2XDYA

Crystal structure of the n. crassa qde-2 ago mid domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
127
Chain Sequence
b'KIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
molecule tags Rna binding protein
source organism Neurospora crassa
publication title Crystal Structure and Ligand Binding of the Mid Domain of a Eukaryotic Argonaute Protein.
pubmed doi rcsb
total genus 41
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xdyA00
1LK0A 5KQMA 5KWSA 1C4WA 2AYXA 1TM2A 3H75A 4RS3A 3I42A 3Q7SA 1BA2A 1NXPA 3TMYA 1JDNA 2FLWA 3RVMA 3GL9A 4Z4GA 2IDMA 4KREA 2QVCA 5C5CA 1A04A 3K9CA 4EYKA 1NXXA 2VK2A 3OMWA 1J56A 5DCLA 4L85A 2A9PA 3SNKA 1DZ3A 2B4AA 3HDGA 1JF8A 1D1QA 3H1EA 5JNVA 3KG2A 4Z4EA 3FFXA 5I4CA 4WXMA 1F51E 1ZDMA 4NCAA 4XLTA 4MS4A 3KYJB 4MPTA 2L19A 4TLLB 4G0QA 2PAFA 2V0NA 2ID7A 1DRKA 3O2SB 2LPMA 5HQJA 3MQ4A 2FMHA 5JNUA 1YIOA 4EYQA 5EWMB 4QYMA 5CNKA 4YLEA 2IYNA 4RXUA 2FQXA 3P9YA 3A10A 1JYFA 4W5NA 3BREA 4F3TA 2N9UA 3IDOA 4LZLA 2I6FA 2E4VA 4H60A 3ROTA 1Z15A 1XWWA 4MRMA 3DLBA 1EAYA 1ZGGA 4EY3A 4D6XA 4MYRA 3QEKA 2TMYA 5TQ0B 3H5TA 1C0EA 3A0UA 3KSMA 4N03A 4NV3A 4G86A 1E6LA 3EQZA 1W9HA 1JL3A 5EWJA 4W5OA 3HV2A 2WJWA 1QO0D 5HSGA 3M6MD 3OLZA 3QLTA 4TLMB 3HO1A 5JNSA 3G1WA 3QLVA 5JS1A 1VLZA 3HSYA 4H3KB 1MVOA 4PZ0A 2F8TA 1Z16A 2E4YA 1DG9A 2Q5CA 4DQDA 2OENG 1F4VA 1GUDA 3N53A 4N0QA 1E2BA 3JPWA 1FFSA 1JBEA 4EGSA 1NXSA 2IPLA 4MLDA 3CLKA 5BRJA 4KQ9A 4DN6A 3RVLA 2B1JA 1NXVA 4M88A 3HVRA 1DBQA 1W25A 3C3KA 1WETA 1NXTA 4MLCA 3O1HB 5IUJC 1TMYA 2MSKA 5KI6A 2XDYA 1TVMA 1JFTA 4FB4A 2RJNA 1KRXA 3K4HA 2FLKA 1TLFA 1YMVA 3KLOA 4MRMB 4JA2A 3JVIA 3UUGA 4OLAA 3OM0A 1PHRA 5DLEA 1XHEA 1Z12A 4KQCA 4OATA 3H1FA 4Q6BA 3NNSA 4F12A 2WRZA 3LUDA 4O1IA 3JPYA 1ZHHA 3T8YA 1M2FA 3CKMA 3T38A 3KKEA 3Q9SA 1JYEA 3RVSA 4KFCA 3CG4A 1MB3A 1AB6A 1PNRA 2IPMA 2WMYA 2BGGA 1PEYA 4RK1A 1YVUA 1RXIA 4YCSA 5T7BA 1I3CA 3LUJA 2FVYA 1JFSA 2PL9A 5KQPA 1A2OA 1USGA 5T3YA 3TB6A 2FQWA 2R48A 3C6QA 2A9RA 3ROFA 1NXWA 3F6PA 1JH9A 3LKBA 3IP7A 2FN9A 4EVRA 3F6CA 4ZJPA 1DBWA 3GRCA 4KK4A 2M98A 4YO7A 4RK6A 3R0JA 2GKGA 3H5LA 1DCFA 4RDCA 3CNBA 2CHFA 5CHYA 1P2FA 1ZY2A 1Z13A 4IMJB 4NICA 3OM1A 2L2QA 1ABEA 3O74A 3IPAA 3QLUC 4H3HB 3EAFA 3KYIB 2NT4A 4WUTA 3LOPA 3RVOA 1OXKB 4E7OA 3N8IA 4YV7A 1APBA 2FKAA 4CBVA 3QELA 2MYPA 1RNLA 2P4UA 2QZJA 3FGZA 3CU5A 3HEBA 3Q7RA 4YS6A 1BDHA 2NT3A 3JS5A 2ZWMA 3NNDA 2MYTA 4RK0A 3HUTA 4WWHA 7ABPA 1EWVA 4Z4HA 2O20A 4N47A 1FFGA 4UHKA 2HQOA 5CNJA 1UDRA 1ZGZA 1JWLA 4RXMA 4HNQA 4HNRA 4G0OA 3BBLA 4W5QA 1T34A 2W42A 3BRSA 3M9WA 5BRAA 2GI4A 4Z0NA 5DGCA 2JRLA 3L49A 5GOTA 5HM6A 2QSJA 5IBQA 3RVRA 3I5AA 4JOQA 3RVJA 1ZH2A 2ID9A 3L6UA 3SY8A 1H9CA 4EUKA 1JFVA 4ZMSA 5KQLA 4MR8A 4PE5B 3SM9A 4MR8B 4MS4B 2RGYA 2KYRA 3LUGA 1LJLA 2MYUA 1Z18A 2LBPA 3LUFA 5EWLB 1Y1LA 1YS6A 1D1PA 2WY2D 1U04A 2FMFA 2PKXA 3A0RB 3CZCA 2QXYA 3IP9A 4OG2A 2FTKE 1SXGA 3OLXA 2JCGA 5TQ2A 1BDIA 1IIBA 2H0AA 3DLHA 4WXEA 1LBIA 3IP6A 4RV5A 1CHNA 4S05A 4RKRA 4IILA 1QP7A 1QQAA 3QX9A 3QK7A 2FW0A 3NHZA 2LIVA 4YP9A 4RSMA 1PEAA 3G85A 2L17A 4ETMA 2IPNA 4HNSA 2PJUA 4QYWA 1DCKA 3ILYA 4RY9A 1SD5A 4MQFB 1S8NA 4F8JA 1U8TA 3CTPA 1GLGA 5ABPA 2HPHA 2JBAB 2R4QA 4XXHA 2MYNA 1Z26A 3C3WA 3Q7TA 4JASB 5DKFA 1ZN2A 5TPZA 2R25B 3LUHA 3MA0A 2HJ9A 2AYZA 4KMRA 4LE1A 3MIZA 4Z4IA 1ABFA 1LBHA 5B3JA 1ZVVA 1VKRA 4RK4A 2CWDA 4PICA 4RU1A 2PUEA 4OLBA 1BDJA 3HCWA 3TO5A 1AB5A 2JVIA 4N41A 4RK7A 4HYEA 5KC9A 4JP1A 1L5YA 3SG0A 1CEYA 1EHCA 2NZUG 3FFTA 1DRJA 2VUIB 3H1GA 3CG0A 4FE4A 4DADA 5FWXB 4KK3A 1NXOA 3BRQA 4UHJA 3T95A 5HKOA 3OLYA 5TPZD 2H3HA 3DGEC 3N0XA 4O5AA 4P1ZA 3HK2A 3FMVA 3NHMA 3HDVA 1BVHA 4LRQA 3W9SA 4ML3A 3OQMA 1VPWA 5TPWB 3VNBA 2CHEA 3GBVA 4G97A 1VRVA 2X7XA 1P6QA 3D02A 3DBIA 3I09A 2FQYA 4JAVC 4LE0A 4XASA 2FEKA 1EWKA 1XHFA 2E4WA 1RZRA 1RPJA 4G0XA 1OXBB 2GWRA 5BQ3A 1M2EA 4MS1A 6ABPA 5BR1A 2P9HA 5PNTA 4RWEA 1URPA 4EYGA 1PUXA 3HJFA 1RXEA 2QVGA 1ZITA 3HS3A 4RK5A 3GYBA 1P8AA 3KLNA 5CNMA 4EVQA 2R47A 1R8JA 3GT7A 4Z99A 3BILA 4ETNA 2PUBA 3Q41A 1YTUA 1MAVA 3CFYA 1DC8A 1QPZA 3N0RA 3RVNA 4ETIA 2QR3A 4MR9A 5B3JC 1E6KA 4S04A 3EJWA 4YWHA 4MR7A 4MQEB 3MYYA 3Q15C 2J48A 4ZMRA 2MSLA 1ZESA 3QELB 5DTEA 3E3MA 1K66A 4ZPJA 2DRIA 1K68A 3T6KA 2PE5A 3DZDA 3LTEA 4KRFA 1TJYA 4QPJC 4MAAA 3F73A 4W5TA 3HUUA 1ISRA 2E4ZA 2YHBA 5F64A 4WZZA 5IUNC 1USKA 5JNTA 4MS3A 4P98A 3O2QB 3JY6A 2L18A 1EWTA 4MR9B 3EQ2A 2RJOA 3KS9A 4NQRA 3MMNA 5EWJB 3NNNA 4EVSA 1JHZA 3FDFA 1BAPA 4XAQA 2VUHB 2IKSA 1QP0A 1QMPA 3O1JC 1DJMA 2QV0A 4RZSA 3NBMA 3OMXA 3OO1A 1CYEA 1KRWA 1D5WA 4GPAA 4PYRA 4GNRA 4MS1B 4RY8A 4WT7A 4Q7EA 5ED4A 4FE7A 4JB0A 5EWLA 4PEVA 2NUBA 3CS3A 1Z2EA 3LMKA 3URMA 5D2CA 2JBAA 3LFTA 2PUAA 2JK1A 3H5IA 3N75A 3MF4A 2M1ZA 5TPWA 3QX8A 4F11A 4MQEA 4MR7B 1JDPA 1P6UA 1JX6A 2FEWB 1QP4A 1QQBA 1SRRA 2PL1A 4YRZA 9ABPA 3E61A 1NTRA 2MSWA 3H6HA 3LUAA 1DCMA 3A3KA 5FWXA 3N6VA 3B2NA 3C97A 2PUCA 4IRXA 4KNYA 3OQOA 2NZVG 3SQNA 1EFAA 2F8SA 3CZ5A 1E6MA 1YK0A 3GV0A 2IOYA 5JNWA 4G0ZA 4LE2A 4Z9BA 5GQSA 5IX8A 1ZH4A 4KV7A 4JB2A 2ZAYA 1USIA 1HEYA 3GBPA 3O1IC 4Z4FA 3OLWA 1KGSA 5CNIA 3I45A 2QW1A 2E4UA 2E4XA 4RXTA 4D74A 1QKKA 2HSGA 1MB0A 1MIHA 3QEMA 2PUFA 4G0MA 2PUGA 3HM9A 3QLUA 4MGEA 4OTZA 1ZAYA 4KZKA 3JTEA 1GUBA 5FWYB 1ISSA 4G0YA 2GX6A 3IP5A 4KVFA 5TE9A 1Z25A 4ZYLA 5TQ0A 5KC8A 3F7NA 2IPAB 3EODA 4G0PA 3HXMA 5TQ2B 5FWYA 1QNLA 4XFKA 3LKVA 1GCAA 1U2QA 2WB4A 3OQNA 4MS3B 4F06A 4E7PA 2JVKA 2FEPA 4XARA 3RVKA 5IULC 4Z9AA 4NCBA 3ILHA 5JNRA 4YGXB 1DBPA 3O2JA 3SAJA 1DP4A 5KQGA 1DC7A 5FBHA 3KHTA 3OLVA 1B00A 5JS2A 2WJAA 3H5VA 3KTOA 1RZRD 4B09A 2PUDA 3EGCA 3EULA 3S99A 5IEBA 1YS7A 1QO0A 4IGAA 1M5TA 3LUCA 2FMKA 2VYCA 2A9QA 3IPCA 1NY5A 3UKJA 4IMIB 3EDCA 1U0SY 3OO0A 1SXIA 4O1HA 2JVJA 3GA5A 3KCNA 2FN8A 4W5RA 1NATA 4D6YA 3RVQA 1KMIY 2OQRA 4N0PA 2YHAA 3O75A 3CRNA 3VNAA 1SXHA 1Z17A 4Q6WA 5TQJA 2CD7A 2LUOA 3RVPA 4N76A 3RQIA 4LDZA 2HQBA 1GCGA 3M9XA 4L4UA 3HZHA 3FFWA 4LX8A 3QLVC 6CHYA 4TN5A 2QU7A 3TX6A 5E3JA 1FQWA 2RDMA 3CHYA 4IF4A 4YR7A 4EYOA 1L5ZA 3D8UA 2FMIA 5FBKA 4KPYA 2LP4Y 1D4ZA 1M5UA 3H6GA 4OBBA 1JLKA 3GWGA 3TD9A 5C5EA 1LJUA 1PNTA 4QICA 5IEJA 3C3MA 3O21A 4RY0A 2HQRA 3N0WA 1FFWA 1A0OA 2GBPA 3MM4A 3UK0A 4Y9TA 4LDAA 5EWMA 3RH0A 2PLNA 2FXIA 3H5WA 2JB9A 2A9OA 3JVDA 3LUKA 4TMYA 5IUKC 3DGFC 2FSPA 1D2AA 8ABPA 3QEMB 1FSPA 1Z2DA 2PMCA 4MQFA 5IC5A 1YMUA 1U2PA 1YK1A 3H5OA 3KJXA 4RKQA 2WWVD 4Z4CA
chains in the Genus database with same CATH superfamily
1Z5VA 1EB9A 1IEXA 3ZOZA 5I7WA 2ZTUA 2AYXA 3WAKA 1I51A 4JC8A 5LCXA 3QXJA 3I42A 5IG2A 1NXPA 5DYYA 2OR3A 2R8RA 4BNFA 4DEVA 3WIOA 2C2OA 2G0AA 1NSFA 1AGXA 2ZBVA 1H94A 1I7LA 3OC6A 4JJ6A 1ARZA 5AJYA 3RHTA 4CV3A 2O8CB 2HXGA 1G64A 6AT1A 2HH9A 2PDAA 3AB3A 4RZ3A 1T0UA 3PXGA 4MJ7A 3STUA 4L85A 4BEVA 5LYJF 1PIWA 1QIEA 1D9ZA 2VF4X 2YVLA 1X8XA 4B4UA 1NE7A 5JNVA 4DFDA 1F7VA 4QTTB 3C0KA 4WN9A 2ZTVA 3OTOB 4AUNA 4DLTA 3L4KA 3UFXB 2KQUA 2OFPA 1LI5A 1W4AA 1BJKA 2GEFA 3ITNA 1XMPA 4LXGA 4P33A 3GLHE 3LHIA 4MINA 2AOTB 4V02A 2VPYA 3I9KA 4JLWA 4BKPA 1Y1QA 1YASA 2I3ZA 4JYPA 1NWHA 3UAWA 1E7WA 3NKLA 1IZZA 3URKA 1FFDA 1MTOA 1F3OA 1F38A 1FDSA 1ODKA 2MR5A 4Q1FA 3RWBA 5G0WA 3UGQA 3NC0C 3HXPA 1Q1NA 5IH3A 2B7BA 4R9SA 1M6NA 1Y5IA 2JJ1D 2ZWAA 1W5BA 2GLTA 2YICA 4ZVPA 2HMAA 2O1XA 2IE8A 3BE5A 4QWWA 5IK2D 1S8FA 4Q9KA 2FG5A 2FSUA 4EY3A 3CR3C 4BGUA 4DEXA 1KK2A 1SR8A 1ULSA 3MN1A 1HBJA 5FQOA 4CNQA 4CTMA 3BX1A 4CT4B 3EQZA 3VNVA 2UZAA 4JIMA 2H1RA 5JWHA 4O0MA 3Q7IA 4EKYA 1AHHA 1BEZA 1ZJ6A 3C1UA 5CM8B 1IAVA 3E2PA 4IEEA 3C41J 4XCVA 2MSDB 2Y2UA 1C80A 4KTTE 5E8JA 4C7KA 4WLUA 1A96A 2I7TA 3P9KA 4GRDA 4KLZA 1F4VA 3N53A 2BM0A 5LP6C 2GPTA 3PGXA 5B1YA 4LF6B 3REOA 1QHGA 3RODA 4HGPA 1U7OA 1Q50A 2OL4A 4G01B 4QJ3A 1WHSB 4DSOA 2Z6QA 2X8JA 4OI0A 3WXBA 4MLCA 4CJXA 3L6BA 4WZAA 5BV0A 1PUIA 3GGGA 4QBTA 4CM9D 5CDYA 1GVHA 2QJRA 1T5TA 1H2HA 1PF7E 1YC2A 4FYJA 4AM8A 4UQOA 4EPWA 1TCCA 2VJLA 1IMOA 1WVGA 4C3ZA 4LXUA 4FJ0A 4IWYA 4AFNA 2HLDD 4EG3A 2GEUA 3UYKA 3D6MA 1EAMA 1EDDA 3SEFA 3V1UA 4D9JA 5IJAA 2OY0A 3KUKA 4RVNA 4P7KA 3OZRA 1U9IC 1ZUD1 1GZ4A 1IOLA 1QG4A 2VZEA 3K0BA 1DG1G 3U5ZB 1B3BA 1I5OA 4ZOCA 2P2DA 2XUFA 2VSFA 4Y6QA 3T8YA 2IP2A 4HEQA 4J0CA 4US1R 3RVSA 1FNCA 2ETVA 3T5CA 1KORA 3G6WA 5HIIA 3QRWA 5FUMA 1GOTA 4DTIA 3FCSB 2XVZA 3P19A 4UZEA 3ZE1B 2C3PA 1OFUA 4G56A 1E1RD 1PZGA 2JA1A 1EFRD 3NHUA 2WJ6A 2NU7B 1Q22A 1Z56C 4UMFA 3R5FA 2FWAA 4PZLA 4E30A 3BIXA 3NVKI 3V32A 4MQ6A 3ZZUA 4EVRA 3WHIA 4FYWA 2Y3IA 1RHRA 1XNGA 4JDUA 3EW9A 2YJ5A 4KR9A 4D3XA 3KWLA 1CBUA 2XMRA 4U1RA 5CYOA 4I50A 3MB8A 4AJ4A 3FOCA 5B3KA 1AOXA 3H5LA 1EQ2A 4TWIA 3TI9A 5EN4A 2EF1A 3BFPA 4GWKA 2H4YA 3I52A 5CHYA 1D6MA 3B6IA 2PJZA 5KTNA 1K7YA 4MKHA 4M0MA 3ERCA 3IMFA 1DKQA 1LTQA 4BDTA 2CSXA 3R75A 3O47A 4B80A 2VHWA 1DO2A 1KFBB 4AJIA 4TSFD 4WUTA 4P38A 4B6PA 4F8EA 4I8IA 2IYYA 4CTKA 1L7AA 1OXKB 4E7OA 1MC8A 3N8IA 5K3OA 3MD0A 1APBA 4HY3A 2YNMA 2X23A 2JGFA 1IDN1 1TA9A 3LV8A 5CH3A 4QASA 5BN5A 4FNOA 2D0IA 3BFJA 3BC1A 3GEPA 3FGZA 1EVEA 2JBHA 4IDQA 5EZYF 3QYJA 3KETA 2XZLA 4O8ZA 4YBZA 1T8TA 4HDKA 3WP1B 5D87A 4FCCA 4LOIA 1CR0A 1CEEA 1EUDB 3MINA 3IOMA 4JUCA 3H9CA 4NZNA 5FKJA 2HK7A 2Y92A 5TT1A 5I9NA 2Q6KA 3GP8A 2IBSA 3P2YA 1XK6A 1ZA1A 2QAGC 1W93A 1XMSA 3QVXA 5AHWA 3S55A 4BJ6A 1CETA 4W7SA 3CUSA 3B6MA 3MWDB 4BIMA 1TNDA 2F17A 3UOGA 1R6TA 3BBLA 4OD0A 2HF9A 2CV0A 3CRMA 3SJAA 4BLUA 1HYEA 2HDOA 4N6OA 1E64A 2W42A 1YFKA 2MOKA 3SXUA 1QX4A 3LYLA 4ISCA 3WZMA 5GTDA 2AOWA 2EAUA 3FNIA 4AS2A 4YYZA 1I9GA 2VSNA 4J2TA 3OT1A 7MDHA 1ZYUA 2C61A 4M21A 3N8HA 4A27A 1H9CA 2BFCB 5TY0A 3OZTA 1BZYA 1ZVJA 6ADHA 2BCEA 3DHVA 3GAZA 1OA0A 4B3XA 1D0SA 3W2HA 7AT1A 3O4HA 4P9NA 3SIRA 3ZZNA 1XLTA 4PF1A 1ETUA 3ROKA 4TUYA 1WF6A 4D80A 1U8XX 3M34A 3FB4A 1X7YB 1X1RA 1G5PA 2OAEA 4YHHB 1MQ8B 1S6YA 3GF4A 5DHAA 3EPRA 3TLAA 3TXXA 3UKOA 4QOIA 5TQ2A 5JSHA 4NNPA 1KOLA 4D9KA 3QX9A 4RE5A 5KVQA 3ZY4A 2H5EA 4H6WA 4L3OA 1GTRA 2UVQA 4ZRNA 2OQ2A 5K3BA 2O48X 3JV7A 3RKSA 3S68A 1KQPA 1NWCA 3AUSA 2XR1A 2QRVA 1G6HA 3EFHA 1XU9A 1U3GA 3IQDB 3KWMA 1GLGA 1Z2OX 4QE3A 4JXZA 1DAHA 1E60A 2VJCA 3E82A 4S12A 3EBPA 5EFZA 4L73A 1AJEA 1ZD1A 1TLTA 4J7CA 4D92A 2HJ9A 2QQEA 5CXXA 4FFMA 1CUWA 2GZRA 4TX1A 1JRLA 1R3DA 2AOVA 2RGUA 5AI5A 5H81A 1UWVA 2Q1UA 4JLVA 5B3JA 3T3GA 3N2KA 1QAOA 1CFZA 1YMQA 3DEZA 1YI1A 4L6AA 4EBFA 1VLLA 4WLOA 3FPSA 2WWTA 5CVTA 3NHPA 2HJWA 2C4VA 1GFSA 2FWNA 2D2XA 2YHSA 3KSDO 1TOAA 3ONWA 4RDIA 2WD8A 3V2IA 2REBA 4D56A 2ESRA 3DLAA 2CNWD 2RHWA 3O8RA 2WQZA 2OECA 5C18A 3SIPA 5FI1B 1HDXA 4LRUA 3BRQA 3KKQA 4OHKA 4ZVKA 3SE0A 4NYMQ 1WX1A 4WFIA 3KE9A 4WGGA 4X24A 2AG0A 3JSAA 2VSOA 3TL3A 3VTAA 3RSLA 1P74A 5FD8A 1N6IA 4YX9A 2QNRA 3KALA 3MT9A 4MMXB 2B9VA 3AZPA 1U1IA 3MJCA 4G97A 5D2CA 1G6OA 1YJBA 4FFBA 4KE8A 4XASA 3ELBA 3SGLA 3VHXB 1JSLA 3N58A 2JJYA 2A59A 4AQDA 3WFJA 3FZQA 2IX3A 3D4IA 3ER8A 4KIJA 4O08A 2UZ1A 3V4OA 4B31A 4DNQA 2FSFA 1NQTA 1NBEA 5FL7A 3WNCA 3NHLA 2EDAA 2Z09A 3S2UA 1L1QA 3WIVA 4F71A 1TM7E 3KLNA 1NF8A 4RAOA 2R6R1 3MXTA 1WSBA 1UDXA 4Z99A 2BE7A 5BYAA 2PUBA 3LQRA 1U8EA 3D4OA 2A5JA 3MK31 2NV6A 4ARIA 4QHYA 1K6IA 1DC8A 1OREA 4FYHA 5I9SA 1RAFA 3A11A 2HSWA 4S04A 1IBCA 5B36A 1NC1A 1L4FA 1WCYA 4HBGA 2UUCB 3DP9A 3MVEA 1IIRA 4LZAA 4YAWA 2BTOA 5DTMA 4ZMRA 1JQLB 2Z2JA 2PIAA 4OH1A 5F9HA 3U4MA 2XRZA 3R7LA 3R7AA 2ZEJA 1UADA 4TQUS 4W5TA 3VV3A 1ISRA 1VGVA 3MAAC 4ECEA 2VAVA 4K8OA 2AE2A 3LT0A 5DU2A 3PD1A 1CLEA 4FQ5A 2JK0A 4GP9A 4WLFA 3K6SA 1JR2A 2YDXA 2ZJ6A 4GXQA 3RGWS 3H2YA 1DIRA 1IWPB 4AZWA 2PQMA 4AY5A 4Z49A 3EQ2A 5JFTA 1YRYE 1V9CA 1U0OC 4M9XA 2PUHA 3WX0A 4L5YA 4EHFA 4BNYA 3S1LA 2PL3A 3LHSA 4JUFA 3SJBA 1E9VA 1NW4A 4DC0A 1DAPA 2RGBA 3GJRA 4CRWB 1L7VC 3PNMA 1VLVA 3OX4A 1O95A 1MPXA 3HGQA 2VJMB 3KJNA 4LY9A 4D02A 1EDOA 3HWRA 3HXKA 4H7IA 2Q27A 5HF5A 2OXIA 3X1JA 5JDCA 3AHCA 4X9XA 5KWJA 4PEVA 4KPUB 1JAHA 1YI0A 1N6HA 1O97C 1G5TA 4DDTA 4E12A 1R6VA 5HX7A 1BH6A 1E2FA 1ODSA 1QIGA 4MV6A 1PBTA 2BEUA 1RACA 3MWLA 2YH2A 4OL9A 4K40A 4L76A 5BPFA 2RHMA 2Z30A 4LZJA 4RDHA 5EXXA 2X9GA 1M1ZA 4PQFA 5GINE 3INGA 4QBIA 1DDGA 1RAHA 1UWCA 4B8WA 2XD4A 2DULA 2FX3A 1AKVA 4YONB 1UKVY 4UCQA 3G59A 1VJCA 4PPYA 4A2WA 1C0LA 2B98A 3GJXC 4I4TF 5IDWA 1DXQA 3SQNA 3UPDA 3RHZA 4ENVA 2WOOA 3WNZA 3BN3A 4L22A 3R7SA 1U8YA 4PC7A 1QK3A 3IJPA 1G98A 2H2WA 2H1HA 3WWYA 1G60A 1HE4A 2F9LA 2C8KA 2P0EA 3C1AA 1G8PA 1II9A 1G21B 1RW4A 4I9GA 1VJTA 4IPTA 4KE7A 1L4EA 1BW9A 3OLWA 5HMLA 3ZK7A 3WQSB 4A8TA 4H4EA 1E2MA 4IO0A 3U1TA 4WBNF 4RXTA 5CFRA 3U44B 3T4PA 3RVDA 3I4LA 1ZFNA 2VO1A 3ETCA 5JS8A 3BL6A 3IHTA 4ZTZB 1RHMA 4JSTA 1FJ2A 3V3TA 1J6UA 3EH2A 2V5AA 1Z7BA 3EIHA 3KYCA 3ZD9A 2XITA 3DDSA 4DMHA 3OA2A 3NOVA 3RUAA 2VAMA 3FYCA 4L8WB 3D1VA 4F85A 4WVLA 2NO7A 2AFIB 4OJQA 4D5GA 4WK0B 4F4FA 1ABBA 4ZEMA 4IF6A 3PENA 2GZSA 4PLYA 1L4MA 1UEJA 4NU6A 3ZHOA 1Y33E 1A8IA 3D3EA 1KC3A 1Q7EA 2GJ4A 4N5IX 3AOEC 4OHMA 4YCDA 3UAXA 1DT3A 1MX1A 1PQ4A 2FPGB 3PIDA 3OQNA 3RAEC 1Z4PX 3OIWA 2Q62A 5I7UA 2SKDA 4D96A 3H5NA 3G2KA 1JG3A 3A2LA 1RKXA 3M89A 3SZRA 1KI2A 5EIBC 5FJIA 5TLSA 4KXYA 5IXJA 4KR0A 2V7WA 4PTYA 2QAIA 3KHTA 2O23A 3NORA 5EJFA 1RQLA 1P1FA 1N2BA 4JITA 3H5VA 1CG6A 2A8YA 13PKA 1A9OA 2XUQA 3A36A 4I4TB 3MWFA 4UUNA 5DYTA 4HVAA 5C1BA 5EXPA 2I4MA 3HEMA 1XTSA 4A8HA 2ZB7A 3L8FA 2AT1A 4TM7A 3SEAA 3G88A 1XQVA 4BZQA 4HAXA 1QH0A 3OLQA 3WKCA 5JR3A 4S24A 4W5JA 3MJHA 3RYFA 4QUEA 2D5IA 1BCRB 3OECA 4BGDA 2XXJA 2BKAA 3QTBA 4D45A 1Z75A 2HOQA 2Y66A 3ZC3A 2K2WA 2OCXA 4R7TA 4PRYA 5F73A 1C9DB 4XGNA 2Q8PA 2WM3A 4H1UA 1SVUA 2P5YA 3U3KA 2XT6A 1G17A 1JDSA 5I7AA 3O75A 3IVXA 1ZK4A 5DHQA 3GRUA 4PY2A 4R2HA 4CWAA 3O7WA 4OU4A 4UEJA 5HP4A 2IZ7A 1EJ6A 2P3QA 1KFKB 1ZQ1A 3HGMA 2MINA 2Q5IA 3DL4A 1VZ2A 1UBLS 1NVTA 5CDFE 1Q0RA 2P2ZA 3CX7A 3N87A 2QRNA 3E5MA 1QS0B 2QZ4A 2BH9A 2R0QC 2DY1A 4G65A 2Z04A 3G17A 4BNDB 4HLQB 2G7MC 5DN6D 4P4SB 4XUGB 4EYOA 2HK9A 4B3GA 1RI5A 1ZS9A 2PRSA 4M22A 1ECCA 2RGCA 3H6GA 2GJ9A 3NBAA 2ZYSA 4DDKA 3NHKA 3I6BA 5A4IS 4JKYA 4MQ5A 1RM3A 3ACCA 1X77A 3HDJA 2WVHA 3VMMA 1N75A 3HCNA 5KNLA 4RY0A 3EIXA 5K3AA 1EFRA 5GV8A 3HPRA 1VLMA 3GRAA 3R2JA 4HN4B 3UJBA 1GZ3A 4NXMB 3ZIDA 2H2HA 2DSTA 4ZC1A 5K3CA 4XGQA 5BUQA 1LCIA 2QENA 3KVVA 3LUKA 3DTYA 1N4AA 4B4OA 3N7TA 3DGFC 3OZCA 2V7XA 2FSPA 2GZ3A 5T4HA 5JYDA 1YK1A 4EKIA 1HZZC 1X2BA 2R7LA 4M87A 4P84A 1QGOA 4NCIA 2JCBA 4OL0A 1JIQA 1J2TA 4PNEA 2I33A 4R2KA 4CEJB 5EEHA 5EJIA 3A4IA 3KJEA 5IT0A 4LOKA 4NEQA 2IDMA 5H68A 4RJKA 3SYTA 4KREA 3L1VA 2EIXA 4FS8A 4NOMA 4QRDA 3FPBA 4OYYA 1I2BA 2ASEA 1DZ3A 1NLFA 1ANKA 1R8YA 5JD6A 4OHZA 1I1NA 2XCSB 2WTNA 1EESA 1FMFA 5K0CA 1TJ3A 3VSEA 1W8DA 2WE7A 5JQGF 3H04A 4WXMA 5I48A 3Q12A 3AZOA 2WT8A 2P2YA 3WLPA 2QTWB 3OM8A 3BQMB 4PFQA 3RE1A 1G38A 4GYKA 1FIUA 3B36A 4J7UA 3LY5A 4CMHA 2NLOA 5IDVA 1VSBA 2DM6A 1OFTA 3QWIA 1D03A 2BDEA 4OOFA 3ECCA 1W9MA 5HKLA 5BSVA 4LF7B 4EO4A 4CQMD 2VT3A 2JFHA 5KU7A 4Q4LA 5FV7A 4R84A 3HTXA 3N2ZB 3WB9A 4MWSA 3F4BA 1DQNA 5G1OA 5AM1A 1JIJA 1XN1A 2YZGA 4A91A 2BEKA 3ZZ0A 3TNJA 3A27A 5H8WA 1NNSA 1NYTA 3OE1A 5DJ5A 1NG1A 1Z15A 1JHPA 2H4WA 4P5PA 3IHLA 2REXB 4Y6GB 5AVYA 2D0DA 4EB3A 3ND5A 4RUKA 2I2DA 2YFKA 2PS0A 5E7QA 5CFLA 3IB3A 4GPIB 4NCNA 1E2DA 4F1WA 5EFOA 3AIIA 1N2EA 1NVKA 3KYCB 2QUJA 4NKRA 3FTEA 3ER9A 1Y8RB 3G1WA 4C20A 4ZODA 3ZU4A 3A9SA 4PZ0A 5A3SA 2XLBA 1TCAA 1YCFA 3UNXA 1UBKS 5D51S 4A23A 1T26A 4P6VF 3VPCA 3BH0A 4MB6A 4CTJA 3RSZA 2BGIA 1X7ZB 1YR3A 3ANTA 1P9LA 3EFOB 1CF2O 1T6ZA 1FS6A 1FXWF 2R6DA 3L8DA 2E85A 3PR2B 1GL9B 2PV7A 2VBFA 4HFJA 2WFLA 1H0KA 4P53A 2C84A 1GNVA 4X00A 1KNQA 1TVMA 4X8OA 5DI3B 1I7NA 4YP6A 5AKZA 1PNRA 4REQB 2H17A 5GMOA 4R3NA 5J2UF 3JVIA 3PX7A 1LS1A 3BOSA 3Q6MA 5JI3E 2FK7A 1H3EA 3PI7A 2Z4SA 4KQCA 3OJLA 1W36C 1R6BX 2WILA 4YCMA 1BVRA 3BUSA 5I9MA 1L5GB 1TRHA 3VNUA 1GP2A 1HYGA 4CM3A 3KDSE 2AFHE 1D8AA 1R0XA 2AJDA 2W37A 4X7BA 1YDHA 1CP3A 2JHCA 2KE5A 2H2IA 3Q8XB 3WL5A 5LBTA 4ETWA 5F98A 4XDZA 2CDNA 1WDWB 1PQUA 2VH1A 3P9NA 1T1IA 4OMFG 5JMWA 2CCKA 1JSRA 4FWBA 4QFMA 3QPCA 1JQBA 3FTDA 2IPMA 2M6RA 2WMYA 3PWKA 3UC5A 1PEYA 3UT0A 3TOXA 4CIXA 1K4MA 2YR0A 2P40A 4OOEA 1Z3CA 2VHUA 1KZ4A 1U8ZA 4Q00A 3SR3A 1FYXA 1RAIA 1K92A 2JRCA 4CV1A 4GM4A 1EWRA 2WV7A 3LLMA 3OZFA 3UCEA 4YJGB 5ITSA 1T3GA 1V9LA 3CF4A 3O94A 4FFVA 1HDCA 3KQVA 3RTCA 4B34A 5DHTA 2YWDA 4Y2PA 2P62A 2HFJA 1GXSA 1RIIA 1CDEA 3GEHA 1HWYA 2XSZD 4V1CB 3KJFA 4U0KA 4KK4A 5EMMA 3ZWPA 1HY3A 3U7JA 3GQVA 1SA0B 1DEHA 5GM2A 4RV4A 2XNSA 3TTYA 2YV4A 3DV2A 4CUZA 2NNLD 2AI3A 1IU9A 3G23A 4Q0MA 2BR3A 2I80A 2XE8A 4FYXA 4ECAA 5A3QA 2HXSA 4GKBA 2R1VA 4X93A 1SKBA 2H2AA 3AW9A 3BULA 3IUJA 1AQ6A 3KTDA 4YJDA 4HD8A 1W19A 3AJ8A 3NBKA 2Z5LA 1NHGA 4DUGA 4NFSA 5KVVA 1GTZA 1W75A 2BBOA 2Y0CA 1EB8A 3T7CA 4A15A 2GJKA 4WNAA 1X7XA 4FE3A 5D7NA 1K7EB 3M5DA 3SHTA 2AD1A 5JPIA 1PZMA 1PYOA 1T5LA 4KXFB 4AK9A 4EATA 3UJAA 5EJ9A 5IMSA 3IUEA 1P5JA 4C9BA 3NNDA 4U02A 1GU0A 1UK6A 1F5SA 3ZX5A 4DR5B 2G36A 3AKCA 2BTEA 3BD6A 3LRTA 5L3VA 3ZU2A 4C01A 2IEGA 4D8WA 2PS9A 3ND7A 2J6CA 4DMRA 2VI5A 4CM4A 1I6MA 3LHKA 1U0RA 4ND8B 2OAQ1 3I2KA 5H9WA 4J6EA 3SF8B 3HKCA 4FZVA 4HEJA 3RFVA 1JAIA 4GUAA 5J23A 5A0VA 5FWNA 1J8VA 4S1OA 4TQAA 3ICWA 5DIFA 5HFNA 1X1QA 1IXYA 2ZSJA 3WGQA 3B53X 3S5UA 3MLAA 4Q21A 2Q3EA 1Z0ZA 3C4JA 4HTAA 1UOQA 1J9EA 5MFPA 3ADCA 4TKUB 4R3UC 2OSVA 3AFNA 1P2UA 2VJYA 1TZBA 4TZTA 3IAUA 1G18A 1D04A 5E1OA 3UGKA 4IFBA 4ZOLF 2DFTA 1L7DA 2NYUA 1XZBA 4HI0E 3MUOA 5JSYA 5JATA 1KZYC 5IHPA 4BUZA 4KSCA 5FUWA 1QGED 1A72A 2LNDA 3AILA 1MB4A 3EQ7A 3L7KA 1PL0A 4HWGA 5DF1A 1ZM2A 3A0RB 2C2BA 5IC4A 4S0ZA 3OX2A 3G0HA 1QGDA 3RBZA 2ZJYA 2JANA 5ALMA 3FZEA 3LVBA 5KDLA 4DY6A 2OHJA 3QK7A 5K09A 2O8BA 5GAJA 4O2BA 2QLNA 1MG5A 4B47A 3P4YA 4B76A 3SMVA 3FX2A 4HQOA 5K01A 5BOVA 3WYDA 2NTVA 4YT4A 1Y4SA 1ZSYA 3A6KA 2GCGA 1N7GA 4F5YA 3LBIA 1JQ5A 2HPHA 4IHQA 1FW8A 4LF5B 1DPGA 1EVLA 3AM4A 4UDYX 1JQEA 1W5TA 3C3WA 4EX6A 2CNWA 3CZMA 2D74A 4B46A 2V58A 1E8NA 2H92A 1GPBA 2JFWA 2X22A 3TLYA 1WB5A 2JCSA 1JMKC 3PVSA 4D46A 3E3LA 4OXIA 4C7VA 5K8UA 3EBOA 3HCWA 2G1UA 5T4BA 5U4QA 2PBLA 4C7XA 4JEUA 4JT2A 4D43A 3HL0A 1GPH1 2RIPA 1SB9A 1T1GA 2OZEA 4WCFA 5ED0A 3DDCA 4AF6A 2N3ZA 3L93A 2HA0A 2P1ZA 4HAZA 3USZA 3HMQA 4H31A 3R1IA 2AEMA 3TJMA 1ECFA 1Y89A 4NFLA 4QXPA 1QIDA 4MVJG 4RQAA 2OC9A 1T4DA 3VTZA 4ML3A 2LZ0A 3BB1A 2R1TA 4ARBA 3OQMA 4CQMB 1FL9A 3EVZA 4EW3A 1XDWA 4YEDA 4A6XA 1I7DA 4MOWA 3STXA 1RBMA 4O1IA 3DMPA 3CVYA 1X1BA 1B8OA 5K0EA 4QFDA 2Q46A 2D1FA 3DG9A 3NB0A 2E4WA 4RADA 3T1QA 1N3YA 2GHQA 3CMMA 4TT3A 3OOWA 4LOLA 5TEVA 3L06A 4EB8A 4M1TA 5KOJB 2DWCA 3ZIAA 1SHLA 3F4LA 4PBSA 2COEA 4F04A 2J67A 4AX8A 4DVJA 4Q1BA 2CMDA 4FXPA 3I1YA 1DKOA 1R27A 4EQZA 4X6LA 2ZB4A 1LC0A 1FSZA 2XMSA 1JEYB 3GPDG 5A2QA 4KH0A 5A6SB 4KU4A 1Z5ZA 4MARA 3M5PA 1AS2A 4LNAA 4KQMA 4OQYA 1TKAA 5B4TA 4RZQA 4E32A 1AKEA 2AR0A 1VB3A 3L2OB 4HDKB 1H1LB 2CJPA 1Y8QB 3BCUA 3DEKA 2A2ZA 5CP8A 3EIFA 4OP3A 1OPXA 4WERA 4BO2A 3Q15C 4HDMA 3KHUA 2XB6A 1JEAA 4R1NA 2W58A 5HIMA 1UJMA 3WOHA 4PGHA 3DC7A 1KKLA 4BLTA 3VA7A 1BU8A 3OVMA 2Y76A 1XYVA 4B3HA 2AZMA 2CFOA 3VNSA 4J0QA 4KJZA 1M8FA 4JFRA 1OI4A 3P0FA 1XEWY 3G2QA 5ICFA 1KPHA 1Z33A 2R44A 3AL0C 2XB9A 3OE4A 5IUNC 1DEKA 2QMEA 1V35A 5C3UA 1RJFA 1M73E 2H57A 4LHVA 4Q3EA 3UG6A 1GJRA 3JWEA 1OB2A 4N9QA 4CVNA 1XJ0A 5C5DA 5EHXA 4Q66C 1Y7LA 2VDUE 4YT5A 4V03A 5AK0A 1XD2B 3TZKA 1JLLA 4TV8F 4NZYA 3UHAA 3WRYC 1JXAA 4DA8A 5H7XA 3H05A 1UINA 4ZYVA 3P1JA 3DZBA 1V8ZA 3GO4A 5DHUA 2GN1A 3OMXA 1P7ZA 3ZE7A 1F8XA 1VLQA 1H6AA 2BFDA 2IVFA 1V8FA 2YCLA 4GVLA 2WMDA 4I5IA 3OJOA 3TUJC 5K7SA 4A0QA 3EUWA 3IR6A 5LDGA 5F3DA 4ZI7A 3D4NA 4MP8A 3ROQA 5TS3A 4X62B 1DJPA 3D3KA 1K7CA 1SU7A 1C8KA 2W71A 3DOHA 3C8UA 5IASA 4H18A 1X80A 3K71B 3QFFA 5KKAA 3BWYA 2MSNA 1N2HA 3IP1A 4IDNA 1ST3A 3VC2A 1V5GA 2M9MA 4PX2A 1C29B 3RCBA 4DA0A 2YVAA 4HQ0A 1SN7A 3I5MA 2ZI5A 5JLAA 1KJJA 1XEAA 2CNDA 2JEOA 4ZI5A 4NYJR 1CZLA 4HTFA 1JR3D 2NPIA 1JHAA 3CYFA 1J2RA 3ZNQA 4CG1A 4G8JA 1JZTA 1FBNA 3MT0A 4KXWA 5IZCC 1L5HB 5AQEA 3DM9B 3RV3A 1NQUA 1XDUA 2GDJA 1AT1A 2HRCA 5C2JB 1EFUA 2FSVA 2W2LD 1P0QA 3DXZA 3AY6A 4MNTA 3S2ZA 4YXFA 3VFDA 4INOA 1L5MA 3QE3A 4N01A 4OXRA 1FFCA 3NANA 1CR4A 3DFFA 3UW3A 4E1BA 2R6FA 1I9CA 2OM6A 5DNCA 4YTEA 2NQTA 3TVYA 4YUAA 1AHNA 1F06A 3KJQA 1QYIA 3GBPA 2SNIE 4R0VA 4AP6A 2DERA 2HF8A 3FCCA 3OPYI 1GADO 2YX1A 2V9CA 4WNAB 4CKBA 2ODNA 5EIWA 5CB0A 2HYIC 3OOSA 3H16A 3MW8A 5EJGA 3ULKA 4W1SA 4XVQA 5FTJA 4C4XA 4Q4DA 2JGJA 1PGPA 2CXNA 3TE7A 4EKDA 5IU6A 5KNCD 4LBWA 1WZCA 5CAEA 3QSGA 1JHVA 3GD7A 4K8RB 4ZO6A 3DM5A 1YJAA 4IHJF 1G8FA 1ZK3A 4C5CA 5L9AA 1BMFD 2H63A 3I28A 2ERCA 3S44A 1ISSA 2VXBA 4R6XA 3IP5A 3MWEA 5AOCA 4IFTA 4ND7A 1UBOS 2G40A 2QVLA 2OBLA 3QTLA 1QNLA 1JR3A 1AO3A 2BM1A 4R9VA 2E5LB 2NVOA 3SI7A 3NV7A 4FP9A 1PT7A 3KKZA 5COQA 4QEKA 2I2AA 2NSJA 3I01A 3QPAA 1P4GA 5CW1A 2ECQA 4OXNA 5GV7A 1L1EA 3NBQA 1CJTC 3D9QX 1AG9A 1AKYA 5GJVC 3KHKA 1T15A 3HUDA 4ARAA 3I9OA 4EHDA 3OLVA 1VC2A 1D0IA 3C3BA 2WJAA 3KNZA 1KQOA 3HJAA 3KM0A 3LDHA 1L5NA 5JYBA 2H1VA 4P3NA 1J1IA 2D5AA 3OD5A 2TSYB 1PX2A 2GAOA 1TL7C 3N2GA 3QKIA 2FI1A 4FHCA 4JENA 2XKBA 4IMIB 1FXSA 3F5QA 2JIMA 3IR7A 3PNPA 1ESDA 5HKKD 3J81k 2VPPA 2XQVA 3OU7A 3A6LA 1LGYA 2F3TA 8ADHA 4IIFA 1H1TA 4M36A 4ZT2A 1RYMA 3PK0A 4EG4A 3UK6A 2XECA 3A1NA 1C1HA 1EEHA 3GDWA 3ORRA 2XUIA 4WUVA 4NTZA 1VHLA 2IUSA 3AV0B 1A9SA 4G4JA 4FKBA 4JS0A 1ZLXA 2DUUA 4UE2A 2FPPA 2PU7A 1TT5B 3DUWA 1K8XB 2B6HA 3VC1A 2FZCA 3OF5A 4KW7A 1AXGA 8ATCA 2R1TB 2X1MA 3IHWA 1Z4KA 2CV2A 2YJ6A 1GCGA 2C3OA 4KO3S 2DOKA 2RBKA 4UCXA 5IKPA 4HUQB 5H80A 1Y9EA 4BRSA 1DAGA 4G85A 3UUFA 1AMUA 4QFBA 4EAAA 3THWB 1LDNA 1W4CA 3GJ5A 1F2UA 4WINA 1PE0A 2A3RA 4NU0A 3D0RA 1H8HD 1KE1A 3BHMA 4KPYA 4HQLA 3QXXA 5FA8A 2JLYA 2PCJA 2XTJA 1QFJA 5CB8A 2QTFA 2WG1A 4JXKA 5E0KB 1RQ7A 3WRVA 4ER6A 1BS1A 3MINB 2FOXA 2YS7A 3PZRA 2NZ2A 1DTWB 2O7RA 2PRKA 4ITUA 4UNIA 5ER9A 3K1JA 3C3DA 1TZMA 1GYRA 4I81A 4ZZ3A 3S2SA 5KYYB 3EIEA 3LSYA 1VCNA 3PTZA 3HRIA 2X15A 3AW8A 1NVAA 3H5WA 4ODIA 3ZK8A 1S2LA 1EVQA 1FFXA 1BQ3A 1D2AA 2PJRA 2X8AA 2H0RA 4B85A 4M1ZA 3QE9Y 1HX7A 2GK3A 3U3JA 2XMDA 3DW3X 4HEHA 3V4SA 1BE6A 4AMUA 1UBRS 3L8EA 5FPSA 4RS3A 4UVEA 4ZEWA 3UB2A 3GRPA 3ZKWA 1W4RA 3EQ9A 1F5NA 2JJ8A 1GTMA 1QCYA 2B21A 1UBUS 1X0XA 2QT0A 4PZAA 2SHKA 5EE0A 4BV8A 2C0CA 2JD2A 5B55A 5FTLA 4C6SA 5JDIC 1L9XA 4YNBA 2I22A 4EQ6A 5L8VA 1EUZA 4BAUA 1NNLA 4TLBA 3KT3A 3D2CA 4KSBA 2R9VA 5TVKA 3FM9A 6REQA 3ENNA 4AUKA 2JIPA 3MRXA 1AUOA 3NVMB 2QB5A 4KBGA 5HA5A 1QDEA 3RAFC 3LVRE 2WU4A 4GMKA 3WL6A 3WTBA 1FF9A 4CEJA 1V5FA 1XSEA 2XTZA 4BVHA 2PL5A 3WE7A 5MN6A 1E7SA 3LT4A 2A4MA 4L5CA 5CLHA 2G5GX 3E3OA 1DKMA 4AJJA 2J7PA 4P2GA 2V6JA 5EIEA 4X1KA 3AKZA 3L6EA 1QRRA 1HLGA 2ID7A 3O2SB 1Y6FA 2IS2A 3KB8A 1SULA 4OHUA 3ZHBA 4E2XA 2UUAB 1FU4A 4A0GA 1JR3E 2NM0A 1QONA 3O92A 4L78A 3VZSA 2BHTA 5KWIA 2VOJA 3A10A 1XJWA 4CPDA 3AETB 2D4AA 2I5PO 1YR8A 5K3EA 3WLJA 4NSNA 5KYWA 1S96A 2O9JA 1VJ5A 1YFJA 2NO0A 4MRMA 3DLBA 1ZGGA 4PC6A 1QDUA 4G6ZA 5L3ZA 3UICA 2FX2A 6YASA 4V1CA 1H66A 3LQKA 2QSUA 4CM9A 5LIRA 2E1RA 5ECYA 1W9HA 1KGDA 3FPHA 2JLBA 2W0MA 4PXSA 3DKKA 1PTJA 3M6MD 3CZ9A 3MPOA 2JGEA 1JSZA 3QLTA 3ZBQA 4YFVA 3N5KA 1W4ZA 3O8CA 3QLVA 2KSQA 1ZXXA 2CLDX 1JG6A 4NY1A 1KMCA 1I3KA 4PM4A 3DFKA 1E4EA 5LNK6 4MVJA 1SZCA 2PRIA 3HUEA 5C8YA 3I34X 3TNFA 3DE3X 1B8NA 4EGFA 4PZUA 2B1JA 2KI5A 3SU8A 4KUHA 3HVRA 1Z4JA 2IX9A 4TQ9A 2WAAA 1IJFA 1XKQA 4LKRA 2QM7A 3LECA 4ZGGA 4A10A 5FOQA 4MWGA 4MV5A 3U81A 4MRAA 4LAFA 4JBXA 1YZHA 3LWBA 1XTVA 5AI9A 3KLOA 2OCGA 1QHFA 1CQXA 1BWQA 1MAAA 1FA9A 1RZVA 2CDBA 4EOGA 1J24A 3FCEA 2RKWA 3R6WA 4YRIA 5JEEA 4RL4A 4MWZA 5B6IA 1L8QA 1U7XA 1M6VA 3ZQJA 3BXXA 3NNSA 1H5UA 4WPGA 3MFQA 3I30X 3DQQA 1E4OA 2P6OA 3IH5A 3D2BA 1P0IA 2DBRA 1G5IA 1NG9A 1GWNA 3PE6A 3RTGA 4Q01A 1WD7A 3DMYA 5J5CA 3KKEA 3SPXA 4KFCA 3HACA 1GARA 4LZZA 1SOUA 3R77A 4DNOA 1NMQA 2AVDA 1J00A 3DWEX 4RZIA 3X2EA 4DW8A 5IYZA 2VK4A 1ODCA 5TF4A 4ZAYA 2QTTA 5CFZA 1G2IA 4JZYA 1L5OA 5K99A 2UYCA 4LXTA 1X1SA 4CR6A 1AQUA 1PWZA 4D25A 2Q28A 3RLFA 1TM1E 1ONSA 2YJZA 4LPKA 5CT9A 2G8LA 5AKKA 4HXYA 4QDKA 1SIWA 2Q6OA 3GPLA 2DBVO 1AGYA 3EA0A 1CUFA 5EJ2A 4E5VA 1DGQA 1O6GA 2QZSA 5BN3B 3ZOKA 5D7BA 3RKRA 1YL7A 2PMBA 2A33A 4IXMA 3SJUA 3WDLA 3FG9A 2ERXA 4UNRA 5J4HA 1YAJA 2IK8A 3TTXA 5JAQA 2OG1A 3EXFA 3RK0A 1V48A 3LXXA 2W2VA 1FDWA 3LX6A 1B6TA 1WMDA 3AY3A 3V9AA 2B35A 4MPPA 3VZRA 4KR3A 1T5SA 4J0IA 3ZI7A 5LIPA 1MXHA 2Q9AA 3FZNA 3AR8A 3OIFA 4RKEA 4QQKA 4HV4A 1KY5A 1J2EA 1BOFA 1L4LA 1A8UA 2Y6UA 4MI9A 4A9AA 4IUCS 3RUHA 5JBIA 5LQUA 1YNOA 2MYPA 2OCBA 3IP8A 4FZJA 2IE0A 2P4UA 2QZJA 2V8BA 1HNZB 5FEMA 2W7TA 2EX4A 4I46A 5GJBA 1L7PA 3DFZA 3M4ZA 1AGPA 5T67A 1DPFA 3C3EA 1XHLA 1EPUA 2IV3A 2ZIXB 4HWRA 3UWSA 1Y63A 3MCUA 4AY3A 4BX3A 4ZTBA 4HN2A 1XRPA 1U0JA 2E18A 3LW7A 1B6SA 5A4FS 4RCZA 4C78A 5FHQA 4BP3A 3ZQUA 1Z4QA 5SYMA 2YXEA 4HNRA 1FRZA 4RQBA 2RJ3A 1XRLA 4GECA 5MHTA 3THSA 3FCOA 1OAAA 2V9PA 1ULAA 4D99A 3PFCA 2GI4A 4Z0NA 2XGJA 5ULLA 3ON5A 2VOEA 5BOSB 3TKAA 1C7RA 2F00A 1K8RA 3M6XA 4OFBA 1NVXQ 5FI3A 4D9CA 2YY6A 3IQWA 4H4CA 3O1LA 1ZI9A 3L79A 4URUR 1W73A 1G20E 3BSSA 4WADA 4AZTA 3ZDXB 1K6XA 3ZWVA 2G0TA 3IURA 1KR2A 1P29A 2QJTA 2LBPA 3UUWA 5CA0F 1Y1LA 4EFMA 4CLEA 1JI0A 3ZE0B 3G8CA 1B4DA 3F3MA 3R5SA 1A5BB 5JYEA 2FR8A 2VJDA 1YA8A 3M49A 2AF3C 3VKUA 3AFGA 4OA8A 1JPVA 1YZ3A 2ZUWA 3PNLA 1LPBB 3I9V6 2ZYVX 1OIXA 3R7WA 1GQ2A 4RV5A 4AKGA 3KV1A 5JUWA 4IILA 4S1WA 4OHVA 5F76A 2Y1KA 2J8ZA 5I7SA 3HNOA 1FPQA 3NOQA 3FI9A 4YQFA 5AI0A 3G85A 3PB3A 3JQAB 3WYAA 4BO6A 4O2AF 1TTTA 1UIRA 4PHFA 1DMRA 1Y48E 3QGMA 4V0NA 1VOTA 5DNVA 2Q49A 5KPDA 5EZSA 1QYDA 5CDFA 2ZG6A 3TIFA 2BVNA 2CLSA 2VEOA 5B7NA 1RXVA 3Q7TA 3X43A 2A9KA 1P3DA 1J09A 1TA0A 1U7UA 4TN1A 3M6VA 5EVJA 3V7FA 4BWVA 4NNOA 2FW7A 4R1UA 2ZJBA 4N3GA 2A1IA 2X8LA 4UDOA 4DCUA 1AK1A 3EXFB 1KKUA 1MV5A 5K0JA 5ILOA 3IMGA 2JVIA 1BO6A 3O9VA 1XVLA 4C3VA 3BERA 4N41A 4RK7A 4RPJA 3MFYA 1B0AA 1HDYA 1TD9A 3H4IA 4M60A 3T3DA 3FFTA 4GI3A 4FM9A 2YCBA 4O3MA 3Q3CA 4RVSA 2J6BA 3GBSA 2HA4A 2AB0A 1T3SA 4LYDA 1G3MA 2M2IA 3ITEA 3OEYA 2G8NA 3OF2A 5A5GA 3HDVA 1E61A 2WPDD 4Z9YA 1VPWA 4IDCA 4ZYZA 5TPWB 2R4TA 4IJMA 1XRQA 4GOND 4DXAA 1L7RA 1WL8A 2AN1A 3GJ0A 1W7AA 3OKCA 2Y68A 2SKEA 5HJEA 4FX2A 1GDHA 5FUXA 4Y2XA 3HJCA 4TUYF 2FWMX 3CLVA 5DLYA 4OQDA 3R8CA 2D7JA 3RB8A 1SNYA 1TEZA 1FVFA 1R8QA 5HUQA 1YE8A 1XTUA 1P81A 3B1XA 3G2HA 1UPTA 1DLJA 3Q1KA 4G89A 4GP7A 2YV3A 2JJMA 5AKYA 4CKEB 3UBMA 2P3LA 3BF8A 3IHKA 3V42A 5FRDA 4CHGA 1KPIA 2NU6B 3KKOA 4QOJA 3P27A 5IT9A 3HB7A 1LPMA 5K6TA 4LDJA 3TXAA 1G20B 2Q3FA 1EVZA 2PANA 1N9GB 1EK2A 3EEIA 3HKBB 4O4IF 1L3IA 1WXFA 3G7SA 1A1SA 4BGIA 5J3JA 1YQWA 1YD7A 4PZ9A 5AJHA 3FCYA 5DTEA 3WGZA 5TVGA 1KYXA 1KTIA 4G4SP 2OA0A 5EQFA 3IV7A 3N8NA 4ZCLA 3KX2A 3EN0A 3CN9A 3ROGA 2RKOA 3HADA 3W2TA 2J31A 4Q4CA 1EGQA 3HYRA 3ZBPA 2FHPA 2QRVB 1NFRA 1UKYA 2VP0A 4Y2HA 2VKQA 3FJYA 3O3NB 4FILA 4BO0A 5F7OA 1H0HA 4NHEA 1JFFA 2XYPA 4IUBS 2D2IA 1ZEJA 2C0PA 3ABSB 2YMMA 4UTXA 4WI1A 3W8NA 3MJVA 1LDBA 1ZUNB 3SSAA 1JHZA 1W44A 1QE3A 3WK8A 4AC9A 5KNBD 1E63A 1P5RA 1T5OA 3W5HA 1E9EA 3WI7A 2V1UA 1QMPA 3CB2A 3OQVA 1PD0A 4RLHA 5IM5A 3UKDA 1ESMA 3ZWKA 2QV0A 2ZRHA 4ZAVA 3ZDEA 3VO2A 1BGVA 3KQQA 5B1DA 3AETA 1BDMA 5FBLB 1S9HA 5AI6A 2KLBA 4ZRDA 2EJVA 4G26A 4HUQA 2FOIA 2AJCA 4X66B 2Q5OA 5ES4B 3ZY5A 2VPTA 3A7EA 1CLUA 5JECA 3OTGA 2IEIA 4NBTA 2UVDA 1QHYA 1SVSA 3N75A 2VYQA 2OLKA 3OKPA 4Z54A 3MXOA 3V4FA 1Q92A 5DBOA 3CKLA 5A04A 1S0UA 2JJ2A 2XT0A 2Z5GA 3ODGA 3TQFA 1TQ2A 1ZD5A 2B9EA 5E9JA 3TJZA 2YWRA 4O29A 5BR4A 3CVVA 4J0KA 4DLAA 2ZLBA 5B7GA 4EGCB 1WPXA 5LU9A 5KQRA 3KQHA 3E84A 2JAWA 2UV8A 3L1JA 2QW8A 2ORED 1QIKA 1RXCA 1LFAA 1V71A 2BUBA 4PZCA 2NZVG 4N54A 4TKZA 3S7ZA 5TSDA 3TTUA 3TOVA 1YK0A 3BWCA 4MEAA 4WXPA 3VDMA 1V4NA 1G8JA 1TVEA 1LVHA 5JTUA 1VGRA 3AUTA 1R12A 3CQ9A 4RSHA 1XQ9A 5DYNA 4DDWA 5IX8A 4X1IB 4CFZA 4CG3A 2MCFA 2ZCJA 2IZZA 3DL2A 2ONCA 1Q7GA 4GWLA 1C3LA 3ZLVA 4TRNA 3CLTD 4BGEA 3O1IC 1T3ZA 1KP2A 3PJDA 2BZ1A 2FH5B 1Q0UA 3H11A 3T5GA 3ICEA 2HUPA 1W1UA 3KVOA 4K86A 4QAJA 3ZWWA 1HC7A 1M66A 3Q5EA 4XSGA 5KYVA 3WGUA 1XP8A 3BZUA 1QKKA 3FDIA 4HPJB 5EC8A 1TADA 3O7MA 4R2XA 1AUQA 2R8PA 4LDQA 5G4LA 2PUFA 3PD0A 5GIPE 3PUVA 1MXFA 4G2TA 3TLJA 3LYHA 4MGEA 1HLDA 2Z08A 3U37A 2ZUCA 3KDAA 4CMCA 1WHTA 1ZAYA 1HI9A 2WVJA 2UYQA 4DLKA 4C4TA 4HXGA 2ICAA 4BYMA 3PIRA 1T4CA 4MQLA 3WQRA 2O8BB 4X3PA 4K5QA 5TQ0A 3EC7A 2VP3A 1YZLA 4GOKA 4NE7A 4MUIA 3EAQA 5JSQA 1T8UA 1SHTX 1V6SA 5E2AA 4PO1A 4OH7A 4EIWA 1M6HA 4RVDA 3Q0EA 5CIWA 5CAEB 1RWMA 3TR5A 4ATNA 1FW6A 3G5UA 4PLZA 1AC5A 2F3SA 3ACDA 4Q4HB 3K3PA 1QOZA 4PPGA 3GJ3A 4BO5A 4RF2A 4MVXA 3G79A 3EK2A 1PYGA 4RLFA 1AU9A 5SY9A 1QZTA 1OUMA 3LOQA 3GOQA 3RRXA 3SC6A 4BB6A 2FZLA 4MWTA 1N5IA 1W88B 2PO7A 3DSRA 3LF1A 3WYEA 5KTTA 1Y4AE 2FEAA 2QI9F 5DXAA 4J29A 2R8XA 2EJCA 4L1KA 2J0VA 2F1JA 4NNJA 3Q0TA 3D3JA 1RQPA 4CR8A 3E03A 1L4GA 5BR8B 3WNDA 1TEHA 1CQJA 5G0TA 3WK9A 3TQRA 2N1BA 5GJWC 1SXIA 3DPSA 2GNPA 4ESOA 1UAAA 1U0TA 1L5HA 2AIRA 1EJBA 2A84A 4EARA 3IDAA 3ZN2A 5GY7A 2JARA 2BSAA 1KI1A 5CFNA 1C5KA 4B7UA 2E48A 4W5RA 3AK4A 3ZYZA 5L53A 1SVOA 4D6YA 3EPHA 1P19A 5GONB 2RG1A 2D2EA 1YJQA 2CXOA 2OQRA 5KREA 4MH0R 4DSNA 3VHXA 1UQTA 4Z86A 3KBBA 4IV5A 3C6YA 1TM4E 2VT6A 5FPQA 5IYZB 2WPNA 4QUGA 4F3YA 4L8LA 1HLFA 4QL3A 4Y6LA 3IAFA 5D6NA 5B1HA 2HMUA 4I6JA 2YHUA 4L4UA 5BXQC 2E7ZA 1UK7A 1IG3A 3IIMA 3DXFA 5J5AA 2FP4B 3C48A 1XCJA 4IDHA 5FR1A 4E2ZA 3R3WA 4NIMA 2J3HA 3NDPA 4L0CA 4DLPA 4ZI3A 2Z95A 5LQMA 3F1KA 1E3WB 1TUEA 3CBGA 4C3UA 2VC2B 1ACLA 1IPHA 1DJNA 3S8YA 4DHWA 1JLLB 4HAIA 1OTYA 1Y6QA 2G76A 3KR1A 4CI9A 4FOPA 1F60A 1OSNA 4XVHA 4FCTA 2A88A 3GVPA 3RYIA 5C5EA 2CJYA 1NKTA 1ZW1A 1H3FA 1DKPA 3C3MA 3K9GA 2EFCB 5UKDA 3WJ2A 4EHAA 2HQRA 1LBSA 4DB4A 3NHBA 3KOWA 3STTA 3ADKA 2D7CA 3Q11A 2ZTHA 4GE0A 1SMKA 3QU2A 1Q83A 3FPLA 2IUTA 2CSUA 2PLNA 4MXDA 5CVCA 3BWEA 1ZSNA 4UASA 4D4KA 1DMSA 2GM3A 4YJ2A 3LXUX 5BSKA 2F64A 1BKDR 2F3QA 1ADCA 4ZYWA 5LLTA 1PS8A 2I8AA 2VNJA 3DKVA 3UK2A 3HU1A 1T4MA 2RAFA 3DYBA 1ODFA 2VAWA 3UMFA 5SICE 4F7WA 2JKVA 1IN5A 1H1LA 1F17A 1EBUA 3BMCA 4RJJA 2IBMA 1C4WA 4F6LA 1ETHA 3TW4A 1LZKA 1QVVA 1C4OA 2HRBA 4QJIA 4D57A 4L4ZA 2JD1A 4LS3A 3GL9A 3FWNA 2XDWA 4OSPA 4GX1A 2ZRQA 3IAM1 4C0HA 3G8YA 2GETA 1NRIA 3ER6A 3OMWA 3LQYA 2XXAA 2O2ZA 4JBNA 2C77A 4U2FA 2A78A 4GMGA 4Z4EA 1I0ZA 1WJGA 1QRAA 1G7SA 1AZWA 3K73O 1E2QA 3IKMB 4JJKA 4UBLA 3ZCTA 1AS0A 2HT1A 1YHNA 2AKAB 3SSMA 1ZIYA 1D1SA 2XV1A 4YALA 4JI7B 2PBZA 1H6BA 5EVCA 1J4AA 1G5QA 1H2ZA 1YQUA 3B1VA 3NC4A 4PR0A 4WESB 3V4VB 2IU6A 3X0DA 4F92B 1V2GA 3C5CA 5KEIA 1X1AA 1U3CA 4N0MA 2H11A 2EVWX 1G63A 4QVKA 4TV9F 2YFQA 2PAFA 2ZJ4A 5HUJA 1Y9DA 4L4XA 2WWYA 1KL7A 2FMHA 3TQOA 3M0EA 1LLCA 3NM6B 1X13A 2BGMA 1KMQA 4FYIA 4PLVA 4WKNA 1ESZA 4YQEA 2IYNA 3R0ZA 4US0R 5JXHA 2GTPA 2ZIFA 3A9TA 4RABA 4Z0HO 2AI2A 4R69A 1VHJA 3PNYA 3I8XA 3EVEA 1M3SA 2E4VA 4P0QB 3ZWDA 5K8LA 3C7KA 1GGNA 3EE6A 1EM8A 4N7RA 3O26A 3G89A 3NMUF 4J43A 1N6NA 4LRWA 4MGZR 5IP5A 1ZMTA 2YWXA 2Z6UA 4YV2A 5THXA 2HHLA 5AT1A 3EY9A 3L1KA 5CPFA 1DDOA 1X6VA 2B7LA 3C3CA 3ESBA 3JVEA 4Q34A 4XIGS 4S2UA 4FGZA 5JS1A 4B3JA 4CGYA 3DAGA 4KXNA 3X1WA 3I6MA 1I10A 5K4AA 4IOKA 4J1SA 3MCZA 4GLBA 3WZ2A 1BE0A 2P6RA 3HBAA 4JSRA 4W8OA 1PK8A 1NXVA 1PJ2A 3VDRA 2ROQA 1DBQA 2W2TA 4IHJA 3NHYA 1XT6A 2EZ9A 2JFFA 2XY4A 4J1TA 2HDNB 4ZCIA 4W7IA 3T15A 1ISFA 5FL3A 3QKSB 1G9SA 3L0YA 3M6UA 4PYNA 3WMGA 3JAWA 3OQOA 3JQ7A 3MRSA 1W47A 1HTTA 2Y1XA 3L1IA 2BH2A 4JQZA 1NBMD 4JA2A 3Q6NA 3GEEA 3GFBA 1XGKA 3QP9A 1MAUA 4C6RA 1XLWA 3KPVA 5DLEA 2BGNA 2WM9B 4DG8A 1AX9A 1X94A 4KIFA 4JL8A 1ISPA 1NUQA 1G19A 2OHGA 3AHJA 4IHAA 3OU2A 3A32A 1JTEA 2OV8A 4AROA 2FWBA 3I53A 4BNXA 4Q37A 5K6AC 1M2FA 4IWNA 4QODA 3UG7A 2O5CA 3Q9SA 4R83A 3C6MA 3T0IA 1CUEA 3MTGA 2ZKLA 3ZWXA 4UM8B 3BMOB 2C8LA 1N0UA 2EQBA 3H19A 2BGTA 3LI2A 3PKZA 1V7ZA 1RM4A 1YVUA 3QE4A 5JXJA 3A37A 1I3CA 2WR8A 2YVKA 3H97A 1JA1A 3RYTC 4X20B 1A4RA 1ZK2A 4DLRA 3AP3A 1SCDA 3MQFA 3IXLA 4YP0A 3OAAA 3SQWA 1Z0UA 3MGKA 4NDZA 2EX0A 4Q9JA 4PANA 2WSLA 2V7PA 2ZYAA 2HO4A 3CNBA 2P5TB 4J76A 4MW4A 4X1YA 1KYWA 3TLGB 2AE1A 4C0BA 1EE1A 3OPNA 2SBTA 5A02A 2FN7A 3AERA 1ZGJA 3I39X 4EA6A 4POOA 3CUWA 3NO4A 5IF3A 2HA7A 2BP7A 3GLIE 1OLUB 2VH2A 2FKAA 3SHWA 3WDSA 2C78A 2GH1A 3IDQA 3MG9A 1SBCA 2KW5A 1SUCA 3AEKA 4ZREA 1OJ7A 1R16A 2ACVA 4UAUA 2NT3A 1JPJA 2ZWMA 3AG5A 3P0JA 4NEGA 5DDIP 4DIDA 2DQSA 3OIVA 5K3SA 1SA0A 4HYTA 4F1KA 2D5LA 2FF5A 5IF9A 4LUCA 4RA6A 1I3LA 1EIZA 2BGWA 1H9AA 3T54A 1DUIA 2QJOA 1UXIA 4O2RA 2OXTA 2O0MA 1BCRA 2CLKB 4K46A 2N1MA 3AINA 4G5RA 4NBNA 4UVGA 4BO4A 3RTDA 3M9WA 4ID3A 1TUBB 2XW6A 2HREA 4BVGA 2P69A 3MSXA 3BXZA 4DCMA 2JRLA 3NEYA 2ECOA 2ATEA 1ORDA 3PC3A 3HWWA 4OBXA 4CQLA 4DQLA 5KNBA 1XRRA 2V59A 5CURA 4KYVA 3TLCA 4RVOA 3RIMA 4EUKA 4ZMSA 4RC9A 3ROZA 4JR1A 3SM9A 3OBBA 3E7XA 3UH0A 2H1LA 3H9GA 1T0IA 4LWOA 3ZV4A 1WUTA 2EKLA 1SQ6A 3A6FA 5AJZA 5IRCD 1MHPA 3QMVA 1GTSA 3FRJA 2Q4DA 1IUKA 3OPQA 1QYWA 4WOCA 5FBRB 1YI8A 1LDYA 1Z68A 1KI6B 2C5LA 5ALRA 3FUXA 4BQPA 1UPAA 2FTKE 1Q3HA 2Z58A 1E18A 1QH8A 2PMEA 1Z83A 2B69A 2G07A 3BE4A 3IVAA 2ZITA 3W4IA 4BCCA 5FH9A 2H1SA 4LSZA 4IVRA 4RKWA 5D5QA 2Y1DA 4UAGA 1YIDA 5C81A 2J0UB 3INNA 3RSSA 1CQJB 4OHRA 4M3NA 3OFNA 2POCA 3W7VA 4JJIA 1Z2AA 3NTVA 4ZVVA 3OPVA 4NS4A 3ZHSA 8AT1A 4DE5A 4W5WA 4OX9B 3ZQ4A 4EI7A 5TNXA 4P93A 4LI0A 3DFIA 3W1WA 3CTPA 4Y1RA 4G9EA 3DL7A 5JZ9A 2WTXA 4W9NA 2MYNA 2DKFA 3H3FA 5AVKA 1C1XB 1XZDA 1Z26A 3W2GA 1YB6A 4GBED 1ORTA 3GVXA 5FDFA 4BMXA 4B71A 3U4QA 4AN4A 4K1LA 4XIIA 4GZ6A 121PA 3OE7D 1ZPDA 4DMLA 5LZ9A 3OSZA 4XI9A 3Q8LA 1R15A 2IF2A 3CSUA 4PRZA 4YP5A 4EHNA 1CY2A 1U4NA 3PHBE 1CUBA 3RG2A 3VPGA 1ZJ5A 2NUPB 3E4DA 4YRGA 4QLOA 2C0QA 1M9NA 1NYQA 3AI3A 3KJZA 3GOHA 2P4HX 1RZ3A 3WWOA 3OQ6A 4BFUA 3M70A 4RVHA 4M8NE 3PUHA 1GXSB 1W0JD 1T8YA 3GLUA 4MGYR 5H02A 3HKEA 3ZLUA 4C08A 2HQ1A 5MFZA 2ODEA 2QBYB 4W1PA 1JHQA 4MV8A 4FEAA 1KI8A 2PWBA 4HQNA 1G8KA 3DAFA 3QQ5A 3B70A 4E4RA 1X3LA 2BBSA 1ENYA 5JO9A 2P9YA 1NUTA 3UWDA 5C8ZA 4UNSA 4RLSA 2CDCA 4J7XA 3NDRA 5E6SB 2Q5JA 2JAQA 3MUEA 4N7MA 1BA3A 3FOEC 1RZRA 4UTOA 1QF6A 3M4NA 4JCOA 1Y98A 1MO5A 4RE6A 4DUYB 5AJWA 3HU2A 3DULA 1SJ9A 4Y6RA 3VHQA 3KYBA 1PG5A 1UC4B 1U6KA 3DDZX 4XWKA 2ZJFA 3SHFA 4FU0A 5CYPA 3GT7A 5KJ1A 1ORVA 1PT9A 2BDTA 4IQ0A 3PPYA 1FSGA 3G8BA 5A2GA 3DLTA 3P8ZA 2FGJA 5K03A 2LE0A 1W581 5EZYB 1ZVQA 5B3AA 3DDOA 3S2FA 2EFHB 4YJHA 3WWZA 4CYMA 1RWPA 2DEUA 2FSIA 3SNHA 5LC1A 4QD3A 2D5CA 4P5EA 3WL7A 1WV0A 4YUYA 4ZPJA 3RS2A 3ZYCA 1AO0A 3MPUA 3LTEA 2WQ6A 2AN4A 1TJYA 4Y1RB 4MMZB 5EKUA 3V34A 4S1PA 5KSWB 2E55A 3ESDA 1U98A 2JGDA 3HDQA 1IH8A 2ZRMA 3RUFA 4B74A 2ILTA 5DXJA 2CNNA 1B1AA 3RIHA 4YRKA 3U6KA 4K7JA 4DTCA 2P6PA 2HPZA 1ONBA 1ZK0A 1YHZA 3GFFA 1IVSA 3LF2A 5K0BA 2DQYA 3ZBTA 3IJEB 4QUBA 4PFKA 1UDWA 4DIOA 3Q7EA 2C97A 2GPSA 3EHEA 1SBHA 2PNFA 4YJ3F 3ZWBA 4N5LA 5CEEA 1HR0B 3IPRA 2PXXA 1KVUA 2ZUTA 4W8HA 1Y1SA 6REQB 2ISCA 1WCV1 4QHSA 1RKUA 3REFA 2BHRA 1N7HA 2FUEA 1MZVA 3QUCA 2ZBEA 1ZRMA 1KEEA 1CYDA 4URXR 1ZLYA 3WHKA 3U19A 2WJIA 3H9UA 1GG2A 1VXOA 1IQPA 1F0KA 1GPUA 3BF7A 4GKVA 5EHQA 2PQ6A 2CY0A 2JW5A 3AIOA 5TMPA 4QFCA 3DTNA 3VR4A 1I4LD 2JIOA 3VZCA 5HRAA 3HR4A 1JHMA 1FXWA 2Z6AA 3BTVA 1TYZA 1ZNXA 2PH1A 3GNTA 2D13A 4CETA 4QDXA 1F3LA 2DQ4A 3BIJA 3CUKA 3HA2A 3LCUA 5KTOA 4BLPA 2WAOA 2BEWA 2PGJA 3DH0A 3TSAA 2QDXA 1QOPB 2IOQA 3L5KA 4M7WA 4AXBA 3JRWA 3R7NA 4G1CA 3WDKA 4DV0B 5J59A 4CEHA 3X1MA 5LP6F 4CCYA 4G5SA 2RCNA 3MUNA 4R1TA 5CK4A 4U6QA 4ZVUA 4L9AA 3BZBA 5CB4A 2OQVA 5F52A 3SFZA 1NZJA 4TVKA 4D8XA 3NALA 2O1SA 3F7OA 4MICA 4O2AA 4QBHA 4NQZA 3S81A 1JDVA 2O8FB 1XEFA 3UWPA 4QJ4A 2V7EA 5BWBA 4BRZA 1O95D 1WB4A 4P34A 1YNSA 1MX9A 4FFWA 1MIHA 1N1GA 2I3AA 1HKUA 3EARA 5TX7A 2XJ9A 4N48A 2EWWA 4M0DA 4F8YA 4R05A 1P18A 1N8SA 5CA0A 3HCRA 1YU9A 2J5XA 4F4JA 2B36A 4TSKA 3JTEA 4OV6B 1RI1A 4N3CA 3KCQA 3KIPA 4DJFC 1DAFA 3K20A 3OCUA 4AI6A 4B17A 4FGWA 5CK5A 4RFVA 2ECPA 1GR1A 3TQQA 2RH9B 4G0PA 3ADBA 1JJFA 5TQ2B 4AYWA 3OM9A 3B89A 3PXAA 2ZT7A 1SVKA 3GEBA 2CFIA 5I9TA 3AEUB 1P45A 4D4MA 1UANA 1TO1E 1P2GA 3MUFA 1T9GS 4X20A 4YXWA 1CRPA 2JIQA 2PZMA 1W2HA 4TMFA 5HKKA 2WP8J 3R9XA 2X3FA 4TUYB 4YDSA 4TT8A 4GYWA 1HNWB 3C8HA 5AUPB 5ARCA 4CLDA 1QYXA 3SAJA 2DYKA 3ONEA 4KWEA 5D8DA 1B0PA 2ZJ8A 3P7MA 1O2DA 4U7HA 2EG9A 4XYBA 4F6CA 1GZUA 1SUWA 3B8EA 1JAXA 1YS7A 2GYWA 2UDPA 2FPSA 3O91A 1BCSB 5KB3A 1B23P 1INLA 2FHSA 4L8FA 3ZR4B 4INAA 4DS3A 1JJAA 2VL7A 3PCRB 3AKEA 1J1UA 2Q2NA 5IAAA 3B7GA 3ZHTA 2JVJA 2DUNA 2PYDA 1V37A 3BVPA 3CLTC 1ZGAA 2VQFB 1A76A 2FPXA 2PZAA 1RMYA 3NDJA 4GQIA 4K81B 3LXRA 2GHIA 4JROA 2QLTA 5BORA 3A1VA 2QN8A 4OBWA 1IG0A 4U9UA 4TKVB 3I72A 3Q6IA 3JYQA 2AC2A 2QUAA 2OHIA 4QNMA 3KZ1E 3LBYA 1V5WA 4F60A 5DK4A 9LDBA 3D54D 2C9YA 1V3VA 2J5KA 4MW1A 2ORIA 2E37A 3BXPA 1NBOA 4LX8A 1OWNA 4TN5A 1HKHA 3A4VA 2P7HA 4G0VA 2WIJA 3S1AB 1OB5A 3WWCA 4G5HA 2WD7B 1UPFA 4Q9HA 1YVPA 1JLRA 3QSYA 2DR2A 1JIIA 4YR7A 4EUHA 2IUEA 5ANRB 4CCAA 4C1BA 2JI4A 3CE6A 3TW6A 1GG5A 2OCIA 3IMEA 4RWZA 4PGMA 5F77A 3VPSA 5BNWA 1EHYA 5AW8A 1FDIA 4OK3A 5LMUB 1AQJA 2DX7A 3ND8A 4A5SA 5K8IA 3PDIB 4ZQIA 3A1DA 5AVJA 3H4MA 4JI1B 1DXOA 2YW2A 3GELA 3THOA 4BS9A 4UUPA 1VP3A 4KYTA 3T9EA 5EJ6A 3LG2A 3N6XA 4IEIA 5IUKC 2IEDA 2ES4A 2XNHA 4RZHA 2O0LA 1A8PA 2E4AA 4JB3A 5CX1B 1KC1A 3QBDA 4R8VA 5KJFA 1FSPA 4DREA 1YMUA 2BFBA 3DDWA 3DE5X 3H5OA 3KJXA 4F4CA 1SOMA 2CB9A 1SU4A 3INYA 1TZJA 1LK0A 3BJEA 3HP7A 1HF3A 2RFLA 5BNTA 4UU1A 2BKVA 1LSOA 1BA2A 2HU7A 2IYRA 1WZ2A 2WIGA 3V8RA 2IYSA 4G5FA 4Z4GA 4EMBA 3HA7A 4JVLA 4HSEA 2VK2A 3PHLA 4BO3A 3KP1A 1LSUA 2V6GA 5DCLA 1QHIA 1DAMA 1M1YE 5EXDA 1GRNA 1E79A 1E3EA 221PA 1NI5A 2Y1LA 5I47A 3AU8A 1D7AA 1ZVKA 2I2CA 2P7IA 2CZQA 2AUNA 1N5KA 3V4PB 4M89A 3VUEA 1RQGA 3NWBA 1N25A 2H4HA 1ZDMA 2FPRA 2VDNB 4MLPA 2F1KA 3KYJB 5AW9A 3TKLA 1ENPA 1YZGA 3SJZA 2ZIUB 3EMVA 3Q40A 1QCZA 1RPNA 2CYCA 4D3ZA 3ONFA 4TS1A 5K6AA 1V1MA 2HEIA 4UBOA 4R1OA 3I1FA 3RVBA 3UMRA 1RRKA 2JHAA 1E92A 4OFZA 1ML4A 3O8OB 2ZZMA 5EIAA 3COSA 5EWMB 2OORA 1IBKB 1RD4A 1YUMA 2A1TR 4G5YA 5G41A 4D41A 3BREA 4OQFA 2O2CA 5L4NA 3DFMA 1WCIA 2QY6A 2I6FA 3P2IA 2A5YB 1VDMA 3FDZB 2FA9A 3RYIB 2NZJA 4AKTA 2INGX 3AVVA 1MGOA 4RMJA 1RC1A 2NNWB 3H5TA 4GPTA 4UHFA 3HDYA 5KKNB 1ZMRA 4BO1A 4J1TC 3DKIA 2FOLA 3OLZA 2PEZA 1J97A 4V24A 4U7WA 4DJJA 2K2QB 4ZDKA 1VLZA 4H3KB 4WK2B 5BWCA 1RPTA 3NYQA 3G2MA 1RQNA 4QGFA 2RGWA 4UEQA 1DG9A 2FSGA 4E11A 1FFSA 3AKYA 4O4JA 3FF4A 4JCCA 4IV8A 3WGKA 4COKA 4LQCA 4TWJA 5BRJA 1NN3A 3RVLA 1AQYA 4M88A 4Q7KA 2GK7A 1AKUA 2FB9A 3CVXA 3DEYX 2A6PA 1IZ0A 3UXEA 2VHVA 4DC1A 4QUHA 1Y6JA 5IABA 1NOIA 3MCVA 1M54A 4ZGBA 1QUEA 5C46F 1KZ1A 2P5SA 4MRMB 4TPKA 3SBXA 2WQ7A 4B3DA 1WULS 5MN5A 3SDSA 2A58A 2R8EA 3UUGA 3C7TA 1SAYA 4ZKDA 3EJ6A 4RPIA 5CPBA 4DBLE 1XHEA 2GO1A 2XF2A 4U7GA 1X7WA 4CIBA 1PJ4A 5U1PA 4BV2A 2ATCA 1E1CB 3NQ41 4ALNA 4L0MA 4NH4A 4LRXA 4PINA 4ZD6A 3CEPB 4BVEA 4BVFA 3UT5A 3AVTA 3JZFA 3DZJA 4X1KB 1Z5WA 3GT4A 1XCGB 2AX4A 1HOTA 2ZIAA 1QHXA 4LC1A 2P78A 3U80A 1FU8A 3AJDA 1X80B 1H42A 5FORA 1XZIA 2Z3ZA 3QY0A 4HXEB 2WUGA 3VPDA 2ZYWX 3RFUA 2PL9A 1GPLA 1DT5A 1O94D 4YQYA 4E33A 1BDBA 3ZV6A 3V8MA 2ZJZA 3BFXA 3ROEA 4MIOA 5C9ZA 2FJUA 3PYLA 4A03A 4IVNA 3SE7A 4ZJPA 3D8TA 2D2FA 3I1IA 3SM3A 5H9VA 4RK6A 4KNVA 2I65A 4EABA 1DCFA 1MFPA 2XZTA 2ZRPA 3GRVA 1JP7A 1HT2E 4IHJB 1THMA 3GA7A 2MSEB 1LKZA 3A04A 4XJSA 2VYFA 4ESEA 2XLCA 4M9SA 2G08A 4PLHA 4QLBA 3BWBA 4YK7A 3DMFA 3IOCA 5BNZA 1D2NA 1PJQA 3UXHA 1QRSA 1MNQA 2XUOA 3L92A 4QX6A 2GXSA 4YV7A 3FOFC 3I64A 2GBLA 2WM2A 1GV1A 4DJDC 2VJKA 3D6NB 1M2OA 2UZ3A 2M6LA 1FRVA 4GU5A 4YS6A 2GILA 1Y8QA 2P6NA 1V8BA 2VWGA 4IY1A 4KYIB 1L8OA 1M6YA 2QD2A 2WWXA 3U56A 2YMLA 3K1YA 3UK1A 1W5AA 3Q7QA 1LDMA 2BCJQ 4XFDA 2BIFA 3B6KA 5KTRA 4R7ZA 1P61B 1WPRA 2VDWB 2WV9A 5ALEA 3O4FA 3E8XA 1J99A 3QF4B 3SS8A 1QYRA 3NGMA 3JRNA 2Y0BA 4X3CA 5KZMB 1A9XB 3IX7A 4LDRA 2AZXA 3VHLB 2EF0A 3OX1A 1MW9X 4RFSB 5CDTA 1ILEA 5LMNB 4XGKA 1QIJA 2H9IA 1XLVA 2WAMA 3GRFA 3H17A 5KHLB 1NW7A 1TIKA 1ZH2A 1USUA 5ICSA 2JI6A 3OQBA 2NTEA 2PSSA 3HGTA 2QRPA 1YGYA 4M8KA 3QA3E 1S3GA 2J9XB 1E32A 4MR8B 1I1HA 1F6DA 4KI7A 3RR2A 5LXTB 4Z53A 2MYUA 5DH9A 4YRQA 2NADA 1HFEL 3Q0IA 1PW7A 2CHQA 5FPKA 2OZLB 3B6ZA 5FOSA 3P32A 4PAGA 2XWQA 3WY9A 1D1PA 4P7BA 2Y1FA 2RGDA 4QA9A 2FMFA 2WY2D 1VJ1A 4HQFA 5BV2P 1UQRA 2VN8A 3LD9A 1GO2A 3OC0A 3IP9A 5HTKA 2XBMA 1XZLA 4WCFB 1XCOA 5ERYA 2RC5A 2MSCB 1J70A 4C04A 3GFSA 3IP6A 4RD1A 4S05A 1I5RA 1VGQA 2VPZA 4EPRA 2V5UA 2WTMA 4R8KA 3R7BA 1N8KA 4YP9A 3VMFA 1PKEA 3WLKX 4OKSA 1SK9A 4EUEA 5HXAA 1MMFB 1IOVA 2TECE 5D3KA 3TRDA 4EFNA 4UTZA 3TRKA 2ZAGA 3JQ6A 4A92A 4EY8A 2ZREA 4A73A 2BKUA 1X19A 4Q03A 2R5FA 2PYZA 3U16A 1EUYA 1S8NA 2QT1A 2W0SA 3L7IA 2Q9BA 5ABPA 4RY2A 2D1TA 3ILSA 3V8EA 3AB7A 4GT1A 4IXTA 4DRXB 4KPUA 4LXHA 3IE0A 4C7BA 4YO8A 1UPXA 4MYUA 1Q44A 2AHRA 2AYZA 2H18A 4AO6A 4Q3LA 4MUBA 2OQIA 1G20A 2I91A 4HNAB 1CKEA 2DPXA 4F4DA 5A4AA 4C0JA 3HR8A 2P9GA 4Q7QA 4ZU6X 4BU0A 3COJA 4HJXA 2BJHA 3N74A 5JJLA 2FLVA 1AB5A 1YBMA 1WCIB 2J3LA 4I50B 4UUBA 2B1GA 2D0OB 3FJOA 1XTPA 1CY7A 1PSDA 1B0ZA 3KAQA 1T0HB 4B2LA 3PXEA 3WMXA 4AF8A 4KAFA 2YTZA 2BEWB 1DRJA 2VUIB 4AX4A 3MGAA 3IE1A 4RBNA 3MLEA 4ALJA 4UHJA 1ENOA 1KJIA 2H3HA 1UBFA 9ATCA 2W4QA 1TC1A 1K88A 3SSNA 4MV4A 4G24A 1O0BA 1N2JA 2CJWB 4CI0B 4B2IA 3ZG6A 4BMDA 2NACA 1X42A 3NEAA 2I7CA 4WJZA 3ONVA 4QUIA 1VRVA 4UZSA 1I7QB 4DR1B 1EK6A 1QLHA 2HMTA 4JAVC 3OY2A 3RAPR 1XHFA 2PVCA 3C5VA 5K8CA 2Q3BA 3OFKA 3VBCA 1U94A 5LZ8A 2FUCA 2ZIEA 2GLUA 4LGMA 4OXKA 3CWCA 5DT9A 1UT5A 1QIMA 2P9HA 2VPXA 2OCDA 2BHSA 2XYVA 1MLDA 3ECAA 2WABA 4JC4A 5IAGA 4YQZA 3T0GA 4I4CA 2FDCA 1QHEA 3TMAA 4DYHA 2VS1A 1NW5A 1J8MF 2WSSA 3C14C 5ELXA 2PA0A 2GPAA 4ZCRA 1Q1AA 2F9MA