3R4VA

Structure of the phage tubulin phuz-gdp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
314
structure length
311
Chain Sequence
b'PVKVCLIFAGGTGMNVATKLVDLGEAVHCFDTCDKNVVDVHRSVNVTLTKGTRGNRKVILPLVRPQIPALMDTIPEADFYIVCYSLGGGSGSVLGPLITGQLADRKASFVSFVVGAMESTDNLGNDIDTMKTLEAIAVNKHLPIVVNYVPNTQGRSYESINDEIAEKIRKVVLLVNQNHGRLDVHDVANWVRFTDKHNYLIPQVCELHIETTRKDAENVPEAISQLSLYLDPSKEVAFGTPIYRKVGIMKVDDLDVTDDQIHFVINSVGVVEIMKTITDSKLEMTRQQSKFTQRNPIIDADDNVDEDGMVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title A phage tubulin assembles dynamic filaments by an atypical mechanism to center viral DNA within the host cell.
pubmed doi rcsb
molecule tags Unknown function
total genus 109
structure length 311
sequence length 314
ec nomenclature
pdb deposition date 2011-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3r4vA01
4X1KB 3JATB 5GONA 3RYFB 5EYPA 4O4JB 5JH7A 1Z5WA 2XKBA 1RQ2A 4O4IB 4B45A 5EZYA 3VO9A 3WGKA 1JFFB 4LNUB 5LP6A 3HKDA 4EB6A 4HNAB 3JASB 4U3JA 5CA0B 3JAKA 5BMVB 3RYIA 1TUBB 2VAWA 3HKEB 5FNVB 3V3TA 5JCOC 5LXTB 2R751 4YJ2A 5MN4A 3JAWA 3VO8A 4DXDA 3N2GB 4ZHQA 3JARB 5KX5B 2Q1YA 4O4IA 5JVDB 4X1YA 3VPAA 5CA1B 3UT5A 5EIBC 4YJ3B 4HNAA 4O2AB 3E22A 3JASA 3HKCB 3RYHB 5CA0A 1W5BA 3M89A 1TUBA 5J2UB 3JALA 3ZBPA 5BMVA 3WGMA 1W5FA 3R4VA 5IJ0A 3RYCB 5M7EA 4IHJA 1TVKB 4I50A 4O4HA 2VAMA 1W5EA 3N2GA 4DRXA 3JARA 5KX5A 2XKAA 4TV9B 3RB8A 5JQGB 4X20B 5C8YB 5CA1A 3N2KB 3VOBA 4E6EA 4IIJB 1FFXB 3HKCA 3RYHA 5LOVA 4X1KA 5LYJB 3JATA 4U39A 5J2UA 3HKBB 3RYFA 3ZIDA 4TV8B 4O4JA 2RHHA 5LP6C 3RYCA 1TVKA 4O2BB 1JFFA 4LNUA 4B46A 4EI9A 3CB2A 4TV9A 5IYZB 2VXYA 4FFBB 4ZI7B 4F6RB 5LA6B 3HKEA 5LXTA 5FNVA 2VAPA 4IIJA 4WBNB 4O4LB 4I4TB 4X1IB 2BTQB 4TV8A 4KWEA 5JVDA 1RQ7A 4O2BA 3WGJA 1SA0B 5LP6B 5ITZB 3WGNA 3HKDB 4YJ3A 4O2AA 4FFBA 5LA6A 5MN6A 4WBNA 2RHJA 4O4LA 1OFUA 1W581 4I4TA 5EIBD 3VOAA 5JCOA 4X1IA 5CB4B 4EI8A 2BTQA 4ZHQB 1RLUA 4EI7A 4TUYB 5KMGB 1W5AA 5JQGA 4X20A 4X1YB 2RHLA 4ZOLB 5C8YA 3ZBQA 1SA0A 3N2KA 4I55B 5IJ9B 5ITZA 3UT5B 1FFXA 3E22B 5LYJA 5J2TB 3HKBA 5GONB 5MN5A 2RHOA 3JALB 5EYPB 2R6R1 5JH7B 4XCQA 5IJ0B 1FSZA 4IHJB 5CB4A 2Q1XA 4I50B 1W59A 4O4HB 5EZYB 4DRXB 4EB6B 4TUYA 5KMGA 3M8KA 5IYZA 2BTOA 4ZOLA 4U3JB 4ZI7A 4F6RA 3JAKB 1Z5VA 4I55A 5IJ9A 3RYIB 4YJ2B 3WGLA 4M8IA 3JAWB 5LOVB 5J2TA
chains in the Genus database with same CATH superfamily
1J8YF 3PB3A 4ZIRB 2A5DA 3KL4A 3AERA 5JAZA 5K3OA 4L9SA 3DOFA 4L6IA 1X7WA 1TU4A 1KH3A 1PLLA 1XR3A 5HMMA 4D57A 4ZI2A 3W0LB 3O74A 1NUPA 4COOA 2GCOB 4LNUB 4K03A 1DPGA 5EHIA 4JBHA 3IEPA 3E3AA 3EXHB 2H31A 1KO4A 5HA5A 4ZZ0A 3ZS8A 1U1GA 1ZUIA 1A2KC 4MV5A 1KH2A 3S68A 4MR7A 2SNIE 3ECAA 4KJZA 1JMYA 4QFDA 3T7RA 1BS9A 4RQAA 3F1LA 4Q82A 1M2NA 2RSLA 1VBFA 2YV3A 3JWPA 5AW5A 2WE8A 1M7GA 4MP3A 5D86A 4IV8A 3THOA 4BO8A 4LXHA 2E82A 5CW1A 2WJZB 1FRFS 4NYMQ 1X38A 1JAYA 4O08A 3AEZA 4YEDA 4TSKA 3R75A 5B3JA 3PGXA 5CA1F 3H6KA 1F9AA 4KYIB 4MS3B 2IZ5A 1SVOA 2ZETA 3A7EA 4LWQA 5IHPA 1JDVA 2B0CA 2QVYX 1WM1A 1ID8A 2WIBA 2MIIA 5EQJB 4ACAA 2Q1WA 3LC1O 4ITUA 2DHRA 3HB1A 4JJIA 4Y9TA 1V5EA 1W2WB 2BEUA 2G0NA 1OYOA 2EGGA 3LKDA 4BBZA 4NRDA 5A4MS 4JXZA 3KDPA 4LFBB 3B53X 2XXAB 4QTXA 2H4FA 3LDHA 3P7MA 5H80A 1OYWA 1HQYE 1Q57A 2AJLI 4MOWA 5FV7A 2DKNA 2QG9A 1G6HA 3QVMA 5CM2Z 5HDBB 2YXDA 4AKIA 3KQOA 2CJYA 5IAGA 3A36A 1Z39A 1E79A 2Q2NA 4PC3A 1C7ZA 2OM6A 3GRUA 5GM1A 3ZTTA 4UBMA 1Q16A 3NBZC 1PCXA 4RF3A 5EPOA 3QFFA 1A8PA 3FBTA 3VR4A 1YRBA 2D06A 4JI5B 3UUEA 1D6MA 3L41A 3EVZA 2I6GA 2FZ4A 2XWQA 5ARDA 1ABFA 1OKKA 3PC4A 1AKTA 1A8HA 2PPLA 5EPUA 4JC4A 1NQAO 1M0SA 1QH9A 1Z6TA 1YGPA 3ZHYA 5DN6D 3IMEA 1Z62A 1WW3A 1Q3TA 2G6TA 2Q0HA 1MJ5A 1IUKA 2DT5A 3EGEA 3F74A 3HE3A 4HVTA 3WWZA 4EL0A 1JB9A 4H6WA 1N6KA 3PJRA 2QZZA 2Q1UA 1LC3A 3TDMA 5ALZA 1J00A 4JJFA 2XUOA 4HS4A 1YF3A 1ZUWA 1H9BA 1FNNA 4FDLA 4X1IA 1JS1X 2XNDD 4CWAA 1IUPA 3UPTA 1ODCA 4PSKA 4YP5A 1M1NA 3L92A 2C58A 1Z5ZA 4G3XA 4IIVA 3SYKA 4AM8A 3O8DA 2J8ZA 3GRRA 1VA4A 1C4OA 3DF9A 1JXQA 2LCIA 3NH9A 4Z49A 4FGZA 4QDUA 2FN9A 2ZYUX 3NPAA 2P9GA 4WECA 4QUAA 2ILVA 2RG1A 1O4WA 1NN5A 2OC4A 3EODA 2A14A 5LYJA 4UVIA 1BH2A 2XUGA 3QTLA 3QIVA 1MO2A 5L6MB 4MDYA 4IVQA 5KIAA 4IY1A 1MO6A 1T9ZA 3KU4A 5HM6A 1RE1A 3EXHC 1KI8A 5CJ2A 5EE0A 1XLTA 3KEMA 5ECDA 1VBKA 3W5DA 1ONBA 1F8YA 2ZI6A 3A4NA 2C4WA 3KHUA 4OHRA 1KDVA 3L4BA 4Q47A 2IX3A 3QA3E 4FYVA 2WR8A 3QWBA 2AS0A 1XAHA 4I3GA 1U65A 4IUDS 3ZJUA 3BZWA 3WQQA 3HZOA 1XZGA 1TPZA 1NC1A 2QRMA 5LC1A 1G64A 2VF4X 1II9A 3AH8A 4DTIA 5FWNA 4KIJA 3HQ4O 4A8JB 4CL0A 5KSPA 1VJ0A 1YZ3A 1Z82A 3KNZA 2VDMB 3DH0A 3T4PA 3HDYA 2ADFA 4PN7A 4EL5A 1E0DA 1HO3A 2ZTUA 1ULAA 3UPDA 4QFMA 2OSBA 3DOIA 4MUGA 1N2HA 2HXGA 1K4KA 3FNGA 3U4IA 4FLMA 1JA9A 1DSSG 3N8IA 4QVIA 2V54A 2V6FA 4URFA 4BO6A 5TXGA 4PRYA 3L1UA 3IUEA 2IHTA 3IPXA 5I9LA 1L5HB 1T8UA 1H8HA 1WXIA 2QVLA 2P6UA 3R7DA 1T9KA 3Q88A 4DG8A 1AMUA 2IZOA 2C8JA 4MS1A 1NE7A 3C7TA 4RA6A 3ELWA 4NKRA 3OSUA 1KPHA 1XEAA 4A8TA 4LTMA 4GR4A 5C7IO 1E0KA 1LPNA 1CNMA 1GPNA 3HJCA 4JENA 5DX1A 4Z9XA 2H4HA 3LLCA 2IYUA 4IYRA 3C3XA 3KRTA 5EERA 4OVKA 4ZXFA 3ZCXA 3LRXA 4M76B 3KLOA 4IS3A 4EJSA 4MUAA 2IS1A 1S2LA 3PXAA 1RJWA 3EPLA 2GUGA 4YQEA 1W34A 3NBKA 2P2YA 2HN9A 4NV0A 4I08A 3WYEA 1F17A 4YYZA 4JI7B 3O8NA 1O6BA 1NRWA 1VLQA 2OAQ1 3H16A 2G3YA 4UVDA 4PLGA 1SCJA 5L3RA 4YUVA 2OGSA 3IE1A 3RIGA 1XRPA 5AFSA 1X13A 1CZLA 1YQTA 1P5RA 2Q3FA 4JLPA 1KE2A 3FKQA 2QYTA 1M2EA 3OZXA 2PGAA 3GI1A 4FFBB 4IXMA 4AZ3B 4CF3A 3PE3A 4J0CA 5HF5A 4HLQB 1RPNA 4V0LA 3S44A 1R0RE 3DFKA 4GEGA 2EW1A 2IHNA 5HRAA 3OTHA 4KZPA 4WK6A 3AR9A 2G9QA 2Y0PA 2XD9A 4DS3A 1X3LA 5L45A 4J7XA 1P1HA 1L9KA 1JAIA 3PKJA 1Y8RB 3VHQA 3PJFA 2GFIA 2I6FA 3OCWA 4NMLA 3VR3A 1MC4A 3K6JA 5L3SA 1KMHB 2XY4A 2ZBUA 3VV3A 1H2RS 2PBZA 1IDN1 4WUVA 3LU1A 4A0SA 3MIIA 1E5XA 4I4TA 2BKVA 3GRFA 1E8MA 1IOWA 1U2ZA 1KIFA 3GFVA 3QV2A 3WIUA 3K6KA 1EZ4A 5KHLB 3VR5H 4Z3OA 3L2OB 3IO5A 4KODA 1AV7A 1DTWB 1E1NA 2QN1A 4C2BA 1OXBB 4GR9A 2FW7A 4P58A 4G09A 4GWLA 4UZFA 1ZGZA 1JJVA 3CKMA 3JZAA 2I4OA 4N7JA 4S1OA 4X0EA 3RCBA 2P9FA 1HLPA 1K3TA 2NSHA 4J4TA 3FYDA 1JEYB 3AUJB 3JQAB 3I6BA 5F52A 3PQFA 2I9KA 4S1PA 4A8JC 2YRXA 3AF4A 1EJ0A 1XZ8A 4LJ4A 4Y1RB 5B4VA 5L8VA 2ODQA 2OXEA 3D6JA 1YMQA 4O8CA 1MG5A 1Y8QB 3F2IA 4XWAA 5CB4A 4OQEA 4IVRA 4GXQA 3LIPA 4YY3B 3VKUA 2ODBA 4MI3A 3A2MA 2GA9A 2CEAA 3NRBA 2VFAA 1YBVA 4G8JA 4OEHA 4PG5A 3QEAZ 1BFDA 2QY6A 4UPVA 1T8RA 1NR1A 2G83A 2IOYA 3JQ8B 1RI5A 1I10A 3E27A 4W7IA 4UVHA 3QYJA 3LP5A 3K3PA 4FOPA 3T1TA 2WKPA 2NUPA 3ZV3A 3BDAA 3K15A 2IU6A 1WAMA 1D04A 5GJWC 4BE4A 5JNVA 3U0BA 2RHBA 3AFMA 1RIIA 2UXBB 3QBVA 5A4KA 4MB0A 3IUJA 3F5QA 2B21A 2RK3A 2Y1WA 3G23A 1JDPA 1P29A 4N47A 3SZGA 1A9TA 4I5GA 3DV2A 1BX3A 4BMCA 1JFLA 4RL4A 4UMVA 1PYDA 4IH4A 5LDDC 2WVGA 1QRTA 2FK7A 4JEMA 5C18A 1DINA 1LXCA 5AXAA 1RAFA 4LY9A 4N9QA 3WJAA 1GZVA 1U0OC 3IJRA 2B8NA 4O4IA 3IB3A 4CIWA 1KEUA 2YXBA 3MB5A 1YJXA 3K5HA 3UT5A 4DJAA 5AT1A 2ZANA 1ZN7A 2AUNA 3G79A 3IB6A 1QOQB 2JI6A 1PEYA 2VOEA 2XRYA 5CP8A 1NGSA 2IW1A 5JFTA 3BULA 3HM9A 2AW5A 2O4CA 4YNBA 2ZJ0A 3QKSA 1DO0A 4GW3A 4E5KA 5KNDH 3GPIA 5KAMA 1HC7A 4B8YA 3RWMB 5K4GA 3K0KA 3KG2A 3PHCA 1F6BA 4QEDA 3FNIA 4LOJA 3OA0A 2XKAA 3GR6A 3MCWA 4L85A 4WXPA 3RB8A 2FE4A 4S2UA 4DAOA 4B43A 2CLOB 2G7MC 1EVZA 5GOTA 1UEIA 4C2AA 3Q9NA 1DAHA 3HC7A 3HXQA 1JEJA 4XYEA 1DKPA 1N1EA 3L93A 4RXMA 4E4TA 2AOVA 4YXWA 4AKHA 5G1PA 1HDRA 5JDCC 3UK1A 2APJA 3KELA 3D1VA 3GMSA 5BSKA 3CO5A 3VU0A 2QT0A 1ZESA 1M2WA 2XE7A 2YBEA 1V47A 1WDTA 1U7DA 3DW3X 1MQAA 3FFXA 3LIIA 4FMPA 4QPZA 1QVZA 4MDHA 1U7TA 3IA2A 3WZLA 4FIDA 2POCA 1U80A 2YOGA 4P35A 1NP3A 5LZ8A 1SXPA 4R2KA 3RHSA 1BXZA 3BWDD 3ONFA 2YXEA 2VWQA 5ECGC 2ZM6B 2GESA 3P94A 1HYBA 3B9BA 1B2LA 4PIPA 2YV2A 4HPXB 5K3SA 2OORC 1H2YA 1PD1A 1TGVA 2FZEA 1Z15A 1SOUA 4CIVA 1B43A 2BGLA 1TI7A 1VIYA 4KGDA 3NBFA 2DKFA 4Q7EA 2V4MA 3OEED 4LBWA 1JR4A 5HIMA 3RWOA 3AX6A 4LHZA 3WKAA 2YJ4A 4F86A 4EO7A 2IIQA 5HGXA 1KSFX 2CMKA 2RHMA 1EXWA 4EGQA 5KBYA 3KQYA 1PJTA 1OGJA 3CX7A 3OKCA 2R2GA 4IGIA 5TE9A 3NJ4A 4IDAA 4FS3A 4R2JA 2P1ZA 2UUCB 1DIGA 1G20A 4PO1A 4F8JA 5K3EA 3LY5A 2FMFA 1SQ6A 3N0VA 4U02A 1BRMA 2H5LA 4CQMA 5KKNB 4RTJA 5JNUA 1ZMOA 1SXQA 3ORHA 1BYIA 4QDKA 4PYJA 4ZMSA 4YJFB 3H2BA 3FGPA 5K45A 2HLPA 1U6IA 4AMUA 5IJ9A 1JFSA 3KYIB 5IMBA 4OJTA 1EB8A 1U11A 3KB6A 4FEAA 2A58A 4HXEB 2IH5A 2OBXA 4JUIA 4XPZA 4YAWA 1FB5A 5JCZA 3G85A 2C3OA 2AG0A 3B8EA 4I4NA 4R3WA 3HVKA 4HGYA 4URZR 3ZW7A 4TS3A 1QYDA 2MTBA 2ZIEA 4G97A 2XZOA 3I6MA 3IEKA 5IW8A 3G5TA 5T64A 2G1PA 2Z1DA 1CP2A 4D8YA 1CYDA 1U0BB 1E1CB 2YNMA 3WFZA 5CA0B 1CSEE 1FRQA 3RKUA 4HVAA 1KKUA 4ZMBA 5BMVF 1SIUA 4IOJA 2EL9A 4DM3A 2AN4A 4TZKA 1WP4A 1ODIA 1Z06A 3GYBA 3KETA 5C2JB 1UBCA 3VH2A 5F77A 1A5TA 5F23A 1ZA2A 1WE2A 1CR6A 4NYMR 2EX1A 2PCJA 1KI6A 2Z57A 3MNFA 4GOKA 4PRLA 5AVKA 4DVJA 4CTNA 2LBPA 3NXSA 1VDMA 3JASA 4LPSA 3VAZA 3VU9A 3MG9A 1T2DA 1LU9A 2H2DA 4K9SA 3RRXA 2RKOA 3O8CA 4V0RA 3Q85A 3I28A 1XAIA 1LRJA 4F3CA 2GKGA 5FBWB 5JFOA 3RVKA 1T35A 3WX0A 1DELA 4P2GA 3BMCB 3QSGA 4U0JA 2Q50A 3O82A 4TGLA 2JIMA 3RT7A 1UBGA 1J42A 3DUFA 3AW9A 4GVPA 4B6JA 2WWYA 1REQA 1JDBB 4RF5A 4WFQA 2VK1A 3QUAA 1SHTX 2RGEA 3KYJB 1M8KA 5FADA 1Y1RA 1D5CA 3ZIDA 5TQVA 4KO1S 3WGTA 4X44A 5JWOA 4ZZ2A 2PMWB 2Q0SA 5LJIA 2GN6A 1RXVA 2R6GA 2AOUB 2IYFA 5DCWA 2Q6OA 3LBNA 2GEDA 2FW1A 1RC0A 3MVEA 4KG7A 3LWNA 3O2JA 5IVDA 3R6TA 2E49A 1DTEA 4EM6A 3L05A 2P2CA 3EARA 4TMYA 3SQNA 2F3PA 2HQOA 3CUYA 1WMEA 4XAQA 4BNFA 4LDRA 4OLHA 3AESB 3D6NB 3OTOB 5G0TA 1BSVA 4JLOA 2XMBA 3PIRA 1M2OA 1TUEA 2IBTA 1C50A 2G17A 1TMYA 2Z8XA 2ZRFA 5G0UA 4PSUA 1QTRA 3JSAA 1BEEA 2OHOA 2EG5A 3QKRA 4J7CA 3KQNA 1RXSA 2ECPA 3FCOA 2PGLA 4NECA 1E1DA 4K7JA 1N6RA 2Q2WA 2WYWA 6GPBA 3KZCA 4NTZA 2JBHA 2J3LA 1MLDA 3QVGB 2ETXA 1QAOA 1YC2A 1DNPA 1W581 2CYAA 5HILA 3RV3A 4D41A 4ZICA 1E5DA 1K6EA 2C8VA 3OQHA 2JKZA 2X8LA 1J09A 4LJKA 1LI7A 2CGEA 4MLPA 1MU0A 3ZVMA 1BVYF 2V7PA 3VPSA 2UVPB 1MH1A 2CL5A 2RKWA 5KJ6A 3KEQA 3WXMA 2BEWB 1TPYA 3QFRA 5BQOA 1C4KA 4UU7A 4LPKA 2D0OB 1CUUA 2VNSA 1FL9A 1YIDA 4N3BA 4D79A 4ZAXA 2FZVA 2VJAA 2Y6UA 4JCCA 3KQVA 2G5TA 2W5UA 3TPCA 2C0CA 1OX6A 1EH5A 2HPVA 2EW8A 3GIWA 5F2EA 1VP9A 1I94B 1LWOA 4V1CB 1Y9EA 2JNWA 3C85A 4RZIA 4DMRA 1AGYA 4R1SA 4GI2A 1Z5VA 1U1IA 3QFTA 3TH5A 3UWKA 2C2GA 5I4CA 2V3VA 2ALJA 5JARA 1ZW1A 2WAOA 1DIOB 3PD0A 4L51A 4KDRA 3UJBA 4B2YA 4YMIA 1E9RA 1O4VA 1TLFA 2JZOA 2W70A 5ESXA 4EGSA 3PENA 4F8YA 4NOJA 1DUSA 2P2NA 2VAVA 3HVHA 3THSA 3W5IA 3SU8A 1QHGA 5TPWA 5FPQA 4A03A 4H1TA 5IBRA 4R05A 1UANA 5L7TA 2ZG6A 5I6DA 1EU1A 1OLSB 3THXA 3UMGA 5BO5A 1NFRA 3DCYA 5GVRA 2NWQA 2H1SA 3ZY5A 4KQEA 2HMSA 1A76A 3AR2A 4C0LA 1CUIA 1JDBC 4NCAA 4DQVA 5EUBA 2HJHA 2KBEA 2VHXA 3USCS 1YXMA 1NF9A 4BC0A 2A4KA 1Q11A 3NWBA 2JJYA 1FU7A 3SZ3A 5FUWA 1V8ZA 2IJGX 4BZZA 2C54A 4IIYA 4MUMA 4ZYYA 4FIZA 4RK1A 1WNFA 1N25A 3DLAA 4L9AA 4M37A 4KVZA 5IC4A 1KK1A 4N41A 1VPLA 2FUNB 4UQOA 3V7YA 3GQVA 3IHKA 2NTYC 3AKDA 3CGWA 4S1NA 4G5FA 3EMDA 3MTIA 4ZU1X 2R85A 2OO5C 3CINA 3OLZA 4IIJB 1CRZA 1Y6JA 2OLEA 5CH8A 3VYTB 3GLGE 4D80A 1DBQA 1FRNA 1PNQA 1TAHA 1XJCA 1QRRA 2J5XA 5I8ZA 2QV7A 3QUTA 4C7KA 4HVCA 2X3YA 2H92A 5D3KA 4N3AA 4YR9A 3RU7A 3U7FB 2XPCA 2BVNA 2NU6A 2HF9A 4MV1A 3DDNA 4EHBA 1G3QA 2Y77A 1HQDA 2ZTLA 4U2BA 4PCVA 4WLEA 5BUSA 1A88A 1PT8A 4U2GA 1CHDA 1CVRA 1VSVA 2O8DA 5ADUS 4OU4A 4NU8X 1FDUA 2WWIA 3LCUA 3C48A 1U6JA 1QDLB 2E5FA 1NRJB 4D8WA 4UPEA 4FMCF 1X1EA 2VPZA 3F96A 4OD0A 4ENRA 2Q2OA 4FU0A 3WY9A 1B00A 1D2MA 1RWNA 2GF0A 2IYSA 4M0MA 5H9WA 1QHNA 2JLSA 2XYVA 2IDZA 2DECA 2CVQA 2EGHA 3NRCA 4H0FA 1Q74A 3B2QA 4I6GA 3EDCA 3C39A 4AY5A 4W6QA 3TRKA 3I9NA 3DMYA 1AV6A 2XMCA 4P32A 3IPCA 4KTVE 3QI2A 4BQQA 4WBNA 4HTFB 5JCJA 5AHOA 4C4OA 2UUBB 4CEHB 1AQLA 1IOZA 4LKRA 1VBMA 2R1ZA 5AVZA 4WY8A 1KDOA 4XVQA 1FU4A 5K51A 2P2ZA 5E9AA 5A6SA 3EUWA 4JD5A 1Y81A 1TIBA 4OGGA 2PUDA 3P0FA 3R9KA 1YRLA 1TZJA 4AQ7A 2X9LA 4QU8A 2B8EA 3PTLA 4Q1BA 3RQIA 4BJ1A 3OOWA 1KBZA 5T5QA 4WNAB 1SBCA 2NG1A 2DF8A 4KV9A 1J8MF 1J9EA 3OWHA 3Q11A 3HKBA 1H1DA 1MB9A 3QNWA 1AKUA 2C3PA 1GEGA 1N5LA 2B8JA 5IN5A 2IYOA 2BI7A 2D7CA 2W11A 1FNMA 5IJAA 5AW2A 1WPRA 1X2EA 4N6NA 2FETA 4YCSA 1YHZA 4XYLA 3BMQA 4Y18A 4TMVA 1RW4A 2DHEA 3MWJA 4FSHA 4D9GA 3L4JA 3PCTA 4KX3A 2AMFA 4X5OA 5ULLA 4PBTA 1SKAA 1WPXA 1Q2XA 1CUGA 2PV0A 1R27A 4XARA 2XJ9A 2CXQA 3GEGA 3V7FA 4CFSA 5B53A 2H6EA 2ZBFA 7AT1A 4KXXA 2NMVA 4X41A 3O7WA 1IQUA 5BYBA 4GUAA 5A3JA 2I7CA 1KDYA 10MHA 3FPLA 3X2EA 4Q3AA 4RHXA 4BASA 5KVCA 1FE8A 1VLLA 2P8SA 1QHYA 1UFVA 2YASA 3EF3A 4FEYA 4QQFA 3MWYW 1OX5A 4ARAA 5HXAA 4TYWA 3D6AA 5AIBA 1GTZA 3PE4A 1QFJA 4LA4A 1SVKA 4LC1A 1VKNA 4GICA 3WRYC 4AO6A 4LF9B 2XT9A 2VP9A 3L6UA 4TYNA 1DIAA 3TLKA 4CKBB 4UFPA 1B0AA 2GEVA 3ZGXA 2R96A 4FBMA 3M6VA 1B8VA 2NYUA 2Z2JA 3TINA 3VYSB 3C1UA 5J4LA 4I99A 1YBFA 4ZQFA 4BDTA 1XZFA 2GB4A 1Q1NA 1Z83A 2IF2A 2NPIA 4J9UE 2AQ8A 2DULA 2EX4A 3NP9A 5AJUA 4AFNA 2DJIA 5LNK1 3LUHA 4F60A 4ZOCA 1DBIA 1VYUA 3NBUA 4JI4B 3AHHA 3WLRA 3V6LA 2AK2A 4ID3A 4B6PA 4P4SA 1YZGA 4YMVA 3CKYA 3INNA 1OB5A 4LHYA 3OM0A 1EK2A 4MA4A 4H7EA 4D4LA 3QX8A 2PE5A 4TZ6A 3D2BA 2AFRA 3L8YA 4UOQA 3SF8A 4O3FA 2UUOA 5G02A 4MCJA 4WXEA 2Z2ZA 3A05A 3DSRA 1XRNA 3G9QA 3P20A 4PQFA 4RSRA 4ZV7A 4OHWA 4KBYA 4B2IA 1YS1X 4EVQA 5FBKA 4PNEA 4DABA 4FNGA 4GGOA 2PR7A 1PW7A 3GWGA 1GV1A 1THZA 5HJ2A 2H2AA 1E9CA 2I2XB 4A26A 3LLMA 3MAJA 4KGVA 4CDMA 2ZIXA 5BNTA 2AN9A 1SCNE 3I6YA 5KEIA 4KO8A 1CQJA 1G7TA 5HFAA 3HH8A 4CKEA 1JNYA 3FCSB 5CDTA 1GFIA 1R74A 4H4EA 2QTLA 4CMJA 1VC2A 3OWXA 2C7PA 4F4FA 4CI0B 3BDVA 3H5IA 2W6JD 5LUAA 1FP4A 1LRLA 1SC1A 4JOQA 3IAS6 4QAQA 2DQ4A 2I0FA 5K7SA 2O6HA 1WSDA 1NVAA 3GRYA 4PZUA 4TL7A 4GM0A 3ZLTA 2JIDA 1ZIYA 3A2LA 2FZWA 2NXJA 3KPYA 4N12A 5K6TA 2XUJA 4MJLA 1ZVKA 4JBNA 2WJ3A 4ZZIA 4S05A 1TTQB 5SYNA 1EWVA 3RD5A 4C0KA 4QFBA 1W73A 2XA9A 2JAOA 2QROA 5TT0A 3ZGOA 2GHRA 3QNMA 2ZK7A 4HUTA 5F3WB 4X90A 4WKOA 1NUSA 3L40A 3LD9A 1Z18A 4L4UA 1X80A 1I5OA 4XCQA 2OM2A 1R9MA 2WSSD 3LOPA 3TW0A 3HU2A 5AXBA 4EG6A 3FTEA 1T0PA 4X6LA 3NIBA 3RSGA 3TL6A 3VU1A 2I4MA 2ZE7A 3T9BA 3UHFA 3TGLA 4Q7QA 3QFHA 2Y1OA 1VG9B 3HU1A 2W6ZA 2QNRA 3PXUA 4PZ9A 3B78A 3ZHXA 5C52B 4J4HA 5K0BA 1WCWA 2NV0A 1W44A 2YMPA 3LY8A 4G8CA 1P2SA 3JVIA 4LVNA 4X1OA 3RC1A 2IOFA 3A37A 3CT6A 4KZKA 4D82A 1Z73A 4A2CA 2IDKA 1O0BA 3B1XA 1OX4A 5REQA 4BMDA 1EG2A 2XHZA 3ROEA 1JFFB 4AZSA 2W58A 4G0PA 2SBTA 4DLNA 4XVUA 2G76A 2QZJA 1E9EA 3CF2A 4L74A 5CT8A 1ECLA 2XAAA 4TS1A 2EOAA 4Z9YA 3CZ4A 4BFUA 1WCV1 1BE6A 1Z4PX 3SC2B 3IGFA 3EA4A 5D3ZA 3MJFA 3LNCA 1OLXA 2FGKA 2JATA 4E70A 5EI5A 1X14A 3TAXA 5L95A 5IJXA 5KQMA 1NPDA 2ZSJA 1GV0A 4UBKA 4EMUA 4ZEMA 4PZAA 2IC5A 3FYUB 2B1QA 2RHRA 2XMSA 1CJUC 3SR4A 2ZCVA 2NNWB 3LKBA 2QAGB 5LQUA 3CEJA 1EVIA 2VAMA 1X1RA 3DBHB 1RR6A 3UCEA 1IM2A 5CLQA 1NPTO 1EVKA 1IXSB 3MN1A 4KEAA 1GA4A 2FOXA 2AWOA 2ZU6A 3HYNA 3E7PA 3V7NA 4DA9A 5DWDA 1SXJA 3P0RA 5BT9A 1IULA 1D1QA 4M9QA 4PAQA 4BNXA 5JXWA 2DBZA 4LF5B 3DE5X 3C1TA 4MW6A 2AT1A 2R6FA 1XDSA 3KPWA 4GL4A 3TZKA 4DLYA 4I3FA 1DOHA 1JR2A 3BMNB 1UP4A 3FF1A 4EJ0A 4KPYA 1H5QA 4K6HA 3MJ4A 2QMHA 1N2IA 1CZOA 1JLLB 3A0UA 4ODIA 4Z7NB 2WNHA 5L3QA 5FPHA 3PXXA 4BLWA 4BVHA 4LQCA 2X8WA 1PLKA 4M3NA 1TX4B 1P2UA 3JWJA 1C4XA 5MDHA 3B6IA 3FG9A 4GI3A 3SBDA 3ZCQA 2XUZA 3U19A 3CH7A 1GKKA 1FBNA 4NK4A 3CCCA 4JJ8A 2IPLA 3B1ZA 1UKZA 4HQNA 2VXOA 3LUFA 4RLFA 3RC9A 3WISA 3TCKA 3JQPA 5B1EA 1APBA 2B83A 1UBJS 4M98A 5IS2A 5F7OA 3O3NB 5BN5A 5C5EA 2J9GA 3ZWVA 1I9GA 2FX5A 1XXHB 3JVUA 3AVWA 3UMCA 4O0MA 1CW2B 2ACKA 2ZRBA 1YUBA 3RKRA 3UAZA 4PGFA 4YCLA 5CD9A 1K6JA 2X0NA 1MH9A 1TK9A 1V1RB 2FKAA 3A4LA 3AG6A 4FFNA 2V45A 3KWJA 1SZCA 2WEKA 1D2RA 3QTBA 1WXFA 4RK4A 3V8BA 4HNTA 1FEZA 1W8DA 2AMLA 1QF6A 2IS2A 4KQFA 2QSYA 2QLLA 3INYA 4U1RA 4OBWA 5F9FA 3DEIA 1OXSC 4A10A 2PXHA 4BO0A 5JW6A 2WWTA 4LVOA 3DDWA 3MCUA 2C07A 5DTIA 4CCAA 4J9VA 4KQXA 1O97D 3K70B 3KQKA 1X86B 3WLLA 1UM8A 3RHFA 1X7ZA 1GGVA 2UAGA 3D8UA 4BO1A 3H5NA 3KUKA 1J1IA 4TPKA 2HMYB 3NDJA 3A6ZA 5ALQA 1JZQA 3P19A 4FINA 4KSCA 2OQIA 4HGOA 1NW8A 2V6BA 2J3KA 2XZPA 4LDAA 4HB4A 4PO3X 5LOVB 2EARA 2QX8A 1CF4A 2B3DA 4AG3A 5EKSA 3JWIA 3UTDA 4IKOA 4P0QB 4L57A 2BKXA 1U2RA 1P4AA 3WGKA 5M5BA 3DMTC 4H27A 2A0FA 5LP1A 5F51A 5JSQA 1MB3A 4ZOBA 1L7MA 4R41A 2QAGC 3WIBA 1YS4A 1H6AA 2B36A 4K46A 4UHCA 4O5OA 3UTCA 5DM70 3VZPA 1W7AA 2R7LA 2DUNA 4EG8A 1DWUA 2IZZA 3UK7A 5JZ9A 1QR2A 1WDMA 5ITWA 2YWHA 1EBFA 4C1BA 3K9FC 4HEA1 3UY4A 4JK3A 2PNJA 2AK3A 3F6BX 4GM4A 4NL4H 4REQB 3OCYA 4HLDA 4MLCA 2VHVA 2I2AA 5K8JB 4JZYA 2CCGA 3MWGA 3OJOA 3HKCB 3OF2A 3SNHA 4ZK6A 3RK4A 4A6PA 1SVLA 4HMQA 4OHCA 4FONA 3VTKA 2UUAB 3WL7A 2BZ1A 3WK6A 4KPUA 1DJMA 2NO5A 3RUEA 1UZNA 5AI9A 4C4RA 1GCUA 2QQ0A 4JIMA 4DIOA 5E2AA 3NEAA 1XTUA 2IV7A 5GJVC 3AB7A 4ZVMA 3LOQA 1CUAA 3D6HA 4WJKB 2IXBA 4EABA 3B1KA 2IU4A 2PV7A 1LLDA 3R3HA 2W8BB 2X0EA 2HNKA 1LPPA 2O1XA 4TSFA 2G7ZA 1U0TA 1YKGA 2QP4A 2RHTA 3EGDB 3HDTA 3BE4A 1E1QD 5H16A 3ABRB 3F5MA 3LYLA 4HV4A 4CTKA 3UA3A 4DCTA 1KK2A 1R4MB 2Z56A 3H13A 3UVEA 3B2NA 1GPYA 2IZ0A 3G7SA 1G8KA 3Q3VA 4S0ZA 4F3RA 3CB2A 4J1QA 3WZ2A 2QL6A 1CQIB 3LV8A 2DZDA 3L8CA 2CNWD 2P4EA 2I67A 3IALA 3DLIA 5DDIP 5FTMA 2A0WA 2KM1A 3FTQA 2XWBF 3DE0X 4NE7A 4M8KA 2Z8YA 3LX4A 2JLZA 4RCVA 3U26A 4QRDA 3NZEA 1HG1A 1NQWA 4LK3A 4QOSA 3C5CA 2O7SA 1UC5B 4RFLA 5EZ6B 5KYXA 3KOWA 2HH9A 1Q84A 4E5VA 4Q4JB 3DTTA 3GAZA 4US0R 1D1TA 1DC8A 1ZUNA 2I1QA 3GT4A 3K70C 3P26A 1LDBA 5LYJF 4YT4A 3DZJA 1QHIA 2H0QA 2PYZA 3A6PC 4HUQA 1WXEA 1O58A 2VA9A 2XIQA 3HY4A 1XE3A 2QRQA 4QASA 4ETMA 2YWBA 1FW8A 2ZSAA 1V0JA 2FPSA 4Y9SA 1P7YA 4O29A 3NWJA 4JR2A 1LBHA 4M83A 3PPIA 4QNMA 3SBEA 2I6SA 4RL6A 3UJ7A 3E8XA 2JFHA 2DHDA 4UCXA 5CLHA 5LB4A 1BXRA 1HPLA 1JQJC 1U1FA 5KSOA 1F7UA 4H7FA 2G1JA 1IC6A 2C59A 1R0XA 2Q8PA 2R84A 3EYAA 3R5SA 1KVUA 1A72A 1UJBA 3RI3A 2X2OA 1VECA 3DUWA 1Z8HA 2WLSA 1NNEA 3L82B 2SCUA 3DZ8A 4PR3A 1S8NA 5AKYA 3WLQA 1ZRSA 3RVJA 4B09A 4BC1A 1P1BA 5HMLA 3HV2A 3ABZA 3OOYA 3N7UA 3AOGA 3OU2A 4DR5B 2ZT7A 4DPLA 5FTJA 1FX1A 2PS9A 4X63A 3GVHA 3FTFA 4DKXA 4C5CA 2WZQA 1N78A 2F3RA 4MVJG 4XOIA 4MTCA 5A5DA 5FI0B 3SE0A 4OB7A 5K01A 1TKCA 4OXKA 3KAQA 1VGRA 1MORA 4LGYA 4MX8A 4WWHA 5CLLA 3G9UA 1BXGA 1Q0QA 2R1TA 3I2IA 3MCVA 1DX4A 3RFUA 3TN7A 4CMCA 1RZRD 5KB3A 1YR9A 2C4UA 1ZA1A 2I2BA 1AZSC 2VLBA 3IQIX 3K73O 1HFKA 3OLQA 2WJGA 3D8NA 2NXNA 2VDLB 2PMFA 3LUAA 1A04A 1K2WA 2Q1YA 4J0IA 5C53B 1TKRA 4PYMA 1T1SA 1XXLA 3AR3A 3OPNA 1IOLA 1FFAA 3WTCA 5EIBC 2Y6VA 1S0UA 1T2CA 2XUIA 3AM3A 3MJVA 3FTCA 4J7UA 2B99A 5CXSA 4JYZA 1YJCA 1L1QA 3BIFA 3GJZA 1KYWA 4B35A 5B1DA 1M66A 1L5VA 4X3PA 4HAZA 5BN4B 4HVLA 5C37A 1OWNA 1J0AA 3AP3A 4D56A 1J5XA 1UC4B 4YX9A 4EGJA 2Q28A 2C5LA 1G7SA 1P7VA 3L1HA 3VZBA 3PQ6A 4U5XA 2EJUA 2BFFB 3DDSA 1E3JA 2HLHA 2YS7A 2VZ0A 4IGKA 1S8AA 3FB1A 1R5BA 3UGKA 3RYCA 2RARA 5A9SB 1J06A 3DMGA 2XZTA 3LC0A 1H2WA 4IX1A 4PIMA 3GDGA 4AJKA 2WJ6A 2OESA 2E5WA 2FR0A 2FJ0A 3WSTA 2WNIA 1A4UA 3ITKA 5E9WA 3D3QA 4I1RA 4EBBA 3A4TA 1ATZA 1M34E 4XCXA 3LTNC 1T1IA 3NDPA 1Y9DA 4GYWA 1QORA 4I4TF 5DF1A 2HQ1A 3E7XA 2UKDA 3K72B 4NPHA 4O2LA 4YDRA 5ESRA 5DNEA 3CNOA 2JJ1D 2F62A 4DB4A 2H8KA 3PNPA 2QRVA 5KYVA 3UW3A 4RAOA 3IYLW 4MITA 2NNLD 2Y0CA 2ZI9A 1A9ZA 3CTMA 5HF6A 1C0LA 1EWYA 4LDJA 4UCQA 3DKRA 2I5PO 1ZJJA 4EB8A 1MKYA 2BCGY 1O1YA 5IVIA 3HFJA 3Q6MA 4O4LA 1WY5A 3MBIA 4EARA 5CVVA 1Y1KE 4MQLA 1HRKA 4AD8A 3FMIA 1S4MA 1QGZA 3HYTA 3TPZA 2FXIA 3W2GA 2G25A 2CLEB 2JIZD 4AS1A 1MJFA 3GFTA 4WCFC 1W30A 4LJ6A 1U3CA 1ZVJA 2GCNA 4Q39A 1H8ED 1W4AA 3RW9A 3AKYA 1ZIDA 1X0XA 3U09A 1FUEA 3GLUA 3P2KA 2VHZA 4M1EA 3RJ9A 4UUAA 3R6WA 6AT1A 4CT5A 3I2HA 5DEOA 4CMHA 4TMKA 2X4IA 4LOLA 4XJTA 3WGVA 2HZBA 1LPBB 1WDLA 3ISTA 4W8HA 4AB1A 3GLFE 2VKTA 4KN9S 1S3GA 4LTDA 4AZWA 2GPWA 4PINA 3I04A 4EGCB 4RPIA 4F6RA 1YJAA 1ISGA 3DP9A 3PC6A 1LA2A 2VP2A 1Z74A 4W99A 3R0QA 2DXIA 4GBGA 3PDJA 3AOEC 3OICA 5GZ6A 3Q41A 3NIWA 4BFZA 2JIBA 1R88A 3MJCA 1AE1A 2XHEA 3FUUA 4F85A 3FMGA 4B7CA 1SKYB 2J0QA 3UATA 3K0AA 1SURA 4QXPA 2QGFA 3LYAA 4RPCA 2AOWA 4HQLA 3HTXA 1UBRS 5J2TF 1KERA 3ANMA 3EK2A 4GP7A 4BMSA 4DUZB 1COZA 4NHOA 3QEMA 4JB0A 1M5RA 4F96A 4KXQA 1Q92A 3LUBA 4ENUA 1R15A 2AJBA 1J6UA 3BRQA 4MYTA 4PGGA 1U8YA 1ZXBA 1Y3IA 2X0IA 1XPUA 1BRTA 1IHPA 1CFJA 1WF3A 1VSBA 5CA1B 5JLJA 1EGMB 5IT9A 1CZHA 1KMMA 2QMZA 3HHPA 3IEXA 4O6VA 1U8EA 3UBMA 1PL6A 5IUJC 4RORA 3VBEA 5LR6A 3CZ9A 2X1VA 1KOLA 3RTGA 4AZ0B 2BP7B 3IX7A 1UDRA 3PCXA 1QQTA 3NANA 1Q14A 3ZUPA 2IXEA 1XN4A 4FYMA 2D4AA 5E0KB 4YBRA 4C6TB 5BV1A 1CNEA 2H1WA 3DDCA 4IS2A 3D2LA 4RE6A 3ZBUA 4ESEA 2R8OA 3BBLA 1VLZA 1IEVA 4BX9A 4C20A 4MW9A 5IJZA 3QEBZ 1EK1A 2A5JA 2Q3EA 3EGWA 2HLDD 4KI0A 4QOJA 2PUHA 3F6CA 3NOVA 4R7TA 5F9MA 5LDHA 1N6LA 1J07A 4RTMA 3CLKA 4JROA 5T4FA 1RXEA 821PA 2W6IA 4ZCIA 1S7CA 1OGYA 3PD7A 4TMXA 2H2HA 1E9DA 1IPHA 2F6RA 4DCCA 2ZDGA 4DJFC 1SH7A 3WMWA 2WHEA 2I03A 2ZR7A 2J3EA 4JKOA 1U8ZA 4RNCA 4KR0A 1B74A 5IKPA 4M9RA 3KJZA 4LJYA 3BJEA 4LXXA 4WFKA 3E84A 4HFNA 4AJOA 1JEOA 4E15A 3CUKA 2G8LA 1C2TA 3IQXA 4LJ9A 4URHA 3G5LA 4GSLA 2XNSA 4FC6A 4JH0A 1OI4A 1VSUA 5HX7A 4WZ6A 5LMNB 3D64A 5HK8A 5CCDA 3ZX4A 1JVNA 4LY0A 3DBRB 4Q9LA 3SGLA 2BDUA 2V65A 4NENB 1QHHB 5TEVA 3TLJA 1C8KA 4O1HA 2NU9A 2P2GA 4CU2A 1ZHOA 3EW9A 2BOVA 2J3HA 1NI4B 1T29A 3OCJA 1E4VA 2RFLA 4ND8B 5EP3A 3ROMA 1ZD8A 1RLIA 1WUIS 4UZEA 2VTBB 3JQ7B 2ZIVB 2PUGA 2O2ZA 2ROQA 3D4OA 4ZVLA 4BV9A 3HCPA 4NC9A 4PLHA 5A7HA 3A2KA 4R9RA 2QT9A 3VHXB 4JWKA 1UBFA 1XWIA 3V1TC 4DJ5X 3PEYA 1FYWA 2D1RA 3KD3A 1VYVA 3DNPA 1ZS9A 1QUEA 1TK2A 2JFWA 1GY8A 4F11A 4MP8A 1CRWG 2VF2A 4WOBA 5JAUA 1FYXA 2VQ3A 4FX5A 4RTOA 3D3NA 4QT0A 4BEBA 1JT9A 1L8OA 4XOUA 3W5SA 1YA6A 4XA8A 2D5LA 2XB4A 2E6UX 2HPHA 4EB3A 5IZCC 5JZSA 1A1VA 5ECYA 1B8NA 5DV9A 1E2MA 3F8WA 1UR5A 1A5AB 1LK7A 4R2LA 2CZCA 1N2CA 2I66A 1LPMA 1X1QA 2YFKA 4NBKA 1UBTS 4RX1A 4C3VA 1Y1TA 4WL0A 4RTKA 5AM0A 4B1FA 3VVLA 4CTMA 2E7ZA 1Z2OX 1BHJA 2FSFA 3EULA 1SR8A 2E2WA 2FSIA 2P35A 2VJNA 2QG4A 1G98A 2J30A 2XZDA 3CONA 3W90A 3WBBA 3RJZA 5IEBA 1OAOA 4MVJA 3OKAA 5DW0A 4ZT2A 2X8JA 3UWPA 4FUQA 2IF0A 5GZ1A 3RAJA 1J21A 3KOUA 1NXPA 1ZN9A 4BV3A 1IVSA 3F6SA 1DDIA 5ALSA 4NBUA 1YDGA 3ZWPA 5F1OA 1LCIA 1JZSA 2W43A 4ND2A 5JAQA 1SUCA 1EJ2A 2GWRA 2N1MA 2VWGA 3M6XA 1QG0A 2R79A 1UK7A 2OCBA 4MJXA 4YJ3B 3S7ZA 4ZU3A 3GF4A 5BYJA 2PEZA 4BE9A 5DLQC 1XIVA 3E3OA 3FMVA 4NFLA 4ARCA 3ERCA 3F8SA 3RVPA 5BN3B 5HZMA 5K3FB 4ARVA 2FSVA 4ID9A 4WBXC 2OYSA 5F21A 3S2GA 2CWDA 3OLYA 1E3QA 1T2AA 3EOZA 3ZH2A 3EVEA 4BQFA 4KPFC 4W5NA 1EHCA 2ARKA 4L3OA 2E87A 3RLFA 2O2XA 4RA9B 3MILA 2XBMA 1AXRA 2GXUA 3OPYI 2AOTB 3ENQA 5BQ5A 3ET5A 4N3NA 4P98A 4PZ0A 5T6MA 4Z0TA 1IEQA 3LECA 4INOA 4QOEA 4J0FA 1PW5A 2CYBA 3D3KA 4YJHB 3WQRA 3THWA 4YT8A 4ZWNA 2F8SA 3EY9A 1YVRA 1HE4A 2FDXA 3VPDA 4OQ4A 3OHPA 4OJKA 1FVXA 1U2EA 5EXSA 4A2QA 3CZQA 3GVXA 3R44A 2O59A 4EFDA 3CN7A 5LKRA 1FYVA 1NMZA 1RZ3A 3LF2A 2QW0X 4JQZA 4TS4A 2GK4A 3W2IA 4KVFA 4LS3A 1Y8ZA 4JB2A 4LY6A 2H5EA 3OPMA 5F5NA 4A0QA 5ADHA 1IU9A 4FN5A 1DAKA 4GECA 4DWWA 3MTDA 3B7GA 4BKRA 1KVQA 2C9DA 2IVFA 4PC1A 1RYHA 3WDKA 5JSZA 2ZRKA 3AIMA 4BB0A 3E23A 4HNGA 5AW1A 4ZPXA 1QNLA 2JLQA 5TQ2A 2PGNA 1QZUA 1M1XB 5IUNC 1AGNA 1R37A 2O2GA 1M34B 4H6PA 4JL8A 4QNNA 3NB0A 3EEFA 5D3MB 1OIVA 2EXXA 3M5DA 4G84A 3OCZA 4K9KA 4LECA 1KWGA 3AF6A 5DI3B 4WQMA 1HE3A 4I1VA 4G1BA 4I9GA 1HZZC 1OJ7A 4YJGA 3TX6A 2REBA 3FNHA 1H22A 5I8PA 4V2IA 2BELA 4HX9A 1FJHA 2I1LA 4EZBA 4U8GA 5E8RA 4G0VA 4ZD6A 1TZKA 2CW5A 2EBFX 2NZVG 3ME5A 3OUZA 3T7EA 4OB8A 4HN2A 4R9UC 1TO6A 2C5AA 2ZW9A 3GLHA 4G9GA 3ZCVA 4G37A 2AD1A 5DSTA 1JHOA 2ZS9A 2X0FA 2GN9A 2O50A 3EQ2A 3TMYA 6YASA 3L8GA 5EXTA 3OH8A 1KVRA 1YDEA 4MCAA 1LFDB 2CL7X 1DU4A 5KYYB 1QKJA 1KAQA 2AFIA 3SBXA 5CLFA 4EB6A 2VC2B 5SZJA 3BZUA 2UV8A 4IAOA 4IMJB 3MUFA 2P0AA 5BQPA 3UB3A 4IHAA 4RH1A 1PFGA 3B13B 1C3OA 2XMRA 4IDQA 4EQ6B 4E2WA 3TUZC 1BQEA 3GLFB 4YAJA 4Q15A 1CEYA 2FW9A 7REQA 3I01M 2EW2A 2QTMA 3AHIA 3KYDA 4ZKEA 1CDZA 1GQRA 3UENA 3O8RA 1ZWLA 3F98A 1SVIA 2BMVA 3G0DA 2PL9A 1Y1SA 2QPTA 2X19A 2Q3MA 4C5AA 1J39A 4NNOA 3NYRA 1K0UA 1S01A 3DV9A 2J3JA 2BHSA 4CM8B 1KY2A 1KU6A 4KLRA 5FPTA 2Z2YA 5DMHA 5J9FA 2ZRNA 3RYHB 1UM9A 2AJCA 1KIMA 2PS1A 5F9HA 3AB3A 5DBIA 1HYQA 4EBFA 4DSZA 3T1NA 4HNQA 4LV5B 3C7KA 4P0TA 4MWCA 1XROA 4GMXA 3BWXA 4II2A 4NARA 1Z38A 4BNZA 4HXGA 4LYHA 1IZYA 3M6IA 5E6SA 1R4NA 1V8FA 4ZAYA 3ZLBA 2QIPA 3UIEA 4PX2A 3VGPA 1AHPA 2CLLB 2ZYIA 3HA2A 3C6YA 1QAQA 2C9OA 1SO8A 4QDXA 3GLIB 1D2AA 2C83A 3OQIA 3ZOZA 2BFDA 3U4DA 1WTCA 3OMLA 5FL7A 3FW1A 1EEXB 4OFBA 3OY2A 4ZARA 1EEHA 1C30B 2DPGA 3AXSA 3D02A 1R0SA 1EX9A 2B30A 4UARA 3AZQA 2VXYA 5CMLA 4NMWA 4BN0A 5IX8A 2YX1A 1EX7A 1V7QA 2XUKA 1I3NA 3ZHQA 2IU0A 1DEAA 1NM5A 2RI6A 2HI0A 4CMEA 5LYYA 2G9VA 1P17A 1E6UA 1I32A 2ESRA 1H2FA 4ECEA 5F1KA 4FYWA 4PBSA 4E2FA 3U44A 1QVAA 2G4VA 2ORWA 2P6OA 3WGNA 4Q1AA 4JJEA 1CK4A 1UBLS 5KNDA 2VJMB 4LQDA 2PZLA 3VNQA 2GYVA 1BX1A 1Z8DA 2VQDA 3MAGA 5DTJA 3I8XA 2ETVA 3I62A 2ENWA 1RMYA 5E0OA 3SQMA 1J2EA 3SQOA 4WGGA 2JZNA 3ZVKA 1G9XA 3ELUA 4OUDB 3LXMA 4PNPA 3GJ7A 4ARBA 2EKLA 4QBTA 5JPIA 2I7VA 3L6CA 3KPVA 3ZBQA 4EW1A 3GP8A 5AK5A 2AWNA 1W9HA 4GRAA 3QVVA 4Z1OA 5LA6F 4DYDA 1QH1B 3I2YX 2F1RA 1OILA 1RWOA 1TRHA 4QQ8A 3A9WA 1B15A 3E82A 4RMGA 1G8JA 1N3BA 3EGIA 3KYBA 3O94A 5ERXA 1AK1A 3HDGA 1FSZA 3AIIA 4W8GA 3WO0A 2Q62A 2FFJA 2FKNA 2XNJA 3JU3A 3GV0A 3FVVA 3MMNA 3Q40A 3RBVA 5DN9A 1RJDA 1L5WA 3D8BA 4FZVA 4U3JB 1U7OA 4NZMA 2HTFA 2L82A 4KFSA 9GPBA 1T4CB 3WBKA 1XVLA 2VUIB 2JHFA 4MEBA 4NYJQ 1FBTA 2QRJA 4XW2A 1L6IA 1THGA 3CMMA 1NW5A 3O47A 2I4NA 3BTOA 1RQ2A 5A05A 4CVNA 4OSEA 1K8XB 1GN9A 4GBED 4Q9JA 1ZM4A 2CFOA 5FAKA 2EJCA 2PSFA 5CDSA 2P9EA 3GA7A 3OQNA 3WA7A 4CHGA 1CLUA 2QSJA 3DPUA 2YQZA 3H4IA 5BMVB 2WU4A 3EG9B 4KQ1A 1G8MA 3M4ZA 4WXRA 2EZTA 4JEIA 2OWDA 3RANA 2HADA 1EUQA 2GTIA 3EHEA 3AL0C 3GCZA 1OQAA 2PEYA 4K2AA 2AG8A 4X45A 4KBGA 4RADA 3V8EA 4BLUA 2XOEA 5KTYA 1FFCA 1ZH0A 4PS0A 4TTTS 1O7JA 4CGZA 4D4GA 4E3WA 4PAMA 2CHEA 5LNK6 1KZ1A 3T9AA 2ES4A 4CM9D 5EJ6A 1USGA 4P08A 3FSEA 3DZKA 2F9LA 2G9ZA 3QIAA 4XIFA 4CCYB 3TSAA 5JDIA 4ZEVA 2OO3A 3Q15C 2GM9A 4YGYA 1RXWA 4G8BA 2NLOA 3HJAA 3W5AA 2OUKA 3TBHA 4Z2AA 1E79D 4LOAA 1O87A 2KMLA 3A1EA 3GFPA 3GN1A 4MWZA 5CHYA 4ZGBA 2FW6A 2JHCA 3VVCA 1UMDA 4W1QA 5B4UA 3AEYA 4MA5A 1UWLA 2JI9A 2Q6LA 2WG2A 4QGGA 1AB6A 1QFSA 2QTZA 1UPXA 5EQFA 4QO8A 2EHDA 3VR4D 5HUJA 5BV2P 2P3QA 4KXFB 4MPTA 4ZVVA 2WFAA 3I8SA 5CLIA 3H7IA 5DO9A 1DG9A 1OKKD 2FMHA 2MYTA 3OZ7A 5GVSA 8MHTA 2OV3A 1GZ7A 2C29D 1N2GA 2WT8A 1Y6GA 1TM3E 3AKCA 4CGYA 2QYSA 4XUGB 4RMHA 3WRWA 4QYTA 3PPXA 2Q45A 3OCCA 3ONWA 3EXG1 3R7WA 5J2UF 3QENA 3QPUA 3SI7A 3A06A 1Y33E 3L7CA 2EFYA 5EEHA 1QH8A 4BMNA 2KX7A 2FYTA 4YAGA 5FEUA 4YQZA 1P0PA 2HX1A 4W5WA 2W8ZA 5AI6A 3BXGA 2QW1A 3ZQJA 2FEPA 16PKA 4MMZB 5AOAA 1P5ZB 2I54A 5FPPA 2HFJA 1FNBA 5CX1B 4OLJA 2RGCA 4EW3A 1PD0A 5BN1A 2BBWA 4X7MA 2MHCA 3ZY6A 3VXKA 4N5HX 4GIBA 5DNCA 3MYYA 4Z4QA 5DASA 3LG2A 2WV9A 4JU8A 4DJTA 3U7HB 2I6UA 2QRNA 1DMRA 1A8UA 1ESEA 2CL0X 3LCCA 4FQ8A 1K8ZB 4C7XA 5BV7A 4DGQA 2O8NA 4MR8B 3SEFA 2YWFA 3HGQA 3AUUA 4RO0A 4RFSA 1BHO1 1PTKA 3CJQA 2ZVPX 1ARZA 3N2IA 1FX0B 4CM7A 3ZCRA 2PRJA 3AEQB 3NHBA 4HDSB 4KJXA 1IHOA 2HIAA 4F1JA 3KB2A 1ORVA 4DV3B 4GX1A 2B98A 2C61A 3MINB 4W5TA 2ZJ8A 3NGLA 1CNFA 3ABIA 3BIJA 1RM3A 3CYFA 3DW1X 2VH5R 1DCMA 3HUFA 1YS2X 1XMVA 3C6BA 5CVEA 3QUSA 4ZI5A 2QI9C 3IJEB 3PC2A 2W90A 4AMBA 2CD9A 3STUA 2FHSA 2VJPA 3VHLB 1BGXT 1AUXA 3WHIA 5BXYA 4DB2A 2DTEA 3I58A 4L2IA 4H17A 2Q4TA 2L69A 2Y2VA 3PK0A 5FULA 4A9AA 5JROA 4RCZA 3OIGA 4S35A 1H8HD 4NU5A 2DFTA 1RJGA 1RYYA 1IL0A 3V9AA 4UOEA 1XZEA 2WSYB 1VJRA 4FR2A 1N2CE 1KC3A 4CMKA 3C70A 1LSUA 1RTKA 2HMVA 4MXDA 1XKTA 3FFAA 4FQ5A 1SPXA 4TWAA 4P31A 2IXDA 1HA3A 3LUJA 1CJTC 1CVIA 2X40A 1YCGA 2RHDA 3D4IA 4BWFB 4L8LA 2VRNA 2B0JA 3TBKA 3VH3A 4HB2A 1KZ4A 1J24A 3E3LA 3GMTA 2DX7A 4UXHA 2QJOA 3SC4A 1VSTA 1XTVA 1CRQA 1U7ZA 3EVDA 3GW8A 4BYMA 5JPDA 1LSSA 4AF8A 1YZNA 2AVDA 1YQXA 3MUNA 3P0HA 3QFSA 3TK1A 5I51A 3I6IA 2GM4A 4CMGA 4HZUB 3EVBA 3ZK9A 4BZQA 1T8WA 5I3ZA 2G08A 5A3VA 5EIWA 3D54D 3N7TA 4N76A 4UU1A 2W4QA 1VRCA 1RKQA 3AY0A 4Z0PA 3W9YA 4UREA 1WPGA 3I73A 5DM2A 5DXAA 4XSVA 2I2DA 3PJDA 3WMFA 4NCBA 3VC1A 4Y8VA 1T8SA 1KA9H 2G0AA 2AHOA 3ETDA 4C3ZA 4C4ZA 3B6JA 4GNKA 4X85A 5KTNA 4HAVA 1UXOA 3O4FA 1YCHA 3IKLA 1TVKA 2ZKLA 3ICVA 5COBA 4YALA 3T5CA 3HU5A 2VJKA 4QDOA 5IK2A 1WDKA 3IEIA 3FCCA 2W98A 3QPCA 4FWBA 1U8UA 4Y3UA 4L4RA 5H82A 3W04A 3LXXA 3WGUA 3GGCA 5FWYA 3TIXB 4KNWA 3K0HA 5IRCD 5ED0A 4FMCB 2QG6A 3VR3D 3EG5A 1AIPA 3MEQA 5DMXA 2CLKB 2UYGA 2BAGA 5FOVA 1C7QA 3B3FA 3QXHA 5AOBA 3VOSA 3BSSA 4KRYA 4RV9A 3U7IA 2HJSA 4FYYA 3AHGA 3EEQA 4TKUA 5EJAA 4NDNE 1MQ9A 4OJNA 1W4CA 4YRPA 1RKXA 3IT2A 1YACA 2RAVA 3ML1A 4AJEA 2WMYA 1CIJA 4BVLA 3HCFA 4KIFA 3RS8A 5CFRA 2F1HA 3H11A 5A1JA 3CW9A 3PCRB 2C96A 4Q21A 4UUBA 2AEEA 2ZWAA 4J1TA 1MEOA 4UUMA 5G4KB 4F5DA 3PNVA 3M49A 2W6PA 4K9OA 1F51E 3IAAA 4ZHQB 5BMOA 1EESA 1QM5A 2ZIFA 5BSVA 3P2EA 3EA5A 3TRIA 5U1PA 1IATA 1X7HA 3N05A 4HWTA 3W8EA 3B8HA 3W2EA 2C9YA 2F3TA 2IQ5A 2W00A 3C15C 4GLBA 4HBGA 1GL3A 1KOJA 1KMQA 3DULA 3FSRA 1ZD5A 3DGEC 1J0DA 1JU3A 1LPOA 2EJTA 3IVMA 3QU4A 4ITVA 4OHFA 4OBEA 3UMBA 2J9XB 2ODWA 2JFFA 4KWIA 4N18A 1EZZA 3AETA 1AO0A 5GQSA 4DMGA 2GNOA 4ZOLA 3UHJA 2BRUA 4ZO9A 1E3WB 2XX3A 2FW8A 1VHQA 1KYVA 2H4YA 3SD7A 5IN4A 4PPYA 2B5WA 2BPOA 3F4LA 5JJKA 1RHJA 3EAQA 2C2XA 5F78A 4E09A 4NCNA 5FQOA 4CM4B 1SG0A 2BH2A 4XSHA 4FW8A 2H48A 2PCLA 4BX2A 2NVUB 1WZCA 5J47A 2M9MA 3GCGA 1ACMA 4ZVRA 4DLXA 4N01A 3BXOA 2WM2A 1PG2A 3IR7A 3MT7A 3M0EA 1QQ6A 4UCFA 3FPBA 3WICA 4JUCA 4MQ5A 4HEA6 3W5BA 3VSEA 2H07A 3IDFA 4EELA 2XLCA 1J25A 4JJAA 2WUVA 2XRZA 3VO8A 1Y3BE 2VG8A 2AFIE 1Z4NA 4BJ3A 4DXDA 5CXUA 2BGKA 1OFHA 1XX6A 3CWZA 4DPKA 5BR7A 3NTXA 3C3KA 1II8A 4QTYA 1PN3A 3TI7A 5CFPA 5KCZA 1RVV1 3T1HB 5A04A 1NJFA 2OBYA 1G41A 1G6Q1 2P2DA 3DLCA 4M21A 4AURA 4LE2A 4MW7A 3GCXA 2D2IA 1V4VA 5IBPA 3NM6B 2JHAA 2BBOA 1L7RA 2AFHA 1SD5A 3R4VA 1UXJA 1GNSA 3DO5A 5EJ5A 4TKZA 4D99A 3FTPA 1HLDA 3TRFA 1GKLA 4L0MA 1UT6A 5ESDA 4HRVA 4YXWD 1O6FA 2P6RA 4HAYA 3FPKA 2DT8A 4RXUA 5CT9A 3RKSA 1VJGA 4LVCA 2UXDB 2J46A 4IZIA 3B1WA 2YJ3A 4L5CA 1IEXA 1YZHA 4WESA 4ASUA 3UBTA 1QQAA 3N2NA 1YR8A 2IDJA 2QRPA 4FUTA 2YXLA 2LIVA 4AAYA 2DMRA 1G1AA 4ZREA 1RZUA 2F9FA 4BP8A 3ZQKA 3WGHA 3TJRA 1CR1A 2HIMA 4NNPA 5LUBA 4FB5A 4FQ7A 4ZI7B 5KQPA 2GX6A 5ALOA 4IILA 5LQJA 2ZRLA 5CM8B 4LXYA 1SHLA 1JI0A 1IXZA 3IVAA 1YR3A 4HK4A 4QQNA 3RAEC 4X91A 3ANTA 2Z1NA 5DLPA 5IM4A 2PZEA 4TV8A 5HOQA 3KV3O 1NJ6A 1QFMA 1INLA 3BTSA 3E8SA 1AHHA 1FYEA 1TXGA 4B5LA 5JVDA 3HXOA 3P9ZA 2GTHA 2O06A 3PGMA 2AEFA 3PQEA 1XP5A 4Q7LA 1N8KA 4QTZA 1BG6A 1EDOA 2OV2A 3OPYB 1P77A 2KE5A 4N9WA 1U2DA 4FNMA 1ZGGA 1I5RA 5L51A 1GCIA 4IIEA 4ZZ1A 3QLVC 4DBLE 2FCRA 2OCAA 4RVOA 3TW8A 1KDTA 2PK3A 1O5TA 4CQMD 5BP7A 1PS9A 3IRVA 2Q3CA 1JYEA 1H3FA 3K09C 3W79A 1XYGA 1UKVY 4PAOA 1BVRA 1BO6A 3NALA 4X20A 1BN6A 3JD2A 4P3PA 3RBAA 1OVGA 1ZW6A 2HWYA 4QOHA 1AXGA 3HL4A 3KSMA 1YDHA 5CK5A 3AF5A 1I4LD 3AUXA 5ARBA 5JAPA 2PX5A 2ZCUA 3UM9A 1CJBA 3NWOA 2A1IA 1PR6A 1KXJA 2WZDA 3DOJA 4EGFA 4WPGA 3BXFA 2QE7A 3WNZA 4M89A 2VTEA 1DKOA 4G4GA 4AROA 4EYKA 3BH6A 3QWIA 1WHTA 3WDSA 4NICA 3RFCA 2G67A 2VSQA 4JODA 3TDKA 1YH3A 3UMFA 3EGXA 2YNMD 4ZOAA 5IT4A 1Z6AA 3Q6IA 3NHMA 1RRVA 4Q01A 2G1KA 3BL8A 3F90A 4UEJA 3TRJA 3ANYB 3KQQA 3K1AA 4P80A 1T1JA 1CS0A 1GXSB 2Y3IA 4R1QA 1SK9A 5EJGA 4LYGA 4V0ME 1PWXA 4B2PA 1F2VA 1TTHA 1X1CA 4CI9A 2O8VA 5C5IA 3RTDA 4M0UA 4RV5A 3GEPA 3GNLA 1HEUA 3ESAA 4JR0A 1WHSA 2YUTA 5HIJA 3GPLA 3FPCA 3PFHA 1ODFA 2XDQA 1HETA 1UBUS 3WQSB 3FYSA 5D5PA 1U02A 4IYJA 2P8JA 2X9GA 5JASA 5EZYF 3LO8A 1QRUA 3QLTA 5K1ZA 3JD0A 1RAEA 4AECA 1XVVA 5DP2A 4FZ3A 5KKCA 4Q3LA 3OPQA 2BFOA 3GVIA 3HZHA 2GJSA 3BL6A 3DTVB 3EEIA 3PF9A 1N92A 1W93A 2D1QA 5JQWA 1UAAA 3OOHA 2IZ6A 4Y6GB 4K3VA 1IE3A 1Z28A 4J6EA 2G77B 1D3AA 1JHPA 1OMOA 3NH6A 5KNBA 1ID1A 1L7PA 5EL0A 1BH6A 4LKOA 4U4AA 3EXG2 2QU8A 4OKSA 1S2NA 4PCLA 4TL6A 2RBEA 3N70A 4RAQA 4EMTA 5KINB 3FJYA 4MRMB 5IMSA 3S6JA 2HYIC 1LPAB 1JHUA 3EDRA 1KJWA 1P2DA 4QQRA 2FSPA 4KB5A 5HF8A 2R9VA 4O4JA 4QUDA 1QTIA 2WSIA 1EFUA 1S1CA 1YQQA 1UKCA 3HB7A 3RO7A 4MWDA 4CCWA 1V5GA 2AJTA 4TVKA 4MIYA 4ZJUA 1JDJA 4KWCA 3VX4A 3IAEA 3GJ3A 4BQNA 4CKCA 4BAGA 3L7NA 4JVOA 1L3IA 5T8KC 1EXMA 1F38A 3IUBA 1N2EA 2Z6AA 3ZD7A 2V7WA 3U5TA 2FVYA 2EBUA 4O4LF 5K0JA 3O0TA 2VRBA 5GV7A 3WIVA 1UAYA 2EKQA 4RD4A 2O6LA 4QLBA 5DNVA 3JAMA 4MW4A 2W2KB 1T3HA 5ERGB 4E32A 5JZVA 3ZV5A 1J2TA 3H1EA 5LJLA 1L5QA 3CJRA 3T34A 3LPCA 1SK8A 1AKEA 1D2NA 1ZNWA 4I2VA 4QHYA 2PIAA 1DKMA 3UMSA 4FM9A 3KQPA 3IAM1 4UC0A 2AH5A 2CXNA 2ZSDA 1XZBA 4BJ5A 4R1OA 3TPFA 4RK5A 4ZQEA 4QVKA 3GQBB 1EWRA 2MYPA 2R3SA 3V8PA 2ZRPA 1W36D 1GRRA 3HYLA 3ORFA 1Z6PA 4TT3A 1MDFA 1TGYA 4C7OA 2FOLA 4WUTA 2VYCA 2OD7A 1N0HA 2ZBVA 1HUQA 3PUVA 4PV7A 5KYTA 4BN5A 3ORSA 1Z4LA 4PO9A 4MRAA 4UDXX 3QHAA 3AFNA 1J0EA 4FFMA 1FMJA 1UP6A 1JJ7A 2BGTA 2QU7A 3G7UA 4WHMA 3V32A 1IPFA 3NGXA 3RIEA 2OCIA 3DL7A 3EA0A 2QLFA 4RPHA 1VHLA 3B9PA 1HH4A 4N0PA 1AKQA 3JYOA 1JHMA 2NO6A 4ER7A 3AWDA 2HSDA 4Z3KA 1TZMA 1B1CA 3ZWOA 1YL6A 4MR7B 1JU9A 6ADHA 1QYVA 1MRZA 4XYGA 2OBNA 3SSMA 2WAXA 4OQXA 1W1WA 5FT9A 2F67A 3LPNA 5BOSA 3UCFA 1HDXA 5H0IA 2JIRA 1NURA 4ZDKA 1M67A 4JS0A 1A8SA 2H85A 2XEDA 2D0PB 3QTTA 3BCRA 3ID6C 4FMBB 1IN1A 2JKYA 4E30A 3JAKA 3SZUA 1XNQB 2IOFK 4WD3A 3GZ4A 4LDZA 4MVWA 3R7NA 3VNUA 1ODKA 5IH7A 4JN6B 2CFIA 2GAOA 2VZLA 3NKLA 4QUHA 1E94E 4NH4A 4PQYA 2QQ5A 1ZK0A 3ORRA 1KEPA 1PJ8A 2BEUB 5FP0A 1HDEA 4DWVA 3HCCA 3UMMA 3ICEA 4ZO4A 3QV1A 2BEVA 2H0AA 2OV6A 4G0ZA 4BO5A 2GT1A 2COEA 2K2QB 4PX9A 3TGPA 4QHTA 3GD5A 3BHMA 4RDCA 3SJUA 4B6OA 3OKPA 1OT5A 2ZXEA 1DKNA 3SX4A 1IY8A 2VJYA 3BXXA 1PFWA 2A9OA 3EZ6A 4PXAA 5AK3A 2WTAA 3VKHA 5AJXA 3B6KA 1WZEA 3DQQA 2PLNA 4BEWA 3RT1A 2I22A 3HO8A 1VLVA 2IA5A 4Y6LA 2XB2A 2Y67A 5HJ5A 1DAMA 4WI1A 1NBWB 3GRKA 4OYRA 3H97A 3Q5GA 3VSDA 1Z08A 1ABBA 2H7CA 1SCIA 3TLBA 1CEXA 2BIFA 3I64A 1H2ZA 5FOQA 1RVDA 4MP6A 4I5FA 2PZAA 4W9NA 1QIKA 4MUXA 3PGVA 2H65A 4JT9A 5DRYA 4Y0VA 4UHBA 2FQWA 3GJ8A 3W7BA 4NZPA 2HA5A 5SICE 2ZUTA 4DY6A 1JQLB 3CEHA 3JQCA 2M6LA 3ZCTA 3II6X 2BKUA 2PVCA 3SDBA 3RSHA 3ZE7A 2DY1A 3ZXUB 3K32A 5LWHA 4X1IB 1XEFA 5JCJD 4NYIQ 1GRQA 1LZKA 2AXPA 2NQTA 4TMFA 1J0CA 5CGQB 2FSGA 2HCTA 4F1KA 1M1NB 3BFPA 4DWOA 4DXAA 1OXXK 1AB5A 3FF4A 4ZU6X 1QONA 3EOAI 4YUXA 2BHTA 1JIUA 3F8TA 3PXCX 4QUJA 4B75A 4PFJA 1WV1A 5C3MA 2XODA 2YJ6A 4RPGA 3GEEA 4ETNA 5I7UA 5EUMA 1TFRA 2O7QA 4DNOA 2D7JA 1QR6A 3IP1A 4TVSA 1Z47A 2QM7A 2OBLA 1ENYA 4TLCA 4B6GA 4BNVA 2Z6UA 1YS6A 2JARA 3OHSX 4JBIA 1NNUA 2O3RA 1F5SA 4JIGA 4QGAA 1W5AA 3KXPA 3GGPA 1T13A 2JS7A 3CRMA 4JJZA 2VVTA 3VTFA 4P6VF 3QBJA 3RSZA 1GKYA 2CLMB 1GZHB 2GN8A 1KVSA 3C3YA 4LRYA 3RV4A 2LPMA 2X14A 5FRDA 2JG3A 3EVCA 1AS0A 3M1LA 1TYAE 1I7SB 1FPQA 2AI3A 2PKCA 3NAGA 2HR1A 1ZSNA 3MLBA 3FPHA 1E2GA 3RRJA 3IBTA 4DNXA 3KOXA 5KNLA 4L3VA 4DLTA 4JX9A 2JLRA 2JA2A 5A7GA 1Y5MA 4E5YA 1WOMA 4ZVPA 1B8OA 2HA7A 5EE9A 4ZANA 4KQ6A 5NLLA 4AL4A 4PZYA 5EIFA 1EBUA 1R66A 4X6UA 5IUKC 2XWJI 5FUBA 3MFQA 4HXYA 5FFNA 5GP1A 4DA4A 1J33A 3JYQA 4FKZA 4RDXA 4AZTA 5JH7A 1QP0A 2XQGA 3EC2A 3VI3B 1VP3A 3Q3JB 2G88A 2RK4A 5CIYA 4MYCA 2JHPA 1Y6RA 2DFKB 2PR2A 4I55F 3PT5A 4RA6B 4LF7B 3GGDA 3W06A 1V1JA 2LUOA 2F3UA 2HSZA 4DCJA 4ND7A 2VBFA 1CUXA 1G3RA 3LGSA 5DJ5A 3TQFA 3D5QA 3KBBA 4GWGA 4KGXA 3P32A 5EKTA 4CLRB 3ETNA 4K05A 3R5FA 5HVNA 3PNMA 1C1DA 1GYPA 2KB0A 1U3VA 3BBPA 4EJSB 5CYFA 2Y05A 1EDBA 3G13A 3I12A 1JXOA 3IH5A 3M4YA 1Y3DE 4D44A 1U31A 3DQPA 4L08A 4QJIA 4P53A 2PL1A 4WLVA 4Y6RA 4EY5A 1Z2NX 1YRYE 2VJCA 2ZJBA 4REOA 3DL4A 1QE0A 1KOFA 3TEJA 3PNKA 2O20A 4IHJA 1AQ6A 4IMRA 3SZRA 2YWJA 1JR3E 4GZ6A 4QGHA 3C4VA 3S8MA 3KL2A 5JXJA 3PI6A 2VO1A 4D1YA 3DKVA 2B4YA 1WVGA 3OM9A 3LCMA 4R9VA 2QV0A 1E77A 2I3AA 2DQZA 5FFFA 5DPMA 3EEBA 2OMKA 1RPZA 1V45E 4GSKA 2C5SA 2XT0A 4FWIB 1MXFA 1YONA 4HRXA 1L4HA 2PMEA 5I48A 1PK8A 1TAUA 2GNPA 3H42B 4HN9A 3DLBA 3WLPA 1A9PA 5K6RA 5AKXA 1LQTA 2OXRA 5HBRA 3BEOA 4KL8S 4B4OA 3TIVA 3P27A 4MWTA 4CFZA 5IYZB 2R0QC 1NXXA 2AL7A 3H6GA 3K92A 3O1HB 1AU9A 2J4DA 2IXAA 4I4TB 5FWXA 3TOZA 3CRVA 5AQ1A 5JT1A 5JISA 2XUDA 2BUBA 3GG9A 4QRIA 2JFNA 4K6KA 5EUQB 2OD2A 2WPNA 3JPYA 1X8KA 2VZEA 1V3QE 4KW7A 2IHKA 4QQKA 3MTJA 2VQFB 1RBQA 2ICAA 1BCRA 1C1XB 1NNLA 2EQBA 2NADA 2QUIA 3GT3A 4YBZA 2P5YA 2AEMA 3T1YB 3CGGA 4UAGA 2B37A 4XWGA 2DH6A 1BGVA 2HRBA 5BW4A 5CB4B 4DBLC 2O5EA 1RQXA 4MHSA 4DBZA 4KH0A 4WN9A 2V7QA 4GDFA 2PQMA 4KOAA 2RBKA 5TS3A 1TJ4A 2VLIA 1W2GA 3N2KA 4EY6A 2VHQA 5AKKA 3Q10A 3U5ZB 4G5RA 1YE5A 1KHHA 1NY6A 3OX4A 4MB2A 5H1YA 1IQPA 2QY9A 3PVSA 2P9YA 4JSTA 2FUG1 3C3WA 3VR4H 3ZE9A 4IDPA 3RAFC 3FZQA 4TQ9A 4XWOA 4Y0NA 1BIFA 1PZHA 2C4HA 2FWMX 1SPBS 2J7PA 3MQ2A 4ISCA 4J07A 2IHYA 4XGQA 5KMGA 2O0MA 3IDZA 3L6OO 4S24A 5E4YA 3S0JA 1GFZA 1U9CA 4J3FA 2M32A 2J3MA 3GFBA 3M4JA 1N8SA 1DXQA 1RLJA 2RI1A 4BQEA 4AXBA 2ZUCA 4IWNA 3V9PA 4EJSC 5FORA 3ZJ4A 4HJRA 1B0UA 4PGAA 3Q0EA 1ML4A 3NFRA 2OR3A 3DYVA 1C1HA 1HDYA 4FMDB 4O4IB 2EGUA 4RHUA 2E4WA 3TOSA 2H7VA 4BAUA 4EHLA 4C2TA 2Y1LA 3ZDRA 1K92A 1H42A 2E0IA 3TTSA 2AX3A 4FXOA 3GMIA 4MVCA 4U7JA 1U0RA 4XPIA 5AHRA 3TR0A 5JTTA 2QMQA 3W6ZA 2BFEA 1Z0IA 3QKSB 3CRNA 2JGLA 2X86A 3KSUA 3OURA 4K9NA 4D3ZA 4BEJA 3CISA 5AM3A 4Q7JB 5CFMA 1Y7LA 1H69A 2D5AA 1RQRA 1SCUA 3DL2A 3AILA 5DTEA 4OGWA 4HLUA 3WK7A 2ZVQX 2H3EA 4QUGA 1N34B 1L4LA 2QZSA 5AW0A 2GR9A 3K9NA 3EDQA 2PUEA 3DAPA 1XJ5A 2AOXA 4GX2A 3USES 2WUEA 2CXTA 2GXQA 4Z4EA 4EX6A 1RBMA 1P33A 2AYXA 1O5IA 4NJEA 1HEYA 3AY6A 5A1TA 1OBVA 2R8ZA 1V2GA 2FX2A 3S8YA 1JIQA 1FPMA 3CR7A 4G0YA 4E12A 5DGXA 2QOEA 3KB1A 2GEKA 4Y2HA 2I91A 4M1KA 4GD3Q 5TQJA 1I7PA 1TCCA 2MSCB 1SOWA 1BCSA 5JS2A 1L8AA 4LOHA 5JMPA 3WJ7A 3ZDFA 3I61A 3JCZA 5KI6A 1Z5GA 3W2TA 1Z68A 2JVIA 2IUEA 4ROSA 2C0QA 3U1VA 4DMLA 2F4VB 3BK7A 4XX0A 5H5JA 1E6KA 4J1NA 4Y2UA 3W4KA 1WW8A 3WKCA 1XZIA 4U2KA 1GU1A 4M1ZA 1AA9A 3E35A 1ORWA 3P9NA 3PYLA 1T4BA 1UDWA 3T1VA 1UJ5A 2QTAA 1TO2E 1KO8A 1PU2A 2PWZA 3O1IC 2CHQA 3HUTA 3I5UA 3VU3A 4XASA 1D09A 4TVBA 1TM7E 3HCWA 3ZWKA 1Y7TA 3ND9A 5CLGA 5H68A 1O94A 3ESCA 2GJ4A 5E6UB 1XV5A 4F5YA 1Y7IA 3DMHA 3HB5X 3H9UA 1G20B 3W34A 2FUKA 2D5BA 3KFVA 1F12A 1A4RA 1R4ZA 4CQMB 3KB8A 4RCYA 4BNNA 2EEPA 3HA7A 2V4UA 4XI9A 1SOMA 3LT5A 1L5RA 1PTJA 4NBWA 2XV1A 4QEKA 4DADA 1IBLB 5EIXA 2OZPA 2QTGA 4YRIA 1XF1A 5G4LA 3UJHA 1PZMA 4I4LA 1ORIA 3RVOA 2HDHA 5IJ9B 2O2IA 5M04A 3H4TA 1WKBA 2GZAA 2DWQA 3LRPA 1A9SA 1K6MA 1YU9A 1I36A 4ZAFA 4D45A 4EJ2A 4M7OA 1IJBA 2BM9A 2AX4A 2A5LA 1BKYA 1MA3A 3MGKA 3SXJA 1DT3A 1W59A 1AQYA 3IE2A 3UXEA 3D7RA 3N0RA 1NQTA 4JP8A 1WXDA 3G1UA 2QM3A 4DCUA 2CLHB 1POWA 4D5EA 1CZUA 4IH1A 5KVQA 2VAXA 3T99A 3N2LA 5D1HA 3T3GA 3W4JA 1F6WA 1G38A 2JLUA 3ZWCA 1J20A 3BGOS 3EF1A 1AOXA 4YTEA 3MLEA 1FDTA 1UXHA 2IYLD 4OH1A 1NVMB 1KP2A 2ZT5A 3CHYA 3RYFB 2GEUA 1E6WA 2Z4RA 3C5VA 1I6MA 1KI6B 2I76A 5FHQA 5DTQA 4AP9A 3CVYA 1WB9A 1YCDA 4OUKX 2A92A 3M6MD 1TW2A 1JDSA 2J0UA 2HO5A 3JASB 3W8NA 4ZQCB 2IPOA 1R9NA 1JSLA 2EP5A 5E6RA 5AVWA 4ZT3A 4F5ZA 5MN4A 1DC4A 2Y9MB 1CUWA 2PFSA 3IOYA 4Q18A 1DC5A 2ZFUA 3P96A 3UJ6A 2VEDA 3E9ZA 3TXYA 3JD1A 1XDBA 1U9IA 2XE8A 5B3AA 2O4UX 3AYXB 3GVPA 4JAVC 4UW9A 1CG6A 1J99A 4E5MA 2IITA 1MMFB 1P72A 1REQB 2GVNA 2X4LA 1OH8A 4XVHA 2C1XA 1YCFA 3E22A 1DAGA 2I3GA 4JGBA 1MABB 3I53A 4BNLA 5CXQA 1UMBA 4E5PA 5K8IA 3BCUA 2JLCA 4L5IA 4TSFD 1IJFA 1R18A 2H1FA 4HWOA 5KC8A 4KK3A 1FJGB 2NUAA 4IOMA 4EB0A 3EQ8A 5TQ0A 4HNHA 4EVRA 4LN1A 1O6ZA 3PNYA 1KQFA 1NNSA 2YVAA 1OU0A 1PAUA 2RGAA 4J0GA 4L15A 4MWEA 1WSAA 4R54A 1OPXA 2LW7A 5BSRA 2CJPA 2H59A 1L5OA 1RTTA 3FYHA 4NR0A 1U1CA 1YFKA 3I76A 4QXQA 4ALIA 1WU7A 2VSFA 4G5QA 3EWIA 5BWBA 3PSAA 1W6RA 3T7KA 4QM6A 1M2OB 3F5FA 3RHZA 2ZUVA 1YRWA 4CQJA 5AD1A 1Z2CA 2GASA 2R4QA 1RQLA 5EMLA 2J9FB 3DPSA 3QKRB 4DVGA 2YWCA 4H2DA 4RK6A 4AF7A 5A4DA 1IWPB 2LKCA 3R77A 3QKTA 4C7BA 2C7QA 3PKIA 4JGIA 5LXTA 4LOKA 1M8FA 3QYPA 1IY1A 4MUFA 5DHQA 3DXFA 5IAKA 2WT4A 5KJ1A 1EK6A 3NEJA 2VNKA 1F0KA 2CF6A 2GAFA 1GDTA 3ZX5A 1JMVA 3THYA 1SC9A 2EATA 1ZICA 3L7IA 2OP0A 2W71A 2RGXA 4RY9A 3J81A 1JDNA 1SZJG 1WZUA 1LLFA 2M6KA 3I0ZA 4NCIA 4Y2RA 5D5QA 5EJ9A 1KORA 1ZJ5A 2BJVA 3REOA 1TQ6A 3N9IA 4DDUA 1CEQA 1DWPA 1R8XA 3GROA 3JS5A 4DHEA 3PR3A 4YRRA 1XQYA 2FRXA 1O8CA 1YBMA 3D59A 4GEKA 4PLVA 1JJFA 4QBKA 1O8BA 3IPYA 2GILA 1LW7A 1SJ9A 5T4BA 2NZJA 2QDXA 2PKYX 4LGVA 3RVLA 3CRW1 3U3XA 1W36B 1R6XA 1XTRA 3CW2A 3MGCA 2B9VA 3K96A 4OA5A 2GJAA 4EI7A 4Y1GA 4UQLA 2E4UA 3OJ0A 3RS7A 3S29A 5D1NA 3BOSA 4H18A 4V0OA 3HL0A 4DF3A 4OHKA 4ZTZB 2OXTA 4G8DA 1HTTA 1WCXA 4Z7QB 1LVGA 1GCGA 2AMVA 2HK9A 4AUEA 4CNBA 3MT8A 4QVGA 5KYGA 1DQYA 3GP5A 3OPVA 4YAUA 3FIUA 4MGZR 4OAQA 3IOBA 1AG9A 3PHIA 2Z6QA 3L9WA 1GARA 4K9PA 3DV0B 1IONA 1R2QA 4PC6A 4C87A 1N8TA 1IYZA 5TPWB 1W9MA 3KTAA 1K98A 3D2CA 3STTA 4IUYA 3WNBA 3B7WA 3FWYA 4QC2A 5FDFA 3LUPA 2F48A 2UZ1B 1PJAA 4YP0A 3R9XA 5FPKA 2WQ6A 3Q4GA 1P7WA 1QWOA 3F78A 1J2JA 1D2GA 2XQFA 2NO9A 2F55A 1X1DA 5LP6A 2WV7A 5A0TA 4CETA 2W42A 2VEOA 1MZPA 5FL3A 3PKZA 2PLAA 2JEZA 2QK4A 2I4LA 2QLMA 3BC1A 1JHQA 3KC2A 3CX8A 4HOYA 3VSAA 4Q48A 3VC2A 1U2PA 2A3RA 3LA8A 4LYYA 2H9IA 4EY7A 3BWBA 3SICE 1UJ4A 2CDRA 1XTBA 4OG2A 1V9SA 4IDNA 3ZS9A 1VL0A 4RBNA 5I4IA 3P45A 2G9RA 2W7TA 1A95A 1EVJA 1SUFA 3DKKA 3JPWA 2H54A 1P1IA 2RB5A 4JP3A 4RELA 5KJFA 3EWSA 1AX9A 4QGBA 1G6KA 3I4CA 4WTOA 1IB0A 2J3DA 3NHFA 1TF2A 2Y1EA 2ZS8A 4UXIA 3U3DA 3WK5A 2BF7A 3QPBA 3D0QA 3JALA 5AK6A 3OMWA 4JYBA 5DKFA 5TR9A 3F71A 1QCZA 2B94A 2BR5A 2NVWA 2PRYA 3LLVA 4MHOA 4P3XA 2WJPA 3N2GA 3AV3A 4PYIA 3OC6A 2NU6B 3EZ2A 3IXMA 3FHTA 4BUJA 4FHGA 3DAYA 3E9QA 4XM0A 3T0GA 1YB4A 3IDSA 2CUZA 2HFKA 4BB9A 2HU7A 1F0YA 1W85A 1ZG3A 3QWFA 4B7AA 1BXKA 1DRVA 3H5WA 5KYNA 3RADC 2O8DB 3ZLVA 2Z98A 3X3HA 1ZVQA 4EF5A 3REGA 1U81A 3KYCA 4NAHA 2J9YB 4NF2A 5LD2B 2B4KA 2D2FA 3CMCO 3IMCA 2P90A 3BA1A 1RQPA 1TVEA 4JLNA 5AM5A 2R8BA 3QEKA 3ZWMA 1RHUA 4IV0A 3D3WB 3L0CA 1XD2A 2WVHA 4CHTA 5H4GA 2PUCA 1OZHA 2CBGA 1YVUA