2XDYA

Crystal structure of the n. crassa qde-2 ago mid domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
127
Chain Sequence
KIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
publication title Crystal Structure and Ligand Binding of the Mid Domain of a Eukaryotic Argonaute Protein.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
total genus 41
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xdyA00
4WXMA 5FWXA 2JK1A 3E3MA 1WETA 5HQJA 1QO0D 3JPWA 3HXMA 1BVHA 4LRQA 2FN9A 1TJYA 1KMIY 3F6PA 4IILA 2PAFA 2LUOA 4JAVC 4LDZA 4RS3A 2PL9A 4S04A 1JYEA 4O1IA 2TMYA 3HS3A 2I6FA 1J56A 1VPWA 1APBA 5IBQA 4D6YA 1YIOA 3LUHA 2IPMA 1E2BA 5KC8A 3KLNA 1BA2A 1QMPA 4NQRA 3OLWA 3QLVC 4WT7A 1NXWA 1E6KA 1NY5A 1U04A 3NNNA 1MB0A 2H3HA 3HEBA 1GLGA 1M5UA 1MIHA 3EQ2A 1JLKA 3MA0A 1MB3A 4F12A 4Q6WA 2IPAB 3L6UA 3SM9A 2PUGA 4OLAA 1DJMA 5I4CA 3HVRA 4F3TA 4PEVA 1DRJA 2O20A 5D2CA 2IOYA 4N41A 3HZHA 3OMXA 4Z9BA 2HSGA 3H5LA 3HUTA 3G1WA 2FTKE 3O1HB 4YV7A 1A2OA 3SQNA 4DQDA 2FN8A 2GBPA 5E3JA 3MYYA 4NCBA 4M88A 4EGSA 2WJAA 4H60A 4KK3A 3O21A 2JVIA 4Z0NA 3ROFA 3H6HA 5FWYA 5CNKA 2MSLA 4LE1A 1ZVVA 4QYMA 5IUNC 4RU1A 1NATA 3Q7SA 3EODA 1BDJA 4G0MA 3IPCA 2IDMA 3RVPA 3IP6A 1K68A 2BGGA 4MS3B 3ROTA 4MR8A 5TPWA 4Z4GA 1YK0A 2PLNA 4JB2A 3LUDA 4WUTA 4MS1A 3RVRA 3NHZA 4FE4A 1EWVA 5CHYA 1Z16A 2L18A 2VUHB 1C0EA 5JNWA 1FSPA 4MR9A 2E4YA 4RSMA 3D8UA 4OATA 2PUBA 1ABEA 4TMYA 3RVNA 1U0SY 2FMKA 3OQOA 3T95A 2HPHA 4LX8A 2H0AA 3CNBA 3KG2A 3O2QB 4MRMB 1VKRA 3M6MD 3CHYA 4IGAA 1E6MA 4IF4A 5KQGA 2L2QA 3S99A 1QP0A 1D1QA 3H5IA 4RXMA 4CBVA 3QLVA 1ISSA 4N03A 1QO0A 2IYNA 2IKSA 1U2PA 1Z26A 4RK7A 4LE0A 1RZRA 4PICA 2MSWA 3Q15C 4GNRA 4P98A 1Z2DA 3GA5A 3LKBA 1YS6A 2QU7A 1NXOA 3QLTA 5TPZD 5BRJA 2MYPA 1MAVA 5EWJA 5JS2A 3QELB 2V0NA 3HM9A 3W9SA 2P9HA 2DRIA 3C3KA 3GYBA 4MYRA 4MQEB 2IPNA 2JCGA 4B09A 1JH9A 1XHFA 4JP1A 2PMCA 4N0QA 3EGCA 3T8YA 3GV0A 1ZY2A 4ETIA 4W5RA 3HV2A 3H1GA 5GOTA 4JASB 1GUDA 3C6QA 3LUKA 4TLMB 3RVJA 4RDCA 3FFWA 3M9XA 5KQPA 4Z4IA 2FSPA 1HEYA 4KPYA 1LK0A 3BREA 4PE5B 3H1EA 4F8JA 3CZ5A 4G0QA 3LUGA 1DC8A 3E61A 3GL9A 3GRCA 4IMJB 4RXTA 1URPA 1JDNA 4QICA 1JFTA 4ZJPA 4MGEA 4XXHA 2B4AA 3O2JA 3NBMA 3DGEC 2WJWA 5TE9A 1DZ3A 1Y1LA 1W25A 2FEPA 1YMVA 1LJLA 2WB4A 4N47A 2CWDA 4LZLA 4OG2A 3EAFA 1W9HA 3QEMA 2NZVG 3VNBA 2M1ZA 5C5EA 1PNRA 5KC9A 1RPJA 4MS4B 1BDIA 1DCFA 3TB6A 3OLYA 3D02A 4G0OA 4F11A 4MR7A 5KQLA 2QR3A 1RZRD 3I42A 3OMWA 3HDGA 4OLBA 4YCSA 2FKAA 4JA2A 3F7NA 3OLXA 3UKJA 5IUJC 5TQ2A 2E4ZA 1U8TA 3IDOA 3NNDA 1ZH2A 3SNKA 4RK0A 4Z99A 3Q7RA 1LBHA 4YWHA 2X7XA 2WWVD 2QZJA 3G85A 3KJXA 3IP5A 1YTUA 5JNTA 2CHEA 4HYEA 1USIA 1PEYA 4KVFA 5EWMA 1YMUA 4KFCA 4DN6A 3CG4A 1JX6A 4NICA 1TVMA 2QSJA 3K9CA 2JBAA 4G0PA 4RWEA 5FWYB 4JB0A 3CS3A 4F06A 1PNTA 3C3MA 4RKRA 4E7OA 1KRXA 4YP9A 5PNTA 4MAAA 1JBEA 2E4WA 4O5AA 4L4UA 3HK2A 2FMIA 5TPZA 4L85A 1EWKA 1PHRA 1TMYA 5DKFA 4MR8B 5EWLA 5TPWB 5KQMA 1A0OA 1P2FA 1P8AA 3CU5A 2P4UA 4EVSA 1Z2EA 4TN5A 3OLVA 3H1FA 1QQBA 2JRLA 5TQJA 3N6VA 1BDHA 3O1IC 5B3JA 1Z18A 4MR9B 4Z4EA 2F8SA 4XARA 2YHBA 4OTZA 2PUFA 1NXVA 2WMYA 4RV5A 4FB4A 2HJ9A 4EYOA 3MMNA 4WXEA 3LUJA 5IC5A 1JL3A 1P6UA 2LBPA 3EDCA 4G0XA 3KKEA 3JY6A 2GWRA 3FGZA 4P1ZA 3LFTA 1TLFA 4YO7A 3K4HA 3CZCA 3DBIA 5HKOA 3TD9A 2FW0A 3IPAA 3TMYA 4Z4HA 8ABPA 1RXIA 3N0WA 4HNSA 1DCKA 3F73A 2FEWB 4XAQA 5EWJB 1JWLA 5ED4A 2FMHA 6ABPA 4KRFA 3RVSA 3EQZA 2KYRA 3I45A 5C5CA 3A0RB 1RXEA 3QLUC 2ID9A 2A9QA 4Q6BA 3VNAA 4DADA 4ETNA 4EVQA 2R47A 4OBBA 3HJFA 1A04A 4LDAA 4KZKA 1SXIA 2R25B 4UHJA 1KRWA 2FMFA 4RXUA 3N53A 1QP7A 3JVDA 3F6CA 3FMVA 4MLCA 3SY8A 1ISRA 5BQ3A 5JS1A 5DTEA 2E4UA 2NT4A 3N0RA 4HNQA 3EULA 1SXHA 1FFWA 2ZWMA 3CTPA 3H5WA 2RJNA 5FBKA 5HM6A 1NXTA 9ABPA 2LP4Y 3CFYA 5T3YA 2NUBA 5BRAA 1Z12A 3KHTA 4YR7A 4D6XA 3H5OA 2RGYA 3LUFA 1CHNA 3KTOA 5GQSA 2MYNA 3SAJA 1USKA 3RVOA 2L17A 1RNLA 4G0YA 4RK5A 1DP4A 3QEMB 3HUUA 2JB9A 3A3KA 3MQ4A 1EAYA 2PUAA 2PJUA 1QNLA 4QPJC 5FWXB 3C3WA 2FXIA 4MR7B 3N75A 4RK4A 3DLHA 4IRXA 1Z13A 2PL1A 3QEKA 3RVLA 3HO1A 5TQ2B 1XWWA 1AB6A 1JDPA 2CHFA 5FBHA 3I09A 4MPTA 3P9YA 5TQ0A 5HSGA 2FVYA 4RZSA 1YS7A 3BILA 4Z4FA 1YVUA 1H9CA 3Q9SA 3OO1A 3BRQA 3M9WA 3GWGA 3C97A 3FFTA 4RY0A 5BR1A 4RY8A 3RQIA 5IX8A 5EWMB 4QYWA 3GBPA 3LOPA 4LE2A 1ZGZA 3OQNA 5IULC 1SXGA 2XDYA 2GX6A 7ABPA 2JBAB 4RKQA 1M5TA 1DRKA 3QLUA 4KQCA 4NV3A 5ABPA 2MSKA 2A9RA 5IUKC 2W42A 3A10A 1MVOA 2GI4A 4G97A 1JFSA 4ZMSA 3NNSA 4ETMA 1FFGA 4XLTA 4ZMRA 4XFKA 5DGCA 4MQFA 1OXBB 1XHEA 2B1JA 3FDFA 1PUXA 5EWLB 3KS9A 3MM4A 4PYRA 3MF4A 1E6LA 5KI6A 1F4VA 1D1PA 1T34A 3NHMA 1D4ZA 4N0PA 3RVKA 5IEBA 1L5ZA 2FQYA 1EWTA 4Q7EA 4MLDA 1NXXA 2Q5CA 4KMRA 6CHYA 3HDVA 4JOQA 2JVJA 4RK1A 5T7BA 1S8NA 2MYUA 4RY9A 4YLEA 5F64A 2PE5A 1F51E 5KWSA 3QX8A 1K66A 5JNUA 2QV0A 1QPZA 1SD5A 3GT7A 5DLEA 4MS4A 1QKKA 4WZZA 4YRZA 3CG0A 2FQXA 3BBLA 4MS1B 2RDMA 2LPMA 4EYQA 1C4WA 3UUGA 2QVCA 2LIVA 2L19A 1EHCA 3H75A 3CLKA 3ILHA 1LJUA 3KYJB 2R4QA 4NCAA 1JFVA 1GCGA 2E4XA 3FFXA 3HSYA 1ZAYA 4WWHA 2IPLA 1DBQA 1D5WA 2VUIB 3I5AA 4W5OA 1QP4A 1SRRA 1UDRA 4W5QA 4KREA 1B00A 1USGA 4YGXB 3O2SB 1I3CA 1ZDMA 3IP9A 3N8IA 3OM1A 2FQWA 5CNIA 5JNRA 1R8JA 2F8TA 5JNSA 2QW1A 1U2QA 1DCMA 1BAPA 2OQRA 1NTRA 1QQAA 3KCNA 2HQOA 1NXPA 1FFSA 2A9PA 3LKVA 4KV7A 4ML3A 1FQWA 1DG9A 1JF8A 3EJWA 3KYIB 3OO0A 3N0XA 4O1HA 3CKMA 2FLWA 4RK6A 3UK0A 4E7PA 2GKGA 1VLZA 5JNVA 4Y9TA 4EYGA 4KNYA 4W5NA 3RVMA 2WRZA 1DBWA 2R48A 1ZGGA 2N9UA 1EFAA 1CYEA 2E4VA 1DBPA 2J48A 3H5TA 2AYXA 2VYCA 2ZAYA 3DGFC 4Z9AA 3SG0A 4D74A 3TX6A 1AB5A 1ZHHA 4IMIB 3OLZA 4KK4A 5IEJA 2ID7A 4Z4CA 1Z25A 2QXYA 3GBVA 4N76A 1IIBA 4H3KB 2HQBA 3L49A 4ZYLA 4MS3A 3RVQA 4GPAA 3H6GA 3Q41A 1OXKB 2FLKA 1DC7A 4PZ0A 4TLLB 2WY2D 2PUCA 2RJOA 3URMA 2AYZA 3B2NA 5TQ0B 3DLBA 2M98A 2A9OA 3QX9A 2NZUG 1KGSA 1M2EA 1ZN2A 4G0ZA 2PKXA 4HNRA 1VRVA 3QK7A 4W5TA 3O1JC 1ZH4A 1ZITA 3LTEA 2OENG 2QVGA 3MIZA 1Z15A 4S05A 1GUBA 4MRMA 3BRSA 3JVIA 1JYFA 3DZDA 4EYKA 1TM2A 2HQRA 5CNMA 3T6KA 3OM0A 2PUDA 3JTEA 4FE7A 2YHAA 3OQMA 4EY3A 4EVRA 3LUAA 3LMKA 2MYTA 3KLOA 3HCWA 1YK1A 1M2FA 1JHZA 4MQFB 3KSMA 3O75A 2CD7A 3QELA 3CRNA 4EUKA 1CEYA 3T38A 1LBIA 4MQEA 4YS6A 3RH0A 4UHKA 2JVKA 3JS5A 4KQ9A 1L5YA 4H3HB 5B3JC 3ILYA 3O74A 3LUCA 3H5VA 1PEAA 2VK2A 1Z17A 1ABFA 2PUEA 1D2AA 1ZESA 2NT3A 3A0UA 3TO5A 3R0JA 5DCLA 1GCAA 2FEKA 4G86A 1NXSA 3Q7TA 3IP7A 4XASA 3JPYA 5CNJA 1P6QA 4ZPJA
chains in the Genus database with same CATH superfamily
3F47A 1PR4A 3HH8A 2ST1A 1XZHA 1BVHA 2WKWA 4KMSA 1E18A 1ZJ5A 2WDPA 1YHZA 1PL7A 3RAPR 1XXHE 1F9AA 2O0HA 1NJSA 1NYQA 4P7BA 3ADPA 4YJ2F 1ZW1A 5ITVA 1OWPA 4I9GA 1DAFA 1KHHA 1VSTA 2HIHA 2H4XA 2L82A 2TMYA 3Q4GA 2BSXA 4JT9A 4R7ZA 4A8JB 4I5EA 5DX0A 3HEAA 5ALEA 2VUTA 4OHYA 4TKMA 1TZCA 2WTXA 3T9AA 4K9SA 1QMPA 4UUBA 5B4TA 4LY0A 3B20A 1ZVMA 1EZ4A 2P8JA 2SHKA 2XNHA 3PNKA 4W8GA 3TSZA 2ZM6B 4JMPA 4HD8A 2R2GA 3PC8C 1T26A 4RCYA 3LGSA 4C0BA 1RAGA 2H1HA 4PFKA 1POXA 4ZV4A 2QD1A 1WEKA 4RMIA 4B2LA 1BWQA 1VHLA 2PD4A 3ONEA 2O3UA 5JT1A 4F6LA 1ULAA 2REBA 3THRA 1WV1A 4R01A 5AW5A 3UOWA 4D8XA 3B1ZA 3K9QO 1XDZA 4U2BA 2YVUA 2V5AA 3MGCA 3OMXA 2A0WA 4X7PA 4N5LA 3GCXA 3GLFB 4RYDA 2ZTUA 4UCFA 2HJSA 2QRVB 2NO1A 2X3UA 1ATZA 1A8PA 3PUZA 1Y1TA 2VUSA 3O8DA 4KNVA 5E3JA 3T0GA 1EFVB 1P7CA 5BN4A 5JVDF 1E2GA 1K97A 1HDGO 2GB4A 3I9KA 1VE9A 5DT2A 5BUZA 1HURA 5CGZA 4H60A 2BFEA 1ZCAA 4WXRA 1UOQA 1KO7A 4J91A 3AERB 3I01A 4GUDA 3USCS 2CYBA 3ASVA 1YRAA 1M2GA 4AROA 3G5MA 4YEDA 1E2KA 1CRZA 1FQJA 4ZAFA 3SPXA 3ZHUA 3CUYA 4PZEA 4EJ0A 3HJGA 4NCNA 1YRYE 5HUJA 4XW2A 3KFLA 4UXHA 3L4KA 3RVPA 1I7DA 3FCAA 1K68A 3H5AA 2UZ4A 5AVUA 3U7FB 3IKLA 4OJYA 1KOLA 5JY6A 3W05A 1VDMA 1QUEA 2I87A 3BWXA 4RIGA 2BBWA 1FXWA 4WUTA 5G3ZA 5A9RA 2Q6VA 1HBJA 3FKSA 1UFQA 4OIMA 2CEKA 5E2AA 2OCLA 2VSQA 1ES9A 4X5OA 1YQGA 5I7RA 3IAS1 5U4XA 5DK6A 5F3WB 2YNMD 4KXYA 4QO8A 4JBWA 2ZI9A 1QQTA 2V7QD 5JS7A 4YT8A 5GONA 1KIMA 4G41A 3TZBA 1OBOA 1USUA 3ZZMA 4EMBA 3BICA 2GETA 4A6PA 4PW0A 5AVVA 1MO4A 4IF4A 4ENPA 1N0HA 4KMOA 1TVEA 3HGMA 5K2OA 5KZMB 3A2KA 2Q5IA 1OYYA 2O8EB 2OUIA 1Y4ZA 2QRMA 2FZKA 3FHJA 4TRJA 4B3SB 1EVQA 5LBTA 1TCBA 2D3TA 4DV7B 3PNSA 4TL8A 4BLTA 2XHZA 3AKZA 5EWJA 5A2GA 5D1HA 1X38A 1ZD8A 1X9GA 4HGOA 1ZQ1A 4HGPA 2QRNA 2WHRA 4L4XA 3RSSA 2QPOA 5L9AA 4WESA 4AMYA 1XNGA 1IN6A 5IKOA 2H57A 3H4TA 4N0QA 2AOUB 4Q05A 5K8CA 2SNIE 2WTEA 4UVEA 2RCYA 1ZY2A 4W5RA 3UHPA 3V4RA 2VT2A 3SDZA 4G0VA 4LJKA 4JASB 1CE8B 5HTOA 1W4LA 1H66A 1V41E 4H1VA 1M2OB 1PL6A 4Q3BA 4XR9A 5J4KA 3B1WA 1I4OA 3FFWA 4N8DA 2O2GA 4WKGA 1M83A 3PEFA 3RVJA 2IYLD 3VYSB 4F85A 3AKDA 3AI1A 2DGDA 2IYRA 2VHJA 1TCCA 3LM8A 1T9GS 1A9OA 2BM8A 3QLEA 1L6RA 4BNMA 1XZPA 3LX8A 3IT1A 4Z86A 2VL7A 3P0EA 2HZ7A 2BI4A 1RE1A 4RM3A 2OESA 3M1AA 2QAGB 1HT3A 4W5JA 3LD9A 3RBZA 1KSJA 1Z75A 2GDZA 1ZO8A 4LQ4A 3F90A 1W2WB 4TSFD 3LG2A 5GINE 2XE6A 2XCTB 4NZYA 4MVJA 3RWOA 2I1LA 3BMOB 4D9JA 1JT9A 4BUZA 1TEVA 2AE2A 2BYTA 2EIHA 4DR2B 4I66A 4QG7A 5B1HA 1RWVA 3BQNB 5COBA 5J1SB 5DHUA 4RJLA 4MO2A 3VO8A 5IUJC 1ORHA 1ZH6A 1B8OA 1GTSA 4R2XA 5EIEA 1ZD1A 5EPEA 2AG6A 3ZDEA 4C7VA 4D9FA 3K94A 4NE2A 2Z4TA 4I3FA 2R6ZA 4A15A 3I8SA 1P9WA 3NEYA 2VHCA 2BGTA 3GEEA 4MI6A 1UANA 1LNQA 3VHXA 1C9JA 5HIAA 5MF6A 2B7BA 4M0EA 3RIXA 3OI7A 2DR2A 3Q6MA 5A7GA 2Z98A 2BFFA 3PNBA 2ZIVB 5DX8A 1XRNA 4DIUA 3I5YA 5K20A 4GE3A 4YJ3F 3SLRA 2WBLC 2JFOA 4FGLA 5JYCA 3PXCX 2I6XA 2XVXA 2D1RA 2P5TB 2P7HA 3IT2A 3TG2A 4RFLA 3NHUA 3VI4B 3T7RA 3QU9A 4HVCA 2O54A 1J39A 5EA2A 4EWLA 2DFVA 5HA5A 1ZJWA 3QPCA 4HPWA 1GV0A 1ZNXA 2X0RA 2G1AA 3KC2A 4FZ3A 2PFGA 4M7WA 5BMVF 2D5AA 1KRXA 2JA2A 1LRJA 1ZXXA 1RAIA 3W8FA 4PO3X 3O73A 5CXSA 1M5RA 5DN9A 4BQRA 3GAFA 4RIFA 4L73A 1NZJA 3P9CA 2VDWB 1UH5A 2ODBA 1RJWA 1UM9B 4I9UA 1NUUA 4PZZA 3BCUA 2BV3A 1EFRD 2OT3B 1PGPA 1GAJA 1UIRA 1LD3A 3PGKA 4ZDWA 1DAKA 2B5WA 5JXHA 2FPPB 2XE8A 3WYDA 1YR8A 4CKWB 3AR5A 5FPKA 2NXNA 4FYMA 1RQXA 3E82A 1VL5A 2XLCA 4R1LA 2XYVA 3LP5A 1NXVA 5LQSA 5CM9C 4TXJA 8AT1A 1E9FA 2J3LA 3VC7A 4YT4A 3UNXA 3U5TA 1AO0A 4IIYA 3ICOA 3B51X 4IQ8A 3ZU6A 2EFEB 3VNQA 5ADUS 3FLAA 2I4LA 3AONB 4TMVA 5ALTA 3UV6A 4RHYA 1A7UA 3I9FA 3IPAA 2WA2A 3FDJA 3H84A 1FS6A 2HD4A 4JL8A 4AO8A 1BD3A 2H00A 3FMOB 3QE9Y 1P1IA 5L45A 3IOEA 4CXMA 5M34A 2FEWB 1T3ZA 2NZJA 3E5RA 3F3YA 4KSBA 4XKJA 4B34A 3MHPA 1OA1A 3E8XA 1X8KA 1VHJA 1SY7A 2YV4A 2HYIC 2BI7A 3SHWA 5LM3A 2II6A 4UBLA 4LJRA 1XXHB 1HLGA 1JTVA 2ID9A 2PX5A 3PR2B 4DADA 5I4IA 1CS0B 3S44A 5ESXA 1Z73A 4Z0TA 1FTWA 4M7OA 1CY4A 1A04A 1IY8A 3OEYA 1G8PA 1EDBA 3MJSA 4QO7A 4RPKA 2FMFA 2WM9B 3LGXA 2EG9A 4AP6A 2LGJA 4WX2B 3VSBA 4QFBA 2Z3VA 3R7BA 4BB9A 3FAZA 3KSUA 4X8OA 3SZOA 2NT4A 4DIMA 5IM5A 3LHIA 2PRIA 3GZJA 1SKQA 2HT1A 1Z2AA 2J85A 4LGVA 3DWFA 5ALNA 3TTYA 2IEYA 3E4DA 1M2KA 3VNUA 3KHTA 1RLTA 3FROA 3GD7A 3OZWA 4CG2A 3P4YA 4ZRMA 2EJUA 1YQWA 2KBEA 4C5AA 5C8DA 3J81A 3PDUA 1H1LA 4LYAA 5DHQA 3G0BA 5CB8A 1RRMA 3QVLA 4KTTE 1ETUA 1LNSA 2W7TA 4EPXA 1AGNA 1PGQA 3IQHX 3L8MA 3ODGA 4DILA 3AW8A 1NASA 3PE4A 4QNMA 1LTKA 1MB4A 4IOJA 3SF8A 3RG2A 4J0KA 2YJZA 2AL7A 1EM8A 4IQ4A 2JIQA 3I0MA 4MB0A 4QPJC 2WPDD 3FVQA 2PR7A 4PQEA 3UZUA 1J21A 3I23A 4FOOA 4MR7B 2XUHA 1KEEB 5AM4A 3IAEA 3RPEA 4Y6SA 1BEUB 3VC2A 4AN0A 3AIIA 2XB6A 4IV5A 3IAUA 1YRWA 3SE7A 3VZDA 5FBHA 1GQQA 1JDPA 4WOPA 5CIWA 3JR3A 2VZEA 3ZOKA 5CVUA 2FWNA 2XA9A 2ODNA 1EVKA 3B1JA 3EZGA 4Q7LA 1WMDA 1Z0ZA 3P2EA 4ZCMA 3BULA 3NC0C 1GQYA 1V3VA 1Y1QA 1EVJA 2FGKA 2PZFA 1UPXA 1W88A 3DS8A 3EQ8A 4C4SA 2GCPA 2Z56A 4XTRA 3E9NA 1H3EA 2IEGA 2WZDA 5F76A 1I5RA 4PX9A 4RWZA 1V7ZA 4OUDA 5ADHA 5CT4A 1NDQA 5KYVA 3EC7A 1TL7C 2JBAB 1OB2A 1HOTA 1FNNA 4NV3A 3QYAA 2PGNA 5D3MB 1NJGA 2AJBA 4G3XA 3CH7A 1XXLA 1KGDA 2CHQA 4YJDA 4ZAVA 5J59A 1A5TA 3LWDA 5FI0B 3F6BX 4IHJA 4YRPA 3LBYA 2BEJA 3K6JA 3O3OB 4LXTA 1DQZA 2QD2A 3QVGA 5A1JA 2CC2A 2F1OA 3H9JA 3PDHA 1XMPA 5HILA 5KI6A 5AI0A 2C0QA 1E3TA 1T34A 2C3UA 4FIZA 2JGAA 4X1YB 3C85A 1BO6A 1T5OA 3GF4A 4X7BA 1P5RA 5BN3B 2Q21A 5K3FA 1HXHA 2F59A 1NXXA 1QVVA 2C42A 4UC0A 4WBXC 5HFNA 4J6EA 3Q88A 3ZWQA 1IULA 1CR1A 2Z9DA 2WILA 4JEMA 4X20A 4H9GA 3MD9A 2O8CA 2AMLA 2DPXA 4NTZA 4RMGA 4BIIA 3I1IA 1ZVJA 2RHTA 2D1TA 4TVSA 1MPTA 1SD5A 2VNJA 2X4LA 2YMLA 2ZRIA 3FF4A 4IHKA 1I6MA 1KFCB 4O6VA 4JWTA 4RGBA 3ADOA 4K05A 3WISA 1P2GA 2Q6LA 4FINA 3U4CA 4BC0A 4MINA 4DCJA 3DO6A 2ZXEA 3V8RA 1CFJA 1SQFA 3OZDA 1EHCA 3HBJA 1M6EX 3JD0A 4GEGA 2XD9A 2D13A 2ZTHA 4R05A 3BCHA 2V7VA 3PEEA 4QDUA 4X44A 1K1EA 2BKUA 3TOZA 3W06A 1KAMA 1II8B 4YONB 1IM8A 1SRRA 2FSVA 3IPXA 5KB3A 2JKZA 2V65A 4FD2A 4KRXA 3QU4A 1VKZA 2RI1A 2BJHA 2Y1OA 3PUKA 4BFCA 1GEGA 3NTVA 3GJ4A 3KUDA 1EU1A 1MXHA 1Z74A 2WTAA 3O90A 3RK1A 4ZXPA 1ZLYA 2OQRA 4MJ3A 5BMOA 1ZSYA 2F90A 4P32A 4X7MA 4QUGA 5K0SA 3LKVA 3SVTA 2VNKA 2EL9A 3KYIB 5A4AA 4M53A 4REMA 5EMNA 4EHLA 4YCMA 3K0FB 4GL4A 1WQ3A 3UK0A 2Z2IA 3B78A 2GKGA 1P3JA 3BF7A 3HDHA 3LX4A 2UXCB 4I4TA 1YUBA 3VOTA 3RYHB 3ZE7A 4CMIB 5ICGA 3DMTC 1RC0A 3FGNA 1TECE 1VRCA 4WUVA 4MDEA 3PUWA 1VFNA 3AUAA 1P9LA 4RHUA 3ZHVA 2AWNA 3F78A 3TZLA 3JZAA 3L92A 2DQSA 4ESOA 1FNCA 3BF8A 2YV1A 4GPEA 4Q7JB 3VNRA 3I92A 5IP5A 4L4RA 5FL7A 4D3DA 2B99A 3WA6A 2FZLA 2JFXA 2EG5A 2QM3A 4LTNA 3UFBA 1JG1A 4GWKA 4MTLA 3W3AD 1EJ0A 1QG6A 2V45A 3A7EA 3QXHA 1FX0A 3BSYA 4IIXA 4MLZA 2P9FA 1ISPA 2J87A 5K05A 2H17A 2O23A 1YKGA 5BN1A 2G0TA 5LIPA 2YWBA 2H4YA 4MW1A 2YMQA 3WK8A 4GPAA 3GUHA 3REQA 3ROEA 1RR6A 2QN3A 4HWOA 4LJ7A 4B84A 2NG1A 4TLLB 3C6ZA 2ZM5A 1C0KA 2AYZA 1KDTA 2A9OA 4YP7A 2Q2QA 3U62A 2D1YA 3S2IA 2OV1A 3FR8A 4JC8A 4FGJA 4URVR 4RD2A 2BSAA 1N5IA 4N54A 4E03A 1EE2A 2BKAA 1VYHA 2OCYC 4MIOA 1O9BA 4RKFA 3RODA 3HR4A 4ED9A 5CD9A 1Q1ZA 4LVOA 1Y5NA 2I3DA 4DA9A 1D2RA 1IC6A 4YPVA 1AT1A 3SYLA 1SIOA 4XYLA 2AW3A 1JILA 4ZT4A 1TM2A 2W6JD 3P94A 3MJHA 3W3AH 3RT9A 3VOAA 3IC5A 3L8YA 4QWMA 5TS2A 3LC0A 3OOYA 4DQUA 1QIHA 2VNAA 1M66A 4R54A 4K6CA 5H0IA 3K70B 1Z36A 1GGJA 2G6TA 4BB6A 2OB1A 3HB0A 4D26A 2QGZA 2X76A 4MA5A 3QXXA 4I2VA 1I2ZA 3KSMA 3DONA 2XNCA 1TMKA 3FZQA 4E30A 4LBZA 3QFCA 3RBXA 2Z09A 3ELDA 2FR8C 4NG4A 3ZJYA 4MWZA 3D4NA 5KCMA 2X0EA 4D9EA 8ADHA 4U4AA 1GDHA 1F2TA 2F8MA 3LGAA 4BUCA 3ZD9A 1QU2A 3GJ6A 1GLVA 3ILYA 3T4XA 3ZX5A 1T8UA 3VX4A 4DCTA 4YCAA 2VDQB 1M2VA 4KQJA 3TSCA 4BNTA 3TOVA 5AFSA 3VX3A 4OXNA 3NFYA 2QRPA 5DK4A 3DOOA 1RJEA 3I6ZA 3Q6NA 2X22A 1CIPA 4ZPJA 3KVYA 3H2SA 4CCWA 3MGKA 4DXDA 3E3MA 3MMPA 4FQ7A 5JAUA 3FPFA 1F2VA 1J8FA 2W0MA 4XD7D 2FN9A 4PZAA 1GFWA 1TJYA 3M6LA 5F12A 5F7JA 3PICA 5JEDA 5JPDA 5KYTA 5J2UA 5A02A 4U00A 2IU6A 2IOHA 3M7IA 4JVSB 5D86A 1IAVA 5C0OE 5IVPA 4OSPA 3VFDA 1NT4A 3EXFB 3WLAA 4CT4B 4XSGA 3OTHA 2C9CA 2DFNA 2G17A 2JRCA 4OI1A 4HQOA 3V42A 1S9DA 4CLOB 1LSJA 1OH8A 1PFGA 1CY8A 1NW6A 3L9WA 1AIPA 1L8AA 1T9AA 2J5KA 1JQKA 1L4EA 2YNMA 1HDIA 2JASA 3QKRA 4MYDA 3JATB 4QXQA 4L27A 4X85A 5IARA 3NMUF 4P92A 3FFAA 4MTCA 1V71A 1FFXA 5CCDA 5IDYA 4ER6A 3E9RA 3JR7A 1U7PA 1KP3A 4PLVA 1OPRA 1Z28A 2FSIA 4K46A 4EUHA 3O4VA 5LQUA 2Z8YM 4RKWA 5ALJA 1XD8A 3B5IA 2QXTA 3IDQA 1Z4JA 5JD4A 5JC8A 4CF7A 1RWXA 3I72A 1KPGA 2Z5GA 4HNUA 4GZ5A 2HXGA 3A9VA 5C7LO 1Z7EA 4OBEA 1GIAA 1TJPB 2UZ1B 1U7OA 3G5TA 4EB0A 5A5VA 2OORA 4FJ1A 1KDYA 4D4GA 2W70A 4LJ8A 2QN1A 1F8UA 1H8ED 2V0CA 1H4TA 3QOXA 4BGIA 2MHCA 4IDDA 4B6GA 2XDAA 3AUTA 4M98A 2R6R1 4UTZA 4F38A 1N78A 3DEHA 3IA2A 4Z0NA 3RSLA 5JRDS 1D1SA 3LBIA 3VVCA 4A8TA 2R4UA 1PTJC 1GVHA 1T2AA 4QJ3A 1O03A 4JLBA 3HKBA 4WAUA 3EGOA 3VGPA 2EBUA 5B58C 3D8HA 4Q37A 2N0SA 4PN3A 2H29A 3WGGA 3RRNA 1VPTA 1Z6YA 3DKVA 3JWJA 1FSFA 4LGYA 1N25A 3M6FA 4Q34A 1SBQA 2GTPA 5GJWC 3VSCA 5IK2D 2AK2A 1YFJA 4LFBB 2OXRA 4LI0A 3BSFA 5ALFA 4MV9A 3T3NA 1G38A 4AMUA 4INAA 4BPBA 1Y8CA 1L8QA 2AOTA 3QVKA 2DPLA 4RHTA 2X8JB 2AX4A 1CV2A 2GQ0A 2H9YA 3P9RA 1G60A 3IT0A 5ESDA 2BEVB 2GPSA 4IDHA 1W19A 4A27A 3OEED 3C7KA 3L5OA 4PHGA 3DO5A 3L01A 4TSFA 1NRIA 4BAGA 3CH5A 2EFHB 5BP7A 5CXUA 1Q15A 4YLYA 3KG2A 3NUZA 5G02A 1TCUA 4ALJA 2QB5A 3JD4A 1T4CB 5KYYB 2CDCA 2VF7A 3CB4A 5EJIA 2XXAA 1NN5A 3OF3A 5TR9A 1I8TA 3OEHD 3PNLA 3PFFA 3Q3EA 1QP0A 1YNOA 3NH6A 4II2A 4N03A 4RY2A 7ADHA 4W6ZA 3SFVA 4N0EA 3P5BA 4UU7A 1SUSA 2IPXA 4C87A 1KMHA 5CFMA 4JI8B 4NI5A 2BZSA 4KKVA 4PF1A 1V3TA 4UNQA 2PSSA 4B4VA 3HCPA 2KE5A 3RDPA 3ORHA 4HAIA 3MTGA 1D8TA 1BHJA 2BR5A 3QELB 3BHJA 2Q4RA 2GPAA 1PJ4A 2UZIR 4GBJA 3NTLA 4FFBA 4QT4A 1R1DA 4K81B 4LY3A 2SKEA 4RE5A 4CDMA 3WRXA 1PNOA 1YULA 4AIIA 2NV2B 2BRUC 3VDRA 3CJTA 3L41A 3LY5A 1JTFA 1J2UA 3RK4A 4AURA 3EVTA 1N5LA 4ZVLA 5GOTA 1GAQA 2B94A 2F4NA 2XADA 4TLMB 3ESQA 2PL3A 1NFQA 3NDPA 3UJDA 2G88A 2IU4A 1K3UB 3PHCA 5KNDD 1WCXA 5KINB 3PDJA 4CWAA 1NW5A 1RBMA 2WJ4A 2PKEA 4GRDA 4HDKA 4C1BA 1GVNB 3T1NA 3ZXIA 1JDNA 3PPWA 4I55B 3UOAB 2B4AA 1S2LA 1ZMRA 3NBMA 3DGEC 1VSUA 4WNIA 1U8UA 2ZUBA 5KDDA 4QQRA 2P4SA 3PFWO 1GZ5A 5D7NA 1D2CA 3GRFA 2VJPA 2CWDA 2HRRA 1Z37A 3KB6A 1OLXB 4J16C 1EFRA 4N18A 4DBLC 1ZKDA 1AJEA 1MIOA 4WKNA 3U7IA 2GK6A 4KO4S 3VKFA 2NU8A 1M1NA 1S7CA 5F3DA 5FEUA 3P9PA 3U3RA 7YASA 1BDIA 5L7WA 4ZO4A 3ZZNA 4W7HA 1I01A 2PS3A 4I8XA 4WLVA 1FJ2A 4YDSA 1GA1A 2JHAA 4B43A 1RWMA 4M1TA 4DHWA 2LE0A 4UJ5A 3EXEA 4P53A 3T7AA 4EL5A 5A62A 2E87A 2VWHA 4I6EA 3E5MA 1U9CA 4LMRA 2JGDA 3OIFA 4OM8A 2QVBA 1LQ2A 3MOIA 4IQ0A 4J0GA 4NU8X 4REOA 3UK6A 2VRBA 1ENPA 1M1YA 1YOVA 2QZJA 2ZE8A 1VG1A 3B52X 3IP1A 4KXVA 3LFUA 3W6UA 4EF5A 3THXB 1MOSA 3PUYA 3WGIA 2CFTA 2C5BA 2R1TB 1V7PC 1PT6A 1MEOA 1N2BA 5AJVB 2BEKA 2WJ3A 4DQLA 4MJ7A 1N6OA 3R5TA 4LXQA 5JPIA 4HAYA 1PZMA 4B17A 3D3NA 3A6JA 2WV7A 1TUGA 3R24A 1BX1A 3R76A 4BNIA 1L5HA 2ODWA 5CX1A 1YXMA 1KYQA 1OZHA 1U9JA 3BA1A 3HJRA 3TM5A 1QK3A 1BJTA 4G1VA 3DCIA 2AYYA 4DJDC 1RKQA 4E88A 1NUTA 4MHOA 1YR3A 4BVAA 1PJ8A 1VE6A 5HGJA 3T5BA 3AJ8A 1FBTA 1CVLA 2P4UA 1ZUD1 5ILGA 1SXPA 5IM4F 3OLVA 4IVNA 1JHPA 5DI3B 3CVUA 3QXJA 1LXCA 2XRMA 5TQJA 3TW8A 3M6AA 2ZBVA 2CV2A 2PS9A 2FF7A 2G0AA 3GEMA 2WYUA 4UCXA 5JADA 1WIWA 2E49A 3L7AA 1I33A 2H1IA 1FNDA 4OTZA 4XIJA 1RJ9A 1QG4A 3LLMA 4K86A 4WL0A 1JFRA 4ZO6A 3WMEA 2DHQA 1XA0A 1GZSA 2Q5JA 1ZK3A 3CRW1 3HMQA 1UXHA 3FGOA 1J9GA 1WD5A 2HM7A 4N0DA 1K7EB 4K5QA 4Q9KA 2WPDA 3RS4A 1N1GA 5EKSA 2PBFA 3M5CA 2K4MA 3QWFA 3S1LA 4BNKA 1ISMA 4DBZA 5BXQC 1FRVA 3PFNA 3TD9A 5FLXA 4MHTA 3KVOA 4G1BA 2I4OA 4CCYB 2OAQ1 2ZRAA 1STOA 3LTNC 1VLHA 1P81A 1TFUA 4GQIA 4YC7A 1P2SA 1N5JA 2BFOA 4E70A 3OU7A 3HKCA 4CV0A 1GUYA 2YHIA 1WPXA 4HUJA 1JDJA 4XUGB 1U2DA 4BMOB 2AEEA 5EZYF 1JUDA 3RVSA 1VBKA 3DVRX 1DMSA 3KETA 1IN5A 2JJ2A 3DV0A 4FFPA 4EFMA 2H2HA 3EXG1 4RTJA 4ETNA 1IZ8A 1V16B 1GKKA 1U0JA 1YL7A 2GEKA 3A36A 3H18A 4AJ1A 1W36C 4OQLA 4LDAA 2QJFA 1NA5A 2IDKA 3E7XA 1MU0A 5E2BA 4DLXA 4E5SA 5CLJA 4ENSA 4FSDA 1T3SA 2QIOA 1Z6XA 2OBNA 3SXUA 4O2BF 1LLCA 2ECKA 2NU7B 3I9V6 3VSAA 3W5DA 4U02A 3FN4A 1U28A 2A5LA 1WZIA 4WN9B 4KAAA 4YQEA 3Q7QA 2V97A 3QJ5A 2XCQA 3LBFA 3H5WA 3AFHA 2FKNA 5ERGB 5THQA 2XT6A 3PXBA 5BN5B 3AHIA 2HFKA 1L5OA 4PPQA 4ZC1A 4CM8B 3D7SA 4HKTA 4R16A 1KK3A 3BC1A 4BEVA 4Y8VA 4CTNA 1CDZA 5DLPA 1TQ4A 4GWGA 2R8OA 2VAMA 2HDWA 3BK2A 1WMAA 4W5HA 4EX7A 3SQXA 3KZOA 4ALKA 4HX9A 5CAEB 4JU9A 2J6IA 3AO0B 5FWDA 4GMDA 2PWPA 4HWGA 4LCBA 1NQAO 5FV4A 1Y98A 4LYHA 4DLYA 3OSZA 2JCYA 3CNNA 1W5EA 2P41A 1PHPA 3CINA 3FY4A 3Q8LA 1FC0A 2C8JA 3VR2A 1XLWA 2D5LA 4HEA1 1T2DA 1AA6A 4X0EA 4KHZA 2VQ3A 1KPHA 4RESA 5TJHA 1N77A 4DNFA 2W2LD 1PZXA 5HF6A 2JH9A 3RU7A 5EIAA 5IVDA 4RUKA 4EK9A 3K9HA 5AJTA 1YVUA 2CXUA 5AKYA 3PE6A 4RQBA 2E0IA 3H2JA 4J8PA 2ZVDA 2A5DA 4TVKA 1JDBC 4S0XA 3ZK7A 2PX4A 3RQIA 4R8MA 4KXNA 3RIGA 1WQ1R 3T5GA 1ZD5A 5HHTA 2XHEA 4MA4A 4DVJA 2DJ5A 5H82A 4N1AA 1XTBA 4NPAA 2FCAA 4Q9AA 3A10A 5IUKC 2NXJA 1LA2A 1Y8RA 3EMDA 1O6ZA 3MSXA 4RADA 2PTGA 4XLTA 1QFYA 1OT5A 3RJZA 2PGJA 2YWFA 2XYGA 2CGEA 1VL1A 4KPEC 3H3JA 5JALA 4MW9A 3LIIA 3UK1A 2CK3D 4C03A 1EEHA 1G8AA 4EVIA 1GPKA 4MUMA 4U0JA 4XGIA 3IRUA 2ETVA 3FRHA 4EG7A 1G2QA 1OQAA 5B30A 4Z4QA 2OO5A 4WGFA 4MLDA 2BGUA 4BCDA 1EX9A 3DM5A 1E1RD 5H1YA 1BE0A 4QXMA 4EGAA 1Z56C 4HWSA 1S8NA 1QM5A 2R1ZA 4EY4A 721PA 3AXSA 1ZSNA 4AN4A 4B3MB 2G4VA 4GYKA 2X8AA 5AW8A 3RTEA 4UBMA 1QPZA 2ZIXA 3W3AA 4MS4A 5L4LA 2C7OA 1FFYA 4HXYA 1SXJA 4C4ZA 3GRUA 4DAOA 3UUGA 2FRDC 3AY6A 2QRUA 1R4AA 4R7TA 6NULA 3ETNA 1D03A 3W6NA 4G09A 4IKPA 4JJIA 2V1UA 5B12A 1PD0A 1KYIA 4Q12A 4RKYA 1KJQA 3H65A 3T7SA 2O5EA 1N2JA 3RFTA 4M1SA 5TDHA 5K0LA 4W5QA 1CR4A 4IGKA 2HBRA 5ECYA 5EJFA 2BR3A 4I50F 4EYSA 1RAFA 2Q7DA 4R0NA 4DREA 1NLZA 3O2SB 2AXNA 1TYDE 3IP9A 1P3DA 1HE5A 4J49A 5B4UA 2ZLBA 3OBIA 3WIBA 4OLFA 1G2IA 2KBFA 1IE3A 1YIDA 2W6JA 3RRMA 1T1EA 4BCBA 1QVAA 2DT8A 1TTQB 1NTRA 3ON5A 4PLTA 3EHDA 3H8VA 5JQGA 3FYDA 2VZ0A 4JHLA 3P20A 1Y1PA 2A9PA 4ME6A 1ACLA 4RLQA 1LLFA 4JT2A 2OHXA 4QFMA 2OK8A 1GRQA 3U7EB 4DCNA 2ZYDA 2OAEA 3TRDA 3EMVA 1HE1C 2QMHA 3BD7A 4G5OA 3ZLJA 1N9GB 3BA6A 3OICA 3R7SA 5L3QB 1G7TA 4YRNA 2Y6UA 3I1JA 4CLRA 2J0QA 5ALIA 1K8QA 4H7KA 2PWYA 2V6GA 1J06A 1DO8A 3FZYA 3TRKA 1DBWA 3GEBA 2BMAA 1DC3A 3SHOA 1WUTA 1T1JA 1I3MA 2D5BA 2IKQA 4LRUA 2AYXA 2VYCA 4YDHB 2NPIA 4Z9AA 2E48A 1VIVA 2ZJZA 3LXRA 5KOIA 3OUUA 4C29A 1EXMA 3BE4A 1YS2X 1G41A 4DW8A 1YIAA 2XBUA 4IX9A 2CV1A 2HHHB 4F1JA 2HI0A 3A3OA 4Z7QB 2IHBA 4BB5A 2ZWOA 1KKMA 2OBYA 2IIQA 3ABSB 3MJRA 5E4JA 1V6SA 2ONYA 2WY2D 3WLNA 1RCTE 3DC2A 2R60A 1LU9A 4G5QA 4P2BA 2AN1A 1DPFA 3IBFA 4XVRA 5ADWA 4FQ8A 5LSAA 2O2EA 1FFEA 2YJGA 1M2EA 4JL6A 1E62A 3MMSA 4MVWA 3EWIA 1IHUA 1VRVA 1NHGA 4WXHA 3SEFA 3SFTA 4CTOA 1B6GA 1ZH4A 1G9XA 2X0KA 3NHWA 2CKMA 2QVGA 3GDOA 3MCAA 1BZYA 5ALQA 1RPNA 2FE1A 5HE9A 3UB4A 4C08A 1DDGA 3PIDA 5CFNA 5KYWA 5AW9A 2BMWA 4AY6A 1TF7A 2RGXA 2RHOA 4RVFA 1SCAA 4MV6A 4NAHA 4E4YA 4EKIA 4M87A 3D8RA 3A9CA 2XTNA 1X1CA 2BTQB 4KPGA 1WDTA 5KWIA 3WS7A 1QB8A 4R1UA 1SUBA 4CQLA 2BVNA 4EVRA 1Y8QB 2MJLA 3KLOA 4RVGA 4TSRA 4P22A 3U4GA 1U8ZA 3WO0A 4BU1A 2B1QA 3DDSA 3V6LA 2CD7A 3E18A 1MGPA 4YA6A 3ORFA 4Z9YA 1T0JB 2P3OA 1BW9B 3THWB 2D3WA 1VLMA 2C5LA 4L72A 2VTKA 3CVOA 5B3JC 4L7QA 2D8MA 3GNLA 3DBLA 5I9IA 2ZZKA 1IHYA 1WL8A 1K8YB 1LK7A 2I3BA 2YWGA 4KFRA 4O2RA 1H8EA 2NT3A 3O6VA 2AXPA 3E9MA 4IXNA 3TO5A 5KYGA 4LF4B 3CH4B 1XAGA 1NXSA 3A26A 2HUPA 1G7CA 1IVYA 2XWSA 1M8FA 1C4KA 1PFWA 2Q3EA 5ALHA 3I0ZA 1WETA 5JS8A 2B98A 2EW1A 1QHIA 1M7GA 2WF6A 3GQBA 1UKCA 3I9JA 4QUHA 3OJEA 4UVIA 1Z22A 1TKRA 3WMFA 4EW6A 3D8SA 3R3HA 4LNHA 2JAOA 4QDJA 2PAFA 1L8LA 4UDXX 4AJ9A 3PNYA 3K9FC 1DKLA 1N3LA 5IK2A 3M6WA 1PU2A 5I7VA 1HG1A 1SC4A 2HWXA 3B9QA 1B3BA 5LYJB 1KAHA 1H2EA 3UKDA 5BSEA 2IPMA 5JZBA 1C9DB 3RLIA 1YFLA 4JI4B 5FORA 1N6HA 3WGOA 1HY3A 1RMYA 2WD8A 3DAGA 2OGSA 1LBEA 2PMDA 4NATA 3SKYA 4NJEB 2WIGA 1SM4A 1YZGA 4H1TA 4C4XA 5LJIA 2JH8A 1HYHA 3TBKA 4JI6B 1BE6A 1I2CA 3D5EA 1B1AA 2OA0A 1GUFA 4M8KA 2IV2X 1TOAA 5I4CA 2H5IA 3OE1A 1WVMA 3OEHA 4OQFA 1WQ4A 1I6KA 2YOFA 1U3VA 1DU4A 2XX3A 4ZQHA 3O1HB 5FOWA 4AN1A 6ADHA 4JSYA 3AF0A 1TZ2A 2ECQA 4TTQA 1QRAA 1V8ZA 3JX9A 3HO6A 4Q4DA 3RU2A 2AI3A 4UAJA 1W6UA 2AHRA 2C2BA 4BO7A 2HRCA 5CG1A 3O7WA 3RYFB 3USZA 3PGLA 2WAXA 4FFRA 1P33A 3LAWA 1E1YA 3N2LA 3QMWA 4RLHA 2C78A 2C98A 4UKDA 4KK3A 2WIBA 3HXKA 2BFCB 2FDXA 5JSKA 3HVIA 4DLKA 4HTAA 4Q18A 3TQSA 1HE2A 2BY4A 3I9OA 1DKRA 5CNKA 4EW3A 1Z0DA 5I5EA 3EOZA 5JECA 3G23A 4HAZA 1LPPA 2QV7A 1HDEA 4DV4B 3ZHOA 2XECA 1EFUA 4PTZA 1MNAA 3LX5A 3DHYA 4EGFA 2ETXA 2IDMA 3JQPA 1ESEA 2XMGA 4O4IF 5KNDA 5D1NA 1MQ9A 4KTVE 5CFQA 1Z2NX 2PLNA 1E2NA 3LT2A 3QUBA 1SVMA 2BDTA 2PH7A 1RRGA 3U48A 4MWEA 5CVEA 1Z16A 1Z7GA 4G1FA 2DWCA 1B14A 3QBVA 1GGVA 2ENUA 4LKOA 3P1JA 2OFOA 1A5BB 1BWPA 2BKEA 4BX2A 2AGVA 1DFIA 3LZCA 4LX8A 3ZW9A 2PS1A 3IB6A 3KOUA 3HBFA 5JO9A 4ITVA 4M8NE 4NH0A 2DUMA 1YT5A 1J22A 3BXXA 1JDVA 1RYBA 4RW0A 4CKZA 4PC6A 1T0UA 3IKMB 4Q4AA 3NAQA 1I13A 1RIFA 2IE8A 2JCXA 5IW8A 1RHUA 1SVKA 3MJFA 4DV1B 3T99A 1J07A 3CGWA 1JZSA 3MMZA 4U2DA 3W2TA 5LA6B 1GV1A 3FRIA 2F3UA 3JD1A 4RGYA 4EA9A 3EXIA 1K88A 4FYXA 2FPKA 2I2XB 4H2DA 4RGQA 3GFVA 5A7HA 4D74A 4C3OB 4FYKA 5LXTF 2ADOA 3HZRA 4ZOLA 1EP1B 4NOJA 3EZ9A 1VIMA 1R0LA 4XGRA 4KKXB 2AWOA 2GKOA 3IXQA 3ZD6A 2CUKA 2I8CA 3JTMA 4K6KA 3E9DA 4AWBA 3PXEA 5H16A 1ORWA 4Q3NA 1US8B 4KLZA 3FOZA 3KR1A 3T52A 2QUZA 3SJUA 3BE6A 3QOFA 5HRUA 2G9QA 4M55A 4YPFA 3K8ZA 1SKBA 2P2LA 5IZCA 3UJ9A 4RE6A 5I48A 1MEEA 3TLBA 3QUAA 5CUQA 5KTNA 4KPYA 3JQ8A 2YCLA 3PS9A 3AWIA 4URUR 1VJTA 5HXAA 3FUTA 3LP6A 4JQOA 3FTPA 4KI7A 2QXUA 4ZVSA 4WNAA 4MGEA 1GGEA 3JVEA 5TGZA 3UJ3X 4AICA 1LS1A 1KQOA 4XRRA 4NJMA 2X8LA 5IBPA 3RABA 1WXDA 2B61A 1I9CA 3RS0A 4B4UA 2FSFA 4HBGA 1YFKA 2Y27A 3KR0A 4FYYA 1SCIA 1PR3A 3GRRA 3D1JA 3NWOA 3EF1A 3GEDA 4HEHA 1P2DA 4XYGA 2PZMA 4PAGA 2HNBA 4Q1EA 1DCFA 1DXHA 3VAZA 5EIXA 4EG6A 3D02A 3DMRA 1AGXA 3HA7A 4RHFA 4TYPA 4Y6OA 3TEJA 1MJ5A 1HT2E 1QONA 2V8OA 2XY4A 1RJDA 1RKXA 3QV2A 5G0SA 1MHPA 3QW2A 2PJZA 4Q4CA 1JEOA 3E58A 2YRXA 4V0KA 4MQUA 4UJ3A 3WIVA 2WUEA 3Q7RA 4NK5A 2Y2VA 4YWHA 5KSOA 3DFIA 4CLXA 1J4AA 3G85A 5IAKA 3HCAA 2A0UA 2YCBA 4JBIA 4NPCA 4EJSB 3QBTA 5IJ9A 3JXEA 5UKDA 1GG5A 1CUWA 3G82C 4BFXA 1SQ6A 3VKGA 2X1MA 2EZUA 2ZBQA 3KPYA 3ZHQA 4Z3KA 1E0AA 2EJCA 3K9CA 2GN8A 3BGVA 2AC7A 3H83A 2N42A 3P26A 4JBNA 1P0MA 1CUYA 5I3CA 4BQPA 1P31A 3R9KA 4WZBB 4B6OA 2B36A 4F06A 2V96A 2O59A 3O3NB 4RPCA 3CLRD 5BV1A 4HO1X 4LVUA 1EDDA 4FBGA 1PLKA 5B55A 1JBQA 3LXXA 3DCJA 5DXAA 5AM2A 3SFZA 2YKGA 4LI3X 3BGOS 1L5GB 5DHAA 1CUCA 2P1ZA 2OWEA 1MFZA 1M6YA 3MJ4A 2WLTA 3JYPA 3K9WA 2AMFA 3ZG6A 2CY0A 1A1VA 1Z83A 2ZBEA 3EF0A 2DKNA 2MSEB 3S1SA 2G6BA 5BSMA 4D56A 3GEPA 1XCBA 4MCIA 3SBEA 3GNQA 2Q1SA 1Q16A 3EWSA 1JVNA 2JFNA 1TKCA 3AY3A 3GT0A 2CVFA 4P3YA 2YHBA 1ZVQA 5EMHA 3LQ2A 3BFJA 2AKEA 1NU6A 2OY0A 2IZ6A 5AJYA 1DG3A 3PIIA 4V03A 1X8LA 3RIYA 3NVDA 5EPOA 4F84A 5ALVA 2R00C 3T7TA 3PGVA 2QN8A 4KQMA 4WDQA 3TG8A 1U99A 4A23A 4FDAA 4EQ6A 4DR5B 1FXWF 4YO7A 1ZZEA 4P36A 3EZ7A 5HF5A 1BTOA 4DGSA 2BEWB 4F2GA 4XSVA 1X9HA 1RXIA 3LCVB 1K6MA 1UFOA 4PIVA 3N0WA 3DBVO 1DO0A 4G1UC 3ZH9B 1K08A 3RI3A 2OPBA 2WEKA 1X1QA 2B8WA 3OX4A 3JQ9A 3G59A 2MU1A 5CVDA 4AZSA 2W2LA 5GONF 3PC4A 1LSUA 3JAKA 4NECA 2AQ8A 1I10A 2IZOA 2WU8A 1ZC4A 3HB5X 3I45A 4D1YA 1K2WA 5BRNA 1ZW6A 3AB7A 4FN5A 3GJSA 1U1FA 4UHCA 3ZHSA 3KNZA 3IQIX 4FEGA 4FDMA 4MEJA 4Y0AA 2ZULA 1GKUB 1E4OA 3DOEA 3N53A 1QP7A 4HMPA 2VP0A 2BE9A 3ETJA 1T29A 1A7JA 2HPAA 4P3NA 2CDRA 2R62A 5M2QA 3CW8X 1SHKA 5GP1A 1JQLB 3AUUA 3OD1A 4DLPA 2ZUVA 3I32A 2HTFA 4OK3A 1NT2A 1NNI1 3HJHA 4XCVA 3ORSA 3ZXUB 3ANYB 2ZJYA 2VQFB 1J0EA 2I5PO 2PEZA 4IM7A 2C8LA 4TN1A 5PGMA 3VDQA 1YS9A 3GZ4A 5BRAA 5IG2A 2ZJFA 1N2ZA 4JIMA 1M75A 2G09A 3B36A 5B2FA 1OF1A 2ZR8A 4ODIA 2CK3A 3FOEC 1K06A 1X7GA 2BUAA 3G49A 3GGDA 4HLDA 1SG0A 4HWPA 5AW1A 4EUSA 2DG2A 3HXTA 3SAJA 1LZLA 4YV2A 3S8YA 4DM4A 1WXWA 1GPUA 1DP4A 1JT2A 4IG9A 4PO1A 3T1QA 4IJVA 3TBFA 4EBBA 1E1RA 1JDSA 4V0MA 2WWWA 1PJTA 4JA0A 3GUUA 5JZ9A 2J09A 1F3OA 3LXMA 3MFQA 3VR3D 3JAWA 2OXFA 4EAAA 4ARCA 2O4CA 4BRWA 1EE1A 1X7XA 5TNXA 1DX4A 2WJ6A 2UU9B 4POAA 1V8PA 2WWYA 1SB9A 3HO1A 1V9SA 1SRQA 1ZJ4A 1HFEL 1RYZA 4EG3A 4E5KA 1ZI9A 1AZWA 1I24A 1C4XA 1OZ0A 2G9VA 3GR6A 2NTNA 1WXHA 1A2KC 1UBUS 1QG0A 1QAQA 2FSVC 2QLMA 3R77A 4NZNA 5BW6B 3RRYA 5KKCA 4MVJF 4Y7CA 1W2GA 2ZYVX 4P0QB 3BFXA 4B3BA 4YP0A 3M9WA 2W8BA 4MUXA 3ILVA 4RY0A 4CDGA 3B82A 1SC6A 1YI8A 1F0KA 1ANKA 1PS8A 3EIHA 1WKCA 4QVGA 3VTZA 4LE2A 2CMFA 4Y2UA 1AK1A 5EKDA 2VEDA 3UIEA 1KZ9A 1QE3A 2ZI6A 2OC4A 4LV5B 4ND7A 3WWYA 3PJRA 2FUKA 2GO7A 3FDIA 4PYIA 1KAEA 4ZKDA 2OGTA 4LOLA 2AB0A 4FX5A 1AURA 2VDNB 3LY7A 1MVOA 5E0KB 1GPDG 1G8MA 1Z4LA 3T1TA 2B69A 4W82A 5DM2A 1YCFA 3CT6A 3M3HA 5JLAA 2YZMA 3EUAA 2ZUFA 4KIWA 1V25A 3HVKA 2HMSA 2UYQA 3H2YA 2HU5A 2R6GA 4R8VA 1P18A 3CEJA 4X3OA 4X71A 4MCHA 1Q7TA 3NIGB 5EWLB 3DOJA 1ORIA 1G4UR 2TSYB 3H2ZA 3IEUA 5FHQA 5EJ7A 1D4ZA 3GCZA 1OBHA 1PFKA 3FUUA 3I9LA 3P2KA 3PHGA 5IEBA 1DIBA 4A2QA 4EAQA 4EMTA 1HUQA 1AV7A 3K3PA 2ZDQA 3HE3A 4HLCA 1N5RA 1EK6A 2ZAIA 1GSHA 1WCV1 2BGJA 4ANFA 5JJIA 2GKSA 4I1UA 2R11A 4BBJA 3DEZA 1SWVA 2HCBA 5AMXA 2RH4A 1L1FA 3B6ZA 3QVTA 1KE2A 3QVSA 5KJ6A 3VPBA 4ALIA 5DCYA 3NTXA 5B3LA 1YSCA 4QPPA 1CY2A 4U9IS 3ZHZA 1WF3A 1UZNA 2PSEA 2TECE 4TTPA 4ZO7A 3SX0A 1HC7A 1MTOA 5DWDA 4K7JA 4X66B 1Q20A 4B40A 1T3TA 4TMZA 1AQUA 4A8JA 3TLAA 1CIJA 1DBQA 2XJ4A 1D5WA 1YUMA 3A9RA 4Q1BA 2A8YA 3QMPA 1R64A 5FJJA 2OD7A 5K4GA 1WB9A 5E6SB 5DHTA 4YAKA 5L4SA 4UU0A 2WSBA 2B5VA 1AV6A 2DSTA 1T8RA 4QLBA 5C32A 4RCZA 3OF5A 4BMDA 3WWCA 3DUFB 1K2VN 4XWAA 4AMBA 3NONA 4WFJA 1NBEA 4D57A 5FPTA 5K0BA 4I8IA 5IANA 3TYXA 3LS2A 4RQUA 1E94E 3SC2B 1X0VA 2VS1A 1RHKA 1XVIA 2EQBA 1B26A 3TQTA 3GLFA 3TW0A 2Q5QA 2QRVA 3OO0A 1R9JA 3CKMA 4O1HA 4O3FA 5DB4A 3WDKA 3RBVA 3G3EA 4QUIA 4BZQA 3K6SB 2C7PA 1EFVA 3P27A 2ZSBA 3HB1A 3PKJA 4NCJA 2PR2A 3K1JA 3WKEA 3OT4A 3QBEA 5G40A 2F48A 4KQIA 3THSA 3RVMA 5ENZA 4QXAA 2IV3A 4N6GA 2P27A 3AERA 3MVEA 4WE3A 2YZNA 2BGRA 2I4RA 4M54A 1QO9A 1J0XO 1RADA 3ZE9A 2HU7A 3SG0A 2GH1A 3K6KA 5J9FA 1MORA 5IN5A 2I76A 4OHOA 3WOVA 1N36B 3BEOA 2Z6AA 1D6SA 3QNUA 1E79D 3MT8A 3T3IA 3HU3A 5BNTA 4PSVA 2J08A 3PSAA 1EDOA 2ZWPA 3M0EA 4P54A 1N5MA 4PFJA 2QXYA 5IABA 2QTRA 3D8BA 1C7IA 5HWSA 3TNYA 1FIUA 4TWZA 1CPYA 4KZPA 4P3KA 2OV2A 1N8SA 3IEKA 3T12A 4HDSA 3G6WA 5THKA 1VBMA 5K51A 1CC1S 1IL0A 2ZUUA 2ABWA 3KWJA 1O95D 1MV8A 4A0GA 2PBZA 2WE8A 2YNMC 2ANBA 3MLEA 4JNCA 4NMHA 4O4JB 1AF7A 1C5KA 4ZI7F 4IHAA 4K8RB 3UYLA 5J3JA 2CFOA 2OR3A 1TTTA 3V1LA 5TF4A 2XDQB 4UTXA 1UKVY 2JW5A 1IATA 1GUBA 1KRHA 5LLDA 1OH5A 4FMCB 4B6SA 2JGRA 4RS4A 4MRRA 3MD0A 4B3FX 3AXTA 4EW2A 2VSNA 3R6GA 4IH1A 4JUAA 2DLNA 4ONEA 4URWR 4Y2RA 1JHUA 4NL4H 4CM5A 2C7RA 2FFHA 1C9MA 1DHTA 3KWMA 4RQAA 2Z8ZA 4A9AA 4WTOA 2C2WA 1KBOA 2AEMA 3KQMA 4QM6A 3VO2A 2AI2A 3LMKA 1ESDA 3LQRA 2GMWA 2OORC 4DC9A 4C7XA 3U61B 3UXEA 4EGCB 3ZS9A 4MW5A 4AI6A 5KYXB 2I3ZA 3RCBA 3EZYA 2D54A 3IOBA 2VP5A 1Y42X 5BPHA 4LY9A 4TT3D 1P2BA 2RSLA 5A4KA 2HNAA 1AVTA 2HJWA 2CLMB 2MINB 3F6RA 4M0CA 1IEXA 1U8EA 2AOUA 2PX3A 3C43A 4JK3A 3GPLA 1CJVC 3ZN2A 5C1PA 1CE8A 3EIWA 1Z0KA 1IEQA 4GI2A 2ZSJA 1M2OA 1TAQA 3ZJ5A 2ZGVA 3FWKA 1KFBB 4QULA 3A1FA 1U0OC 4FLEA 4L28A 1PJQA 2Q8QA 2XT0A 4IHJF 3ZWWA 5GGXA 3ZE2B 4HDQB 2JK1A 3AEQB 3G7NA 1P1HA 1QO0D 4KGVA 5JSFA 4X62B 3HXMA 4Q3LA 2IS4A 3N2KB 2OBLA 1YB1A 1L6IA 4IJUA 2HNKA 2AMYA 3V1TC 4JAVC 3IIMA 3K6RA 3PQ8A 2FMUA 2QAGA 1P5JA 4QSMA 2BL4A 4F7DA 3O91A 1MJGA 1WSAA 3ECAA 3PL5A 3V4OA 1KYXA 2EGGA 8MHTA 3VR6D 4DIDA 3BORA 2A33A 1APBA 2IQ5A 3FNIA 1JQEA 3KZCA 3UMRA 2EBHX 5CCBA 3A1VA 3A3NA 2QRQA 1DUSA 1L7EA 4M0MA 3AGPA 3H86A 4UHBA 4XB6B 3BMOA 1GL3A 4IJ5A 4L6IA 4ZEXA 2F17A 2BR4A 3F8SA 3C8ZA 4RF3A 3IYLW 1Y4DE 1UPAA 1C29B 3FF1A 3P9NA 4U7PB 4JVMA 1S3SA 4BE7B 1K5HA 1IWOA 2HBYA 4FR2A 2O20A 2EV9A 3LH5A 1D3AA 1JNYA 1O7JA 2HR1A 5F1OA 1DV1A 1E0DA 1RFLA 3HZHA 1K0UA 2GPWA 3LFHA 4Y30A 2WTNA 3WVNA 2QRKA 1J2EA 2Z3ZA 4BMXA 1FEZA 2Y4NA 4BJ1A 1XDSA 3FE2A 3ZDYB 2GBPA 3V8MA 1DARA 4P2GA 4ZT2A 4X61A 3WRXC 4JQZA 1BCSB 1MKYA 1EDZA 1QIGA 2JD2A 2QTFA 4EGSA 3LWBA 3HJNA 2XGOA 4KE6A 2OCBA 1PW5A 3H8WA 4U2GA 1PG2A 4R2LA 2VI5A 4U8HA 2QSZA 3RADC 5A9SB 2WSYB 2RHDA 2NXEA 2H2FA 2HL6A 1VQ1A 3A06A 4FEYA 4FSXA 4KV9A 4L4SA 1JHRA 3OPMA 5F52A 1GADO 1T0BA 4NF2A 4LQDA 4UBIA 3RC7A 2VBIA 4J1SA 3DYIA 2I6TA 1WX1A 4KXWA 1FMLA 4LFCB 4FEEA 2B1IA 2LXNA 3KEQA 4B6PA 3TMKA 5FOUA 2R5WA 3DE6X 3U3JA 2PV7A 4I4TF 2WMNB 3ROTA 3S81A 4WY5A 2ACEA 4PXAA 3TTWA 2ORED 4YCBA 5CLLA 2VDWA 4D92A 1UM9A 2WC1A 2B37A 3NHZA 2NV0A 1N8NA 1TUBB 2QNRA 3NBXX 3HCBA 1C0EA 3MWYW 1FSPA 4YP5A 5HFAA 2ZYSA 3P2YA 2FPPA 2YVKA 3ACCA 5B2ZA 3D3EA 3E48A 4WY8A 1WLSA 1ZNYA 3FTNA 3O4JA 4HN2A 4MUYA 1WY7A 3GLSA 3UH1A 2Z1DA 1RTTA 2Q3HA 3OM8A 1LBSA 3B3QA 3W7VA 2YFQA 4FUTA 3TQHA 1D1QA 4GECA 2P4HX 4RXMA 1L4BA 5L3SB 3QI7A 2YICA 2FHSA 1U3DA 4S2UA 1H65A 1XZCA 2JIZD 3CZMA 3D2CA 2HA4A 5TGDA 2ZBPA 3D7LA 5AKKA 2WWHA 1JHOA 1QGDA 2OXEA 2BM1A 1AKQA 1IM2A 3U4QA 3H11B 4FHCA 4WOKA 5BYJA 3S28A 5FUQA 5TQVA 2GEDA 2V0NA 2HWYA 4MWTA 5EJGA 1SU7A 2CFIA 2P9HA 5FULA 3V1KA 2A94A 4FDTA 1P0PA 1XXHA 1J5EB 4CEJB 3EEIA 1DTSA 4KE9A 4DVGA 1CS0A 2E1RA 3TE6A 3D64A 3U40A 3UAGA 1FBNA 2YXBA 2A5GA 3C6MA 2JGFA 4RTSA 3LUKA 4A26A 1AXEA 3TSWA 3WTBA 4QSHA 1RWKA 3TFWA 2BGNA 3UFXB 2DZDA 1V8DA 2QP9X 5JBNA 3OJCA 3QPDA 1C1XB 3L46A 3FWYA 2PVPA 121PA 4Y9RA 3TD2A 4E14A 1E3LA 4FGSA 5K0GA 2RHHA 1VG9B 2O1XA 4YUVA 4EF6A 3HCNA 3L2OB 4CYMA 2AH5A 2P40A 4OOEA 5AK3A 3RFCA 4YRJA 3RNLA 4AAYA 4JC5A 4NU6A 3JYOA 5B1SA 5JYBA 1YTLA 3C3AA 3W1VA 4QGBA 1R5NA 2HSDA 2EWWA 3B2EA 4LSWA 3ADCA 1FDUA 4Y2TA 3NUQA 1WVGA 2IEZA 1CF9A 3I2KA 1CHDA 1P0FA 2Y66A 3I2IA 5HF9A 1F8GA 3SC6A 4TQGA 1XCJA 3BJIC 1YB5A 3VNBA 4A5OA 5LVAA 3RUHA 4EJMA 5KC9A 1KZ7B 3GXOA 4W1RA 5CLQA 2HW8A 1AXRA 2H4WA 4MR7A 4CM1A 1KEEA 1Y3CE 4LBVA 5G0TA 3WICA 5CEEA 3OWHA 5J2UF 2YINC 3LCRA 4JA2A 4MDFA 5TEWA 1H1TA 1CUUA 5EJ5A 5KPDA 1VKNA 3SYTA 1U8TA 3FHLA 1T2VA 1L3IA 2OHHA 1TIBA 5CA1B 1U2DC 5HK9A 1Z7WA 2XSZA 4Z99A 1IZ9A 4AZTA 5CGQB 4IZHA 4LY6A 2YJ5A 1FUUA 3EEQA 5B5SA 4IEFB 2YMPA 2F55A 1XVTA 2RIPA 3V7FA 4QRIA 1U80A 4OPMA 1NW9B 1QQ6A 4Z0HO 1SVOA 1GPWB 3ECSA 1HDZA 3ZQJA 1E69A 4EDFA 4L22A 1DWOA 2QGNA 1SEPA 3M6XA 2WU4A 5DRYA 1FJXA 2G80A 221PA 4HNAB 1AQNA 4JI0B 5LQJA 4HV4A 2HZBA 3WE7A 3Q6IA 3L4BA 1CWUA 3FPKA 4YRBA 2DUNA 2JBAA 2RGNA 3QG5A 3QSGA 1U28C 2CKDA 4G0PA 1UKYA 4GC9A 3IULA 1EZ1A 3TGLA 2SKDA 4MGKR 1NJ8A 1QDLB 2GXQA 4IXTA 1GNLA 3VJMA 4TTAA 4EJ6A 1Q3KA 3HI4A 1LNZA 3L0YA 1NP6A 3S55A 1NUQA 4LDQA 3RS2A 2E4WA 3A4YA 3OJWA 2XUGA 5JTTA 2FN4A 5HPYB 5A5GA 2ZBUA 1XDUA 3SK0A 1KIAA 4ZVRA 2WVGA 2WJZB 1NM5A 1IZYA 4QYIB 2VHYA 3QQPA 4PRZA 3I2HA 3PDWA 3O1IC 5BN3A 3UKOA 3D4BA 5FBVB 4HPXB 2HLPA 1E4YA 2VP6A 4A2CA 5JAPA 5JANA 1MO2A 2FWPA 3Q8MA 2C9OA 4FT4A 1N6NA 2H59A 3KO8A 4YMHA 1IRIA 2DQKA 3B9PA 3R3UA 5AVXA 1PSWA 4AZWA 3IODA 1LTHR 2IP2A 4RETA 4QEDA 3VR3A 3OU2A 3USES 1PQWA 1WMEA 3ETEA 4MHSA 4XWGA 3SP1A 2HHCA 3HLKA 3W5UA 1AKMA 2IF2A 3TMYA 4DR4B 4LF7B 4RANA 4NCKA 2FPLA 1KH3A 4PYQA 4MROA 3IVMA 1N1EA 4FBMA 4AY4A 3OIGA 1U0FA 1SCDA 2R65A 4IJWA 1II8A 3R5HA 3R0ZA 4RH3A 3V55A 1GQOA 3COYA 4N5IX 3A32A 3UWPA 5E6RB 3F3MA 4AMVA 1L5MA 3R4VA 3HJFA 4HEJA 1Q57A 3F1KA 4QUBA 2ZRJA 5IAJA 1KRWA 1R66A 1M2HA 3G2HA 1T8TA 1U0TA 5DWQA 1G8HA 5FO0A 1XZJA 1YOBA 3EA0A 4KYVA 5DRTA 2Q5EA 1A9YA 4XQ9A 4HJRA 3K0FA 5EL0A 4B7CA 4DR1B 2IGBA 3JVVA 4QOJA 1KPIA 1OU4A 1RHQA 2OO5C 4J9UE 4XOUA 2WP0A 4RFVA 1IOLA 1ZONA 4OAQA 2QG9A 2WKPA 3RYHA 2W6CX 1AD2A 1I2BA 2NSLA 3UT6A 1N92A 1OWLA 1P1JA 2FZVA 4Q02A 4JLUA 3AP1A 1JSCA 2L17A 1RNLA 3MWEB 4G0YA 4ZVPA 2C1XA 3Q0TA 4LVCA 4IDAA 3UB3A 2WUVA 4HMQA 2CNNA 3EASA 4MW2A 4Y2JA 3WLRA 1EAYA 2ZVQX 3MFYA 1X3LA 1QOPB 4JB3A 1CB7A 3Q2OA 4UMVA 4WADA 2YC2C 5HE8A 4YRAA 5FWXB 1IWBB 2XF8A 4R1PA 2Y8EA 3ZDBA 3DR5A 3O8LA 1O6GA 3WLEA 3AESA 2IHVA 2PL1A 2BWJA 1L5NA 3F67A 1JLMA 4OB8A 3WFJA 2ZEJA 3H1TA 1T5DX 3EPPA 4IJMA 4NMWA 4DRXB 3FIJA 5A4FS 1EFPB 2EFCB 4Q4HB 3PZBA 2F67A 3PRKE 1UBCA 5HIIA 5BQPA 4QVIA 4TYWA 4E6EA 4K2HA 4RD3A 4OBXA 1IN7A 2QE6A 1TUEA 2W83A 1Q1AA 1SK9A 2ZSHA 5AM1A 3R9XA 4XYMA 3RJMA 5BSRA 4FDUA 1RKBA 4J6FA 5FOQA 3LPDA 4KO1S 3A9TA 4K9LA 2H1OA 1NZDA 5EHXA 1HM5A 1JG2A 3PF9A 2Z4RA 2GX6A 2Z2YA 1VLJA 2B9VA 1M5TA 4BLRA 4E15A 4OA5A 4GLOA 5BOSB 2XCOA 5I4BA 2ERYA 2E7ZA 2KB0A 3E81A 1WHTB 3KE9A 3QKWA 4M1OA 1JSXA 4EEZA 4XQ0A 3EW9A 4TTVA 4C7KA 4AU1A 1QFJA 1YZVA 4YBRA 5HG0A 1PUXA 4U6SA 1HX7A 5HZHA 1ETHA 4HRXA 4C05A 1AUXA 3F2IA 3WYEA 5BXYA 5CYPA 1XQXA 3EXHB 5ANRB 1QUFA 1RM5A 4UPEA 2CVOA 4HLNA 1SHJA 2IYUA 3ZV6A 5JMTA 4HDNB 5KJCA 2V1XA 1WDWB 4XIYA 1XLTA 1DELA 5HOQA 4GGOA 1RCFA 5HUHA 4TVOA 1T8YA 3OCZA 4KU4A 2OFWA 5K8IA 4XB2A 2I66A 4Z1MD 4BV8A 3ZV3A 1E79A 4BAUA 3JQQA 4X1IB 2R751 3NGMA 2QZPA 4RJJA 1WBBA 2FMTA 3CCFA 4LF6B 1N2HA 3CLKA 3KYJB 2HH9A 4J4TA 4Q4JA 1E6WA 3EXFA 4HZIA 1Z62A 4CLOA 1FRFS 1PVOA 2VG8A 1O95A 5JHGB 3T9BA 1FFDA 1SULA 2BLLA 3KB1A 4AZ3B 5H5JA 1IBLB 2WF7A 1YA8A 3G17A 1USGA 3JATA 4GP6A 1OWMA 2EKBA 3DE2X 4IIFA 2QI9C 2R6DA 4GBED 1E2UA 1L2TA 1S2NA 4TWBA 1QCYA 1SO8A 4GEKA 4ZKEA 3RG8A 4JR0A 2YUTA 1D2HA 4NHEA 1PJRA 4TWIA 2C1EA 2DSNA 4R1QA 3FPJA 1NULA 1PWZA 1QQAA 2E1PA 2X1VA 2AJLI 3FOCA 3IJ5A 1NXPA 3GRKA 13PKA 2QQFA 3MERA 3MJTA 4ZYVA 5C8VA 3WYNA 2YFKA 5LQNA 2QD5A 2UYHA 5E1BA 2FLWA 3KKKA 2AG0A 4Z53A 1N7GA 2F9MA 3LSTA 3FCCA 3KLPX 1PD1A 3D0QA 2HDOA 3OCWA 1AUPA 2BFWA 4ZJUA 1ZG3A 1IY0A 1QHYA 2OV6A 3DTNA 4UBNA 5DNUA 5LUBA 1TQ8A 4M99A 1GZ6A 4TT3A 3SDBA 3WNBA 2VIIA 3WRVA 1NF9A 1I6LA 4PG5A 3KDAA 3BB3A 1NIJA 3OCYA 2EZTA 2VTDA 3K0CA 4NZPA 4Y3UA 1UBGA 1FXUA 4DV5B 1QQ5A 1NDHA 1Y82A 4YI3A 4UOZA 2W6PA 3FLMA 2JLVA 3IQWA 3Q5GA 2EQAA 2GCIA 3HB4X 4NR0A 3TD6A 4JJZA 1XCPA 2HQBA 1M67A 1Y80A 1VSBA 1JWAB 3L49A 4J43A 4B35A 5FUXA 5F1YA 1C2TA 2B8EA 3N6RA 1RP1A 5KNBD 1HTTA 4GUAA 5DV9A 1HT1E 5DMHA 2CJFA 4PZ0A 2Q45A 4N01A 4PZLA 3DLBA 2GNPA 4CETA 1KQPA 4M1YA 2GA9A 2HMAA 1Q7BA 4NE9A 2X4GA 4TPKA 1UJ6A 4WOCA 2BEVA 3C3CA 3TNDA 1SUWA 5J2TB 4MDHA 2WUFA 3WGUA 3Q12A 3TLXA 4CIVA 2I1VB 5ALWA 3B3FA 1AGYA 2I4IA 1XKTA 1HZZA 1C1HA 1JZTA 3ZNPA 1MUUA 1XQ6A 3COPA 1T4CA 3NW9A 4D9BA 3V1UA 5KYYA 2LVBA 2NZWA 4KJXA 3DEAA 2G77B 3NCTA 3PLRA 4MV3A 2QTGA 4AJIA 2O8FB 1MMFB 1V96A 2IHTA 3AHCA 3ZEAA 1J5XA 5MFZA 2O8DA 2YHAA 3UEOA 4CMAA 5CK5A 5G4KB 4A3SA 4LEIA 4GX1A 3X43A 2JHPA 3H0EA 1AS0A 3ICCA 4QXRA 1NF8A 1XEXB 3C8UA 2C54A 1O96A 4EUFA 3GMSA 3JD2A 4WD3A 4WKPA 3KT0A 3DLIA 3QELA 3PPYA 1JHAA 3ENZA 2Q9UA 5IAGA 1E3DA 1NMYA 3Q9LA 2ODEA 1I7QB 1N5DA 1OLUB 2JVKA 3JS5A 3V4VB 4EFDA 3UAOA 1F8YA 3A4NA 5DYTA 1MXFA 1KI9A 4BV3A 3UA3A 3RTBA 5GAJA 1OZFA 4RAQA 3A0UA 1LLDA 3IUMA 1G8SA 1O2DA 2P2SA 4Y2VA 3JZFA 1FYXA 3JQGB 4F56A 5JDIC 2CZGA 1D04A 4BLVA 3VRHA 3IP7A 4UE3S 2NUPB 2PUWA 2W93A 2Q9BA 2P2GA 3BE5A 1E9AA 1N8TA 3ND9A 3CEHA 2UUPA 1M6WA 1XTUA 3AUXA 1Z06A 2OQIA 1ACJA 4PS1A 3BD9A 4JKOA 4U2FA 4I55A 3I64A 4RS3A 4C0WA 2H92A 3H2HA 3EGEA 2W98A 5BT9A 2HHLA 1SC3A 1HO3A 3NC1C 1TM3E 3QEOA 4RF5A 1XZQA 2OQ2A 3WLOA 4D6YA 4ETWA 2M6SA 3VO9A 1C8VB 3PWSA 1VBNA 3O7MA 3UXYA 2WFLA 1EJ6A 4WT7A 4DANA 5CK4A 2BTEA 2ZRPA 5D8DA 1U04A 1GPNA 1OMOA 3FCEA 4ENRA 3Q7EA 7REQB 4X24A 4TS9A 2XMRA 2MCFA 4DBVO 3EQ2A 2IU3A 1V5GA 1O87A 1UDAA 3P8ZA 1A8QA 2WU0A 3C5EA 3FZGA 1UXGA 1VMIA 3KHSA 4JYBA 4ZVOA 3S40A 4BVBA 2J6BA 3NT4A 4LYFA 5K3CA 5LMUB 3RAFC 1VCHA 3IURA 3WDMA 3OKCA 4PO8A 2DPYA 1PJBA 2JIZA 4A36A 3LHDA 2C4HA 3PWZA 1OXMA 4MYSA 2YC4C 2EZ8A 1X2BA 1HZJA 1W73A 2PXCA 3EQ7A 5FADA 2HY7A 3GN1A 2X41A 3K0HA 4P83A 4MQLA 2WSLA 3GEGA 5ES4B 2R1TA 1H9AA 1KXZA 3G5UA 4J1QA 4MJLA 4QBGB 3U3DA 4CT0A 1Q74A 4G4GA 2GCOB 4UHEA 4LZPA 4UNPA 4KH1A 3AHJA 3PB3A 3KYDB 4ER3A 2CCJA 3KK0A 2JBHA 2C5FA 4IEEA 2NVBA 3G1UA 5B53A 4AO6A 2FW9A 3TNFA 5JQGF 1NKTA 4LZOA 2JKVA 4UPVA 4ZOEA 5C31A 5BUSA 3EC1A 3HDQA 5KNCD 5IUNC 2BDUA 2VJAA 5FV7A 4HWRA 2G04A 2X1LA 5A5DA 5J23A 3U4MA 1E64A 3IP6A 5JZOA 2CD9A 3IIJA 4F6CA 2BGGA 1CP3A 3PJEA 1E1QD 1FU7A 1XQ1A 4OUKX 2WYOA 4Z4GA 1I36A 1RXCA 1Y4SA 4Y9UA 3LPNA 4JJEA 2IXDA 5DI3A 3IH5A 4FE4A 1PV2A 2DCUA 3IQXA 4N6NA 1YGYA 4KH0A 3B13B 4TT8A 1ECPA 1V11B 3VAAA 4EA8A 2BN4A 1O6BA 1QZXA 1DSSG 1T9HA 2W8ZA 1Q12A 4RZXA 4N7MA 1WP9A 4OQEA 4TMYA 1YWGO 2SKCA 4TWAA 2WQ7A 1RC8A 1HNXB 2O0MA 1CNEA 4QUKA 2QIPA 4HTFB 5I45A 3PU6A 1E6MA 2PY6A 3RLFA 2JJYA 3H5IA 2AZ4A 5KNCH 4W9RA 3GVIA 3OWXA 2A4KA 3QLVA 4Y7DA 4PGMA 1JR3E 2GF0A 4EG5A 2H9IA 4TMXA 2J46A 2C20A 4O2AF 1NQVA 2VA9A 2MSWA 4ZCTA 4CCYA 1SVNA 2PBLA 2GZ2A 3Q3GE 4XDZA 1O8CA 2POQX 3H9UA 1CD5A 3E8MA 2H6EA 3DAOA 1PRYA 3C1OA 3BSSA 4UTOA 2P78A 5H8WA 1ZK0A 1ESZA 1KJJA 3PA8A 4NS4A 5CM2Z 1G1MA 4ZEOA 2MOKA 1OFVA 2FQQA 1GRCA 4M4SA 5L40A 1JAHA 2AHOA 4BMSA 1QGYA 2VTVA 3BQMB 2PMCA 3ENVA 3H99A 3U37A 4K6HA 1V16A 4P4UA 5B1EA 3PFGA 3LC1O 2C2XA 3NC4A 3AYZB 1PFYA 2NUAB 1ABBA 1MOZA 2OFFA 3RSOA 1GUDA 5LC1A 2QI9F 4E2ZA 4UZEA 3W9BA 3OZCA 3KXKA 2NU7A 1P1BA 1PIWA 2NZ8A 2ZJ4A 4AUMA 2PV0A 3HN7A 5KJFA 3OC6A 4UQLA 1H3NA 1M1ZA 1UPBA 4WN9A 5AJHA 5G4LA 4P7KA 4FC6A 4RXTA 5H02A 1ONPA 1XTSA 4DDMA 4ZOCA 3LHFA 3BB1A 2OO3A 1UK9A 1RXUA 3ANTA 2V59A 3ROGA 4NOMA 2C5AA 4CM8A 2XQKA 1J2RA 3GDFA 4Q1FA 4GKKB 4BVGA 4KXQA 1YF3A 2ZT7A 1U0HC 4CI9A 3N2YA 2C2YA 2IF0A 5ITSA 4AQYB 1U7WA 1W4CA 5CAEA 4DJFC 2EIXA 4N7RA 3AK4A 2DOKA 4OD0A 2EFJA 2JEYA 4DY4A 1ONOA 4I3HA 4V1CI 1C0PA 4UEWA 4KXMA 3P9IA 3QVOA 2VWGA 1XE3A 4BLQA 3D4OA 3UKJA 4QDTA 1SKAA 4AFNA 3JQ9C 1TLTA 2ACKA 2PBRA 1KI4A 2QQGA 3WMGA 2OKCA 3E05A 2QTVB 5KHAA 3TLMA 4U3JB 1V6CA 3PK0A 4H31A 2DWOA 4IZOA 3INGA 1DRUA 1K5DA 2Y0BA 5SZIA 4FEAA 3K0EA 1ZA2A 2ZS8A 3WLKX 1G63A 2Q0XA 1OSNA 4BC1A 4DRZA 2YDYA 3LP8A 1YTUA 1B8UA 2KPOA 3N2GB 3VTKA 4Z7NB 1UBNA 2FWIA 4RTPA 1ZHOA 4ZAWA 5LZ2A 3K9NA 4ZYTA 4YJ2A 4TOIA 4AKTA 4NICA 4QM7A 1N75A 1BEZA 5FNZA 3N05A 3GQVA 2AG8A 1M76A 1L7XA 4H08A 4PAQA 5JWHA 1OU0A 3PI6A 5GGYA 4HQRA 1LPNA 2DUWA 1YI1A 3F46A 3W6PA 4O5AA 2OCXA 4AKGA 2Z6QA 1N4DA 3PQ2A 3BXOA 3OOJA 5LD2C 3RANA 2H52A 2Y99A 5A71A 1NX9A 1MAWA 1N6IA 4KE7A 2P91A 5HKAA 3B12A 3LF2A 3QF4B 1N2SA 8ATCA 2W2XA 2CLLB 1OVGA 3DJFA 1OYVA 5BSWA 4Y0NA 4A0SA 3OOSA 4OGLA 2AF3C 3NOXA 4R2MA 4C6SA 3ZDQA 5JVDA 3R0XA 5CEJA 1IEVA 4V38A 4Q5IA 3QWIA 3U7HB 2A0KA 4G0UA 1U9IA 1QE0A 5CBPB 3SMVA 4YVFA 5LB4A 2C5GA 4OXRA 1EG7A 1DIAA 1YJAA 2AV6A 1O89A 2O14A 2CDBA 1O5OA 2J3HA 4TM7A 3SHQA 3L7YA 4NABA 1SB8A 2P9BA 2P77A 3K5HA 1JU9A 1DOHA 3HFRA 4KDEA 5DBFA 1JEYB 3KDSE 1ZMTA 2HCJB 3RIEA 1E2HA 1V8FA 1Y3AA 3GLQA 2PVSA 1F0PA 3I73A 4EY6A 3QZUA 3GJ0A 3LCJA 1CDOA 3TDMA 1Z34A 5TLSA 1K6EA 5HP4A 1ULBA 1HMYA 2HF9A 5AI6A 5EP4A 4QBFA 1VL8A 2P9GA 1MC4A 4EFNA 4E5UA 4UHJA 2J5XA 3RJ9A 4E5NA 3N8KA 3U81A 2LV8A 2WOJA 3FMVA 2BISA 4BVHA 1V5FA 2WD7B 1ISRA 1LWNA 1O58A 3C7DB 4GIBA 3WHKA 3S5JA 4CHTA 3EISA 1T3LA 1ZOIA 2XQJA 1P6XA 1OWOA 3EULA 1SXHA 1GUZA 1SA0B 1YBAA 3O8BA 4L1KA 4ZOLF 2ZU6A 4W1PA 1RWWA 2V7BA 1VLLA 4JBLA 1FFBA 4LOHA 3LVQE 5D01A 3FB4A