4Q00A

Crystal structure of an s150a mutant of the e. coli feob g-domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
255
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAERKEGQFSTTDHQVTLVDLPGTYSLTTISSQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVATRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the correlation between the sequence composition of the nucleotide binding G5 loop of the FeoB GTPase domain (NFeoB) and intrinsic rate of GDP release.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
molecule keywords Ferrous iron transport protein B
total genus 85
structure length 255
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q00A01
4OHXA 2VHQA 3KKPA 4Q1FA 1HT2E 2I3BA 1BKDR 5KHOC 4IDPA 3D31A 4Y0AA 2FSHA 2ZPTX 4PANA 3B1XA 1OH5A 4HUQB 1Z0DA 1MRNA 3REFA 3V00A 4HLUC 3ZVMA 4H1VA 1T91A 5BW8A 1VYTA 1S3GA 4KXFB 3C41J 2GVDC 1SHZA 2QU8A 2ATXA 3TSWA 2F43A 2P6RA 5L3SB 4US2R 2GJSA 3Q7PA 4JVLA 2W0MA 3BERA 4K46A 1UEIA 2VP0A 3BORA 3KQNA 1JR3A 1FW6A 3PUYA 3PFIA 4FCTA 2B92A 3EARA 1XMJA 3GFOA 3PUWA 5K8LA 1TAGA 5B57C 4BGDA 4AG5A 1G3RA 2WM9B 3W5IA 3KL4A 1O87A 4MGYR 5M04A 1PUJA 2FFAA 2A5YB 1HURA 4O2RA 1Z6GA 3F5FA 3OIVA 3A1TA 3FMIA 2QGNA 5GJVC 3W5JA 5ELXA 3SFVA 2ZUCA 3ZLJA 4S2EA 3THWA 3CLVA 2GZAA 3B5JA 1N6OA 1JBKA 2QTVB 3KQLA 3BD9A 3B78A 4RFVA 4TTRA 4D0GA 1AQYA 2NQ2C 1TADA 3QE0A 1E2PA 3KXKA 4IKEA 2ZXUA 2PZGA 1B23P 1ZNWA 3OHMA 5FBWB 3T5GA 3L8YA 4ZI3A 1G5PA 5TMPA 3PEYA 4NE2A 4US0R 1Z0FA 2XTZA 2UKDA 5D3QA 1GKYA 1E9EA 4WA7A 2QG6A 4KODA 2IHBA 2ZRDA 2DFNA 1G7CA 2KBFA 1SVIA 4OKSA 4Q1EA 1GAJA 1L2TA 3AVYA 1Q1QA 4IJMA 3X1WA 4OBEA 2BMDA 4IEIA 5LD2C 2HYIC 2BVNA 1SXJA 2ZR0A 4EJSB 3RHFA 4QKQA 3U5ZB 5DI3A 4A0GA 4G5RA 3K0FA 2NO1A 2W00A 3EC1A 3OEEA 4RZXA 3CF0A 3ZZUA 1E0SA 1ZW6A 2WSMA 1DAFA 1GL7A 2H5EA 5E7MA 2VHJA 4E22A 1HA3A 4DT1A 2J0SA 3T1VA 4KLNA 3T1QA 1KSGA 2BIFA 2MSEB 3MMPA 4LYFA 1CXZA 2P5TB 4YDHB 2HCJB 4M22A 3PJRA 1YR8A 1T8UA 1VG8A 2HXYA 3FMFA 2FPMA 1P2UA 1E1QA 4NZYA 2X8AA 5FI0B 1O3YA 2ZITA 1R5BA 2F3TA 5FOXA 5EE5B 1E6CA 3HU3A 2ZSEA 3JZMA 4LJ4A 3ZQ6A 5DE3A 2DFKB 4JBYA 1AQUA 1H8HD 1W36B 1TTTA 2KJQA 1II0A 4A1FA 1NRJB 4XVUA 2D4HA 3UG6A 2IS6A 3NEYA 1VCOA 3KX2A 3QXHA 3ASYA 4DEXA 3R7WA 1FNNA 4RCYA 1RW4A 5JWRA 2O52A 1A5TA 1YZUA 5DGXA 2NMVA 5DYGA 1K6MA 3AP1A 3ICQB 1JJ7A 4TTPA 4AYWA 2E9SA 2ERXA 3BE4A 1E9CA 5TV2A 2DB3A 4NTZA 5DLQC 1A2BA 1M7GA 1CU1A 4DCVA 2AKYA 2ASEA 2BDTA 3DDCA 4PPNA 3SN6A 4H1UA 3N2IA 1MABB 3FMPB 4WXRA 2BJWA 5GVRA 3HU1A 3TUIC 3W34A 2IS1A 5DO9A 1VG0B 2P6UA 3DKPA 1I4LD 4N0EA 4CEHA 1NVVQ 3LA6A 3ZIAA 1KO8A 1XCPA 1TU4A 3TBKA 3P26A 2WTUA 1SZPA 2D7DA 4TL9A 5CJPA 1XP8A 4DSUA 3HPQA 2GRJA 3IBYA 4QOSA 2ZU6A 1S9HA 2GKSA 4URXR 1Z8FA 3V9PA 3LD9A 3Q7QA 2O8CB 2OFOA 2IL1A 2ZRGA 4Q7JB 3RS0A 2AXPA 1EX6A 1R5NA 1NBME 2C5LA 2UVQA 1HEIA 5D3MA 1W7AA 2W6JD 2GK7A 3GJ7A 3AUXA 3UG7A 1U0JA 5KU1A 1H8ED 4BLRA 4HB0A 3EAQA 3C5HA 2O0JA 1XZPA 2VO1A 4RCZA 3EPLA 1DARA 4TN1A 3SR0A 1GRRA 2V7QD 1XMSA 1KDOA 1QRAA 2B7CA 3CIOA 1NKTA 3KTAA 1LW7A 2IA5A 3OEED 1NN1A 5LB4A 4QFMA 1NY5A 2ZIAA 2AD5A 1ESMA 3QUSA 4B75A 1L4YA 2DYKA 1G20E 5EJEA 1P61B 1NN0A 3E70C 1JR3E 3MJHA 2GCNA 4IEEA 3CW2A 4LZZA 2IYWA 5IDVA 4AI6A 4MDEA 3P4YA 4XTCS 2GXSA 4LYJA 1UKZA 4BFUA 4URWR 1RRPA 1VTKA 3CBQA 4OYHA 2JLRA 4HZUA 4M4SA 5KNCA 3RRMA 3CX7A 2X77A 1KJZA 1T3HA 2G77B 1ESNA 5FOVA 1X3SA 5FPYA 3LO5A 5EQTA 5KSZA 2EWWA 3OAAD 1E2LA 2CNWA 1VCNA 421PA 4WAUA 3A58B 2FFQA 4BLPA 1R7RA 2WPDD 2J0UB 1Y63A 1D9XA 1DELA 3ZZ0A 4BECA 2O8CA 3EG5A 3T61A 2WBLC 2ZQ5A 1NG1A 3ONWA 5SZKB 2YHSA 4Q01A 3ZD7A 1CJMA 1H8EA 2W2XA 1VDZA 3QOFA 1AM4D 5J40A 4C30A 1JQJC 2HEIA 3QXSA 3VMFA 3BFVA 3OFND 3QPVA 5IF9A 4WZ6A 4Q1DA 4C0AC 1X8LA 1ZVQA 4HLUA 5EP2A 4A9AA 1S96A 3OZXA 3UMSA 2G3YA 4JLJA 2OE2A 4BUJA 4DLYA 1WDTA 1W36C 4LHYA 2QTHA 4FWTA 2D74A 1G9XA 1FTNA 2FG5A 3Q5EA 4KSBA 2VP6A 3MWLA 4Q21A 3KFXA 2RGGA 3UPUA 4C3ZA 1NNEA 3BJIC 1GNQA 5JI2E 3OAAA 1FOEB 4M53A 1YU9A 4US1R 1KNXA 2XNDD 5KPDA 1G16A 3TVDA 2ODBA 2PL3A 2FZ4A 4HAXA 4FCVA 4YMTA 1KHTA 3LBNA 5TDHA 1G6HA 2O0KA 2GXAA 2ZJYA 2OLJA 2PEZA 3VX3A 3VKHA 1E9BA 2C96A 3CUEF 5JJLA 3ICEA 1W4RA 2C2HA 2N1BA 1P6XA 2QAGC 5HCIA 3CKLA 3TAHA 5L3SA 4TQUS 1QHIA 3CH5A 1E79A 4DCNA 2GEDA 2FJUA 1IY2A 1PUIA 4RVCA 4A8JA 1MRSA 3Q9LA 4UNRA 4FW9A 3PG5A 4ZPXA 1Z6TA 5E7IA 1ETUA 1TPZA 4GT1A 2J7PA 1FPMA 1FNMA 4HLQB 3T1TA 5G3ZA 4BZQA 5EE1A 2ZJBA 2HUPA 2QUZA 3KJHA 2CLDX 4DZZA 2IS4A 1XDBA 3KJGA 2P67A 4L9WA 4G5GA 2JA1A 2OFXA 3HP1A 1KTVA 2CK3D 2GJ9A 2KSQA 4F7WA 4EPVA 1ZC3A 2QBYB 2AK2A 4AKIA 2VP5A 1CR4A 5J5CA 3RWMB 4PC7A 1WBDA 2WSSA 3SC3A 1AGRA 4KO8A 1T3LA 4A36A 4O2LA 4L5BA 1WMSA 1R0YA 4YONB 4OHVA 3X1XA 2XOKA 3BGWA 4XOIA 4A6XA 1FQKA 1NBMA 2FV8A 4TYQA 2OBLA 1JR3D 2OILA 3OEHA 3RC8A 4DSOA 1Z6XA 4OI2A 5FFMA 2VF8A 4Q9HA 4MH0R 4A2PA 1GRQA 3WRXC 2FX3A 1Q1BA 5G41A 8OHMA 4DLVA 4AK9A 3DOEA 4Q4JB 2RGNC 4RZ3A 1GG2A 4TWZA 2ZRPA 3SU8A 1W44A 4TMVA 2H16A 4D4JA 2V54A 2CLCX 2N42A 5HZHA 2QI9C 2XSZA 3CB4A 3K0FB 1G291 2AK3A 1PLLA 1W0JD 1VG1A 4KITB 3IPYA 3ZGXA 3JVVA 2IYRA 6Q21A 1T9HA 4QBIA 4PHHA 3ZVRA 4JLMA 5FBVB 4I1UA 4ZDWA 1KI7A 1OIXA 3IQWA 4MKHA 3NTUA 2A2ZA 4KU4A 4D82A 1BH2A 4KSCA 5JHGB 2Z4RA 1UKVY 4RJLA 3KB2A 3ND9A 4ZDKA 2VP9A 3ZVNA 5BQ5A 3GLIB 1OB5A 1HQYE 3TNFA 3IIJA 3L0SA 4HDQB 1EK0A 3DEFA 1N6KA 1E9FA 5FOWA 5H8WA 4MYTA 1R0ZA 3BK7A 3UWKA 4LYAA 1RC8A 4NYJR 2ZYVX 1Z6YA 2CVHA 1EFRA 2ZE7A 3WNDA 3C7KA 1W36D 3NH6A 1II9A 2ZRKA 2IYLD 3QQ5A 3REGA 1PZNA 3LLUA 3U7HB 2DFTA 5A4JA 3GQBA 3LVQE 1A7JA 1U8ZA 4EKDA 1F2UA 3EW9A 1L8QA 1R8SA 2F55A 5AJYA 1FP7A 4A8JB 4LHZA 3FFAA 4DRZA 2O8EB 1M34E 4GSYA 1F2UB 3U3RA 2EFDB 3EA0A 3U6BA 3RAPR 4XSGA 1ZM7A 2D06A 1MOZA 2R2AA 2REBA 3A4MA 2I1QA 4KYIB 1T3SA 2FPKA 4MRSA 3RVBA 5FTNA 4ZDIA 1NN5A 3ZD6A 1W5TA 2H7VA 1D8TA 3AVPA 4NH0A 4V03A 1OH7A 1R10A 2RGNA 4MYUA 4OHYA 2JJ1D 1X8KA 2Q3MA 2IW3A 2QAGA 5J4YA 3RS7A 4E07A 3UMFA 4CEIA 4DB4A 4GL2A 4BASA 2ZUBA 3WYAA 2EYUA 1UDWA 4FI3C 1E1RD 1T5LA 4OQMA 4L15A 3THXB 3HR8A 1W4AA 4U5XA 1HQCA 1D2NA 4UXIA 1J90A 3QKTA 4LYHA 4QHYA 2WSSD 4BRWA 4GBMA 2PMKA 3IHWA 3CNNA 5A5GA 2XEXA 3KXIA 1COWA 3VQTA 2V3CC 2WICA 3BB1A 2XXAA 3SHWA 3VR2A 2JLXA 2BBSA 2ODEA 5FBLB 2OFWA 2ZS8A 2QRZA 5KO2A 2C03A 4BQSA 4NYJQ 2FZLA 4PC6A 3RS2A 2IC5A 1F2TB 5UKDA 5AUNB 2PLFA 4B43A 4BLTA 4Q7KA 5AWFC 3AP2A 1J70A 3X1DA 1ZIOA 2XNDA 2FSFA 4Q9KA 3VKWA 1F2TA 4W5WA 1XF9A 4HB4A 1NVXQ 2PX0A 2YVUA 4DLUA 2IT1A 5B64A 1QDEA 1Z28A 4L4UA 1Q44A 3SYNA 3ADKA 4M1YA 1XPUA 4CYMA 2QP4A 1S8FA 2YWGA 2QP3A 3IEUA 5TY0A 3RYTC 2CLSA 2Q9CA 1GRNA 3KJIA 1FQJA 1XCGB 3ZJYA 2XXAB 3GLGE 3B1WA 3IO3A 1KDTA 5C18A 2C98A 4RKEA 2BKEA 3MRSA 1C1YA 1JJVA 3WHLA 2WKPA 3KZ1E 1LVGA 1OE0A 1EG7A 3R7WB 4HZIA 5CITA 3RWOA 4ACAA 3CRVA 2X19A 3C15C 1Q21A 1ZINA 2V6JA 2BMEA 1T4GA 1SQ5A 2G88A 3KXLA 1YZTA 1S0UA 1A1VA 1E2GA 3QSYA 2X2FA 2FEOA 4G0NA 1YRAA 4LOAA 1FX0B 1EGAA 1CRQA 2GXUA 1KKMA 2VLIA 3EWSA 4QM6A 4TZ0A 5KDOA 1BMFA 3MD0A 1T0JB 4AG6A 1D2MA 1JI0A 4TMXA 4DDTA 4O3MA 4Q9IA 4HAWA 3FHOA 4GZMA 1AZTA 3PENA 1CLUA 4JLBA 3AKCA 4JLVA 5IK2A 5KSYA 3RNLA 4QJ3A 4B73A 1E9RA 2QNRA 4QGAA 3TR5A 2VHCA 4LDJA 2YINC 4WZAE 4DJTA 4JL5A 4LX0A 4MITA 5D3MB 3PUXA 4QJ5A 1WP9A 4DEYA 1NIJA 4FMDB 4UXHA 3AV0B 4FINA 1NP6A 1OLOA 4PXAA 2IUTA 3BH0A 1G8GA 1ZM2A 3A4LA 3IGFA 3QEOA 3RS3A 3G82C 2BMFA 2H8KA 1P9WA 2ZRLA 2C99A 4P4SA 4BFYA 4U00A 4F92B 1XJ0A 3IIMA 4JL8A 3AGQA 1P60A 4IOLA 1Z0IA 4JLNA 2OSBA 4M21A 2ZTSA 1GVNB 3LQQA 1AS0A 3HPRA 1SVOA 3J81k 1KYIA 4BLSA 1S4QA 3SJAA 3KJEA 1JALA 2DPXA 3K70C 1XXHE 4KI0A 1ZNXA 2G1KA 5LDDC 1GNPA 1HE1C 2QMOA 1E2NA 1U0HC 1ZU5A 4Q9JA 1NLZA 5CIQA 1KMHA 3RRZA 4Q1BA 3Q72A 3ZH9B 2DR3A 4CT4B 4D4LA 5JCZA 2OEPA 5P21A 2XZLA 4MGIR 4MRPA 1Z06A 4NL4H 1RJ9A 3C4JA 1RYFA 2FN4A 3DL0A 3P27A 3HYTA 2OAQ1 3SE0A 1FUKA 1ZRHA 2MSCB 1XJCA 1T8TA 1OKKD 2J5XA 3AKYA 4IXNA 4BZPA 1DOAA 4N3NA 1F3OA 1E2IA 3LX8A 3EC2A 3L0PA 4MKGA 1BYIA 2CL6X 1IN5A 3QKUA 1QHYA 1MO6A 4JZKA 2YJTD 2BEKA 2WVJA 1KK0A 3AF3A 3BH6A 4X8LA 1SXJE 1DG3A 2ZU0C 4F4JA 4M1TA 1R5OA 3AH8A 5JHHB 2JDIA 4HEJA 1OIWA 4E03A 1SVLA 1W5SA 4P4TA 1KK3A 5BWMA 3O47A 1DTSA 3L8ZA 3A1WA 2HDNB 4GRAA 4LV5B 4BFVA 1EFTA 3RSLA 2GF0A 3WMFA 4DLTA 3QI2A 1YQTA 5SZHB 3AVQA 4EFNA 2FSGA 1TL7C 4D4KA 3L0IB 2UZ3A 2JLQA 1E69A 2CDNA 1IN4A 5J4KA 1ZAKA 1GL9B 2DFLA 3QPUA 3T06B 2GVZC 1DAHA 2AKAB 3GFPA 4C9BA 1COWD 3TAUA 3FGNA 4JLAA 3SHFA 4ACBA 1N5IA 3KUDA 2QT0A 3FWYA 3W8NA 5G53C 4A82A 4UQOA 3NC0C 1E99A 3FKSA 4PHGA 2C78A 2ZJZA 1KDRA 3OEHD 4ERNA 5AUOB 4D0LB 1QHXA 1GP2A 3QF4A 1DAMA 4C2TA 3LW7A 1IY0A 2W6IA 3X2SA 3FKQA 3MFYA 3WBKA 3SQWA 4C0KA 4NYMQ 3K0AB 3SFZA 3VNUA 1NIPA 2QE7D 2JLSA 3KKMA 4IOMA 4PFSA 2ATVA 4B3BA 4EJSC 5FPHA 2QBYA 4NCNA 2ZSDA 2QQ0A 2OO7A 2P65A 3CWQA 4HB2A 3MCAA 4LY6A 4TT3D 3NIBA 4HLDA 4Q4AA 4PQYA 3UWOA 3DMNA 2BC9A 2BOVA 2JATA 2ZRNA 4IVQA 4XWOA 4CGZA 4BEJA 2J7PD 3UIEA 5JS8A 4YQFA 3VR1A 3KQKA 3D7MA 1TUIA 3CONA 4DDUA 1ZMXA 4LCBA 2WJYA 4PR0A 1KMQA 2RH5A 1WCV1 1OXUA 1PLJA 2Z0MA 4R9UC 4D2IA 2ONKA 4L8GA 2OLKA 2G6BA 3IDQA 4LUCA 5EZ6B 3FOZA 1DPFA 5DN6A 2YYZA 1XTJA 1KO4A 3L82B 4B3GA 2GJKA 4XWKA 2ZREA 4BFTA 1YKSA 2ECKA 2V4ZA 3QBVA 3W6NA 4JLPA 2GZHA 3EIQA 1SXJD 2Q3FA 1NSTA 1FZQA 2GK6A 2VEDA 1NF3A 3F0TA 5JWHA 3DMDA 3NC1C 2XAUA 1EWRA 1HV8A 5HE8A 2PH1A 1EX7A 2RHDA 3C5CA 4OJKA 2ZI6A 1KI6A 2ZETA 4JVSB 2ZI3A 2NG1A 5F2EA 5FBRB 4U7DA 5HKKA 1KGDA 3AVXA 1QHSA 3CNLA 4DT1B 2JLYA 1EWQA 2CMKA 4WOPA 4QNMA 1KK1A 1OXSC 5CYOA 2KWIA 2VL7A 3QNUA 3KKQA 2R6CA 4JBWA 2ZE5A 3BBPA 2ZI4A 4QG7A 1FMLA 2PZEA 5G3YA 3RDPA 1XEWY 5BXQC 5TB5A 3FHTA 5SZJA 1ONBA 3EZ2A 4ON9A 2EU8A 3RRYA 3B1YA 1ZU4A 2WMNB 3NH9A 4LHXA 2IEZA 4PAMA 2F6RA 3EWAA 3WYFA 3U7FB 3VX4A 3DOFA 4GNKA 3KKNA 3QXCA 1HT1E 5CIWA 3CRW1 3F8TA 4Q9LA 2CVFA 2W83A 4PSVA 4RD4A 3AF4A 1KIMA 2EVWX 4B74A 1HUQA 2AL7A 3NXSA 3TSZA 1XPRA 1RFLA 2A9KA 1G19A 3ZQJA 2J41A 2D7CA 1TQ4A 1UPTA 2UZIR 3HJNA 4HLCA 4JSTA 1W0JA 3WRYC 4Q48A 1M8PA 2QMEA 4AYTA 4G5SA 3BB3A 3U44B 2G83A 1YZLA 2QSYA 3N2EA 4CVNA 4X8MA 4JLKA 2B21A 4Q03A 1JQLB 5KNBA 2GAAA 2P5SA 2GCPA 2ZR9A 4GP7A 2J9RA 1Y3AA 3H84A 3PXGA 3A37A 2NZ8A 1K5DA 1CKEA 2V7QA 4IXMA 2YWHA 4KAXA 2BCJQ 1CR1A 4V0MA 1OFTA 4NHOA 3L0OA 1OPXA 2IYVA 4R2HA 4XJXA 3GJ0A 3Q8XB 1E1RA 2FFBA 1ZUNB 1MKYA 2QMUA 1QVRA 4AC9A 3HWSA 521PA 1NVWQ 1U8AA 1PVOA 4TYPA 1KJWA 3C8UA 1SGWA 1G18A 1OHHD 2ZROA 5FPKA 3EASA 4IOJA 4YC7A 5FR2A 1Q1EA 3UXMA 4JYBA 3K0CC 4EPTA 4C0JA 1JNYA 5AK0A 1DBSA 2XOKD 1EFCA 5KSOA 3PEVA 3UANA 3I8SA 1BS1A 4KFRA 3FKSD 1E0KA 4WBSA 1NVUQ 4JKIA 1LS1A 3SJCA 2VH5R 2EFHB 5KDLA 2ONJA 1G3IA 3ZVLA 1EFRD 3EPJA 1T0HB 4C2UA 5DI3B 1IXRC 4PPQA 1R2QA 4NMMA 3NBYC 4GMDA 3VR6A 3BS4A 4NU0A 3BWDD 3K0AA 2RAPA 1AN0A 1Z83A 4HAZA 2WZQA 2QTFA 1IY1A 2IWHA 1SKYE 1N0WA 1VIAA 3U7EB 4QC2A 4LC0A 1SKQA 1X6VA 3QKSB 4DCSA 5C4GB 1XTSA 1IQPA 1UM8A 5F9FA 4JS0A 1XRJA 4LRWA 1KSFX 1ZCBA 3RS4A 2WWYA 2W2TA 4W7SA 1J8YF 3KQUA 1IOZA 4B48A 3NDPA 1EESA 2J45A 1N5KA 1RRGA 3W90A 4GP6A 4ZI2A 221PA 3TLXA 3VAAA 4PX9A 4M9SA 4D6PA 4RZUA 4K81B 3AVVA 1N6LA 4TZ6A 5J4HA 3CO5A 2JLZA 2RHMA 2RMKA 4RZ2A 1F5NA 4RFSB 2R6GA 5EXSA 2Q6TA 3GJ6A 2ZYUX 1N6HA 5EUMA 3FDIA 3GJ4A 3K0SA 3CF6R 1CTQA 5FTLA 2QN6A 4DUGA 5SZIA 4NDZA 4YXWA 3TE6A 1G8PA 3CNOA 2YZ2A 4DDWA 2AWOA 5K8IA 4V0ME 2C04A 1DG1G 3LWNA 2RGDA 5DIFA 2OHFA 3EZ6A 4RD3A 2ZSFA 2QE7A 1TNDA 5EXTA 4F4CA 4AKGA 2ERYA 4RD2A 4B3DA 4X8HA 2VIIA 1N2CE 1KO1A 2B8TA 5EZ5A 5JLJA 1E2MA 4F93B 3Q5DA 4GI7A 1GWNA 1N5JA 2QORA 3CRQA 3K9LA 2HXSA 4N0DA 5KPJA 2OCPA 1X8JA 4LJAA 4M1SA 3A4NA 5FOTA 4JLOA 1XEXA 2QRNA 5CM8B 3FB4A 3WNBA 4GFDA 4G01B 4WXPA 3SEAA 4BEBA 2B6HA 4AIIA 4TYNA 1GKIA 2BWJA 4M1OA 1E2FA 1I2DA 1GSIA 3K8YA 1E4VA 2IK8A 1GZSA 3EZFA 2YWFA 1OV4A 2XZPA 1G64A 5CDFA 1HY3A 2D2EA 1Z08A 4W9MC 4UJ5A 2MMGA 3DKVA 1GUAA 1ZNYA 1XD2B 2REOA 4DLXA 2OCAA 1TQDA 1JB1A 4LGMA 2ZJ8A 1GIAA 4DXAA 1P4SA 3DM9B 5FBQB 4ASUD 5BN3A 1X1SA 3BFXA 2GWHA 3L2OB 3BOSA 4IW3B 4Q4HB 1RPZA 5J4VA 1II8A 1T5IA 1ZP6A 4JIMA 4IVRA 2HLDD 3V4FA 4LHVA 3EZ7A 2IF0A 3EA5A 4JVMA 1M2OB 4PC2A 3DZ8A 2FSIA 4KFSA 5IK2D 2J0QA 4CIDA 3LFUA 4TSFA 3KB1A 1P2TA 5TXGA 3S1AB 4Q4LA 2C9YA 5CK5A 4AKEA 5G40A 4P4SB 5JRZA 4HZUB 4NYIQ 2A5FA 2WAXA 1KI4A 4MKFA 1XTRA 2ZUDA 2X2EA 3GLFE 1GITA 4LBYA 3WP1B 4EQ6A 4MDFA 2IYUA 4S35A 4MRRA 1FX0A 1Z6AA 2NZJA 3B85A 2GJ8A 3P4XA 1GL6A 1M6NA 4HYYA 3VU9A 2PBRA 1ZC4A 4EQ6B 3RS5A 5CYPA 4B34A 1BO6A 1DAKA 1AS3A 4LJ7A 4LV8B 1D9ZA 5B30A 3MWYW 5IRCD 1LFDB 4E5UA 2YWEA 3I62A 3U44A 1PLKA 3VKGA 4IFEA 2H18A 3K1JA 1YZQA 1I4TD 4FMBB 2C77A 4A2QA 1M7BA 4NCHA 1N0UA 2L0XA 4CZ2A 2RCNA 4PZLA 3DHWC 1WXQA 2REXB 5AJVB 4Q18A 2JJ2A 5FL7A 3OIUA 1XWIA 3UK6A 1H8HA 3GLHA 1ZJ6A 5KYKA 5ANRB 3SS8A 3IHLA 2ZAOA 1CIPA 4TMTA 3K9NA 1KY3A 1ZBDA 1XZQA 3NBXX 1XD8A 2AN9A 2ZRBA 3TIFA 1XJQA 1NVVR 1WE2A 4KBFA 4GOXA 3WXMA 4ASUA 4B33A 4MQBA 3TW8B 3BXZA 1KMHB 2IYZA 4JVNA 3TQFA 3C14C 3TJZA 3IEVA 1VECA 4FIDA 1D5CA 1E0JA 1W48A 2QROA 1PV4A 5F98A 1ZM4A 4TQAA 3QXXA 4C4PA 3GEIA 1KSHA 4KVGA 3R8CA 4DCTA 3DPUA 5IHPA 4B71A 5JMTA 2J59A 5TVKA 4YLGA 3ADBA 2R6DA 1NSFA 2GESA 4ILEA 4PC1A 4PPFA 5B2ZA 3EIEA 4URYR 3R9IA 2JJ1A 3O8DA 2IYXA 1AIPA 1LY1A 4C0HA 4QBGB 3LW8A 2GTPA 3ZDQA 1G1MA 3QG1A 2V8OA 5L3RA 1UAAA 1N25A 2H57A 4LBVA 3PV0A 4HDOB 2CHGA 4P3YA 1N5LA 1U81A 3NWJA 4TL8A 2WWWA 5JBQA 1D2EA 2D3WA 1NMXA 3GJ3A 4DWJA 3CM0A 3ETLA 3OESA 1UBCA 1OHHA 1P75A 4URVR 1TF7A 1P73A 2IYQA 1E98A 2ZRCA 1QZXA 2GNOA 3PUVA 1YE8A 2Q9AA 2VQSA 3B13B 4F91B 5K8UA 4OHZA 3IBGA 5LPNA 4CW7A 1L4UA 2KI5A 3O8BA 1FP6A 5EP3A 2D2FA 1UBFA 5EE3A 3CPEA 5FI1B 4W5HA 4CEJA 1JECA 1KNQA 1ZD9A 2Z83A 4I99A 4BFWA 4CT5A 4YXWD 2RGXA 5CJ2A 1QHHA 4A8JC 4PZYA 1B0UA 1G4AE 1QHHB 3D8BA 3MG9A 3A1UA 2BKUA 1DADA 4TL6A 1XNJA 1G7TA 4JT4A 2OCYC 1KZ7B 3N70A 3VNVA 4ZCIA 1G4UR 5KNDA 2GA8A 4OK3A 1XXHB 2JLVA 5HTKA 1EFHA 1U99A 5FOSA 1IXSB 1IJFA 2YC4C 5IT5A 4MRVA 3T12A 4GMXA 2OXRA 3U6KA 3CR8A 5EE0A 2GETA 3WBJA 821PA 1OYYA 2BCGY 4LJYA 4Q4JA 1QHGA 4EPRA 3QENA 4NBSA 4UJ3A 3ADCA 3AKEA 2E1RA 5JZVA 4P33A 1GDDA 1P7CA 4NP6A 5GJWC 3ZZTA 2RB4A 3Q3JB 3VHLB 2DWPA 2ORVA 4JMPA 1ZUHA 2XSZD 3TK1A 4KVAA 4QGGA 2O0HA 3QF7A 2QAJA 2JEOA 1FMJA 3RANA 1E1QD 1A2KC 3GJ8A 3FMOB 4Q7LA 1U98A 4AWXA 1L7VC 2JJ8A 3LDAA 4AURA 1XX6A 1WA5A 2J3EA 4Q1CA 2AD1A 1P9NA 4OQLA 1AKEA 5CLLA 4DB2A 2CEAA 2O8EA 3E2IA 5JRJA 2IUUA 2IS2A 5A0FA 3FVQA 3Q85A 1G7RA 3THWB 3GLHE 1NI3A 3B7GA 4LV6A 1E0AA 4XVQA 4JL6A 2WIAA 1A4RA 2VA8A 4V0NA 4V0KA 1ZUIA 4TYWA 4DLRA 2NOAA 1XMVA 3TH5A 1XTQA 3PQCA 2HT1A 2EW1A 2FGJA 4R7ZA 4DKXA 3VFDA 1AJEA 4ZIRB 3KDSE 4MA4A 3B9QA 3RSOA 4J0QA 1FL9A 3SDZA 3MWKA 2AHOA 4TT3A 4EAQA 2YKGA 2FOLA 4L16A 2P6NA 2NTYC 1N6NA 3LRPA 2YC2C 3O8RA 4KFUA 2F1JA 3S1AA 3SNHA 2GEUA 3VHXA 4BFXA 3K9HA 1Z0AA 1EFUA 2QP9X 2XJ4A 4DUGD 3B60A 4M1WA 2BBTA 2RGBA 4Q1AA 1UEJA 3QPWA 4ZDJA 1TUEA 3CRRA 3BAFA 5C1BA 5DH9A 1BYUA 2F9LA 2CNWD 1H65A 3U4QA 2W2VA 1OFIA 4IOKA 2FFHA 4FWIB 1Z29A 3ND8A 3FPAA 1XPOA 4Q02A 2G1JA 4TL7A 1WQ1R 2QY9A 1NMZA 3GPLA 2DCUA 2YNMA 4PSKA 4LK2A 4PSAA 1NMYA 3I73A 2WWIA 1Z07A 2O5VA 2RGAA 3TQCA 3IO5A 5KTYA 3GEHA 2HV8A 3HYRA 4TSFD 2Q21A 2XITA 4UXJA 1U94A 2IXFA 3MJRA 3TUJC 2FNAA 2J7KA 2NPIA 3LAWA 1ODFA 2V55B 4OI1A 1Z5ZA 4B3CA 4F4IA 4OQFA 2H1LA 4CDGA 2EFCB 2J87A 2FA9A 5DHFA 4BLQA 4B2IA 5FL7D 4DC9A 1XTIA 3OIWA 1R0WA 3SQXA 3SYLA 1UFQA 2XTNA 1KKLA 3HR7A 3CR7A 3TKLA 4TLBA 3GCGA 1OKKA 3NG1A 4GPTA 4BFZA 2XTMA 4EUNA 4YMSA 2HJVA 3DO6A 1QG4A 3NBZC 2GHIA 4MRNA 2IYYA 4B6EA 4EPYA 3PEWA 4QHTA 1KZGB 1G3UA 4O0MA 4XVRA 4E09A 3K53A 4LPSA 4D81A 5JSZA 3PVSA 5JEDA 1IHUA 3GLGB 5LB2A 2KBEA 1QBKC 3LBHA 1U9IC 4UNSA 2IXEA 1I2MA 2BV3A 1VCMA 3NHBA 1Z2CA 2ZSAA 2D62A 1ANKA 2ZJAA 3AB3A 4QBHA 4QL3A 4TMWA 2PJZA 4W5JA 3H2YA 2XJ9A 3AGPA 4TTQA 5FPSA 4WVFA 1ELOA 3B9PA 1SKYB 1WB9A 2VSXA 1V43A 1G3MA 3A6PC 1RRFA 2A78A 5CDFE 4GDFA 4R2IA 5E4FA 2FF7A 1CF4A 5JSZB 1UDXA 3D3QA 4G5OA 2WWXA 4EDHA 1IBRA 1RJ9B 4R71A 2ZI7A 3ADDA 1G17A 3KKOA 1YR7A 5DSZA 5E3HA 3GLIA 4P32A 4Q00A 2HF8A 4ITRC 4M9ZA 1U90A 3MWJA 1OSNA 5HZKA 1N6RA 1RRCA 1W2HA 4AKHA 1OH6A 1DS6A 4RSGA 1KI8A 1S9DA 2QPOA 3IQXA 4NPHA 2PT7A 1IJEA 5H1YA 1OH8A 5JJIA 1G5TA 3EZ9A 2OUKA 1EXMA 4LPKA 2O8DB 1JR6A 3W3ZB 4NCKA 4KCGA 3TW4A 2I1VB 2QQEA 2O8FB 3HU2A 3R8FA 3LBIA 2O8DA 1HH4A 4OK5A 1DE0A 5HPYB 4DLSA 1HYQA 4OQXA 4JJZA 1KK2A 4JYCA 3FTQA 4PAQA 3W6PA 4MGZR 2NO0A 3CRMA 1P2VA 2QA5A 1G7SA 4C7OB 3NBFA 4ABYA 2A5DA 4IFBA 621PA 1DEKA 1E9SA 3BIFA 4RD6A 1GOTA 4DBLC 1QHNA 2ZR7A 2PJRA 3AKDA 4BRUA 5JJKA 1W4CA 2GJAA 1P9RA 2XX3A 5EE9A 1MABA 3E5HA 1F48A 2ZJ5A 3QXJA 3LQRA 4GOKA 2A5JA 2B7BA 3TMKA 2IEYA 4EFLA 4HATA 2G9NA 4FMDF 3LX5A 1Q1ZA 4B6FA 4DIEA 2VSOA 2R6FA 1UADA 4JBXA 1C9KA 5E7JA 3WY9A 2NO7A 2NPFA 5E95A 4KV9A 2WJJA 2OBNA 4RD0A 1CR2A 5JECA 2FGKA 1LTQA 3M1IA 4IDHA 2QENA 4YMVA 4ESVA 1IAQA 1VCIA 3T15A 4A2WA 2FDCA 3BB4A 4Q19A 1M7HA 3I32A 5FUXA 1KSJA 1YJ5A 3GLIE 3QBTA 1JPNA 2QZ4A 3A1SA 3VR4A 1DAEA 2Y8EA 4M1KA 4RKFA 1S2MA 2P2LA 1E9AA 1Q57A 1XEWX 2R65A 3TR0A 3I4LA 5J47A 1E9DA 2IYTA 3SBEA 4JLDA 4IDNA 2A30A 1BIFA 1US8B 1TQ2A 3L43A 3AEZA 3CF2A 4KJZA 5JS7A 2GAOA 3CZPA 5LD2B 1ZM9A 4YMWA 1A82A 1VHLA 3A36A 4DHEA 3U7GA 3WYGA 4QHSA 4G5QA 4A6PA 2F3RA 1K5GA 2WJHA 4NONA 5KSPA 2XZOA 2PLRA 2RKOA 2P0EA 4OI4A 3SBDA 1DAGA 1LF5A 2HF9A 2WOJA 5FH9A 1YZNA 2QEQA 2LKDA 4H9GA 5GADl 4LBZA 5KDDA 4BLOA 4DVGA 1OXTA 1ZD8A 3WHKA 1SVKA 2WAYA 2RGEA 4KFTA 1E94E 5DI9A 3ZS8A 5FPTA 1TX4B 1JAIA 1R8QA 2JLUA 1RYHA 4HSEA 2P3SA 2FEMA 3PCRB 4M9QA 2R62A 1YR9A 1GTVA 3SZRA 3U3MA 5F9HA 2V9PA 4QNRA 2CJWB 1J8MF 2I4IA 2F7SA 3WP0A 2OBMA 1W46A 2PT5A 4PAOA 4P31A 3LVRE 1Q22A 2OXCA 5AR1A 3QJYA 2IBMA 2LWIA 4UKDA 4CF7A 4B32A 3KUCA 2JIZD 1AGPA 4R98A 3X1ZA 2H17A 3R9XA 3E1SA 1E2JA 1N3BA 1AZSC 4PTLA 2BJVA 2VHUA 2ODNA 2CCKA 1TEVA 4OI0A 5GJBA 3ZS9A 4G3XA 5JWOA 4YDSA 5L3QA 1S1CA 2GBLC 3EXAA 3M6AA 5CLQA 4B35A 4TYYA 2J46A 4MYHA 4RD1A 2VTKA 2GEVA 3AQ4A 2PEYA 1IONA 3ECCA 1VHTA 2ZE6A 3LNCA 4TQ9A 3THYA 4D4MA 1OXVA 4TLAA 3SJBA 4V0LA 3T1OA 3THOA 1W0KA 3OE7A 4M1MA 3A1VA 1DVRA 3VU9B 3U2QA 4ZIRA 1BMFD 2BMJA 1KAOA 1W4BA 4HDCA 1LNZA 3PIRA 4V0OA 3KTAB 3WNCA 5JCPA 1VYUA 3JVUA 2CK3A 2Z6VA 1XBTA 4ZV4A 4XD7A 2OV2A 2BBWA 1OXXK 4PQRA 4TLCA 4AY2A 2EWVA 2BM0A 3CX8A 5AUQA 1N6PA 4DCUA 2CE7A 3THYB 1NKSA 3W3AA 2Z4SA 2ZRAA 1XD9A 2ZRIA 3I61A 2VF7A 2OT3B 3FYHA 4G1UC 4PO8A 4Y0VA 3I92A 1KI1A 2CJWA 1G6OA 2ZYWX 3CX6A 3M0EA 4QJ4A 121PA 3OIYA 2DY1A 4NCJA 3U60B 3AVTA 1JXOA 1UBGA 2OG2A 2FE4A 3BC1A 4KYUA 4TLEA 2ZEJA 2LCFA 1W0KD 3OE7D 2E87A 4PQFA 2WKQA 5CM9C 3DM5A 1JEEA 5JEEA 1OFHA 2VHTA 4EFMA 4ESHA 2F1IA 2BEJA 3PEUA 3GJ5A 1G41A 4A92A 1VKJA 1GILA 4ZKDA 2KE5A 2FH5B 1JAHA 1UKYA 2IWRA 1XTKA 3TGPA 3PITA 2NGRA 4I1SA 1HE8B 3I5YA 4ZKEA 1XFAA 3U3JA 3W8RA 2J1LA 1MH1A 2N46A 4MYCA 5BN4A 5H70A 5C46F 1Z0JA 1S1MA 1AS2A 3I8XA 3QKRA 1J99A 5BN5A 5L3VA 1AKYA 2O8FA 1LV7A 3QY0A 2OAP1 2FMXA 2IUSA 2W6ID 2ZRHA 4JSYA 1E2DA 1YVDA 2CL7X 5FTMA 5K8TA 3LXXA 4D26A 5GJCA 4QGFA 3CPHA 1YRBA 1OIVA 2WJIA 2FWRA 2HT6A 3P1JA 3P32A 1CULC 1Z3IX 4Z8YA 2V1UA 4TMZA 1MO3A 2VP2A 4HAYA 4Q7MB 2O8BB 2R6AA 2A5GA 3EX7C 1R4AA 1UBEA 3B1VA 3GLHB 2XB4A 4JT2A 1C4OA 4CEJB 3DZDA 4K8OA 1JEDA 3B1ZA 5DYIA 3D6TB 1OT3A 1W1WA 1RZ3A 2ZE8A 3IIKA 4NCIA 2QT1A 3AM1A 5LBIA 2A3RA 1VMAA 2J0VA 2XB2A 1U9IA 4BE7B 5EP1A 1D6JA 2SHKA 3T35A 2ZM5A 1QF9A 1TMKA 1XU4A 4X8OA 2V6IA 3GMTA 2IXGA 3QG5A 3CZQA 1CJUC 2JGNA 3UATA 5HKKD 3I1FA 3IPXA 4EJSA 4IVPA 2HLDA 2PZFA 1WF3A 1Q12A 4Q4HA 1T6NA 5DN6D 1CP2A 4BZXA 4YMUA 2Z43A 4DDVA 3VR3A 1P72A 3H4MA 1TEXA 2WMOB 2NO9A 3AP3A 2ZRFA 4II7A 4UNPA 4B3FX 1SXJC 1E2QA 2C8VA 1J2JA 1Z47A 2ODWA 4Z8XA 4Z54A 3BH7A 1Q0UA 5KUTA 3W9YA 3THXA 2JLWA 1Z63A 3T34A 2C95A 1G3QA 1Q3TA 1NN3A 2QPTA 2NIPA 2ZVPX 4M2LA 5HE9A 1OB2A 4CEHB 3SJZA 2MSDB 2DWQA 1RVDA 4LC1A 1LS6A 2G0TA 2JIZA 3JZAA 4RY2A 4LI0A 5C4MA 2BM1A 1P3JA 2F9MA 1G8YA 2NO6A 2OZEA 2VPPA 3A8TA 4I1VA 2GXQA 4PC3A 4BWYA 2EQBA 1X86B 3X1YA 1DO0A 1VIYA 3K0EA 3U4QB 2CCGA 2EFGA 3SOPA 2JDID 3LXRA 4B47A 3KQHA 1F6BA 1CBUA 2C9CA 3RC3A 3QEJA 4Z1MD 1NL3A 3RLFA 2ZRMA 1US8A 3NVAA 3CH4B 1SHKA 3AF1A 1ZYUA 2QSZA 1AK2A 4LWZA 4BPBA 1ZIPA 2IYSA 1Q3HA 1TF2A 1RKBA 3IKJA 4XIGS 4A15A 3U3OA 3R9WA 2GF9A 4TMKA 2AR7A 2O8BA 3LV8A 4RFSA 2ZRJA 4GOJA 3QVUA 2RGCA 2VBCA 3UKDA 5CB6A 3K9GA 3OFNA 4M9XA 4ARZA 5JI3E 1YZKA 4QM7A 3ZIAD 1XMIA 4GZLA 4LJ5A 1KJYA 3ZYCA 1I4DD 4LSGA 2PMDA 4XWAA 2AFIE 1E2KA 2GCOA 3QIAA 4OHWA 4M8NE 5EP4A 2IF2A 2IHYA 1E79D 4A0FA 3AVUA 2WHXA 721PA 4URUR 1BOFA 2WPDA 1E2EA 3AF0A 2Q0HA 2FU5C 2ZI9A 5FL3A 3AVWA 3O8CA 1Z22A 1N6IA 3CPJB 4WZBE 1IN6A 1OF1A 1CJVC 1CEEA 2CXXA 1IM2A 4EPXA 2IX3A 3EPKA 3LH5A 3K09A 2TMKA 3MLEA 4C0SA 3U61B 5BYJA 1OJLA 4V02A 2H92A 2EFEB 2V1XA 2QPAA 2QGZA 1AA9A 3AUYA 4DLWA 4B76A 1SVSA 2CHVA 4DIDA 2ZYTX 1E96A 2J0UA 5FUWA 1VYVA 3SI7A 4Q66C 1LF0A 5DNYB 4MUBA 3T5DA 4HAUA 3LLMA 4C0BA 2ZS9A 3BFKA 1E4YA 2AWNA 1KI2A 3AVOA 1WRBA 1XD2A 5CB8A 1XEFA 3WMGA 1GM5A 2A7QA 3AF2A 1WBBA 3I72A 1FTSA 2R44A 2X1VA 3H86A 1R6BX 3BRWD 5H68A 3IILA 4POAA 1W2GA 1VG9B 1CJTC 5FUYA 5HR5A 2ANBA 4LJ9A 3FFBA 2DHRA 1TQ6A 1W49A 3CWZA 3GLGA 1NLYA 2OESA 4AD8A 4BFSA 5F3WB 1KI9A 2OCBA 4LJ8A 2ZANA 2VP4A 4I4LA 4XH9B 1Q20A 2WOOA 4HUTA 3NKVA 4LHWA 2WWFA 5CK4A 3K70B 2GBLA 3FHCB 2K5UA 1KAGA 2XNSA 2YOHA 3F3YA 3RABA 1J7KA 1YHNA 4B44A 4M0LA 2Q3HA 3I5XA 3EPHA 5HCNA 2HCBA 2PCLA 2FPLA 3K0CA 1NLFA 3B8HA 3MAAC 4B3XA 1NY6A 1ZCAA 4OL0A 4A4DA 1G8HA 5KOYA 2WV9A 4D80A 3G0HA 2VRWA 5BYKA 1FUUA 2QL6A 5JFGA 1OFUX 1SVMA 2CE2X 1MR3F 3GFTA 1SVWA 2GCOB 3QKSA 4OQNA 1GFIA 3H0KA 4D25A 1CJKC 1YR6A 1Z2AA 1X1RA 2JCSA 4DSNA 4JKYA 4PO1A 1R0XA 4EIWA 2LKCA 4QGHA 2HYDA 3LY5A 2BBOA 2WJVA 3R20A 3GEEA 2ZVQX 1IXZA 4P4UA 3TRFA 1ZM3A 1UF9A 5AUPB 5FOUA 4C0LA 1SXJB 2CBZA 1JXMA 4FD2A 4IRUB 1F60A 2WIBA 5EUQB 4C7OA 5GVSA 1U2RA 4D0NA 5C2JB 2W6JA 1P5ZB 4KBGA 1GKUB 5FTJA 4P0TA 3QKRB 2F1HA 2GDJA 3GLFA 1MV5A 5DHAA 2KB0A 4WIAA 3TSOA 1IN8A 2BHRA 3QVVA 3V4RA 1MO4A 4WW0A 3FE2A 1DO2A 2YOFA 4Q5IA 4QRHA 4QXAA 3K09C 2CL0X 1M74A 1XEXB 1RIFA 3HDTA 1KO7A 3RRNA 2OM2A 4Z51A 1HTWA 2WWGA 4XD7D 1W47A 2HJGA 1KI3A 1MO5A 1U8YA 1Z0KA 2ZS7A 5EXXA 2YV5A 3GD7A 2F1RA 4UNNA 4ZCMA 2XGJA 4B2LA 2PX3A 5B58C 2CCJA 1YZGA 4LBWA 2W0SA 2VSFA 3EIHA 3VTKA 3PR1A 2AXNA 1VPLA 2MMCA 2GZDA 1CRPA 4TLDA 1CR0A 3ASZA 4HI0E 1DAIA 1NJFA 1XXHA 3QF4B 2DBYA 2B8WA 4EPWA 3K70D 3GP8A 4F38A 2QM7A 4PPGA 3GJXC 4FXPA 5EXPA 1V5WA 2R8RA 3NHAA 3P20A 2CHQA 3MGCA 1U0LA 1TU3A 2AFHE 2ZAMA 1ZD1A 4LJ6A 4IDQA 4FCWA 3MSXA 3M4YA 2EYQA 4ZO4A 5DISB 2GILA 2ORWA 1NBMD 1K8RA 1S3SA 2QMHA 2WJGA 4ZCLA 3PUZA 2ZI5A 1P2SA 5FTKA 3SYKA 3MUFA 1SULA 4A0HA 1KY2A 3TVTA 4PZZA 1XB2A 2PCJA 4N1AA 3B82A 1RE0A 4PHFA 4NKRA 1UJ2A 2F43B 4HUQA 3N5CA 1E32A 3TUZC 4CRWB 5TARA 1QVAA 5FR1A 2ORIA 1G8FA 4AYXA 3B2EA 2WKRA 4MKIA 1NG9A 3H1TA 4OK6A 3C16C 4MUAA 4PO9A 5L3QB 2VYFA 2YOGA 4HB3A 4IHQA 2QM8A 4NYMR 1FFHA 4A0RA 3KFVA 4Q4AB 4QBFA 4URZR 2ANCA 4O25A 3B6EA 4DSTA 3DVLA 3U3KA 5L8VA 1OYWA 4U02A 1NJGA 4HAVA 1LB1B 3W6OA 1IN7A 3NDBB 3GLFB 5J4LA 4B2PA 2R9VA 2G0NA 4Z1MA 1KOFA 4FMCF 4I81A 1II8B 1UKEA 3OF5A 4JJKA 1QG2A 5AJWA 2Q9BA 4Q47A 2JJ2D 4I1OA 2AX4A 1XCMA 5FUVA 4XTRA 5AJZA 4MGKR 1E3MA 1ZNZA 4OJQA 1KDPA 1GNRA 4KHZA 4NYIR 2WWHA 1G21E 3G5UA 1MT0A 2JASA 4KLZA 1M1YE 1KI6B 3WMEA 4FMCB 4FN5A 4DLZA 1OW3B 1JPJA 4C0QC 1KO5A 2ZJOA 3VR5A 3IUYA 4XSHA 2ZSBA 1CS4C 2QAGB 4CEIB 4L9SA 5AJXA 3UMRA 1N0VC 1G5RA 1E2HA 2JAQA 1TF5A 4PHTA 2ZJ2A 1P62B 4IDOA 2W58A 3NEJA 1PJRA 2DWOA 2Z5FA 4ARZB 4UNQA 2C9OA 3I3SR
chains in the Genus database with same CATH superfamily
5CA0B 4DYHA 1SA0A 4DJJA 1HT2E 3BTUA 5I7SA 4IDPA 2ZPTX 4PANA 5KTTA 1U2PA 2WFAA 4HUQB 3NATA 3WB0A 2D5IA 3N05A 2PKWA 3PSAA 3REFA 3V00A 4A27A 1BE1A 1R0SA 3TZLA 4YAKA 3ZVMA 2P77A 4FVTA 4INAA 5BW8A 3VU8A 1ZD3A 2JW5A 1LQUA 3ASVA 1CUBA 1U3TA 2UUAB 2J5BA 1KZ4A 2XUFA 3MK31 5FAKA 5L3SB 5CH5A 4F3CA 4IQ0A 4YH1A 5J2TA 1OA0A 4H6PA 2IH4A 2HSJA 2M98A 1L7NA 2W0MA 5DB4A 3L7IA 1TGYA 3H3XA 4CKEB 4MR9A 3BORA 5JR3A 3PXBA 3KQNA 1JR3A 1Q6ZA 4M1ZA 4MWDA 3PFIA 2Y76A 4FSXA 3QIVA 3EARA 3K6SA 3GFOA 1W96A 2FXVA 1MA3A 3LUBA 3Q41A 4AAYA 4BMXA 2YW9A 3OI7A 2EFJA 2H7XA 5GADl 3A1DA 3IT3A 3ITNA 5B1EA 5M04A 1TQ8A 3I2YX 2IQIA 2HI0A 2BELA 3UA3A 3EUWA 3LRXA 3BQNB 3ENQA 5ELXA 3GZNA 1WZEA 1KAMA 2O2SA 4ZCTA 1Z0ZA 3C3WA 4RK5A 1XQ1A 3BSWA 1MV8A 2ZYAA 3CLVA 1J8FA 4IH1A 1F4VA 1WB5A 4MPPA 4HGYA 5LYJA 4C6HA 4D0GA 3QE0A 3WISA 3ZU5A 3IFSA 1E2PA 2QTCA 4F0JA 5IWCA 2H63A 2ZXUA 4PW0A 2PN1A 5HX7A 5IAAA 5ALLA 1DIAA 1UOPA 3O26A 4D79A 3SD7A 3T5BA 4YJ3A 4Q4CA 3GEPA 1EVKA 1A3CA 4LDNA 2ZJ7A 5FCDA 1Z0FA 3E9RA 1MC1A 2XTZA 4DJ5X 2UKDA 2C2OA 2WUEA 3DEJA 3DUFA 3FCXA 3PHJA 4MIYA 1WCIA 1BQ3A 3IBTA 4UE2A 3ZV4A 1LPBB 2ZRDA 3CLSC 4UAUA 4DMUB 3UK1A 1QHFA 2KBFA 4AXXA 5KYGA 3AVYA 1L2TA 2A33A 2CMGA 1Q1QA 2EKQA 3DO5A 5LD2C 3DMTC 2FKNA 2A9JA 2BVNA 2ZR0A 1RXYA 4RW0A 4QODA 5IT9A 5HILA 2QUKA 4HMPA 4RZXA 2NO1A 2W00A 3OEEA 2X9QA 3OCXA 1G8KA 1ZK0A 2JG3A 1NXQA 3BGVA 3CF0A 3QUAA 1NF9A 1RYBA 2WSMA 1UDCA 2GO1A 5JQGA 2Y3IA 2Q4EA 3GJYA 4DNPA 4DT1A 3T1VA 5J3JA 4H4DA 3D4LA 4KLNA 4K9KA 1OV6A 4A8PA 2Y05A 3OPMA 2AZTA 4KR3A 3TL2A 4YDHB 1XYVA 4I2VA 3PJRA 2B1IA 1RAFA 2E3JA 4BBJA 3PDIA 3QU2A 3FMFA 3OUZA 3D8UA 3TLEA 3CJQA 3UEOA 2X8AA 1O3YA 3ZEIA 5C52B 3FCEA 2ZITA 1NP7A 5K3DA 1R5BA 2DPLA 1RBQA 4O63O 4REQB 4WY2A 3BGSA 4CFYA 3ZQ6A 4R1MA 2EZ4A 2DFKB 1Z7YA 5KTOA 1QUFA 3ELUA 2G4VA 2AG0A 4A1FA 4XVUA 2BGRA 3BCRA 1ISHA 4NESA 3NEYA 1VCOA 1USGA 1A5SB 3I6ZA 3KX2A 3QXHA 1JFLA 3ASYA 2XXAA 1DEAA 5D86A 2Q5LA 1U80A 1P8JA 1RW4A 4TV9F 3TSYA 1U0SY 1A5TA 2O52A 2VVTA 2UDPA 2Z3WA 3M6LA 2Z9CA 3H2SA 3AP1A 3ICQB 3W5AA 3FWPA 3ZKWB 4AYWA 2ERXA 3RTEA 1GPDG 3I9LA 4L3WA 4QOEA 2Z30A 1V5FA 2D0IA 4DKJA 5DLQC 2EP7A 2NSJA 5KNLA 1QMGA 2D3TA 2Q5OA 2WVAA 5SV2A 1CU1A 4R84A 3O7MA 4MW4A 5E8JA 2BDTA 4E08A 4PPNA 5IWAB 4NF2A 4IMJB 4WXRA 2BJWA 3TOCA 4DRYA 1NRWA 3O2JA 3K32A 5DO9A 1WD5A 2CB0A 2P6UA 3QVSA 4R2KA 4CEHA 2OBXA 1NVVQ 3ZIAA 5FWNA 3PHBE 3AJEA 2I87A 3SS9X 3GT4A 4HKTA 2A1UB 4EYSA 2H9AA 4D45A 3P26A 1I51A 2WTUA 1SZPA 2O7SA 1P3Y1 3HHEA 3BKXA 1PG5A 2GRJA 3HPQA 4RA9A 2P3LA 3IBYA 2GKSA 3V4OA 4BTLA 3BWMA 10MHA 3V9PA 4EW1A 3VOAA 2RGRA 1M66A 1X1DA 3PCXA 1ADBA 3Q7QA 2OFOA 2BD0A 5BVGB 2I9KA 3N2LA 4ND7A 3BRQA 1R5NA 5D3MA 4MS3B 1HEIA 1GR0A 2Z58A 4HNSA 4XYEA 2BMVA 1QIIA 4BLWA 4H7HA 2GVNA 2GLUA 3BJMA 5EMLA 3RCBA 1JMVA 4D3DA 1SIWA 1U0JA 2RK6A 4MQ5A 5HZMA 3PJFA 4BC1A 4IIYA 4HNAB 4E1AA 1QP4A 2BGGA 3ERCA 1XIVA 3V1NA 4WADA 3C5HA 1WS6A 2YZGA 1FVHA 4KE6A 2VO1A 4BX2A 4E2WA 5BR7A 1QPZA 1RQ2A 1DARA 3SC2B 3AI3A 3F7OA 1LWNA 3R0JA 1GRRA 1HE4A 4JQSA 4MARA 5DKFA 5FP0A 1KDOA 2VWPA 2LE0A 4PRYA 5H9WA 3LKBA 3DDWA 1QRAA 4NX2A 2W2LD 2QR2A 1RRKA 2B7CA 1TAQA 1NKTA 3LQ4A 2GF2A 1DX6A 3FFWA 1BC5A 3SIPA 2GYUA 2WTXA 4HAIA 4UBKA 5A6VA 1W6UA 4OXNA 1RWKA 1Z0SA 4P36A 4XWGA 2DYKA 1G20E 3BREA 5IASA 3IKTA 2UVPA 3KFLA 3MJHA 4DCGA 1KVRA 3T9CA 5GPBA 4LZZA 2VUIB 3S0JA 5IDVA 3UV3A 4ZHSA 3FNIA 4B8WA 2PFGA 3D81A 2BMWA 4Q16A 4XTCS 4N8DA 1E3TA 1UKZA 4N7BA 3QPBA 1T1SA 4C7JA 4OYHA 4R8SA 2OBFA 2VRBA 4UHBA 5CTAA 4HZUA 4EB8A 4P82A 3OSUA 1V1RB 3ZE8A 3RRMA 3FCAA 2J9FB 3ZHYA 1GGMA 4BIIA 3OQOA 2G77B 1N32B 3Q3EA 5FPYA 5DNCA 1JHQA 1VCNA 3T7KA 3ND6A 1M2HA 4JA0A 4GYJA 4MW7A 3TOXA 3UAVA 1W88A 4S3MA 4BLPA 1I9GA 4FYVA 3KR2A 1EK1A 2IX9A 1M2EA 1Y63A 4TPKA 2MSNA 1M2JA 1ISRA 1VSVA 3NUQA 2F3UA 2BYTA 4NZMA 3KEGA 3NXKA 1EGMB 1EQAA 4MQMA 4J6FA 5HS4A 3COJA 1FX1A 2UZ1A 5DBFA 3TX6A 3CUSA 1U6KA 2OENG 4EFDA 2BUAA 3ONWA 1NVEA 2VYCA 3ZD7A 1CX9B 3VXKA 1H8EA 2W2XA 1L5WA 1SCDA 3VMFA 1D4OA 2HEIA 4DMFA 1BXRA 3BFVA 3H7IA 3H9GA 3OFND 1A5ZA 2WW8A 4YJ2F 4XARA 3ZV7A 5F4ZA 4B40A 4F5ZA 4Q1DA 2V7EA 1X8LA 1HO3A 5EP2A 2BFCB 1I14A 5CXXA 4GR4A 4A9AA 1P0FA 2XT6A 1L5SA 2OE2A 1WDTA 4C08A 3UMBA 2QTHA 3QX8A 1SBCA 2ECFA 4CMBA 2B4AA 5CLFA 2FXIA 3LRTA 1T6XA 4LVUA 1H3EA 2VP6A 3AWIA 2HRCA 4DV3B 2W8BB 3QWIA 3RARA 4C3ZA 3AUFA 4HQRA 5JJBA 1GNQA 1L8XA 2FPRA 1NQAO 1T4DA 2EGUA 4L28A 4QOJA 4CLOA 1QYCA 2SCUA 2W2KA 3GW8A 3K1AA 3PFGA 4IFIA 4NG4A 3OOWA 3EN0A 4RPHA 4WQMA 3SSMA 3T7IA 2B0CA 4F9FA 5JH7F 5KPDA 1X7XB 3Q3IA 3HUUA 3E4DA 4YMTA 1CYEA 1KHTA 5TE9A 4GECA 1LBTA 2O0KA 2XXJA 4GF5A 3JQGA 4R40A 1SQSA 4RS3A 3OU7A 2B61A 4MA0A 1U7WA 1B3BA 4LISA 3H19A 1EVIA 3Q6NA 4OKNA 5JJLA 2PS1A 2WVGA 2ILTA 2C2HA 1QLHA 1P6XA 5EY5B 1RYYA 3AONB 2UYQA 3E27A 3CKLA 4AJ1A 4DCPA 1FVOA 3U26A 1JTVA 4F3RA 3BXHA 5AHKA 1E79A 2CLFB 4DCNA 2GZRA 3MCWA 4RVCA 5ERGB 5BNTA 1PYDA 2XT0A 1MRSA 1W59A 2O6HA 3G68A 3LF2A 4L6AA 1B74A 1ULTA 1R0LA 3IV6A 1PJTA 3PG5A 4ZPXA 5HKOA 2JBHA 4FYKA 2RGUA 4GT1A 4IZIA 4IEFB 1TGVA 3RKRA 4BZQA 4AQYB 1YQGA 2QUZA 3SHVA 3R2JA 3BDAA 2Y0BA 2HJSA 4IH9A 1XDBA 1E1CA 3ISJA 3K9WA 1OFUA 4JUBA 1GEGA 1WU8A 2JA1A 4K0KB 2G7ZA 4MR7A 1FS5A 1KTVA 2Q2OA 4E7OA 4EPVA 1ZC3A 5ITVA 1QZ3A 2EG9A 5EMHA 4QWMA 5J5CA 3W9UA 3A6GA 3BWVA 4PC7A 4Z0NA 3X1JA 3SC3A 1V11A 3CEPB 2FLWA 4NFYA 4KO8A 3L77A 1OT5A 2E4YA 2FPOA 1JEJA 4FFDA 4A36A 1RZUA 4AO6A 2FOIA 4MR8B 4OHVA 4E5YA 5FV4A 1GA1A 2JVKA 2NUPA 1CUHA 4WDRA 2XOKA 3BGWA 4XOIA 3U9TA 2GFIA 4TYQA 1WDWB 1JR3D 1EUZA 4DTCA 3RC8A 1CB7A 1ORWA 2I4RA 2PKCA 4OI2A 4NZNA 4K28A 4MH0R 3LLVA 4O5AA 4OD0A 2FX3A 4RSMA 3WRXC 2J9YB 2IUEA 2Z56A 4AO8A 8GPBA 1VKHA 1Z25A 1J8DA 1LI5A 1XCLA 5C8YB 4G26A 1J00A 2ZRPA 3N0XA 3SU8A 4D4JA 4DMHA 1VIVA 5ICGA 2AN1A 2N42A 1PNTA 1NR1A 3EEYA 3JTEA 1HDIA 2Z2YA 5HZHA 1W0JD 3U3XA 4WK6A 1VG1A 4YRPA 2JANA 5SY6A 1AUXA 1JHXA 5E1BA 5FHRA 2FQYA 3P8ZA 1EXVA 6Q21A 3O82A 3AHHA 2QUAA 3W8EA 5FBVB 3KLNA 3S2UA 2OC4A 4I1UA 4CL2A 1U2EA 4LRQA 3JSXA 1A8IA 3IQWA 4KO1S 2OOSA 3LS2A 1S2GA 3MVEA 4MKHA 1I36A 5KKAA 3ZZNA 5KSWB 4XVHA 4LJRA 1DRVA 1BH2A 5JHGB 1UKVY 1ST3A 1U8FO 1YVPA 3KB2A 1YQEA 3ESYA 2QLJA 2VP9A 3K6SB 1UAGA 3N5KA 1HQYE 4BMCA 5IULC 4PYKA 3HEBA 1DQPA 3ZUGA 1TZBA 1FP4B 3WGZA 4AMUA 1DBVO 1N6KA 3DEFA 4ZT5A 2BMAA 1JB9A 4QEDA 5ILGA 4MYTA 3IAHA 3DOHA 3H3FA 3FPCA 4LYAA 5L53A 1FYEA 3T7JA 3DT9A 1Q7RA 2VRCD 3A9CA 2CVHA 1WNTA 3N2GA 3WNDA 4DA6A 4IZ6A 4EATA 4YJGB 3HH8A 1ZH0A 4UBJA 4XGNA 3REGA 4KXNA 1PZNA 2HWWA 5ECGC 5SYAA 1F2UA 2JGLA 4QLOA 1Y8RA 3EMBA 1MX3A 4C6TA 5LSAA 2WQ7A 2HFJA 1XMOB 4LHZA 4J03A 3KTFA 1ZK3A 4KR6A 1M1YB 2I2CA 3Q40A 3U6BA 1T43A 4I4NA 2EBFX 3RAPR 5BN1A 1FRVA 5GZ3A 1KIAA 2A86A 2Q5IA 3ZU2A 1MOZA 2R2AA 4MRSA 2I1QA 4PX3A 4C07A 2FPKA 1YDHA 2Q7XA 2ZLBA 3BJZA 4ZVPA 3U4IA 2H7VA 1VJGA 5DNUA 2O5EA 1FSPA 1DKMA 3SC6A 1RCTE 2OZVA 1GA6A 2Q3MA 1D2CA 1V7ZA 3VH1A 5EJAA 2LPMA 3KHSA 1MC8A 2FY8A 2DJ5A 3HCAA 3GRFA 3I4CA 3T9FA 1UDWA 4BASA 2C7QA 2K6GA 2A5LA 3SM9A 3AR8A 1U8EA 3GUCA 5ALMA 4DR7B 3C3BA 1MJGA 3WGNA 5C3UA 1NBIA 3HVRA 1UFOA 4L08A 1Y1KE 3HR8A 1W4AA 4LXGA 5ERYA 2IYPA 1PRYA 4MW0A 1PGPA 3MRXA 3LPCA 4QELA 2ZRQA 4RY0A 3T9EA 1COWA 2FN8A 3EIFA 3VQTA 3N8HA 4R54A 1PQ4A 4W9NA 3X2FA 4FQ8A 3Q12A 3ZZ1A 4HOYA 2AOTA 3ACCA 2P9TA 2B4QA 1UM9A 3JWIA 1Y8ZA 4J7UA 5LQKA 4GGPA 1NUQA 3D3JA 4AZ0A 1SCKA 3NVDA 2C5SA 1EUCA 3OUTA 2C03A 4KWTA 4NYJQ 2VAXA 4R7GA 1B6RA 5I7RA 2B9VA 1F2TB 1MZPA 4L4YA 1V4VA 2IE8A 2RH9B 2ZCVA 5AWFC 3IAEA 2ISCA 1F9AA 1Q1AA 2X8WA 2FSFA 4G4IA 4OLFA 2HPAA 3VKWA 1B3RA 4TVOA 5B3AA 5DCUA 4GAEA 1NVXQ 2PX0A 4DLUA 2IT1A 1Z28A 3WLNA 6GPBA 1Q44A 4Y6GB 4R5MA 2PUWA 3OLQA 3SYNA 4GDFA 3N76A 4BNWA 4BNIA 2QP4A 1S8FA 4N03A 3M4ZA 4FGZA 3RYTC 4CYMA 3VHXB 3QW2A 4G0MA 1GRNA 2E4ZA 1SUEA 4J07A 5EG5A 3HV0A 1JG1A 1EVZA 1YB6A 3B1WA 1C9JA 1EDEA 1KDTA 1L5VA 3IO3A 3MIIA 3NDRA 1CUXA 3PNLA 3ZNNA 1YB1A 3WHLA 1LVGA 3FPHA 1EG7A 4KE9A 3NB0A 1MEOA 4UZEA 2OHJA 5BOVA 2Y1XA 2I3GA 3KB8A 3O8NA 3C15C 5DIZA 4N3BA 1GGHA 3G2QA 5K0EA 3KE9A 1ODLA 2AG6A 2UVPB 1P1JA 2PSJA 2X5OA 2X8JA 3GGDA 3GQBB 5K6TA 3ZI0A 3JQAB 1MF7A 3LCJA 2O57A 3QSYA 2X2FA 3AUAA 5IUNC 1HKHA 3FKJA 1YRAA 1JH9A 1C0LA 1RR6A 5AM0A 3VNSA 2H5JA 4ZALA 3FJYA 5KS2A 1ACLA 2GXUA 4TXNA 1KKMA 2BN4A 2BI7A 1UBLS 2OO5A 3JWPA 4MRMB 2NLOA 1NATA 3T0GA 5KDOA 3HJUA 3LUDA 4J9UE 1JI0A 1UJ4A 4TMXA 2J3JA 3RFUA 3WK5A 5HTOA 4Q9IA 4HAWA 1IJBA 2JBWA 2JFZA 3FHOA 4GZMA 5DYNA 3PC4A 5E7QA 1CP3A 2QU7A 1W9MA 3GPBA 3C3CA 1CLUA 3AKCA 5IK2A 2J3MA 5FWYA 5EUBA 3R7NA 1CS0B 1E9RA 1YJBA 4L6IA 3TR5A 4RWEA 4B73A 2YINC 4WKGA 5LQRA 3OE4A 1O1YA 3GPDG 3GNTA 3NDIA 2I55A 4OHOA 4IJ6A 1GSAA 4K9MA 1R3DA 3FYDA 4KPUB 4LSWA 5D3MB 3PUXA 3BF8A 3SX0A 4EKNB 2C5BA 1IVYA 2K2QB 1OLOA 3KL2A 1YHZA 4QAJA 3PDCA 4EA8A 5KCMA 2JFUA 1G8GA 1ZM2A 3DT8A 3ENNA 3HCEA 3QEOA 3G82C 3QWFA 4FQ7A 5KIAA 1TT5A 3A26A 2H8KA 2ZUWA 4FDAA 1VC2A 3CGWA 4GVPA 4F92B 3HB9A 4QYIA 4MAMA 4EVIA 2PLWA 3SC2A 5CB4F 3FZGA 3NETA 2E6UX 2Z04A 1A77A 4M21A 4AN0A 2Q2NA 1GVNB 2F2TA 1A4XA 1PHPA 2FPIA 1SVOA 5D5HA 4AZ0B 4BWVA 2Y0CA 4Y2GA 2QTBA 1Y9ZA 3DDNA 4QZVA 5I9IA 5BSFA 3A6DA 2DPXA 1ENYA 1IHYA 4G4GA 3QVTA 4XPIB 1HE1C 3RRZA 3EYWA 3AYXB 1U0HC 1ZU5A 3TQOA 1EDZA 2X6QA 1BJRE 1KMHA 5CIQA 3LVFO 3WIUA 3BM5A 2HA5A 2DR3A 3CUVA 4RM2A 2OEPA 3ORFA 1NULA 2E4AA 1EK5A 4M60A 4D9HA 2B1QA 2FMTA 1RYFA 1ZVVA 4ED9A 4EYEA 2DERA 3MQ4A 5CNMA 2QWXA 3MW8A 4UUQA 3B9BA 3SE0A 1K3TA 2EKPA 4AL4A 1B41A 1RFGE 1T8TA 3UWDA 1DWUA 1GQYA 1I7PA 4IXNA 4I55A 4NHEA 4N3NA 4GQBA 2Q29A 1F3OA 5COBA 1KQNA 4W5RA 2XKKA 1Y82A 4BIMA 3DC7A 2CL6X 2XUKA 1A2OA 3D8NA 3INGA 1B42A 1F06A 1MO6A 1ZJJA 3L0DA 4S12A 1NASA 2AFHA 4AP5A 5A3QA 1IVSA 4CM7A 3GLSA 1KK0A 3O1LA 3AF3A 4I8XA 3IEKA 3PCTA 3FH0A 4LHVA 1TB4A 2BR5A 2V59A 2R7MA 3AH8A 3FDZB 4HEJA 5J59A 4C4TA 1NQVA 1YB7A 3L1JA 1QLJA 3IHTA 1JFFA 1Q0ZA 2ALJA 3DZFA 4L75A 1JZTA 1YD7A 3ESQA 4BFVA 4J3FA 1XHLA 3GYGA 1TRKA 4TRNA 4R71A 5JMPA 3EVDA 3QI2A 2BFDA 4BB6A 4AX8A 1JLLA 1EK6A 4KG7A 4D4KA 1Z5GA 3L0IB 4Y6RA 3OJXA 1U63A 1RKVA 2JLQA 3N0WA 4KRFA 4G0VA 5K6RA 4X61A 3GGSA 4MUMA 4Q7EA 3FG9A 5KHLB 4EKIA 4ZT6A 1UWKA 5B7PA 3FNBA 1HYBA 4Z9FA 4JLAA 4TWRA 5LDGA 4C9BA 1V9SA 3FWYA 1SURA 3T5CA 5G53C 2BFEB 2D5LA 4UQOA 4D9NA 5C8YA 3ZIDA 4GPD1 1TKRA 1YI1A 1YKFA 3P9KA 4JROA 3OZBA 2P5YA 1C1XA 2C84A 4CMJA 4GWLA 1GP2A 3QF4A 2W6IA 1FVFA 1LPSA 2NT3A 1XE3A 3FKQA 3KP1A 4K6MA 3SQWA 2G28A 4AQDA 1P6QA 3BGIA 3SFZA 3VNUA 3K3PA 1PZGA 1UBMS 3CRNA 3IMEA 2ATVA 4JP3A 4E2ZA 4B3BA 3FTPA 3BQMB 2EZ8A 1JDJA 2ID9A 3TRJA 4B80A 1ZI9A 3DE5X 4NCNA 4KMMA 4K88A 1P5RA 3DV2A 3ZN2A 3MCAA 2O8EB 1PW7A 1OXMA 3ETEA 4KQJA 1DU4A 4ZJYA 1HEYA 4F1KA 1CIVA 1P7WA 5JDIA 1DIHA 1ZI8A 2ZRNA 3FZYA 1JDVA 3L07A 4CGZA 3CEMA 2J7PD 3U1VA 5DHUA 5F7OA 3KD3A 3ZJUA 1W73A 3FLMA 5EINA 1YIAA 4GM1A 4IV5A 4Y9TA 5I9TA 4PQGA 4I9GA 2DUJA 1JU4A 3VR1A 4CM4B 2I7CA 2YMLA 4YJGA 2ROQA 4DDUA 4PR0A 1E3DA 3FDXA 3CLUD 1PLJA 4BNDB 3VO2A 4H18A 2ONKA 2CDRA 1L1EA 2OLKA 2G6BA 4JP5A 4B0PA 4D41A 4BC0A 3D5QA 4JY7A 2Q45A 4U0JA 3K5PA 3R3WA 4UAVA 4Q24A 1EM8A 1QP8A 1KBQA 1NE2A 2V4MA 4M7WA 3TLJA 4CM3A 3Q9NA 1Z2NX 3D5EA 1L5RA 4EJMA 1R6TA 2ECKA 4OP3A 3MYRA 3QBVA 5EIWA 3TYXA 5JCJA 4WKPA 1H2HA 2NUTB 2GZHA 3EFBA 4MIKA 5DK4A 4FYMA 2R68A 1EX1A 4P53A 3O75A 4TXLA 3ZJ5A 1NVBA 1RJEA 3ONDA 3F0TA 3ESAA 3I28A 4UTVA 4MWSA 5ALPA 2PH1A 1SUAA 4BN0A 3SKXA 1IEXA 3KYDA 3OQIB 3OOHA 2JFVA 2RHDA 3C5CA 3K9CA 3PNOA 4FGSA 4GPIB 4J9VA 3U19A 2VJAA 3ECAA 2I2BA 2XDYA 4U9HS 2Q4OA 4OTZA 3AVXA 4BV8A 2IUFA 3H16A 3KWJA 3MERA 4O1MA 4XPIA 5F73A 2JLYA 4QNMA 3QOYA 5CYOA 2Z2ZA 3DZIA 1X38A 2XUGA 3DP7A 3K0BA 2V0GA 4L8YA 1X7XA 3G0DA 1T2FA 4DMLA 2X3UA 2ZI4A 4QG7A 5G3YA 3IEUA 5BWLA 2XUZA 1XEWY 3C45A 3I9OA 3WICA 3WNZA 3NTOA 2P6PA 2G5CA 5BR4A 1AKNA 3W05A 4OQDA 4E4TA 2Q07A 1UPAA 2C2KA 2ZBQA 3V1YA 1IZYA 1H4TA 2WMNB 1I01A 1UZLA 2CY0A 3D4PA 4H17A 5DWDA 3WYFA 4C4SA 4PG8A 4HEQA 1JFSA 3WAKA 4OGLA 3SDBA 3K9BA 4WKNA 3QXCA 3BCUA 5AVYA 1PK8A 4JEHA 2YWCA 3R5XA 1Y8AA 3ROGA 5A4MS 3RV3A 5TQ2A 1JJBA 1BA2A 1X0XA 5LP6C 4PSVA 3UGJA 1QU2A 3TXXA 3EEOA 5HUHA 1VKOA 2AL7A 2H5IA 3NXSA 3TSZA 1CDOA 4KRYA 4PEVA 3O4VA 2V9CA 3EVTA 3AJ9A 2A9KA 3ZQJA 4QVKA 5EIHA 2PPVA 2YZ7A 4R2XA 1XK7A 2NSYA 4F56A 1TQ4A 1UPTA 2EQ5A 3AVWA 1EDBA 3ETGA 3HN6A 4AYTA 1M8PA 4JR0A 2ZYRA 3I45A 2FKAA 3CEAA 4Y1RB 5JUWA 4H4EA 2JLAA 3U37A 4AJIA 2G83A 3K6KA 4QG3A 2VDLB 4X90A 3JXEA 4JI1B 4MVJA 3N2EA 4JLKA 3TTTA 3V8PA 3C8HA 2P5SA 3OTHA 1USWA 2J9RA 1XLVA 2BTEA 3H84A 1XI2A 4RE5A 3T0FA 3OJOA 1CY1A 1GT91 1WTAA 2NZ8A 2WIJA 2V7QA 3LZDA 4IF6A 4KAXA 1SCUB 3DFIA 3D2BA 4RXTA 3HZOA 5BT8A 4BQOA 1OFTA 2PKQO 1V5GA 4NH4A 3E35A 4R2HA 1SQFA 2DHCA 3T3PB 5JOQA 4HV4A 2FFBA 4P98A 4F5WA 5K0TA 3ITDA 1ZMOA 3GUYA 1ZUNB 4ZZIA 1QVRA 3AWDA 2C4KA 3QX9A 3QU5A 2TMYA 4JEMA 3E8MA 2IJGX 3K5HA 4CG1A 3FTEA 5CUQA 1W34A 1DJLA 1HF3A 1U3UA 2MIIA 2C3OA 3OTQA 4ZD6A 1P4AA 3CCCA 3G8BA 1G18A 4CG2A 1OHHD 4MEAA 1EFKA 4JU8A 4IOJA 5EGNA 4IS2A 1PT9A 2FZKA 1SBNE 3K0CC 4JYBA 3M6UA 2WQZA 3FZNA 3H8VA 4MNTA 4FFMA 1VM6A 4MZXA 4I1PA 4YT2A 2WIFA 3RFTA 4F71A 3F6SA 2VDOB 3FNQA 3UANA 4BGVA 1GCAA 2QZJA 1IWBB 5LQAA 3EVEA 1BS1A 2RCYA 2QIOA 2P9HA 1NVUQ 3P0FA 4J0FA 2QTMA 4QXPA 4CM9A 1GAQA 3OVMA 2W42A 2VH5R 1C9DB 2ONJA 3TG2A 1G3IA 2ET6A 5C51B 2NZYA 1HKUA 1RI3A 2WF7A 4R6WA 2DLCX 1IRXA 3AEUB 2H3HA 1W25A 2XE6A 4YYZA 4C2UA 1JI3A 3GWZA 1R9GA 4B2YA 4GMDA 4J29A 4N47A 3BS4A 3IP8A 1UDAA 1L1QA 4NU0A 4GXQA 3IDSA 4RZQA 3W7VA 3JWHA 4ES6A 1Z83A 4K9RA 3I0ZA 4LSZA 5IVIA 3V1UA 4MUEA 1IY1A 1IBLB 1SKYE 1N0WA 3KZMA 5CJJA 3JQDA 2C1ZA 1VIAA 1SG6A 2I9PA 1L5LA 4FZ5A 2NUAA 3UJAA 3FHJA 3QKSB 1N7IA 5DT2A 3S28A 3VO8A 1QP0A 1GTZA 2Y0EA 3ZNOA 5LBTA 4XFKA 1R8YA 1XTSA 1Z4MA 4GMHA 4DCSA 2OVFA 4ZYXA 5KWVA 1XRJA 4LRWA 3WBFA 3P0EA 1X2BA 2VH1A 3L5KA 2BW0A 4GZ3A 2W2TA 5ICEA 2WWYA 2WFMA 4L0DA 1IVNA 4B48A 1JJIA 1N2XA 3ABQB 3R0XA 4AJEA 4MGEA 3NKFA 3W90A 4GR9A 221PA 3TLXA 1LLFA 2W2PA 3OTWA 3IH5A 3UAOA 3V80A 4M9SA 4CTJA 1IL0A 3O84A 4FKMA 4K81B 1AMUA 1AT1A 2H1SA 3KQWA 4TZ6A 4BXOB 3NVKI 3A06A 1F4LA 2RMKA 1ZQ1A 3NZEA 4OAOA 4RFSB 3SF0A 1QPGA 1JLHA 2Q6TA 3GJ6A 4FHEA 2ZYUX 4ZOLB 3A3NA 4O2BA 5EXSA 1U9CA 2GYWA 5EUMA 3JQPA 2CW5A 4HDKA 3K0SA 3OQIA 4K6KA 5DNVA 4OPMA 1EE1A 1J09A 4HVTA 3N87A 1C8LA 3TEFA 4YXWA 3K9FC 4WEQA 4RYDA 5IXSA 1U1EA 2FJPA 4G9EA 5BR8B 4B4DA 4V0ME 2C04A 1DG1G 3B3AA 3LWNA 5DIFA 2BL4A 4J0EA 1AO0A 2AG1A 2CFCA 2XCRB 2ZSFA 2Q3DA 1TNDA 3DVSX 3MTJA 5EXTA 4MYDA 4AKGA 2ERYA 5JXWA 4M54A 4Q9AA 5JLJA 1S3FA 2V6BA 3ENZA 1JHVA 3WYEA 4PWYA 2HXSA 4BNYA 3D2LA 3FNGA 1ZGCA 4X00A 4EG4A 5IJZA 3A3PA 1X8JA 4P3NA 3RSZA 3WGYA 1FJ2A 1GPMA 1NDUA 3A4NA 3RSGA 1AC5A 3FB4A 3WNBA 3FSGA 1EGQA 4WXPA 3SEAA 1F17A 2B6HA 4MULA 4TYNA 4WBNF 5IKPA 3V7NA 1D1TA 2J09A 1E2FA 2EP8A 2F67A 5JC1A 4M9RA 1M9NA 2B30A 1ZY2A 3HJHA 4CXMA 2ADMA 1SBTA 1OV4A 4LRXA 5CDFA 3G1UA 1ZA2A 4KR2A 2EOAA 2ARKA 2IQ5A 1UANA 1Z08A 1F8GA 3LCCA 3JQRA 2Z5VA 4LXTA 2HO4A 4UFOA 1XVUA 5G4KA 1TLLA 3AMVA 2X58A 3VRHA 2OCAA 5IHXA 1A9ZA 1VJ0A 2CJPA 1GIAA 3E22B 3KZOA 1QC5B 1PK7A 2KMLA 4HDRB 4WPGA 4DXAA 3S27A 1FXWF 2BCEA 2JD1A 2PT9A 4HXFB 4QRIA 1Q1GA 2GWHA 3BOSA 3JD2A 3JQCA 3L2OB 4IW3B 5D87A 3RVDA 1II8A 2AEJA 4AF7A 1WXEA 3ENWA 2OCGA 4C14A 4IVRA 3EJ6A 1E6MA 4DPLA 1MIOA 4ZV9A 3HO1A 2OPBA 4QPDA 3W77A 4XOUA 4MVJG 4PC2A 4NCXA 5TQ0A 2Y1EA 3PHIA 1PEAA 5IK2D 2YJ3A 3TSCA 2O4UX 4CIDA 4GICA 3HB1A 3KB1A 1P2TA 2VJMA 3DL2A 3EVGA 3S1AB 4Q4LA 5F5LA 4L74A 3U40A 4DF3A 5GZ1A 4AKEA 3FUXA 4FYWA 3NT4A 3P2JA 3QFTA 1ML3A 4PF1A 1V41E 2OXIA 1KI4A 3WGOA 3IP6A 4EB0A 3Q0IA 1YRHA 2XMGA 3EW7A 5HVNA 1YUMA 2YWDA 2ZUDA 3MQFA 4QVIA 3JX9A 4LBYA 4EO4A 3GLFE 2I2FA 4MDFA 4PG6A 4S35A 2JLCA 4MS4B 2NZJA 4E6PA 1C0IA 2GJ8A 3VSAA 1Y1QA 4DQUA 2GOYA 3RVKA 1QGUB 5KWSA 3OY7A 2QK4A 2QG4A 5CYPA 4B34A 1EVQA 4XR4A 1JE1A 5F64A 2P90A 1OOEA 2DR0A 4JJAA 4BN4A 4EHKA 2PYZA 3M49A 3ROXA 2ZWAA 1JFTA 3KV3O 1RM4A 3K1JA 1YZQA 4FMBB 5TGTA 4E51A 4I19A 3JQEA 4NCHA 1JFVA 1PO7A 3RQIA 1WPGA 3ESCA 4RKRA 5JYCA 4NOKA 5AJVB 1WMAA 3OOYA 5F3RA 3OF2A 3RG2A 4ZQFA 5EIBC 1SKUA 1UBTS 3SS8A 2H06A 3V3TA 4TMTA 4E0BA 1QFMA 5GTDA 1G42A 1XZQA 5CHYA 2G80A 1R66A 4CMIB 2C94A 3Q7IA 1PEYA 1XJQA 3PEFA 3WWYA 3F71A 1UQUA 3JU3A 2RC6A 5EMMA 1Y1SA 3WXMA 4MQBA 2HDWA 3FIUA 3L1IA 1HEUA 4J3NA 4MHSA 3KAJA 3O4FA 2X13A 4IYRA 4LZJA 4Q3LA 2ZJ0A 1RTTA 3W3AH 3U39A 3TJZA 1VECA 1E2BA 3P0RA 3C1UA 3KLBA 3R3VA 4LYYA 3L9WA 1YZFA 4C4PA 1SZCA 1SPXA 1KSHA 3GEIA 4DCTA 4L6CA 2DLNA 3DAFA 2ZDGA 5TVKA 3ADBA 4C3OB 1DFHA 5LBUA 4I8DA 4QDOA 3BK1A 5B2ZA 1EZ4A 4PC1A 2WINI 3AHFA 3U3RA 2JJ1A 1WOMA 4K6GA 3W4IA 1AIPA 1LQTA 1GLGA 1VA4A 3MJCA 1D2HA 4YRTA 3LW8A 1BQEA 3MS7A 2V8OA 5L3RA 1UAAA 5IDXA 1UMBB 3EXEB 3HO8A 1WDLA 1TDJA 1CWUA 2EX0A 1KC3A 4UBNA 3W2HA 4TL8A 2VUTA 2WWWA 1OYVA 3GJ3A 4EGSA 3ETLA 2IDMA 2OKGA 3OESA 1KP3A 4BPRA 4JLSA 4KQCA 4OX9B 5KOJA 3TLYA 1GZ7A 1P75A 1TF7A 4KXQA 1VP9A 1WUHS 1E98A 2NU7A 1C0KA 1FU7A 3CR3C 3GGJA 3KTOA 4RTJA 4PFKA 1U8XX 3TPCA 3A04A 1R8XA 3OJ0A 5DGTA 3STWA 1JDBB 3O8BA 2M9MA 1O5TA 2R79A 1ZAYA 1C41A 2D2FA 1UBFA 2DY0A 3FMGA 2VEOA 3MPOA 5JPCA 4U2GA 3HR4A 3FTFA 3CIFA 2Y68A 4LQDA 4CEJA 1JECA 2R1TA 2Z83A 4OEHA 3IQZA 3RPEA 3HGQA 2BLLA 3EXFB 2XMRA 3TM5A 1U4NA 5JJ5A 4A8JC 2EJBA 1P5FA 1A7AA 4PZYA 1ZUNA 1MRZA 4P5PA 5B6PA 1VBFA 2XUPA 2QVBA 4JUIA 2GNPA 1L3BA 3D8BA 4ZVUA 3F67A 3D7SA 3TFOA 2Y1OA 4IHJB 1GPNA 2HTFA 4ZHQF 2AMLA 5JATA 2C3PA 1A69A 1XNJA 1G7TA 4JT4A 4G1BA 1AMNA 3MWEB 4TKZA 2QUIA 1H1TA 1WMBA 3VNVA 2Q2VA 2GA8A 3AI7A 4U7PB 1OXBB 1DQRA 4ZQCB 1W6RA 3JV7A 1GZHB 1UUFA 2C0QA 1QIGA 3EAFA 4G1CA 1EFHA 5A5FA 5BPHA 3P9PA 1IXSB 2YC4C 2W9XA 1KY5A 1JEAA 2YQZA 3AEKA 2OXRA 1RZRA 4FS8A 3U6KA 1Y80A 2JAUA 3Q2IA 4XCXA 3V8MA 4ZJPA 4NJMB 2Z6QA 3HYCA 1GTRA 3EYAA 4LRUA 2BCGY 3UWPA 1AU9A 1CZNA 5BW6B 3ZIUA 4L72A 2DC1A 4EPRA 2VTBA 1Y42X 3PL1A 2E6KA 1XZLA 4H7FA 4NBSA 4UJ3A 4DA8A 3AKEA 5JZVA 3RUFA 3HTXA 4GYYA 4IKOA 1GDDA 1MIOB 3ZZTA 3KUUA 1VI6A 3OE5A 3Q3JB 4WCDA 4X84A 1OI4A 3E9ZA 4JMPA 2MTBA 4I5GA 3WIBA 4KVAA 3AR6A 1FFDA 2O0HA 4JITA 4NJEB 3ETDA 3IUJA 2JEOA 4D3FA 1TZMA 1L4GA 1R50A 3EZGA 1B16A 4ABTA 1U3DA 2VFAA 3PYLA 3FMOB 2NXEA 4OLHA