3R4VA

Structure of the phage tubulin phuz-gdp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
314
structure length
311
Chain Sequence
PVKVCLIFAGGTGMNVATKLVDLGEAVHCFDTCDKNVVDVHRSVNVTLTKGTRGNRKVILPLVRPQIPALMDTIPEADFYIVCYSLGGGSGSVLGPLITGQLADRKASFVSFVVGAMESTDNLGNDIDTMKTLEAIAVNKHLPIVVNYVPNTQGRSYESINDEIAEKIRKVVLLVNQNHGRLDVHDVANWVRFTDKHNYLIPQVCELHIETTRKDAENVPEAISQLSLYLDPSKEVAFGTPIYRKVGIMKVDDLDVTDDQIHFVINSVGVVEIMKTITDSKLEMTRQQSKFTQRNPIIDADDNVDEDGMVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title A phage tubulin assembles dynamic filaments by an atypical mechanism to center viral DNA within the host cell.
pubmed doi rcsb
total genus 109
structure length 311
sequence length 314
ec nomenclature
pdb deposition date 2011-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3r4vA01
3HKDA 5CA1B 4TV9A 5J2UB 5J2TB 3WGNA 3VO9A 4O4LB 4TUYA 5KMGB 5JQGA 3JALB 4F6RB 4TV8B 4I4TB 3WGMA 3JATB 4U3JB 5GONB 3RYHB 5IYZA 4X20B 3E22B 3JASB 1FFXB 4HNAA 5LOVA 1W5EA 4O2BB 1RQ7A 5M7EA 4O4JA 4IIJB 5LP6B 1SA0B 2R6R1 5C8YB 3RYIB 3HKEA 1Z5WA 4YJ2A 5KMGA 3VPAA 1TUBB 4F6RA 3N2KA 5FNVB 4EI8A 4ZI7B 4I4TA 2VAMA 3RYHA 4DRXB 2RHJA 5CA0A 2R751 4X20A 5EYPB 5JCOA 2RHHA 3JASA 3R4VA 5IJ9B 4X1YB 2XKAA 2RHOA 1TVKA 3ZIDA 4EI9A 4X1IA 4B45A 5C8YA 4ZHQB 2VAWA 3JAKB 4FFBB 3JARB 4WBNA 5BMVB 2BTQB 1JFFB 2BTOA 4O4HA 3WGJA 5JVDA 2Q1XA 3HKBA 4O2AA 3HKCB 4U39A 3JAWA 4X1KA 3RYFA 4E6EA 5ITZB 4I50B 4I55B 5CA1A 5LYJB 5IJ9A 5J2UA 5J2TA 4XCQA 1W5BA 5MN5A 4O4LA 5EZYB 5EIBC 4O4IB 1W5AA 3WGLA 3JALA 3RB8A 4KWEA 1W5FA 4TV8A 3VO8A 4EB6B 4ZHQA 5IJ0B 3JAKA 3JATA 4U3JA 5GONA 5LXTB 4LNUB 2BTQA 1RQ2A 3E22A 4ZOLB 1FFXA 5ITZA 1FSZA 2Q1YA 3ZBPA 5CB4B 4I50A 4O2BA 3ZBQA 3RYFB 3N2GB 4IIJA 5LP6A 1SA0A 3HKDB 4EI7A 3CB2A 3RYIA 3V3TA 5JH7B 4IHJB 4O4IA 1RLUA 1TUBA 4TUYB 5FNVA 4ZI7A 5JQGB 5MN6A 5IJ0A 3M89A 1W581 5KX5B 4DRXA 1OFUA 5JCOC 2XKBA 4ZOLA 5EYPA 3VOAA 4X1YA 2VAPA 4YJ3B 5LOVB 5EIBD 5MN4A 3RYCB 3M8KA 3VOBA 4O4JB 5JH7A 4FFBA 4IHJA 3JARA 4DXDA 3HKEB 4YJ2B 5BMVA 4M8IA 3UT5B 1JFFA 3N2KB 5KX5A 5LA6B 4B46A 3HKCA 5LYJA 4I55A 5CA0B 2VXYA 4TV9B 4YJ3A 5EZYA 1Z5VA 3RYCA 1TVKB 4X1IB 4EB6A 2RHLA 5LXTA 3WGKA 4LNUA 3UT5A 4WBNB 5IYZB 1W59A 5LA6A 4HNAB 4O4HB 5JVDB 3HKBB 5CB4A 4O2AB 4X1KB 3JAWB 5LP6C 3N2GA
chains in the Genus database with same CATH superfamily
1Z25A 3IAUA 3D59A 4TV9A 4Y2PA 4KGDA 4B47A 2EG5A 1GQQA 1GNTA 2FPMA 2RBKA 3QELA 4P7KA 1GPYA 5CEJA 1P1IA 5LYJF 4DM3A 1DO8A 4RL4A 3DM5A 2IS2A 2JZNA 3OIDA 1LZKA 3VYSB 4HAOA 3ND7A 5DGCA 3JPWA 3WRYC 2NX2A 4BFLA 4KPYA 2WYVA 3HLTA 3DOIA 4RVHA 1JYFA 4FM9A 2XZLA 1EE9A 1OPXA 1SBTA 3V9PA 3B2EA 3KJQA 4C4AA 5L95A 4XLLA 2VWGA 2GTHA 3H42B 1SUPA 2NVWA 3OF2A 6NULA 1ZPDA 2ONYA 1YO6A 3EGXA 2W6NA 3RIYA 5C34B 3TPFA 3ZWCA 1I9GA 4ASUA 1D07A 1M67A 4X00A 4I0WB 4BP8A 1MW8X 4OU5A 4ZZ0A 3Q8LA 1YB7A 4X6UA 4Z7QB 3CJRA 3GFRA 5HR5A 3KKZA 1SC3A 2YQ5A 4DLBA 4WDQA 2FQXA 2PTGA 1IIBA 3E3OA 1TLTA 4KPUA 2VCYA 3OJCA 4TWZA 1JTVA 4D99A 3HZOA 2C1XA 5KSWB 2VYND 3JAKB 5G0VA 2V45A 4CR7A 5L4LA 1SO8A 1S7CA 2PVPA 4GPEA 4XD7A 5ARCA 3GZ4A 1SU6A 2VUHB 4D9FA 3ZVMA 4EHFA 4MI3A 1V41E 1GUYA 3ASVA 3BWDD 4M1TA 1PT6A 1RYHA 4NYJR 2YY6A 4HRXA 3WWOA 1RYYA 3UAYA 2G1UA 2VDPB 3D2BA 1P4SA 3I9KA 2GO7A 3NIDB 1F9EA 3OEYA 1QBKC 2PT5A 1I7QB 2ZSDA 2I6QA 1XLWA 2Q2WA 3SU8A 3ZS8A 5CR9A 1XAHA 4W5RA 2QUKA 2XH8A 4E12A 1IZZA 1Y3HA 3Q3VA 4AZ3A 5LWHA 3DAHA 4JOSA 5JAMA 1D4AA 1S8OA 1Z6YA 4JN6B 3HCPA 5CK5A 3ZY2A 2CUTA 3QUSA 1BKDR 1PSWA 4XOIA 4C6TA 3KG2A 4EATA 1FPQA 1XMOB 5KX5B 2O5CA 4WKGA 3A9VA 4GX0A 5AR1A 3NT4A 2CL0X 4R41A 2ZBFA 1V37A 1P81A 1C0EA 3LKDA 4UZFA 4B83A 4RZ2A 4BXOA 1ZNZA 2Z8YM 4MJ7A 1ZJ6A 3VKWA 2BFEB 2IW1A 5LOVB 2OBFA 3R7WB 2VTBB 1NJGA 4X63A 2ISSD 1JHOA 4RVDA 1Z17A 2KMLA 3B9PA 4JI4B 1SUEA 2GH1A 3KL2A 3HNPA 3R24A 3T0GA 2CJYA 4DMMA 1AOXA 4J2TA 3RRMA 3T7JA 1HLPA 1KJWA 5KQPA 1GZHB 4PCAA 2WA1A 1H3EA 3SHOA 1I1OA 3EDQA 3ROXA 3LC1O 1LDBA 2H1VA 3VKUA 3FFBA 3W4IA 4BGDA 2I6TA 4KL8S 1H6DA 3ZE7A 4TKZA 1R0WA 2J3IA 1QRSA 4JHXA 1NQTA 1NVTA 1SUSA 3G5LA 2R9VA 3MT8A 1M6YA 3TTTA 3Q3IA 1MT0A 3PZRA 4KAAA 3R5TA 3IP3A 1PJ4A 2AWNA 2OAGA 1ULZA 1UPTA 4IMPA 1SD2A 3I30X 3BMQA 4MWBA 2HJHA 3FUCA 3O3CA 5AUOB 3GUHA 4CMJA 1F51E 1X1BA 2IOQA 1Q95A 1X14A 2XMPA 5DHQA 5JZMA 4KQ2A 1YKSA 4FNMA 2EX0A 2HCFA 1ANKA 3B3QA 4GSKA 4K9PA 1A9RA 3EIQA 3HN2A 4LGVA 2YFQA 4PZPA 1SVWA 2O57A 2J3LA 1BVHA 1BU5A 3OCUA 5JU6A 3OC0A 4JY7A 4A2WA 4XVHA 3RTDA 5K8TA 3AM1A 1X94A 3AQ4A 4AJLA 1RI4A 1LXCA 4R81A 3UGTA 1E1MA 2V0CA 4BAUA 1QC5A 3TFOA 4II2A 4FS3A 1O95D 1XO1A 5TDHA 1PL0A 1AUVA 3Q8WA 4F3KA 5CYGA 2WQ7A 3GUZA 1N36B 2K6GA 4DE5A 4FK8A 1J0XO 1W0CA 2J5QA 1S3IA 1PR4A 3LHDA 2ZM6B 5IM4F 3S2ZA 1BOFA 2XUDA 1SKUA 1JI0A 2HXSA 1OLXB 1A2KC 3KNZA 3LLVA 4PVCA 4UAGA 5DASA 5DIZA 2ZBPA 3UXMA 1FX1A 2DUWA 1HQDA 2PZBA 5AW4A 2WHEA 1DG9A 5DGIA 2UYYA 3HCCA 2AFIA 3H1BA 2EBHX 3L6EA 4IDDA 1OR8A 4KNWA 4WBNA 2PH3A 1VE9A 1XEFA 3FGOA 1ZD2P 3A1NA 3WGJA 1VL2A 3A1EA 2JEZA 1TQ6A 2JFYA 4AY4A 3P9XA 2GSWA 3E18A 1PWYE 3IP1A 1TM4E 2ZJ3A 2AZTA 4ZO4A 3RV3A 3E15A 2UZ3A 1XNRB 2IUSA 5EIWA 3RNOA 3CE9A 1XMQB 5I7FA 1OIXA 1QV9A 4KKVA 4UVGA 1N8TA 1ODFA 3GYGA 5D00A 3JATA 2Q3EA 4RV5A 3QW4B 1A8IA 3D2CA 4V0KA 1J70A 4Q4AA 4BKUA 4DL9A 4CQLA 4NXMB 1E5VA 3GPDG 3R09A 4BV2A 4J0GA 1DSSG 2Q29A 2QLJA 3F8SA 1T10A 1JFTA 1WDWB 4HWPA 4JGIA 5HJ5A 4F9FA 2JHFA 4YJGA 2VPPA 3ADOA 1F8XA 1YB4A 1S4MA 1KMCA 3HLYA 3RKSA 1KJYA 2ATIA 3KUDA 4B3SB 1KE1A 5IAJA 1M2VB 2Q6KA 4ND3A 3UJ9A 4DV7B 5D3MB 1P3JA 3AHFA 4E07A 3GCXA 3TRJA 1I24A 3SS8A 3LJKA 3BRWD 2GFHA 3PFIA 4C06A 3IE1A 1N7JA 3ZK9A 3C6QA 3DZIA 4GHWA 3PT9A 4XGQA 1XNGA 3U3MA 3HBLA 2EL7A 3M4ZA 1ADGA 1ZL0A 2JBHA 1YXMA 5D8DA 5HM6A 3OBIA 3HTXA 1BKSB 2EP8A 2FEWB 3K16A 3O2SB 3ZDQA 5DBOA 3VV3A 4WK6A 3OMXA 3LUPA 4WW0A 1XJCA 3EULA 4FW8A 3NRJA 4IJ5A 4BE7B 1ONNA 2BZSA 3V00A 2ORWA 5E6SA 1GPKA 2H5LA 3SC2B 3QNWA 2NV6A 1P4HA 1FU8A 2AX3A 2XCLA 4OHOA 3CA8A 1MO6A 1SCUB 1H0RA 1KEEB 1YZ3A 2D1TA 3RYCA 3K0AA 3ORYA 2WV9A 2VK1A 3LUJA 4M36A 5G4LA 3BL8A 2V3VA 2EJUA 1X38A 2ZIAA 4FDUA 4HX2A 2O7NA 3E5NA 3K6KA 3TZLA 2QMEA 3OJLA 4DLKA 1Y8RA 4R8MA 2PSDA 3PFHA 4N3BA 1B8VA 3RIGA 1SUIA 3OLCX 2C2KA 3WB1A 4B3JA 1WETA 1VRWA 3FNBA 5FAXA 5H83A 5J63A 2XYHA 5C2JB 1NFFA 1WMEA 1FJGB 3IB6A 4B4WA 4HXFB 1MZPA 5LFAA 3FIJA 3EUFA 3PPYA 3TZCA 2BCGY 2ID9A 1E3SA 2BUBA 4DZZA 2PRYA 1N0HA 3M5CA 2CXHA 5ICMA 2HXYA 5CJPA 2ZJFA 4P31A 2YUIA 3DZGA 3MUEA 4WV3A 4KWTA 3U17A 2PYZA 5JCJD 2Y93A 2MR6A 1CUVA 4Y2RA 3IUBA 4L4YA 2QRLA 1DO0A 1Z5WA 1SZCA 3LI2A 3LXXA 3LX5A 1EWQA 2Z6QA 4ZI7B 2EFHB 3O8DA 2AYZA 3AUAA 1Y37A 3GFVA 1FP2A 1A5TA 1Z3CA 2X1VA 4DUPA 1PX2A 2J3QA 2Q5CA 1PK7A 4LZJA 4TT8A 1E6MA 2QTVB 1DXQA 3DG9A 2FA9A 5DXFA 1SBIA 5AKYA 4UASA 3L0OA 4X3CA 1DT3A 1UM8A 1EFDN 3K15A 2IELA 2IUTA 5L3RA 1QZXA 3VC1A 5TF4A 4LISA 1P1JA 3UMRA 3RK1A 3BBLA 4XWAA 3NHWA 2BEWA 4MQBA 4DKXA 4M7WA 1QVVA 3TFQA 5U1PA 3SSOA 3O4VA 3WHIA 3W4KA 3WOHA 1CUEA 2NZ2A 2HW8A 1P72A 1NJ5A 1S2GA 3SM3A 1G98A 3EVAA 2WM3A 1AV7A 4C4YA 4JKOA 3EYWA 4EB6B 2A4MA 4LV8B 5DNCA 4YRGA 1ZMBA 2HIAA 2ZRCA 3QE9Y 3OKCA 3PUJA 3U7FB 3PDIB 5K45A 3AFMA 1OCEA 3EJ6A 2A14A 4BLOA 3C8HA 3HE3A 2PUCA 2ZVDA 4QU0A 5FLXA 1EFLA 1HMPA 5F9FA 2JAXA 2LKDA 4L07A 2P7IA 2RG1A 5AW3A 3F3SA 1M1YA 1FIUA 1XV5A 2F1KA 1M1NA 2UYQA 3AP2A 1CRZA 1KEUA 1W4ZA 4I8XA 2H4JA 1W0JD 4LNHA 3PE3A 4K2AA 4R83A 1SY7A 2QG9A 2X6RA 1QQTA 2IYSA 1US8A 3H13A 3NOVA 3RJ5A 1PGQA 4XJTA 5IKEA 2EIHA 4P7JA 4HYYA 3U4MA 1LUAA 4L8FA 3UV3A 4B7AA 1E62A 3OOWA 3CF0A 4CM4B 4EUEA 2JVKA 5K0ZA 1QF9A 4ZWNA 1D6MA 3PWSA 4JQOA 5C3MA 2ONJA 4R2XA 4DWVA 5HKOA 1UOOA 2PD3A 3CZMA 1X80B 4AX4A 4FZ5A 2XQVA 4IZ6A 1SC9A 1AIPA 4GM4A 4DSNA 1RWQA 5IDQA 2VUIB 2GAAA 2C5HA 5TEVA 4FMDF 1JIQA 3CT6A 3DAPA 5IWAB 2QK4A 4V02A 3PX3A 1XKXA 4I2NA 4UU0A 3K2BA 3CPEA 3OF5A 3KYJB 3C70A 4YMGA 1DC8A 5IEBA 1E2BA 1LRLA 2IYPA 3W0LB 5AHRA 1DC6A 4UDOA 4X94A 3F5FA 3T7RA 1T2DA 4ACAA 2FVYA 2FR8A 1OPRA 1QHHB 3LC0A 4HYQA 4LHXA 1YB5A 2LXNA 3FMPB 3ZJTA 4GZ3A 4N6NA 4QPDA 2FQWA 3ROPA 2FSFA 3ANMA 3CEHA 4RVFA 4ITVA 5A3SA 5TNXA 2WE8A 5JASA 2DLDA 4HDMA 5IXSA 2XCSB 1S5PA 3QXJA 2Z95A 2C8JA 2AFRA 3ICCA 4Z9XA 2JAHA 3A2KA 1PFQA 1QBGA 3IMGA 2O07A 3H0EA 4AO7A 1F6BA 3OCCA 1E1NA 1EJ2A 2FV8A 2DKOA 1MB9A 2H7VA 4RHUA 1S1MA 1QF7A 2IPOA 3QYPA 1GKIA 3W8EA 5AW8A 2QRMA 1LVUA 3NAMA 2Q2NA 4D0LB 4YHHB 1FZTA 2BMAA 4HG2A 3GEHA 1G4HA 1FSPA 1KZ1A 5T3UA 1V8FA 1CIJA 1VZ3A 1YDHA 2W6OA 3N2IA 2OPHA 2WJZB 4J1TA 4B4VA 4R2LA 4X24A 2G9UA 2O2IA 2SCUB 5CFRA 3EXHC 2J45A 4J0JA 3PXEA 1DDIA 3R4VA 1PWXA 1HL7A 2B5WA 1T5IA 4QPCA 4U7DA 2PL5A 2CLKB 1MJGM 4ACBA 1GLVA 1QGZA 4R0MA 3OMWA 3W9SA 2P5UA 1B14A 2XTZA 3R6TA 5ENZA 1J0DA 5DX8A 2V6JA 3PJEA 3ZHCA 3IRVA 3F73A 2WM8A 3K4PA 4ZVPA 4DIEA 1IC6A 3A3KA 3PUZA 4NP6A 5T67A 4B7CA 4DR3B 3U3KA 3INTA 3KR0A 4HPXB 4BB6A 5L7WA 1YR6A 1F4PA 5IDXA 3EXHB 3V7YA 2ZJ1A 3LV8A 4GX2A 1TUGA 1W5BA 1B26A 3HCNA 4B6PA 2OUKA 1U0GA 2PX8A 4MRRA 1U99A 1PR2A 5ALYA 1KI1A 5KCZA 4A23A 2BBTA 3ZWVA 1N6KA 3UCEA 2VEDA 1CWUA 1FLVA 1QV7A 1WA5A 3B38A 1LBSA 4PZEA 4F72A 5ITZA 3UEOA 4KRGA 2IS4A 3FJOA 3H0KA 2QVBA 1T26A 1GPAA 1XK6A 2C2YA 1WUYA 2Z9BA 1E98A 2QTCA 1Z22A 4RM2A 1YT5A 2PWYA 3WE7A 3GUVA 4LJRA 4DB2A 1JI3A 2MSLA 2PPLA 5GZ6A 4DHWA 1E66A 3IPRA 1WDTA 2ECPA 4FBLA 2HH9A 2REBA 4C7OA 1A97A 1DCFA 2QT1A 4RA9A 3U3DA 2ZYDA 4OX9B 3ADDA 3M1AA 1D2GA 1ZDMA 2CJFA 1OBHA 1NMZA 2V0NA 4X7PA 3T7TA 1MPXA 2CMFA 3SOZA 3WLQA 4KHPB 2VYVA 1HZJA 2DY1A 2ZRJA 2VJQA 2OO7A 3WZ2A 4YAGA 5FUQA 3LWZA 5EP4A 3FCUB 1QPBA 1X9IA 5H81A 3O95A 4JI1B 1Y6JA 3S3TA 4ESEA 1U1IA 4RK4A 3UKJA 1R10A 2HDNB 3TNFA 1FU7A 3VU8A 1SHLA 1ID8A 5EZ5A 4AO6A 2CY0A 4N40A 3BREA 3L6DA 3K1YA 3P9KA 2GZAA 4Q12A 5AHWA 3SN6A 1B00A 4BNKA 4Z4IA 2P3LA 3OAAA 4U2EA 2WC1A 4H6PA 5JAIA 1LZLA 3IP7A 1USIA 1NPDA 4GWLA 4E4TA 4ER3A 2E3JA 2Q1UA 3H2BA 1BDMA 2V7PA 3PCTA 3ZGNA 2OO5C 4ZU6X 3TI7A 3CZAA 1VLJA 1KJZA 3GJ4A 1EGHA 3WYFA 4F1KA 2Y0BA 4L6CA 2VS1A 3P2YA 2N42A 2VUUA 4R9NA 1U7WA 4MDHA 3NTVA 4DYVA 4UHCA 3FAKA 3P2KA 2A57A 2I8CA 4FJ0A 3KOZA 3FOWA 2WUVA 4OP1A 5FBRB 4CKBA 2DWOA 3IVAA 3OU7A 4X84A 2XCUA 4DR4B 4Q7KA 1WP4A 3EZLA 3O84A 1PV4A 1RQ7A 1G0OA 1E9VA 3HP4A 4BIIA 3FM9A 5HMLA 3GELA 3J80A 2VP5A 4NC9A 4FYVA 2HF7A 3I2YX 1VKNA 1SIUA 3MPOA 4D8YA 3V8VA 2GUWA 3C39A 4HGOA 5K7SA 2ZDGA 2OBMA 5AK4A 1EFPB 1CE8B 1NMXA 3L07A 1UK6A 4R8VA 5CA0A 5JDIC 1GO2A 1GG2A 2QLFA 1Q0ZA 1J33A 2XWPA 2E55A 1DG3A 1Y4SA 1MQ8B 2QP9X 3E0QA 3K31A 4HK4A 4MR7B 4TVBA 4BQNA 4YIHA 1WVIA 3BD8A 4MRMA 1IZ0A 1BRTA 1Y3DE 2FSGA 3OZGA 1E61A 5CFQA 3AVQA 1P2GA 1NZDA 1ZEMA 3ONVA 3G9ZA 3IAS1 3VM6A 5IRCD 3KEMA 1WBDA 1C3LA 2J33A 3UMYA 2BDEA 4TKVA 1XDZA 2J0UA 3R6LA 4TYWA 1KDTA 2QYTA 1Z34A 3AHHA 3BGOS 1QS0A 1MRNA 4LJAA 5CDGA 2NMVA 1UBTS 2O3SA 4Y2GA 4PYMA 5ISMA 1WJGA 1X1CA 3QKRB 2BFNA 2BFWA 1AY0A 4FZRA 3UTCA 5IU6A 1N1DA 2GUGA 1NU6A 1U11A 1JA9A 2RGBA 2YUTA 1V1RA 4IGKA 1HXHA 3ZNPA 3DV0B 1C7FA 1OX4B 1XKQA 3L77A 3OPMA 1OC2A 4XJSA 3P9PA 5JMOA 4QXOA 3QIVA 3RNLA 3WFJA 4PN7A 1XMPA 1KBZA 3IMFA 2FUG6 2I9KA 2NADA 2L69A 2O3QA 4G3XA 4BV9A 5AVTA 3R5XA 1IHUA 2C9MA 3TJZA 4ZQIA 4YUYA 4KVZA 2IEZA 4D46A 4DR1B 1OH8A 2OYCA 3TTXA 1PUXA 3GCWA 3FUTA 3O8OB 2CL7X 2JFUA 1I7NA 3D1LA 3QWHA 4AMYA 4Z9BA 5BT8A 2KM1A 1T2VA 4L2IA 1XTQA 2NO9A 2QN2A 4M1WA 1W581 3OQBA 5T6BA 4AU1A 2WD7A 3DLIA 1ZR2A 2OMKA 1KNQA 3QM1A 3IBGA 2GK7A 2IODA 3DHYA 2L82A 4EOGA 5C52B 4YJ3B 2H1IA 2JIQA 3TYXA 4HNSA 4OPMA 1DJQA 2CCGA 3BK2A 4HYEA 5IVIA 1YR1A 2F7SA 2IK8A 1OFUX 5ADUS 1XFAA 3IURA 4ER0A 4DLSA 1QQAA 4B3TB 1IN6A 3E8XA 1X6VA 4M8IA 4CLHA 2EYQA 4CM1A 4OQQA 1UXOA 2Q5JA 5JQWA 3L3BA 1EK2A 1UBEA 2EQ5A 5T7BA 3RVLA 2JLSA 3ZE0B 1HOXA 2IEGA 1YJBA 4U6QA 1I6WA 1UK7A 3WXBA 3IKJA 4LF7B 1FP7A 3C5WP 1RRFA 1A4XA 3C3WA 2PXHA 4PS1A 3MCVA 1K3UB 2OGUA 2QL5A 3FZQA 2GBFA 2Z4RA 1VC2A 3GAZA 3ORHA 1ECGA 2EQAA 3GLSA 4UTZA 4OEHA 1I3LA 3I1FA 4YBRA 5C18A 3A9WA 4DIKA 2CLIB 3JQCA 2YC2C 3BKWA 5H16A 5JJ5A 2ZZNA 1GWNA 1NULA 2O6LA 3Q85A 5TY0A 4NE7A 2Z08A 1LF5A 2BT4A 4X1KB 5LZ8A 1SRQA 3NHZA 4TYYA 1OE0A 2FFHA 2V4UA 2HU5A 2ZKLA 5I7EA 4XSVA 5CDYA 2FFQA 4I50F 1W35A 3I9NA 5JQGA 4GOLD 3DEJA 3NWPA 1L4FA 1HL3A 2AI2A 4FYKA 4R9RA 1BSVA 1T6XA 5CJJA 3PR3A 3UUFA 1TD1A 3AUSA 3FHCB 2G36A 4IOMA 2AG8A 3CPHA 4JJ8A 3UOGA 2C4HA 4WK0B 2IGBA 4MS1B 4BY9E 4OLAA 3AQIA 3DZKA 4PXSA 4TMVA 3T4PA 2IYNA 4L7VA 2DFVA 5ALXA 4K9MA 2VI5A 1E8NA 5I48A 4N7JA 2Q2QA 3SQXA 1Y48E 4MW6A 5IC6A 1N2XA 3H9BA 2NGRA 3WK6A 2NNLD 4BMPB 1TA0A 2JLBA 4P4SA 1TC1A 2FFAA 1OAOA 2BHLA 4IUDS 4LF6B 1JR2A 1EVZA 4FX2A 3SE0A 1L7PA 3U3OA 1AGRA 1DIGA 1ZK1A 8AT1A 3D8RA 4J0DA 4KFSA 2PKXA 1A77A 4HH1A 5EWMA 1BDHA 2RHCA 4IDAA 4XKJA 3G5MA 3NEJA 1QCYA 5TMEA 4E2FA 3V7UA 4PAMA 3QUQA 2FZWA 1Q2XA 3V32A 3D6VA 1OZGA 3CFYA 3FNRA 3BMOA 3I0NA 1G9TA 3F1KA 3GPCA 4QVKA 3O4FA 4D1YA 3LBHA 1ADBA 2DRIA 1T8RA 4FTWA 4TQ9A 3UWPA 5CIYA 4KFCA 4G9BA 3SQNA 4WT7A 4JWTA 4OI2A 4FS8A 5DSXA 2C7RA 3DPUA 3WZLA 4BRZA 4RNCA 2Z1MA 3ONNA 1Y6ZA 1DCMA 2LPMA 1GCIA 4YRNA 4P3PA 3L18A 2IYVA 3CISA 2A1TR 1TI7A 2ZSJA 4U3JA 2HK8A 1N2ZA 4PFJA 2RKWA 3TW8B 3EMBA 3QSYA 4C9BA 1NVAA 3B12A 5BPFA 2IPNA 4IIDA 4JYCA 4N5DA 1Q1ZA 3FTFA 1Z38A 1G3UA 3GCGA 4I50A 4D9NA 4DV0B 2OZKA 1EK1A 3PEUA 3W78A 1VHJA 3WYBA 3DLAA 2GK4A 1Y1SA 5K51A 1AUPA 2YIMA 5B3AA 4B6EA 1FMFA 1E69A 1UOPA 1WB5A 2Z5VA 1PEYA 1J9EA 5EL0A 5FL7A 4D5GA 4DMHA 6GPBA 3C43A 3SEFA 4TM8A 5JCOC 4AF8A 1P4GA 5KDOA 2E18A 2YWGA 3G9TA 1A9OA 1CZUA 4OCZA 1Z62A 4UAUA 5CTJA 3ZDCA 3NHUA 4P32A 2PO7A 3NV9A 3X1DA 3WHLA 3PJFA 2PLRA 4MVJA 4YRDA 4PQEA 1N2OA 1AB6A 2OORA 1Y82A 5ERXA 4ISBA 3H3FA 2ODTX 3P4XA 3ITKA 4L57A 1Q0QA 3PQ8A 4M7RA 1KZGB 3TCKA 3WNDA 2R6DA 3ZDYB 3H3XA 1CZKA 1H1DA 1MV5A 3RVJA 5DN6D 3H05A 4LBYA 4B4DA 2XVAA 3F3MA 4UHJA 3JS5A 4MUAA 1UOQA 2ZKIA 3DXFA 5KDDA 1COWA 3MTAA 1A8HA 4MPTA 3K72B 5AVJA 5KYVA 4COKA 2WB2A 4WZAE 1UQRA 4MINA 3RD5A 4MZXA 4DBLE 1B1AA 3B9QA 2VAXA 1A9XB 5BRAA 1ES9A 1XYYA 1YULA 1U5AA 2A7QA 2JKYA 2DZDA 3DHWC 3H9CA 4BKPA 5I7UA 2QQGA 3AESB 5REQA 2YWBA 4ZOBA 3WQQA 1U0OC 3DMGA 4LOAA 3PE6A 1ZESA 4KK3A 4XCVA 5KTRA 3HYNA 3A6LA 4FNOA 1R0LA 3RAJA 3C3YA 2VCHA 1FDIA 1VLZA 4LOJA 3U3RA 4UEOA 5HKLA 4EUFA 2GM4A 3CRRA 5KTSA 1VOTA 2ZTVA 3PPXA 4UEWA 3TRDA 3KKQA 3QKSA 1I7LA 1QYWA 1RS0A 3ENQA 1KR5A 2LCIA 4FEEA 4QHYA 1T0HB 5HA5A 1JXMA 2OK7A 3PC3A 1ECBA 1FVHA 1SVOA 4ZYYA 3F97A 3ND8A 1JAIA 1HDYA 4AXBA 1X7DA 4QO8A 1AQ6A 1NURA 1ID1A 4OKNA 3H2IA 1FFWA 5BV7A 1XTBA 3GDGA 3DYIA 1AKWA 2O06A 2Z5LA 1AKTA 1KIFA 1RLIA 2Q6IA 3ED5A 3HEAA 3L1VA 3TKLA 2FPGA 5C81A 1BJRE 1PE0A 1Z4QA 2OCIA 5EYPB 1OHHA 1RYZA 1OMOA 1ZD3A 3TSZA 1MDBA 3QJ5A 5F7ZA 5F51A 3BN3A 2PIDA 2OHHA 2HREA 2DFLA 5B4UA 4G24A 2RSLA 3V8QA 3GEPA 2R1TA 1OI4A 4FYXA 5HS4A 1HEIA 2PVCA 1WXHA 3HJUA 1VECA 3HU3A 1N0UA 2I8LA 3F4KA 4AJ4A 4M7OA 4XYGA 4IBOA 2ZDQA 1NM5C 4Z49A 5FBZA 2VHEA 4DM7A 1P39A 2XUHA 3EQ7A 1E3LA 1Z2CA 3G17A 3Q9SA 3UFBA 2CVFA 2ZYHA 4BQEA 2NVBA 5JECA 1KPGA 4L4UA 3DOCA 3A9UA 4AKEA 3ZD7A 1U8EA 1UP4A 4YRRA 4AP6A 4MQFB 4LPSA 4DDUA 3DDNA 3IAM1 3NJ8A 4JT4A 1FSFA 2G09A 5CNMA 5THXA 1CQIA 4F3RA 1AA9A 1VE1A 1YH3A 2PL1A 5GOTA 3VTAA 5L3SA 1RYFA 1SURA 3MT9A 1WSBA 2N75A 3UAXA 3KKKA 2ZRKA 4AT1A 4Q21A 2HK9A 2GEBA 3NX4A 1UPAA 4MV0A 1SZJG 5BUQA 4PHCA 4BO0A 3EXFA 1R8XA 121PA 1E6UA 3HWRA 5FD8A 2ZR0A 4QDJA 1DQZA 4TL8A 3BXZA 5FV7A 3SLKA 5K6RA 4FZVA 5D87A 1L9XA 3KAKA 3NONA 2WYHA 2E49A 2H06A 1V25A 4DMRA 1I5RA 4V38A 3G7UA 4ALIA 5IKMA 3DBHB 4TQGA 4A8PA 3HKEB 1IN7A 3FLBA 1EM6A 1OAKA 1QMGA 1UBOS 1X92A 2IZ1A 2VK8A 4UD2A 3VPHA 1XRPA 1ZGAA 2EP7A 3LC2O 3CONA 2C29D 4REOA 1N32B 5G0UA 4Y0VA 1P6QA 2VYFA 4EHDA 1GOTA 1VIYA 2YR0A 3OWOA 3KXLA 4RH1A 5EMNA 1QRDA 3ZXIA 1I13A 4Z53A 5A5FA 1HDGO 4LV5B 1CFJA 2PGIA 4BLWA 2EFJA 3K2IA 1NBAA 4HFMA 4EDFA 2ZBEA 1XEWY 3MMNA 1V4VA 5HGJA 1QQ6A 3T1QA 1I8TA 2HLDD 3CURA 5JDCA 5ALWA 3KJGA 1IVNA 3LM8A 3P52A 4FDVA 3LOUA 2ZYIA 1L3IA 3N87A 4U0JA 5JSKA 5ILOA 3GVCA 2ZUCA 4HY3A 3MTDA 4EHBA 4R2HA 1AGYA 3OM8A 1U8YA 2N3ZA 3OIVA 2C97A 3ZVKA 3FZYA 2WFLA 4Q66C 3KL4A 1FRZA 1FDWA 4CUJA 2ZSAA 2O59A 4WJLA 1Z4IA 1XHEA 2FPXA 2QR3A 3DKIA 3PD7A 2WICA 4LHVA 1FXWF 1SN7A 2UZIR 4MX8A 4N03A 4NJMA 1WY5A 2H29A 4L74A 4OBEA 4DV6B 1GTRA 4P84A 3KVRA 3RIEA 2B94A 5FX2A 3O8LA 4KYIB 2GZMA 3BZWA 5AXDA 1P4RA 3HU5A 1AVTA 1QTNA 4MW4A 1V8ZA 2PA0A 3TZQA 3UK6A 3K20A 4KWIA 2IOYA 4ZOQI 1IXSB 1MXFA 1N2HA 1NUTA 3GFPA 5JWRA 1PJ3A 4ARVA 1XF1A 4PX2A 5DLYA 2FETA 5SYAA 1O03A 5LLSA 4BJ5A 3ICWA 5AWFC 5ITWA 2WWHA 2QS9A 2ZUVA 3Q9UA 1P7ZA 1G8KA 2G1AA 1EU1A 4X1IA 2FOIA 1KEVA 2ZRAA 4AB1A 4C22A 3WL7A 3SYTA 2HA5A 3RW9A 1JYSA 2PH1A 4JVSB 3RU2A 3MYYA 4ZXPA 2VQFB 1EFVA 2RAVA 2XNHA 4RY9A 3ZUGA 2FPSA 3K09A 4HRAA 3MHTA 3HKCB 2GVZC 5HTOA 4MPPA 4FIZA 3FSJX 4AWXA 1GTSA 2O0HA 5JAPA 2ZQ5A 3PS9A 3L6BA 2I7CA 2K2WA 1UC4B 4A4DA 2ZRNA 3PNVA 3RF7A 4TYQA 1W1IA 3KWFA 3PQCA 2Z43A 4RABA 1LBIA 4PSDA 4D3DA 3KQUA 2BLNA 1CERA 1BCSA 3CX3A 5EKUA 5A3RA 5AK6A 4ILKA 1RQRA 2AFHE 3VQTA 1D4OA 3N7UA 1W6UA 5THQA 3WFIA 2VT6A 1VCHA 1T0IA 3UQZA 3VKVA 3MNFA 1LTKA 5JXGA 5KTYA 4AW9A 1NMSA 2J85A 2I2AA 2DQYA 2O2GA 1XCBA 3JQDA 3NHFA 3PC2A 2AT1A 4JBGA 3UMCA 3THWB 5I7RA 1FXWA 4B35A 4AUMA 2ZBUA 4M46A 2ZT6A 3KVNA 2OXFA 3SMQA 4MGZR 4NU6A 4RZSA 2XRYA 5JPIA 4WKBA 1DIBA 4QTXA 4PVDA 5ICCA 2VSFA 3CF6R 2YOGA 4RIFA 3SKYA 1Z8NA 1P17A 1U1GA 5JAZA 4RFSB 2HYDA 2QP4A 1Q1AA 1GCGA 1MGPA 1ESNA 1KI8A 2BR5A 3EA0A 4TZTA 5H02A 2QI9F 2WHPA 1JDZA 4JLDA 1ZM9A 3RRFA 5HUQA 3FR8A 1RD4A 2CK3A 2O1WA 1XUOA 4QQKA 1KZ7B 1JAZA 4IWXA 4KXYA 4X6LA 3DFIA 1LPNA 1YR2A 1AS2A 4E5KA 3RUEA 2HK7A 4N41A 2QE7A 4WFIA 4NG5A 4A9AA 5I7WA 1DADA 1Z5ZA 1F5NA 1UZLA 2RIPA 4NCAA 1GKUB 1V5FA 2POQX 4NBTA 4X44A 5FQNA 4NZNA 2GBLA 2H16A 2DPHA 2W2MA 3DP7A 1IOLA 4V0QA 5A9SB 2FOLA 3ZI7A 1RPNA 1N6IA 4D80A 3K32A 4C7KA 1UZNA 3S5JA 2P90A 4HDAA 4C7JA 1M2HA 5AW6A 4MARA 4PFQA 1CUGA 4NBKA 1RAIA 4U7TB 4F6CA 3CVYA 1RLOA 2OFPA 3MJDA 1DC5A 1DOHA 1R7RA 4C5BA 3FWHA 5KYKA 3FYDA 1E96A 3U39A 3R9XA 5EP3A 1E2HA 1SBYA 3W05A 1ZMTA 4WOPA 4YJDA 4F9EA 5BOSB 4FGJA 3ZHQA 2A5FA 5KMGB 1R5BA 5CNJA 4CW7A 3GJ3A 4IICA 2HLHA 1QO7A 2M6LA 4RY8A 4BFTA 3PF9A 2D4AA 4XFDA 5DTIA 2GKGA 4FYYA 5FBKA 1SU8A 1HO3A 2G9NA 1V4NA 4TX1A 2CHFA 5I8PA 4I4LA 2C9CA 1EP9A 1OZHA 4KCGA 4W5NA 2FKNA 2RGXA 2H4YA 3NAQA 1NOIA 1VPEA 3TR5A 3RYIB 2AJCA 2XAUA 3PRKE 1G5QA 4QE3A 1V71A 1IU9A 3H4MA 4LJ4A 1XIVA 3WL8A 2FU5C 3QKIA 1SJ9A 1XXLA 3ZXXA 5ICSA 4PIPA 3I1JA 4UBLA 3O8BA 4EHAA 3S8YA 1A95A 1TUEA 1MH9A 4UW9A 2ZI7A 1VBNA 3BCRA 1KEZA 3EQ8A 1J9GA 3MJTA 4DPKA 3VHQA 4OATA 2F8SA 1HRKA 4ZV4A 4PRLA 4PWYA 4TMWA 3U4AA 5K4AA 1PJCA 3EPRA 4G1CA 2OVFA 3PVSA 3ZNNA 4YRBA 2Y05A 2MYPA 3Q7IA 5EJ2A 2P6UA 4KRFA 1UKVY 1ISGA 2FW6A 1AMNA 4XB1A 1GAWA 2PZGA 2YV5A 3FJYA 4NYJQ 3TLGB 1UBNA 5D5QA 3GLTA 4L95C 3R9IA 4DCSA 1DXYA 2P0AA 4AAYA 2I22A 2XMSA 4JX8A 2BEKA 4Q0MA 2ARKA 3AJDA 4ZVRA 4LFBB 2VDMB 4P7BA 4KWEA 4KMRA 3TD9A 1D3AA 3IV7A 1A9TA 1E9RA 1BS2A 3ESZA 5K0BA 2JARA 4UNIA 1F7UA 1UPUA 4DQXA 2FTKE 4N18A 3HVKA 4KIGA 1C9YA 5JJKA 5CB4B 1TJPB 3CUWA 1WQ1R 3D5EA 3F6PA 4QUAA 4DT1A 1YKGA 2C0QA 2QL6A 1MIOA 5A6VA 1IK6A 1E4OA 4ZDKA 1AG9A 1ZSVA 2OHXA 3FYTA 3MMPA 4WL0A 3IMEA 4OREX 5G0WA 521PA 2WJ6A 8ATCA 2PBZA 3GWGA 3CF4G 2AOVA 2DQZA 3LCCA 3W34A 4WFJA 5L40A 3BB1A 3A6PC 2AQ8A 1RJFA 1E2NA 4E21A 3OLXA 5JUWA 1BEUB 2VT3A 3K0CC 1R66A 5AKJA 3ZLVA 4O0LA 3JWGA 2TMYA 4NF2A 5A1TA 1J4AA 1SKMA 4FFBA 1ESEA 2CXRA 3H99A 2O2CA 4QHTA 2UUOA 3DDWA 3QE0A 4YFYA 3TSWA 2Q2VA 3KC2A 4JVOA 3IUMA 4G0PA 2VPWA 3TQQA 4TLAA 3L8MA 4TS1A 2O0LA 4H35A 5HG0A 1VIDA 2XCOA 4XFJA 5EE0A 2WPNA 1YQUA 1Z2AA 4MV9A 4E2WA 3SYKA 4OLBA 1YJAA 1JDNA 2VNIA 1BO6A 3AR8A 1GR0A 3KALA 4LS3A 4DNXA 2UVDA 1E7RA 4GPTA 2LCFA 3DLCA 3S1AA 3VR5D 4JUCA 1B6RA 1RE1A 4HLCA 3VNBA 2WWTA 2FJUA 1J8DA 3FVVA 2ZITA 1G291 2IYTA 2WSYB 1F0YA 3T9FA 1OUMA 3SR4A 3TOCA 3ZXYA 3GAMA 2C7BA 1XVVA 2YIJA 4DLLA 2HSDA 2HQRA 4RS3A 2DH6A 1L5NA 2X0KA 4KQFA 4PX3A 3T3GA 4AKSA 2AJBA 4KLRA 2WF5A 1QWSA 4P9NA 2FKAA 3SJZA 1KGDA 1RU3A 2RJ3A 2JFOA 3NJ4A 4BPRA 4EDHA 1E2GA 1CNFA 3AI7A 3LNCA 3UJDA 4RTPA 2B4TO 1UP6A 3QSGA 5IBQA 9LDBA 1CJKC 2PRJA 5HYVA 3Q87B 1C3VA 5LMZA 1ORDA 1L7AA 1NN0A 3LCJA 2IZ5A 4JCOA 2OP0A 1E60A 2OGZA 3B7PA 1MVLA 5TQ0A 3RU3A 3WLMA 2GPSA 1EWRA 2W6JD 1SBNE 4OB6A 3CKYA 1TAGA 4XIFA 1UT5A 1XLTA 5JAHA 4DRZA 3NC0C 2YVQA 1H9BA 3DJYA 3ESXA 4OU4A 1WF6A 2ZR9A 1J8FA 4Y9SA 1LLCA 4QOSA 4E22A 1MOZA 2Q8QA 3BC1A 3ZW8A 3NALA 5ABPA 5JH7B 4B84A 2PX3A 3W8NA 3ZCVA 3O8RA 1YASA 4MRPA 2C9BA 5EJIA 3HR8A 1D09A 1HG0A 4D8XA 3LH5A 4HNUA 1F4VA 3FMOB 1OILA 3L04A 2ZIUB 4I55B 5FRDA 5ELLA 1WVMA 5JS1A 1QJ4A 1E6KA 1FNDA 2AYYA 2D5LA 2FYTA 1OXMA 2VO1A 2Y99A 3GL9A 4HPJB 5LQCA 4O4IB 2JLYA 5GMOA 3JALA 3HUTA 1YV9A 1Y7TA 2VF4X 1P2TA 2GZRA 5SYNA 4MUNA 1DWUA 1JKJB 4OFZA 4RMJA 5DDIP 1VMEA 2IUUA 3ZGYA 4NH4A 3PQEA 2BGTA 3UXHA 4OXYA 1SIBE 3BFPA 1ODCA 1VG8A 3SYRA 4MHTA 1CLUA 2PL9A 4ETWA 1DIOB 1KAQA 2NXCA 5ES3A 1UDBA 2PKEA 1UAAA 4DADA 5BQ3A 4DDMA 2HHJA 1EUCA 3GFSA 2Q46A 3ZK7A 4C2UA 2ZRDA 1POXA 1I1QB 1MB2A 2J46A 4Q1VA 4WLUA 4A0QA 1KJQA 2AWOA 3HXQA 2DFKB 3JQ8A 1UMBB 1XX6A 3HPQA 1SEVA 2DGDA 2YOHA 4JXZA 4W9RA 3PGMA 3R3UA 2NOAA 5H70A 3RUFA 5AIBA 2OGWA 5F1PA 4NU0A 1FC0A 3TZ6A 4F4UA 4WNIA 3T5GA 4ZAYA 4YJ2B 2W4MA 1CY1A 1JLMA 1SXJE 2YASA 3JVVA 1MZVA 1RYBA 2DM6A 2HCBA 2QTFA 3E3AA 4HLUC 4RA6A 4WKCA 3PB3A 1IG3A 1NVMB 1T3HA 4A73A 5C8DA 5CITA 4DN6A 2NN3C 3MC1A 3T7SA 5K8JB 1HSZA 3LGXA 3JPYA 1VHQA 1TRHA 3UUWA 1CVRA 1VTKA 1ONBA 1XN4A 3ESYA 3B6ZA 1ZIXA 1OI2A 3B8EA 4NMHA 1QCDA 1GN9A 2Q7XA 4BOYA 2CLEB 4QT4A 1EFCA 5INTA 5KOYA 2IOFK 4A0FA 5SYMA 4A8JA 1K3FA 2X8WA 4X8LA 2FMUA 2IS6A 5E4TA 3K0FA 5FLYA 3HKBB 1VKOA 3ZWWA 4KUEA 1E2PA 1M2NA 2ZSEA 4Y9UA 5IC4A 3FTCA 2XYVA 3ND9A 2A0UA 1SUDA 2EYUA 2PZEA 3H8JA 3KXIA 1RHUA 2EHDA 3QOWA 3U62A 3I76A 3ZKAA 1IMJA 4RK1A 5THKA 2A8YA 1QFMA 1MX5A 2GVNA 1W48A 3LXUX 5JYDA 4EA6A 1CETA 3E22B 3MJSA 2YZGA 2AVDA 10MHA 1TMGE 1WSDA 3DO5A 4M9CA 4IZIA 3G8DA 1GPNA 1RI2A 4M0EA 5D86A 5SY6A 4K6FA 1N3YA 3DW1X 1E1DA 2X0RA 2CYAA 3VFDA 1CEEA 2V5VA 1Z6PA 2XVMA 3LECA 2X76A 3NYIA 5MFZA 2O4UX 2XNDD 2HPZA 2PBFA 5G1OA 5IAKA 3P0EA 4BNHA 1E92A 4M0LA 3N5KA 4KQHA 3BH0A 4F46A 1E3TA 2G5CA 3TQCA 3QVJA 4RVOA 4PRYA 3ZOKA 2P8JA 3TOSA 1CZOA 4AC9A 5L4NA 1PFGA 1YAHA 3VX4A 3J81A 4CKWA 4H59A 4BUZA 3I1IA 4UEJA 3AIMA 5B5SA 3AVOA 4UMDA 2IX3A 3IOEA 3RVBA 1SUCA 1ZS9A 3MQ2A 1YNOA 3LUGA 2ZDHA 2RI1A 2FEOA 3EH1A 3QTBA 1U98A 4OAOA 3GGPA 3PFNA 3MTJA 1PZFA 2Z6UA 3NETA 4LF9B 4LDNA 4RJJA 5F35A 1HWYA 2CFTA 3JSXA 2F9LA 4EKGA 4HUQA 4N5HX 1XTZA 5DP2A 3IXQA 3KRTA 1AO0A 1JEQA 2LWIA 1HLDA 3ZDDA 1NONA 4XCQA 3X44A 3LL7A 1RZRA 4DQKA 4ND4A 4ZT4A 4CM5A 2WKPA 1X7ZB 2Q45A 1IONA 1W5AA 3AWIA 4LJ7A 4UM8B 3PP8A 3UOWA 3W7AA 4D57A 3V48A 3EXIA 2JIRA 4P2GA 4OHZA 2I2FA 3KKNA 4GOMD 1XVAA 2H65A 3IERA 4N39A 1O2DA 5BN4A 4MTCA 4QUJA 1PTJC 1DMRA 4U2CA 1CR6A 4MQUA 5F7OA 1EX6A 2YTZA 3CZ4A 3EZ2A 2BZGA 4D7AA 1NBEA 4WLNA 5AXBA 5KHOC 4ENVA 3LUCA 2Q1TA 3N2GB 5LP6A 3U5TA 3LBIA 3BD7A 4BWFB 1A98A 1T8UA 4M1ZA 3EZ6A 1CC1S 1ZISA 4WN9B 4U0KA 3U31A 5J58A 2TRSB 3BDIA 1MG5A 2WJHA 3P0HA 2RJNA 4IJQA 2RI6A 5EHQA 1MJNA 1V2GA 3JWEA 4M76B 2CV1A 1Y8CA 3ZY4A 2CUKA 2WTEA 2BI7A 3ZX5A 1UZMA 3N39C 3HO6A 4NHEA 2PT6A 3DS8A 1LDNA 4V1CB 1ND5A 4ZQFA 1V9CA 1O77A 1OI3A 2XTJA 1M8GA 3G0IA 5I8WA 3ZYZA 4F7DA 1GIAA 1JUDA 1LD3A 1ORWA 4QDUA 4UMFA 4IG9A 4RK0A 5GJCA 2N9UA 5IVDA 1I1NA 1G7RA 4OHRA 1CRLA 2WWRA 1SQ5A 1J2YA 4MGYR 4QXQA 3TN7A 3OJOA 5KU7A 1TM7E 1GNSA 3PIDA 4L6AA 1BXGB 3SIPA 4ED9A 4E7OA 1ISPA 5B57C 3TH5A 4AULA 2Z5GA 3OCVA 2QJRA 2IOFA 1JIKA 3RDPA 4YAJA 3SIRA 4GOJA 2FUNB 2VA8A 1Z6QA 4DA9A 3K0SA 3QIAA 1O0SA 3ZE1B 1SCNE 2KI5A 5EG5A 3S40A 1JIVA 4C0WA 3WWCA 4GPAA 1GQOA 1MTZA 3LQKA 5GY7A 2WTXA 1KHHA 4YC7A 5ICEA 4MRAA 1ZNWA 3ZC3A 4R2JA 1JLRA 4R2MA 2PGAA 4N4AA 5A3QA 1KSFX 1REQB 3CT4A 3GLHA 1CZRA 1ST2A 2ZZKA 2R6CA 5BNTA 3DDZX 4C0SA 1OBVA 1SXHA 5GGXA 1BIFA 3M9WA 2EF1A 3W2IA 4KR2A 2O1SA 2PS0A 2YW9A 4LJ6A 5BN1A 1TTPB 1U9ZA 4FQ7A 5A5GA 1SM4A 1OQAA 1KPHA 2Y2VA 4OOFA 5DX1A 4EKYA 4HH0A 4A91A 2VTEA 2J5RA 4K6KA 5EXEA 1OXXK 1SCAA 1WG8A 1ISMA 2H1RA 1YRQA 1RP1A 2QGFA 2ZE5A 1N7GA 2WF8A 3DZJA 3COVA 3AIIA 1XE3A 3L6RA 4FGZA 3U9SA 2E5FA 5DM4A 3ZJVA 4BLUA 1WWKA 3IOMA 4L9RA 4X8OA 4DEXA 4MWEA 1NUPA 4IIGA 3M6IA 3O8NA 5A4DA 4BUCA 2REOA 2IDMA 5BWLA 1YJXA 2AOWA 2NYUA 3SKXA 4E4RA 2J7KA 3FETA 5K1ZA 1LLQA 3CNEA 2J30A 5BNIA 3EIXA 3D8NA 3Q7PA 2VYQA 4KE6A 3G2JA 1TECE 3KVOA 3PITA 1SOVA 1JEOA 1VRCA 1T35A 1XD2A 1DAGA 1MEJA 5EE5B 4C29A 3EPHA 4MVJI 4G1UC 1NLYA 5KO2A 3BILA 2V8BA 1SEPA 4FMCB 2EJVA 2BP7A 1IK4A 3P9YA 4ECEA 5EEGA 2ZBDA 3VR0A 3MELA 3EEBA 3V42A 3V1KA 1WPRA 3O8CA 4JX9A 1TT5B 5GM1A 3WLTA 3OZFA 4AI6A 2ZWIA 5DHTA 1AMUA 2OCAA 1R6TA 2JBWA 1C50A 4J6FA 4UD6A 3BAFA 5KNDD 5KYXB 2P68A 1WHSB 4DV2B 3H4TA 3B51X 1XCLA 2Q27A 1NVVQ 2WJIA 3MRTA 2PR7A 3BEDA 4IDFA 5HF5A 5K2MA 5ELMA 3WRXC 4CIBA 1YIAA 5CX1A 1A50B 1MORA 1Q84A 3M4XA 3MJEA 5EPOA 5BW8A 3WISA 1CUCA 2AEEA 2MSNA 3EZ9A 4O2AF 3I8SA 1H2WA 3IDOA 3P0JA 2GJ8A 5JADA 1RMQA 2IYWA 3DZBA 4JLVA 4RGQA 4KR9A 1QM5A 4DMCA 2XMZA 3D4IA 2ODPA 1BMFD 4X54A 1ODJA 4GLBA 3YASA 5CBKA 1K27A 1LRJA 4S1PA 1A8PA 1TKCA 1G8PA 4TGLA 1E0DA 1NE7A 1I0IA 1T2CA 2OE2A 8ABPA 1J2TA 3I2FA 3LWNA 1KYVA 1J0EA 3PFFA 2CZGA 1WMBA 2VC2B 2W48A 1H85A 1JXAA 2ZJOA 2IPAB 4URWR 621PA 1ONSA 3KQHA 3BGWA 5ALSA 3B20A 2DXIA 4R7ZA 1NASA 4HWKA 1K9VF 3SC3A 1AS0A 2IYRA 1OZFA 2EDAA 3FHLA 3QPVA 1DINA 1UIMA 1CQJA 4N0MA 4MWCA 5BSHA 2A35A 2GHQA 2G0TA 3CEMA 3OZBA 2VNJA 1MX3A 3DT6A 3PR1A 4GVXA 4W9NC 4BMYA 3QLJA 4GO1A 4C6SA 2MT9A 1WPGA 5CG1A 3DZDA 1R5NA 2ASEA 2Z4TA 2QA5A 1E1CB 1Z4JA 1QU3A 1P5ZB 1RC0A 4ETIA 3BWBA 4CLRA 2RKOA 2MHCA 3CV3A 4RLFA 2ZB4A 1PG2A 4XLTA 4YLYA 5F9HA 3ZGVA 3ZIDA 1MCZA 2WKSA 2DQ4A 3L8YA 1X7WB 4BVKA 2ZJBA 4D6PA 4EMUA 4N12A 4RTQA 2TYSB 5TMPA 3CX6A 3JR3A 3W06A 4QTTB 2EFCB 1M34E 2Q41A 4GLLA 3JX9A 3NOXA 1QAQA 1YE3A 2JAUA 1NUQA 2NP6A 1KSHA 3HJTA 1PIWA 4BECA 1T36A 1LBEA 2AJTA 2CBZA 2ODNA 3FJ1A 2RGGA 5FNVF 4CQMD 4WZAB 2C7GA 2VRCA 2ZFUA 3OT1B 5TE9A 2ZXFA 3R41A 3VYWA 5AJVB 3G02A 5DF1A 1Z8DA 3TFWA 1EEXB 3AR5A 5I7OA 1AQNA 4H7JA 4C2BA 2UKDA 1YKFA 1JKMA 3I9JA 1GL3A 2G9VA 4DZRA 4EB3A 1NRXA 2P2SA 3FW1A 2DUUA 2H9YA 3AOGA 3VSCA 2B2CA 2VPIA 5CGZA 3KETA 3DMHA 4BFZA 1AE1A 2G07A 4PYOA 1Q1NA 1QQ7A 1XELA 3CNNA 1Y81A 4LE0A 4I3HA 3OSUA 2GCOA 3QPUA 5KYWB 1XEXA 4RJ2A 4OO3A 4OQEA 1S9DA 1X1TA 2JJYA 1N3BA 1JFSA 2R48A 5AD1A 1LDGA 1YL6A 4UOQA 2Q1XA 5A6SB 3FSGD 2ZK7A 1XA3A 1E7WA 5NULA 3DVQX 2O7QA 4OLHA 2BH2A 3TI9A 1T5SA 4JI5B 4E08A 5JJIA 1KO5A 4HB0A 2IYQA 4MULA 1T8TA 3DWIA 4LXYA 1IBLB 1P2UA 1V43A 2X5NA 3EC7A 1RM4A 1FYWA 1U2DC 4LCEA 1JJBA 1RVDA 1UDXA 3E53A 4YHBA 3UUEA 3PUXA 2FZGA 2NSHA 2VF7A 3VV2A 3WYDA 3DB2A 3D0QA 4FE4A 1EIWA 4R0VA 5WRFA 2FMTA 2XLCA 2PMBA 5G02A 5F7JA 2ZOSA 5G3ZA 2NUTA 1OD6A 1BEEA 5KYYA 2OGSA 3ZZ1A 3BPSA 1V1MA 2D5CA 3QNUA 5HIMA 5FNVA 2CZCA 3RVPA 4ZO8A 4ZK6A 3O0TA 5LWQA 1X8XA 4XXHA 5TVGA 4RVUA 1V95A 1GA4A 3TB6A 4KQ1A 3W4JA 3NORA 1RRMA 2WAMA 1JZTA 2WWYA 1PV1A 5AM0A 1Y3CE 1Y1RA 1NQOA 3D3KA 4MROA 1XG5A 4Q7MB 5D1NA 2C3OA 4X1OA 3ZH9B 4D43A 5AW2A 4BO1A 2QMHA 5HZHA 3N75A 1EMDA 1SQSA 1T0JB 1UWVA 4JJ6A 1P1CA 1XTUA 3SHVA 3VAYA 1RACA 2V6BA 4WJKB 1E8MA 3PDCA 1C8LA 3VH3A 2GBIA 4J4BA 2JA2A 2IPLA 2CE2X 4OBWA 3DMRA 4IY1A 1ZKDA 3DXXA 1LX7A 4GP6A 4MWDA 1P8JA 3FNIA 1KZYC 1CUSA 3CO0S 5H4HA 2JI6A 3BD6A 5E1DA 5M2QA 2B1JA 1G5TA 1ZH6A 5DM1A 5FKJA 4BWYA 4ZEVA 2V4MA 3E05A 1AF7A 3KSZO 2JK0A 4QATA 5CUQA 1SXGA 2WPDD 3H2YA 5AW9A 4O8CA 3KTDA 4GDMA 3CS3A 3VDXA 2PKQO 5JVDB 5E4JA 1CS4C 3MSCA 4G4JA 1H8HA 3ZPXA 5JCXA 1RE0A 5AKEA 4RK6A 2DVMA 2JIZA 5FYDA 4OIMA 5TB5A 4M54A 4G5GA 3F5SA 4JJ7A 1Z13A 3AILA 3QVGA 4FI3F 2IHVA 4QUEA 3LD9A 2PL3A 1IAQA 4IVRA 5FWAA 3RJTA 2TMDA 3SEZA 4B17A 5ADHA 3THYB 1M0EA 3DBOB 1BXRB 3EXG1 1RIIA 3H2KA 4XGKA 3JYNA 2P79A 4KXMA 4XTRA 1HGXA 4DY6A 5CVCA 4ENPA 2HCTA 1C5KA 1MV8A 1V96A 1GU7A 1WPXA 1Z82A 2GN4A 2BM0A 2OILA 1IZYA 5LXTF 4CM3A 3RUIA 4BO5A 1P4AA 1K66A 2ORED 5JOQA 1JX6A 3H65A 4EHKA 2Y27A 4M9QA 2ZJ2A 4WXPA 4RIGA 1DFGA 1V16B 3KUKA 4GLOA 1G8MA 3T3OA 4MQLA 7REQB 1T8YA 4R5MA 1YZKA 4HQ0A 2ZS7A 4UEQA 3KQVA 4JBHA 4YLEA 3VVBA 3HDVA 2D00A 1Z2PX 3H7IA 4C3OB 4NXNB 4HC4A 8GPBA 1S2DA 1O9BA 5EIAA 1XCGB 3SNHA 1DOAA 4QYMA 4NI5A 1V5GA 3QVKA 3BGDA 4BNDA 4YCLA 1E3DA 4JVNA 4UE3S 3D7SA 3D2AA 2FPPB 4FE7A 4HEHA 4F3YA 3KSUA 3ETCA 1E77A 4MUKA 3R7NA 2UXBB 3IT1A 3D02A 3VZRA 2VNHA 3E61A 2CVQA 4US1R 2JLWA 4Z0PA 1UDCA 3OE7D 2QM7A 2QUBA 2HJSA 3FKSA 3W2EA 4JUFA 2YXPX 1NUSA 2HAEA 3EZGA 3F3KA 3KEFA 3ND5A 2OL4A 1WNTA 4LY0A 5J1TB 1P18A 5ICGA 1RPZA 4YCCA 1OXSC 3TZHA 1CYDA 4UFPA 3ESQA 2I66A 2R4QA 4LYDA 4UVEA 4UTVA 1KO8A 1U28A 4KR7A 3NWEA 3GLGA 4I9UA 2E4VA 1OVMA 4GRIA 1FJXA 4URZR 4JHLA 4MS4A 2YWCA 3AJ8A 4EQ6A 1X70A 2OAQ1 2ZPTX 1VG1A 3M5WA 4B71A 5HPYB 1WTCA 4B32A 4DIBA 4KW7A 5KOHA 2Q9AA 3AK4A 1Y3IA 2JD2A 2RHDA 5COQA 5GIOE 4EEKA 1WUTA 2YFKA 1ZUHA 3AV3A 3GLVA 3CTPA 3SSNA 5HIAA 3DL0A 3ET4A 3TOVA 4JEUA 4L9SA 4E70A 1E99A 1ZRSA 2POCA 1MFPA 3GJ0A 2FMXA 3JZIA 3OIUA 3I62A 1PI3A 2J3JA 3ECCA 3KJZA 3R3WA 4P3XA 3SFZA 5HX7A 3L0ZA 2OBNA 4G09A 4CT4B 5I7AA 2VBIA 1WXIA 2X19A 1QHEA 1CZNA 4FR5A 2A9JA 4O2BF 4JL6A 4F92B 1ZBDA 1WCWA 3UW1A 9ATCA 2I91A 2Z3ZA 2ZTUA 4HDKA 3KB8A 4FWBA 1WMDA 3ASUA 4NWIA 4JZKA 5EJFA 3DFUA 2R84A 1VKRA 3KP1A 4O4HF 1U7TA 1WMSA 4DCTA 1Z7EA 4ZCIA 4CIVA 5E2BA 4RW0A 2VHZA 1KJ8A 4TMKA 5G4KB 4HS4A 3V80A 4Q4JA 1GVHA 4F06A 1CUWA 1EWYA 4ANFA 4WE3A 1VMKA 3BMXA 4U4AA 4L7QA 1VCMA 4JSYA 4PO9A 3GFFA 5E9WA 4MJXA 1WVGA 2CB0A 1E59A 1PZXA 2PMKA 3DZHA 4BLRA 4KLZA 2WW8A 1BFUA 3AUXA 1O54A 4C6HA 3KT0A 1J90A 3RYFA 4EF5A 2XJ9A 2J3HA 5M5BA 2QV7A 1U3GA 4E1BA 4LVUA 1U7XA 3K30A 4BU0A 3NNDA 1DL5A 2AOUA 3COYA 1NF9A 3WGOA 5BWBA 3TZBA 5K2OA 3P27A 4ZXFA 5HIJA 1KC1A 2NW6A 1JHMA 1NF2A 1YAJA 3HNOA 1M8KA 4ZT5A 3RTEA 3HJFA 1ZJ4A 4KNYA 3JASB 1JPJA 5JCZA 4CEHB 2JFNA 2VJYA 4B4UA 3PL1A 1UMDB 3ZDZB 1GGHA 1ZJ5A 2WWWA 1I2MA 4YROA 4D81A 4XRGA 1FUYB 1OBCA 3UTDA 1ARZA 1T4CB 3ELDA 1ORRA 1TZBA 5EFOA 3UWDA 5ALEA 4BRWA 1ULUA 4CKEA 4LF8B 3SS7X 3OSZA 2QGNA 1Q1BA 1TM3E 1ZSNA 3F4BA 2NO1A 5EQFA 4P7GA 4YPOA 3KFXA 4XDZA 1FTQA 4AF7A 4LTMA 4Y1GA 1E1RD 4X9XA 3N2NA 3Q72A 2XHEA 5KNLA 2IVZA 3QVMA 1XTSA 1RM5A 1F9AA 3QXGA 3H2HA 3FIUA 5BYKA 1HTWA 1A3CA 1USGA 3FGZA 3AL0C 1FXUA 2I34A 3EOBI 1NF8A 1QGAA 1KAMA 2BFFB 1A9ZA 3NKVA 2ACEA 4O4HA 3VU1A 2QL9A 4EYQA 1EDOA 1KI9A 2I0FA 2OHJA 3F8WA 1L5HB 2G72A 3TRHA 1AKUA 3Q11A 3OCXA 3WA6A 1E9EA 1UBJS 5LQMA 1FYFA 1XOIA 2JFHA 5DI9A 1RXVA 3VBEA 2HB6A 1XLVA 2MSWA 4J75A 4Q1FA 3HRIA 1MQAA 3ASYA 1NXTA 4PO8A 1MH1A 2VDOB 4M0PA 5JFOA 1KAOA 4NFLA 1NR5A 3FYUA 1QUEA 2QF7A 3NM5A 1BH6A 4FT2A 4HOYA 3A8TA 3C3CA 1GDHA 4YJFA 2B92A 5LUAA 4YAUA 3GT4A 1GAXA 3ZIUA 3GRKA 5D5PA 4TWJA 3MWEA 3TSYA 1R6UA 3PHHA 4BEBA 5A62A 3BT7A 2ZE8A 4LRXA 3VR6D 4L28A 1T9DA 3HHEA 4GPD1 1VPVA 4A6PA 3B1JA 4C4ZA 4YAIA 1UR5A 1L5RA 2NQ8A 3KBBA 4V3CA 1EXDA 2CW5A 3A06A 4LMAA 1VI6A 4JZYA 2W0SA 4M8NE 3KYCB 3P4YA 3WBKA 4C76A 3TIIA 1Z63A 2W8ZA 1ZCJA 1K88A 2Q62A 3KAQA 3RKRA 5FIUA 1E1YA 2BKAA 1M2JA 3E5RA 4U7FA 4GQBA 1P75A 3O38A 1HC7A 3EC2A 3RCBA 2B9EA 3HSKA 3NXKA 1IMOA 3SZLA 3ZHTA 4INOA 5I5EA 3HR4A 3PEWA 4M0MA 2OBXA 3QWIA 5B3KA 5T41A 2F67A 2V1XA 5B7QA 4ALJA 2ZG6A 1YJ8A 3E9CA 4OM7A 1L5WA 3TLJA 1FYEA 1K7XB 1RQXA 5JRJA 4OMUA 2WTUA 4TV9B 4WBXC 2GYUA 3FPFA 1CZLA 4E3ZA 4XR4A 2VHJA 4OFWA 2Q6LA 5MF6A 1YTUA 4RV4A 3B1ZA 3AIOA 5HM8A 1UDWA 5JZBA 1YI0A 2Y6UA 3OM9A 2OFFA 5JALA 2LNDA 2UV8A 1YUMA 4A0SA 1GILA 1VA4A 2OK8A 4CG0A 5ALHA 4HXGA 4QOEA 2P40A 1N9GB 4JP1A 3DBRA 1AURA 3GI1A 3RSSA 3KAJA 2IXGA 1BVRA 2ZIFA 4KITB 3E48A 3RTCA 2QRPA 4CMBA 2FR1A 2PR2A 2W9XA 3STXA 1O7JA 2GI4A 2OXTA 4LJSA 4RWZA 4X6XA 4DMLA 3KLNA 2IF2A 4MVJH 2ATVA 4BKRA 9ABPA 3UPUA 2HBZA 2OHFA 2LD4A 2XGOA 4HDOB 4ENRA 5AXAA 1JE1A 4NENA 2HDOA 3G2KA 2VP9A 3AY0A 4X95A 3T34A 4EO9A 4LBZA 2HRRA 2B5OA 3HV0A 1UXJA 2P6OA 3U7JA 4Q93A 1L4BA 2BHRA 4Q02A 2GAJA 4KPEC 3RFVA 3OOYA 4KSYA 5DNUA 1IXZA 3K9BA 3QU7A 4Z8XA 3OMLA 3R9WA 2WP8J 1QIHA 4CNBA 2PUFA 4EPWA 3K5IA 5I45A 1UZUA 1Q0RA 2FPUA 1J2JA 4TSFD 1IUOA 4XIJA 4E5UA 1FTGA 4UMVA 4BQQA 1L7DA 1KNXA 2AEJA 3EF3A 4IFIA 5LC1A 2O8CA 1SQGA 4JQYA 1F2VA 1D7AA 2JFGA 2HY7A 3OOHA 4L9AA 4PQGA 4TTQA 3VR4A 4MI6A 4F8JA 2IBTA 1Q83A 1K7FB 1IWOA 4MK4A 4NMMA 1Z6ZA 3EVNA 1CQWA 2NTVA 3AF4A 2RONA 1UJCA 4LJKA 1YJCA 2ROQA 3D8TA 4DLUA 4EG1A 5LYJB 1YVEI 2BKLA 3A9TA 4BCCA 4AZ3B 2YJ4A 4HH3C 4ER7A 2X4LA 4CM8A 3T5BA 3GJ8A 1U2SA 5AM2A 1B0ZA 3TEJA 2XE4A 2GXQA 2B9VA 3AF5A 3EVEA 3MLEA 4I6JA 4TV8A 3DOHA 1P0FA 5C3UA 1N78A 1V7PC 3REQB 4Q3OA 1Z5UA 4RE5A 3LPMA 1Y0BA 2IY9A 4I1UA 4MW1A 4BVJA 1JHDA 1FYDA 2WA2A 1ISFA 3E2MA 2GCEA 1NW4A 2OG1A 1EJ6A 2IYFA 4YONB 2CNWA 5DGDA 2D74A 3P0FA 5G1NA 2HSGA 3OEEA 4C03A 4KDRA 4RGYA 5L4SA 1YC2A 2Y9PB 3BE4A 1IXYA 1QRRA 4R71A 2QRZA 1H0KA 2HCRA 2B5VA 2QEQA 2OG2A 1ZP6A 2Z2IA 3QUCA 4QHSA 1HR0B 2CF5A 2HA4A 1IEXA 2OAP1 4I6GA 1TJ3A 4GAEA 4YP7A 3CTMA 4D0RA 4W5QA 1BG6A 1HKUA 1T2NA 2HSWA 2WTMA 3PFCA 4PHHA 2ZETA 3LPCA 1T1SA 3IAM6 3L7JA 4L15A 4YX9A 4OYYA 2V7UA 3VSAA 3BE8A 3LLCA 2F8LA 2W98A 4Z0TA 3MXOA 4PR3A 2V97A 1NQ5A 3D0RA 5JATA 3FTNA 4PPFA 2O5VA 1ZJYA 1I3CA 2B8WA 1C4WA 3RUDA 2ILTA 1D04A 1M5UA 1XRQA 3GGSA 4ND8A 4WNAB 4DIUA 4DLTA 4LZNA 1E20A 4PC2A 2EJBA 1NFRA 1PGPA 3MWGA 1I4OA 3CO5A 4UQOA 4CGYA 3WRWA 4S0ZA 4OAPA 4PQYA 1O6BA 1PDVA 4LK2A 4UDXX 5CPFA 1KY4A 2AG1A 5GV8A 4P3KA 5TQ2B 3I3SR 4WESB 3ZHZA 3AERA 5AJXA 1IXKA 2V7XA 5HEKA 3NXSA 2A1UA 2G8LA 1H9CA 1G2IA 1WD5A 1T2EA 2VCEA 2VHUA 5JLAA 3DGFC 1UBHS 2R6FA 4D3SA 2Y1LA 1UJMA 1LS6A 3VXKA 3THXA 1H23A 5DBEX 1AKQA 1UFOA 3C85A 1OX5A 1YK0A 3B89A 4RPJA 2VQSA 4PBTA 2P3OA 1P19A 5E9JA 1B43A 1M2WA 2OZLA 4ASUD 4ZTUB 3GP3A 4L9WA 1B6GA 1E9FA 4UNPA 4TLEA 3CNOA 5MHTA 3BSFA 4B3FX 3EY9A 4R6WA 1DHTA 3NEYA 4C4PA 4TWAA 2XUAA 1QKJA 4NCXA 3TIFA 1JS1X 1P1KA 2X2PA 3FCAA 3H11A 4GP7A 3UT0A 1MEOA 1JNYA 4U7WA 4B7ZA 1T4DA 3KDPA 4EFNA 5EJ9A 3A14A 4MA4A 2R2AA 4IHAA 2NUPB 2R47A 3B2NA 3JSAA 1GLNA 1BFKA 3HGQA 1B0UA 1IQ0A 2WSIA 4XD7D 5IN5A 4U2DA 5JV5A 2Y0EA 1DPFA 3WMEA 1QQBA 3PXBA 4FYIA 3WNQA 4XUCA 4YCSA 2QUZA 3JQAA 3K6JA 5LQDA 3OFSA 4R51A 2P30A 4BQOA 4Q4AB 3ZNQA 1K6EA 4OMFG 1EDEA 4XM0A 1Q57A 1U5BA 2LDBA 1PYOA 3DWFA 1B7GO 2VPQA 2G5PA 2P9FA 3R5JA 4Y1FA 5LA6F 1TAUA 1SVIA 4UNQA 1D4FA 4OF4A 4WCFC 2NO4A 2C95A 3TK1A 4RJIA 1G6KA 1XQWA 4LZLA 4WOJA 2GF2A 1TQHA 2G0NA 2FDCA 1T91A 3BSYA 2H3EA 2X2FA 2PFKA 4JOCA 3H84A 1E63A 4K81B 4YO8A 4YMIA 1SXQA 3FPJA 4Z54A 2YWRA 3EWIA 4HVAA 2GILA 4PY2A 2XIQA 1NVFA 3ONWA 4UFNA 1HMYA 2GCGA 1X8LA 4X62B 4ZODA 4UE6A 2NQTA 2CF6A 3ANSA 4WCFB 4I9HA 5IJ0A 1XMJA 2VJKA 4ZCLA 4WERA 1JHXA 3BCUA 3N59A 3X2FA 2FUCA 1OGYA 3F6RA 3LGSA 5E6SB 3ZCUA 1EG7A 4MA5A 3QKUA 3I5AA 1XJ5A 4NK5A 2Q5EA 2FQYA 1A5ZA 1X7YA 3RYCB 2BFCB 1DAIA 3AB8A 4MIEA 5JLJA 4CZ2A 3PA6A 3BA6A 4I1VA 4L22A 3VZPA 4F86A 2M6KA 5CB6A 4MKRA 3S28A 1VKJA 4TQUS 4NCKA 2VH2A 1ISRA 1V3QE 1WKCA 3AUJB 4YA6A 5AJYA 3T7AA 4HWRA 3TS1A 3WNVA 1QVRA 1Y8RB 4B31A 4GOKA 4HYTA 1IJKA 3FA2A 1UADA 4C05A 1VG9B 2D2VA 4IXWA 4Y6PA 5TPZD 4DGSA 1UBUS 4O5AA 3UNXA 2QPLA 2J07A 5P8WA 3WMGA 2QDKA 3JYOA 2QUIA 4H0CA 1UK8A 5AI8A 3WGKA 4BP1A 4BUJA 1M6HA 1IRXA 4BFSA 5BW4A 3CN9A 3R40A 5LA6A 4QUIA 3DPIA 4ENSA 3Q7TA 1TZKA 4LXTA 2IKQA 5JFGA 1I3MA 2BN4A 3GJSA 2IWRA 2GN1A 1C8VB 1B0PA 3C8ZA 1H2XA 2L19A 2FAXA 3LX6A 3ORFA 1F5SA 2QD2A 4TS3A 4URXR 3AEQB 4Y0AA 1PT9A 4QYWA 4RQUA 1IPFA 1RRGA 1EGVB 4YV0A 5F73A 3KTAB 4LHWA 1E3IA 3D4PA 5IZ4A 4K5QA 1ESCA 2OKGA 2X8AA 5HCUA 5ARBA 4G5XA 2PMFA 2PGDA 2V9ZA 2G80A 4O4JA 1AF4A 4TTVA 1MX1A 3HBJA 1G60A 1KP3A 4E14A 1UJNA 5HRAA 4U5QA 4Z3OA 4YRTA 2ET6A 1C8BA 2WSBA 3N2KA 5DB4A 4R1UA 5A06A 5ALPA 3HCEA 3TLXA 3AKDA 2FG5A 2PMEA 1T4BA 3RGGA 1PUJA 2YMLA 2GF9A 5KHAA 2UYHA 2ZULA 2FF7A 3L7AA 1AXGA 2YCLA 4H4DA 1THGA 3DBIA 4NABA 1TVKA 4PYLA 2D8MA 5E2IA 1NKVA 4M55A 3O21A 4RL6A 1FDRA 1RBMA 2IUFA 3L6UA 5DNAA 2DFPA 1OGJA 1UBGA 4IDOA 1T9GR 4J16A 5DLPA 3WY9A 4EJ2A 1PNQA 3P8ZA 5B55A 4IKPA 2I4OA 4PR0A 1N5IA 2CL5A 3DDOA 3A04A 5HKKA 4V0MA 1I3OA 3QK7A 3PTZA 1EP3B 4UNSA 1X19A 5EIBC 2O1XA 4QDTA 1M1YB 3KPVA 3TL3A 1GG9A 4B33A 1GM5A 1UEJA 5A02A 2B8TA 3USCS 2F4VB 2P2CA 3M3PA 2BTQA 1NJ1A 1GXSA 3G2LA 3NAGA 3QNMA 4YGYA 3LDFA 5EMJA 3BS4A 1Z74A 2I1VB 1FSZA 1US8B 3OZCA 4EHLA 3WGVA 5JO9A 4QARA 5JXWA 4XYEA 1MIHA 1U7OA 3OWHA 1CVLA 4M1SA 4NQRA 1U2PA 4DV5B 1QHGA 3ZR4B 1X0XA 3UGQA 3ZTYA 2A0KA 2PX5A 2GD6A 3F5QA 4JITA 5J59A 4J0IA 1GRCA 1Z56C 5BR4A 1Y6QA 4X1YA 4KXXA 4NV0A 3ZYCA 3A27A 3NYQA 1ZHHA 4BTEA 2BCEA 3IUJA 4DDHA 4NMWA 1U0LA 5KWSA 1YU9A 2QTMA 3EGDB 3L4EA 4HR7A 1JAHA 4EP1A 2P2DA 2JB9A 3CVUA 4OHUA 4DCCA 1IN8A 3BL5A 1KETA 2JAQA 3K6SA 1NZJA 2C4NA 3ZWDA 4UU8A 1JKFA 1TRKA 2UZ1B 4ZO9A 4GMGA 3CNLA 4M0KA 1CSEE 3C6KA 2R6HA 3EMKA 2C2BA 2R8BA 3JWHA 4EO7A 1NAIA 2EZ4A 3ETJA 1ZK4A 3D6AA 3CU5A 4WZBE 3EG9B 2FPIB 1HPLA 4ILEA 5FHQA 2GDZA 4POAA 5J2TF 5KKNB 3L8GA 1GNLA 2ORYA 3VNSA 4BNUA 4ZQGA 3JQFA 3AV0B 4YP9A 1RHMA 3QU2A 7ADHA 1KVRA 2GTIA 4Q7JB 2HIHA 3M6MD 3X1KA 3VJRA 1EHCA 2YRFA 4B8YA 1DELA 4BVBA 3AI1A 4MV4A 4DM4A 2I67A 2XYQA 2DPXA 1F20A 1CR4A 3AKCA 3MWLA 4CMIA 1R4NA 4G0YA 3UB3A 3HMQA 2QRQA 4AURA 2JW5A 4M4SA 3MMSA 1U8TA 4HAVA 4DWJA 4UCWA 4BVAA 1JR3D 5DXJA 4RKYA 1PNTA 2ZJ5A 2W6IA 4L85A 4ZZ2A 3DUFB 1G21A 3RVRA 1HFJA 3USZA 3C3MA 1E0SA 2JZCA 2XAAA 3D3QA 4NV3A 1OWPA 2QZPA 3JXEA 4XVQA 1DUSA 1G1AA 4BNMA 3LLSA 3ADCA 4Q9LA 4UU1A 2FNAA 4UUNA 3DNMA 3DAGA 2PA3A 2JAOA 3JVEA 2V6FA 3G0BA 2JCGA 4F85A 1AB5A 3I9MA 3TL2A 5TQJA 2C7VA 5ADVA 1JIIA 1M6VB 4IDBA 5A2QA 1EBFA 3BRCA 3PNMA 3QEMA 4FMDB 4GVLA 4EB0A 1WW2A 3DO6A 3TLCA 4X65B 3KYDA 4IW3B 4K9OA 4NBSA 4BVHA 3NW9A 1NW6A 1I2CA 5HILA 2EX4A 5J40A 1IUPA 4WEOA 3WLNA 2LV8A 4QOGA 1M34B 1J1ZA 4PPGA 4HGNA 2EEZA 2LVBA 2WHRA 2C58A 3FH0A 2OT3B 2FSPA 6REQA 3SZGA 1QU2A 4LI3X 4ZAGA 4Q3KA 3VBCA 3S55A 1PJQA 3FR7A 3ZS9A 3KQKA 5ITZB 4Z9AA 3NWOA 3RHFA 2ZI6A 3JD0A 3P5BA 1H42A 2ZYGA 4IQ4A 4NQZA 2H4ZA 5J2TA 4YMHA 1PFVA 3F6BX 5AMXA 3RBAA 2WT4A 4G63A 4N5IX 3Q1LA 1EX9A 1I01A 2XA9A 1IZ9A 2P9HA 2ISCA 5FCDA 1ZNXA 3RABA 4RFVA 3AKZA 4KB5A 3L92A 5HQ3A 4JP3A 4LNUB 2WLSA 4RA9B 2ZZMA 2PU5A 3F9IA 1JHUA 2HRCA 5AESA 1A5AB 3LSYA 3AYXB 3E9ZA 5G3YA 4NARA 3NTQA 1CYEA 4YH1A 3FNEA 4EI7A 2PWAA 3NVMB 4J7CA 1FP4A 2OSBA 5CXXA 2Z0MA 4PSAA 3IOBA 4W4TA 1S2IA 1P0CA 1TYZA 3FNFA 4ABTA 4N76A 1EXMA 1MC8A 2OQRA 3DC7A 4PWZA 1OFUA 5BVGA 2RC5A 1EUDA 3M6FA 3RRXA 2R5FA 3IPAA 1ADJA 4LBWA 1OH7A 4W1PA 4BMCA 2AN9A 4G25A 3SEAA 2YC4C 2JLUA 2J87A 2QENA 2XMCA 4ATNA 5EIBD 4HGRA 4D4KA 4EJMA 3CMCO 2DR2A 1M6NA 3PNQA 3NBZC 1I1HA 3BVPA 1BE0A 2Y1XA 3DSRA 4CUKA 5JARA 2E1PA 3S44A 2J09A 3F0TA 5IT4A 1UFKA 3MEQA 3IXMA 4BB9A 1WAMA 1AT1A 3QENA 3KOMA 2ST1A 3DKKA 4J0HA 4RANA 5CU7A 5T4BA 3V6LA 2IC5A 5AOAA 4O29A 4BVGA 4AKIA 3AR2A 4H77A 4DCOA 1JXOA 1I14A 4JYZA 3KSDO 1VE6A 1RTTA 2H59A 2JFPA 3OT5A 4INPA 1OLSA 1WB9A 2I6SA 1G8SA 2P2YA 5HIKA 1M1UA 1SKBA 4EJ0A 2OQ2A 1M7HA 2MYTA 1FX0B 3PICA 4TS9A 3M6WA 5TC4A 2J6IA 2WKRA 4H7HA 4Z9FA 2VJMB 3KOUA 2NXWA 4B3DA 2RGNA 4IO0A 3ZCTA 1FYVA 4C2TA 2PGLA 4UXJA 1Q50A 5FLKA 1Z4LA 1A0OA 1ODLA 4LDQA 4ZVLA 1FFDA 2OHIA 4WZZA 3S0JA 2QUJA 4E09A 2RGDA 5AQ1A 3VGJA 1KJJA 3FYCA 3O90A 1ZGJA 4IYJA 3QLVA 3SK0A 2QL7A 2XOEA 5JYBA 1A5SB 5AXCA 1F7VA 4R3NA 1IWPB 3NHAA 1N4AA 3ZWXA 2NO0A 3FD8A 2BR3A 3BWCA 2CV2A 4LF4B 3EODA 5IX8A 3IILA 3QVOA 5AUPB 2CDRA 2P9GA 1IPHA 5D3ZA 3MCTA 1M0SA 4C4RA 2XDAA 1CY6A 3HU2A 4TKVB 1K8RA 3GA0A 3HFSA 4IHJF 4W5JA 4X20A 4Y2QA 4DYHA 3K9HA 4AJKA 1QS0B 4F5EA 1F38A 1RTKA 3NGXA 4XW2A 5LSAA 5KNBA 2XRMA 1ZOSA 4HQOA 4HTFB 4QVGA 4W5WA 4YDHB 3PFWO 1U8XX 2QRUA 3GGGA 4M6WA 1P80A 3S2SA 1V1RB 4A27A 2BEUB 2GJ9A 1U3DA 4K2HA 2PRKA 4C04A 3IT3A 3OQIA 1H5NA 5FBHA 2ZI5A 1HE2A 4D9KA 1HG1A 3LP8A 4KO2S 4ZP1A 2H00A 4IMRA 2GK3A 3C97A 1ZY2A 5DNWA 1RRPA 1OFHA 1AGPA 4D4HA 2NXJA 2QMUA 1KZ4A 2GN8A 4B6SA 1JDUA 3D4OA 2ZIZA 1I4WA 5JI2E 1J20A 1L7QA 2HJWA 1XCOA 3KEQA 1YSCA 4L2IB 4S1WA 3ZGZA 1LNZA 3SR3A 2XWJI 3C4JA 2PV7A 4BFYA 2V55B 3DZFA 1CNEA 5AKLA 3LF1A 4FGLA 3TD2A 3C4QA 3PWKA 1NJ8A 3DZ8A 4MCAA 3WSTA 1D6JA 3IQIX 4I5GA 3ZCRA 4JFAA 1Z6XA 1G20A 3HV2A 2CL6X 5AHXA 2XTMA 1MO5A 2OAEA 1R0KA 1CR1A 1VHDA 1R8SA 2B3TA 3C5HA 3QFSA 4HKTA 4I2VA 5DGXA 1NG9A 1R64A 6YASA 3ROKA 3U4QA 1O96A 2VK4A 1CT9A 3V7NA 4PZ9A 5T8KA 2IUYA 2FPRA 2VYVD 2Y0PA 4MLZA 4U5XA 2BGNA 4W1SA 1J1UA 1N2CE 4U2BA 1VPWA 2SKEA 1U3UA 3IH5A 5DM70 3RWMB 3BX1A 1YQWA 1GFWA 4IHJA 3LCUA 2OD7A 5C1PA 4EF6A 1YWGO 5IDYA 2NUAA 2RHBA 1M2OB 1TT7A 1XQ1A 4B46A 5I9SA 5IHXA 1PV2A 3IDZA 1M2GA 4NTZA 1I0ZA 4HZIA 3MAGA 4XQ9A 1KOGA 3P9IA 3OAAD 1JJFA 1KVSA 4OXNA 4XQGA 3W5SA 3QA9A 8OHMA 5J43A 5BR7A 4H08A 1BWQA 3GR6A 4PPNA 1G2QA 3A11A 3TIGA 5E4YA 3I9OA 3JQ9C 2FCRA 4ZREA 3QP9A 3QJYA 4UVHA 2KB0A 3UN1A 4XSHA 3W6NA 3M3DA 1TAQA 1BHO1 3BSWA 5SZIA 4CDGA 2CVPA 5DM0A 4GZMA 2NU6A 2XWBF 3QFRA 4NATA 4OA5A 4QYSA 3UJ7A 3W2TA 5FWYA 1T6ZA 5KKAA 2GD0A 1FJHA 4CI0B 4KBYA 1HNWB 1GSOA 5BN5A 4C2AA 3FVTA 3FZGA 3DULA 3N53A 4Q4DA 3RASA 3K05A 5LM3A 4TMYA 2NWQA 3I9LA 5A5DA 2JA1A 3E58A 2DLCX 1T6BY 2FN8A 1QH8A 2R6JA 3M33A 2UYCA 5HXAA 2YHUA 2Q1SA 1W5EA 3GCZA 4HHEA 3QWAA 4IIJB 1F1JA 1A8UA 2HMVA 4HLDA 4CF4A 4C5CA 2N46A 1A2QA 1J25A 3P9ZA 1KJNA 2PX4A 3T1HB 1X1RA 3ZZMA 1QGUB 4B34A 2FPOA 5HZGA 3GVXA 1E2QA 2J0VA 3T7DA 1NF3A 4MV1A 3TTUA 4BYMA 1B8UA 1R0BA 1WULS 2YMMA 2ZJYA 1NOJA 4PN3A 4TTPA 1V11B 1Z18A 4MHSA 3TAUA 3TDMA 3U44B 4P53A 1KI3A 1G3IA 1WOYA 4LWOA 3MWKA 4LYFA 4CLXA 4MUGA 4PGGA 1Q7GA 4B0PA 2IEAA 1OLOA 1W76A 3KFLA 2OCKA 2MINB 2SNIE 4YFVA 1Z5NA 1IDN1 3C15C 1S4QA 1SKYE 4I50B 2BMJA 1MA3A 1MEEA 5F3DA 4AUNA 3PU6A 1Y4DE 1KDVA 2BHTA 3BRQA 4RD0A 1C7ZA 3EZ7A 5EIHA 3ULKA 1U3FA 3ZJ4A 2V65A 4X66B 3ECAA 4JJGA 3ZWOA 4EPVA 1WXWA 2UYOA 2BFBB 3VHLB 1KARA 1YFLA 2Q28A 4DLZA 4NCIA 1YCGA 2A9KA 3QLTA 4N49A 1RVV1 1RAGA 3I53A