2XDYA

Crystal structure of the n. crassa qde-2 ago mid domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
127
Chain Sequence
KIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
publication title Crystal Structure and Ligand Binding of the Mid Domain of a Eukaryotic Argonaute Protein.
pubmed doi rcsb
source organism Neurospora crassa
total genus 41
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xdyA00
1Z17A 3BILA 3JPYA 3LUHA 4F06A 5JNWA 4OLBA 3LKBA 3K9CA 3OM0A 3C97A 1Z13A 2GKGA 4YLEA 5PNTA 1JFTA 4KQCA 5FWYA 1E6MA 3TD9A 4B09A 5KC9A 4MS3A 4Z4FA 1C0EA 4Z4CA 3RQIA 1RZRA 4RY9A 4OTZA 3L6UA 2FMHA 1H9CA 2OENG 2VUHB 1QO0D 1TLFA 3GYBA 4DQDA 4KVFA 4EYQA 1PUXA 1JF8A 3GWGA 4LE0A 5EWLA 4RK4A 4W5NA 1JWLA 3RVNA 5B3JA 2H0AA 3BBLA 3CU5A 2FN9A 3EQ2A 3LUGA 5BR1A 4Z4HA 2AYXA 2R48A 4XFKA 3QX9A 3RVSA 2OQRA 2QV0A 2MYNA 4YCSA 3HDGA 4IGAA 4IF4A 1NTRA 4MR7A 1LJLA 3CS3A 4FE7A 3HEBA 5KQMA 1BDHA 4QPJC 4EYOA 1TJYA 1Z12A 1GCGA 4YO7A 2FN8A 3CG0A 3KTOA 4MR8B 3EDCA 2IPLA 2PJUA 3CG4A 3RVQA 3IDOA 3W9SA 3D02A 2J48A 5T3YA 3HM9A 1FSPA 3MA0A 4RSMA 5TPZA 3OLXA 4PZ0A 1ZITA 3H6GA 5DTEA 5GOTA 3MM4A 1QP4A 2GWRA 3JS5A 3F73A 1RNLA 5DLEA 4G0QA 3B2NA 3TX6A 4G0MA 1F51E 2VUIB 3QEMB 1LK0A 3H5LA 2ZWMA 4XLTA 4MQEB 4G0YA 4Z9BA 1PEYA 4G86A 1JLKA 2X7XA 4G97A 2LPMA 2BGGA 1QMPA 4IMIB 4LDZA 3HK2A 1FFWA 1KRXA 4NCAA 4NV3A 4Z0NA 3KJXA 2PAFA 1FFSA 1PEAA 2Q5CA 2IOYA 1ABEA 4OLAA 1VPWA 1D1PA 3H5OA 2GX6A 4QYWA 1C4WA 4QYMA 3IPCA 1A04A 4MLDA 2A9QA 2FW0A 4RU1A 2FMIA 4EGSA 2AYZA 3H75A 4MR9A 1EWKA 3G85A 3I09A 5CHYA 2HJ9A 3N0WA 1D4ZA 3GA5A 3EQZA 3OMXA 1DJMA 1M5TA 4RV5A 4G0ZA 4UHJA 3O1JC 5IBQA 5FWXB 4RXUA 2YHBA 2FLKA 3IPAA 2E4ZA 5FBHA 2M1ZA 1PNTA 2LUOA 1Z25A 4G0XA 1I3CA 3JVDA 1MIHA 1UDRA 3OQNA 1E2BA 2MYPA 4Q7EA 1M5UA 4MS1A 4OG2A 2RJOA 3KLOA 4UHKA 1A0OA 4WXEA 4MQFB 5DKFA 4KZKA 2QU7A 3C3KA 2JVIA 4WWHA 2FQWA 3RVOA 2WJAA 4MRMB 2HPHA 3EJWA 4H60A 1ISRA 6ABPA 4P1ZA 3E3MA 1D2AA 4YGXB 1R8JA 4ETNA 3LUDA 1SRRA 2NZVG 4TLLB 3QLTA 4IRXA 3QX8A 3HS3A 2E4VA 2L18A 3OM1A 3N0XA 1Z15A 4Z4GA 4JB0A 4MLCA 4HNRA 3Q9SA 4XASA 1ZGGA 4H3HB 5E3JA 1U8TA 1YTUA 2F8TA 5TQ0A 2H3HA 3OO1A 3QLVA 3EGCA 5KI6A 2PUAA 4MS4A 3NBMA 1TVMA 4E7PA 4WXMA 3C3MA 4Z9AA 4LE1A 1MB3A 2PUEA 3LUCA 4KMRA 1YK0A 1A2OA 1DBQA 1ZDMA 1ISSA 5EWMB 1QO0A 1JFVA 4GNRA 3KHTA 3RVJA 1FQWA 2WRZA 3GBPA 2NT3A 2NZUG 4RXMA 4YP9A 1BDIA 1T34A 2ZAYA 4S04A 1W25A 4EVQA 1PNRA 1EAYA 3SG0A 2L17A 2MSLA 3GV0A 2R25B 3H5WA 2FEPA 4N41A 2JVJA 3JY6A 3RVLA 3RVPA 4DADA 4D6YA 4LZLA 3HZHA 2CHFA 1KGSA 1CYEA 1NXWA 3ILHA 5EWJB 5ABPA 3A3KA 3O2JA 2QSJA 4HNSA 3Q7SA 4XXHA 3BREA 4NCBA 5D2CA 3O1HB 1DG9A 3OLZA 1U2QA 4RK7A 3DLBA 3EODA 4S05A 1L5ZA 1D5WA 1MAVA 4RWEA 3LKVA 3EULA 2PLNA 4N47A 4D74A 3RH0A 5FBKA 5F64A 4EYKA 4P98A 3QLVC 5IUKC 2WJWA 3H5TA 4JA2A 5JNUA 1U0SY 1URPA 3GL9A 5IULC 4O5AA 1QQBA 1EHCA 2NUBA 4FE4A 4KK3A 1M2FA 3OLVA 4MR8A 1JBEA 1E6KA 2QR3A 1ZN2A 3C3WA 1XWWA 2IPMA 4JB2A 4O1IA 4JASB 1RZRD 3SQNA 4EY3A 3LUFA 2W42A 2MSWA 5T7BA 1LBIA 3HV2A 4XAQA 2R4QA 2P4UA 3HDVA 3MIZA 4IILA 4LX8A 3QEMA 4RY0A 1U2PA 4KREA 3ILYA 1USIA 2VYCA 5CNMA 4MQEA 3MQ4A 5HKOA 1SXHA 2PL1A 1F4VA 2I6FA 3HUTA 4ZMSA 2PUBA 3CNBA 3ROTA 3CZ5A 4OBBA 5B3JC 4KRFA 4N0PA 3QELB 3A10A 5TPWB 1RXIA 2E4UA 3A0RB 3NNSA 2V0NA 1JX6A 4MGEA 4ETMA 5C5CA 1IIBA 3QEKA 5IUJC 3CFYA 3SM9A 3KKEA 2PUGA 4Z4IA 2RJNA 1U04A 4LE2A 3TMYA 4YWHA 3KG2A 2MSKA 1DZ3A 1JYEA 1ABFA 3K4HA 2FQXA 1YVUA 1AB6A 1GUBA 1DCFA 5FWXA 1Z16A 2HQBA 4RK0A 4CBVA 4D6XA 1QP7A 1XHEA 4L85A 5JS2A 2E4WA 1JDNA 5CNIA 4EYGA 1MB0A 4JAVC 4MQFA 1APBA 1VLZA 1W9HA 1E6LA 2JK1A 2A9OA 2N9UA 1LBHA 3O74A 1QQAA 2JBAB 1ZGZA 3TO5A 3JTEA 3N0RA 3CZCA 2RDMA 4MRMA 2JBAA 3RVKA 3T95A 3BRSA 3UK0A 3CTPA 3M9WA 4Z99A 1NXPA 1SXGA 2FMKA 3URMA 3KS9A 1TM2A 1ZAYA 2YHAA 1GLGA 1SD5A 3MYYA 1K66A 2JRLA 4QICA 1ZH4A 3SY8A 1JDPA 2FSPA 3DLHA 2PUDA 2LBPA 5TQ2B 4IMJB 1BVHA 4TLMB 4O1HA 1SXIA 4RK1A 1BDJA 3HO1A 4LDAA 5C5EA 1RPJA 1DCKA 2PMCA 3Q7TA 1YMUA 5KQGA 4PYRA 2IDMA 3IP6A 3I5AA 4EVSA 3H5IA 1DBPA 2WB4A 1DRKA 3KYJB 1YS6A 2PUFA 1CEYA 2FMFA 5EWMA 4HNQA 4FB4A 1YMVA 2PKXA 2PE5A 3OO0A 4NICA 1RXEA 3F6PA 4YRZA 1P8AA 4LRQA 2IPNA 3H1GA 1LJUA 2HSGA 3DZDA 3F6CA 3OMWA 4E7OA 3SNKA 1ZY2A 1DRJA 1OXKB 2FKAA 4F8JA 4ZYLA 5JNSA 1QKKA 4JOQA 5IEBA 3CHYA 1P6UA 2FEWB 3IP7A 3T8YA 1EWVA 4DN6A 3VNAA 2CD7A 1NXXA 1OXBB 2B4AA 4L4UA 5FWYB 5EWJA 4F3TA 1KMIY 1JL3A 3TB6A 1NXSA 3HVRA 4MS3B 4TMYA 1GCAA 1VKRA 2MYTA 4WT7A 4F12A 1YS7A 4WZZA 2A9PA 3FDFA 1Z18A 2JVKA 4RXTA 1QPZA 2IKSA 3NHMA 3KYIB 2QXYA 3FGZA 3EAFA 4RK5A 5JNVA 3N75A 3H1FA 3NNDA 3RVMA 5GQSA 5BRAA 4ML3A 1NXVA 3QK7A 4H3KB 1JYFA 2P9HA 2FLWA 5HM6A 2L19A 2QW1A 3QLUA 5EWLB 8ABPA 3Q41A 4RDCA 1M2EA 2WWVD 3GT7A 4EUKA 4ZMRA 1Z2EA 3IP5A 1USGA 3LTEA 4YS6A 4PICA 4N03A 3RVRA 4N76A 1AB5A 1HEYA 4KPYA 2GBPA 9ABPA 2JB9A 1S8NA 4TN5A 3O2SB 2HQOA 5IUNC 3O75A 1L5YA 4MR7B 1GUDA 3NHZA 4MAAA 1NXTA 1D1QA 2IYNA 4KV7A 3VNBA 4G0PA 3DGFC 5BQ3A 4OATA 5I4CA 3HXMA 1NY5A 3O21A 2QVGA 4XARA 3UKJA 1DCMA 1MVOA 2R47A 3S99A 1J56A 2CHEA 4MPTA 5KWSA 3CRNA 4RS3A 4PEVA 3T6KA 2MYUA 1P2FA 2VK2A 3N8IA 3UUGA 5CNJA 1P6QA 2GI4A 1ZESA 3HCWA 4N0QA 3FFXA 2LIVA 3IP9A 3O2QB 4RK6A 4Y9TA 5HQJA 2L2QA 3OLYA 3CKMA 4GPAA 5IC5A 4EVRA 3D8UA 3LUKA 1DC7A 1TMYA 5DCLA 3OLWA 4W5TA 1KRWA 3JPWA 1DC8A 2FTKE 5IEJA 4MYRA 4Q6WA 3OQOA 1JH9A 5JS1A 4KFCA 3P9YA 3QELA 2FVYA 4Q6BA 5TPWA 4RKQA 2QZJA 4HYEA 1WETA 2PL9A 6CHYA 1USKA 2NT4A 3HSYA 3GBVA 3MF4A 4ZPJA 5TE9A 1PHRA 2F8SA 3LFTA 1B00A 1NATA 4WUTA 3CLKA 3O1IC 3N53A 1QNLA 1Z26A 7ABPA 3QLUC 2KYRA 5JNRA 1BAPA 2E4YA 5TPZD 1DP4A 3R0JA 4W5QA 1ZH2A 3SAJA 3BRQA 4ZJPA 5HSGA 3I45A 1ZHHA 3M6MD 1VRVA 4KQ9A 4RY8A 1Y1LA 4MR9B 3L49A 4ETIA 3HJFA 3E61A 3H5VA 4PE5B 1ZVVA 3LMKA 1YIOA 2RGYA 3LUJA 1NXOA 2HQRA 4RZSA 5TQJA 2PUCA 3I42A 2B1JA 1FFGA 3JVIA 2O20A 1YK1A 3A0UA 3DGEC 5JNTA 2CWDA 4Z4EA 1JHZA 3FMVA 3G1WA 3H6HA 4MS1B 4W5OA 2IPAB 5IX8A 3LOPA 3F7NA 3Q7RA 2FEKA 3H1EA 1BA2A 4YR7A 3T38A 1EWTA 1JFSA 5KQPA 5DGCA 3HUUA 3ROFA 1K68A 3GRCA 1QP0A 2JCGA 2FQYA 4M88A 3KSMA 3OQMA 5TQ2A 2QVCA 3C6QA 2DRIA 2WMYA 4G0OA 4JP1A 3M9XA 4KK4A 2M98A 3KLNA 2E4XA 1DBWA 2A9RA 1EFAA 3KCNA 2XDYA 4RKRA 1XHFA 2ID7A 3NNNA 2ID9A 5BRJA 3FFWA 3Q15C 4YV7A 4NQRA 3N6VA 2FXIA 5CNKA 1CHNA 3MMNA 5TQ0B 2LP4Y 3FFTA 2WY2D 5KC8A 4KNYA 1Z2DA 4MS4B 2TMYA 3DBIA 4F11A 5ED4A 4W5RA 5KQLA 3LUAA
chains in the Genus database with same CATH superfamily
1GSHA 3E22A 4PRLA 3REQA 6REQB 2BI4A 5K8IA 3T99A 1EXVA 1U28C 2X0NA 5HF5A 4B7UA 3KZKA 4D0RA 1Z2OX 4A92A 3DL0A 1DO2A 4RD6A 4X7BA 4YRFA 1XJ5A 1E6MA 4LHEA 4W8HA 1YJAA 2J41A 4OUDA 3BFKA 5BYBA 3REOA 4L5YA 1C1YA 2AG8A 1Y7PA 5H59A 4WEQA 5IDVA 2NMVA 3L1IA 5B7GA 3BQ9A 4RY9A 4AUKA 5JJ5A 1FUEA 3OZAA 1GCUA 4CL2A 5D3MB 1CEEA 1FFXA 2RK6A 2G1JA 2PPLA 3MWLA 2DC1A 1II8A 3KC2A 2QY6A 3QKSB 4L9WA 1P9LA 1Z0IA 3DXXA 4N9QA 3TOVA 1A69A 5E4TA 3OM9A 5K01A 1FXUA 4K88A 4GQBA 3F97A 3OFVA 1WB5A 3MAAC 4W5NA 4HAIA 4KITB 3OD1A 4LMBA 4UM5A 5AOCA 3I9FA 1P1HA 1R6TA 1YA8A 1KJYA 2BFOA 3A4LA 3C24A 1VA5A 1QHHB 3C98A 1EUDA 2J4DA 2L69A 2V45A 1PZGA 5E6UA 4MK4A 2NPOA 1U1FA 1A9OA 3EEFA 4MB0A 5KKNB 1SIOA 1M8JA 4G5YA 5CJJA 2QD2A 3AJAA 5FPHA 4BFUA 3UAWA 1DKOA 3T61A 4FHDA 1SC9A 3FI9A 2YDXA 1NDUA 1T91A 5JALA 5IJXA 4QDUA 3CH5A 1THGA 3V7NA 1GZ4A 1V0JA 4MQBA 2X23A 5AUPB 4QUBA 2NZ8A 1A95A 4QPJC 2WJYA 5DJ5A 2XY4A 3GZ4A 2V5UA 5F33A 3ZCPA 4PU0A 5FOUA 4BO5A 4F9FA 3PNMA 3QTTA 1IMJA 3KKPA 2NIPA 1N34B 1NWHA 3ABQB 4DDWA 2POCA 1HUQA 2G83A 2P65A 4IQ0A 4DWJA 1KO4A 3UW3A 3V8PA 2BGWA 2PZKA 1KEEA 4CLXA 2X5OA 3TI7A 3PGXA 1SCQA 4KIUA 2OECA 2YICA 3TN7A 3RRYA 4RCZA 1FBNA 1RMTA 2I6UA 1I2MA 1M7HA 4IDDA 4EP1A 5KTRA 2OZKA 2GAJA 2P4HX 3C41J 3I28A 4UAVA 3IV9A 3W5IA 1KK0A 5INTA 4IJQA 2OFXA 3FGNA 2PMEA 3WB1A 4QGGA 2IH4A 4BBPA 4EHHA 1FLNA 2QLLA 5DW0A 5HKKD 2BZ0A 4KNVA 2ZSJA 1JAXA 3KAKA 4L78A 4EI2A 4GLLA 3M89A 4KP7A 2X4LA 3RTDA 4IHQA 4X92A 5KNBH 3VZDA 3FZGA 2HO5A 2O59A 2BSXA 2P6MA 2VDQB 3ZGLA 1Q0HA 2EJUA 2XUQA 4HFMA 4RGBA 2YV5A 3HU3A 4QGBA 3M4ZA 2J0VA 4AJHA 4D4KA 1O0BA 2FZKA 2QUJA 1ODLA 1O9GA 3CSDA 3RLFA 1OV4A 5B30A 1W0KD 4WOCA 5KWIA 4Q9HA 1OGIA 5ENZA 4EG7A 3FYUC 3IIJA 4FINA 1ZM7A 4V39A 3V42A 1NYLA 3LCRA 5AVXA 5EIFA 3TE7A 1GO2A 4F2GA 1SU7A 1E3SA 4MB6A 4H6WA 3IIKA 1STOA 2GM3A 4HQOA 1WDWB 1E0AA 4K6MA 2FX5A 3BAZA 1Y3IA 4ND3A 5CK5A 4EG6A 1E2BA 1CZUA 1HDYA 2J0UA 1EJ6A 1LQ2A 3A9VA 3CNHA 3DB1A 1Z8DA 1KZ9A 1T0JB 2RKOA 1R5BA 2V6IA 4TTQA 4D80A 4RORA 5B4VA 3G49A 5BO5A 2R0QC 4L6AA 3T7EA 3SEZA 1B73A 1LGYA 3AL2A 4IDFA 1KDRA 3K1YA 4UW9A 5AWFC 3ROXA 3WQSB 3S2ZA 1GZ3A 3U3XA 3K8YA 2OO7A 3BD7A 4Z0PA 1P9NA 3WV4A 1U0TA 1GLVA 2ZB7A 1YRQA 4XD2A 4UTZA 4HH0A 2OV4A 3UV7A 4D25A 1Q91A 5G1PA 1ISGA 4KQ1A 2CHVA 3PVSA 3BHJA 4ZAWA 5C4IA 2INGX 3L41A 3SNHA 5EUBA 1EFHA 1RRFA 3N0XA 1S8FA 2FPPA 2XNCA 1F9EA 2BONA 3D5QA 2JKZA 3L1VA 4GC5A 4R69A 4TWRA 4BN4A 1X7YB 1YTUA 4EK9A 3L46A 1GQ2A 4RL4A 4Z0TA 4B2IA 5TIIA 1KEKA 3QXHA 4Y1EA 4XIYA 3F1LA 5JS7A 1H1TA 1JV2B 4GF5A 1IZ0A 3RHZA 4Z9AA 2JFYA 1DBQA 2E4AA 1ISSA 3IFSA 5JAIA 4KN5A 1JWAB 3RD5A 3N0VA 4JEUA 4DM4A 4FFSA 5DMXA 1BMFD 1E77A 1SC1A 4X8LA 3SBDA 5J23A 3HCPA 4EHDA 1T34A 3LHDA 3M4YA 1NJ1A 2BRUC 2OP0A 5K45A 4RSHA 3HR7A 1ZK4A 3HKDB 2Q7DA 3RJ9A 3AH8A 4N41A 5DNWA 1IWBB 3BDIA 3LX4A 3P9NA 2XZLA 3RVLA 5IP5A 3RVPA 4FFRA 4KPGA 1QU3A 1MOZA 3BT7A 1AKYA 2GVNA 1ATIA 4BVEA 4RE5A 1NXWA 4V1CI 3O8NA 1MHPA 4HAWA 3MMXA 4DIOA 5IDQA 3IR5A 2R5WA 2EJWA 3PKZA 1S7GA 1P5HA 3ROQA 3T0GA 2G04A 4AJKA 3PC8A 3R3ZA 1YACA 3HUFA 3NBZC 3NC0C 1GTZA 2AFIB 4W63A 1I0LA 3PXDA 2ILVA 1X3LA 4L4RA 5JSYA 4F4HA 3M1YA 1E1RA 4FLEA 3T5MA 1CIPA 3GVPA 2OY0A 3BGWA 3DE2X 4JD5A 2H18A 4UC0A 3RYTC 3WL5A 2P5UA 3FF1A 2ZYWX 4NYJQ 3AERB 4DDKA 3V6MA 4OI4A 1VJ0A 3HJNA 4URXR 4Q3NA 2HWYA 1GGJA 2OYSA 5JJCA 4ABTA 1OPRA 5FBKA 3UGJA 1YQEA 3V34A 4M0MA 1FDRA 4AIRA 4JA2A 4PY2A 3IV7A 3SQOA 3W3ZB 3EIUA 2GK6A 4LHXA 4NCXA 1I5EA 5A71A 3AK4A 1JBEA 1R50A 3C3WA 2W0SA 2DFKB 2ZSHA 3KR1A 2IPMA 4P33A 1KGDA 1UQRA 4L76A 5CX4A 3S27A 2QWXA 1G291 3GDGA 3UIEA 1HQYE 1FLAA 2BFFB 4GLOA 1E58A 3QXXA 4GPD1 4ZAVA 1T9GR 4UBNA 4ZVSA 1Y9EA 3ER9A 5DEOA 3G8YA 3IE1A 4MHTA 3WJAA 2BGMA 2H9YA 1WXIA 4X0EA 1RPNA 1UBRS 2DHEA 5L95A 1UBGA 2RGGA 3OKPA 2PJZA 3MG9A 4DLPA 1VDZA 2I67A 1CFZA 3B7WA 1BU8A 3JD3A 2VP6A 2WG2A 3JZFA 4EKDA 1EGMB 4TSFA 3VPXA 3WQBA 4NXNB 1E7QA 1IN4A 5KNLA 3ONWA 1HNWB 4AS3A 2XKKA 2P0EA 4YFVA 1YL6A 1CCWA 3KHUA 1UWKA 3DZJA 1ORHA 2ZTHA 1Y6FA 2PUGA 3AR4A 2DLCX 3KKEA 3BXHA 3VR5H 1IBSA 2XE8A 1V7PC 1R1DA 2Y1CA 3CEMA 3W3AA 2HTEA 4BMYA 2C8LA 1FL9A 3FUCA 3EPJA 4WCFA 5JQGB 4PO1A 4A10A 1SUDA 2BE7A 4NV0A 4D98A 2F7SA 2VK8A 1OHHD 2P1ZA 1Y80A 5F1OA 1DCFA 2J7KA 1GFWA 2Q0HA 3CCBA 9GPBA 1NVAA 1VCHA 2O54A 3G9ZA 4IIDA 1DKNA 2B8TA 5ICEA 2CJWB 4FLFA 2LD4A 2YOHA 1VMAA 1XHEA 1NJSA 1PR1A 5G4KA 5JS2A 1JDNA 2OHFA 4NFLA 1TIPA 1EM6A 4EMTA 4AYTA 4FUQA 1N2ZA 3QFCA 4MTLA 3PNOA 3EXIA 3Q40A 3U56A 2JCVA 2XUHA 4C21A 4I6JA 3HBJA 5CYFA 2F1RA 2WJIA 1HORA 3ER6A 4DSNA 5AW1A 3CM0A 3EXHA 2PV0A 3CEPB 4L15A 5CYGA 1CUWA 2JBAA 3IMKA 2ETXA 4MJXA 3T95A 4HDOB 4F5DA 4NK5A 3M9WA 1VSVA 1NXPA 3ZW7A 3OJFA 3I23A 1TUBB 3N1UA 3URMA 1RQXA 5AJUA 3HP4A 4GHWA 3RK1A 2JRLA 3B70A 3R76A 3QGMA 1ZCBA 4A8TA 1CRQA 4KGXA 1BVHA 1ADCA 4MUBA 2HKIA 3O4RA 4BLVA 1LRLA 2HWXA 4GUAA 5E2IA 2F17A 5IFLA 4XVQA 8ATCA 5B12A 2WSBA 1CP2A 1CV2A 5HIJA 1I6KA 1O95C 5I8PA 4UU0A 1TAGA 3QFFA 2A5FA 5HK8A 1C50A 3ZHYA 4I5EA 3UJDA 1YB6A 3DKIA 1LLQA 2B7CA 4JBNA 5AHOA 2XB9A 1MU0A 3U4HA 4YT8A 2P0YA 3NALA 3CGGA 2XWPA 1J1UA 3DZDA 5C51B 3MILA 3EF1A 3RGWS 5BVHB 2OORC 4XWWA 2XDWA 1JI0A 1WTCA 2CE2X 4X1YA 3RVBA 2IPXA 4JITA 3V2HA 4ASUD 2VAWA 4L9RA 3F6SA 3MINB 1G59A 1Q1EA 2E1PA 3TLEA 4B3GA 1SD2A 4HNHA 3ONVA 5EMHA 2PBRA 2V1XA 3HZRA 1N1DA 3KXIA 1ISMA 1YZ3A 4CR7A 1PUJA 4QSHA 4A0RA 3ERCA 1XXHA 5TMEA 1VBMA 4OKSA 1HMPA 1LS1A 2YUIA 2IF2A 3DOHA 3KDSE 3MRSA 4ESEA 3K7EA 3K92A 5GONA 5FBVB 3ISJA 1CQJB 1ENOA 3T1NA 3G0CA 3DR5A 1O0CA 1B8NA 1GNLA 4PR3A 1QM5A 2BBSA 2GXSA 1L9XA 2W4QA 5HM6A 4AUMA 1KO5A 4LMAA 3B6EA 4POOA 4NDZA 4GO1A 2YZMA 1J33A 4YFYA 1FTNA 3Q9NA 4LECA 2OLKA 2XTNA 1UBOS 3CUUA 3TLBA 3VR2D 1HEIA 2QL7A 4HX2A 4AZSA 5ALVA 5C7LO 3PP8A 5DIFA 5EIAA 1U2RA 2JLAA 3MHPA 4CR6A 9ABPA 5AW9A 3LX8A 2PQ2A 3O75A 3DQPA 3PCRB 3B6MA 3ZE0B 4ALLA 4UZFA 3W6UA 2XXJA 4QT0A 4IG4A 4ZFNA 3ESDA 2FWBA 4CLRB 2MU1A 4OREX 1WSAA 3UQZA 4LHVA 2CL5A 3PDWA 4XYBA 2J67A 4YDHB 5LR6A 4LYGA 4IXDA 3T6KA 1W35A 4A9AA 3PR1A 2AFHA 4O8ZA 1UK7A 4QDJA 2GM9A 4KMSA 4ZVLA 4D5EA 1P6QA 2GI4A 4PG6A 1LK5A 4XGKA 1J5EB 1KETA 4RK6A 5GINE 1L5WA 4QDZA 2X58A 1KH2A 4JIMA 1LLUA 3G2NA 4B5KA 1A8PA 5B3AA 3UV6A 2BVNA 2Q99A 4II7A 3RFXA 3GAAA 3K70C 3G5UA 5K03A 1CRZA 1IM5A 1HZZA 2GHQA 2XTZA 1JH9A 3LRPA 2AI1A 3P9YA 4OAOA 1MZPA 5JTTA 3HWWA 4PCVA 3SC2B 1FNNA 3F90A 3QU5A 6CHYA 3H4IA 2DHCA 2XBMA 4HWSA 1PHRA 2PCJA 5CIYA 4DA7A 4R3NA 3CLKA 2EKDA 1Q1BA 5DH9A 3AB7A 2WHPB 5AMXA 1QNLA 4D3SA 2AD5A 2ZIXA 4B4KA 1UJ5A 1SCDA 1NKTA 4Y30A 3RRNA 3RF6A 3H2SA 3GFSA 1ID1A 1QH0A 3T3DA 4EKEA 4AJJA 1R3DA 3CWQA 3LCCA 4CG3A 4CKEA 4YJ2A 1UKCA 5FTJA 2DG2A 4CMIB 4NG4A 3C3YA 1G2IA 2P67A 2FZWA 2IJGX 5K3BA 4LBYA 1QMGA 2ACEA 2WLSA 2Y4OA 3L43A 1F5NA 5HQ3B 4BVLA 4IFBA 4J4TA 4NU8X 4OSPA 2IT1A 4JZYA 4MLZA 3FMIA 4YRDA 4PX9A 3RABA 1DX9A 4OHCA 3LI2A 1AE1A 1AV7A 2FP4A 4YN3A 2WZDA 2VBGA 1U2ZA 3B6IA 1TAQA 2PUCA 3IO5A 5K5EA 3TLJA 2BEJA 4HFJA 5AW7A 3TJMA 2HIHA 2OZLB 4GLJA 1VL1A 1KFBB 4N6OA 1LS6A 3ZDBA 4QGSA 3UXYA 1WSDA 3OPXA 3SYNA 2X6TA 4AS1A 2FPXA 2Y0EA 3PSAA 1JFSA 2FMTA 5A4MS 3DZ8A 5KQPA 1NBAA 3HUUA 2VDNB 4S35A 5JNVA 3OIVA 1B74A 4WZAB 3ZHQA 3UMYA 3DLTA 2V7XA 5C2JB 4F3KA 1TKCA 4TMZA 3KSMA 4BRZA 3VX3A 2F8LA 2IL1A 2YHUA 4GXNA 1V2HE 5KTYA 2ATXA 4YAWA 3FNFA 5K1ZA 4L0MA 1AO0A 2LWIA 1YCGA 4Q9NA 1K5HA 4OOEA 5DX8A 3RRJA 1W0CA 2JK0A 2F8MA 3DV9A 1WY7A 4BS9A 4CRWB 1U0LA 2OTCA 5K3SA 1GPDG 3WLIA 5KEIA 4GBMA 1XZGA 2R96A 4R0MA 1I1OA 1L5VA 1N7JA 2JHCA 3ZU3A 2MTBA 3CLUD 1N6PA 2C1ZA 3ZIAD 1CQZA 1UZNA 3JR3A 1D6NA 2QE6A 4Y2QA 4DDTA 2JARA 1COWA 2ZG6A 2TMYA 2A0KA 2FZVA 4IFIA 2WV7A 1GHTA 5EXDA 2R86A 3QF4B 3KWJA 2V0GA 3RU7A 1C1XB 2HPAA 4URVR 1IZ9A 4CF6A 1J70A 1RZUA 3EBLA 3GLQA 4NBVA 3TAXA 2Q4EA 4HYQA 2DHRA 5JNWA 5CX1A 2BJVA 4IEEA 1EIWA 4I1IA 1GUYA 1KNXA 3JV7A 2BKXA 3HY3A 1WLYA 5I48A 4OQPA 4KAFA 5EINA 4I99A 1THTA 2L0XA 1BA3A 2BJWA 3CMCO 3FSEA 3GK3A 3GJSA 4HFNA 3EQ8A 4OCZA 1XL1A 4OJMX 4OXXA 4RQAA 4ZQFA 5FI3A 5BN4B 4EKYA 1B14A 4F72A 3QV1A 2UZ4A 3O84A 3BH7A 3L6UA 2PU7A 3CNOA 3KV3O 2OENG 1VHJA 3RHFA 4OK5A 4RKEA 3DBOB 1N77A 1B7GO 2PLRA 5IF3A 2DBQA 3S2SA 2UV8A 3OQJA 3HFJA 3AEYA 2EKLA 4LE0A 5IW8A 1X86B 1Z7EA 3P1JA 2O2HA 5BSWA 3BBLA 4ZAYA 2OR3A 2KHZA 3WWDA 1YFLA 3ANTA 5G2OA 3MJTA 2HF8A 3E84A 2B30A 4E5KA 3KEQA 1GILA 3ONFA 5I7UA 5JIBA 4QVIA 2H1FA 1QF7A 1J25A 1XFDA 4BUZA 2VZLA 1VRCA 4NMXB 3IOYA 2A88A 4BWYA 1NUHA 3DHWC 3BWYA 4BNNA 1M0WA 1JIVA 3OCYA 1XVIA 2PJUA 4M54A 1TA9A 4HXGA 4JXJA 4UEOA 1NPYA 5C8VA 1N33B 3FDZA 5DDIP 2Q1YA 5DBHX 3E5NA 4YY3B 3TDNA 3HM9A 4K9SA 3UQYS 4QQFA 1ZITA 4GKKB 3TSCA 1PVDA 4RTSA 4AULA 1A71A 4D8VA 4RA6B 1C1DA 2I4NA 4J2OA 1NLYA 4BNTA 4IDHA 2DSNA 2G06A 3LVQE 3A6PC 1Z6YA 3DMPA 5L3ZA 4X9XA 1O03A 1EVJA 3D2AA 2HMUA 4K0KB 2Q6IA 3I58A 4F6RB 3FD8A 4JKYA 4TV9B 3CPSA 1L4EA 3HK2A 2WINI 1CRWG 4KSCA 4CKCB 4GICA 5BW6B 1Q1ZA 2PX0A 2FWRA 2ZE7A 4YECA 1W73A 3Q85A 3UT5B 1PL8A 1WZIA 2PD4A 1QHGA 3PIRA 4CM9D 1E4YA 2A9QA 2Y0BA 3GNSA 4DW8A 3ICQB 2J3QA 5CT8A 3JTMA 1XMPA 1IG0A 4C4XA 1FJXA 1NR1A 1KFKB 2AVDA 2WW8A 3Q9UA 4J2HA 3TQRA 3H13A 1G2OA 1RS0A 2BP7B 4HGOA 4IHJA 4DCUA 5EHNA 1VJRA 2AD1A 3FCEA 3K0CA 2FOIA 2LCQA 2GEJA 3LKDA 4V0LA 2ZVDA 2HEGA 1JP7A 2B2XA 3ETJA 3LPLA 2RB5A 3AUKA 3GJRA 2ZWOA 2M1ZA 1N75A 4PZLA 3GD5A 5FBHA 3DC7A 3K9WA 4RKWA 4BYGA 2VATA 4RZUA 5IBRA 4ZPXA 4H1TA 3D7NA 3VU1A 3I5YA 4OQMA 1T1RA 2BI8A 3BMNA 3PYLA 4DV1B 3ANXA 4F9GA 4LY0A 3OEED 4Z53A 3CUTA 5D5QA 4EABA 5ALSA 2REQA 4M9RA 4RH0A 4OEHA 4XYEA 3UXEA 4CQMB 2QU7A 3GJTA 3DMYA 3RANA 3TJRA 4E2XA 2DWPA 1LTQA 3O2NA 4PWZA 3CEHA 3AR7A 4UCWA 1I0IA 4ZZ2A 1T35A 1BEUB 2EWWA 4RWZA 1KEUA 1EFTA 3LU1A 4XX1A 5L3VA 3CLRC 1Z28A 4E22A 4F7DA 2EFDB 5FPPA 5BN3A 1P0MA 3E3MA 2ZUUA 1RDFA 2VPQA 5C1PA 4OHUA 4WKOA 2I8CA 3ROEA 3LM8A 4FR5A 4KR2A 4CM7A 1J9GA 4BZXA 3A4TA 2DWOA 3EVBA 4D3ZA 4RTQA 5LZ4A 3WAJA 1PKEA 4WJLA 4YUZA 1Y5NA 4ER0A 2CLLB 1J5XA 2M32A 5E3JA 3LLUA 3AKEA 4KJXA 5HEKA 5EQFA 2JGMA 1R8SA 4JV5B 1FYEA 4HQ0A 4W9MC 5EJGA 4IZHA 4D8UA 3GOQA 4G24A 3AHDA 4UUBA 4P3KA 2GMWA 1KF0A 4FK8A 3D9QX 1LSUA 4NV1A 2XNSA 4PBRA 3B3JA 4JI6B 3VDMA 3ZCQA 3JXEA 5BMVA 1M72A 2PD6A 2ZOSA 2ONKA 2VF8A 1WHSB 2ZBFA 1M6HA 4A16A 1N32B 1BQ3A 2BAGA 2JIZA 3C48A 3GV0A 4Q4JB 5U9CA 2KLBA 4ARSA 4IWYA 1H6CA 1ZWLA 1R6BX 2C54A 2ON6A 4QRDA 4Q1EA 4X6LA 3ZE1B 2VDLB 1S4QA 2JVJA 2B1QA 4JYMA 5TT1A 1GTRA 1USUA 2IEAA 1WMSA 3SQLA 2ZRDA 4DS3A 2EG5A 1L5LA 2QTVA 4EW3A 3MJFA 4FOPA 2EATA 4G3XA 5CG1A 4GQIA 1Z0AA 4HBZA 4DC0A 1A8SA 2B83A 2JFQA 4O02B 1ZOSA 4TKUB 4S1OA 2BN4A 3ZX5A 2FPIB 4JELA 4BKPA 3P32A 2MINA 4Q93A 2QUKA 3RSCA 2QLFA 1I8TA 1BO6A 1HDOA 3G2LA 4BNGA 1PFYA 3H2BA 2FK8A 4D74A 3E7WA 3QEBZ 1KYZA 1MXHA 3SM3A 1NBWB 1OLSA 3QPAA 2HRDA 3IX7A 4PGMA 1NI4B 2CXNA 1S9DA 2YCBA 4FGZA 1U0SY 4XWAA 3TM5A 1DG1G 4FFWA 3TTTA 1N3IA 1XTTA 1TVKB 2CFRA 4NLLA 4MR8A 4MKIA 2ZU6A 2QT0A 5FUMA 3VKHA 5LMUB 2XWJI 1KVRA 1FTSA 3BXOA 4YXFA 2HRRA 2ZJ5A 4M0UA 1QKJA 4HC4A 1DFHA 2F64A 4LOKA 1KYVA 4WKGA 1LY1A 1C81A 4KGZA 3WGMA 4DM3A 2HMAA 4QFDA 1BS9A 1FYXA 1H94A 2YHIB 4LNUB 1DRUA 1U2PA 2B4RO 2N0SA 3DBLA 3DO8A 4MXDA 4NEGA 4BQQA 2BTOA 4Q3OA 1NF9A 2XZPA 4AKGA 1ZGJA 2P6UA 2IYWA 2PYDA 4H7JA 3BTVA 5GM2A 1CUDA 1I4DD 5BSGA 3E03A 4QOIA 2HFKA 1HURA 3FNHA 3KR9A 1FMJA 1TKAA 2JJ2D 4A1FA 1XEWY 2GAAA 4V0ME 2ZUDA 4DT1B 2CF6A 1D2MA 2YWRA 3C4JA 1Q7RA 3AJRA 4PS0A 2WFLA 3SXPA 4Y6RA 2V0NA 2R00A 4WL0A 5TEWA 4ETMA 1IIBA 3AM5A 3H42B 4GM0A 7YASA 5IUJC 4OJQA 4CLOB 5IVKA 2BUAA 4LYYA 3ZGNA 3OETA 1F12A 4XDGA 1SHJA 4F45A 4JT2A 2BH9A 3KQWA 3VOAA 1CD5A 2IU6A 2VF5X 2X3YA 3HY4A 4MH0R 2ZB8A 3PL1A 4FR0A 2CVQA 4X24A 1GUAA 4MW4A 4UTXA 4PNHA 3T0IA 1P29A 1WTAA 2FAXA 2VI5A 3OCVA 4ZOCA 5HF9A 1XZJA 2C42A 4G0VA 4KRYA 1G6KA 1QOQB 2GOYA 1MORA 2XZDA 2R7LA 2YVQA 4RKYA 3O93A 4WFKA 5E6RA 2QGNA 3VR3D 5A2GA 5AUNB 2Q3DA 3SC6A 2HQBA 4JWTA 3RRMA 1R18A 2Q28A 3U7GA 2RAVA 1BXGA 3BMQB 4EBBA 1E0DA 2GCIA 1MB0A 4KYUA 1PSDA 3EAGA 4WACA 4PF1A 4C0KA 1GTSA 1R8XA 3UWMA 2A0YA 4PZEA 3DLPX 1RHMA 3PXGA 2PGXA 4ZCTA 2GN1A 5CFPA 1R4ZA 4J0QA 3SZGA 4QE3A 4Q3DA 2JD1A 3IRUA 1TQ8A 1N57A 2ODBA 1BG6A 1SB8A 1ZGZA 2R6JA 2WK1A 3EXEB 3JTEA 4GMGA 2G6TA 3CZCA 4XCQA 3TO5A 4CIDA 4BO8A 4CXMA 3X1KA 1RC1A 2QTTA 5J4LA 3BRSA 1JJIA 1FDUA 1VHTA 1W8IA 1P9OA 3G1UA 2J08A 2CVPA 4QBGB 3EAQA 3KS9A 1F0YA 1ZN8A 3I6IA 3PNSA 2R8XA 4P5DA 4D9HA 4CIWA 5JISA 4IIGA 2D1FA 1GT91 1ZH4A 2PRSA 3RUEA 1AMOA 4MWBA 4JMPA 1C2TA 1E1DA 2GXQA 4JB8A 1IK4A 3GNQA 2AMVA 3NHWA 5C5EA 2PSSA 1JXOA 2PFSA 3K0FA 5KQGA 3AI3A 2J5RA 2WP0A 3F3KA 3NTOA 5JLJA 1KMQA 3OQBA 4ZCSA 3CVVA 1LC3A 4JVSB 4N3GA 2C2XA 1T1JA 2WSYB 4JSYA 1Y8QA 4O2AA 4RVGA 4Q4HB 2RH9B 4ZZ3A 5CBPB 5K2OA 3WLMA 2IYEA 5CVJA 3WDKA 2BCEA 3UUEA 2I3ZA 4PWYA 1TQ2A 4NICA 1D2RA 2W22A 1QIIA 3S2YA 4EZIA 3N8HA 2A30A 2ACWA 3DAFA 3HYNA 5K9ZA 3LW8A 1EB8A 1Z4KA 1NMEA 5EYPB 4FKMA 3RS2A 3QA3E 2XOXA 2Z1MA 2ZUBA 2OLEA 3H0EA 4DARA 4JOQA 5FUVA 3KT3A 4JN6B 3ZW9A 5JRDS 3RIYA 4J0CA 5BSEA 5FEUA 1ZNXA 1SJ9A 3N8GA 5LLDA 4X71A 3OZRA 4L4UA 1XN1A 4BP1A 2H4FA 4HR7A 2QX8A 4KH0A 1JG1A 4IVRA 2WUWE 4J0FA 4XDZA 1QR2A 5ALIA 4CETA 3WA7A 1GCAA 1XJWA 4I55B 4EGQA 5EPUA 1P0FA 4ZCQA 4ZDWA 2E3JA 3OCWA 1TEXA 4BB0A 1L4GA 3HCDA 5KYWA 2LDBA 5AK3A 1NP3A 4ENUA 1RWWA 3EQ9A 3OECA 3C5VA 3BZUA 3QUAA 4X54A 2XXAA 1CQJA 1H66A 1QE3A 2QRMA 3MGCA 4KSYA 2JJ1D 2R6R1 4OIMA 5CW2A 5EQDA 3KQNA 3VOSA 1JKFA 3ZD7A 3WK8A 1XZKA 4X20B 4KVAA 3U4MA 4CDRA 4D97A 3IQWA 3THYB 2J8ZA 3GLHB 3GARA 3K0AB 4G09A 1D6SA 2VSYA 4HEJA 4JHLA 2C9YA 3IELA 3QUTA 4MV1A 4PICA 1R6XA 3GGOA 3DCIA 2CBZA 1ECCA 4ENPA 3KKMA 1R64A 2XNJA 5F3WB 2X2PA 2ZR8A 2CLHB 1YOVA 5HVNA 4KV7A 4G0PA 4LY3A 3NIBA 1JHMA 2NWQA 3ABZA 5LCXA 3PGA1 1JR6A 1W93A 4CMGA 2YQ5A 5AVWA 1WB9A 3QUCA 1A82A 1IBCA 1PYOA 1F8GA 4A3SA 2EU8A 5GMOA 2NQ8A 4XUCA 5CNJA 1E5VA 1RQPA 1Y3DE 2N3ZA 2V58A 3IP9A 4GOMD 4NL4H 4U39A 4WESA 4X94A 2XQGA 4P82A 4PZAA 5DBFA 3JQ8B 3LUKA 2FLVA 4EVRA 5JW6A 1LNZA 2JFPA 1H2BA 1XRRA 3QOXA 2M6KA 4EJSA 4JJZA 4ND1A 3EGOA 3TKAA 1RR6A 3NCHA 5IJ9A 4B3TB 3Q3VA 2Y0CA 1QCCA 3QELA 4MWOA 3T4UA 2Q9BA 4LC0A 4QARA 3I9JA 3KZCA 2IGBA 5A6VA 4Q4CA 4ODIA 2VNIA 3HKCA 3IMGA 2H8KA 3M6UA 2B5VA 3PE3A 3OJWA 5LQMA 3O4HA 1WXWA 3MBIA 3TTUA 1WE2A 3CRW1 1JPNA 4UTOA 3SF0A 5IXSA 4S1NA 4AJ1A 2O6LA 4KQIA 3DMGA 3EFEA 3EIOA 3AHCA 2ACKA 1AUVA 4Y0AA 4YASA 1ATZA 3I45A 2IYPA 1OZFA 3KUUA 4M8LA 1RBMA 3WJ1A 5A0TA 2HADA 2W2LD 4D0SA 3QWHA 3HZOA 4JLKA 5LQRA 2P6OA 2HXGA 2AI2A 1XEWX 1M34E 1SUAA 4DSAA 4OHKA 3K0SA 1TA0A 1NA5A 3VPSA 2CN1A 3M2TA 3FYTA 3W2GA 4A73A 3AR2A 3ASVA 4S12A 4ZVVA 3HTXA 3F5DA 3FPFA 4G81A 3RKUA 2JEOA 1Z4NA 5AW4A 1VI2A 3C3XA 3ZLUA 1EFDN 2VNHA 1PSWA 3WRXA 1YK1A 1SOAA 3OZSA 2HUPA 1NBMD 5HJ5A 3AY0A 2G8NA 1JIXA 2HC9A 3RFTA 2OGZA 3IAM6 4XYMA 1QB8A 3T38A 1JDJA 2IBSA 4IQ8A 2I2XB 3AKDA 3VTAA 2VZ0A 4UE2A 3U4GA 3OKFA 3VAYA 1Z5OA 1CUYA 4HNUA 3OQMA 3BD6A 2QVCA 1Y6RA 1CUIA 1O95D 1CUAA 2V3VA 4CM8B 1NNEA 3PUVA 3BL8A 3M9XA 3F46A 3L4BA 3NCTA 1DFIA 5YASA 4H1HA 3JD1A 4E30A 2W6ZA 4H7EA 4CEJA 1LPPA 2A1UA 1P7WA 4F2PA 1P2VA 2A9RA 4HZUB 3RS5A 4LHYA 1M3SA 5EOVA 1GUFA 3GFTA 2GPJA 3PPVA 3FBTA 4DVJA 1JG6A 3K6KA 3KUCA 4A0QA 4WA7A 1ZH8A 1W59A 1KVTA 3CJQA 3TQQA 3D6HA 3FPHA 3P9RA 4DQ0A 3AIKA 5TQ0B 4F6CA 3NUGA 1N0HA 1MJGA 1VKJA 2O2SA 3F6RA 2CXSA 3M5CA 1DEKA 2C84A 4G84A 2C9OA 4LIPD 4L6IA 4MGZR 3EOAI 3V2GA 1YDWA 3LX6A 4KOEC 2VC2B 1Y4ZA 1MEOA 1TTHA 3GJ4A 1KI2A 1LSJA 1Z17A 1GTVA 2V0CA 2YIMA 3GCXA 1PFUA 2XQIA 1EWQA 1C3VA 2FZLA 4JYCA 3E1KA 1CUGA 4IXWA 4KL8S 4CKBA 4RM2A 2J85A 2P9GA 4F8EA 4FIZA 1D03A 3F5MA 1IY2A 2WF9A 4ZQGA 5FWYA 3FMOB 4FFMA 4LISA 3DKRA 4IBOA 4XWTA 2BKUA 2PLFA 3R6TA 3UWSA 4DRXA 4P7KA 4Z4CA 4WBNB 5MGNA 3QIVA 1SG6A 1TD9A 4RHFA 4TM8A 3UOWA 4XW2A 1FZQA 4U2GA 3IHLA 5GJCA 1TZKA 4NFSA 2IW1A 1RQGA 3B1YA 5BN4A 4KLNA 2D6FA 1GD1O 2J0QA 3TKLA 1W5BA 3IKMB 5AVTA 2POQX 5BWLA 4JMLA 3RAJA 4QOSA 2QUZA 1ZM2A 1PR6A 3CZ9A 3AEUB 1M73E 2NQ2C 4G9GA 2XCUA 1KMHB 1RABA 4K6OA 4BKUA 1P7PA 3EXG1 4AO7A 1ODCA 1CE8A 1AXEA 1U7WA 3ZG6A 4QJ4A 4ND4A 5BP7A 4YRJA 5EMLA 3HDGA 1T5HX 4BE9A 4B44A 2P2ZA 2QAJA 5M34A 4H08A 4FE7A 2QLTA 2H92A 3P5SA 3ZWCA 2M6SA 3IXLA 3BIWA 1W2WB 1XD9A 5A6SB 3IVAA 5KB3A 3EYAA 3NORA 4FI3C 4PZZA 1P0CA 1MC4A 2KS6A 2A0FA 3EWAA 4U7HA 4IH9A 4V2IA 3W8NA 3LZCA 2KI5A 3RW9A 4CUJA 4TGLA 3K70D 1QRSA 5EIBC 4R1QA 1FJGB 4I5FA 3U3JA 2R1UA 4BKRA 5J4HA 2ZU0C 3GH3A 3HG7A 3SP1A 3IC5A 5AHKA 3S2IA 3ZVNA 4ALIA 4DA9A 3FIUA 1BMDA 5ANRB 1YZVA 3B2NA 1IBLB 3C7KA 4NH4A 4ARCA 4PPYA 1USVA 2PQMA 3OX3A 1LK0A 5AM0A 3W2FA 2CZQA 5HF8A 5SZKB 5AXDA 4ZREA 5HBGA 4QXQA 2ECFA 3ELDA 3ZY5A 5LB2A 1RWKA 4BO3A 3AQIA 5K3FB 2GEDA 2B98A 2OOSA 4LZWA 2C0PA 2PX8A 1ODSA 3C74A 3H6KA 4F6RA 4LRXA 3TF5A 2DTXA 4Z0NA 4K7JA 4KOAA 3P45A 4WGFA 3WMEA 5LQUA 3VGPA 1R2QA 1U02A 3HVUA 1H2YA 3R41A 1VHQA 1MR3F 3DBHA 4M8SA 5DBEX 2HEIA 5AK4A 2O3TA 2IHUA 3QVJA 1PEDA 2FW0A 1LSOA 2FMIA 5G0TA 1MXFA 1ULTA 5CFRA 3TNLA 2AQ8A 2MSEB 5NLLA 4DGQA 1B6GA 4GBED 1RCUA 3VYWA 1YWGO 1QGED 5J59A 3SHOA 4U9UA 1VG8A 4HGPA 4RHCA 3NHYA 3FLBA 3U4CA 5M2QA 2WD7A 5L3QA 1B1AA 1PJZA 4M9XA 2ZBVA 5DSXA 2X8JB 5B4UA 2BY4A 2VDKB 3ICOA 3T9DA 5JC8A 2GZAA 2VCEA 4H35A 4MVJI 4R8VA 4CMEC 3ZQKA 4DR6B 1I3CA 2Q3BA 4JQCA 1DADA 1TZMA 1E9BA 3DE6X 3KPJA 1XEAA 2WVGA 3PD0A 3PXUA 1Z63A 1BDMA 3LPDA 3ZY2A 1FVFA 3AKZA 4B33A 4J16C 2XMPA 4OKNA 5K05A 3C3KA 2R7AA 4QEDA 3GB9A 1SXJB 5TGDA 4KH1A 1RQ7A 3V1KA 4COKA 1IC6A 2PWZA 3CX7A 4DDHA 4WEOA 3BL5A 3NM4A 4XGNA 3S2FA 1XLVA 4J76A 1SCKA 4TT3D 4AF7A 3KOWA 3ND8A 1C3EA 4Q3EA 3HJCA 4EHJA 2J4FA 1EM8B 5IMSA 4KHPB 2AOTB 1H9BA 1LH0A 5D87A 1B1CA 1T9DA 1YHNA 1RLIA 1DHRA 3RSSA 4D79A 3UFXA 1TQHA 3BH6A 5IC6A 3T7SA 5BSKA 1A5TA 2WJ6A 3CCCA 5ALZA 3ZWWA 3U44A 1YONA 2PQ0A 4C29A 1TK2A 2B8JA 1S3SA 2Q49A 1EINA 2Q45A 4WXMA 5AK5A 2VKQA 1BN6A 5ALDA 3WKEA 3B5IA 1A2OA 5D1NA 2NU9A 4WVFA 4AD8A 3TNDA 2Z8YM 5EESA 4EUEA 5BV2P 1MTOA 2UYGA 3TTWA 3MTIA 4C5CA 1TECE 3V1LA 1MTZA 1D6MA 3KSUA 2OILA 2GZSA 3Q11A 3IPXA 9LDBA 4NENB 4GYKA 1KC1A 4YJ3B 3ZCXA 4WOJA 3QBTA 3UW1A 1QGUA 2MDTA 2MSCB 3LQFA 4DUZB 1R4AA 4LSGA 1GNRA 2XQFA 1TCAA 4U7JA 1F4LA 1QG0A 2F1HA 3L7OA 4NYIR 4LTMA 5BT8A 4KX5A 4LUCA 2Q07A 1CYEA 3ZHUA 3LKZA 4FCTA 4O08A 4RVDA 5KCZA 3RS7A 2QSJA 1PZEA 1LD3A 4L2IB 2UYQA 3OFSA 2YWEA 4D9FA 5JCJD 3H18A 3QE9Y 1E2EA 4N5HX 3T3IA 5JSZA 3A25A 3AI1A 4DWWA 2G0TA 2VQFB 5FI0B 4QXAA 4ZQEA 2QNIA 5EEGA 3TQHA 1I7QB 1E1KA 1NM5A 1OGJA 2GPSA 4TRNA 1Z74A 2EFCB 2R62A 3C87A 4HXYA 4Z3DA 3OU2A 2QUBA 4K9DA 3L7NA 2V59A 5CRIA 4CN8A 2H1HA 4PC7A 2LKCA 3NVAA 2PZMA 3OAAD 5I01A 3E9CA 4AQ7A 4AZTA 5I7VA 4LOJA 4K87A 5A4AA 1YS1X 1Y1SA 1IM8A 1L5FA 2QM0A 4B8WA 5CXQA 2OA0A 3LSTA 2HA0A 2SHKA 1HWYA 1W6UA 2QBYB 4D9BA 4N82A 4E94A 4BKOA 4A6DA 1V9LA 8GPBA 2VJAA 2VHWA 4C76A 4PLHA 2G72A 3LUFA 2IXEA 2A9VA 4HUQB 4YP6A 3W5SA 3H2YA 3LHKA 1ILEA 1CF2O 2QAIA 4Q1DA 4C04A 2JCSA 3ZI4A 3JX9A 3N86A 1ECFA 1PV4A 4L02A 1TIKA 2MSDB 1KY5A 3NU1A 4O4LA 4OHXA 3OZDA 4IILA 3UMBA 3TGPA 2DHQA 2QG4A 4BO9A 3DNFA 4NBRA 3ZU5A 4ZEXA 2IHBA 4G9EA 5L3SA 4ZVQA 2HB6A 4IUBS 4PX5A 5IVIA 4ID9A 1ZJ6A 2IYLD 4CIYA 2LXNA 5HKOA 1FQKA 3MSXA 3QXJA 3QFHA 3MJDA 2M2IA 1BHSA 1OWMA 4H7DA 1TEHA 4Q21A 2FN7A 3FR8A 1PYGA 3MC1A 5LP6C 2B69A 3VI3B 4ZMSA 4PM4A 3PC8C 3D6AA 2I2DA 3GLFA 1D2EA 2G9VA 1YZFA 4Y18A 4AICA 4NZMA 4LMRA 4YUXA 4WECA 2IFTA 1JEDA 1SIUA 3FJ1A 2YJ5A 2Q41A 5KSWB 1F0KA 2V6MA 3PEVA 3UMJA 2SKEA 3AETB 3WK5A 4HI0E 4IQGA 5DGHA 3U3ZA 2WQ7A 1OX4B 1UDAA 4KLRA 3W78A 3ZHBA 4OUKX 4AQYB 2UXDB 2FFJA 3DZBA 3G9TA 4WFQA 1SBHA 2G63A 2DHDA 2VAPA 2VK4A 2XQJA 4KRGA 3SXUB 1PWHA 4R0VA 2C2MA 3BE6A 5IDYA 3VVLA 2DE0X 2CFSA 4ZZ0A 1G20E 2FX2A 4KR3A 2C4KA 4NARA 4BMSA 2V9ZA 1ORWA 2ZK7A 4G0WA 4PVDA 3KTAB 4Z0HO 1U0EA 4HB3A 5ALUA 2DAPA 3CLRD 1SHTX 5CTAA 3ZHXA 4XEHA 1S0UA 4Z6KA 2IH5A 1FYFA 4G5QA 5DK4A 3FPEA 3L7LA 3NWEA 5CXSA 2J59A 5C4GB 3U4AA 2C5GA 2UAGA 4C88A 2RDMA 4C1BA 1POXA 4RVOA 3CO0S 5BNFA 3QPDA 3Q12A 5REQA 1DIHA 5KNDD 1WZNA 3QYAA 4DL9A 2CDNA 1P0PA 2QP4A 4D3DA 4EENA 3BK1A 4W1RA 5DTJA 1ECLA 2JCBA 3Q0IA 2X76A 5IJAA 3AV3A 5LA6F 1SOVA 1K66A 1T2AA 1YR1A 2PMBA 3IPLA 8AT1A 2QRNA 4ZMBA 3FTDA 4HGYA 2ZANA 2X2OA 1C3OB 1W4LA 3U40A 3R0XA 1VKNA 2HMVA 2ZI4A 1JKIA 1UJCA 3CKYA 3FKSD 2O1XA 4LQCA 4UEWA 4ZVPA 2PXHA 1AQLA 5BSRA 1JLMA 5U1PA 3KZOA 5AJXA 1S4MA 2Z2YA 1KAEA 2ZUEA 3MJHA 3HFSA 2IDMA 3PJGA 5AW5A 4CF5A 2VUTA 4EVSA 2O06A 3H5IA 1DV2A 2WB4A 1NURA 4II2A 3P4XA 3DJFA 2E85A 2BFEA 1BXZA 2P3SA 2XIQA 5EWMA 4JZKA 1EWYA 3M5PA 4KO8A 3S6JA 1GP2A 3HDTA 2I7VA 4U6QA 2YBDA 3FRHA 4WSOA 1YB4A 3IR7A 4WJKB 1E2JA 3AVXA 3WLJA 4JI7B 1UC4B 1Y98A 1N2SA 2EBFX 2JHAA 1KI4A 2JIMA 3PD1A 4M7WA 5LBIA 3SDZA 4B46A 2F43B 4OGLA 4QUHA 2BM8A 1K06A 4JI2B 1C9DB 3SVTA 5LWQA 1KK1A 3AGQA 3C8HA 1H4TA 3FHLA 5DX1A 5C7IO 4LOHA 3RIXA 4H17A 2CSXA 4C7OA 5EI5A 5AM2A 3KQOA 2PNFA 2WIDA 3D3QA 2HV9A 1C3LA 3DE0X 4N1AA 4DN6A 3E1SA 1NXXA 1BFKA 4P92A 4OP1A 1FYWA 4AJEA 4B31A 1AURA 1E3JA 3AIOA 1JL3A 4QVKA 1ZK2A 2RFLA 3RU9A 4XWKA 2Y68A 4F12A 2RHTA 3GBSA 3V4FA 1W4CA 3FDFA 1Z18A 2HHLA 1RJ9B 1VPLA 1JQ5A 4KXQA 5L7TA 3B5JA 1BMTA 3GUHA 3KYIB 2IC5A 1L2TA 2QXYA 3FGZA 4Y2JA 2P8JA 4BTLA 1AN9A 4CIXA 1LI5A 1Z3CA 4IDQA 1EESA 2O0KA 2X8WA 1R6VA 5DBOA 1QYXA 3P7MA 3KL4A 4R41A 5EWLB 1EDZA 3QBVA 1EH5A 4JCOA 1UAYA 4RS4A 4Y2PA 2FPUA 4O3FA 4FU0A 3ZE6A 3PKJA 3QJ5A 1FP2A 1FY2A 1YR3A 1X1AA 4I9FA 4ZDKA 2JF0A 4JUAA 3DMHA 1RHQA 1OXUA 1S8NA 1T4BA 1JG2A 4OA8A 1DL5A 3I53A 3NHBA 4S2EA 4PLYA 1L5YA 3FGOA 2Y1EA 2Y1DA 1ZVKA 4WD3A 5DISB 2QL6A 1J06A 3PI7A 2VRWA 1QAOA 1CQIB 3VBEA 4O2AF 3ZK8A 4D42A 2R47A 1SUPA 3BE5A 4FZJA 1FDIA 4KQHA 1DIOB 1ZD5A 3MTBA 4PINA 1E6CA 3CRNA 4PLGA 3O4VA 4J7XA 2PGIA 1X70A 3QPUA 4X62B 3ZBUA 3LLVA 2C07A 3D3KA 4M8IA 4MEBA 1DUSA 2EF1A 5IC5A 2K87A 3CEJA 4TL9A 3RU3A 2PTGA 3OLWA 4CUKA 1GG9A 1N2CA 1U6JA 2R84A 5CGZA 5F21A 1KRWA 2WAMA 3GEGA 1OTYA 4WZ6A 4FHZA 3FTPA 2PM8A 4UNQA 1G64A 1NLUA 2CEAA 3H7AA 2I1WA 3IIEA 5TC4A 2F62A 3IALA 5CDTA 1Q50A 1KIAA 4P58A 1RFGE 5KUTA 4MP8A 1YR9A 2NG1A 2NXWA 2YXLA 1TOAA 1DUVG 1Z45A 4A8JB 2CKMA 1WKVA 5FNVA 4NCKA 5FBWB 2QNBA 3ABSB 5IKEA 4W5QA 2FEAA 2VRCA 3SHWA 5ENDA 1OUMA 2AZ4A 3FM9A 1XTZA 2QZPA 1CQWA 3FSJX 4R1NA 3PVCA 3U62A 1Z8FA 2M6LA 1OLXA 3K1TA 2W2MA 4CTJA 1U0BB 3N2YA 4K8RB 2HXYA 2R44A 2O8DB 1QFYA 3VPHA 4AZ3A 3WWPA 4JYPA 4QU5A 1RYDA 3TLGA 1ZSYA 1MO2A 3BORA 4G85A 5C8ZA 1PJRA 4BRSA 1K8XB 3KOXA 1NXOA 3QXGA 2I34A 3CPEA 1E2HA 4PYQA 4GOLD 4RTMA 5A7HA 1JMVA 1QBGA 5KAMA 1NV9A 1EE9A 4DR5B 4HVTA 1AS0A 1BKSB 4HMQA 3ZR4B 4EY7A 4WNAB 4X1OA 2ZXEA 2PX5A 2RAUA 1G42A 1QZUA 4AKHA 4RPHA 2PIAA 2AW5A 1WBBA 4IFEA 4BDTA 3KVRA 4AWBA 1G5HA 5AFSA 3PXCX 3I6BA 5BWCA 4ZP1A 4HO1X 4EG0A 4M9CA 4TXLA 4CEHA 1HZZC 1NUTA 2QN8A 3K9FC 2JCGA 4UE6A 1RACA 4M88A 1IZZA 3V4VB 1KEVA 4ZCPA 4BFSA 3RIEA 5JT1A 4JJGA 4V0SA 2XGJA 2NVUA 2W6ID 4G0OA 3ZWQA 1XA0A 1TYZA 4S0XA 4G5XA 2F3SA 1YJQA 4JVNA 1V6CA 4KB5A 1MNQA 2EHJA 4QOFA 5CJ2A 4OK3A 2CXHA 2PO7A 1E1MA 2DUNA 2FWAA 3NBUA 2BTQA 3EC2A 4IINA 1U31A 3HRIA 3NNNA 3PXBA 4JL6A 4KI0A 1BRTA 1DBRA 1N7IA 1Y1RA 4HEA1 4K3UA 4YJDA 5CVVA 4ZOLB 4KIJA 3GIDA 1I7LA 4N8DA 4DB2A 2C9ZA 1YU9A 3E4CA 4L4SA 3AFNA 5JXWA 5JXGA 5JAQA 4INJA 3HWX1 5LMCA 2DF8A 4GE0A 1Z0ZA 1H3NA 4WDRA 3T35A 4F11A 5K0ZA 1U6KA 4IX1A 1CF4A 1X1DA 2G82A 4WZAE 2Q0XA 5DWDA 1G7CA 5ULLA 4ZYZA 1PI3A 4G37A 1QPBA 2XMQA 3SIPA 4K28A 4CU5A 5EHQA 5LQSA 3JALA 3ZHTA 3GPCA 4CQLB 1JFTA 4KQCA 1DXHA 3SFVA 2H48A 4R8KA 3HCNA 3DL4A 3EFHA 4UULA 2V7WA 3WIEA 1PEKE 4LJSA 3HV0A 4JLAA 4DBVO 3L5KA 2O8FB 3T1OA 4JJ8A 3MCZA 2BBOA 4OTZA 4JJAA 5IS2A 1AD2A 1QYDA 1FDOA 1UEIA 2D8AA 1VIMA 4RETA 4DB4A 2CUTA 4MGHA 3UENA 1WCIB 2GESA 5BW4A 1G5PA 1PQYA 5ALEA 1ZC3A 4Z2YA 4BB9A 4QPPA 1RAHA 4EF6A 1HFKA 1CY8A 1DPFA 2YVUA 1E5QA 2Z08A 3EB9A 1JIQA 4FMCB 4KLCA 2ZYDA 1GGFA 5CDFA 1KHHA 2J3HA 2GSWA 4OKIA 5LZ7A 3TEJA 3IULA 1QQ7A 4J75A 3J7TA 5DTQA 4O5OA 5G1NA 2A6PA 3P9PA 3H9CA 1BE6A 1QBKC 1QLWA 1E7WA 2X9GA 2EHDA 4N0MA 3I4CA 3O9ZA 1Z12A 1XDDA 2QLJA 3NGXA 1VJTA 4EM6A 3NI2A 3OPVA 4XCVA 3QOFA 2LVBA 2DFDA 4EG8A 4M49A 3ZH9B 5KJ1A 4OYHA 1PJQA 3L8DA 1OC4A 2J48A 1O5OA 3FOCA 3IESA 5TPZA 3R9WA 2HJWA 4QQRA 3HRHA 1Q15A 3V33A 2VRBA 2WJHA 3CKLA 1G6HA 4BE7B 3WL6A 3NPMA 1JEAA 4J49A 4OBXA 2GTPA 3RS9A 5AO9A 4YQYA 5FWAA 5CCBA 3UKOA 2H0QA 2NTJA 3DUFB 1Z6ZA 3PPXA 3CR7A 3SR3A 1ZJWA 5DNYB 4KPFC 2X7XA 1WW2A 3TDMA 4J94A 2ETVA 4KLZA 1TGYA 1IATA 5KDLA 4ZO8A 1SBYA 3QKIA 5FFNA 2E6UX 2OCBA 2ICAA 4ZVOA 4CV3A 1R16A 5JZ9A 4NCAA 2DBVO 3KB1A 4ZYUA 3VDQA 1UMBB 2GS9A 5L53A 2C7QA 2JLWA 5I47A 3PQ6A 2YWFA 3T5BA 4J2TA 3E48A 4J90A 4N12A 5E4FA 3AF6A 1L7VC 2PJRA 2GX6A 3VDNB 1I33A 1WHTB 5TARA 1C8LA 3WIVA 3A14A 1XP8A 1TZCA 5KU7A 4KJZA 2ZRIA 4JB3A 3GI1A 1M1ZA 3K2EA 3W5HA 1O58A 5JDCA 4MQLA 121PA 4LY6A 2PX3A 3A1FA 2XMBA 3FWPA 4V02A 5HYVA 3TIFA 4J3NA 6NULA 1XELA 2ZQZA 3FFBA 2ZJ7A 3BEOA 4D4MA 3L0CA 4JLUA 5LPNA 1QTRA 1B0AA 2OAQ1 2Y6UA 2CUZA 1BYUA 3C1AA 3RS4A 1G8SA 4EMBA 5KQRA 1GZVA 4HLQB 1J0DA 4J91A 3BGIA 2GDZA 1JKJB 3ODGA 4LF9B 3PL5A 3RI3A 4UHKA 3ND6A 1P3Y1 2JFHA 3NLLA 5KHAA 1BD4A 4BIIA 3KXPA 4PZPA 3JAWB 5H80A 3NT5A 3K35A 3NH6A 4N6NA 1FU8A 3UOAB 1X39A 2E7ZA 1WZ2A 3A6DA 1PG0A 1ZXBA 3IQXA 1R0XA 1FJHA 3IBSA 2WD8A 4IGIA 5ILQA 5IU6A 1YR8A 1ZI9A 5ALWA 4CMJA 3L0PA 1PTJC 4GYYA 1BW9B 5SYAA 1GLNA 2W2KA 3MEQA 4H60A 2C4NA 3PK0A 4E51A 1M8FA 3IQEA 3PC6A 3F5FA 4NE9A 4R2WA 3ZU4A 1SRRA 5T6BA 5HZGA 1NSFA 4IRXA 2L18A 4B84A 1N2JA 5K6RA 5JAUA 1ONNA 1ZN9A 4UHFA 1RI3A 1NMYA 9MHTA 4HAYA 5G41A 4Z54A 4HLDA 1J00A 3PUIA 4PO9A 3T1QA 1AA6A 2Q3MA 3SQWA 3UYLA 5EHIA 2HWUA 4GUDA 5ER9A 2BH2A 4TZKA 1MB3A 2WILA 4HD8A 1US8A 3PEYA 1X7ZB 2WLTA 1I2ZA 1PFQA 2DLDA 2HA5A 1LNQA 2A3RA 4UHCA 4OHRA 4CCSA 2RI6A 4S24A 5FUYA 4P7JA 2XOKD 3ND7A 1K5GA 4PNPA 4OSEA 1W25A 1LSSA 3W6PA 3ZUPA 2XPCA 3GJ3A 1XZPA 2WOJA 4GX1A 3SG0A 3WLNA 1G60A 3K15A 1R37A 3KPWA 1KH1A 1VE7A 1WWKA 4O2RA 3PFFA 1OT5A 4BZQA 3JY6A 1E3EA 1XTUA 1TZBA 1OZAA 3BK2A 3BG5A 5SZJA 2DFNA 3GFFA 5IFKA 3LC7O 4B2YA 1MG0A 1CJMA 3ZWAA 1N5RA 3E05A 4HDCA 2A1IA 1CC1S 2DPHA 2FR8C 1Z2PX 3JARB 1ZLYA 3B82A 4XXHA 4US2R 4MV9A 2C9CA 1NMZA 1AKWA 2HSDA 3NIWA 5CVCA 5D2CA 3SBEA 3ED1A 5FKJA 3GT0A 2ZCUA 1PV1A 1OWPA 4HL6A 5LC1A 1MLDA 2C2YA 3LKVA 2AKEA 4HKTA 4ZIRB 2V3CC 1Y3BE 2OGUA 3ITKA 5AI4A 4DG5A 1NYRA 1PK8A 4MYCA 4U02A 4MX8A 5FWDA 2ZRFA 2IOQA 1P2SA 3QFSA 3NBYC 4G8JA 4CFYA 4P98A 5EIBD 2WJWA 4JLJA 3H5TA 3GPBA 1R0CA 2GFQA 5K0LA 3B13B 4U3JB 3VDRA 1DOHA 1IHDA 2Y05A 3E7DA 5HKKA 3AC0A 2FDCA 3A7EA 4QASA 2NUTA 4US1R 2G5TA 2WYWA 5A3JA 1U2EA 4JASB 1IWPB 4C05A 3QPWA 4WRRA 2OD9A 3KO8A 4W82A 4RDHA 2YN2A 5I9MA 1O8CA 1IVNA 1CDOA 1U4NA 1SCNE 4M2LA 3KV1A 1U7DA 4C0XA 2Q7OE 4ZYVA 4WOBA 4X1IB 2JAHA 2VLBA 1H2EA 3EMBA 1T2FA 3HABA 3QUQA 3RS0A 4GZLA 2I7CA 2MR6A 4P81A 1UL1X 3CNQS 2V6FA 2AE2A 2I3BA 3ILYA 2ZJ6A 5JAMA 4GR9A 3OEHD 5I4BA 1NOJA 1EVYA 3K05A 1XLTC 4TXJA 1W0KA 1Z34A 2YJTD 5T8KA 3UAYA 5AVYA 1K5PA 4GMXA 4P54A 5ECDA 4IZOA 4UDOA 1POWA 1CX9B 2P9YA 3BFJA 1WQ4A 1CUFA 1XKLA 1MKYA 4FYPA 2C94A 4K1LA 5DOVA 2VT3A 2Q3LA 3NS7A 3NTRA 4IO1A 2PUBA 1IG3A 4MW2A 4KXMA 3FDIA 4YALA 3DMDA 4URZR 1L7MA 2CNDA 4FUTA 3NBQA 3ENKA 1UK6A 2ZAGA 2FVXA 4UU7A 4C3ZA 2EDAA 3BMOA 3UWOA 1OJLA 1XMXA 2COUA 4F5ZA 1GGEA 2EV9A 1IBMB 3EXFB 2IV2X 1C7FA 3WTBA 1NW3A 2ZGVA 3GG2A 4FYKA 3WNZA 1H1LB 3AXSA 3MTEA 1T26A 1U04A 2WAOA 4LE2A 2VJCA 2NUAB 3EOZA 3TMYA 2PZ8A 2VSFA 3RTCA 5A5DA 2DPGA 1XDWA 5JROA 2IIBA 3FLAA 2BC9A 3FWYA 2OD7A 3TUIC 5LMZA 1F2UB 2JCYA 4OPMA 4DMKA 1GUBA 1N6NA 3AWIA 1DHTA 5FWXA 3RS3A 2VT2A 3NOOA 3M3DA 3JQAD 4UAUA 1T8WA 1LTKA 2H54A 3FNRA 4MKFA 1RJWA 3K2IA 2X77A 3F9RA 4GXRA 4KW7A 4TPKA 3VR4H 1WPGA 4G56A 4NIMA 3AXTA 5FTLA 3CQ9A 1Z7WA 1UOPA 5CT5A 4UMVA 1E2FA 3E23A 2G5PA 2ZI6A 1C14A 3GNTA 4AMVA 4U5QA 2WSLA 5AHWA 1W96A 3T41A 4M1YA 1D4OA 3C6KA 2IA5A 2ZP1A 4FBMA 2DTDA 1YCFA 1ULHA 2VJMA 3T7DA 4DLNA 3WK4A 1LBHA 2VYND 1CJCA 1LW6E 3AO0B 2BMEA 3JQFC 5SZIA 4FFLA 4ZAGA 4FGLA 3TH5A 3U2QA 2QI9C 2IYOA 4UEJA 1U7ZA 1WZUA 2AN5A 3B53X 5KJCA 2F4VB 4TYQA 1F2TA 2IEGA 3DAYA 5HJ2A 1HLFA 3Q5DA 1UOOA 1BMFA 3M82A 2O7NA 3PHCA 3SY8A 4DWOA 4ZHQB 1GM5A 1T3ZA 2O7VA 2VF4X 3A06A 2NZJA 2FCRA 4I1PA 1ZS9A 2R00C 4O1HA 5F98A 1QIEA 1OT3A 4LDAA 2CJPA 1KYXA 4JODA 4I36A 1XA4A 4X85A 4MDEA 3P9XA 1P61B 1UDWA 1Y6QA 4HS4A 2PUJA 4MQMA 4R5MA 3T3PB 2XF8A 3GVCA 3DW3X 2W48A 3GP5A 3MELA 1VM6A 5WRFA 3GJ7A 4HRVA 1OTHA 1K7SN 5HILA 1VLMA 2CDRA 3DLCA 5LDGA 5CFNA 2EWVA 4W6QA 3L7MA 3FCSB 2PGNA 2Q1UA 2V8BA 2PDAA 1Y8RA 4NMHA 2FRDA 3AILA 3DEKA 1RXEA 1KMMA 2I71A 3GRUA 5HF6A 2I8LA 1IFXA 2ATCA 1UFKA 2I87A 2R8YA 2TSYB 3AUAA 1L7NA 3MW8A 2OCXA 5E1BA 4LYHA 4CIBA 1YBHA 3A9RA 2IEIA 1RWNA 3OIFA 3QYJA 5CIQA 3BWBA 3WLEA 4XSGA 1WPQA 4ZTZB 3LY8A 3NOVA 3JYQA 5CGQB 5DVZA 1YO6A 221PA 3N6XA 1G8GA 1MAAA 3DEFA 5HOEA 1XT6A 2FFAA 4OHPA 4IWNA 2LCFA 4MI9A 3WXMA 1NXSA 5KHOC 2VSXA 4P0PB 1XZLA 2QXUA 4AG3A 4IWXA 1XVVA 5EN4A 5JANA 5KQSA 1Q6ZA 3KT0A 1XQVA 3WLKX 4Y1GA 1EVKA 2A7QA 2GEUA 2Z2JA 4PC6A 2D7JA 1Z7YA 5EG5A 1YGPA 3BMCB 4ND8B 2ADMA 2TMDA 4PFSA 2GXUA 3UEOA 1BNCA 2QW1A 1DC5A 1J97A 1OA0A 4KQGA 4YMHA 2JCXA 5KTMA 3BSSA 1WG8A 3AF4A 3FKJA 3Q41A 2NTEA 1LC0A 4GKVA 1U0OC 3D54D 3DDHA 1PL7A 3RUFA 4EARA 1PL6A 3HGMA 3EZGA 5EEHA 5JRZA 4OX9B 2QTRA 1VSBA 1IQRA 3RVRA 3TFOA 2OK7A 2C0QA 2R85A 2VJDA 7REQB 2VTBB 5BT9A 5I7RA 3VC7A 3AR5A 3I4LA 4QLAA 4P3OA 1P72A 2V9PA 4OATA 1NY5A 4BVFA 2EGUA 3K72B 1N5KA 1QTQA 3ZXIA 1E94E 4WLNA 3M81A 2VHJA 2YYZA 3I1YA 1BHJA 1U3VA 1KVSA 1VIYA 2WIGA 3K6SA 4PN3A 2QK4A 2YZ2A 5HFNA 2FH5B 2BMVA 3LBFA 3N8IA 5JHGB 3DE5X 3MNFA 3OZWA 3C2QA 1PGJA 1G3QA 4Q16A 3HBLA 1RYMA 1E1RD 1Y82A 1Z5WA 2WM3A 3BCUA 1D0SA 1UBEA 3F4LA 5ESWA 2WVAA 5D6NA 4ACAA 3DBRA 1Y9DA 2HPZA 3ZDRA 2LCIA 2OHXA 2PCLA 3R09A 4MYRA 1SQ0A 4BV2A 5C9ZA 2AH5A 4HCJA 2H9IA 5TPWA 3B6ZA 3V8RA 4AECA 3I6MA 4D9KA 2EOAA 2NT4A 1WL8A 3C4QA 3C45A 3I2IA 3MF4A 5EPOA 5TE9A 4UAJA 1ZUWA 1ORRA 2IYTA 5AQEA 4EEZA 5B64A 2NQTA 4W9NA 4C01A 1KK2A 1IBKB 5KINB 1RTKA 1TJPB 4MQ5A 4Q4LA 1YF3A 1BAPA 2OCKA 3BXPA 1EDOA 2OCYC 2XKBA 4UBMA 3NYQA 3LT4A 1R0WA 3KOMA 5EE3A 4YRIA 1N7GA 1LI4A 1ZH2A 1XF1A 2O0MA 3SDBA 3BRQA 1YI1A 1ZHHA 1SEPA 2CYAA 2W8BB 4JJ7A 5F3DA 3EC7A 5BR8B 1S1CA 3KJEA 3RYIB 1RM4A 1Z0DA 3UFBA 3A6HA 4TYPA 5EJAA 1DAHA 4CMBA 5A9TA 5DNVA 3EDMA 1CULC 2P90A 3OSUA 1ZVVA 1JDBC 3W0LB 2P5YA 4EJ0A 3L0OA 2O4UX 3LSYA 1FRVA 1FP4A 1W5TA 2WSMA 3PF8A 9LDTA 3UJ7A 3LIPA 2R7KA 1RAEA 1UBSB 4UDXX 3RT9A 1IY0A 2AN3A 3IQZA 2J6HA 4N01A 1YIAA 2NSDA 4C3VA 1ODTC 4QXRA 2RHRA 1P5RA 1CVLA 4QYXA 4P22A 4MS1B 4B45A 2OGTA 2OMKA 2IPAB 3NIFB 1E32A 4JQZA 2BBWA 1T1SA 2G4VA 3C6XA 2AW3A 1ODIA 3W3AD 4CDNA 4EJSC 1W36C 3A7DA 4WASA 4KQ2A 1ND6A 2Y27A 1QP0A 5I7FA 1C9MA 1R4NA 2R97A 4X7PA 3QWIA 1ECGA 1XZNA 3X1MA 1RRMA 3Q87B 4JQOA 3LP6A 1GPAA 4GLFA 3N76A 2TMKA 4UNPA 2YX1A 4ASUA 3PDJA 2UUPA 3HJRA 1H6AA 2I78A 1HPLA 4ZT5A 3WLFA 2DTEA 1TM3E 4C4AA 3U39A 2X6QA 4MUIA 1D3AA 3FFWA 1W46A 3JQ9A 4LSZA 2F1OA 3OZFA 1IHXA 2FXIA 1BX3A 4E4TA 4UTNA 1TX4B 2HRCA 4E5DA 3GMTA 3OOEA 4MW6A 4O2BA 2Z8XA 3AFOA 2O19A 1DXOA 3WIOA 3SFZA 1S3GA 1JHDA 1SR8A 2QLNA 2NSHA 2OYCA 3RC1A 3HYTA 4I4TB 1EFVA 2NO9A 4IV5A 3DHEA 3A6ZA 3TKYA 1JXMA 3THRA 1A2KC 2QN3A 4PYLA 1XXLA 2NAPA 1WQ1R 3R5JA 4FEYA 3WRXC 1BVRA 3DS8A 3NTLA 2HHJA 2C00A 1PD0A 1S5PA 3ASZA 4M6WA 5EXSA 3ZHOA 1FXWA 1VYTA 2BFDB 3S8EA 1YQUA 4JC4A 4P4SB 1K75A 1OREA 2H1WA 1A5BB 4NHEA 1ZOIA 5DULA 3HVIA 2IEYA 2YR0A 1TCUA 3O4FA 1QO0D 3QKRA 4XKJA 4QJ5A 3FMPB 4XWOA 1M9NA 1TA4A 5SV2A 1HT2E 2OWEA 4BO6A 4D4GA 5EZSA 5A04A 5C0OE 2XDAA 2G4CA 2HIGA 3L4BC 3NC1C 4IIJB 4OJTA 1KI6B 1U7HA 2ZRHA 4YDRA 2KB0A 4BFTA 5LXTB 3EQ2A 3AF3A 2XMCA 3KU1A 2CV0A 3VHXB 1SU4A 5DHSA 4AKSA 2WIBA 2OQRA 4JI3B 1P2UA 4YCSA 3EBOA 3ZS8A 5DEIA 1XEXA 1KJJA 5D5HA 4MRSA 4K9LA 1WMAA 4G0UA 2WKPA 2I4RA 4FFOA 4OXQA 4RF3A 1YR2A 4Y2UA 4YC7A 2LTAA 5BSTA 3ZWPA 3OIDA 1VLQA 1GU1A 4YQFA 4EAQA 3IDAA 4LGMA 4PCAA 4EUNA 5DNCA 2QDKA 1GGNA 1T0BA 2ILTA 3MWEB 5CLIA 2FZCA 4MDYA 1JDTA 4MVJD 4MQ4A 4M60A 1EK5A 4ARIA 1G20A 1YDFA 1ZW6A 2P5SA 2DETA 3R6GA 3LIIA 3PU6A 3NO4A 2ZBQA 2ZS7A 4A0GA 2O1SA 1UAGA 1CS0A 5GY7A 1OBCA 2ZE5A 2P77A 1RYEA 5T3UA 5AM3A 1MENA 3L6EA 4NHOA 4HTFA 4P36A 5HIIA 2IHNA 1EBUA 5EZYB 1E1LA 2ST1A 2C2ZA 3P4YA 4BO1A 2O0LA 1NRJB 5E1MA 1FYVA 2NZ2A 1N2GA 1JMKC 3QVMA 5C32A 1QOZA 4REMA 3BCHA 4KQEA 3R24A 4RQBA 1KRXA 1AOXA 1OBVA 2YWBA 4B7AA 1AF4A 1ZI6A 3GRAA 5LBUA 2CUNA 1XZDA 2FUKA 4PAQA 1E3TA 3H5OA 1DMRA 3MVEA 1Z37A 3E82A 1L5HB 3T3OA 3EJ6A 3QU4A 3D8BA 4H7FA 4A26A 3FIJA 1T8PA 3UC5A 1OYYA 2AYZA 3NHPA 2AV6A 3WDSA 2IQIA 2C4HA 3VNUA 3GA5A 3L7BA 3OMXA 3L3BA 3CW8X 1IXSB 3FOBA 4RLHA 5E2AA 1M5TA 1XWFA 1YVEI 4LNHA 4PYNA 4RV5A 1WDMA 4B4DA 4DCNA 3Q3IA 2C3OA 4IJVA 4LPSA 5CD1A 1JNXX 5J5CA 2RH4A 1VHWA 2IXAA 4U1RA 4XGIA 4B0OA 2GKOA 2PYZA 3PQCA 3GIWA 3G7UA 2ZXFA 2I2WA 3L8GA 5G3YA 1E3WA 1RHKA 2FPOA 1F8FA 1W7AA 4QTTB 2EFHB 2GD2A 5G1OA 3UA4A 4MSUA 5LVAA 3R3YA 1G1AA 4YJGA 3VU0A 4AO6A 3ZIAA 4TS1A 5JD6A 1U90A 2VHEA 2DXIA 3MT9A 4PYIA 3DQQA 1A72A 1SD1A 3O90A 4OFXA 1ISRA 2PT6A 3JSAA 1QVRA 1V37A 2EQAA 2R4UA 3CX6A 4FS3A 3NYRA 3OJ0A 2RONA 2J5KA 4IJWA 4QAQA 1WBDA 2GXAA 1ZH6A 1FNSA 3FVQA 4Q3KA 2ZJAA 4CL3A 3UPUA 3T7TA 5IM5A 3RCBA 1JS1X 3N2NA 1G5FA 1OGYA 4RENA 2X9QA 4K40A 4HJRA 1E8MA 1QRRA 1YE8A 4MLCA 3Q9SA 4RVCA 5J2UB 3ZNOA 2D2XA 3KQTA 5JWHA 3RYFA 4FNGA 4OU5A 3VR1A 4CKWB 2QRGA 5C80A 2XE7A 3CKKA 3EGCA 3LJKA 3OX4A 4AJ9A 1UPFA 3GLSA 5JFOA 4C6TB 2IUTA 1G8YA 3H9UA 3NRJA 4MS4A 1I24A 2PUEA 3FPGA 4N49A 1YK0A 4L3VA 1N4DA 1UF9A 2AMLA 1DAFA 3NVMB 4HB2A 3WSVA 2Z09A 4UVHA 5BOSB 4MGKR 1Y5RA 2C2WA 5HUJA 2NZUG 3GRPA 2G17A 1XQ6A 4TWBA 3VMFA 3FOAA 2W83A 1XMQB 5FHRA 3BXZA 2C78A 4EVQA 2OKGA 2VHQA 3IA7A 5HZMA 1VMDA 2PRIA 5DI3B 1H2RS 2ZFUA 3VNQA 1J07A 1JTEA 1NVGA 2VZ9A 3GGSA 1DDIA 1ETUA 3OZ7A 3D4IA 3KSZO 5EWJB 3U1BA 1BKYA 2CNOA 5L40A 2O14A 4I9NA 1G4UR 3PYXA 5AESA 3G2IA 1VG9B 2JJQA 3KQVA 1QTNA 5DTMA 4ZJUA 2Y66A 4IDBA 4LXIA 4RD2A 1CR4A 1CUCA 1IULA 2B36A 2PXCA 4PHGA 3B8HA 3WGYA 2EJCA 1L5ZA 3TLMA 1COWD 3BFXA 3EGWA 1DTWA 3FTQA 3GMSA 1DTEA 4EI7A 1TI7A 2QAGC 2ROQA 4GVPA 4RESA 4DA4A 2R6FA 4G1UC 3T4XA 1Y37A 2Z9CA 3B48A 5LJLA 2IHKA 3K0BA 1HFJA 1U0RA 3OCUA 1G5RA 3CMMA 3I37X 3MJCA 5AJVB 3ZQ6A 3PX7A 5D01A 4YT5A 4DZTA 3TFQA 1NYTA 3OHPA 1VPDA 4AB1A 3Q0TA 1M76A 1R9MA 2F1KA 4JOBA 4O59O 2IOFA 1Q5PA 3OZEA 4FOSA 5LM3A 2P9BA 2R3SA 4REQB 4WN9B 2V54A 4XGRA 3O3NB 4PG7A 5SY4A 4BBAA 3X43A 2GETA 2VP3A 2HIAA 1NAIA 1XDGA 3EZLA 5FX2A 4QNNA 3KK0A 5JI3E 1I4TD 4XAQA 5KOHA 2ZQ5A 3DL2A 3W04A 1YQXA 5JMWA 4AY3A 2PS1A 3C3CA 2CV2A 1EE2A 1FK8A 3K32A 2PZLA 3CSUA 1QIMA 4KREA 4BDSA 1R9GA 2F3TA 4TWIA 5AI9A 3PE6A 1A9TA 1T8YA 1CNEA 3NX4A 3G0IA 1BGXT 1Q22A 1OZ0A 3WIBA 4ENWA 1Y7IA 5KMGA 1WXHA 4QHSA 4S1VA 4I50A 5EP4A 3CNBA 3FR7A 2VJPA 5E8RA 2W98A 3FCUB 2R2GA 5TT0A 5IAEA 1FP7A 1OTXA 1EK0A 1WXFA 2HFJA 1O94C 1EYZA 3EUWA 4HYYA 3V7WA 4DIMA 5C5CA 2A4KA 1NM5C 3CFYA 5FHQA 1VJ1A 1R7RA 4ZVRA 1SUCA 5DRTA 4RPKA 3OPYA 1SUBA 3QKWA 1ODJA 4MVWA 2QS9A 1ZL2A 3C1OA 4R6XA 5CTJA 4B9AA 5DP2A 4XQCA 1O89A 2OQ2A 3O1LA 5HJ7A 2AKYA 1G5IA 4AVYA 5K7SA 3E15A 3R0VA 2AXPA 4LKOA 5H70A 3S4YA 4EHBA 5BQ5A