4RD2A 4LCBA 4OYHA 2GILA 4DRZA 4PO1A 1PUIA 2XAUA 2JJ2A 2QI9C 4JYBA 4BLSA 4JLAA 5E3HA 1W49A 3GFOA 3H0KA 4G5QA 1GRRA 1FMLA 2ZSAA 4TQ9A 1VYTA 3CZQA 4TMVA 4DZZA 2FFHA 4MKGA 4WVFA 4FMCF 3RAPR 1GUAA 3I73A 1EGAA 2FSHA 3B1YA 3IIMA 3ZIAA 5C4MA 3UXMA 4LYJA 3MWKA 1Q1BA 1SXJE 4C9BA 1G8FA 4HYYA 4Q1DA 4DIDA 2FA9A 4IDQA 1Z63A 4DBLC 3BORA 1ZNYA 2RKOA 3HPQA 4CF7A 1CLUA 2ZTSA 4Q02A 4ZO4A 1SVIA 3L0PA 2ZRIA 4TQUS 4TL9A 4G1UC 5KDLA 2OLKA 4XTCS 5FOVA 3PFIA 3HU2A 4R2IA 2VP5A 3ONWA 4QBIA 4RSGA 3GLIE 1QHSA 2J45A 1XPUA 3DPUA 1E94E 3EZ6A 4PPFA 3K9NA 2QA5A 3HYTA 1EK0A 1ZBDA 1DEKA 2X1VA 3ZZ0A 1KAGA 2XTMA 2EWWA 1XF9A 2QN6A 1J70A 2CNWD 3OEHD 2HXSA 2YJTD 4Z8XA 5CDFA 1E2NA 1NMXA 4LSGA 3LA6A 4KFSA 1T8UA 1E0AA 4OHVA 1JPJA 2XJ4A 4B48A 2V9PA 2H17A 4XSHA 1G1MA 1E1RD 3LQQA 3GJXC 1ZW6A 2J0QA 3GLHA 2BKUA 2F1HA 4GT1A 1NVUQ 4II7A 4M9SA 2JIZD 4PANA 2AD5A 3FYHA 3LH5A 4LPKA 4Y0AA 4LJ9A 4ZI2A 1XU4A 5FOSA 2WKQA 2ZAMA 4M1TA 3ADKA 2RGCA 3BH0A 1N0UA 4LY6A 5JS8A 3GJ6A 1PV4A 2O8FB 4KAXA 2XTZA 2AX4A 1Z83A 4LC1A 2NO7A 4TLDA 1OFUX 3SU8A 3HU3A 1E2FA 2JLRA 1NVVQ 2GZHA 3TUIC 4TLCA 2ZRCA 4HDQB 3TW4A 1GRQA 3OIUA 1G7CA 1CXZA 1UBFA 2YNMA 2EQBA 3D6TB 4YDHB 1KKMA 4HB0A 4Y0VA 4B44A 3BK7A 4B3FX 4ACBA 2B8WA 4KYUA 4JL8A 5BQ5A 4RD6A 3CRQA 4MDFA 1BYIA 2IXEA 1XEXB 4QBFA 4OHYA 3N5CA 3TAHA 1DAEA 2A5JA 4PHGA 1QRAA 1ZUHA 4QM7A 2DYKA 5J47A 1YR8A 5FTNA 3ZVLA 4AD8A 3SYLA 4LHXA 2V3CC 2EFGA 2ZJYA 3V00A 1CR4A 3ZVRA 1U8ZA 1NN0A 1BOFA 4NCKA 3CX6A 4HLUA 5FL7A 3NDBB 1XTJA 4H9GA 1P6XA 2DWPA 1KMHA 4QHYA 3QG1A 3GEHA 2GESA 4JVNA 2ZRJA 3AVVA 1U9IA 3NC1C 2FOLA 2GCPA 3BH6A 4FCVA 2IWRA 2AL7A 3OEED 3GLFE 3MWLA 2OILA 3AVOA 2VHJA 4OQNA 2ZR0A 4CZ2A 1P5ZB 1TU3A 1ZMXA 2QRZA 1ZRHA 2IS6A 4YMSA 4GDFA 3IPYA 1NMYA 4LJ5A 4R7ZA 2G83A 1Z5ZA 2PEZA 5BXQC 1S9DA 1F2TA 4M9ZA 1YJ5A 4N0EA 1F48A 1JR3D 4C0JA 3LV8A 3J81k 4LZZA 4DDUA 3RSLA 4Z51A 1YRBA 2BWJA 5AR1A 1D9ZA 1Z6XA 2BM0A 4DEYA 1V5WA 4Q4AB 4ASUA 1MH1A 3B13B 2OAQ1 3L8YA 4QBHA 4EAQA 4GSYA 4QG7A 2DFLA 3W6NA 2HCBA 2GJAA 3EW9A 3PEWA 4CIDA 2EFHB 1FTSA 2ZI4A 1YU9A 2NPFA 2JJ2D 2F43B 3U7EB 4BFYA 1ETUA 4EPYA 4LV6A 3Q5DA 4PSKA 2NQ2C 1E9CA 4LX0A 2QT0A 3C8UA 1R10A 4UNNA 2RB4A 4RD0A 3FKSA 1JB1A 3ZIAD 2RGNA 4DJTA 4B75A 1KTVA 1SXJC 4BPBA 3PITA 1YQTA 2XX3A 1NLFA 1XXHB 2FEOA 3I61A 2ATXA 5JWRA 2PX0A 3A1SA 421PA 2GCOB 4CRWB 4G01B 3O8CA 1G64A 1L7VC 1M7GA 4KFRA 1COWA 1UDWA 4R9UC 4NONA 3QBVA 4DLUA 3IGFA 3V4FA 3SS8A 2GVZC 2GF0A 4CYMA 2QTHA 4ZCLA 2ANBA 1VCMA 5FOTA 3AVQA 4UXIA 4CT5A 4X8MA 1VCOA 1OFHA 2PJRA 4QJ3A 3PEYA 4PC6A 3SN6A 4ZKEA 1EFRA 5KDOA 3CPEA 2P2LA 1U0LA 3A1TA 3D7MA 4NBSA 3DZ8A 3TKLA 2IYZA 4MRNA 1F6BA 3I92A 2E9SA 3VX3A 3K53A 3FHOA 4P3YA 2GZAA 2HF9A 2C2HA 1CP2A 3CPJB 2J9RA 2ZE8A 1WF3A 2OEPA 2R6CA 2CCKA 3MSXA 4ITRC 5EJEA 2WAXA 2I1VB 3UKDA 3HP1A 3FTQA 4Q4LA 3R9WA 2QQEA 3A6PC 4KCGA 1Q0UA 4MGZR 5C4GB 5JMTA 1E9EA 3U4QB 1DAGA 3SR0A 3U3OA 2O8CA 2XSZA 2DY1A 3K70C 3WMFA 2QY9A 2ZJ5A 1Q20A 2Y8EA 4PQFA 4ZDIA 3THWB 3AVXA 1NKSA 4IVQA 1Q12A 4DCNA 1NN5A 2KI5A 2HYIC 4AKGA 3QE0A 3GLGB 3EPHA 3UK6A 1RKBA 4OI0A 4V0MA 1U90A 5EE9A 3W6PA 1XX6A 4EPTA 1UKEA 2PLFA 2W0SA 1B23P 1K6MA 2ZE6A 4YXWA 4PC7A 4HDOB 1CTQA 1K5GA 2REXB 1AGRA 1LF5A 3NH9A 2R6AA 2WSMA 2G6BA 2VTKA 5BYJA 3ZS8A 3TVTA 3BWDD 3CH4B 4OJQA 4OQMA 1GNQA 3CNOA 4RD3A 5K8TA 3VHXA 2QSYA 1EFTA 5FBWB 1NNEA 4DWJA 3O8DA 3IUYA 1I2DA 3U60B 2D62A 1Q44A 2RH5A 3KKMA 4WXPA 2NZ8A 3W8NA 1IM2A 2G3YA 4IXNA 2AK3A 3AVUA 4EJSC 2QU8A 2QUZA 3MWYW 2QTFA 4C3ZA 2C8VA 2Z6VA 4DLRA 5DI3A 1E2DA 3VKHA 4JBYA 4PZYA 5JLJA 2JA1A 2GF9A 1N6RA 1OXXK 2EWVA 1Q1EA 1R6BX 5JSZB 4WZAE 1JBKA 3ZJYA 2FN4A 3I72A 1ZIPA 4HLDA 4RVCA 2H5EA 3L8ZA 1WA5A 3B1VA 3FB4A 1UFQA
chains in the Genus database with same CATH superfamily
4AL4A 1AHIA 1C7JA 2FMXA 4ZIRA 3QE2A 1A4IA 1SAYA 1T5IA 1U4SA 2C78A 4LXYA 4Q05A 2JLUA 3QMVA 4JBLA 1L7RA 2B7CA 1HNXB 2O8FB 4QU0A 1S2OA 1ULBA 3C1TA 3KHSA 4M9XA 3FPJA 1TPZA 3SYRA 4QASA 4CM1A 1JDTA 4OK3A 1NJ8A 1U4OA 2RGUA 3AF5A 1VSBA 1OLUB 3AFMA 4N48A 1OU0A 1YZGA 3R44A 3OIVA 3I1JA 1ZD8A 5FUMA 2GBLA 2VA9A 4MW2A 1G9SA 4B3HA 3CJQA 1KO7A 2W2NA 3I9V6 5HJ5A 2NUPA 2Z6UA 4M87A 2GDZA 2HJGA 4JMPA 2WSLA 4UJ3A 3E4DA 1JLLA 5FWYA 4KNWA 4UU0A 1AU9A 3LECA 4DN6A 2R0QC 1Z2AA 2A5DA 3DBLB 1E0KA 4X8OA 1GQFA 1LBTA 4AWBA 4F93B 2CSXA 4CEJA 4L5JA 1ZN8A 2OV1A 2WVJA 1KSHA 2CKDA 4OLAA 1M2OB 2KMLA 3TW0A 3MRSA 3PENA 3RV3A 3ZWYA 1BWPA 1BWSA 1BMFA 3VPXA 4Z4IA 1AF4A 1M66A 2AR9A 1ZAKA 3IHWA 4Z9FA 1Y6QA 1IN6A 3QENA 2II6A 2Y71A 5CITA 4X71A 2DRIA 1JMKC 1JIUA 1NRXA 3N7UA 1KYYA 4LOAA 5KTNA 1A7JA 3GU3A 1IY0A 4TYYA 4JA2A 4YRKA 1C1DB 2FW8A 4MW5A 4JYZA 3EGDA 3PJGA 3UBMA 5LYJF 3CT4A 2BGUA 5COAA 1WXHA 1P4GA 2JAPA 1AIPA 3UIEA 5IT0A 4R1OA 3QVKA 2FPXA 4GM0A 4LV5B 1OH7A 2E0IA 1GQSA 1C0KA 5E4FA 1MJFA 2Q2NA 1UZNA 3D64A 1RWBA 4UJ5A 3W8RA 1GPH1 3HVUA 1YNOA 3F74A 3LAWA 1G18A 4QPPA 4X94A 3S2ZA 2CZQA 3W90A 4DLBA 2B6HA 5A4DA 2UXCB 4X1OA 3CM0A 5J2TF 3TUZC 2AFIA 2WHYA 3DDOA 3IJEB 2PKYX 2AMFA 3ZWMA 4M76B 4M21A 5ALFA 4RSMA 5F78A 3DXZA 3TK1A 3C3EA 4IKOA 1JR4A 4LMRA 5B3AA 1AN0A 3D0RA 1RRCA 4LF5B 4KVZA 2QX4A 1AK1A 3T8YA 2P9FA 3QVJA 4IQ8A 4NHEA 4DR5B 4RH1A 1OH5A 1ZI6A 4Q5IA 2GAAA 3DMDA 3N75A 1MXFA 1I1QB 2ERCA 3G79A 2VCYA 1ZK0A 1W94A 1LFDB 2GT1A 2V1UA 3BMNB 1VM6A 4GS5A 2XGJA 2AYXA 1BE6A 1J8QA 3DE5X 3SZMA 1AGPA 3K2IA 3H2GA 1L5MA 3HCAA 1TYCA 2F9LA 3P26A 3EXFB 5HQ3B 1IOVA 1COZA 4LRXA 1NBMA 3PWKA 5DNEA 4QQFA 4J9UE 3OBIA 4AW9A 4JB8A 4G65A 4TYWA 3KCNA 1PGJA 1W581 4GRIA 4P5DA 2PUBA 4BNZA 4DSZA 3TPFA 1ZAYA 4MZXA 1AX9A 1G7RA 1H22A 3UC5A 3ASZA 3ZWQA 1YL5A 1N2JA 1QCDA 3WLTA 1MW8X 1O94D 1YS1X 4B6JA 4MWSA 4ON9A 2OYCA 3UUGA 4AMGA 4DKXA 2XNCA 4EECA 5SV2A 4I1OA 4B2IA 2D0PB 2PU7A 1QTQA 1LI7A 3FUXA 1UK9A 5LB2A 5ICCA 3FMGA 1F5NA 4PTLA 2IYYA 5AVTA 1S7CA 3WYDA 1KBQA 2D3WA 3AR4A 5GOZA 3ZGYA 3AVWA 1CR0A 3TLMA 3CVVA 3P4XA 4DGSA 2OB1A 1FUEA 1QCCA 3M6FA 4CEIA 2ZDHA 4JUIA 1Y42X 1P0MA 1E5TA 4Q1CA 3KOXA 1Z0AA 1CHDA 1QTIA 1J24A 2Z3VA 1OXKB 1ORHA 3GW8A 1T9ZA 4KZPA 1PX2A 4LWQA 4QQKA 3TTUA 5IG2A 5GIPE 1ZU4A 3DMPA 3ME5A 4MWZA 2NTNA 1FYXA 4QE3A 5ESRA 3JRXA 4KVAA 4MIOA 2AFRA 2A1UB 4QPNA 1JT9A 4W1PA 2PWPA 3WI7A 3QBEA 1JDJA 4LOIA 3ZQJA 1RR6A 2ZWVA 5A7GA 3L07A 5DHUA 5EKUA 5G3ZA 3ZU2A 4GPAA 4U7JA 4HDKA 4WE3A 1P0FA 4QOJA 4DWWA 4Y2RA 1PSDA 3FOWA 2XHZA 3KC2A 1P3DA 4KXYA 1Y3CE 1M54A 4MUEA 1QHEA 5AVYA 1CUVA 5DK6A 1QC5B 2V5AA 1M1NA 1L5GB 3TMKA 3GPCA 1L7XA 2BV3A 1IHYA 2V55B 5H9WA 3C6QA 1E59A 4REOA 5PNTA 5JIBA 3R7WB 3PC7A 1KVTA 3HLYA 2QUAA 4WEOA 3RIEA 5IVIA 2VTBB 1ZYUA 4YN3A 3CZ9A 3KV1A 2AX3A 5HFAA 2ONKA 2OORA 3WK6A 2J9ZB 2A3RA 3NR2A 5JXGA 2X8AA 3JZIA 3JARA 4JJ8A 3BUSA 3C4JA 2PZKA 2DC1A 4JIGA 2I5PO 4L5CA 4D3FA 1FFGA 2BT4A 3B3GA 3SIRA 2VRCA 2WFZA 3AUSA 3U6BA 2FLWA 1D6SA 1IQPA 3CHYA 3HP7A 4R1NA 4INOA 4TWIA 3DZDA 1M76A 4S3MA 1KH3A 2EFEB 3BZBA 5CUQA 4O2LA 4UQOA 4EYOA 3IKTA 1HURA 4C6TB 4CEHA 4FE4A 1Z9BA 4NBVA 2IPOA 1TRKA 2ONZA 5IDXA 1XAJA 4AZSA 3UPTA 1Z37A 5ER9A 2IY9A 4WBNB 5ANRB 1G60A 3OZTA 3TLEA 1EM6A 3FZEA 4B35A 4L8LA 2IU3A 4F4CA 2BJHA 4PG8A 1S3IA 1S8FA 1ZICA 2YIVX 2QTVA 3EZFA 1G2QA 3K0AB 3TZHA 4IQ4A 4ZHQF 3F78A 3CIOA 1UJ4A 3JSXA 3B53X 1RKQA 3OFNA 3FUCA 1E2PA 4W5NA 1PL6A 3UJAA 1VYVA 1BIFA 4PAMA 1VIYA 4R98A 2BUAA 3E6AA 2NO1A 3ESZA 3EUFA 4WY8A 3S8EA 3NO4A 5KSZA 1O5OA 4L1KA 3UYLA 1WZIA 1CB0A 2EHDA 2I2XB 2VOEA 4RHCA 1ZNQO 4PAOA 1KL7A 4LZWA 1F1JA 3BE4A 5I4BA 3CX8A 1N2EA 1QOZA 4LJKA 4NSNA 4RXMA 4QJ4A 3WGOA 4ESOA 4CQNA 1SKYE 2G0NA 1MHTA 4P8RA 5JO9A 4FFPA 1BKSB 2IPNA 4U2DA 4WA7A 2BI8A 3F97A 3KT0A 4F6RB 4QOFA 5JS1A 3H84A 3O3OB 3ZJ4A 1YRAA 5GVRA 1M8JA 2J3EA 1ILEA 1ADJA 3G2PA 4E5UA 2R00C 1HGXA 1PO7A 4LZAA 1HNNA 4TKUA 5JJIA 1ORTA 1M2VB 3HQ4O 3MOSA 4KITB 2ECFA 1FE8A 1VLJA 3A6ZA 3LLVA 4H0CA 3COPA 1QB7A 1LW7A 3I37X 1SJ9A 3R7SA 2ARKA 1TZKA 4XSGA 4EHAA 3G5AA 3L7IA 3F9RA 3E15A 4HVCA 1YCGA 4PNHA 2OMKA 4QXPA 3UMFA 4EY8A 1ONBA 3L7MA 4KQFA 2VBIA 1E8DA 2I7CA 2XKKA 1Q91A 4WWHA 2HEIA 2PNFA 2HF8A 1GUYA 4HYEA 4ZC8A 4ZJZA 3UZUA 1M73E 5FWXB 2O8BA 4NZYA 3SHFA 4FT2A 1SWVA 2OK7A 2WIJA 4AZ0B 1ENPA 2GS9A 2WNIA 2ZI7A 4PG7A 4CNBA 4I19A 2CW5A 1TFRA 2H1VA 3NT2A 3LUPA 3CX3A 3OA0A 5EPOA 5FA5A 4Z0TA 4PLGA 1IBRA 4W63A 4IJWA 4ZYZA 1K7CA 4KO2S 4J0CA 1ZK4A 4KPGA 3ZLUA 5CD9A 2I0FA 2X7XA 3SXJA 1BJTA 1BCSA 1L2TA 3DOJA 1U31A 2AXEA 3AONB 1F38A 1YE8A 1CUEA 1C50A 3IP6A 4IVPA 3LVRE 4MV7A 1SFRA 3NX4A 4PXAA 3QUTA 5HYVA 2IUFA 1ONNA 2AQIA 4ND6A 5BN3B 2W6JD 4J0DA 4OIMA 1DGQA 2GKGA 1QBGA 1LPPA 4JP3A 3GZJA 4FZVA 3IIEA 1ISSA 2JFWA 3TW8B 2BYTA 3HU5A 1E6MA 4R3UC 1XN1A 3GGPA 1X0VA 2IITA 3JQAD 2C9MA 3PTZA 3T41A 5KTOA 2FMTA 1FX0B 5BSFA 1EIWA 2CXOA 3VSEA 5M29A 4P9NA 1EINA 4TVBA 4I14A 2GNPA 1Z7YA 2BM8A 2POCA 2VWQA 4ZI7A 3BXEA 4ABTA 2DR2A 1BFKA 1XHFA 3WLPA 4DLXA 5BSTA 3VYWA 2ET6A 4AM8A 4MTLA 2HJSA 5JJLA 4O29A 1GCOA 1QHHB 4DC9A 1U3DA 4NE7A 4ZDKA 5LOVA 1VJGA 1MAHA 1Z13A 2WTBA 6Q21A 4GG1A 2IT1A 1GFZA 5L3RA 2UUCB 3WQHA 2ZUEA 2ZB2A 1Q16A 3QLEA 3THOA 3V3KA 5HXAA 4CTMA 2D0DA 3ET4A 3L8GA 4CLEA 3EPRA 3K96A 5LZ8A 1V6SA 2OE2A 1PLLA 3AF0A 3EA4A 4Z0NA 4QZVA 4WNCA 5A5GA 4Y6RA 1OIXA 4BNIA 3BRWD 3BK1A 1WDLA 1NPDA 3D1JA 4JJEA 4KFTA 4R83A 2IZ6A 4RTRA 5FA6A 1N9GB 5IYZB 4LKRA 3RR2A 3EYWA 5KKAA 1ZIDA 2Y1FA 4LQDA 4MKXA 4DA8A 4WL0A 1E3IA 1OI2A 1G291 5LBUA 2I6QA 2V0CA 2J4CA 4PZZA 1W88A 2OD2A 3ZNNA 3ZPXA 3LRXA 3ACBA 5JNSA 2F64A 4I5EA 5EZSA 2H1LA 4LDNA 2VWHA 2CHQA 5JRJA 1SXQA 2OCXA 1IDOA 2C54A 3WYAA 2XNDD 3EVBA 3DF9A 2ASEA 2GJ9A 5JSYA 1L4KA 5B36A 5JCOC 1R0SA 5JEEA 1N3BA 3EFBA 2XH8A 1X7YB 1D0VA 5FRDA 1YR6A 3LHKA 4B31A 3KQQA 1T8PA 5I7AA 2GPJA 2ZI3A 4OL9A 1KY4A 1QGOA 3AH8A 1G5QA 4CIXA 1GSHA 2PX8A 2X0RA 2IEZA 4ENRA 4XI9A 1UPUA 2DHQA 4P4LA 3QKSA 5F73A 5BVGB 1GT6A 2EX4A 1TIBA 4OXYA 4LJ8A 4MVJH 1FS6A 2V3VA 2G5TA 1MAWA 4M9UA 5CDSA 4G1MB 3R9KA 2NN3C 3PPWA 4H0NA 3HB1A 1CERA 2PGIA 1T6XA 3DBOB 1EFVB 4U5XA 2HLDA 2I6TA 2NPOA 2WF9A 2P0YA 3KQNA 3DMNA 1GPYA 3PQEA 4MK4A 2P9YA 3ABQB 3KYDB 1OBHA 2JIQA 3H2ZA 4D9JA 1XLVA 3UJNA 1Z4QA 1E3EA 1C8KA 4ZAGA 3GWZA 4IZOA 4L75A 2VDKB 1HQDA 4UATA 3RUHA 3UQYS 3A3PA 3L0IB 2G70A 3GEEA 1PV2A 4DDMA 1R5JA 4BMOB 4HDCA 2PH1A 1DKRA 1MIHA 5EPEA 4PVDA 2Q7DA 3I0NA 5BR1A 4QC2A 3T3EA 1CW2B 3HN2A 4YC7A 1Q21A 1ONPA 1TL7C 2XCOA 5A02A 5LQDA 4FQ7A 5EXDA 4F9TA 1A8UA 3ER8A 1CR1A 2FHSA 3EWIA 1O6ZA 4ZVPA 4AJPA 3A0UA 3ZG6A 2DX7A 3W06A 1A8QA 2A2ZA 1I4EB 2EFJA 4EJ2A 4P36A 2DE0X 4LQ4A 1OZGA 3T61A 5J2TA 5K3CA 3FTFA 1L4BA 4HVAA 3QX3A 4DV2B 3MRXA 5CLIA 2XMDA 1WXWA 3GLTA 4HUQB 2QX6A 2V7QD 1NY6A 1Y3FE 4MV8A 4F97A 2YWBA 3ZDFA 4JGGA 4JP2A 1PVVA 2FE4A 1DB3A 1U0HC 2CGEA 4EHIA 4UNQA 1YF3A 4ENUA 4CMAA 3UPUA 1YFLA 1KEUA 2PDAA 5AESA 2FDCA 2I9KA 1WXEA 4XFDA 3NC0C 4RD1A 3BE5A 1KNQA 2W7TA 5JFTA 1R0RE 1OI4A 1T4DA 3ILVA 2Q6VA 3PGLA 4CVNA 5I3CA 1KDPA 3BKXA 5JV5A 5LNK1 2OKCA 3E23A 3V1TC 1OYOA 2EKBA 3KHTA 2YJZA 3ZD9A 4EI7A 3VH3A 2X41A 2X3YA 5CFPA 3D6MA 3KX2A 2IH5A 5AVUA 4IMJB 4E70A 1DG1G 4M88A 3R20A 2J3MA 3RU3A 5AUOB 3B1FA 3NB0A 4RGYA 3TR6A 5JS2A 3IEKA 5K0LA 2FFAA 1FVOA 2APJA 2BGMA 3R77A 4L9RA 2FJ0A 3ICQB 2DFNA 3BGIA 2CUNA 2QK4A 4B33A 5KSPA 1J20A 2WM9B 4JGIA 3GHYA 1G21B 3O8QB 4IIYA 4PS1A 4BIMA 1YVEI 4J03A 1YOVB 4XTRA 4YPFA 1OYWA 1WU7A 5EUMA 4K0RA 1PS0A 5JI3E 4N3GA 4B6GA 3H9QA 3O3CA 5F1PA 4EA8A 1NBIA 3A6LA 4CF5A 5FR1A 5FWNA 4F11A 4JIMA 1BJRE 1DRVA 4GVPA 4X7MA 1L7DA 3LL7A 1UXGA 1XJWA 4TZKA 1K3FA 1AS0A 1TVKB 2P2CA 3D4LA 3DKPA 5GONF 4JEUA 2YWRA 3JALA 4J2HA 4PZCA 2BOVA 3P5SA 5AXAA 4ZYTA 3KKPA 3W8EA 5MGBA 2OKGA 3DMGA 4AP6A 2LNDA 1GTRA 3MJHA 1WU8A 1SQ5A 5KQMA 4UUMA 1FRVA 1QHGA 2R87A 4HAXA 4M36A 4ZCTA 1X86B 5CD1A 2W42A 4UTXA 3RUCA 1A8HA 2PWYA 1VL1A 1WJGA 4FI3F 1LS6A 4HFMA 3U39A 4X91A 4D4KA 1Y1QA 5C1BA 3GEIA 1LNQA 1M5TA 1FMCA 1A98A 1JPVA 2O0HA 2WV7A 4L8GA 4R8LA 1VE9A 2L69A 2ZIXB 3KIPA 4ND7A 4JI6B 3SGLA 5TPWB 4CKXA 5L4NA 4CG2A 4KMMA 4BECA 1IZ7A 4C7OB 1TTHA 3A1WA 3D31A 1L1FA 2DUNA 2QRMA 4JB0A 2GA8A 1X1QA 2Z56A 4BY9E 3ZX5A 2XQVA 1Z68A 3SSAA 3L0OA 3FLMA 2F3RA 4OD0A 2SCUB 1E9VA 1OF1A 5TRTA 3Q7IA 3AETB 1JJBA 3LDAA 1V9LA 4E11A 4D3SA 4L5IA 2JAOA 4J76A 1JUDA 4MZDA 4BLUA 4DADA 3A26A 2REQB 3Q9SA 4IFIA 4DA6A 2QRUA 3TLAA 1YI0A 3NQ41 1SBQA 2V1XA 1XMQB 1EEXB 1GYRA 3JWIA 3QELA 2HSZA 4H60A 4DM4A 2C1EA 1AK9A 3BGVA 4B43A 4GKVA 3CG0A 4Z2AA 3PIIA 2H8KA 3LYHA 3WLOA 4D9NA 4EW1A 3SJAA 1XVTA 3UPDA 5KNCA 3REGA 1FTNA 1GQRA 3ZJTA 3DKIA 3IHTA 4ZFNA 1W5EA 2VLBA 1SIUA 4AECA 4Z1MD 4PPYA 4FONA 3AY6A 2XMQA 3WYFA 4DREA 3A58B 5ALMA 3P0JA 1EG7A 1ZJ6A 4BQSA 1TU4A 3SJCA 4CV1A 4PNEA 1SCAA 3ABSB 2QL5A 2VJDA 1NQ5A 1G1AA 3I0MA 1ULZA 2VRNA 4X1KB 2P75A 5HFJA 2B37A 3EDMA 3RC3A 3GJTA 3RC1A 2R8PA 1KHTA 1M75A 5C7IO 2VYCA 2C03A 3SBOA 3UJCA 3GJ8A 2AYZA 2DUWA 4QXAA 4WNAA 1N2HA 2ZB3A 1OILA 4RDIA 1K7EB 2G17A 2ZJBA 5C8ZA 4ARCA 2Q8NA 2HSEA 1N5MA 4M0FA 3A14A 3IIIA 3L04A 5M7EA 2GPTA 2IEDA 3AUAA 4BRZA 3V9AA 4DR6B 1OV4A 1NXWA 3IA7A 3HVIA 5ECGC 5HMMA 1WO8A 1RZRD 1SC9A 1UMDA 2X8JB 4M8NE 2V03A 3TFQA 3G7SA 2AZXA 5IANA 1UJMA 2OFXA 4CTKA 9LDTA 2JG3A 1M8FA 1JIKA 2BM9A 4D6YA 4PX3A 5MFZA 1U0TA 1WW2A 3GLKA 3K8ZA 4LBZA 1I80A 3W2IA 1U0FA 5EJ7A 4LZLA 2YVKA 1ZG3A 5FL7D 3STVA 4R9RA 2E6KA 3CWZA 4TUYF 4QOIA 4C43A 3NHSA 2ZI5A 2F00A 4TM8A 1USIA 1VE1A 2QP9X 1IMOA 3H7IA 1WXXA 2CK3A 2X23A 3KG2A 5BSMA 3KUXA 3B3AA 4EVIA 5A9SA 5JD3A 1EVJA 3ILXA 4HZUA 2WJIA 2ZT7A 2JH9A 5BSEA 5CIWA 1E1KA 1WM1A 5HBRA 3SHVA 4DLSA 2P6MA 2V58A 3SC3A 2JFQA 2ZSFA 5JNRA 3HG7A 4CTNA 1P4JA 2CN1A 3ROGA 2H07A 4X7RA 1H2FA 3GRCA 3KKEA 4M99A 2A35A 2CLLB 3GRKA 3JPWA 3DCYA 4HDMB 3EBOA 3RCBA 4ZTZB 1YIOA 3ZK8A 1GG5A 2H3HA 1NW4A 2WFLB 5F7ZA 1CKEA 3E22B 1OFUA 3EH1A 1QANA 1S2MA 2W2KA 2X8WA 3M2TA 4H7FA 1OFVA 4YRLA 5DHAA 3OOEA 3WXBA 4O3MA 5EZQA 4W5OA 2CLCX 1Z73A 3TL6A 4GF5A 1N2CE 1XTSA 2XNSA 4E08A 3MUOA 5HKBA 2A5FA 4TL6A 4XIFA 1WW8A 2QYHA 4MXDA 3BREA 4YRQA 2V6JA 2K4MA 3K1AA 2BHTA 1TQHA 2JGMA 2QRLA 4FHGA 1FFBA 4NU8X 3VPAA 5C7LO 3V4RA 2OR3A 1N5KA 1M6YA 4RKWA 5GJBA 1AKMA 2CCJA 1DTSA 1CY2A 1RYHA 2MYUA 4GLBA 4J0EA 4HNVA 3E27A 1T0UA 2Z2IA 3TVYA 4AURA 1CS0A 4V2UA 3G8BA 4AJ1A 3U44A 2RK6A 2N75A 1J25A 4K8RB 5DI9A 3Q7TA 2FJUA 4HB3A 1VE5A 2D8MA 2MYTA 3WFJA 2ZEJA 4DWOA 5KHAA 4FR5A 1N1MA 2DVMA 2OXTA 4OLFA 2WYIA 1LTKA 1YQDA 3GX1A 4EO9A 1RRKA 1ST3A 3ZD7A 3VJRA 3PWTA 4FBGA 1ULUA 3K9QO 4G5OA 4Q47A 1I3NA 1E1QD 2RGAA 4EHLA 4UTPA 3OQMA 3ZDRA 1PQUA 4ML3A 4BX9A 4PSDA 3H99A 3QEOA 1M1YB 1VGRA 4R9VA 1DV1A 3R5TA 4PIVA 1PWYE 4NAHA 2WG1A 4DA7A 4E6PA 2HIAA 2JHCA 1QUEA 4EKYA 4MW7A 1YA6A 1D2GA 4XM2A 1VXOA 5AXCA 3S27A 4CLDA 2GMWA 1SUAA 2HU8A 1EUCA 1PLKA 3I1FA 3DS8A 2PMFA 2QIOA 4U2BA 5AVJA 1NI3A 3DNMA 2CV2A 1FPQA 4OK6A 2HZ7A 5FHQA 4HAOA 1JLRA 1ZCBA 4WOCA 4IBOA 1FYFA 5KX5F 4G0QA 3JQGB 3TKAA 2N47A 2WWFA 2EWMA 5EIOA 1KSFX 4G8JA 4RY9A 4B7XA 2DCUA 2W6OA 1GR1A 2QD4A 3NT5A 5L4SA 3D4BA 2C92A 3RFTA 5ICGA 1XIVA 4H4EA 3IVCA 1ODFA 3V4VB 1TC2A 4EI9A 5D3KA 4DG8A 5TLSA 1UFRA 2E49A 3UK2A 3NBZC 4L9SA 4FEEA 4IMPA 2XXAB 1ENOA 1EVLA 3KAPA 4Z49A 3D4IA 4B6RA 3WA7A 3NS7A 4V38A 3HBAA 4NZMA 2V5VA 3JCZA 4LDPA 1QLWA 1HDZA 4LX8A 5H3HA 1UANA 3R24A 3L92A 2P11A 1RWMA 4RE6A 2JFUA 1U9IC 3AHIA 3AZQA 1QQAA 3SBDA 3NUZA 4I4LA 3D2AA 4UOQA 1IZ8A 1M9NA 4FEAA 4E51A 2A1TS 1H94A 2DPXA 4EWLA 4L6IA 1OHHA 1LX6A 1SHUX 1JKXA 2CL6X 4IVRA 3MCZA 1SC4A 4TQGA 5D5PA 4EW3A 3KQKA 1JW9B 2OENG 3I52A 1CR6A 3ZNQA 1WBDA 1MNQA 2OUKA 1DG3A 5HIKA 2DGDA 3AQIA 1XKQA 1RU3A 4R1TA 3ULKA 5IN4A 2TYSB 5IJ9B 3BH7A 5K0CA 1IN5A 1GKIA 1B2RA 5GMOA 1A27A 3DSRA 1D4OA 4FGJA 2L18A 4Q3AA 3USCS 3FHTA 2MINA 4MIKA 1K4MA 1AGXA 3M0EA 3WK4A 1ZN9A 2BLNA 2KSQA 4AQ7A 3HRHA 1TVMA 4MUXA 1OKKA 2O8EB 2YBEA 3CWCA 2WV9A 4LJRA 1NC3A 2V45A 4LYFA 5EHQA 4E3WA 3LY5A 3H1BA 2I9PA 3P32A 4BE9A 4C6RA 2F1KA 1KFCB 1UK7A 4MKIA 2J5QA 4F9GA 4KXVA 5CYOA 3TJRA 1JH9A 4UC0A 5KTKA 3ZXIA 3PVCA 1S3SA 2KB0A 2JCSA 1FXUA 1H3FA 4R84A 3ADDA 3L4SO 5DHFA 1NMEA 3LDGA 1P5JA 3OM1A 5FBLB 2PKRA 4J1SA 4YAWA 5F51A 2AEMA 2IOFK 2Q3LA 5B1HA 5DSTA 4LSMA 1FDSA 2AOTA 4TMKA 1MMFB 1TJNA 3GVIA 1XZLA 3I01M 1Y6ZA 2LCFA 3QG5A 4LK2A 3O2QB 4GMGA 2I62A 3VFDA 1DQYA 3QP9A 1EWRA 1B15A 2ZDGA 3EEYA 4B5LA 1YQUA 5FH9A 4B3GA 2BGLA 3LRPA 4Y1RB 1JH8A 3VPFA 1NJ6A 1CCWA 4B3BA 1EE1A 1NPYA 2WQ6A 3WYBA 1FUKA 4RZHA 2AGVA 1XKXA 3MJ4A 3PKIA 4JHXA 4JLKA 3AJDA 4RK5A 1U0JA 1B1CA 4PN3A 2WUWE 4EKEA 1Z07A 3LA8A 3LLMA 3QWFA 1JAHA 1E3LA 5DBEX 5HCUA 1QP0A 1QYVA 2IPLA 2P4QA 1PG0A 1AHHA 2GRJA 1R3UA 1ZGHA 3GJ3A 1R6VA 4F7DA 2AI3A 2O3UA 2ZJOA 3FTDA 4J75A 3NAGA 4O2BF 4TKZA 4NK5A 3S5JA 3QJ5A 1HDRA 3QSYA 1HNZB 3HCDA 3NIFB 2VXOA 2XWPA 4QAQA 1DKUA 2AZDA 5SYAA 3HM9A 2OZLB 3QTTA 3GPDG 1E4OA 2P35A 4RCVA 3TMYA 2HLNA 1GA4A 2R60A 1IXYA 5CCDA 3N8DA 4LF4B 2G7ZA 4CT0A 5T4EA 2XBMA 3SZOA 5C37A 1Z0ZA 3G2NA 1AXEA 4C4OA 4OV6B 5LP6C 3R3XA 5DW0A 2RGGA 1ZM9A 4PO8A 1VMKA 4YFYA 4FFOA 3GQVA 3DYVA 2VDUE 1F17A 3P4YA 1RXVA 4BNMA 1S8NA 3S5UA 4NOJA 4EABA 3WL5A 1Z08A 2H7VA 1QR6A 2Q0SA 3B48A 3RADC 4N7RA 3FMIA 2I2FA 2PCJA 1Z06A 3MB8A 3EISA 1MDBA 1LDYA 1IN8A 2E4XA 3BTVA 5GZ1A 4X9XA 1QO0D 2QUJA 4EHJA 3WL7A 3O4RA 2H2DA 3C3YA 3SLGA 9ATCA 1SK8A 1U3WA 1JEAA 1GZ3A 1I4LD 2H18A 4LDRA 2OUIA 4U7TB 2JBAA 1GZ7A 2IZOA 1ZA2A 1AS3A 5KMGA 3TQCA 2E48A 3FHJA 3O92A 2WWRA 3QQ5A 1PTKA 2Y1LA 1JDSA 4XLZA 1XDBA 2J5XA 3V8NA 3C43A 1VBMA 2GO7A 1Q5PA 4WIAA 3N53A 5HIMA 2HH9A 3A8TA 4NL4H 3TBHA 1SKQA 4P32A 1JKJA 1A0OA 3H5TA 1NC1A 3G88A 4IIGA 4ZCMA 1VIAA 2B3DA 1YRQA 3QKTA 5C8DA 5JALA 1RIIA 3DNFA 5T41A 1V4BA 5JUWA 2M2IA 2WW8A 3L0YA 1C0LA 3CZMA 4ND5A 1ISGA 3COWA 2QTGA 5IDQA 1RXUA 4RK7A 3B3JA 5IJZA 3C4VA 3ELUA 5BQPA 2F55A 3ENQA 3E7FA 3PLRA 3TIGA 2BKXA 4BL5A 1UDBA 4E5KA 5IBQA 4X93A 3RVMA 3PUWA 2RHOA 2FSVA 1BEEA 4BFSA 3HN6A 3VQTA 3IV7A 5CT9A 4P0PB 2PMDA 3KU4A 2ZYWX 2P2GA 4N8EA 1SM4A 1TLLA 5BW6B 4BFXA 2B30A 2ZJ1A 4RPGA 2XQJA 1OAKA 3PX2A 5CT8A 1P33A 3RRYA 4TRJA 3TE6A 2Z9CA 3JZMA 3RODA 4C4YA 3GLHB 4R3NA 5DYNA 3GK3A 4RXUA 4ZMBA 1CUGA 1TUIA 5TE9A 3RVRA 3CRZA 4HGOA 2VT2A 4REQA 3JAKB 4HH1A 5F23A 5E6RA 1ZD9A 1DU4A 1RQ7A 2GK3A 3GP3A 5J2UF 4A0QA 2RFLA 1UJ5A 2XODA 1F3OA 1JLHA 3WRYC 3CVYA 1WB9A 3A4TA 4RFLA 1ISHA 4EX6A 1K97A 5A03A 3LBHA 4YB8A 3VGJA 3S7ZA 1UMBA 3I23A 2OFOA 1EK2A 5LZ9A 3DMFA 4JQCA 4F3TA 1DKLA 2G9ZA 3ABZA 5D5HA 2YZ7A 2AVDA 4CT4B 2GLXA 3CZ5A 3DE0X 4EX7A 5J4VA 4ZV9A 3DE3X 2ZIFA 3IAS1 5CLQA 3NOVA 3DB2A 1T9BA 4BNKA 4JEIA 2C98A 3S4YA 3WLMA 1Y9AA 4C0XA 2P67A 4RPHA 4ZDJA 3EBLA 1X13A 2ZPAA 3FSRA 4CM8B 1ES9A 3TEFA 4UM5A 2OHFA 4QARA 1OJ7A 3I05A 2NYAA 4NH0A 5FPSA 3I0ZA 5LYJA 4CMJA 1AMNA 1RYNA 3EAQA 1EM8A 1R4AA 5KNCH 3E82A 3L1HA 3AL2A 3KL4A 2YY6A 3WLEA 3HO8A 4DCTA 5IHXA 2OGWA 1JAZA 1SXGA 3L1UA 4PYLA 2E37A 4E30A 3WNQA 2J3JA 4PAWA 1DEAA 2EYUA 2Z30A 3UGQA 4J7CA 3AC0A 4L4ZA 4FMBB 2VHQA 3RK4A 8MHTA 2NZXA 3FR8A 1L5HA 4V1CB 2Z83A 1LS1A 1T2FA 3BB3A 2UYCA 4D82A 3PX3A 1HTTA 4R0VA 5CB8A 1LD3A 1S2GA 4AXXA 3PUJA 1WIWA 2FP4B 4WZZA 1NW7A 4JC0A 5B3LA 3ZW9A 2X9GA 2Q3FA 3EVGA 1BEUB 3QU7A 4HJRA 1R9MA 4UU7A 4XQ9A 2ZYRA 5K8VA 3FYCA 1ST2A 4TUYA 5ADVA 3ZWXA 4ARVA 3QHQA 4LI0A 1AV6A 1O8BA 3TRIA 1WMAA 4TMXA 1T4GA 5B53A 4AS3A 5IVHA 2QRHA 4EJSA 4ZYWA 1JSCA 3UAYA 1L7AA 5EGNA 5KWIA 3H1EA 2FX3A 2JI7A 2A7QA 3RVOA 2Q5QA 5FEUA 4K03A 3H2JA 5BT9A 2OM2A 1SOUA 2BI4A 3GJ7A 1XWIA 4IRMA 2AC4A 2NUAB 4Z7NB 1M2EA 1K6XA 2JHAA 5ED4A 1EQ2A 1BD3A 1NVVR 1UBJS 3WLNA 1KQFA 3FYSA 3HA7A 3GCWA 3JQ9A 4E22A 3DDNA 1PE0A 5BUSA 4C0HA 1KEZA 1RXCA 3P96A 4KQKA 5IWAB 1SHTX 4PCAA 2PGOA 3PXGA 3EUAA 3F1KA 5EYPB 4W6QA 1D6NA 3E7PA 5C34B 1REQA 2W90A 3ZKWB 4X8LA 1H42A 3LUHA 1DEOA 4ZO9A 3SQDA 1OE0A 2HQSA 4ZOLF 3SHTA 1HTBA 5H5JA 1IC6A 4PG6A 4WACA 1O5TA 1NA5A 5F9MA 4ER6A 3KQLA 3TYXA 1R27A 4EZIA 1O4VA 3AF3A 4RNCA 4B2LA 4K9MA 1WB4A 3NJ8A 5CNMA 1N2IA 3GGSA 3T7IA 3WGKA 2C9OA 3KKNA 1QIJA 3NHAA 4G1VA 1PJRA 4WERA 4TT3A 1RJFA 1T2NA 5FPTA 2B34A 4B3JA 3DG9A 4RQBA 4MYUA 4OB8A 2EJVA 4EARA 4ZPXA 3BWYA 4H4DA 4BWYA 2VJPA 2ERXA 3T1VA 4DAEA 4CLOA 2GLUA 1UEJA 4JVOA 1QHYA 4FZRA 4FYJA 4FHDA 4JOBA 4D9KA 4FS8A 3W1EA 1ODTC 5DM0A 3PHBE 4KV9A 1OW3B 1HK7A 3CEHA 4YFVA 4ZMSA 1UDCA 3LO5A 3VTZA 1T4CA 3OU7A 1SCDA 4EKNB 4FB4A 1B4DA 2O2GA 1BVRA 1KI1A 1Z34A 2V4ZA 2WAMA 1G2PA 2HUNA 3O8OB 3QMPA 4B74A 3AUTA 2DMRA 3JYHA 4ZU3A 1WXIA 1WZCA 3GC6A 3L4JA 4MYTA 4EFNA 4Y7DA 3PV0A 3U7QB 4F3KA 1KMMA 3CLUC 3B52X 4PRYA 5HMLA 2C2OA 4MVJP 2H1RA 3WWDA 2IEIA 2OHIA 2ZE7A 1XYYA 2OHHA 4NMWA 3DEHA 2HPVA 1HOXA 2O50A 4FTWA 3F6CA 5T4FA 1QG6A 3FAKA 4C0KA 2GXUA 1UPFA 3FHLA 2VK4A 3AW9A 3UAZA 1KDTA 2NNLD 2DUJA 4A7PA 3IE1A 1SKUA 4E5VA 3QVSA 4QNRA 2CMKA 1KRHA 2DU8A 2P77A 4KW7A 4M8SA 5KX5A 3B70A 3UJ9A 4OIFA 4I46A 7REQB 2C1XA 3AGPA 1X7ZB 4BO0A 2JEOA 1CEYA 3BQMB 2GAFA 3A9SA 2D1QA 1WWKA 3BRSA 4HKTA 1VSUA 2VK1A 5E6UA 1IK6A 5IC6A 1H2RS 4B4OA 4HNAB 1HLDA 1L5SA 3OTIA 1LPSA 4J7AA 4GRDA 1OJLA 5IKOA 1AUVA 3NBYC 4MS4A 1GCGA 2H7CA 4FU0A 1WPGA 2ECQA 3KV3O 4O0MA 3IPCA 1RQGA 4R8RA 3UV6A 5LD2C 4ER0A 1EWQA 4MOWA 3PDJA 4NEHB 4Q15A 2BTQA 4B7ZA 1UJNA 2M6SA 3U31A 3BWVA 1HORA 2DWUA 2JFGA 3ZDEA 3AEYA 3TI9A 2QPTA 1AKTA 4ZA2A 4DGQA 3K15A 2O8CB 1T13A 1XJQA 1LQTA 2PPVA 3KSMA 5ALNA 1E3MA 3UT0A 3VAAA 1I1HA 3NLLA 2VVTA 4D0LB 3DEFA 3G7UA 4LBYA 3H11A 1RACA 1WMEA 2LWIA 3IUSA 1R16A 3PDCA 4IGIA 4KN8A 4EUHA 5K4HA 4LNUB 4B4KA 3FXAA 3IAEA 1P0CA 1XDSA 3O75A 2I03A 2IWHA 3WO0A 1NF8A 3ESQA 1XU7A 4W7HA 3I4LA 3VU9B 4C5CA 5B6IA 1II8A 1YR3A 3DEKA 3DR5A 1W36B 3TE7A 1KAEA 3EZLA 3HDVA 4F5EA 3FKQA 2WVGA 1EE2A 2PJUA 1H93A 4MTCA 4JJ7A 2FPRA 3A1NA 4RAOA 3I2YX 3VHXB 2A6PA 3B3FA 2PLAA 3EYAA 3ELYA 1E61A 5FHRA 3RT7A 2EU8A 2CMFA 5CIYA 1PWZA 5AXDA 1NVFA 4FMDB 1BHO1 3EHDA 1B8VA 5DF1A 2CXXA 3AV3A 4A26A 3U13A 4Y2PA 4HZGA 1PZFA 4Q6WA 3SWWA 1BXRA 2V7XA 3LQ1A 1RYEA 1OXSC 3L4EA 1DAFA 2ZJFA 3O9VA 1PEKE 1JT2A 1NXTA 4FGSA 1PT7A 2J3DA 4RU1A 5T8KA 5TX7A 4LF8B 1XD8A 2NMVA 2MSNA 4NJOA 4Q7LA 4F3RA 4UULA 1TNDA 1M3SA 2AG8A 5BUQA 2JCXA 3SHOA 5KTYA 4ZEXA 3TZLA 2C2ZA 1SU8A 1K08A