4Q00A

Crystal structure of an s150a mutant of the e. coli feob g-domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
255
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAERKEGQFSTTDHQVTLVDLPGTYSLTTISSQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVATRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Exploring the correlation between the sequence composition of the nucleotide binding G5 loop of the FeoB GTPase domain (NFeoB) and intrinsic rate of GDP release.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 85
structure length 255
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q00A01
3IHWA 4PPGA 5AUQA 5FUVA 4FCTA 3LVRE 3AVXA 1GG2A 2PZFA 2K5UA 3GQBA 4YMWA 3CF0A 3IKJA 2OXCA 4UNPA 2IX3A 2J45A 3AEZA 2OLKA 3ZD6A 5JJKA 1R0ZA 2ZJZA 4EPWA 1W47A 5AJWA 1UPTA 2D06A 1XTQA 1WQ1R 2XOKA 4HAYA 4NCNA 3A1VA 3K53A 1U8YA 1BMFA 2ECKA 2GJSA 2QRNA 3GJ3A 1X8JA 3KJGA 2QSZA 4P3YA 3KB1A 5BYKA 2C9OA 2CHGA 1XD2A 4GP6A 1YZUA 2RAPA 1TF7A 5C4MA 2FZLA 2QBYA 4TYPA 3R7WB 2ZUDA 1Z07A 3DM9B 1Z22A 2G0NA 5TARA 3AF2A 2VEDA 4F38A 4YQFA 1IN6A 2FSHA 1YHNA 4O2RA 3V00A 3L43A 1E2DA 3W3ZB 4QBGB 3QOFA 3QXXA 1NKSA 1TF5A 3GLGE 1ZD8A 4HUTA 4AI6A 2QP9X 4V02A 4TLCA 3QEOA 1T6NA 4IDQA 1U94A 4G5OA 4B44A 3MWJA 1JQLB 4G5RA 1J2JA 4KBGA 3RWOA 3U7EB 3BH6A 2QAGB 2EVWX 3OE7D 3T61A 1DAKA 1UDWA 4D81A 5KU1A 4P33A 1P2UA 1E4YA 3NG1A 1R5BA 1IM2A 1Z6TA 4LHVA 2QEQA 2FFQA 3B1WA 2OLJA 4E09A 2A5FA 5HR5A 1G17A 4B2IA 4DIDA 1LVGA 2NG1A 3MMPA 4NYMQ 4DLVA 4DB4A 3VNVA 1G19A 2QPTA 5GJBA 1B0UA 2G88A 4LYJA 5C46F 3I73A 4MGZR 1UKVY 4OK6A 4PSVA 421PA 4A8JA 3D6TB 5HKKA 1BH2A 2WPDD 1OE0A 2E9SA 1W0JA 4L5BA 3CO5A 2RH5A 3B1XA 4Z1MA 4KXFB 4WIAA 3W8RA 5EE3A 3ZH9B 3E1SA 1E0JA 5J5CA 2ZYVX 2GF9A 1GFIA 4HDQB 2QP3A 2FA9A 4L16A 1KI1A 3RRYA 3QVVA 1DG1G 3B1VA 5EXPA 4X8LA 2NTYC 1KI8A 3QUSA 3IQWA 5JRZA 1TX4B 4V0OA 3W9YA 3LDAA 2IC5A 3TQCA 1RW4A 2FG5A 4PPNA 1LFDB 2PZGA 2XX3A 3H4MA 3RYTC 1XXHE 3T12A 1WXQA 3IBYA 4DC9A 3TUZC 4DLTA 1G8FA 4QGFA 4A2QA 1Q1ZA 3B9QA 4FWTA 1S0UA 2Q6TA 4IKEA 3QVUA 1AGPA 2JJ2A 4V0KA 4BLQA 4L15A 4QGAA 4NYJQ 1ZNXA 3FKSA 4DT1A 4BLTA 3CBQA 3QBTA 3PIRA 3KXIA 3AVYA 3Q9LA 3RLFA 3CX7A 2OBMA 1IHUA 1SXJC 2AWOA 2A3RA 3L0IB 4MKFA 4C30A 1DO2A 3TNFA 3TRFA 1GUAA 4ZDKA 3SQWA 2IHYA 2WAYA 4Q4HB 1E3MA 4C3ZA 2AN9A 1WBBA 5FBWB 4HAWA 5P21A 4PHHA 4M4SA 3TW8B 4U5XA 2F1HA 2IUUA 2ONJA 3BXZA 2HCJB 2TMKA 2WWYA 4DSTA 4EFMA 4FCWA 4KFUA 2W2TA 3FWYA 5DI9A 2WWFA 1MV5A 3PUWA 4HEJA 2IS1A 2W00A 3CRRA 1D2NA 1UBGA 3QPVA 4PAQA 1EX7A 2FU5C 2WMOB 3QPWA 1OH6A 4E07A 5GVRA 4ZCMA 4JIMA 1F60A 3DDCA 3RWMB 2YV5A 1Q22A 4Q03A 1D2MA 4TQAA 1Z29A 1G3IA 4K81B 1XB2A 1GRQA 4A0RA 5EP1A 3Q5DA 2A5GA 1XD2B 3WNDA 2EU8A 4LHXA 4A1FA 2DPXA 3QKUA 4AWXA 2DFTA 3MSXA 3BB4A 2QM8A 3A8TA 3K70C 3OZXA 1H65A 4LV5B 4QNRA 3REGA 3T1OA 4C0JA 5ELXA 5KHOC 4DKXA 3U2QA 1Z6XA 1RC8A 1K8RA 3Q8XB 2OHFA 1E2KA 1NN5A 1G3RA 1TAGA 1ZM2A 2G3YA 2IF0A 2LKCA 5AJYA 1BKDR 1HTWA 1KKLA 1X8LA 1E9DA 4D0LB 1W36D 3GLFA 1VKJA 4IDOA 1PLJA 1T5IA 2ZJBA 1HV8A 5BW8A 4BE7B 3SYNA 2JLQA 4M1MA 3ADCA 4G01B 3LW8A 4PC2A 3PXGA 4IDPA 2QY9A 1GKYA 3SQXA 2CE2X 3CRMA 4ERNA 2IT1A 3AP3A 1OXTA 1XEFA 5ANRB 2MSDB 1P2TA 3SBDA 1YR9A 5FL7A 3ZDQA 2WV9A 4D6PA 1KDTA 1XMSA 4BECA 1OFIA 2RGGA 2IYUA 4MUBA 2BMFA 3KKQA 3I8XA 4JLPA 2GK6A 1XJCA 4RZ2A 1VHTA 2IXEA 1Z2AA 4HB4A 4I1VA 1MOZA 3RC8A 4MRVA 1NP6A 1KDPA 4MYTA 1E2QA 4A8JB 5B64A 1SVOA 4R7ZA 4P31A 4WAUA 1VCNA 2V7QA 4WZBE 1QHNA 3SJAA 1BS1A 2BBWA 1KGDA 2BKUA 4NCKA 1P72A 3N2EA 1E9FA 4O0MA 3JVUA 3PEYA 4KFRA 3EZ6A 1II9A 5HCNA 2Q21A 3Q5EA 4US0R 4AIIA 4DLZA 1CIPA 1I2DA 1YVDA 3MUFA 1E96A 2VSFA 4KYUA 1G21E 3QG1A 3VR3A 1Z0JA 1XZPA 4OHVA 4TT3A 3NBFA 1F3OA 4QJ4A 4DXAA 2QT0A 4QM7A 2VH5R 3EPHA 1E1QA 1KMHA 1CXZA 3KKMA 2O5VA 2QA5A 4MUAA 1DS6A 1RKBA 2PMDA 4AKEA 1KI9A 4DT1B 2CDNA 4QL3A 3IDQA 4PAMA 3NXSA 3DEFA 1BMFD 4X8MA 2WWXA 1MO3A 4BLOA 2FSIA 4MKIA 5EP3A 2BBSA 2XITA 1SHKA 5AJVB 2GESA 2OO7A 1YKSA 3CF2A 4GDFA 4BLSA 4AC9A 2EWWA 1P9WA 4HAZA 1DELA 4PZLA 1Z28A 3WP1B 1HH4A 3G82C 4IVPA 4QKQA 1YZQA 1UKYA 5FUWA 1TTTA 3QI2A 4AYXA 3VR2A 3D31A 1KK1A 2RB4A 4CEJA 1A5TA 5IK2A 1XTRA 2A2ZA 1GOTA 3W6OA 4AKGA 1KZ7B 3SDZA 3B2EA 4F4JA 1QG4A 1A7JA 1BYIA 4QBIA 4RVCA 4TYYA 1O87A 3M0EA 3O8CA 4HAVA 1TL7C 2QNRA 4ZIRA 3AH8A 3AVWA 3T35A 1LF5A 1Z47A 4GPTA 821PA 1GRRA 3BJIC 2J7PA 1R0XA 3WMEA 5CJ2A 4BEJA 5CITA 1E0AA 2ZE6A 3X1WA 1XPRA 3FGNA 1GL7A 1KJZA 1XMJA 1D5CA 4EFLA 2X19A 3IUYA 1KI2A 4LOAA 4M1OA 4CW7A 2JLUA 1UKZA 1G9XA 3SEAA 4EPYA 1OKKA 2ZM5A 2G1KA 2QGNA 1KI3A 3R9WA 1IJFA 2BHRA 3SOPA 1E79A 1Q21A 4GL2A 2C78A 2CL6X 2DHRA 1J90A 3BRWD 5B58C 1W0JD 2GJAA 2NZ8A 4Z1MD 1E2MA 3FB4A 4M21A 3GLFB 4Q7KA 4TTPA 4W5JA 3IIMA 1E2JA 4IXNA 2ZRAA 2RHDA 3SJBA 1UADA 1NI3A 3PEVA 1Z0FA 1M2OB 2OG2A 3QY0A 1GZSA 1NKTA 2RGNA 3GJXC 3L0OA 1KJWA 1LNZA 1GKIA 1Z5ZA 5JI2E 1IN7A 1CR2A 4OI4A 1IY1A 3QQ5A 5CK5A 1IXZA 1G6HA 3BBPA 3CPEA 4OBEA 4PC6A 2WJGA 3NVAA 4KBFA 1N6LA 4HB0A 4LV6A 3BE4A 1T8UA 4W5WA 4KU4A 3G0HA 4WBSA 1KZGB 1ZM9A 2JJ2D 1S9HA 3FFAA 3FKSD 3KZ1E 1FOEB 1E98A 4UJ5A 4C9BA 3O8BA 2ZRHA 4URYR 3P4XA 4BLRA 4HI0E 1VIYA 4XJXA 1YE8A 1IN5A 4BPBA 4H1UA 2IXFA 1E2IA 2H92A 1ESNA 2QBYB 1SULA 1VYTA 2YKGA 4GOXA 2G0TA 3TSOA 3A4NA 4US1R 4JVLA 2EQBA 2XJ9A 1Q20A 1DAHA 2AHOA 3CNOA 4BWYA 1G3MA 2C5LA 2ZIAA 4EPTA 2GZHA 1JAIA 1R6BX 2HJGA 2PT7A 2ZRMA 1VG9B 2WAXA 3IEUA 2P0EA 1KMHB 1QZXA 4B75A 2DFNA 1OXXK 3AKCA 4TMXA 3H2YA 3OIYA 1ZNZA 4NPHA 1XFAA 3K0SA 1ZCBA 3KJEA 1E9SA 3NDBB 3ND9A 2FWRA 3LY5A 3WRXC 5EQTA 2ZTSA 2OCPA 4LJYA 4MKGA 4NTZA 4OQNA 3OIVA 4DUGD 4A8JC 2ORVA 5CB6A 2L0XA 4F7WA 1AJEA 1JR3A 3AB3A 4B3CA 5JECA 1PUIA 1OFTA 1RRGA 4O25A 2ZE5A 1YJ5A 1EXMA 2OCYC 3AKYA 1XJQA 2O8BA 4D25A 2H1LA 4WW0A 3EPKA 2EYQA 1FP6A 4HB3A 1DOAA 2JA1A 2H7VA 2P67A 3W6NA 4DCSA 2JJ1A 3IIJA 1W0KA 2FH5B 3KQHA 5F98A 4URUR 3VHXA 4CEJB 1H8HA 1OXVA 1SXJA 5E3HA 2Z5FA 3W5IA 2DY1A 3LXRA 5FPHA 2R6AA 3CF6R 2FJUA 3B7GA 4P0TA 4QRHA 3P32A 3GMTA 4ZIRB 4URVR 1GKUB 4FMDF 3K9GA 1ZW6A 1FQKA 1RYFA 4PHFA 1U0LA 5FL7D 1F2UA 1CJTC 2ZE7A 1R5NA 3BC1A 1W1WA 2JLVA 5KSYA 1S1MA 3O8RA 2WJVA 2XNDA 2NO0A 1S8FA 2CCJA 3TVDA 4TTQA 2BEKA 5LB2A 2R44A 2CEAA 3FTQA 3CUEF 4DSUA 2GNOA 1I2MA 1XJ0A 3LBIA 5FTLA 4JKYA 5EP2A 5HTKA 5L3RA 3AM1A 5F9HA 2WWIA 5L3QA 2NO6A 2CLDX 4Q21A 3QJYA 4C0QC 1Z6YA 1D6JA 4Q47A 4PZZA 1II8A 3SFVA 3SNHA 4MRRA 4LHYA 1AZTA 5FBLB 3DVLA 1GIAA 4IFEA 5AWFC 2BCGY 4PAOA 1KO8A 4FMCF 4ACAA 2J0VA 1G8PA 1W4CA 2C2HA 4GI7A 4L4UA 1CR0A 1J7KA 4TT3D 4TZ0A 1DAIA 3BGWA 1KTVA 4XWKA 1IJEA 2BDTA 4KSCA 2DWPA 1NIPA 4W5HA 5D3QA 4BEBA 1E1QD 2WJIA 5FI1B 3PCRB 2ZRPA 4WXRA 3SFZA 5L8VA 3NIBA 3BOSA 4A2PA 3R8CA 1OT3A 4PX9A 1CJKC 3WMGA 3K0EA 1N6RA 1FTNA 4G5QA 2F43A 1G291 2ZRJA 4Q66C 4XSHA 2D4HA 2GXQA 2WJHA 3AP1A 4EUNA 3U61B 5BWMA 3FYHA 3BORA 3H1TA 2GXAA 4ZDIA 4G5GA 1XTKA 2BMJA 5EE5B 4JLVA 4I1UA 5FBVB 1AGRA 4YXWA 4CGZA 2BV3A 1T9HA 1OSNA 2J1LA 3MLEA 4ZKEA 1J8MF 2ZI4A 2P3SA 4ZPXA 1S96A 2FGKA 2OFOA 2GVDC 3T34A 4DJTA 1N5IA 2AD5A 4KVGA 4BRUA 3THWA 3DL0A 2J0UA 3RS3A 1OIVA 4PO1A 5DO9A 2Q9BA 1MRNA 1M8PA 1WB9A 2WTUA 2MMCA 4EIWA 1YRAA 4R2HA 4LJ8A 1Z63A 4II7A 1L2TA 1IOZA 1XTSA 4BZQA 3H84A 4FINA 4TQ9A 1QHGA 4KODA 1GL6A 2BM0A 2I1QA 4RD1A 4V03A 3SE0A 3RAPR 1W7AA 3EA0A 4FW9A 2GHIA 3AUYA 3LRPA 2CK3D 4JVSB 1JBKA 5TVKA 1MO6A 3KTAA 5FOWA 3KJIA 1CR4A 3I3SR 2FFAA 2GEUA 3WNCA 2ZRGA 3SBEA 4LJ4A 2ZPTX 3B85A 1N25A 3BFXA 1YR7A 1JECA 3NDPA 4CIDA 4NCHA 2O8BB 4PSKA 4MGIR 1CRQA 1E79D 1YZLA 2OCBA 3L8ZA 3SJCA 2P5SA 2CMKA 2IYZA 3QXSA 4F4CA 1K6MA 2CE7A 1DG3A 4KLNA 1CS4C 1SXJB 4DWJA 1N6HA 3EIHA 4NKRA 3C5HA 4IRUB 1PUJA 3IQXA 4KJZA 4P32A 5FTNA 3K9HA 4IVRA 1GRNA 5CM9C 3W5JA 4CZ2A 2C96A 4TTRA 3KUDA 3X1YA 4AK9A 1AQYA 2F3TA 2X8AA 2ZUBA 3ZLJA 3WHLA 1J99A 1F2UB 2D74A 4TL6A 221PA 1AS0A 1FUKA 1KIMA 2AD1A 1FQJA 1N0UA 1N6IA 5SZHB 3VR4A 3KUCA 5H70A 4M9SA 4Q1DA 3ADDA 3BK7A 1AKEA 1L8QA 1NMYA 2IWHA 1ZU4A 4QJ3A 1AA9A 3R9IA 3LD9A 2KE5A 1E9BA 3EZ7A 4LJ6A 4UNRA 1P60A 5J4LA 5AK0A 1TMKA 1KAGA 2ERXA 1DO0A 2YC2C 1HA3A 3QXJA 4M1SA 5L3QB 1G64A 2ZSEA 4LC1A 1RE0A 3GJ7A 1II8B 4TLEA 2KWIA 1ZM4A 1EK0A 1W46A 4V0LA 4A0HA 2IEYA 4Q02A 1PV4A 4JVNA 1GL9B 4G3XA 3LFUA 2QGZA 1ELOA 1KNXA 2ZJAA 5JCPA 3CB4A 3PUZA 1R8SA 2QROA 2CLCX 4TSFD 5D3MA 2W6JA 2IWRA 2J0QA 4EQ6A 1K5GA 1CP2A 1AM4D 2FPKA 2QTHA 4IEEA 2FGJA 1NL3A 3GLHE 2G77B 2HLDA 3ZZ0A 2ZRLA 4I4LA 1AS2A 2OCAA 5FL3A 3OHMA 2B6HA 2C03A 4V0ME 3QG5A 1N6NA 2V3CC 1NMXA 4PO8A 1ESMA 2F43B 4JSTA 2QI9C 1FTSA 2YHSA 4F93B 1XRJA 4OQXA 3NEJA 4F4IA 1D9ZA 3T5DA 1JR3D 4A36A 1ODFA 1OF1A 4O2LA 2EFHB 4LYHA 1UFQA 4ZCIA 2QE7A 1KSHA 2C99A 4B3XA 3LX5A 4QXAA 5K8UA 4CEIA 3ZIAD 2CJWA 4PC7A 4B2PA 3THWB 3TSWA 3VR5A 2J0UB 3JZMA 4G0NA 5HZHA 1DTSA 3K9LA 3SI7A 1XPUA 4KV9A 1E6CA 1SXJD 2RGNC 2FNAA 1JJVA 3M1IA 3I8SA 4Q00A 3AF0A 4C7OA 3NC1C 2GBLA 4PFSA 4UJ3A 2HYDA 3UXMA 1NVUQ 2GCNA 3PR1A 3PQCA 5LD2B 1GNQA 2ZJOA 3ZYCA 1SHZA 5E4FA 1X1SA 3KTAB 2ZI6A 4L9SA 1FZQA 2IUSA 3PV0A 1E4VA 5FPTA 2ZS8A 3U44A 4RCZA 2N46A 2XNDD 4L9WA 4EFNA 2DWOA 2B92A 2D7CA 1DPFA 4B6EA 2V1XA 4AKHA 2GXUA 1E2HA 4NP6A 4EAQA 3OIUA 3GPLA 4B2LA 2ORWA 5CJPA 5JS8A 1EFRA 3E70C 3UG6A 5G3ZA 2V6JA 1P73A 4BZXA 5TXGA 2AWNA 3EX7C 1Z0IA 1NLYA 4UXHA 3VAAA 4XVRA 5KSOA 3K70D 2HCBA 1JNYA 4JBXA 3AVTA 2J59A 1NVXQ 2VHCA 3O8DA 2FEOA 2Q3FA 3K0CC 2Z4SA 3VNUA 4OK5A 3VFDA 4PO9A 3CH5A 4GBMA 2N42A 3FMFA 4NDZA 4R2IA 1U90A 5KOYA 4IFBA 3ZVMA 1XCMA 1G8HA 1D8TA 1NF3A 2P6UA 1YRBA 1EFCA 1F2TA 4LJ5A 1KAOA 1DAFA 3I32A 3DOEA 2Q9CA 1Q0UA 4MGKR 1SGWA 2CNWD 5CLLA 5FOSA 2QSYA 1VIAA 3UATA 2XSZD 3NH6A 3UK6A 4X8HA 1IBRA 1D2EA 2ZVQX 1E2EA 1LF0A 1G5TA 1M7GA 3LX8A 1T8TA 4Q01A 1XTIA 5KO2A 4QM6A 3VHLB 4EDHA 1G7TA 2BMDA 1A2BA 1NBMA 4ZI3A 1ZC3A 3TBKA 3CX8A 1H8EA 4MYUA 2JIZA 4YXWD 2D3WA 4A2WA 2IBMA 4LHWA 3C15C 4FXPA 4EKDA 4MRPA 2CCKA 5IDVA 4BQSA 1HE8B 1FMLA 2J46A 3F0TA 1OHHA 2ZJ2A 4IOLA 4Q1BA 5D3MB 3QIAA 4EQ6B 1XTJA 2XGJA 2WJYA 3C7KA 4GRAA 2J0SA 1WBDA 4IVQA 4LWZA 3FDIA 3K9NA 2HDNB 4Q4AA 1TF2A 1MT0A 4RD3A 3PUVA 5CK4A 5SZJA 2HXSA 2ODEA 2QZ4A 2C95A 3HPRA 4BFTA 2IS6A 1VCMA 1JALA 2N1BA 1B23P 5L3VA 1CJUC 1NG9A 3B13B 3D3QA 4Q1CA 3ZVLA 1OFUX 3FFBA 4YMTA 5LPNA 3U3RA 1A82A 4FN5A 2QG6A 1NN0A 3OFNA 4Q9HA 4BFYA 1XMIA 3HR8A 1MO5A 4PXAA 5JCZA 1ETUA 4RZ3A 4LSGA 4JLBA 5JJIA 2J9RA 1EESA 4PQFA 3F5FA 4D26A 4CEIB 3K8YA 3MFYA 2P5TB 2CJWB 3DHWC 1W4AA 1Z08A 2PX0A 3K0AA 4M2LA 2GTPA 2UZIR 3CZPA 1E9EA 5KTYA 3X1XA 1RPZA 2FX3A 3RSOA 1OH5A 2R65A 4JLJA 3ADBA 5B2ZA 4GFDA 5KPJA 4C7OB 2WWGA 2VHTA 2JLXA 4YDSA 4Z8YA 4TMTA 1XEXA 1SVIA 1Z06A 4WZAE 3WBJA 2ZYTX 3NHAA 5A4JA 2JDIA 2ZEJA 1XD8A 2QMOA 2Z0MA 3ZZUA 2VRWA 4UQOA 2XZOA 1ZCAA 4A92A 4DZZA 1R8QA 5EE0A 4Z54A 3U44B 3B6EA 3MGCA 5DHFA 2KB0A 2IYQA 2ZRKA 1W44A 1I4LD 1KO4A 3LWNA 1TEXA 1KK3A 2CL7X 2ODBA 1ZUHA 3NWJA 3U4QA 2WMNB 1E9RA 3EG5A 4OJQA 1GNRA 4DIEA 5FTMA 5FI0B 2AXNA 1UAAA 1IN8A 3KL4A 5LB4A 3RANA 4UNNA 2UVQA 3PEWA 4PSAA 4DCVA 1G18A 1YZKA 4PHTA 4RD0A 3SHFA 3MWYW 2QAJA 1KY3A 2ZSAA 2REXB 4IDHA 3ZVNA 3CRQA 2VQSA 2AR7A 4AKIA 4IEIA 3BB3A 4NCIA 5AJXA 1XU4A 1W48A 2FN4A 4DLYA 3ONWA 2JLWA 2VHJA 4Q19A 4TLDA 2YINC 3W6PA 2F55A 1NJGA 3GD7A 2IS2A 1N6PA 3HPQA 3MAAC 2GJ8A 2DWQA 1N0VC 4US2R 2W6JD 1NJFA 2J41A 1T4GA 3S1AA 2ZR7A 5LD2C 3HYTA 3GJ5A 5CM8B 2R9VA 5EZ5A 1F2TB 1PJRA 2Q9AA 4JLMA 4BFXA 2PBRA 1A2KC 1KHTA 1T3SA 4F91B 3J81k 4JT2A 4XTRA 1RJ9A 3FVQA 2W2XA 2JLRA 3MJRA 4HSEA 4J0QA 2PZEA 1T0JB 2FPMA 1KYIA 1TU3A 3MCAA 1CRPA 3ZVRA 2XOKD 1UBCA 4LZZA 3RS7A 1BIFA 4FIDA 4MQBA 5KDDA 3MD0A 4I1SA 1EWQA 4OK3A 1OW3B 4JLOA 2DFKB 4GOJA 5GADl 3IBGA 1ZNWA 3NKVA 5GJCA 4C2TA 1OIWA 5CB8A 4DSNA 5J4KA 1G7RA 3W8NA 4IOMA 4NBSA 2EWVA 4YONB 2JLSA 3GEHA 2OAQ1 4LY6A 5J40A 1HT1E 3KDSE 4Q4AB 1YR8A 2X2EA 3L2OB 1EFTA 3BB1A 4PR0A 1CR1A 4XIGS 4XTCS 3WXMA 3ZGXA 3EIEA 1QVRA 1AQUA 1ZD1A 4ARZA 4XD7A 5KSZA 3IHLA 2QMHA 3TQFA 3Q7QA 5A5GA 1YU9A 1AN0A 1WA5A 4BFSA 2ZJ8A 3ECCA 2E1RA 3LBNA 2VPPA 1V5WA 3AGQA 2J87A 3E2IA 1OXUA 4NU0A 2IHBA 3IPXA 621PA 2ZYWX 4BFWA 4M1YA 2QN6A 2GKSA 1E69A 4OI2A 4DLSA 2BKEA 1ZNYA 4PC3A 5HE8A 5KYKA 4FMDB 3B9PA 4Q1EA 3WRYC 1EFRD 3K0AB 4Z51A 2ZAOA 1YZTA 721PA 4DSOA 4NCJA 1QDEA 1R7RA 3RS4A 3REFA 1E94E 1NVVR 5HKKD 1KY2A 1MABA 3ADKA 1QRAA 5CLQA 5CDFE 1XEXB 4JJKA 3KX2A 2WSMA 3A4LA 2ONKA 5DSZA 2FFHA 2QTFA 1OB5A 1EGAA 1P75A 3VKHA 2B7CA 5J4YA 3F8TA 4YLGA 5DIFA 5KDLA 4XVUA 3H0KA 3MRSA 3KKOA 3WHKA 4ACBA 2LWIA 4BLPA 3WYGA 4HAXA 4D4KA 1N6OA 2OZEA 4KCGA 5EXTA 4C4PA 2HYIC 1W49A 4RJLA 8OHMA 3CRVA 1LS1A 5JJLA 3TIFA 2CL0X 2ZITA 4RKEA 4C0SA 2XB4A 5EJEA 4CDGA 4LYAA 3U4QB 2PEYA 4D0NA 3AUXA 3HDTA 4PC1A 4B43A 3CH4B 3TR0A 5BXQC 5DYIA 1DARA 2ZJ5A 3OIWA 4FMCB 2ZXUA 4OHZA 4JL5A 2QMEA 3OEEA 1TADA 5DLQC 1NBMD 5EE1A 4OI1A 2PT5A 1OYYA 3X2SA 1H8ED 2BC9A 3FKQA 2OAP1 2I1VB 2GDJA 4LV8B 2WVJA 2VP0A 1ZIOA 2GBLC 2FOLA 3BIFA 1GAJA 4TLBA 1II0A 2RMKA 1M34E 4QFMA 3S1AB 2IK8A 3DPUA 2V4ZA 4MDFA 3C41J 4GZLA 1P9RA 1SKYE 2VSXA 4HLCA 1GM5A 4Z8XA 1VHLA 1RJ9B 2C8VA 2ZS9A 3CKLA 4IXMA 3K0CA 2JLZA 1U0HC 1NLZA 3AP2A 1CU1A 2D7DA 1GDDA 2QU8A 4KHZA 1VYVA 4HZUA 4DLRA 1G5RA 4YMUA 1G3UA 3CWQA 3EWAA 4B73A 1SVKA 1JI0A 2QQEA 3UANA 4B71A 4JT4A 4C0BA 3SR0A 1RFLA 1Q1QA 4DHEA 4D4MA 3ZS9A 4BFUA 2ZRBA 3V9PA 1PLKA 3W90A 2RGCA 2DCUA 4QHSA 1KOFA 1RRFA 3EAQA 4LUCA 3IO5A 3KXLA 5JEEA 1ZBDA 4KAXA 1S9DA 4FI3C 3QSYA 5C2JB 4JYCA 1OFHA 1TQ6A 2KI5A 2O0JA 2W83A 4B74A 3KKNA 3EARA 3X1DA 3ZZTA 4N3NA 4ARZB 4MRSA 4ON9A 5CYOA 3X1ZA 1RIFA 2O52A 1Z0KA 4B47A 2IYYA 5BQ5A 2WKPA 1VTKA 3L0SA 2WIAA 1NRJB 1LS6A 2A5YB 2WM9B 4HDCA 5JBQA 2NMVA 3FMPB 1G8GA 1N5KA 1WP9A 1KO1A 5BYJA 4Q9KA 4LBWA 3L8YA 4NYIR 1JR3E 4GZMA 2HF8A 3U6KA 5G3YA 5HCIA 2FV8A 1TUIA 3TH5A 4RCYA 3DM5A 1MABB 1A1VA 5KDOA 1TNDA 3RRMA 2V7QD 2FSGA 1IY2A 3A36A 4RSGA 1T3LA 3B1ZA 1HURA 1SXJE 5JI3E 2R62A 1J8YF 1KDRA 1XX6A 2ZE8A 2W6IA 1IQPA 3F3YA 4LBZA 3Q7PA 4AURA 2O0HA 3WP0A 5GJVC 5CYPA 2OBNA 3BH7A 4JBWA 5FTJA 2J5XA 3U7FB 2IXGA 5DISB 3IO3A 1OXSC 3AVOA 2ZQ5A 4E22A 3C16C 4HB2A 2H18A 3BH0A 4M9QA 2VSOA 3RC3A 4CT5A 1C9KA 5UKDA 4LRWA 5IF9A 1VG0B 3QE0A 4JZKA 1OV4A 3FHTA 4FWIB 3UMFA 3FE2A 4AG5A 2NOAA 1CLUA 4NHOA 2XTNA 3EZ9A 4HUQA 1WCV1 1U9IA 3BFKA 4DLWA 4PTLA 2NQ2C 4K8OA 5SZKB 3GEEA 4URXR 4UNQA 2PLRA 3U6BA 3A37A 1TU4A 2GK7A 1KO7A 2OBLA 2W0SA 4OKSA 2ZR9A 2RGXA 1COWA 3AF4A 4Q9LA 3VTKA 5GVSA 3SYLA 3THXA 4URWR 4WOPA 3KJHA 4M1WA 2AFHE 1NVVQ 3TVTA 4LC0A 3PEUA 2OILA 4AG6A 3A6PC 2UKDA 1KI6A 2HJVA 2X77A 4JJZA 3GJ4A 5IK2D 4PPFA 1UEIA 4HZUB 5M04A 1OPXA 1X8KA 3SN6A 3T06B 1T91A 2WSSA 1VMAA 2CLSA 4M1TA 5J4VA 2VTKA 2J7PD 4LJAA 2XZPA 1LV7A 4BFVA 4LDJA 5FPYA 3PUXA 2SHKA 3GJ8A 4EPRA 1E2LA 5FUXA 5TDHA 5B30A 1WRBA 1X1RA 2AL7A 2DBYA 3RSLA 1W2GA 4DDUA 4ZDJA 1NN1A 3NBYC 3UKDA 4PHGA 1OKKD 4L8GA 2ZVPX 5GJWC 1TEVA 4BGDA 4DCUA 2AKYA 2WZQA 5K8TA 1XPOA 3QEJA 2BIFA 4S35A 1KK2A 1KNQA 3OAAA 3TUJC 2MSCB 1MRSA 2P2LA 2VIIA 3A1WA 4YDHB 5FOTA 4EJSC 1CKEA 1R5OA 2A30A 3CIOA 3GFTA 1SVWA 5FUYA 2A5JA 2ATVA 4QC2A 3P4YA 5EE9A 3WY9A 3CONA 1C1YA 3CX6A 1QHIA 3K09A 4M9XA 4PQRA 4M8NE 5EP4A 5IT5A 3D8BA 2H8KA 4MRNA 2F1JA 1QHHA 2Z4RA 1DAMA 3RS0A 1N5LA 2NIPA 2IYRA 2WKRA 3RABA 2QT1A 2XZLA 4E5UA 1W2HA 4NE2A 4HATA 3QBVA 1ZUIA 4V0NA 1AIPA 2FF7A 5DYGA 4DRZA 2H16A 5JLJA 3CR7A 1K5DA 1P2SA 5FR1A 5FPSA 1S3SA 3OEED 1FNMA 1XDBA 1EG7A 3IPYA 4JL8A 1KSFX 1SQ5A 3EW9A 4LYFA 4U7DA 2BEJA 2LKDA 3GLIA 3WYAA 1KSGA 2EFDB 4B6FA 2ZRFA 1FPMA 2OFXA 1GITA 2ZANA 3DO6A 3WBKA 3N2IA 1WF3A 2GZDA 2VBCA 2C98A 1NLFA 2D2FA 2HT6A 1R4AA 2Z6VA 3EIQA 4GSYA 5KNDA 3EPJA 2ZAMA 3VX3A 2ZSDA 4B32A 3VKGA 1IXRC 5AJZA 4A6XA 2BM1A 4IHQA 3GLHA 3M4YA 1Z2CA 1N2CE 2A78A 3UIEA 1Z8FA 1E2NA 5TV2A 1QHXA 5EXSA 5E7JA 1ZAKA 2RGAA 1N5JA 3UWOA 1D9XA 1JEEA 4B35A 5DI3A 3SJZA 2FPLA 2JJ8A 2R6GA 1KKMA 1ONBA 3W34A 1UJ2A 4B48A 3EASA 2FFBA 3TW4A 4HUQB 2ZROA 3TK1A 5AUNB 1XF9A 5CIWA 1NG1A 2BJVA 2WWHA 1SZPA 4OJKA 4TYQA 4GT1A 4TYWA 2IYWA 1JPJA 1JQJC 3C4JA 4NYIQ 2OM2A 3A1UA 2AX4A 5DH9A 2JEOA 3QXCA 2NO9A 2ZU6A 3AV0B 4OHWA 4UKDA 4WVFA 3THXB 5FR2A 4HYYA 4U00A 1MKYA 3KQKA 2NO1A 1VG1A 3HWSA 3LAWA 2QP4A 2O8EA 1KI6B 1E9CA 2JJ1D 2V6IA 4IOKA 1W0KD 3FMIA 1H8HD 4NONA 1OIXA 3GLGA 2HUPA 1DADA 2AK2A 2F1IA 1JEDA 3RNLA 4BUJA 4QJ5A 2QMUA 2DFLA 4BRWA 2YOGA 1RZ3A 2Z83A 3LH5A 1FNNA 4KLZA 4UXJA 1NVWQ 2YVUA 1Z0DA 2GCOA 3MWLA 3AVQA 4BFZA 2ZI9A 3LBHA 4HLQB 4Q7MB 1CBUA 1YR6A 2AK3A 3R8FA 3T5GA 3UWKA 1CTQA 2F6RA 2JCSA 4LJ7A 1OLOA 4WZ6A 1I4DD 1QBKC 2V9PA 4DCTA 4F92B 1XMVA 2IL1A 1TQDA 4JVMA 4ESVA 1F5NA 1XCGB 1SVSA 2GJ9A 1QHSA 2ZETA 3QPUA 2C9YA 2NZJA 2VO1A 2REBA 1UDXA 3I4LA 5CIQA 4OYHA 1ZU5A 4B3BA 3K1JA 2QM7A 1OH8A 4OI0A 2W6ID 1G3QA 3NTUA 1HEIA 4TL9A 1FL9A 3I61A 1ZINA 5E95A 4ZKDA 2WWWA 1XWIA 3NBXX 1HQYE 3DKPA 2CXXA 3I1FA 2PL3A 4JLKA 4DDWA 1QHHB 3TGPA 1FX0A 2AXPA 4NZYA 2ZRDA 4DLXA 5F9FA 1JXOA 1KO5A 1NSFA 1DAEA 4D2IA 1EFHA 2B21A 4QGHA 1T3HA 1P62B 3T15A 2ZREA 1PZNA 3JZAA 4Q4LA 1XXHA 1ZVQA 2C04A 3KXKA 3TKLA 1CJMA 4C0LA 3QKRA 4XH9B 3AVUA 1F6BA 3P1JA 3TAHA 2VP5A 3ETLA 3QKTA 2ERYA 2ANCA 3VKWA 2IS4A 2G83A 2OE2A 2XTMA 2IYSA 2PX3A 5LDDC 4W7SA 4B76A 2O8DA 1QF9A 3GLIB 1S4QA 2JGNA 1G41A 2P65A 5FBRB 1G4AE 1W36B 3CRW1 5F3WB 4POAA 2XXAA 1VDZA 2GCPA 5C4GB 3LO5A 2P6NA 2YOFA 1COWD 1KDOA 1ZJ6A 4P4SA 1S2MA 4M9ZA 4PQYA 1UEJA 3GLHB 5AUPB 3PITA 1DE0A 1EFUA 3AQ4A 1G7CA 3U3MA 3TAUA 2XTZA 2YJTD 3M6AA 3IEVA 3GEIA 4ZV4A 4A15A 5DI3B 4LHZA 3Q3JB 2WIBA 3C8UA 1HE1C 1L4UA 2O0KA 2WSSD 5G40A 5KUTA 3OF5A 4ASUA 5TB5A 1VCOA 1Y63A 3JVVA 2ODNA 3TMKA 2V8OA 2H5EA 1Z3IX 2IYLD 4OQMA 2EFCB 1R10A 3AVPA 4JKIA 1L7VC 1CJVC 4LK2A 5C18A 1LW7A 2IYVA 3CNNA 3KFXA 4XSGA 1NBME 4LCBA 2EFGA 2PLFA 1I4TD 4NL4H 1TQ4A 3AF3A 3DMDA 4D82A 4CF7A 1J70A 2RCNA 3IGFA 4PZYA 1GNPA 4MYHA 2O8EB 3FHOA 5JHHB 3DZ8A 3OAAD 4RD2A 1TPZA 4Q48A 3GFPA 3GLGB 3QNUA 3I5XA 4LJ9A 4KYIB 5FFMA 2WOJA 5TMPA 1E2PA 1E32A 3THYA 2IUTA 2QORA 5DNYB 4TZ6A 2YNMA 1AK2A 3RS5A 1AZSC 1R2QA 2GCOB 4JSYA 1UBEA 521PA 5E7IA 4A0FA 4DUGA 1U99A 4ILEA 5E7MA 1G16A 2LCFA 3HU1A 3KQUA 3ASZA 1KMQA 1U9IC 4K46A 3LNCA 1G4UR 3PUYA 4E03A 2IA5A 2B7BA 3ZQ6A 2GWHA 2XEXA 2I3BA 1P61B 3ICEA 2RGEA 5TY0A 1FUUA 4LX0A 1QVAA 5EUMA 4OQFA 2H17A 1ZM7A 4KITB 3U5ZB 3SU8A 1ZD9A 4HLUA 3BFVA 4IW3B 2VHQA 4CT4B 5BN4A 2ZU0C 1SVLA 1JAHA 2W0MA 1T5LA 3NBZC 2KJQA 1U98A 3B82A 3LQQA 1ANKA 1XP8A 2P6RA 4RD4A 3ND8A 5BN3A 1FX0B 2JATA 1GILA 2FZ4A 3GLFE 4YMVA 4QHTA 3I5YA 2W58A 1ZMXA 5DN6A 5KNBA 1YZGA 3MJHA 4HDOB 1QHYA 2VL7A 2R6FA 2R6CA 3B1YA 4TL7A 5K8IA 3TUIC 3ASYA 3EPLA 3U7GA 1XXHB 5FPKA 2VF8A 3QKRB 4B3GA 4EJSA 2IYTA 3AKDA 1M6NA 3A1SA 2HLDD 3RS2A 5FOVA 3UG7A 3Q72A 4IJMA 5JHGB 3B60A 1ZUNB 3WYFA 1M7BA 2IYXA 2VHUA 2QTVB 1Q1EA 3G5UA 2O8DB 1SVMA 2YWEA 5F2EA 1Y3AA 3VR6A 1VECA 2XXAB 1DEKA 4CEHA 3IIKA 2NPFA 4QOSA 4DB2A 5B57C 4MYCA 4P4SB 2VLIA 2QENA 2QPOA 5G41A 2ZSBA 1NNEA 1N6KA 2O8CA 4TWZA 2QE7D 1UKEA 2FSFA 2FMXA 1L4YA 3TLXA 4Q18A 5LBIA 4JYBA 1KI7A 1WE2A 2QRZA 1W4RA 4AY2A 3K09C 3C14C 3LLUA 3KKPA 2BJWA 3I92A 2HV8A 2BWJA 1IN4A 4LPKA 1HY3A 2QAGC 5EZ6B 4C0KA 1E99A 1HQCA 4C0AC 4QGGA 1HT2E 2GAOA 2V1UA 2RGBA 3WNBA 1ZRHA 2I4IA 3K0FA 3HR7A 1IONA 1CF4A 2XNSA 4DBLC 2MSEB 4IDNA 4ITRC 3CNLA 2OV2A 1GVNB 4Q5IA 1E9AA 2ZI7A 3UMSA 1BO6A 2GF0A 4IOJA 3AF1A 5JMTA 5H1YA 3P27A 5JFGA 4Q9IA 1E0SA 4JL6A 3T1VA 4ZDWA 2BVNA 3C5CA 4DDVA 1W36C 2DYKA 4RFSA 3QENA 1PVOA 3EZFA 3GCGA 1Z0AA 4DVGA 2OESA 5JEDA 1JPNA 1XBTA 4U02A 2E87A 5FOUA 4HAUA 2VF7A 5CDFA 6Q21A 2NGRA 4S2EA 1OYWA 5JZVA 2JAQA 1KK0A 4KFTA 4A0GA 3ICQB 2GRJA 2CHVA 2WKQA 4URZR 3THYB 3W3AA 5FH9A 3RVBA 3T1TA 5G53C 4TMWA 2B8TA 4FD2A 3VX4A 2GXSA 4Q4JA 1PLLA 1E1RA 1DVRA 1Q1BA 4TMZA 3IILA 3U3KA 2CK3A 2VP2A 4RY2A 4MDEA 2H57A 2OSBA 1SKQA 2UZ3A 1A4RA 3CPJB 3NHBA 4HLDA 1RRPA 1ZP6A 4MITA 2DR3A 5IRCD 4N0DA 3PJRA 4ZI2A 2VYFA 4MKHA 3LXXA 4LGMA 2GA8A 2OUKA 3CR8A 3Q85A 3HU3A 3U3JA 4MH0R 1MO4A 4PPQA 3PG5A 1FW6A 2Q3HA 4QBFA 3ZD7A 4Q9JA 1YQTA 1XEWX 2F3RA 2ASEA 2XJ4A 3BS4A 2HXYA 5AR1A 3FPAA 4P4UA 1HUQA 2MMGA 3I72A 2OEPA 1LY1A 2JIZD 2DB3A 3QXHA 5KPDA 2HEIA 1P6XA 4G1UC 1UM8A 4OHYA 3VQTA 1U0JA 1R0YA 3QKSA 5BN5A 4QBHA 3LVQE 4OHXA 2XB2A 2AKAB 2KBEA 1OHHD 2IF2A 2REOA 2ATXA 4LI0A 4B3FX 4EJSB 3PFIA 1Z6AA 1JJ7A 3LLMA 1MR3F 4KFSA 4A4DA 5JSZA 4ASUD 1Q44A 2J3EA 4ZO4A 4TMKA 4H1VA 1RVDA 4Y0VA 1JXMA 2PMKA 1WMSA 2ZR0A 5H8WA 1M1YE 1M7HA 2RHMA 4XWAA 3OEHA 4QHYA 4OL0A 2A7QA 1NSTA 3SYKA 3NEYA 3GFOA 4DCNA 1EX6A 3R20A 4CEHB 2KSQA 3OFND 4B34A 5JRJA 3TR5A 3ZQJA 2HT1A 4KI0A 1NMZA 4NH0A 4LPSA 2G1JA 2O8CB 2B8WA 2VA8A 3TJZA 2BCJQ 1DBSA 2C77A 4JLNA 1IAQA 5DGXA 4P4TA 1US8A 3GJ0A 2GEDA 3AVVA 2CVFA 3E5HA 4TSFA 4HZIA 1QG2A 3P26A 2WHXA 1W5TA 3EC1A 3RRNA 1E0KA 1P2VA 5JS7A 4GP7A 5A0FA 1N0WA 2X2FA 4KO8A 3K0FB 121PA 2PEZA 1E2GA 3H86A 4X8OA 2EFEB 2JDID 2WICA 1XCPA 2G6BA 4FCVA 5J4HA 1OJLA 3CLVA 3N5CA 2BBOA 4N0EA 2BMEA 3VU9A 2VP4A 2OT3B 3U3OA 3QF7A 2R6DA 2ZI5A 3CPHA 3B78A 4C0HA 3RDPA 4D0GA 2PCJA 4RFSB 3SS8A 3EC2A 3ZJYA 3R9XA 1CEEA 2F9LA 3ZIAA 3CZQA 2R8RA 4WA7A 2O8FA 3B5JA 4EPVA 1W5SA 1ZC4A 2Q0HA 1P7CA 3QF4A 2FE4A 4ZCLA 1NN3A 3DKVA 5KNCA 1U81A 2FDCA 1G8YA 3N70A 3NH9A 1OH7A 2RGDA 4A82A 1AKYA 5H68A 3PENA 4JLAA 3AKEA 4Q4JB 1OB2A 1GSIA 4GMDA 5HZKA 2ZRCA 4GNKA 1UBFA 4N1AA 5DN6D 4QNMA 4C2UA 5JWHA 4GMXA 2YWHA 5DE3A 1TQ2A 2GAAA 3HU2A 4DEXA 2PJZA 4YMSA 3NC0C 2OFWA 3OE7A 2IEZA 4I81A 4BASA 4EPXA 1S1CA 1VCIA 4XVQA 3U7HB 1WDTA 4Q7JB 4JMPA 2JASA 1Q12A 2ODWA 3KFVA 2EYUA 3UMRA 4AD8A 4MA4A 1GWNA 4KSBA 4Q1AA 1G20E 2ZUCA 2YYZA 2Y8EA 3I62A 1C4OA 4UNSA 4WXPA 2GZAA 3CWZA 1X3SA 1EWRA 4M53A 1O3YA 1NY6A 1X86B 4I99A 2ZJYA 3D7MA 2WPDA 2KBFA 3DMNA 4G5SA 1VYUA 4I1OA 1T0HB 2CBZA 3CM0A 4CVNA 4D4JA 3SZRA 4TMVA 1DAGA 4Y0AA 5L3SA 3FHCB 3P20A 3QKSB 5JWRA 1SKYB 1P9NA 3RHFA 3L0PA 1G7SA 5SZIA 2OXRA 2PCLA 2YOHA 4LBVA 2V54A 1ZIPA 3L82B 4UXIA 2J7KA 3V4RA 4XOIA 5JSZB 3CW2A 2FEMA 4RZUA 4Q1FA 1P3JA 2CNWA 1W4BA 3BAFA 5JWOA 2D62A 2XSZA 1GP2A 2BBTA 2JLYA 3A58B 4NYMR 4XD7D 5HPYB 3LQRA 3MWKA 2PJRA 2R2AA 5AUOB 4TYNA 4AYWA 1XZQA 2ORIA 1HYQA 4JS0A 3ZS8A 3GJ6A 1S3GA 1P4SA 1G5PA 1GTVA 2V55B 2ZRIA 2F1RA 1E2FA 4B33A 3VMFA 1FFHA 2GVZC 4ESHA 3BERA 3PVSA 1US8B 4HLUC 4QG7A 5J47A 2PH1A 1ZYUA 2A9KA 4XWOA 2NPIA 1FP7A 1U2RA 3R7WA 2Q3MA 1UF9A 5HE9A 4CRWB 3FMOB 3SHWA 2ZRNA 5KSPA 4DEYA 1N3BA 1XD9A 1X6VA 1KI4A 2YZ2A 3A4MA 3O47A 4RFVA 1G6OA 2WJJA 4M22A 1U8ZA 3A1TA 4TQUS 1E1RD 1Q3HA 1XNJA 2HF9A 4CYMA 1LTQA 1LB1B 2CVHA 2A5DA 3LA6A 1TUEA 2QQ0A 2QPAA 1F48A 4YC7A 2NO7A 4NYJR 4R9UC 3AGPA 3VU9B 3RRZA 4TN1A 4RKFA 4KVAA 3T1QA 1IXSB 2QAGA 4R71A 4A9AA 3HYRA 1R0WA 1RYHA 2IW3A 3LV8A 2C9CA 3EXAA 3THOA 1BOFA 4H9GA 4JLDA 4RD6A 4ABYA 4O3MA 2O8FB 4A6PA 1BYUA 1YZNA 3QF4B 1CULC 1Q57A 2GILA 3FOZA 2W2VA 2ZYUX 4W9MC 5DHAA 1KSJA 3BD9A 1NY5A 2CCGA 2VP9A 2F7SA 1JB1A 2WBLC 3DZDA 1G1MA 4DLUA 4RZXA 1AS3A 2AFIE 2GEVA 3TSZA 4OQLA 3KB2A 4B3DA 1XEWY 3SC3A 4Q7LA 2YC4C 1Q3TA 5FTKA 3EWSA 1NIJA 1U8AA 3TE6A 3KQNA 3KQLA 4LBYA 4M1KA 3MG9A 2ZI3A 2Z43A 5FOXA 2YWGA 3EZ2A 1VG8A 2QL6A 2CHQA 1KJYA 4M0LA 4D4LA 1RRCA 1FMJA 4FMBB 4TLAA 3VR1A 4D80A 4V0MA 3HJNA 5K8LA 4JBYA 2G9NA 3WMFA 2ANBA 3OEHD 4NMMA 2RKOA 2EW1A 1ZM3A 3DOFA 2VP6A 3K70B 2XAUA 4DDTA 2X1VA 4R98A 4AYTA 1MH1A 4PANA 2GJKA 2GETA 3GLIE 2ZSFA 3BWDD 1Z6GA 4GOKA 2YWFA 5EXXA 1JR6A 5C1BA 4MGYR 5FBQB 2D2EA 1P5ZB 3B8HA 4TL8A 3GP8A 3UPUA 1V43A 4Q4HA 5L3SB 3HP1A 1VPLA 1IY0A 2ZS7A 3LW7A 4BZPA 1Z83A 1M74A 2F9MA 2BOVA 3V4FA 3EA5A 5IHPA 5EUQB 3OESA 2WOOA 2QUZA 3U60B
chains in the Genus database with same CATH superfamily
2WYOA 3HVIA 4E70A 5L6LB 1MAVA 2K5UA 2PZFA 2XQFA 1Y9EA 1JDJA 2PKQO 3O3MB 1XO1A 3BKWA 1RWWA 3IKJA 3JAWA 3K72B 1USWA 3W7BA 3AEZA 1QFZA 2OLKA 3R5HA 5GGXA 1UBJS 4BP1A 5DX1A 5I8ZA 3ZE2B 1YL7A 1P3DA 5DT2A 4HQOA 4JJ6A 1T5BA 2P78A 1T24A 1U8UA 1Q92A 1SUIA 3K53A 5D7BA 5CEJA 4HRAA 2B5OA 1E7WA 4OHBA 3KLPX 4U7PB 1C0IA 3KJGA 4P3YA 2A7XA 3D4OA 3MWFA 4FFOA 3OTOB 3G0HA 3KB1A 3TB6A 2AG8A 3NNDA 4F2DA 3AIMA 2RAPA 1ZLYA 2J09A 4TROA 1HOTA 3UUWA 2FZLA 5I5EA 4IH1A 4NFHA 2Q2NA 1PTJA 2GTIA 1VL6A 3C7AA 3F47A 3U39A 4YGYA 1W73A 3KAPA 5KHAA 4I2NA 5TARA 2HA6A 4IEFB 4LX8A 2E48A 2VEDA 3AF2A 4TXLA 3S7ZA 5A3JA 4N3AA 3OMWA 3WL4A 2PLWA 5DMHA 2FSHA 2OORA 3TB4A 4DG9A 1FS6A 2Q7XA 3AEXA 1JQBA 2HW8A 3NVDA 4Q12A 1RYYA 3Q3CA 1J2RA 4B85A 3KLBA 4D42A 4AI6A 3MJFA 3AXTA 2JKYA 3QEOA 5TEVA 4G5OA 3JD2A 1GPDG 1D1SA 5EJ2A 2V0NA 4UE6A 4G5RA 3RWOA 3BH6A 4MGEA 2F1OA 5L7WA 5L95A 4R1PA 3TLGA 1Y82A 3OPXA 3SMQA 5C7LO 4CTMA 4HMPA 2DECA 1LPSA 1E4YA 3LF1A 3ONFA 4UM7A 3K4HA 3B1WA 2P0YA 5HR5A 4B3IA 5AW6A 1ND6A 1OXMA 1Y7PA 1G19A 1LX7A 1UPCA 2G88A 3OUTA 5CEFA 5FBHA 3AETB 3RAFC 4YIKA 2CY0A 3TNYA 5BR4A 1KEPA 1D0IA 3QEAZ 1H2ZA 1FPQA 2E9SA 4RF3A 3ICVA 3FCSB 2PMWB 2RH5A 1Y6QA 1L7MA 4KXFB 1XMQB 1QU3A 4GLOA 1QTRA 1Q7CA 2PRIA 3E1SA 3PL5A 4U0JA 4WINA 5J5CA 1DQZA 5E3JA 5IC5A 2GF9A 1Q91A 2M9MA 2YRXA 5LNK1 2BPOA 2PWAA 2GNPA 3JALB 3GB9A 1VSQA 4L16A 4MKRA 4E5KA 5C35A 3RRYA 3QVVA 3B1VA 4X8LA 2NTYC 3M5WA 2XGOA 3LP6A 5AHRA 3B9RA 4AZWA 5JDIA 1K88A 4RVFA 3HY6A 3L6UA 4V0OA 3W9YA 4AIRA 5CG1A 1RW4A 2FG5A 3UPTA 1DTWB 2WZDA 2QVYX 4J0DA 4PPNA 1LFDB 3DDNA 4YRPA 1EXVA 1DBIA 2HSJA 1J33A 3FRIA 4JJEA 4RSMA 1WXQA 1E5LA 3EXHC 4DC9A 3T7JA 3FHJA 3TUZC 3AUFA 1PT6A 1G2OA 1XQ1A 4OXKA 5DEIA 4BVJA 1JFSA 2KHZA 3K1ZA 4O08A 2BFBB 4N8EA 1ADCA 2FFJA 2NN3C 2PPVA 3FZQA 2JJ2A 4FZ5A 4GGPA 4URHA 2JAWA 3CHYA 4G5XA 4L15A 3UAYA 3J7AC 3GJQA 1QB7A 2EZ9A 2NSDA 3ETDA 2L82A 2YIDA 3IVXA 3IUNA 3PIRA 5JD4A 1I1QB 1WY7A 3A05A 4JKOA 5I01A 1PAUA 3HNOA 4N0PA 5LOVB 3L0IB 4C30A 4CCYB 3TNFA 3CNHA 2IEAA 4ZVKA 3USZA 3IVMA 2FW1A 1FQOA 4C3ZA 2AN9A 2O2DA 2QL7A 4NY1A 1JLLB 4HAWA 1KFBB 1ZSYA 3JQGA 5BVGB 1J0EA 1NNUA 2OB1A 4HLNA 4FFWA 3PPYA 3EWIA 3SAJA 4NNPA 2HCJB 2TMKA 3DWEX 1L4LA 3LVFO 3GQBB 1XL1A 5JARA 1K0FA 1MV8A 3IQHX 3FWYA 3SQLA 3VNQA 1JKFA 1D2NA 2VNIA 2CNDA 4L95C 1J2TA 4PZAA 4RTLA 1EX7A 2FU5C 1B2RA 1JIVA 2AW5A 2HQBA 2WMOB 2XECA 2D8MA 1U9JA 3QPWA 5ICFA 4E07A 1OH6A 3DE6X 4JIMA 3TTXA 1TD9A 1Q1AA 3DDCA 3PUKA 4TQAA 1Z6PA 3W06A 3OLXA 5B3AA 3JTEA 4FFMA 3DR5A 1Z29A 4N5NA 3D0QA 1JHDA 3GBVA 1BW9B 1QANA 2X8WA 4L0CA 4PNZA 4Y2PA 1RXIA 2PIAA 4BOYA 3OZCA 3F3SA 5EYPA 3DKIA 4I6JA 5JNSA 2VK4A 4DCJA 4JQSA 2Q6LA 4AWXA 3VYUB 2DFTA 3MSXA 2QBYB 2QM8A 4YH1A 4ER0A 4LV5B 3E3OA 4C0JA 2DGDA 2ZAIA 3REGA 5IEJA 1YOVA 2CKDA 3A6ZA 4G37A 5T57A 2H4JA 3U2QA 2VTBB 1R6UA 4WSOA 4G89A 1XZJA 4YAUA 4WECA 1GHTA 1NN5A 4D44A 2ZG6A 1G3RA 1ZH6A 3I6YA 5G1PA 3IBFA 4FYHA 5DMXA 2LKCA 3K9QO 3AFHA 1BKDR 4YRKA 1HTWA 5I3CA 2UYYA 5K3DA 3M4NA 4ARUA 4LDRA 2C58A 4DIFA 4ZHQA 3NGMA 1VL0A 3EVDA 3SYNA 1M5UA 4IMIB 3LW8A 4A8PA 4R8RA 4YRRA 1TCVA 2WP0A 2QY9A 4KACA 5DWVA 1OI2A 2CE2X 2PWZA 3CRMA 1M2OA 5LLTA 1HKHA 1OZ0A 4C2AA 4J16C 4XDHA 4BO5A 1W1UA 1XEFA 3SBDA 1V35A 3ZDQA 5CR9A 2B78A 3QE2A 1GLNA 5HUHA 2WQ6A 1W34A 2XY4A 4UTPA 1FVXA 2AX3A 1A7KA 4LXGA 5T64A 2ZT7A 3KKQA 3E58A 1Z4NA 2JFVA 3I8XA 1H1LA 1XJCA 2X9NA 4JLPA 3VVBA 5TJ9A 4FDVA 3SWWA 2G76A 1TYEB 1M6WA 3GRFA 4H1TA 2CT8A 1OU0A 1KDPA 1J5XA 1WLSA 3GARA 5ADUS 1E2QA 3VPXA 2AZXA 2BGNA 3EXIB 4P31A 1Q7RA 5CVCA 4JYZA 1VCNA 4CMEA 2V7QA 3ZCPA 2NYAA 4R40A 3UMVA 3ETGA 1OGIA 1QHNA 2PVPA 3IMFA 3PNPA 4FW8A 2AC7A 3DT9A 2G4LA 3FCCA 3N2EA 5JC1A 3FMGA 2JIPA 1E9FA 3H5NA 1KJIA 1QFJA 3HZRA 2NXCA 3LQ2A 5H80A 3PEYA 3EZ6A 4AU1A 3Q5EA 1R6VA 3VYVA 3VU1A 2HSZA 2ZB7A 1J06A 1I2DA 1NXXA 1KY4A 2I2BA 1AOXA 2OCIA 4MTLA 4ZVNA 5AKEA 2VBFA 2VSFA 3L1JA 2EL7A 2VUSA 1Z0JA 1XZPA 1Z2DA 3O3OB 4GX0A 4M8KA 3CLRD 1T2EA 1UKBA 5K0FA 1KZ1A 3ANYB 1EX9A 3HV2A 5JANA 4MYRA 3K4QA 4KFCA 4P92A 1I7LA 1JG6A 4QJ4A 3T7DA 4RZQA 1E1QA 5A4DA 4RM3A 4MUAA 1RKBA 4KQIA 5FA8A 3VNBA 2CDNA 1U1DA 4QL3A 2AZDA 3L8EA 3KPVA 2JGIA 1LNSA 2H2FA 5EERA 1BA3A 1BMFD 4GW3A 1A9RA 1N2SA 5BUQA 1MO3A 1VE5A 5DM1A 5J43A 4C43A 2O05A 1KPIA 2BBSA 3ABZA 1SHKA 1RJGA 1ZGHA 2GESA 2OO7A 3KQYA 3CF2A 5AI4A 4GDFA 4E5YA 4LKRA 4E5VA 4UAJA 2XWPA 4U7TB 5E8RA 5EIAA 1BE6A 1Z7YA 1P9WA 1B8UA 3CX4A 3KDAA 4PNPA 4HAZA 4AULA 1FXSA 2JK1A 2Q3JA 1Z0ZA 3G82C 1YZQA 3C8HA 4R68A 5BP7A 4MROA 1GPH1 1H4QA 2G8LA 1PR6A 3H1AA 1KK1A 2QLNA 4ND7A 2FHPA 2FLVA 2FWAA 4HDNA 4QPJC 5IK2A 2E5WA 1MIHA 1DX6A 4CEJA 1KMCA 5IJXA 3HVRA 2ALJA 3TM4A 1QG4A 1A7JA 1BYIA 1PW7A 3KLOA 1UANA 3M0EA 2BELA 4HAVA 4HH4A 2C97A 2TSYB 4INJA 1QLWA 3AH8A 5DGIA 4ZIRA 5JTTA 4BE9A 4NJEA 1OV6A 1T0IA 1L9KA 1LF5A 2XE6A 4J8PA 3NKFA 4LVNA 4Y18A 4JU8A 3KYCA 1P39A 4EG4A 3RQIA 3ENWA 3DLTA 4IJKA 2R47A 3HKEA 1CY7A 3F9RA 2A5LA 3FUCA 3IMGA 4L27A 1GL7A 1KJZA 5DU2A 5HRAA 3HXOA 1V5IA 4K3UA 4GOMD 4CV2A 4EFLA 2X19A 3G68A 4M1OA 4E4RA 1HNNA 3FW1A 5DM70 1S2NA 1UKZA 3QYAA 4EPYA 1P77A 4HC4A 5K8JB 4L72A 3ZTYA 2G1KA 3J7TA 2QGNA 3HJCA 1KI3A 4P4LA 1IJFA 4PXSA 4U6SA 1A5ZA 1D04A 1SUAA 5D5HA 1Q21A 4WESB 2CL6X 4Y6RA 1VSUA 2NZ8A 5EMLA 1XF1A 3IPLA 1IBCA 3UWSA 4DM3A 5HJEA 4M21A 4R1TA 3GLFB 4LS3A 1VL5A 5IN5A 4GXNA 3N2LA 4IXNA 3VDNB 2O7RA 3VGPA 2RHDA 2GYUA 1QM5A 2PSJA 3PEVA 4XYLA 2AZTA 2QN7A 1RCFA 3C3BA 4O2BB 1BEZA 3QPBA 1JLSA 2C57A 4RDHA 2BDUA 4A27A 4DLLA 4GKJB 1KJWA 5A62A 4ISCA 2GRAA 1GKIA 1Z5ZA 4QNNA 2K87A 3EDQA 4C6TB 1W93A 1IN7A 4RDXA 1IY1A 2XWJI 3ICPA 1MEEA 3QQ5A 3UF0A 1JILA 4CKYA 3MW8A 4L0QA 3NKLA 4KPFC 4U7GA 3DDZX 5BPHA 3NVAA 4ZZ3A 1OBCA 4KBFA 4PAWA 4LV6A 3LIIA 4EAAA 1JA9A 5J2TA 5BUSA 1VKNA 4KU4A 4W5WA 3PK0A 4TLMB 3EJ6A 4WBSA 3LK7A 1TCUA 2WWTA 1BH6A 1PZEA 5C4IA 1SB9A 3IA7A 4UJ5A 4C9BA 1F0PA 1SXGA 1NQ5A 3U4CA 1L4HA 4URYR 4DILA 3K9BA 3MBIA 5HOQA 4RMIA 3BXOA 4GBED 1VIYA 4DLAA 3A2NA 4BKMA 4KQ9A 2ETXA 3MBKA 5KYXA 1E2IA 2I29A 3OCXA 3U61B 1PEKE 3HCPA 2DULA 2Z1MA 3IB6A 4YO7A 3NCTA 3OG9A 4OUDA 5JCXA 4GOXA 4LOLA 2FB9A 4HDSB 3DLAA 5ALEA 1FRZA 2FP4A 4RTPA 2W8BA 4Y6SA 2PUBA 4NG5A 1NXTA 1V8FA 4PX5A 3UJDA 3T7AA 5CLGA 1G42A 4MB0A 2AHOA 4BWYA 4U8GA 4LFCB 4PX3A 2GZHA 4RXTA 1AXRA 3CLTC 5CUQA 1JAIA 1HYHA 1LI4A 2OBBA 2ZRMA 3S2ZA 1VG9B 1VMEA 4I3GA 2WAXA 5YASA 3UA4A 4EECA 4UHCA 1QZXA 3TN7A 4YMHA 1P1BA 2C2XA 2AHRA 1A7UA 1GPKA 4KZPA 2IOHA 3S2GA 2DFNA 1XKLA 3H2YA 1ZNZA 4HADA 4RABA 1USUA 5U4XA 1E9SA 4A8HA 3GN1A 2FWRA 3WRXC 2IZOA 2PZBA 5CB4A 1U9YA 3C3WA 2WDPA 1YS1X 2C4NA 3H42B 3UB2A 4LJYA 5KTOA 1AMUA 1ZI9A 1N4AA 3WV5A 3MCZA 1Z82A 3RIGA 4A8JC 1H4SA 3G8BA 5CB6A 4F7WA 2Z6AA 2JIQA 1AJEA 1JR3A 4O4JB 1ARZA 4IICA 1PUIA 1RRGA 2AQKA 1GAEO 1G8MA 1ZD2P 2GN6A 2ZE5A 2IGTA 3LCRA 4GWLA 4P80A 1QQBA 2QU7A 3I3OA 2O8BA 1LQUA 3TXAA 3AR7A 1C1XA 2BP7A 1WVIA 2Q3DA 4HB3A 2P67A 2RJNA 3GLRA 3TNDA 2G5CA 3W6NA 1IY9A 5B3JA 3IIJA 4JD5A 4F84A 3CF4G 4WXEA 2PYIA 3I01A 1MHTA 4URUR 4JASB 1FMCA 4B4OA 1SXJA 4OAPA 1DDGA 1FDOA 4CMBA 4HBZA 1ZVVA 3KQSA 4WOJA 3W5IA 1T26A 3LXRA 1WU8A 3P7MA 4WHMA 4P0TA 3BD7A 2E49A 4OQDA 2EEPA 2V5AA 2DMRA 2P1ZA 2X3YA 3DZFA 4F04A 2FX2A 4FMDF 2VUUA 4MLDA 2AYZA 1WV1A 1SD5A 1U0LA 2IY9A 2FI1A 4D8YA 4O1IA 4L7QA 3KSRA 4QYXA 1CJTC 5EZYF 4JA2A 2XE8A 2YL2A 1PSWA 4ND6A 2NZWA 4PYOA 1W1WA 1NJ6A 2ZBRA 3UBMA 8AT1A 5KSYA 2LBPA 4E15A 2HMAA 3GGCA 2W93A 2J48A 4BNXA 1TMYA 4OKNA 3LYLA 2XWBF 5LB2A 4ZC8A 1O95A 3GCZA 5TX7A 3CUEF 3PXCX 5BSHA 4MWOA 1RPJA 4XPZA 1SQSA 2GHQA 5AQEA 2O1XA 4LOIA 3VH4A 4AICA 3FNGA 4JKYA 3A27A 4WLOA 1NU8A 4C3VA 5EGSA 4ER5A 2OHGA 2RDMA 5FTNA 5BWOA 2CN1A 5CCBA 5GM2A 5LKRA 1YCGA 1JJIA 3MT8A 4IF4A 2NO6A 2QTLA 1ISRA 5FWYB 1Z6YA 1NQXA 1L8AA 4PZZA 3SNHA 4CR6A 3PXEA 1HTBA 2BTEA 1VGQA 3IERA 2DETA 3GLKA 2ZZNA 4IFEA 3E8SA 4PAOA 1GGNA 2AFHA 5LIPA 4ZZ1A 1R37A 1G8PA 1YQUA 1CR0A 1J7KA 2R00C 1BVRA 2Z3ZA 3WG9A 1DAIA 4DPMA 1LC0A 2CC2A 3KYJB 2BDTA 4KSCA 4XWKA 4BEBA 1JEYA 1UC4B 1S7GA 3GT0A 2PBLA 3F6CA 1Q0HA 3C3JA 4H1HA 4QT0A 1X42A 5FI1B 3WDSA 2C82A 2YMPA 5E8JA 4IR7A 4Q16A 3VDMA 1PJTA 3PCRB 2ZRPA 4WXRA 1P0IA 3NFYA 3L9XA 4Y7CA 1YZFA 4YP9A 3NRJA 3V4OA 3R8CA 4I55F 3WMGA 4F0JA 5KQPA 3FSGD 2CLMB 1N6RA 3M4ZA 1FTNA 5EA2A 3QP9A 2I6XA 3GBSA 2QV7A 1K8QA 1B74A 2D4HA 2Y2UA 2PNJA 3IV7A 4ZQCB 5FYDA 4BNWA 4AY6A 1H6CA 4LFBB 1GCIA 2W6OA 2C7OA 3ZWQA 4F1KA 3FYHA 2QMZA 3BORA 2WA1A 2RBKA 1G6KA 1RR6A 2GXAA 4ZDIA 4G5GA 2C7BA 3OZ7A 2WB2A 3GGJA 1FZTA 1C4WA 1L9XA 4WEQA 1OBFO 2HH9A 3MTDA 5L3ZA 4B46A 5AW0A 4RW0A 3D3WB 1EI9A 3LXMA 3MLEA 4CKCA 2ZI4A 4PN3A 1F4VA 4XQEA 4DKJA 2OFOA 3T34A 2GVDC 4M46A 3T1NA 4GYJA 1I7QB 5B4VA 4BRUA 3DL0A 1P0CA 1WKVA 1NYTA 5DO9A 1OROA 3AUAA 3RS3A 1N0HA 1OX6A 3TSCA 4LRYA 3I09A 1OA1A 1Y3HA 2F17A 4X61A 3UK7A 4EIWA 2BFDB 4RLQA 4LJ8A 2JL1A 4LOJA 3QPAA 5B2EA 5E1MA 1AGYA 3TIIA 1NNSA 1YL5A 4FINA 3CUUA 3GH1A 2H7CA 2VBIA 5EJIA 2BM0A 1THMA 4ID3A 1E5QA 4EG5A 4BN5A 1NVFA 1JBKA 5LYJB 3KTAA 4RETA 3KJIA 1EU1A 3I3SR 3GJTA 3SDSA 2FFAA 3WNCA 1BXGB 1I4OA 1Q0SA 1YR7A 3NDPA 4CIDA 4NCHA 4ZJPA 3NQ41 4TS3A 1C29B 4UBIA 2ID4A 4U9HS 3U0VA 5BNTA 1CRQA 1AKMA 4MCAA 3HXLA 1A8UA 1YZLA 3QVSA 1HGXA 4KLAA 3GY0A 2P5SA 3LCJA 3SJCA 2NP7A 4I08A 1A97A 3BGSA 3C5EA 2CE7A 1N8NA 3ESQA 3HG7A 1B76A 1NAHA 4G81A 3C39A 1GYRA 2G1AA 1SOAA 4WLUA 3VC3A 1FDWA 4FQ8A 3GD5A 1N6HA 3EIHA 4L2IA 4TS4A 4IRUB 1JDBC 1WZNA 4UBNA 1RADA 2L2QA 3P9YA 4QFBA 1TTQB 4YBRA 5CM9C 2P79A 1Y9JA 4BMDA 2C96A 2CGEA 3KUDA 4XPIB 1AQYA 1L5HA 5A6SA 3WLRA 1LV8A 2X8AA 1HRKA 2BFCA 3CCCA 1F2UB 4HNGA 4NH4A 3VNSA 3IJPA 1NXPA 5HJ7A 1B2LA 1FUKA 1LD3A 1K2VN 1K8YB 4B2YA 1N0UA 2PT6A 1DRKA 3AUKA 3GF4A 5T4BA 2C8LA 3DAYA 4M9SA 4OOEA 1Y5MA 5JSQA 2DBVO 3ZE8A 5DTRA 3D5TA 2CLOB 3R6GA 3OZDA 3MRVA 3KZNA 3R9IA 3IR6A 4Q1VA 1D2RA 3LD9A 4OP2A 1SU4A 3GAZA 4X1IA 2JIBA 5JS6A 4ID9A 4FBLA 1QNFA 2HWXA 2V3WA 1JSXA 2VYND 1TMKA 3D4IA 5AK0A 4P53A 3HVHA 3QEBZ 1PFKA 2YC2C 4GI3A 1HA3A 3AR6A 4BO2A 4XA8A 1RXUA 5LUBA 4CMKA 5A2QA 4P4GA 1VIDA 3GJ7A 1JDVA 4GEKA 1GU7A 1ULBA 1EK0A 1Q19A 3OCJA 1Z5WA 5LOVA 1ZY2A 4WACA 2IEYA 4I5EA 4A0HA 1PV4A 2DWCA 1EJ6A 1V47A 4H4EA 1GL9B 1Y42X 4G3XA 2CMHA 2D13A 1T36B 4D8WA 2ZJAA 1XJ5A 3CB4A 3F7NA 5GTDA 1YQWA 4YUVA 2HBZA 2QROA 2XRZA 1N7JA 4KN5A 3ZE1B 5I6DA 4EGQA 1VHJA 1K5GA 1AM4D 3CW9A 1Z15A 2FGJA 4MQMA 1MAHA 3I2KA 4LMPA 3EZNA 4QXMA 2OCAA 3HXKA 3U7JA 1SHJA 1TZJA 3BSFA 3ZV3A 3OHMA 1XDDA 2FEKA 5DNUA 1L7AA 1NDHA 1NMXA 3R24A 3R77A 2V3CC 4K28A 5F21A 1IHPA 2TRSB 3RK1A 3GMDA 2OGUA 5KEIA 5EEHA 2EFYA 5LP1A 2IHKA 4ND5A 4K1LA 2QYOA 2NUTA 1I1HA 3A9RA 5DLDA 2B4AA 4HGQA 5FEMA 3TPFA 2OVFA 1E92A 1MIOB 4D9NA 2G04A 1C9JA 4CMHA 4YPFA 3EIWA 4HXFB 4CQLB 1Y7HA 2X76A 4HPWA 4LOHA 3HS3A 5F7OA 5K3EA 1SG9A 2Y76A 1ZN8A 4EG3A 3STYA 3COSA 4RQAA 3S2SA 3W2IA 4KGZA 4B2PA 3VTFA 1Q15A 2J9FB 4YCAA 4UBMA 3UWDA 5IYZF 4LF7B 1PX0A 5CDSA 3SI7A 1B6TA 2C2WA 3C70A 5JSHA 4RPHA 1E6CA 1XPUA 3RG2A 4EY6A 4WPGA 4ZCRA 5KNCD 3WB1A 4C7OA 4MUJA 3V9AA 4LXYA 3T95A 3ZWOA 2FUCA 2XT9A 1V6CA 1VE6A 1YMQA 2HYDA 1VLJA 1NVUQ 1SCDA 3PP8A 4EL5A 5LFAA 3G5MA 1TK9A 4O02B 4KXLA 3LZCA 1PJ2A 1GNQA 1W85A 3ZYCA 3IUPA 5ALRA 3LC7O 3ELDA 1GPNA 3LUDA 5LZ5A 4BNUA 4KB5A 4LWPA 4FKZA 5M34A 3L1IA 2XCTB 1FZQA 4OGFA 3QHQA 2VHZA 3GVXA 2QW1A 2ZS8A 1ZQ1A 4Q05A 4L9WA 4EFNA 1Z5VA 1BMDA 2EKPA 2FR8C 2WSLA 3C1OA 4N3CA 2BEUB 2DWOA 1WZ2A 1ADJA 2GKOA 4PZCA 4NDAA 5FKJA 3U3ZA 4YLYA 1DPFA 1WB4A 4LN1A 4X6YA 4A6DA 1U4OA 4NP6A 4Z7QB 5CT8A 4AKHA 1SHUX 3HFRA 5A3VA 2VKQA 5B5SA 4GZ3A 4PPYA 3D3NA 2H08A 3FAZA 3EX7C 2FOIA 5E2IA 5DNVA 2RHCA 1VCHA 1V3UA 3GUVA 4MHSA 3IP9A 4UXHA 4ZO6A 4DSZA 1GRVA 1H4TA 1YONA 3BMQB 5JZMA 2X0DA 3AVTA 2J59A 1NVXQ 1JFTA 3BWXA 3O8DA 4Z0PA 1U0BB 2VPXA 4UW9A 2Q3FA 3NV7A 3IP1A 1J21A 2JGFA 4CTKA 2Z4SA 1IMOA 2PLNA 3DV2A 1YUBA 3L1HA 3RRJA 3SVTA 4CLRB 3I28A 2IEGA 1ADBA 3MBOA 2ACKA 1IZ9A 3ZVMA 2Z5GA 4P98A 4M9RA 4F9TA 3ZWPA 2X86A 3LA8A 2AN1A 1Q0TA 2YWDA 4KRXA 4K9SA 5CHEA 1LWNA 1YRBA 1EFCA 3LOUA 2IV7A 3H5IA 3WLEA 2B1RA 3L4KA 4LJ5A 1KAOA 5C8ZA 2R87A 4MQEB 4MGKR 5E6UA 1SGWA 3UTCA 2WU3A 5CLLA 1DJPA 2VF2A 1K4KA 1JHMA 3FDFA 2VZLA 3FNBA 3NH6A 3R6DA 4QPDA 4X8HA 4BEWA 4UPEA 2G0AA 5FCDA 4B9AA 2W6QA 1D2EA 2BKLA 3U7QB 5AM3A 3LYHA 1RJDA 1ES9A 2W2NA 5AW3A 1XTIA 3MRTA 4CT0A 1E2BA 1G5QA 3I53A 3F5DA 1NBMA 3DBRB 4ZI3A 2BTOA 2HBRA 4HL6A 4O1MA 5B1EA 3FPKA 1YIAA 1NF2A 1X8XA 4P3KA 1XNGA 2BGLA 3PJDA 4MYUA 4RE6A 4RYLA 4UUBA 3MGAA 5D85A 4A2WA 5HOEA 1E3SA 1K9SA 3N8GA 4LHWA 3FG9A 4JGGA 2CCKA 1Y4UA 5BV1A 2V7TA 5IDVA 2IQIA 2J46A 2GUGA 1UZUA 3GA7A 4EQ6B 3PEWA 2XEDA 3BJMA 3OZUA 4E5SA 3ZUPA 3JQEA 4Z4QA 1GYPA 3QVTA 4LQCA 3TQQA 2V5VA 1Q7GA 2D1RA 1JSZA 4BGUA 4BQQA 5KC9A 4UE2A 1HTTA 3C3YA 3FYUA 1B15A 2EJCA 4J07A 1UZLA 2C95A 4QU0A 3ID6C 4JI5B 2IS6A 5IXJA 1TT7A 2Q8QA 1C7ZA 2PKCA 4MVWA 1CUXA 2FW0A 2YR0A 3MJCA 3B13B 3D3QA 4Q1CA 3D1LA 1OFUX 2AG6A 3FFBA 3FM9A 4JXJA 5FWNA 2IYFA 4FN5A 4X1OA 1XJWA 4FGUA 2NYVA 2V7UA 2CWDA 1MO5A 4NC9A 1UM9B 2OXIA 3EEQA 4QUBA 1NXVA 5HDBB 3ZLVA 4WY2A 4QT4A 5JCZA 3EH2A 3JPYA 3MJEA 2Z1DA 3M4XA 4TTTS 1NA5A 4EYSA 4EA7A 3PI7A 4D26A 3HRKA 4CEIB 2Z5VA 2HX1A 3PPIA 2P5TB 2TYSB 4QXQA 2FSVA 3CUVA 1W581 1UUFA 2C0CA 1W4AA 3WQQA 4NESA 1XVUA 2GTPA 2UZIR 1O6CA 2SKDA 3GAMA 1Y8AA 3LRXA 3O31A 5E6SB 3S28A 5EZYA 3X1XA 5DHRA 2R65A 5CDHA 1VZ3A 1J9GA 2IP1A 2Q4OA 5B2ZA 3S2UA 4HX9A 2WWGA 5EHZA 4KQWA 4C4XA 1ULUA 2YUTA 3DMFA 2ZWIA 3BJZA 1GUDA 5E38A 2QT9A 2QTAA 3KHSA 1XA4A 4MKXA 5K51A 3WBJA 1BG6A 5EIBD 1GDTA 3COWA 4RJTA 1YI1A 2IOFK 2JDIA 2ZEJA 2B8EA 4BC0A 5A4JA 3ZY4A 2PVCA 2VZ9A 2H0QA 4BNYA 3T5AA 3USES 4EYOA 4TT8A 3A9CA 3ONEA 5JFOA 2Q2VA 5HCUA 2Y2VA 2CNNA 1S8OA 2ZJ4A 3VR4D 2ID9A 5LXTA 3B6EA 3JASA 3MGCA 1XZNA 2QTCA 4KW7A 2IYQA 1W44A 3U48A 1KK3A 5EJAA 1SD2A 2ODBA 1QIJA 2PYDA 3WL3A 3U4QA 2H07A 2QVCA 3IAXA 3ZBTA 4DIEA 1GNRA 4D9GA 5FI0B 3EOBI 2VDOB 1UAAA 3UJHA 3MA0A 3RANA 1XT6A 3QFHA 4CV3A 3GUUA 3HI6A 4AKTA 5BORA 1D4FA 1O94C 8ADHA 4PHTA 4RD0A 4TV9B 4B8YA 1AK9A 1U9CA 4DPKA 1A9XA 3I9FA 3UAZA 2ZSAA 5C5DA 4FJ2A 5SY4A 2OD9A 5LYYA 2JI9A 4K87A 4MPRA 5JLAA 1GR1A 3OU2A 3X1JA 4B7CA 4EDFA 4AKIA 3BB3A 3I0ZA 2P41A 3WLMA 2G07A 2FN4A 3ZHQA 2PS3A 3PXBA 2JLWA 2JS7A 3C8DA 3E84A 4MULA 2F55A 4BNGA 3JWJA 1E3WB 3C74A 3DAGA 4I55A 1EDDA 1N6PA 3HPQA 3MAAC 1PK7A 4YJFB 3F46A 2B34A 3L05A 4I1IA 3ZZNA 3GRCA 3G7SA 5KC8A 4HTAA 3UH1A 3HYTA 5CM8B 5F23A 1ZXLA 2Q9AA 4YBZA 4AJKA 1SCQA 3RJMA 4F91B 3OJLA 4HPXB 2GCIA 4HSEA 4JNCA 4J0QA 4NHEA 4P36A 1T0JB 2AC4A 1N9KA 3TPZA 3ZGYA 4EG1A 5LKAA 1KYVA 2H2WA 5F5XA 4D3YA 1ZIXA 1NLUA 3D1JA 3N75A 4LZZA 3RBVA 1RAGA 1U3TA 2YV3A 4MMXB 3S8EA 4ZK2A 4BLUA 5BSWA 2W9XA 2DXIA 1ZNWA 3FYDA 3NKVA 5FA6A 1PR9A 4ZVRA 1CUHA 1NHGA 4C2TA 1OIWA 1BAPA 4I9GA 1R12A 4OAQA 4BNDB 3MB8A 4KE7A 4C76A 1MC5A 1G7RA 3ZY6A 4DUYB 4BX2A 1OFVA 2X0RA 4IZIA 1X7WB 4MYDA 1K98A 1V4BA 1CSEE 2DX7A 1W30A 2OAQ1 1CVIA 1Z2EA 4LY6A 3D7KA 3LKBA 4MR7B 1FE8A 1A04A 3BHNA 4KPUA 1B1AA 2X8LA 5JROA 1U11A 3DBVO 2QUIA 4Q3LA 3D8HA 3NV9A 5BN1A 3LQKA 3W77A 1SHTX 2JHFA 4ERXA 4QTUB 2IHNA 1YU9A 1L1EA 2LIPA 3ECCA 2RAVA 2VPPA 4JHLA 5L51A 2J87A 4BWFB 4CV0A 3L6RA 4E5NA 3K20A 3GDOA 2WHRA 2XVXA 3ND7A 3WGHA 4UD2A 1J42A 2WIKA 3O0DA 1TGVA 1XZKA 4L08A 621PA 4M1YA 1YD7A 2D8AA 3O8QB 4XYGA 1U28C 3F2VA 2Z2YA 4PC3A 1DT5A 3WS7A 3NTVA 1KP2A 1Y4AE 1JEQB 1YASA 2QLTA 1KC1A 3KL2A 4DQVA 3G3EA 4Q1EA 5E4JA 3IEPA 3WLSA 4CMJA 5K0TA 4EEKA 3DEKA 1CZLA 3EMKA 1AKTA 3H9QA 5MN4A 1CT9A 2CNKA 1ZX1A 1QDEA 2I7DA 3QGMA 4EM6A 3RJ9A 1NVVR 5HKKD 3DB2A 1PT8A 1VDMA 3ADKA 1QRAA 4F9EA 1RWPA 3QLEA 2WSMA 3ZCVA 1U3CA 3D2LA 1V8PA 3A4LA 2Z58A 3ZY5A 3LYUA 4PZEA 5FIUA 3GCWA 2GERA 3OJ0A 1CUIA 3H5OA 4YO8A 5K3FA 1P75A 4DDHA 3VKHA 5CA0F 3I04A 1DQPA 3F7MA 3HL0A 4KE9A 2R3SA 5KDLA 1U0EA 1SPBS 1ZOLA 3KKOA 4KQMA 1U1CA 1ZUD1 1OLSA 5ALFA 3WHKA 2RD2A 1N6OA 4ZMSA 1P1JA 1YA4A 3GT3A 3AINA 5CYGA 3GFVA 4C4PA 4ZQFA 2QRGA 3GEBA 1W49A 3HSSA 1QOZA 5EMKA 4RJLA 1Q0LA 3KEMA 1L4EA 2ZITA 1UIRA 1XZCA 3NI2A 1HWYA 5EJEA 2DTXA 2V4MA 3VPSA 3LT2A 4CJXA 5CFOA 4AP6A 2PEYA 5GY7A 3AUXA 4D0NA 3L06A 4E5MA 4WKNA 4ATNA 1NI5A 3TR0A 1W4LA 1DARA 2B36A 4B82A 5AOAA 4CKWB 1PV2A 1I0LA 5I47A 5FJIA 1ZKMA 3KUKA 4QODA 1QMPA 4DW8A 1E66A 1EP9A 5EE1A 4FYYA 3UYKA 3WLAA 1U1IA 1ODKA 1AV6A 3D64A 3O92A 4MRMB 1OYYA 3V7WA 3HN2A 3W2FA 1I3LA 2YWBA 1W6UA 1FDSA 3OIGA 4GR9A 1G21B 4O6VA 2WVJA 4I1YA 2Y27A 5KVSA 2WT8A 4DMMA 2QTWB 1DLIA 3QV1A 1YS9A 1GPJA 3KOWA 3ROMA 1II0A 3NS7A 3E8XA 3S1AB 2AQIA 1AQNA 4DR6B 5IF3A 5ULLA 4F3CA 4CI9A 1QPZA 4U2FA 2GUWA 3STUA 5CFPA 5ALVA 1P9RA 3ZBQA 1A4XA 1RKXA 2FK8A 4I50F 2PGOA 5IASA 4BO4A 5AVJA 4GUDA 2XQGA 3V1KA 1RJ9B 2C8VA 2GBFA 2OCLA 3FOBA 3OTIA 4O1HA 1U0HC 3N28A 2QKYA 4X91A 5AIAA 1SH7A 1VYVA 4Z99A 4EBBA 1YGPA 2BI7A 4LF9B 5C8XA 1KTIA 2PUGA 3RC1A 3E5MA 5HX7A 1G3UA 4REQA 3UH0A 1SVKA 4PRYA 5IYZA 1NASA 2VPQA 4JT4A 3L6EA 3SR0A 1AZLA 1ZMRA 5KX5F 4N5DA 4DHEA 3GNTA 3NDIA 1L5GB 4BFUA 4X7RA 2PWPA 4JELA 4G4GA 2PXAA 3CN9A 3GRZA 3PTZA 4GKVA 4MW7A 5U1PA 1UKAA 3RT7A 3EAQA 1RRFA 4AXBA 3IO5A 4DMLA 1XI2A 5TRTA 1C7EA 2XUOA 3C6XA 1UDAA 1G8JA 3QSYA 3GZJA 1DC7A 5KU7A 3PC4A 4MB6A 3D81A 2CXPA 2KI5A 3TQHA 2ZIXB 4AP9A 2C88A 4AJNA 4B74A 1M2HA 4FFRA 1N9GB 1PJQA 4UFNA 4R2KA 4LGVA 5CNJA 5K0NA 3EARA 3B6ZA 5FTWA 3TQTA 2J6IA 3UB4A 2BGJA 5COBA 1J1IA 1PU2A 4ARZB 1KYWA 3HCOA 4ON9A 4LZJA 2IHUA 1Z0KA 1PGNA 2H5LA 4Q24A 5TS2A 1NHWA 3L0SA 1N1EA 2NMVA 1NRJB 1LS6A 1JFLA 2A5YB 3AZQA 5CLIA 3X1KA 1PQPA 3FMPB 3KQWA 5LBUA 1VPVA 1U2TA 1N5KA 3K6RA 2PS0A 3AESA 4ND8A 3AMVA 5BVHA 1DZIA 1PD1A 3DBLA 3EXFB 5K9ZA 2XNHA 5A0TA 3L8YA 3BCHA 3G5TA 3QK7A 2QM3A 4FB5A 2B3DA 2P6OA 4K2HA 3T7CA 1R4MA 1FFAA 3U6KA 4MPPA 2I34A 3ZKWA 1U7OA 2FV8A 3QX3A 5ALJA 3NU1A 2XKAA 2BZGA 3HKBA 4CMEC 4RCYA 2D5CA 5KWJA 1RTKA 1YOBA 1TNDA 3I5MA 2WQZA 1F17A 2O2EA 1WD5A 4MV3A 4XYMA 3B1ZA 1HDOA 1HURA 2XDQA 4KQFA 4BCCA 3F3YA 4GL4A 5JI3E 3H1PA 1U3GA 5IAJA 1NVGA 1RPNA 2XLBA 4X64B 1L5ZA 5GJVC 4PFQA 1GPMA 3LKZA 1IATA 3L07A 3AM3A 4ZD6A 2DM6A 3M3HA 1PTKA 2DPLA 3ULKA 1QF6A 4GOLD 2FMHA 2ZTVA 2HMVA 2H2HA 1OT5A 1TW3A 4E22A 3ZJVA 3LY8A 1T2VA 3BDVA 3HQ4O 4HB2A 3U13A 3SEFA 3QITA 1DNPA 1C9KA