2XDYA

Crystal structure of the n. crassa qde-2 ago mid domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
127
Chain Sequence
KIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure and Ligand Binding of the Mid Domain of a Eukaryotic Argonaute Protein.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
total genus 41
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xdyA00
3I45A 2FSPA 1NXWA 1TJYA 3F6CA 3IP6A 3RVKA 4CBVA 5KQLA 3HUTA 4JASB 4PICA 5EWLB 3W9SA 4F06A 3QEMA 3O1IC 3Q7RA 8ABPA 5HQJA 4YWHA 3KKEA 4LZLA 1DRJA 2JBAB 3JS5A 2FLKA 3GBVA 2E4VA 5JNRA 3EODA 3TD9A 2R25B 4ML3A 4S05A 1Z16A 2HQBA 2E4UA 1ZH4A 4RY8A 3OLVA 1JDNA 4RY0A 3N8IA 1ISRA 2WB4A 4MR7A 4RDCA 3H5VA 2RJOA 4MR8B 1M5UA 3RVNA 1ZESA 2GKGA 4MGEA 1OXKB 5JS2A 4LDZA 4RK7A 4EVRA 5T7BA 4LX8A 4XFKA 1SD5A 1UDRA 2J48A 4MS4B 3HM9A 2E4WA 3NNNA 1FSPA 5GOTA 4MQFA 5FBHA 3DGFC 3HV2A 2FMIA 5HKOA 1D2AA 1D5WA 2N9UA 1RXEA 4MPTA 4EUKA 2LPMA 3M6MD 1D1PA 5PNTA 3O1JC 1USIA 3ILHA 3HZHA 2QW1A 3I5AA 4RKRA 2JVIA 3T38A 1DC8A 4WXMA 3N6VA 5ABPA 3P9YA 1USKA 1JHZA 4KK3A 1M5TA 3H1FA 4MRMB 1LBIA 4G0MA 1QPZA 3KLOA 3KYIB 3O2JA 2JCGA 1LJLA 4M88A 4MS3B 4ZYLA 1YK1A 2MSWA 4L85A 4WWHA 4P1ZA 2M1ZA 1GLGA 5KQPA 2VUHB 3LOPA 5C5EA 1PHRA 3LFTA 1MAVA 2PE5A 1BDHA 6ABPA 1PNRA 4Z0NA 3N53A 1NXTA 4YCSA 3CHYA 4EVQA 3CS3A 3DLHA 4G97A 3N75A 4XASA 4Q6WA 4XARA 5HM6A 4Z4IA 1QO0D 4MR9A 3MIZA 3UKJA 1Z25A 2F8TA 1SRRA 2A9RA 1LK0A 2R47A 3RH0A 1EAYA 3S99A 3QELB 4G0ZA 3KLNA 4EYOA 5TPWA 4LE0A 1ISSA 3C3WA 5FWXB 2PMCA 4HNRA 3HEBA 3IP7A 4MS1A 2NUBA 1JH9A 2NZVG 2PAFA 3KS9A 2QVGA 3GYBA 4O1IA 5ED4A 1DZ3A 3LTEA 3LUGA 4G0XA 3RVSA 3N0WA 2FXIA 4G0QA 2IPNA 2LBPA 3HJFA 5EWJB 2WY2D 2H3HA 4WXEA 1E6MA 1U2QA 5IUJC 1JF8A 2HQRA 3QX9A 4MLDA 3FFWA 3RVRA 2PUDA 1NTRA 4TMYA 5B3JC 5FWYB 1DBWA 3G85A 4GPAA 2PUCA 4ZJPA 3CG0A 4WT7A 5IUKC 4O5AA 5KQGA 5TPZD 3HDVA 4RU1A 3GV0A 3HVRA 1YMVA 3T6KA 4W5NA 1B00A 4DN6A 3CNBA 9ABPA 3M9WA 3H6GA 3A0UA 3K9CA 2JK1A 1GCAA 4KVFA 3MM4A 2LP4Y 2A9OA 4D6XA 3OO1A 4LE1A 1A04A 4UHKA 1FFWA 4F12A 3FFTA 4Z4FA 3OLZA 3H75A 3KTOA 4IF4A 4RY9A 2TMYA 5TQJA 1NXVA 3OM1A 4RV5A 4JB2A 3I09A 3H5OA 2R48A 1CHNA 1A2OA 5JNUA 5IEBA 1ZN2A 5TPWB 1MB3A 5TQ0B 4EYGA 4E7PA 3CKMA 2P4UA 4PZ0A 5CNIA 1T34A 1YTUA 4G0PA 3FMVA 2B4AA 3UK0A 4N47A 2FN8A 3NBMA 2X7XA 1YMUA 1MB0A 3R0JA 3RVJA 3BILA 2E4ZA 4KRFA 1TLFA 1URPA 4RZSA 3URMA 1KGSA 2IYNA 5EWMA 3KSMA 5CNJA 2CHEA 5TQ0A 1PEAA 2O20A 4OTZA 2FVYA 2PLNA 1RXIA 4KPYA 3EQ2A 3HDGA 4QYMA 3OQNA 3DBIA 2CHFA 4TLMB 3GBPA 3RQIA 4YP9A 3OLYA 1NY5A 4RXMA 5B3JA 3EJWA 1EWVA 2ID9A 7ABPA 2PUAA 3CRNA 1QQBA 2I6FA 4OLBA 2FEWB 2YHAA 3HCWA 4Z4CA 4NCAA 3ROTA 2GWRA 3LUHA 4ETMA 3O2QB 3C6QA 3ILYA 2RGYA 4YRZA 1ABEA 2L19A 5C5CA 4Q7EA 3HO1A 4OLAA 1VRVA 4RK6A 3LKBA 5FWYA 4JP1A 1Z15A 1XWWA 2RDMA 3CU5A 2FKAA 3GT7A 2QV0A 3I42A 5JNWA 4MS4A 3VNBA 1XHFA 2R4QA 2LUOA 4LRQA 3L49A 2P9HA 4KZKA 2WRZA 1RPJA 1Z26A 5IEJA 1DJMA 4QYWA 2PJUA 4GNRA 1S8NA 1W9HA 1DCKA 2QR3A 4MLCA 1P2FA 2AYZA 4MR8A 5T3YA 4LDAA 1U2PA 4PEVA 2FEKA 3K4HA 4D6YA 5CHYA 1GCGA 1EWKA 3KG2A 3QLTA 4MAAA 5KC9A 2IPMA 4G0OA 1Z13A 2RJNA 1M2FA 1TVMA 4N0PA 1L5YA 1EWTA 5CNMA 1RZRD 2PUEA 3KJXA 1CEYA 4FE4A 4EVSA 1YS6A 4H60A 1DRKA 1DCFA 4IGAA 3NNSA 5FWXA 1NXSA 1PEYA 3LMKA 1JFVA 1MVOA 3OO0A 2IPLA 5EWMB 1YK0A 5GQSA 5TE9A 4F3TA 3OQMA 1K66A 3C3MA 4RK5A 1FQWA 1AB6A 5DCLA 1LBHA 2V0NA 3IPAA 5JNTA 4RK4A 1P6QA 4WUTA 4W5OA 1WETA 1JLKA 3EDCA 4TLLB 4MS3A 1VPWA 2L2QA 3Q7SA 4YLEA 4QPJC 1ZGZA 2AYXA 1FFSA 3QLVC 4MRMA 3GA5A 5I4CA 5IX8A 3H5TA 1LJUA 1Z2DA 5DKFA 2QU7A 4KK4A 3LUKA 3RVMA 4KV7A 1JFSA 1Z2EA 1U8TA 2E4XA 1BDJA 2FMHA 1U0SY 3JVIA 2VUIB 3IDOA 3MQ4A 4DQDA 2NZUG 2PL9A 1AB5A 1YVUA 2OENG 4N76A 1NXOA 2NT4A 2HPHA 4LE2A 2A9PA 3JPWA 3E3MA 2MYUA 4OBBA 3RVQA 2HSGA 2ZWMA 2FTKE 2FN9A 2FQWA 1D4ZA 1ZDMA 3QX8A 1JYFA 4EYQA 2FQYA 3M9XA 3MA0A 4JA2A 4YS6A 4PYRA 1DBPA 2FMKA 3O75A 3GWGA 1Z12A 4UHJA 5BRAA 2FLWA 5BR1A 4Z4HA 5JS1A 1QKKA 5JNSA 2A9QA 4MQFB 2LIVA 4ZMSA 1M2EA 1W25A 1YIOA 1SXGA 3OLWA 4MQEB 3L6UA 3MYYA 4NV3A 2FW0A 5EWJA 2OQRA 1YS7A 4G86A 3JY6A 1JX6A 4IRXA 3D8UA 3E61A 1KRWA 1BAPA 3O1HB 4KFCA 2PUFA 4FB4A 4F8JA 1MIHA 2L17A 4S04A 4N41A 4MS1B 1BDIA 4N0QA 3QLVA 1E6LA 3NNDA 3A10A 3QELA 3OMXA 4YV7A 1QMPA 3RVPA 5E3JA 2JVKA 3CTPA 4EY3A 1IIBA 3HUUA 1SXIA 4MR9B 3O74A 4EGSA 1RNLA 4HYEA 4MYRA 1GUDA 5IULC 3MMNA 1J56A 1P6UA 3QEMB 3LKVA 4Z9BA 5EWLA 4RK1A 3KYJB 2VYCA 4JOQA 1GUBA 4NQRA 1Z18A 3OM0A 3HK2A 4IILA 4Y9TA 2B1JA 5BRJA 3G1WA 5KC8A 2E4YA 3JTEA 3LUCA 4RXTA 2L18A 3A0RB 5D2CA 3SM9A 4HNSA 2GX6A 3SNKA 2PUGA 3SQNA 3F7NA 4NICA 3UUGA 4D74A 1ZVVA 1ZH2A 1VLZA 3SG0A 3H6HA 2MYPA 2XDYA 2M98A 3BREA 3QEKA 3SY8A 3OMWA 3IP9A 1DC7A 4XLTA 4FE7A 3QLUA 4E7OA 3HXMA 1C4WA 1NXPA 2KYRA 3H1GA 3RVOA 3O21A 3TMYA 2ZAYA 5HSGA 4NCBA 2IDMA 2WJWA 1DBQA 1USGA 2Q5CA 2QZJA 3OLXA 4JB0A 3IPCA 5F64A 2GI4A 5FBKA 3KCNA 4JAVC 3HSYA 1BVHA 3H5WA 3EAFA 4QICA 3C3KA 1JYEA 1F51E 3BBLA 1JFTA 1QQAA 2QXYA 2WMYA 2HJ9A 1DCMA 3Q15C 1SXHA 1KMIY 3T8YA 1APBA 1JBEA 3FFXA 2F8SA 3NHZA 1D1QA 3OQOA 3F6PA 4RSMA 2MSLA 2IPAB 2PKXA 2JVJA 4H3HB 4ZPJA 3GL9A 5KQMA 3H1EA 4IMJB 2QVCA 4ETIA 4F11A 4H3KB 3H5IA 4MR7B 2HQOA 1ZGGA 3IP5A 3LUJA 3O2SB 4RKQA 2JRLA 2FEPA 3ROFA 1ZAYA 3NHMA 4XAQA 3EGCA 1QP4A 4PE5B 1E6KA 3LUAA 5TQ2B 1OXBB 2IKSA 2JBAA 4L4UA 3CLKA 6CHYA 1ABFA 1QP0A 3B2NA 1A0OA 3EQZA 1PNTA 1K68A 1Z17A 3Q9SA 5KWSA 4KNYA 2WJAA 2PL1A 4Z4GA 3BRSA 1I3CA 1C0EA 1RZRA 1BA2A 1FFGA 5JNVA 1R8JA 3JPYA 3N0RA 3SAJA 1XHEA 3HS3A 1QP7A 4YO7A 4EYKA 2CWDA 4O1HA 5KI6A 3F73A 1F4VA 1VKRA 3N0XA 1EFAA 5TPZA 4G0YA 2QSJA 1NXXA 1ZITA 5TQ2A 4XXHA 4N03A 5CNKA 4TN5A 2DRIA 4OATA 4ZMRA 1P8AA 4KMRA 5DGCA 4MQEA 3EULA 3TO5A 3Q7TA 5IBQA 4OG2A 2YHBA 3JVDA 1TMYA 2MYTA 3DGEC 1NATA 3LUDA 4KQ9A 4RWEA 4YGXB 1E2BA 1PUXA 2IOYA 2MYNA 4YR7A 1JDPA 3CZCA 1QNLA 4Z99A 3D02A 2WWVD 4Q6BA 4RS3A 5BQ3A 2NT3A 3Q41A 1HEYA 1ZY2A 3CZ5A 3MF4A 2ID7A 3FDFA 2BGGA 2W42A 5DTEA 1U04A 3H5LA 2PUBA 3TX6A 3DZDA 3LUFA 4KQCA 3QLUC 1KRXA 3CFYA 4IMIB 4ETNA 3VNAA 2FMFA 3CG4A 3TB6A 4DADA 3A3KA 4W5RA 4RK0A 2FQXA 1QO0A 3GRCA 4HNQA 1JWLA 1L5ZA 2VK2A 1H9CA 2H0AA 4RXUA 1EHCA 4WZZA 4B09A 5IC5A 3DLBA 1DP4A 2JB9A 2CD7A 3QK7A 3KHTA 4Z9AA 1DG9A 2MSKA 4W5TA 3RVLA 2GBPA 3FGZA 3T95A 3C97A 1TM2A 1ZHHA 5IUNC 1CYEA 4P98A 5DLEA 4W5QA 4KREA 1Y1LA 1JL3A 4Z4EA 3BRQA
chains in the Genus database with same CATH superfamily
5K6TA 3AM5A 3TR0A 4NENA 3W2FA 4MJLA 2R87A 2Z0MA 4DC9A 3N0TA 3BQNB 3RVKA 5CXUA 1SUPA 3H9CA 5EWLB 4M8KA 1V1MB 5DRTA 2CHUA 1RLJA 1U8CB 4WKGA 3D1VA 2OYRA 4QOHA 1DRJA 2ZJAA 4AJHA 1WDMA 1YVDA 1DJPA 2PLFA 2JGIA 3DLCA 5FO0A 1W46A 5SY6A 3EDQA 3M3DA 3SXJA 1ZD9A 2E4UA 4R8MA 1TYAE 3NU1A 1ZW1A 1XTVA 2OV1A 3RSCA 1C9EA 2M6RA 4TMTA 4WKPA 3U3KA 4PZPA 1QH9A 2JW5A 2X6RA 2IEGA 2ZB8A 3BN3A 3IKMB 3SYMA 2H4JA 2WUGA 1Z82A 1T9AA 1ZESA 1SA0A 4EPTA 1ZJ6A 4HN2A 3AB8A 4LYYA 4UE3S 1OLXA 1DHTA 2GEJA 1XX6A 1FW8A 2WJ4A 4ZCIA 3BSYA 2RGCA 3NDRA 1TU4A 1B1CA 2RGWA 4XFKA 4YYEA 4M7RA 3IE2A 3CNLA 2O8VA 1NE7A 2XQIA 5CFRA 1KEVA 1H85A 3SCZA 3U13A 5CA0A 3EA0A 3SSNA 3W8DA 1ATZA 4JELA 2H1IA 3ZK7A 4K81B 3RHTA 4UTPA 4FZJA 5FQOA 3G0CA 2PR7A 2QE6A 4EJSB 3RC8A 4RTSA 2IGTA 2NVUA 3LT0A 3MUEA 2G5PA 3H83A 2UUAB 2QRUA 3HCAA 2A4MA 2O19A 3E9YA 3ZZMA 1QLJA 1DEOA 4FGZA 5B64A 3RG8A 2QW1A 4NXNB 1ENZA 1RRKA 4BFLA 3LYHA 2JVIA 1MXHA 1NVMB 1Z3CA 2Y93A 1IQ0A 1RS0A 3E15A 4Q3BA 4DQ0A 1OW3B 1T5LA 1T9BA 3EGWA 5HGJA 1LJLA 1EVEA 4BV3A 2ZYHA 4TWZA 4I0WB 2OL4A 1WSBA 2NG1A 1X1BA 3H9UA 4UUOA 4PSCA 4PFQA 5BOVA 2JH3A 2PGAA 4IKPA 1TK2A 4F9EA 5CURA 3C4JA 1XAIA 1W4AA 3ANLA 4TLAA 4DDMA 1FTQA 5IKEA 1NXTA 2DT8A 2IYZA 2RAVA 3KT0A 5AKLA 1N0WA 1MEOA 2H7CA 5IP5A 3U3XA 5J2TB 2R8YA 4Z4IA 2JI8A 1AKTA 3PNPA 4IDHA 3WHLA 3DHWC 2B36A 4CU5A 4EZIA 3F46A 3CRRA 2A9RA 3WNVA 3GLIE 1RD4A 3UBTA 3KV3O 1BSVA 2XUDA 4MARA 2AUTA 5F33A 4B7UA 3HCDA 4RDXA 4KMMA 3NX4A 1E1RD 3GUCA 4LE0A 5FWXB 1CHDA 3KU1A 3VHXB 2VRCA 3U4AA 5GM2A 5IK2A 3I73A 4QUIA 3EAQA 4EEXA 1A98A 2PAFA 2VBCA 3DV0A 2GM3A 1WSDA 2QQEA 4B6FA 5C8ZA 3THWB 2F17A 2R4UA 1XHLA 3IIIA 3NJ8A 4KMOA 4Q7JB 5JMPA 4BUZA 3RT1A 3F71A 4LGVA 3FDZB 3G8CA 1Z0UA 3DZJA 2B4RO 5F3WB 1G3IA 1GLVA 1QJCA 4B31A 1YV9A 1XOIA 2HQRA 3P0IA 4EUFA 3EZFA 1U7DA 4MWTA 1OLSB 2X0IA 1IN6A 2OSBA 3IBSA 3IHTA 4KWIA 5CHEA 3QW2A 1DBWA 3WAKA 1H9BA 2P9GA 1E7YA 1KH1A 5JBQA 4UW9A 3MCTA 3C7KA 4O4JF 3CNHA 1XZMA 2B78A 1KI4A 4G5HA 2M6KA 4B73A 3DC2A 5M29A 3J81k 3OKCA 1G8GA 2HYIC 1JW9B 1ODTC 3A0UA 4TYQA 2ODEA 2COEA 2H0QA 2JK1A 5E7JA 4AIIA 1VCHA 2LP4Y 3CZAA 4FFBA 4AMGA 4ENPA 3B9BA 2GLUA 3G8DA 1XSEA 3K20A 4QD3A 1UBLS 3S68A 3WYDA 4UAGA 4UTOA 1TJ5A 2WIGA 4DA7A 2ZKLA 4F12A 3AI3A 3UMMA 2YJTD 3EXHC 3H75A 3B6JA 3GLSA 3NG1A 2UYQA 3OM1A 3O8CA 2D1YA 1U3VA 1J33A 1T36A 3OESA 2EW8A 3IESA 5F5XA 5TGTA 3WGHA 1Z88A 2IHVA 2POQX 1MB3A 3U37A 4P36A 2NUAB 3VR2A 4E7PA 4PRKA 3CZQA 1R88A 3BXZA 3PHCA 3ZZTA 1Q3TA 3FA2A 1BNCA 2FR0A 2E1PA 4BFSA 3ILXA 4WBNF 1QSGA 2ZBUA 2HWWA 4JP3A 5DN6D 1OGIA 2E4ZA 1LFAA 2IA5A 3K1AA 3DFZA 4AUEA 3B8EA 4PONA 1Y5IA 3OT1B 3GHYA 1S5PA 2RB4A 2QRVB 3ELWA 5ILGA 3JATB 4HB3A 1PEAA 1Z6ZA 4OQMA 5KNCH 5LM3A 3RAFC 4J7UA 2ZI4A 4I14A 2NSLA 3OZUA 3SYKA 1CR4A 4ZT7A 1TM7E 4YBRA 3MFYA 3D4PA 3JQAB 4BBZA 4C14A 4CN9A 2H17A 4KXNA 5FEMA 3ZKAA 3TJRA 1V16A 2D13A 2OC4A 5ELLA 3UMYA 1INLA 4Q9NA 2YJGA 3IDSA 4BNWA 1EFKA 1FYWA 1QHGA 5H9VA 1XJWA 4ZCSA 3TL6A 4QRIA 2NAFA 5FUMA 4PW0A 1MJGM 3PXEA 4QAQA 4EQ6B 5DNUA 3I4LA 4JLPA 2H5IA 5KQRA 1F8UA 1Z0FA 4HFMA 4NU5A 5TJHA 4TWBA 2FRDC 4TL6A 3C6QA 3O38A 3WYFA 2FSGA 1G66A 4LV6A 2QLMA 3ODGA 3NIWA 1FP4B 4Y7CA 1OVMA 1A3CA 1TCAA 5BYJA 4IFIA 2I1QA 4II7A 5IARA 4GU5A 4JGBA 1EVZA 2LE0A 3EXIB 4UAUA 4DLWA 2DFKB 1PDOA 1XN4A 3D6HA 2H06A 4RAOA 1PGJA 1U4SA 4PO3X 5BUQA 2BDUA 3PWTA 1W47A 2FPOA 3B1YA 4QXRA 1ECJA 3U44A 4BE4A 5LZ8A 1YQDA 3TM5A 5FD8A 1WJGA 3JZIA 3L1VA 4MI1A 1CUDA 1Z26A 3L84A 4O2AA 5DHAA 4NYIR 3ROMA 2V7GA 3PXXA 3TXAA 1MMFB 2H7YA 3UAVA 4A91A 5CCBA 1UUFA 4PFJA 2AYZA 3E22B 4Z9YA 1Q21A 3AJDA 3B78A 3IEXA 2G09A 4L9WA 4NZOA 1PG5A 3SHWA 3PL1A 4PV7A 1EE9A 1JMKC 3AM3A 5E6SB 3ONDA 1LJ8A 1TYZA 2OQVA 3ZHYA 4I99A 1CRQA 1MNAA 3ZLBA 2LDBA 3AINA 4UUNA 1V5EA 5H3HA 5JC8A 2ZJ5A 1LS1A 1WUIS 3AQIA 2FUNB 2IF0A 1P1BA 3M4XA 1ST2A 4LJYA 4MRPA 4C87A 2EFJA 1HLFA 3OFNA 3R2JA 2D1TA 4KAAA 4NONA 3TH5A 1YS6A 5KTMA 4EPVA 1XZHA 1DCFA 2AXNA 1L6IA 3HVJA 4Z3OA 4M36A 3SEZA 5E2IA 5A3VA 1GPH1 1NM5C 1P31A 1JFVA 3JD2A 2IPLA 4HQKA 5BXQC 3PUJA 1L8AA 1JU9A 2C00A 2R7LA 1FQWA 1XCMA 2XB9A 1AV6A 1S96A 1AZLA 2WILA 5U9CA 3DP7A 4P4TA 2RJ3A 3ADBA 3UQYS 1HZZA 3FSRA 2W2KB 4KXMA 2WTNA 4QECA 1NVVQ 3DBLA 5JDCC 1R9MA 2JZOA 3ZQ4A 4ESVA 3OBBA 1QIGA 1UP7A 1E5XA 4LV5B 1K2WA 1Z4NA 3OEED 5ES4B 1HORA 1K8ZB 2J3JA 1NULA 7MHTA 2JFPA 2EATA 3P19A 5AIAA 1BMFA 3RVMA 2ZBVA 4DLSA 3GCDA 1C9KA 2Z6VA 1MIOA 2VUIB 3L8DA 2WKPA 3V1NA 1T9KA 4XUCA 3SR0A 2VIIA 4TRNA 4NAVA 3R5FA 4E46A 2GKSA 4PLYA 2ZWIA 3E3MA 1MU0A 1ZH0A 2BKLA 2Z2IA 1S6YA 1W35A 3GROA 4G84A 5HR5A 3LA6A 1Y8ZA 3QPUA 3HKCB 2YCLA 2HDOA 3Q9NA 1IY8A 2BMFA 2DERA 4OHYA 1PF7E 5C80A 2M32A 4GDMA 4ZD6A 3L0BA 1RWXA 5KPJA 2V45A 4BJ5A 1KEPA 5HJEA 3A6GA 1JT9A 1YC5A 4KTTE 3AF0A 4U7FA 2YCBA 4C1BA 2C9MA 4JQZA 4KIUA 1FRFS 1Y6RA 2O2EA 3C7AA 4OHWA 3MWEB 1PZXA 2B99A 1ISPA 4JJGA 1D6MA 1XAJA 2V7QD 3C8MA 1KJYA 1KP3A 1UC8A 2XNKA 5CYGA 3E3LA 3KJNA 4KFCA 2A88A 3GQBA 4PYLA 1U6JA 2JIDA 2I87A 4KN8A 3SEAA 5JRZA 1JQJC 2BSAA 3A10A 2GN1A 3AUYA 5HKLA 1WL8A 3X1WA 2A1UB 4ZHQA 4ZAXA 4S35A 1NQAO 5KNDA 4DR1B 2HMUA 1DAFA 4UXIA 1I4TD 1RAIA 2GNOA 4G1MB 4F91B 1GTG1 3QVLA 1KYTA 1ESDA 1YRBA 3HYCA 3LCJA 2V65A 3QEMB 3SDBA 1PNQA 4UZSA 1N2OA 3ICEA 1PJRA 5I8ZA 4DIBA 4CL0A 3A36A 2W6JD 4N1AA 2BY4A 4R84A 3IQHX 1SVIA 3E7PA 3ZXXA 1X7ZA 4JJ6A 4R2KA 3DEAA 1FS4A 3L0IB 1X2BA 4YONB 1F2VA 3M1LA 3DW3X 1T4BA 2QY9A 5B58C 5EE5B 1ECPA 5IWAB 2GX6A 3C8HA 3KE9A 2NO9A 1BH6A 2REXB 4U3JB 4CMHA 4D74A 2OB1A 1P0FA 3CW8X 2W2TA 4MDYA 4DR6B 4TLDA 1LWOA 2GJ9A 4OHVA 1NZDA 1SO8A 2FLVA 2M98A 2D59A 1YI8A 4IXMA 5DEIA 1DB3A 2VRWA 2ZBQA 2QRZA 1NXPA 3HXMA 5HSGA 4DCOA 3QWFA 4JB0A 1D04A 3EIOA 1P39A 3JRNA 2XGSA 4BLQA 4RL4A 5JR3A 4QICA 5HFJA 4KFUA 3IKTA 2UZIR 3C3KA 2XKAA 5B6JA 2LGJA 1U3WA 3S8YA 1ACMA 1X8LA 2WVJA 1JFTA 3BTUA 1QRSA 2GPSA 4AVYA 3LLUA 4JP8A 1PBTA 4MLPA 2J0QA 1Z0AA 4D43A 1OU4A 5FBLB 9LDTA 3RU9A 4CMBA 4V3CA 4YRGA 3OEWA 4EVQA 4CLDA 1YRYE 4EDHA 2PG3A 1D1QA 3HB0A 3D64A 4MUJA 1M54A 4RSMA 5CRIA 2SKDA 1WDLA 1ARZA 4XCXA 1J9ZA 4JOSA 2QVCA 1ZI8A 3FKJA 3QUSA 4YECA 2HDNB 4R8VA 1XNJA 4F11A 5DHUA 3BWXA 3EH1A 1RI5A 1VLHA 1YD7A 5F1KA 3KQSA 5DGXA 3LDFA 3CN7A 2R44A 4YP1A 3GEMA 5G4KA 3WNCA 2GJ8A 1KP2A 4TLCA 2J0UA 4B6QA 3AIMA 5DNCA 4QPPA 3P26A 2VAMA 3AONB 4RTKA 2ZJ8A 2IYYA 1G2PA 1RAAA 1T2AA 2EKDA 1OXBB 2GZ2A 1EZ1A 4PS0A 2CV2A 1KVTA 4PZCA 2EV9A 1MABB 4DMHA 3HTXA 2YZNA 2B34A 4L16A 5CCDA 4B4OA 4IUBS 1PE0A 1C5KA 2DUWA 2QG4A 1P7WA 5HKAA 3Q9SA 4U8HA 1II9A 1UK8A 2AZDA 4E07A 1O6GA 2J8ZA 3O73A 4WUVA 2QTCA 2II6A 3NOXA 4OI1A 2DEUA 2OFXA 1EFVA 1I3CA 1SHKA 1H6BA 5CDHA 2Y1XA 4CKCA 3R5JA 2WJJA 3EGIA 4B35A 1CF4A 4TXJA 2NOAA 3N0RA 1XHEA 3UHOA 3C16C 3W7VA 1HT1E 5KIAA 4B3GA 3TLMA 2CWDA 4D6PA 2ZT5A 3AI7A 4NH4A 2W6NA 4JSRA 3QF4A 2XXAB 1CJCA 4REMA 1JA0A 3MWEA 5FBWB 1JR6A 4BKOA 2JASA 1W8IA 2XGOA 3D3EA 1B2RA 4YWJA 1GVNB 4ZO4A 2AF3C 1VYHA 3EULA 2ZB2A 2PMKA 4OG2A 5DW3A 5ELMA 4G0VA 4O8CA 1TMYA 1IULA 4C7JA 1NMQA 4DUYB 2XAAA 3BRCA 1GNQA 4C01A 4MKXA 4RWEA 3KTDA 1YS1X 1LI5A 4M3NA 4P34A 4Q48A 3HRKA 4YDHB 3OEHD 3W7AA 5JUWA 3HXKA 3PC3A 3HSSA 1BJRE 2IOFA 2YY5A 1SZDA 3MHTA 1ONBA 4RS3A 4GMGA 1XQXA 4PAGA 4V39A 4MW1A 4X6UA 2HV8A 5HF9A 3SKXA 2HUNA 1L7MA 4KVGA 2BI7A 4Z1OA 3E2IA 2BGGA 3I01A 1ATIA 1EVLA 3FXAA 3MJSA 5HKBA 2ZSBA 3EXEA 1C7JA 2REOA 5FI1B 4YRTA 5JVDA 3STUA 4IMIB 5ALZA 2A30A 3FM9A 3WIBA 1FDWA 4JVMA 3W2EA 4JI4B 3VR4A 1EFTA 3KXLA 2AA3A 2G40A 4M60A 1G5TA 3VHRA 3ZPXA 1FP6A 5KUTA 3RSHA 3KT3A 5KNDH 3W9YA 4G07A 1XROA 3CJRA 3UJ8A 4XVCA 1EHIA 1GGEA 2AK3A 2QM0A 3KUUA 5F2EA 1OV4A 2ILVA 5KHLB 2Q7DA 1IXZA 1GZDA 1XVLA 2WWHA 2Q1TA 2GEBA 3E3NA 3L40A 1UJ4A 2REQB 3KZVA 2D0IA 1BHO1 3P52A 4L50A 1QZ3A 4UFNA 4XCQA 1QKIA 2W70A 1F8XA 5E6UB 1Y4UA 3T7IA 4BWFB 4DPLA 5B1YA 5JPDA 3O3CA 1OH6A 1ESNA 1M2HA 2JJ2A 3UIEA 2ON6A 3UHAA 4GSKA 3W90A 4E1AA 5BSGA 5DB4A 2R6DA 1LPAB 2QTBA 1ZHHA 5JAQA 3WWPA 2XKKA 4HPXB 4CM3A 2C3UA 4UZFA 1DXOA 4D98A 4JT4A 4O3FA 3ZNOA 5JSQA 4PU0A 4FSXA 2XUJA 5AOBA 1UMBA 4FX5A 3CX6A 3LGSA 3KJFA 1Y8RA 3L4SO 1ZXLA 5AXCA 3I4CA 1BROA 3AV3A 2GFHA 3CRMA 5KQLA 2EZTA 3W9SA 1FXSA 1RRVA 2I76A 1NYRA 3PQ4A 4G5QA 5E1OA 5DHQA 3A1CA 4P86A 4R54A 5DYIA 4HC4A 4S0XA 4Y6PA 4ICIA 5CVVA 4BNNA 1X38A 4C21A 1LBEA 1E2HA 4KYVA 3OEHA 4L4YA 5TS2A 3WLJA 4GMKA 3RC7A 3COPA 4KIJA 3O9ZA 1WY7A 2B21A 4R1TA 1BIFA 1FFXB 2C2HA 4V24A 2JLZA 1XRSB 3EH2A 3A26A 1ZUNA 3GLIB 3GCXA 1GM5A 1RYBA 4KRYA 3G88A 4YQZA 2XA2A 1GZVA 4IQFA 2JATA 2WTAA 5BYBA 4PYQA 3ABZA 3EUFA 2HJGA 1E9FA 2I2WA 1O08A 3WIUA 2ZYRA 4PRLA 4AN0A 2BHLA 3QEAZ 1LU9A 1QFJA 1WVGA 4DBZA 2J48A 4M0LA 1T6ZA 2HA0A 3P0JA 4NFLA 5GOTA 5BN3A 3A1FA 3LJKA 4W7SA 3WLTA 4ZVOA 2FFJA 4H1WA 2D5LA 3F4BA 4F92B 2IY7A 1P45A 3AIOA 3T3IA 3ETJA 3AFGA 4LMPA 4OSEA 1I5EA 3K8OE 1SCNE 4ZYTA 4IJQA 5CB0A 1DCTA 1USIA 3SU8A 1XB2A 4BQEA 1WZ2A 2JAXA 3MB8A 2YDXA 3NM4A 3DQZA 1PZGA 4MJ3A 1J90A 1E4EA 1PGQA 1ZOPA 3ZCQA 2C5AA 3TQCA 5FP0A 1DIRA 5FI3A 5K45A 4KVZA 4B3FX 5CJJA 3P9YA 1IMOA 3VYTB 5LWHA 1O8CA 3H1FA 4CCWA 4PAMA 2X76A 1EUDA 3PNSA 1TMOA 2P6RA 2ZRIA 4ZT5A 4E5MA 1JQBA 2Q50A 5CLGA 1EBUA 2PX5A 3D43A 2A35A 3D7KA 4CU2A 4XSHA 1MOPA 2FJUA 1O0BA 2I6UA 4QHYA 1AK1A 4ZVQA 4PC2A 5KQPA 5G0WA 5A71A 4PYJA 3KTAA 2ZU6A 1L4UA 2AEMA 3STXA 2E55A 2WTEA 4Z1MD 3ZDRA 3FAKA 1KK3A 1ZYUA 3C3BA 4KQJA 3GLUA 2X6TA 5JE8A 3ECSA 4PYKA 3RS4A 3WTCA 3DFIA 2B25A 3UBMA 4EPYA 4P58A 2C7BA 4AY4A 3JR7A 4LHWA 1KFBB 3RQSA 1PZHA 3AOGA 2XQVA 5FA5A 3OAAD 2Y6VA 2R47A 1UDBA 3Q7IA 1R0CA 2HMTA 3DHEA 2NUAA 3I9FA 4ER5A 2D5BA 2YXNA 16PKA 1THZA 4UXJA 1QVAA 4OHXA 3IKJA 4XZ3A 1FYFA 2EFEB 3EISA 1GEEA 1X1SA 2B0CA 3NHYA 4G0XA 1DOAA 2DPGA 4MW0A 3PC6A 4BJ1A 2BKUA 1Y3BE 3RODA 3AP3A 1OBHA 2BGIA 5CVTA 1N5DA 2IPXA 3HFJA 3KM0A 1FMJA 1TL7C 2IVZA 3E4CA 3FGPA 3U4HA 1C7ZA 4BP3A 1JF8A 4HH0A 1HYQA 5ALXA 3SSOA 1C41A 4GHWA 3TXYA 1DIOB 1S02A 1TLLA 5BXYA 3A1TA 4XTRA 4EZBA 4NOJA 3HVUA 4CDNA 1OBVA 4O4IF 2NO1A 5KOYA 1MEJA 1GILA 1HZJA 2YVKA 3INYA 2J9ZB 1HG1A 3K5PA 4GYYA 4G81A 4TV8F 2IXTA 3IQGX 3M9WA 3W3ZB 4RLHA 4A0FA 1YC2A 5I8PA 3G82C 3FFBA 4IZ6A 3SBDA 3P96A 3ZDXB 3ZZ0A 5BNTA 1IN8A 2ZTLA 1M34A 2PWPA 1AM4D 1T9CA 5FUXA 2GSWA 1AURA 1J49A 1YFKA 1Q0RA 5H02A 2H65A 3OWXA 2IVFA 3JD4A 1RRCA 4NV1A 1CIJA 5ELXA 3OPYI 1S89A 4PANA 3THWA 4Z4FA 5TQVA 3MEQA 3TEJA 2F3PA 4OH7A 5EJFA 4E14A 3TN7A 1V6CA 3HR4A 4DIFA 3AV0B 4LC9A 3KX2A 4JNCA 4ZHQF 2NV2B 1CHNA 3RFCA 4TVKA 5FPHA 5JNUA 1GWNA 5HBRA 2Q0SA 2RBGA 5GVRA 1NTOA 2H00A 3ROEA 1H69A 3BD8A 3DNPA 2FFHA 2I4OA 2BZ0A 4G1EB 4Y2PA 1W4LA 2OHVA 4R7TA 4YTEA 5ARCA 3WWYA 4HP8A 1O5TA 2VJMA 1PIWA 3TAXA 1JHYA 1OC4A 2E2WA 1JLMA 1YBHA 2ACKA 2ZCJA 4TMKA 1Q7CA 3G2LA 3UJAA 3M1IA 5HRUA 1KERA 1WPGA 2IW1A 1VM6A 2JGDA 3AYXB 1E63A 2D74A 4JJZA 3CLRC 3TQFA 3UM9A 4LNHA 3TNFA 4L5JA 1WB6A 2VJCA 3EUAA 1IIRA 1S8OA 2WE8A 3JQ7B 3KB6A 1OMOA 2FWRA 3KQWA 3OLYA 4F2HA 2I3BA 2DXIA 3I58A 4JYMA 4W8OA 2CUKA 1AKNA 1GR1A 2PXHA 4F6CA 1UKZA 4FFPA 4BP9A 5LSAA 2PUAA 4N40A 1Z0KA 2I2CA 4Y7DA 4ZI7B 3U61B 2E3JA 2IBTA 2FK7A 3FX2A 2BM1A 2OBLA 5GP1A 4OQDA 3PLRA 3R6DA 1G63A 3C3CA 3LXUX 4AJEA 3ICQB 3GVHA 1UXIA 2ET6A 1SCJA 3H65A 2RGYA 1FLNA 4I9FA 3ABQB 3ZZUA 1U63A 3AEKA 1FDTA 3WJ7A 1A5ZA 1Y3AA 2GJAA 3JQGA 3T06B 1Q0PA 3ICCA 4NBUA 3L0DA 4HTFB 2NVUB 4GGOA 3ZY5A 4QBIA 4YP0A 1GZUA 4RK6A 5TMDA 2GUGA 2XD4A 5AM5A 1N7HA 2BM0A 2MCFA 3TSOA 4QJBA 3F8WA 3BXFA 5CA0B 4FEAA 1SD2A 5C1IA 1PT5A 1T4GA 5A4DA 3ASYA 3KPUA 5IMBA 3ZGYA 3ZE9A 2PS0A 2Y0BA 1DBVO 2GR9A 4NS4A 3EFEA 2ATVA 4GNRA 4F93B 4UU0A 3A2MA 1QO9A 4ZA2A 4YACA 3JWIA 4ZEXA 3S2UA 1R5NA 2FEKA 3JARB 5JNLA 1QWOA 1MHTA 4V0RA 3DAHA 1CJTC 3IV7A 4G0OA 2NO4A 1R3UA 2O5EA 2RJNA 3Q3IA 1T5IA 4O59O 1KMNA 2X9NA 3LBFA 4JU8A 4V38A 4FHCA 3C4QA 3GRZA 3AY3A 3DMFA 5DYGA 5J40A 4DTCA 3PYLA 2PUEA 4YLYA 1KZ9A 4RESA 2YNMC 3I53A 1OAOC 3RASA 4ADSG 3GLGE 2MHCA 2NP7A 1CETA 2Q6TA 4C4YA 5K3FB 1PEYA 3D6UA 4X41A 5FBZA 3AVVA 1EB9A 2VDKB 1P2DA 1KYWA 1BEUB 3KJQA 2Q8PA 4B6RA 4K9RA 5IDXA 1HDYA 2GAAA 3DUFB 4PHTA 4QOIA 3KAPA 2Y0EA 1N8NA 2WOOA 4OMCA 4YQFA 1VPWA 4QQ8A 1C1XA 3LV8A 4QPJC 2R0QC 3K2QA 3EZ2A 3NP7A 4CEJA 5I3ZA 3U3MA 2QRLA 3V4PB 2P2NA 1AMNA 1QX4A 1YI0A 4Q9LA 1TUEA 4NFHA 1RJ9B 1E4EB 4ZXFA 3GLFB 1BX0A 2ZRHA 1CE8A 1PG0A 1X8JA 4PX3A 4GMXA 4WASA 3TLBA 1IOWA 1TTHA 3CX4A 4GX1A 2ACEA 1XZCA 4M1WA 1AA9A 1RM0A 3WB0A 3ZVKA 1QHHA 1XAGA 1ZW6A 3F4KA 1NXOA 2ZJOA 5AK6A 3R3ZA 3GLIA 1V47A 3FZQA 2HH9A 4CM9A 3AJ8A 2ZWMA 4DIKA 4DUZB 1X1QA 3TEFA 5JS6A 2P69A 3KOXA 4RCYA 4EB3A 1NAHA 3N2GA 5ADVA 2VJAA 3AK4A 2GAOA 4BNDB 2SKEA 3M9XA 4B0PA 1TEXA 2PSHA 4OFWA 1NT4A 1H3NA 1NYTA 2D62A 2VHCA 2V3VA 4BO7A 3AVXA 2D8MA 3NEAA 1H23A 4D7AA 2WJ3A 3ENZA 5DO9A 5F51A 4FQ8A 4MWBA 2X40A 1TC2A 2Z2ZA 3E7DA 3PUKA 4D3FA 1VI6A 2QTGA 1D8TA 3KRTA 4HDRA 1UINA 5E1DA 1FFXA 5CG2A 4YROA 1AO0A 5A1JA 5DF1A 2B1QA 2DMRA 5BQ5A 5BVHB 4HWOA 4RTOA 2J0SA 1B93A 2QQGA 4HO1X 2QKYA 5ERXA 4G86A 2VT7A 3FUTA 2XUHA 4H27A 5EMKA 3HR7A 1EVIA 2HN9A 1ZKMA 2DFVA 2X1MA 1VB5A 3HLKA 2VT3A 3IA7A 3M3HA 4UDOA 2WHQA 3D2BA 3IERA 4PQGA 4WIAA 3Q5GA 5CP8A 2EFHB 1OFHA 5KBYA 3EOZA 3INGA 3NNDA 3NBYC 3HP7A 2XY4A 1FMLA 3CTPA 2AMLA 3UGTA 1L4LA 1QNFA 2EEPA 5HOEA 3IO5A 5FIUA 1RNLA 1N34B 2CD9A 1J5PA 3O93A 2VQEB 5EZSA 3TW8B 4FINA 1ULAA 1R1DA 3NAZA 4YV2A 4FUQA 4MUAA 1GUBA 2VCEA 2JI9A 3CF6R 1KO4A 3NYIA 3FZYA 4XIFA 3OM0A 1KI1A 4ZQFA 4IKOA 4KX3A 4YAFA 4JYAB 1C1YA 1QHXA 2AE2A 2YXPX 4XA8A 4KMSA 1E5TA 3LX4A 4NKRA 4AJIA 5KOIA 2HR1A 1J8YF 3D4NA 3QX7A 3ZIAA 2DR2A 1U5AA 4IDBA 2F3RA 1FRVA 1HDZA 4CMKA 4U6QA 5E7MA 1N75A 3BB1A 4DT1B 2DKOA 3UK6A 1C8LA 5DT9A 1VCOA 3ESBA 3UUGA 1I7DA 1M1YB 3AG6A 3EXEB 2FPLA 13PKA 1PR2A 4LCJA 4A6DA 1TT5B 2XT9A 3LUBA 1BS2A 4RVNA 3CZPA 4K3VA 4F97A 5CLJA 2J32A 2QN9A 2W2QA 3BDAA 4A2QA 3QENA 5I7HA 2VJPA 1NE2A 3GMTA 3KCNA 4JQSA 3N7AA 4XWGA 1N6NA 5D00A 5TEVA 3WDMA 5ADUS 2KM1A 3O3OB 5TEWA 5L3SB 2PJRA 1XDBA 1F51E 2JPDA 3VV3A 2QJFA 3FVVA 4FYWA 2QAGC 1SOUA 2FJ0A 1YGYA 4UTVA 2HRBA 4H31A 4UPDA 3ZC3A 2XDAA 3GFOA 4UPEA 3AVOA 3MFQA 4PHFA 8ADHA 4P38A 5KTOA 1JKXA 2GZMA 2QDXA 2F8SA 3NOVA 4DA6A 3TVYA 2O3JA 1J22A 3BE6A 1VKJA 3F6PA 4QTUB 2PKXA 5EQFA 3JYPA 2R2AA 3QF4B 3TQIA 1JP7A 2CVHA 5I4KA 1AUXA 1XNQB 1LNSA 3DFKA 3H5RA 3DTVB 3OIWA 2Z04A 4YASA 3QZUA 1YFZA 2F1IA 3IP5A 4IXTA 4PZYA 4BWYA 2J9FA 1SG6A 2PFKA 3B3GA 3R7DA 4KU4A 3ZDBA 3LPAA 5JD4A 2X58A 3BMCA 4XAQA 5AJWA 4KQKA 1T9HA 1SC6A 4PN3A 2OBYA 3PCTA 1IONA 3QWBA 4BJHB 1GQRA 5I4BA 2J3KA 1U90A 5CDYA 4TXHA 1NQUA 3L7LA 2Q2WA 2YN0A 3IDZA 3OLCX 1EVYA 1TE2A 4I1RA 1UC4B 4CDMA 2FDXA 2WWTA 3WYCA 3T1OA 1XQVA 1YB4A 3SC6A 1GRRA 4D99A 3R3HA 4Y18A 4DABA 4E2XA 3UANA 3PNOA 1VHWA 2AT1A 3TLGA 1AKEA 1XE3A 4RY2A 4FGJA 1X94A 5HG0A 1NN3A 3WGNA 2CGEA 1SB8A 1SUSA 1EUYA 4H16A 4A26A 1EDDA 3W1WA 2CXHA 2LXNA 2INGX 5EP4A 5CDFA 3LDGA 3IUEA 5FJJA 3LK6A 1ZOOA 1FU7A 3VUFA 4UOZA 3OJLA 4GE3A 1JHQA 4PXYA 3EASA 3I0NA 3ZVNA 3CW2A 3GT4A 3ORYA 3FOAA 4WAUA 1EWYA 4LHSA 1ZM9A 4NNOA 1RQLA 4E03A 1GPMA 3NV9A 3KKKA 2J9RA 4GFDA 4JWTA 3C43A 3CR8A 4YCJA 5JEDA 5EYPA 1N9GA 1V11B 3V1YA 3ORSA 5DBEX 3JYLA 3ABOB 4XYLA 2CLEB 4G9BA 3DM5A 5ENZA 1E5VA 3RAPR 1QNLA 3VDXA 1FTNA 1JQLB 3AIIA 4ND4A 5AI5A 3ZDFA 3A1DA 5BQ3A 5LIPA 1FBTA 2PYIA 3GRUA 4O4HF 2UZ1A 5CM2Z 3KOOA 2RC5A 1ZIPA 4FC7A 3FDFA 3H5LA 4Z2YA 2RC6A 1WZIA 1BMTA 3EC2A 3H99A 3OA2A 3U3JA 1I5OA 3VISA 3I6BA 2CJPA 1KOLA 1M2OA 4J9UE 1L2TA 1LDNA 3U7RA 2AZTA 1IVYA 3R8FA 4U3JA 3V3TA 4CMEA 4LDNA 1LV7A 2GBCA 1DBRA 1RWMA 1SIWA 4PLGA 4QSHA 4BB0A 4ZCTA 3E1KA 3HBAA 4OGKA 4YRPA 4RK0A 3WYEA 5JMOA 4TKZA 2XYPA 4DMRA 2DC1A 2P2CA 2WF8A 3C3DA 4RXUA 3F5MA 2ES4A 3G0IA 1IN4A 2ZRCA 3UJNA 4YX9A 3PZRA 2WTXA 3TI7A 2BELA 2O8DA 4XLZA 4W5TA 5IJ9A 221PA 4KQ1A 5EVJA 2UUPA 3RVLA 2O1SA 5LC1A 4ALMA 1M6HA 3T95A 3DO6A 3DTYA 5D7BA 1ML4A 3W6UA 1RVDA 1XZKA 2IOQA 2CDAA 4PLVA 3IB3A 5DP2A 1TZKA 5DW0A 1T3SA 1QYCA 1RWWA 1ZZGA 2CL6X 2K2QB 2PR2A 3PHBE 1DARA 4W5QA 2DUNA 1Q92A 1KAQA 2UUBB 1K4KA 3VPHA 1USUA 5LZ7A 3L7MA 3VR6A 1OKKD 1FCJA 1HEIA 1KRHA 4OQZA 3UHFA 2XZOA 3T12A 1ZGBA 4QOEA 2OMKA 4UVDA 4K0RA 3BJRA 1FLAA 4QSMA 3GQBB 2CEAA 1U0RA 1WIWA 2DBQA 1G1MA 4L9SA 3WY9A 3ZD8A 2X8JB 2D6FA 4QJIA 1Z4QA 2EJCA 5JCOA 4I5IA 2D06A 3VZQA 1T8UA 3ZKWB 3MMXA 1R6DA 1CY6A 1CQJA 4QVKA 2Z58A 5A0TA 5I9SA 1EWRA 1FS6A 5JHHB 1MX3A 4DC1A 1HQDA 4MHOA 1E0JA 5IM4F 2JDID 3F3MA 3L8MA 1Y7IA 1P5FA 1W96A 2ZBPA 4AX4A 1J8FA 3EIHA 3FMIA 2EBHX 3N8IA 4MVJE 4I2VA 3VVCA 4FFDA 2H31A 3H17A 4IIYA 3X2SA 2QJOA 4JSTA 1H0HA 3P9QA 1P2VA 4PQEA 3FNQA 1JLRA 4RVCA 1U0OC 4DIMA 1WMAA 1ZD1A 2F64A 1H0KA 3UFXA 2E1RA 4PBRA 4PC6A 1GQ2A 5TGDA 3OJ0A 4MKZA 4I1IA 3S2FA 4HNVA 2HNKA 3CO5A 1GGFA 1RJFA 5LYYA 3T9AA 5AUOB 3B60A 2A78A 2P78A 3S0JA 4QGAA 1C2TA 3G9ZA 5LBIA 3UMFA 4YQYA 3SX2A 3R8XA 4DAOA 3N2EA 3KL4A 4RTLA 4IFTA 4C5BA 3WDKA 4JYBA 1VZ3A 3ICVA 5KSWB 4XVQA 2NACA 3PUXA 3U7GA 5CIWA 3WXMA 4LECA 1G2IA 1DWOA 1HPLA 3E0QA 1BE8A 1MV8A 1V4NA 5DWVA 1X6VA 4B87A 4O4IA 1JAXA 1OPRA 1FB5A 3G9XA 1D5CA 2XTMA 4MRMB 4KBYA 5K0LA 4KR3A 3SR4A 1FSFA 5DISB 2JCGA 3HKBB 1SU6A 3OY7A 4N3CA 4PLHA 4PZEA 1SCAA 3VR6D 4CLOB 2JKYA 5KNBD 1JIVA 1RKUA 1XQYA 5H3LA 3W79A 1VLVA 1PHRA 4BNGA 4EHNA 5LN1A 1FFAA 2OV8A 1O89A 4OOEA 4DR7B 2FPPA 1GGVA 4D9CA 3L4EA 1GNRA 3IT2A 4YCSA 5LQMA 3B48A 3LQFA 1UBCA 2D2FA 4A1OA 1SUIA 5IF9A 4L57A 3MIZA 3OIGA 3G7SA 4UU7A 4DJEC 3P2JA 1VE5A 3RH0A 2O1WA 5JQGA 1ID1A 2ICAA 2N0SA 3QEJA 2YHIB 4MGHA 3C5CA 4WKNA 4DB4A 2G6TA 3EZXA 2VNKA 3NWPA 2PH5A 2OBFA 4P5PA 4DPKA 3N5CA 2NZVG 5ED4A 3QFCA 1Z6PA 4FOLA 1SHZA 2IQIA 2XRFA 4MQ4A 7REQA 3H2YA 3LC7O 4O2AB 2AOTB 5F9MA 2P9BA 2PKWA 2DR3A 2XE4A 3U7JA 1K5PA 4BTLA 2K7FA 1DZIA 3FLMA 1LRLA 4TTSA 2Y1LA 4NCKA 5TY0A 1E89A 1U5BB 2RGBA 3DWGA 5K3AA 4NCNA 2O0HA 4LDJA 4G09A 1MJHA 1MH9A 4MVJA 4KNVA 1NBOA 4U2EA 5GJVC 3VQTA 2Z2XA 3NVAA 1SKMA 4IWNA 4YDQA 1IG0A 1W7AA 1B00A 1R8YA 4HDMA 2J5RA 4I36A 2C97A 1C30B 3PNBA 1KP9A 3R3VA 4Q18A 3LUPA 4CCYA 1M83A 1KWKA 3L5KA 1UFOA 2WA1A 3MCAA 3TX2A 3K9WA 5ALHA 5EOVA 1V8ZA 2B92A 3UAWA 2VXBA 3WZMA 3RUDA 2MMGA 4B2PA 4M7OA 5AI4A 3PI7A 4FSHA 2VATA 1UCFA 2CKDA 2GEDA 4GC5A 5DOZA 4DILA 4M1SA 4BAZA 2YFKA 3K0AB 4QVGA 4HDOB 1BO6A 2FWJA 2O48X 3GXOA 4PHGA 5TQJA 3T1NA 5I7SA 2ZR0A 1PWYE 3INTA 3CRW1 2VP6A 2YASA 2A14A 4EJ0A 2IHYA 4OB7A 3SXPA 1ADBA 3KOYA 4YRRA 1IEWA 2A5JA 1KJWA 4MYTA 5B4UA 5EJ8A 3DZHA 1FPMA 1TD1A 1LY1A 2W7TA 3WQQA 1W2WB 5DFAA 2XTAA 4JIGA 4EBBA 1IVNA 1WOYA 1WW2A 3L4KA 5B3KA 2JBHA 1RTKA 2FPPB 5EAIA 1ZVJA 2EKQA 1K2VN 2OILA 5EWMA 4NPHA 2KQUA 1AQ6A 2NYUA 3KSAC 3DWFA 2ZJ0A 4BQFA 4L08A 4KPYA 4D42A 1EFCA 3C6YA 5DIZA 2CHFA 4A9AA 1VRCA 1J07A 1E1KA 2CLKB 4OFZA 1GT91 1IBCA 2F3SA 2VTBA 4URFA 2FRDA 5E0KB 2ARKA 2HX1A 2RMKA 3DV9A 3PX3A 4BX0A 2PM8A 1K5HA 1OE0A 1CUJA 3E1SA 5AOCA 3JQFA 1A9XB 3HUDA 3I5UA 2H1LA 2A9FA 2JIPA 4NSNA 4DQLA 4O4IB 3ZJYA 2OCXA 3K7EA 4Y9RA 3SJBA 3QU5A 4X8LA 4PBTA 1IEVA 1J5XA 1JQ5A 1ZMRA 2K5UA 4NWIA 1NC1A 3Q3HA 3V55A 1I4LD 5BPHA 1CEEA 2FN4A 2GETA 3AHJA 4J1QA 5CH5A 3S2GA 6PFKA 2VS1A 2GVDC 4YCLA 4R6XA 3K73O 1TMGE 2AG6A 5DM0A 2ZIUB 4IHAA 4QAJA 5HIJA 2GOYA 4M9SA 3RRJA 1XF1A 3ZHBA 3H9GA 1Y82A 1WSWA 3PRKE 2NXEA 4HMOA 4EG6A 5F98A 2GZ1A 4OQNA 4UNIA 1FVHA 2OM2A 1PR1A 4YVFA 1T9DA 1DV2A 1EK2A 1Y7PA 2ID8A 4AYXA 2I65A 4LV8B 3ZCRA 3BWYA 1FF9A 2B69A 2UVPA 4HQRA 4WK2B 2P9HA 5JI3E 4QM6A 4E0BA 3HNRA 3MCWA 4LZWA 3T1HB 4BQIA 3FOWA 4UFPA 5JHGB 4GP7A 5UKDA 1AXRA 4W6QA 4KXUA 5DX8A 4ZN6A 4OM7A 3CBQA 1Q0TA 1WG8A 4RPHA 3D0OA 4I55F 4JOBA 4D0LB 2AMVA 5F5NA 3VHXA 1JKIA 4DR4B 1FNDA 3I6QA 3ZJTA 2A9VA 1AX9A 4FBGA 2V59A 1SR8A 2F6RA 2XCQA 4H18A 3EBPA 1ZH6A 1L5GB 3B7GA 2Z2JA 1E1DA 1Q1EA 1NXQA 3NEYA 4Q9IA 4F72A 4NYJR 1HY3A 1YJBA 3OCCA 4FE4A 4LJ7A 4LOJA 1JSXA 2BMDA 4Z6KA 2QTLA 3UJDA 1JI3A 5ISMA 1U1EA 3ANSA 2NZYA 4PIVA 1DG1G 2HMYB 3KQMA 5FTWA 3SF0A 4F38A 3GJ3A 1DAPA 1YK0A 2IZ6A 2JFOA 1F48A 2IDJA 5E2AA 5GQSA 1VSQA 1USWA 2IHNA 1IL0A 2O0MA 4GGPA 1SURA 1X0VA 1KJ9A 2G25A 4S1OA 1QH0A 3C41J 4NIMA 2BGKA 2VDWA 3MIIA 2C8JA 1YRWA 2OORC 3GDHA 3F2VA 3LGXA 1IJBA 4C3OB 3QOXA 1WXIA 5JH7F 5AI0A 2O8DB 4EK9A 5AXDA 1E1QD 2F3QA 3IQZA 1KL7A 1IQPA 3BKXA 3EVGA 3L7IA 3ZQJA 3H5TA 1ZPDA 3BGVA 1O5IA 3IMEA 5EKXA 3KNZA 4DA0A 1CY2A 2ZITA 2SHKA 1PRYA 3KWFA 4ZI5A 1DBIA 3L0ZA 1F8GA 1P7ZA 2JLBA 4RPKA 1X39A 3ZHQA 3Q10A 4EYEA 5JRJA 2Q5EA 1AQIA 4R2MA 4EB6A 1C9MA 1WF3A 4N76A 1J97A 2NT4A 4NL4H 4TYPA 3QA9A 2XOEA 1VDZA 2CLHB 4RHUA 2H9YA 1Y9JA 2OFWA 5CLQA 1SY7A 2ZTMA 4B2LA 3S8MA 4K9SA 5LZ2A 2YDYA 2FPGA 3E35A 2FQWA 1TAUA 1ZDMA 4HX2A 2Z3ZA 3PXAA 4PC3A 1ADJA 1Y98A 1S2MA 2WHPA 4RHFA 1QVVA 2GA9A 1RWPA 1NYQA 2XWJI 1GTZA 4CQMB 3EIEA 3F47A 2AR7A 4HD8A 4CODB 1RU3A 1VIVA 2ABWA 4RD6A 2O2YA 1UJ5A 4NQZA 1EDEA 4EKGA 2IZ0A 2WB2A 1PCXA 1X1RA 1YMQA 2ZPTX 3EZNA 3HDJA 4EKIA 1M2EA 1VKZA 5IVHA 1Z4OA 4UKDA 3EFBA 3LT5A 4GT1A 3HVKA 1F38A 1EG2A 1E1YA 3ZXSA 2ZSEA 4OP3A 1B73A 1LSSA 2VL7A 2QLFA 5L7TA 2IY8A 1MH1A 5DCWA 2HD4A 5DHSA 1R6AA 4H3VA 2SICE 3GOQA 1I2AA 2ZT7A 5AQEA 2I6GA 1NF3A 3VKUA 3VBCA 5F9FA 1WMSA 2ZIFA 1KZGB 2D1QA 1P1FA 5D01A 3RKSA 4CNQA 3CY6A 1B3RA 2IT1A 3OX1A 3PJDA 3OT4A 3A1SA 3T7SA 1W52X 1XVUA 3NTLA 1ONNA 1L4HA 3KV1A 2VRCD 3EE6A 2VQDA 4L15A 5A05A 2HF8A 1YRAA 5GV7A 1DOHA 3DKPA 1SHJA 4G36A 4QJ5A 3VTKA 4GLOA 3ELDA 2WM8A 5KHAA 3GLHA 2FMTA 2FR8C 3HK2A 2G5TA 4F1JA 2H6EA 4WN3A 1KETA 4UMDA 4UHFA 2FOLA 5IW8A 1LLDA 2IU6A 1H66A 2VP4A 3BMCB 3DXFA 2W4IA 1QZTA 1PLJA 521PA 2FPIA 5FA6A 5JMWA 4FWIB 5JSUA 3ZBPA 4RWZA 4ZU1X 1U02A 3U56A 1SPXA 3PC2A 4FLMA 4K03A 3VR5D 3ZCVA 4CKYA 3HUEA 1I14A 4EUNA 1RACA 1I7SB 3B12A 4AY6A 2MYPA 1C3OB 4D0GA 2JI6A 1GD1O 3H9BA 5JYCA 3W6OA 2ZSUA 3NEJA 2ZJ1A 1YZKA 3L06A 1HGXA 3DM9B 3OLXA 3VPAA 3JQ9C 3LSTA 2H29A 4JFAA 1ZIOA 1DNPA 4AKTA 1EP2B 3EGXA 2O2HA 1FVFA 1GKLA 4G5YA 3V32A 3UT0A 2G9VA 5CA1B 1RM3A 1YE5A 3AR3A 2RHHA 4RMNA 2C1EA 3GT0A 3X2FA 2ZT6A 2DPXA 1XA0A 4G8BA 4KPUB 2X9QA 1YDWA 3RYTC 4EGFA 4V0OA 2B7CA 1YJAA 1YRHA 2JVJA 3HYSA 4ETWA 1ORDA 5F78A 1HR0B 2Q62A 4U2BA 2PRZA 2J3LA 4HEA1 4GWGA 5AYVA 5C5IA 1T6XA 2B1RA 3HQ4O 4RZXA 1F8YA 2YFYA 3VU9B 3BCSA 1NG9A 5FAKA 4D4JA 2GTIA 4BFVA 3GZTB 2D0OB 4PC1A 4UJ3A 4DCVA 1QDLB 4MGIR 3TE6A 1DFHA 3BJMA 2H18A 3G9TA 1T91A 1M1XB 3A58B 3B2EA 3D3WA 1RXVA 4EDFA 1KSHA 1XU7A 5A5VA 2UZ0A 3AKZA 2RGEA 4J9VA 5BNFA 3ML1A 5HUQA 1IY9A 3HSKA 4WE3A 4YCMA 4ZT2A 1KPIA 3KQKA 2P0AA 4R1OA 3ZCPA 3D6FA 1RQXA 3OPVA 3LFHA 4YMWA 3PXGA 2E0IA 4AICA 4OB6A 5L4NA 4G2TA 1XBTA 2XDWA 4MUYA 2PCLA 4BX9A 4FX2A 1YB7A 5DTIA 2ONZA 1K9SA 4RZQA 5BUSA 2IXBA 5CW1A 3ZG6A 4Q4AB 5J47A 1BA2A 1J5EB 3TGPA 3FTQA 3AHFA 1IBLB 1Z2OX 2AJTA 4DCCA 3CN9A 2VR1A 2ZQ5A 4QUHA 3TZ6A 1QP7A 2ZI9A 3IV9A 2H63A 2QSJA 2VRBA 3K31A 4XEUA 1WO8A 2AZXA 1OYOA 4OKIA 3HN6A 5B2FA 2SCUB 4GKAA 4K2AA 1NVKA 3JVDA 1E3JA 4KW7A 1KK2A 3N8KA 1KO7A 3LLSA 4S1PA 4WOJA 4C5AA 5K8LA 2J3MA 3BAZA 2F2TA 1W2HA 2GXQA 2Y3IA 1E2GA 2J5XA 1MEEA 2PT6A 3EGXB 4QU8A 4B6PA 4YR7A 2G9ZA 4JLMA 3VJMA 1HMPA 2YV3A 1T29A 2ZBEA 4RJKA 5BRNA 3TW6A 3Q6MA 1RMYA 1YQWA 2YICA 3AUXA 1P61B 2C9YA 4AS3A 3B3AA 3LRXA 2EL7A 2OZVA 5JIBA 2HU5A 3IOBA 4M98A 4RTPA 1BFUA 2Y92A 3FPJA 3FTNA 2UXCB 1IC6A 1QCZA 3HMQA 4ND7A 3KEFA 4ZT4A 4BVEA 1OYVA 2NQTA 3G17A 1TIKA 1C1DA 3G5TA 1PVDA 4J0QA 1XEWX 3L7CA 2AG5A 4WGGA 4L9AA 1Y7LA 1RYNA 2J46A 2WFLA 3CYFA 1JWLA 3OAAA 1XJCA 2R6AA 3BAFA 4INPA 3R6LA 2O3UA 1VOTA 5CFZA 3BC1A 5F77A 1B41A 1P73A 3GEGA 3RREA 3E70C 5JZOA 3U0BA 2FPRA 1WQ1R 4BRSA 1UBKS 2R79A 4DG9A 4QGSA 4FDAA 2VTEA 2AKEA 1J1UA 4HL6A 3DXYA 1YCDA 3QKIA 4PO9A 1YIAA 4L5AA 1OX6A 2QRMA 4L3WA 4B3HA 1M6WA 1IRIA 1V1RA 3U6KA 1Z63A 2H1WA 1RXSA 4EX7A 4B3IA 2A9JA 3QNUA 3UVEA 4X64B 4DE5A 3PFNA 1TA0A 3I1JA 3E5RA 3F6SA 1FU4A 4QPCA 4BKUA 1EJBA 3L7KA 4FGUA 3HDHA 4YJ3F 4EFLA 3LW8A 3A70A 2V1XA 5DT2A 1EGVB 2OYCA 1N92A 1PJ4A 1Q2UA 1XI2A 2WYWA 1TNDA 3H18A 4IZHA 5IKOA 1WABA 2MSEB 8ABPA 3TG2A 4LPSA 3QOYA 5EERA 4LWOA 4M4SA 1H0RA 3KL2A 4MIYA 5KVSA 1HWYA 1FC0A 2JFUA 3FG9A 1M6VB 5KHOC 1ODLA 1OIWA 3WDSA 1PJQA 1ZH4A 3L41A 4YN3A 3TXXA 3DDOA 2CC2A 4IOLA 3VUEA 4MR7A 1VQ1A 2B5VA 2H8GA 2Q1YA 1AGXA 3GP8A 4AJLA 1IJEA 2BC9A 2FEXA 4HXGA 2BDTA 2H54A 1WHTB 2JJYA 3A05A 1ACJA 3P9IA 4CQMA 5D1NA 1Z5GA 2I2FA 5JS2A 1J09A 4FQ7A 1QE3A 1HNXB 3T1YB 3A1UA 4J4BA 2PMEA 5F2KA 1DAIA 3JRXA 3WL8A 3P9ZA 2AQIA 4I3HA 3HM9A 2N47A 4XSGA 2EJTA 5LMZA 4JA0A 1NKTA 4Y6QA 3S44A 1OJ7A 3U19A 2PMBA 1Q91A 1TGVA 3GRVA 1FNBA 3NKVA 5JECA 4IIJB 1Z62A 1HYHA 1LNZA 3FZGA 4BWVA 4U39A 4DMUB 5EZQA 1HFWA 3N3AC 4JUFA 5PNTA 2O8EB 3BQMB 1OFGA 3NDIA 2HJWA 4TXNA 5JZBA 3KE8A 1LBTA 4GI5A 5H80A 1AGYA 1IXKA 4FEGA 1L5HA 2BZ1A 2QLJA 2I03A 3C15C 3I8XA 3I04M 2ZIZA 1VBNA 2ZANA 3G2NA 3OICA 3FBWA 3IQWA 3JWGA 1HF3A 3TZBA 4TSRA 1NJ6A 4E70A 3KLOA 3MG9A 3WO1A 1WDTA 4KSYA 3KD2A 4M88A 2KE5A 3FUUA 4QFDA 4UTRA 4MV9A 4RM2A 1KE2A 2C4KA 5E0OA 4FU0A 2ZLBA 4UUBA 3RFTA 4JJ8A 1JHDA 1S2OA 4LCEA 2XWPA 1ZN7A 4TYYA 3FGNA 3PR2B 1O6BA 4NOMA 1ZIXA 1R4ZA 1QO0D 2A1IA 4NPAA 3P97A 1ZK1A 1RJDA 5ADWA 4E5SA 1AKWA 5HW0A 3L0SA 4CM1A 2HY7A 3FUWA 1LK0A 4YCNA 1YZQA 5BMOA 3P94A 1GTL1 1LDGA 2V6JA 3F7OA 2ZYTX 4AF7A 4EG0A 2BUBA 1H2XA 4UM9B 4AMVA 1N5RA 2I7TA 4MUMA 4WZAA 1ZHOA 4L27A 1K0UA 2C7PA 1BCSA 4RH0A 5DBOA 1VIAA 4ND6A 4BEVA 4GLJA 2VLIA 1DRVA 2FZKA 1GUZA 5REQB 3BGSA 5IFLA 1WUTA 2IPNA 5EWJB 1I3NA 1YONA 2WD7B 2I4RA 2HHJA 2WKRA 5T8KA 1BXRB 1UC5B 4FDUA 2QPLA 4JT2A 2W2LA 3CUWA 3KJIA 4Y9DA 1VZ2A 4ENTA 1E0AA 1NJ2A 1A9OA 2FEMA 2CXTA 4TMYA 5KB3A 1NVWQ 1VJ0A 3WGZA 2WMDA 4Q15A 8AT1A 3CPEA 1X8KA 5GZ3A 4BLTA 2BFNA 1G8PA 4JX9A 3BORA 3EVZA 2OGUA 3L0YA 4D44A 3I6MA 2AHRA 5FBQB 3IKLA 4I55B 4OGGA 3CJQA 1KDZA 2ODNA 1BMDA 3AESA 4DGQA 1UMDB 1BW9B 4TS3A 4J0EA 2Z2KA 1G20A 5G0SA 3FLAA 3HYNA 2GKOA 3OZAA 3N58A 4Y2VA 2NU7A 3L7AA 3HA7A 5EJIA 1KAGA 1SUCA 3HJBA 4DPMA 1AY0A 1UFVA 1Q57A 1YR9A 3MTIA 4LRWA 5IC6A 2W6CX 4O4JA 4FMBB 3RUHA 1QTQA 4I6JA 4UATA 1GPBA 3ANTA 1ZK0A 4YAKA 3MLEA 1YR7A 4MRVA 3T1TA 1KS2A 2VTBB 2G1JA 1NXVA 2O0JA 4FE3A 1U9IC 2F4VB 4KQ6A 3FPLA 4MTLA 3LCRA 4IH4A 1GITA 1UJ6A 3AZQA 2WYHA 4K9PA 4FEEA 4MW7A 1SUAA 2Y8EA 3CSSA 4BKMA 5K0SA 2XUOA 3IAM6 3VOBA 4TRMA 1Q19A 1R6XA 1NG1A 5LPNA 3B7PA 5FOXA 1QFYA 1GADO 4I1SA 4C7MA 3UWOA 5KOHB 3KSDO 3BILA 1SBNE 4BQSA 5CFQA 1HFKA 4RZSA 4JZYA 4FFNA 2VH1A 3V48A 3IR6A 3WLHA 2FG5A 4HAYA 3MJEA 1KYIA 4DBVO 3PT9A 4EHDA 2Q8QA 4YT8A 3G9UA 1RE0A 3ZY3A 4AURA 1AUVA 3MD0A 1XZBA 1O0SA 1NNEA 2Q5HA 1R74A 1Z0DA 2X15A 4OO3A 3KB2A 4RSRA 1RP7A 4YP9A 1UK9A 4OQQA 1HKUA 3R9IA 1W5FA 1YBFA 5AW5A 3TCKA 1MT0A 3NXKA 3WBFA 5FWNA 1VG0B 2IYXA 4OHZA 4DOMA 4E2ZA 3PUZA 2IITA 2VXYA 1JR4A 1A8UA 3SFZA 2HA5A 2IHTA 3PC4A 4FGWA 4LCBA 2C4TA 3DJYA 2F1KA 3ZUPA 4ZO9A 1KPHA 4KO4S 4CCYB 4GI1A 3UPTA 4IMRA 4R98A 5ALRA 4CDRA 1E7RA 1EBFA 4HDMB 2IIBA 2O5RA 3QFHA 1N7JA 4OUDB 2X2OA 4RHTA 3JV7A 4B7AA 3G23A 2MJLA 4H7HA 2ECQA 4DUGD 3ZWAA 4QE3A 1XPJA 3FWHA 2ATCA 4JD5A 1S3IA 4J76A 1GTRA 1YDFA 3CZ9A 3ZWXA 5JEEA 2ZETA 2N46A 3DUWA 5JNWA 2WG0A 5TARA 2WJZB 2RK4A 1P60A 2OCPA 2OAQ1 3JD1A 1HLGA 5CFPA 5CA0F 4EL5A 2VT6A 5CBPA 3W5JA 4NU0A 1RPJA 4MV7A 1HT0A 2FSVC 4D79A 3K4QA 2Q6LA 3O7WA 2OT3B 5CG1A 1UQTA 4EGJA 1TJNA 5HQTA 3FCAA 4HVAA 1AUQA 4A8HA 3FY4A 5H9WA 5EEHA 3KKLA 1NRIA 1OU0A 2IHKA 5D5QA 2I7VA 3SFVA 4TQAA 1M2FA 3P9SA 5JZVA 1T6NA 5G1NA 3EF3A 4OX9Y 4RHYA 3DR3A 1UP6A 2PZMA 2EF0A 4B3MB 1II8A 3K9QO 3M49A 4LX0A 1X7DA 2C5FA 3IVXA 3I83A 1D6NA 1AK9A 1YR8A 3CUYA 3MPUA 3ZQKA 2WVHA 4CW7A 4ZMBA 4ZANA 2UZ3A 3WHKA 3NNSA 3F3SA 1GSHA 4IRUB 5HUHA 1Q1GA 3NB0A 3ZQ6A 4M0PA 2B30A 4LW8A 3LCCA 4E32A 4J0DA 4IV0A 3C3MA 2XCUA 3AY7A 4IIVA 5DCLA 4X95A 3L05A 3LH5A 1OOEA 1QOPB 3E9CA 4M6WA 2A0FA 2XQKA 1UT8A 5CPFA 1RC0A 3RHZA 2CEKA 1VIYA 1SKUA 2ZYSA 4JLSA 2L2QA 4OHBA 4BJ3A 2NMVA 3AH8A 2IYTA 4HYTA 5HFNA 3N2IA 3D81A 3BICA 2QN7A 4MRMA 1TKRA 5BSUA 1K7SN 2Q3CA 2REQA 2F8LA 1EZZA 1R9JA 1GOTA 2YV1A 1WUHS 3BIWA 1RTTA 3HXLA 3O0DA 1Z37A 1KDTA 3PDUA 2C4HA 3MZ0A 1VGRA 1Z2DA 2VBIA 3OQBA 1D0IA 3LUKA 3LBIA 2AWOA 2J31A 2KLBA 4WLUA 1RXUA 4O4LA 5T4HA 4GR9A 1O4VA 4JDUA 2QAGA 1XU9A 5C8YB 1DC4A 2WJPA 1HFEL 2P79A 1ZEMA 4CL8A 2WFMA 5KJ6A 3AILA 4OJYA 1E9AA 1T0IA 2ZP1A 4I4TA 3I30X 4MROA 4F4FA 3C70A 5CXQA 4MLZA 3EHEA 1P4JA 1X3SA 1AE1A 3OJFA 1UZAA 4PYRA 1DBPA 2FMKA 3KQHA 2FWPA 2Q4TA 3QPDA 5DI9A 5B3AA 3PPWA 2BGRA 4PG7A 1ZNWA 1QONA 4YUAA 1Y5RA 1S4MA 2CL0X 2V58A 3IHWA 3LFUA 1D4AA 3O7MA 5DNWA 2I4MA 1UODA 2GO1A 4RTRA 4MQFB 4X3CA 5JWRA 2ZSIA 1AT1A 4G1BA 4HAOA 2B1IA 3FYCA 5TF0A 4BN0A 3KEQA 2PQ2A 3W2HA 2A1TS 1KVQA 2VP5A 2LCQA 3FPBA 1RWOA 3E7XA 1OH8A 3CMCO 5KOJB 4H4EA 4TLBA 5EJGA 5JYDA 1Y1TA 1DIBA 3KEOA 5DN9A 3U80A 3H6KA 4F8JA 2O8BA 2D0DA 4HLQB 3T7AA 4MUGA 2HWXA 5E95A 3W8NA 3NBAA 4DLPA 4ZOQI 3K9HA 2H9AA 3DG9A 3NBZC 1XNGA 2FE1A 4NOKA 5LMUB 1DO8A 4EY3A 3K1YA 3HUUA 1AS2A 1W0KA 3EIXA 5E2BA 4BLUA 2QD1A 3Q5DA 3LY8A 3SN6A 2HFKA 1GUDA 2Q1UA 2X5KO 5JSYA 4EBFA 1EE2A 1P1RA 4B43A 4GVLA 3PZBA 5EP2A 2NGRA 3A6EA 3CKKA 4XIYA 4Q1VA 4XX0B 3O03A 1I2CA 4CM6A 5DMXA 3LUCA 5ALTA 3IPRA 5G4KB 2OV2A 4NTZA 5CT8A 1J9GA 4DA8A 3GGGA 2JG3A 1PQWA 1WAMA 2X6QA 4RGBA 1HOXA 4RQBA 2PVSA 1N5OX 4Z9FA 2PUGA 3IQEA 2GT1A 2PBLA 3OIFA 4QA9A 1ZH2A 2O3QA 2PSEA 4GWLA 4MRAA 4EGQA 2GCOB 5A6SA 3TG8A 5AHOA 2ZUEA 3GRFA 4LY6A 4RQAA 3QEKA 2AYYA 3A9VA 3RUAA 3BGIA 3W1VA 3C8DA 4IS3A 1DQPA 2QIPA 3HGTA 4R1SA 2ZUDA 3WWZA 5DSTA 2OO7A 2UZ1B 2CFRA 5FOVA 1L5WA 2ZAYA 2IDMA 2WU0A 2Q5CA 1PJSA 1YT5A 3IPCA 3IIKA 3URKA 4UQPA 3VR0A 2GN0A 1ZU5A 1RRMA 1E7WA 2C58A 2Q6IA 4QFCA 2K6GA 4K9NA 1GTSA 4D46A 4NV0A 1OHHD 3OTWA 3MCUA 1DCMA 2UZAA 3NDPA 2J59A 1FUKA 4X45A 1T3HA 3D8RA 3OP1A 4KH1A 4ARIA 2RGUA 2FZGA 1LUAA 2K7ZA 1SBCA 4LTMA 3F67A 3LBAA 1QK5A 2FF5A 4HSEA 2RAUA 3IMFA 5DCUA 3UJ3X 1N36B 4OBWA 4ZPJA 5H59A 1POXA 5DGHA 1L7PA 3Q8MA 4ZOLA 4DLUA 3WMRA 1TF2A 4O5OA 1W36B 2R1UA 4BVKA 1JFFA 1OWLA 4NMXB 2H0RA 5CVCA 2EIHA 3BH0A 3PNMA 3A3OA 1NF8A 1G19A 3AF2A 2MTBA 3QG1A 4IVNA 4RVUA 5ESDA 3ROFA 4H4DA 4BZQA 5B36A 3JYHA 4FT4A 4WTOA 1QP4A 1B7GO 4INOA 2O59A 1E6KA 2OFOA 5CW2A 1YZ3A 1BU8A 3N76A 2IKSA 5L3RA 2JBAA 4L4UA 4R1PA 3MQ2A 3E05A 1E62A 4UMFA 2DE0X 3D54D 2VHEA 4CETA 1IM8A 5K05A 1XCLA 4QJ4A 3PDHA 5K4AA 3OZBA 2IYFA 4M86A 4V03A 1RM4A 3TQSA 3W5BA 3ZVMA 2QBYB 5I9NA 2NM0A 1M8JA 3IC5A 1V96A 4YPFA 4KJZA 4CIXA 2XUZA 2QBYA 4Z4GA 1OKKA 2OZLB 3IELA 4MWZA 1Q3HA 4P0TA 3EPKA 3N6RA 3B6EA 1X1DA 5FR2A 4C6SA 2QL5A 1QUFA 2COKA 2PLAA 3HS3A 4OREX 2OO5A 2ZAIA 5D86A 5AJYA 2PMWB 1RWQA 3DVLA 4O1HA 4CN8A 3TINA 1R0KA 4WD3A 1PFKA 2H4HA 3BFKA 4K9KA 1NXXA 2G63A 4WA8A 3T0IA 3T9DA 1DMRA 3TLYA 4QYSA 4QLBA 1F0NA 4IO0A 1HDGO 1QDUA 3MT7A 2FEOA 2OXFA 3RGWS 4O33A 1ES9A 2MYTA 1XZNA 3S7ZA 5COBA 3UPDA 2VHXA 2EJWA 3P71T 3SJ7A 2AFIE 4R5HA 2ZRQA 5E3IA 3WYGA 1Q1AA 1J39A 1JS1X 1Z6XA 3B20A 4JJ7A 3BL8A 4BMVA 3WYAA 4C0WA 3VO9A 2BPOA 3CZ5A 4KUHA 4OYLA 2NU8B 4C08A 1QP8A 4H35A 4YP6A 3FJ1A 4JC0A 1TT5A 3UJ6A 4U7WA 2ZYUX 1T2CA 4MVWA 3QUAA 1M1YA 4BCDA 4H17A 3UV7A 4D80A 3QLUC 4ZEOA 1J70A 1X74A 1KI9A 4ETNA 5JFTA 4ARBA 3CLUD 3K6RA 3NHJA 3QM1A 4GKBA 3VBEA 3REQB 3EC1A 1SZPA 3EYWA 3PHGA 5JBNA 3AVTA 4IY1A 4P3XA 1HX7A 1TECE 5JS8A 4Y1RA 5L7WA 4WKBA 1UPCA 2BZGA 1A9RA 1DEKA 1XTQA 2AC4A 1CDDA 1EPUA 2D7CA 2PZKA 1XZGA 4AJJA 5LU8A 2J7PD 1YQ9A 4D0SA 2VNHA 1T35A 1E94E 1TUIA 2MSKA 2PANA 2HREA 4XIGS 3IL2A 3FBTA 2W2KA 1X7XA 2WD8A 3C7CB 1OXUA 3SX0A 1Y9EA 4B6GA 1PR3A 3O31A 4DCSA 1I3OA 2GPAA 4ZDKA 1DQRA 2NYVA 3QVMA 2RAFA 3X1YA 3BL5A 3ABIA 3LNTA 1H22A 4Y1GA 1DWPA 5IT9A 1KS9A 1NUPA 2O2JA 4F9FA 3ZYCA 3BXXA 1XZDA 2YS6A 5IZCC 3Q2KA 4MO2A 4U2DA 4DMLA 2J41A 4B9EA 3C1AA 1T15A 3NYRA 5LYJF 2P9JA 1KWGA 1L8OA 2ZQYA 3PE6A 4HQ0A 3VH4A 3P4XA 2HRCA 1QR6A 3ICPA 1JDVA 1YTLA 2R25B 3DSRA 3FDJA 1C0KA 3H84A 1UDCA 4LDQA 4LMAA 3RRNA 3M5CA 5I7FA 2PL3A 3E27A 4BQNA 4CQLA 5JSFA 3GA7A 2W8ZA 4UCFA 2BKXA 2I2DA 1YB5A 2O8BB 1JJ7A 2E18A 2WB4A 2PDAA 3E22A 2I67A 5FAXA 4G85A 3C24A 2QLBA 1KJZA 1G59A 4D4GA 3I04A 4C0SA 1SEPA 3E2MA 4A5SA 3NUQA 4CIVA 5T7BA 2GK6A 2Z8ZA 4CE6A 4E5UA 5HZGA 3N2GB 1MAUA 1UDRA 4MS4B 2QD3A 5A5GA 2ALJA 4Q47A 5AK0A 4ZVNA 2FWBA 2FMIA 1J2RA 2W6QA 3K72B 3GGPA 2GEKA 1IDN1 1TAQA 4A0SA 4MVJD 2BWJA 3WNQA 2I2BA 2JC3A 2PKQP 2H07A 4D4IA 3BD9A 3LCUA 1DKMA 3HNOA 2AC7A 3O1JC 4XUGB 5ECWA 3VTAA 2BW0A 3V7FA 3ZE1B 5EHGA 5JAHA 3JD3A 5LQSA 1CE8B 1YS2X 3FMOB 3USZA 3HB5X 1UPAA 3CWCA 5KQSA 4W5JA 1RJ9A 1DIHA 1JEDA 4MA4A 2Q6KA 3T38A 5K6RA 2O7RA 1NU8A 5H3CA 1XG5A 1GPDG 1A2KC 2EG9A 3BH7A 1ZK3A 4GX0A 3AEZA 1LLFA 2BGLA 4OSPA 5ARDA 5C8YA 1Q14A 4ZVLA 5JVDF 2H2FA 5BV8A 2P6MA 1L7BA 3H87A 3IYLW 1WQ4A 4YI5A 2XB6A 4US0R 3CINA 5HJ7A 1DIAA 2PUHA 4EHAA 1U4NA 5ITZB 3L8GA 1MOSA 2VEOA 2CYBA 3LOPA 5CYPA 2EF1A 1AXGA 1N78A 4CM4A 1WVIA 5ARBA 6ABPA 4PQRA 3N2ZB 1LSJA 1LXCA 1WZEA 1AUOA 2BZSA 1ZK2A 2A7QA 3D8TA 1QVRA 1O95A 3P2IA 4INZA 4R1QA 1QPGA 3CHYA 3HJUA 4UEQA 3FDXA 3WTBA 4G01B 2CJFA 1CVIA 5LA6B 1IK6A 4YFVA 1Y3DE 3N0VA 3ZLTA 4WXYB 1F7VA 3FTDA 4XWWA 1J21A 2Q1WA 1EJ0A 1GXSB 3CZ4A 3QELB 2CVPA 3UAOA 1IE3A 1QGDA 4JT9A 4KYTA 4MUHA 3PRYA 3FPAA 4IWXA 2VHQA 2Q5QA 3KAJA 4R1NA 3WWEA 1P4AA 4C03A 3T7DA 4FZVA 5C2JB 3G7NA 2W71A 2QVGA 1DZ3A 2Q3HA 1RQGA 1XPUA 4TTVA 4UARA 5AVSA 4C7VA 3STTA 3O1LA 2WNHA 1YWGO 3JSXA 2QNRA 4D4KA 3TLJA 2Y1EA 5IUJC 2QLNA 4P7GA 4R8RA 5HX7A 3FFWA 2MSDB 3O8BA 5P21A 1J42A 2ZTHA 3KLPX 5B3JC 1Y4DE 1SC3A 1XP8A 1ZD2P 1V3TA 2JRCA 3RM3A 1K88A 3WG9A 2QD5A 2PJDA 2HIMA 2OR3A 1TCUA 2QXTA 4JLNA 4CIWA 4FEYA 2UVDA 3H6GA 1GPAA 1OLSA 1F0KA 3HJTA 8LDHA 2GD6A 3SJUA 2C7VA 1NMSA 2NTEA 1D07A 3V4SA 1AZSC 1GCAA 3PHLA 4I7EA 2JFQA 1BKYA 3AF4A 3BWEA 3MM4A 4PAQA 4XJSA 5EJ4A 4FUTA 1D2CA 4ZI7A 1ML3A 1SFRA 2YXDA 3OO1A 4L76A 1O4WA 2O57A 4UHKA 1SC4A 2MINB 3T3EA 1PLKA 4EP1A 3LQKA 4QTYA 3LYUA 2FV8A 5AVQA 2VHTA 4JBHA 2TMYA 2HADA 3AXTA 2LZ0A 3CLUC 4OUDA 4Q7QA 2Z09A 5I47A 2GCIA 4D9KA 5L53A 3FIUA 3O82A 1O6FA 3LYLA 2YIJA 4YAWA 1J24A 1H8ED 1KHHA 3V46A 3ICOA 2NU6A 4BRWA 1NM5A 3SIRA 2X8LA 4ZI7F 1P3DA 1JWAB 4PZ0A 5MHTA 1T34A 3CNQS 4G0PA 2OD2A 1EINA 4WCVA 4JVSB 1QLWA 2CB0A 3I3OA 2M6SA 1EGAA 4RDIA 3MWLA 1O97D 3WVNA 2ZJ6A 4E5PA 2CHEA 4QT4A 3ELBA 1F2UB 3TQOA 3PJFA 3EQ2A 4ENSA 3EIUA 5CCEA 3EYAA 3KQPA 2FA9A 3L93A 4QYTA 2XGMA 3NVKI 4RCVA 5KOHA 3EJWA 1X7GA 4RW0A 3B82A 2XNJA 1HKHA 3CRVA 4ZVMA 5BSFA 4IJMA 2OMEA 4TS4A 3DD5A 3ADPA 5FB3A 2RHTA 3WV5A 4LJ8A 5A62A 5SYMA 4X66B 1M34B 3A9WA 1U0GA 5EXDA 2BHNA 4WECA 4OUKX 2ZRAA 2I80A 3BWVA 3RK4A 1PNOA 3AWIA 1QE5A 1PK7A 1LKZA 2ZS7A 4L8LA 1HRDA 1TKCA 4PSKA 3RIGA 3MWYW 1W0JA 4J4TA 4BU1A 3B5JA 3ZNQA 1FDIA 2BF4A 3QP9A 2O8FB 1RQPA 4FR2A 4IS2A 2W6IA 3LHFA 5DE3A 3F3YA 3GPLA 5AW9A 3RE1A 3CU5A 4H2DA 1TXGA 1P3Y1 3NM5A 3ROKA 3RI3A 1WDKA 3AESB 1FSSA 2BEKA 3GG2A 2GLXA 2X8BA 2C98A 2HBQA 3PFKA 4KKVA 3QLEA 3ERCA 4KZKA 3PIDA 2H2DA 3ZXUB 5BW4A 4FLFA 2PX8A 1SVUA 3MYRA 2B2CA 3PFIA 4NG5A 1SA0B 2I4IA 3TZKA 1DCKA 2QB5A 1P2FA 1FDSA 3RYHB 4LDAA 4ZYZA 3AKEA 4XDZA 4ZRNA 4XQCA 3LWBA 3UUEA 4D6YA 1SXJA 1N6LA 3HBNA 4WBNB 5EY5B 1TQ8A 1W87A 4XR4A 4BO4A 1E20A 4JI8B 4OFBA 4HB2A 2W22A 5DEOA 1JV2B 3G8AA 3GNLA 4OMDA 4JX8A 2EZ4A 3K0BA 4PGHA 1VHQA 2C4WA 2XODA 1EWTA 5REQA 3W2GA 2ADFA 1NOIA 2X2PA 3IEPA 4LBYA 4UHEA 4NMHA 1BCSB 2ZSAA 4ONEA 1VIDA 3DMYA 3FWKA 3DHVA 4NRDA 1SVWA 2WT4A 1P80A 3ZLUA