2XDYA

Crystal structure of the n. crassa qde-2 ago mid domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
127
Chain Sequence
b'KIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
publication title Crystal Structure and Ligand Binding of the Mid Domain of a Eukaryotic Argonaute Protein.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
total genus 41
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xdyA00
4KNYA 3LUFA 3O75A 3QLVC 3DGFC 3G85A 1FFGA 1C0EA 3NBMA 3I5AA 3LUHA 4M88A 3IP6A 4QYWA 5DCLA 2IPLA 3H5TA 5JNTA 4MR8B 1QQBA 2W42A 2QU7A 3IP5A 2CHEA 3DZDA 4W5RA 3LOPA 3QEMB 4KV7A 4F11A 4N47A 3HDVA 5ED4A 1Z26A 2HJ9A 2L18A 3FGZA 1ZGGA 2GX6A 1T34A 2IYNA 2L19A 2QXYA 4MGEA 4MQEB 4YLEA 2CD7A 2ZAYA 4G0ZA 2PLNA 2TMYA 2A9RA 4G0YA 4O1HA 4XARA 1H9CA 1URPA 5TE9A 3BRQA 3S99A 4W5QA 2JK1A 5FWYB 4DADA 4Z4IA 4EVRA 5TPZA 2WMYA 2PUEA 3OQNA 2QW1A 3N0WA 4ZJPA 4LX8A 2RGYA 3D8UA 4ML3A 9ABPA 2CHFA 3JPWA 1EWVA 3HM9A 1RZRA 1YIOA 2GWRA 2H0AA 2JRLA 3H1GA 2B4AA 4H3HB 4B09A 3HVRA 1XHFA 3EULA 1D4ZA 5CNMA 3HO1A 4F12A 4TMYA 3EDCA 3N6VA 1QPZA 2PUCA 1SXIA 1P2FA 1ZH2A 1DZ3A 4JP1A 5KC8A 4JAVC 4YO7A 5KWSA 3RH0A 3QX9A 3I45A 1P6QA 1VKRA 3I42A 3TB6A 2ID7A 1L5ZA 2CWDA 4O5AA 3NNSA 1JH9A 2QZJA 5EWLA 2PUDA 5TQ0A 1IIBA 3UUGA 4KRFA 1E6KA 2PE5A 5IC5A 4D6XA 3MIZA 4MYRA 4RKRA 1NY5A 1TLFA 3T38A 3RVPA 1A2OA 3OLYA 3QEKA 2PL1A 3H5OA 1KRXA 3QELA 1U0SY 2M1ZA 1LK0A 3O2QB 4YCSA 5JNUA 5I4CA 4WWHA 3DLHA 3F6PA 4JB2A 5TPWB 2GBPA 2NZVG 1DJMA 4MRMA 3MMNA 4HNQA 5FBKA 1Z25A 5ABPA 2PAFA 1RXEA 3LUKA 4Z0NA 3RVOA 3HSYA 2PUAA 4RWEA 5EWJB 3JY6A 2FN9A 2WJWA 3FFXA 4IMJB 3RVMA 2HQRA 3M9WA 3H6GA 5IUKC 5BRAA 2MYUA 3H75A 4WXMA 2HSGA 4EYKA 3FFWA 5IULC 2PMCA 4XLTA 3RVQA 4EVSA 1TMYA 2FQXA 3KSMA 2RJNA 4ETNA 4XXHA 5C5CA 4HNRA 4H60A 1M2EA 3OLVA 2A9OA 4Q6BA 3MF4A 2XDYA 2FVYA 3OLWA 3RVKA 3E3MA 3ROTA 5KC9A 5DLEA 4JOQA 3OLZA 2WRZA 4G97A 3N75A 4D6YA 4ZPJA 3RVNA 3M9XA 5CHYA 4YP9A 3GWGA 5IUNC 1FFWA 1BDIA 3DGEC 1W25A 1PEAA 3HCWA 3N8IA 4RSMA 3CZCA 4YGXB 3CFYA 1APBA 2FEPA 1ISRA 4RK6A 3H1FA 1TJYA 2VYCA 4KVFA 3OQMA 3KLOA 2LIVA 4N76A 1M5UA 4PEVA 1YK0A 1Z2EA 3BRSA 4Q7EA 3G1WA 4IILA 1Z12A 1PNTA 5T3YA 1KMIY 5HQJA 1I3CA 4MS4A 3B2NA 3P9YA 4WUTA 4G0PA 1FFSA 3KKEA 1QNLA 3H5VA 4RK4A 2YHBA 3N0XA 2E4WA 2VUHB 4OTZA 3IPCA 3O2JA 1PNRA 2O20A 1DCFA 1PHRA 2FEWB 2FKAA 1Z16A 3A3KA 3FFTA 4IF4A 2ZWMA 4LE0A 4ZMSA 3NNDA 4N0PA 4RY9A 1LBHA 1P6UA 3BREA 4IRXA 1JL3A 4KFCA 4MS3B 1MIHA 3BILA 4UHJA 4RS3A 3LUGA 1NXSA 4MLCA 4IMIB 3CZ5A 7ABPA 1VLZA 4CBVA 1JFVA 1ABFA 1Z17A 3LMKA 3SAJA 1EAYA 1E6LA 1SD5A 2QVCA 3T6KA 4YRZA 3C3MA 4ZMRA 3H5WA 1DC7A 3GYBA 1JWLA 2E4UA 4PE5B 2V0NA 2P9HA 4KPYA 3OLXA 4Z9AA 4NICA 3O1JC 3ILHA 4MQFA 1A0OA 1U8TA 3F7NA 2I6FA 3GL9A 1YTUA 3CLKA 3H5IA 2E4XA 2L17A 1ISSA 1GUDA 1LJUA 1TVMA 2FQWA 2FMIA 4MR9B 3DBIA 5T7BA 1ZVVA 1Z15A 1FQWA 1D1PA 2IDMA 2R47A 3KCNA 4QYMA 4EYOA 5JNSA 3N53A 5IEJA 4Z4FA 1MB3A 3RVJA 4F06A 5BR1A 3A0UA 3RVRA 1QMPA 4P98A 4Y9TA 1ABEA 3VNAA 4HNSA 3KHTA 3QLUA 1GUBA 1QO0D 1NXOA 4KZKA 2Q5CA 4YR7A 4MS1B 2X7XA 2QSJA 4W5TA 3CRNA 4KQCA 4G0XA 1QQAA 2N9UA 2JBAB 3E61A 4MR8A 1JYFA 2MSWA 4H3KB 1C4WA 4Z4GA 4RK0A 1NXPA 1NXXA 3GV0A 3JTEA 4RK7A 5HSGA 1SXHA 3QEMA 5HKOA 1DCKA 1DC8A 5IEBA 5C5EA 4ETMA 4JASB 5TQ2B 4NCAA 2FTKE 4LE1A 4MQEA 1KRWA 3A0RB 4RXUA 1NATA 2IPAB 3HDGA 4Z9BA 4YV7A 1R8JA 3LKVA 4LDZA 2NUBA 5KQPA 4EYGA 1VRVA 3HUUA 5FWYA 1ZN2A 3EJWA 4TLLB 5DGCA 3F6CA 2HQOA 4LRQA 4RY0A 3NHMA 4RK1A 4WXEA 3M6MD 1EFAA 1QKKA 3CNBA 2FSPA 3URMA 1F4VA 2FMHA 3OM0A 1U2QA 4NQRA 5EWMB 1E6MA 3CS3A 3QLUC 4ZYLA 3UK0A 5IUJC 3DLBA 1ZITA 2FMKA 2LP4Y 1MB0A 2FEKA 1SRRA 4F3TA 1P8AA 1Z2DA 3MA0A 4G0MA 3LTEA 4KQ9A 4MLDA 4HYEA 2PUFA 1JYEA 2JVJA 4OLBA 1DRKA 3LUAA 3N0RA 1AB5A 1USGA 2E4YA 3CTPA 4O1IA 4EGSA 2GKGA 2PUGA 3JVDA 3SQNA 1GCAA 3LUCA 4KMRA 3SNKA 5JNWA 3OQOA 1NXVA 5JS2A 5GQSA 1RXIA 4FE4A 3R0JA 1QO0A 1D2AA 4DN6A 2QR3A 1BDHA 5IBQA 1JX6A 1LJLA 6CHYA 3D02A 1PEYA 2WWVD 2YHAA 5TPWA 3O1HB 4MR7B 3TD9A 2M98A 1CYEA 3Q7RA 1U04A 2HPHA 2FLWA 3JVIA 2VK2A 3KTOA 5EWJA 4Z4CA 1S8NA 2WB4A 3JS5A 4S04A 5FWXB 4GNRA 2JCGA 5CNJA 1ZAYA 1L5YA 4JA2A 1VPWA 1WETA 2MYTA 2P4UA 1QP7A 5DTEA 3GRCA 1DBPA 1JDPA 4W5NA 3H1EA 3K4HA 1A04A 5JNVA 1W9HA 2QVGA 4PICA 1RZRD 5IX8A 1DP4A 4D74A 5BRJA 2WJAA 3MM4A 5JS1A 4YWHA 2LUOA 3TX6A 4DQDA 4EVQA 4RXMA 2PL9A 2PUBA 2AYZA 1MVOA 5F64A 2R25B 1DG9A 4WZZA 2PJUA 3Q7SA 3K9CA 3MYYA 3OMWA 2VUIB 5TQJA 2JVKA 6ABPA 3KYJB 4RU1A 1TM2A 4E7OA 1FSPA 1J56A 4Q6WA 1XHEA 1GCGA 4UHKA 3GBPA 3KYIB 2IKSA 2FMFA 1YK1A 2LPMA 1BAPA 4Z4EA 3C6QA 1YMUA 3IDOA 3Q7TA 4OG2A 3TMYA 1JHZA 2MSLA 3H5LA 2AYXA 3OM1A 3SY8A 3TO5A 3C3WA 3JPYA 2R48A 2MYNA 3OMXA 2PKXA 1EWKA 4MAAA 2ID9A 4MS3A 3O1IC 2LBPA 2B1JA 1JFTA 5JNRA 2RDMA 2DRIA 4NCBA 1OXKB 2IOYA 4RKQA 4TLMB 3L6UA 4RK5A 4N03A 4G0OA 2KYRA 3IPAA 5EWLB 4KK3A 3HXMA 2BGGA 5TQ0B 3O74A 4G86A 5KI6A 4G0QA 3NNNA 1ZHHA 3ILYA 5KQLA 4RZSA 3EGCA 2E4VA 3LFTA 3LUDA 1DBQA 4L4UA 3H6HA 4OLAA 3QELB 2GI4A 1YMVA 2HQBA 2MYPA 4MR9A 3CG0A 4W5OA 3L49A 1KGSA 3KLNA 1M5TA 3Q41A 3ROFA 3EQZA 5CNIA 3VNBA 1ZDMA 4RV5A 5E3JA 4XFKA 4MRMB 2L2QA 1YS7A 3IP9A 1UDRA 4PYRA 2F8TA 4FE7A 1U2PA 4E7PA 4MS1A 2A9QA 4RDCA 3SM9A 2JBAA 1OXBB 4L85A 1ZH4A 4TN5A 4XAQA 2RJOA 4Z99A 3Q15C 4OBBA 1EWTA 3CKMA 4FB4A 1BDJA 1DCMA 2E4ZA 3C3KA 1BA2A 1JDNA 2J48A 1XWWA 1QP4A 4WT7A 4QPJC 3HK2A 4ETIA 5TQ2A 2FW0A 1Z13A 3KG2A 3OO1A 3CG4A 4KK4A 1NTRA 3SG0A 3T8YA 1CHNA 5DKFA 3RVLA 3O21A 2NZUG 2FQYA 3CU5A 2OENG 4LZLA 4KREA 4F8JA 3F73A 1JFSA 4N0QA 1CEYA 3CHYA 3HEBA 1LBIA 2FXIA 5B3JA 1NXWA 3RQIA 3HUTA 1AB6A 4P1ZA 4XASA 2R4QA 4JB0A 5EWMA 1DBWA 3NHZA 3HZHA 1M2FA 5GOTA 1BVHA 1GLGA 1K66A 1ZESA 4MS4B 2FN8A 3FDFA 3Q9SA 4EY3A 1JLKA 3EAFA 3KJXA 3UKJA 4Z4HA 1D1QA 1E2BA 2MSKA 4N41A 4GPAA 3LUJA 3FMVA 5CNKA 1PUXA 3QX8A 2OQRA 3QLVA 2QV0A 3QLTA 4EYQA 4NV3A 1Y1LA 2NT3A 8ABPA 1B00A 3EQ2A 4PZ0A 3QK7A 1YS6A 2NT4A 2WY2D 5FBHA 5TPZD 1USKA 3GT7A 4OATA 1DRJA 3BBLA 1JF8A 1K68A 3A10A 3IP7A 3MQ4A 4YS6A 1HEYA 1Z18A 2A9PA 2FLKA 4EUKA 3C97A 1USIA 4QICA 3HS3A 5HM6A 2JVIA 1NXTA 3HV2A 3EODA 2H3HA 3GA5A 5B3JC 1ZY2A 5BQ3A 1RPJA 3OO0A 4MR7A 3RVSA 1RNLA 5KQGA 4MQFB 4IGAA 3GBVA 1EHCA 2IPNA 4LE2A 1YVUA 2F8SA 4MPTA 4LDAA 5KQMA 4RXTA 3I09A 1MAVA 1QP0A 1ZGZA 3T95A 3HJFA 4RY8A 3O2SB 3W9SA 1JBEA 5FWXA 1F51E 1SXGA 2JB9A 3KS9A 4S05A 1D5WA 3LKBA 5PNTA 5D2CA 2IPMA
chains in the Genus database with same CATH superfamily
4GQBA 2XXJA 1U1FA 1INLA 1VA4A 3CKKA 4IQ4A 4MICA 4PC3A 4Q9AA 2QY6A 4IJUA 2QBYA 2YIDA 4LXTA 3DDNA 1RVDA 5TSDA 2VZ9A 4MR8B 3I5UA 4QOIA 1S01A 2EF0A 2DUWA 2BEJA 2REBA 3CM0A 3KZ1E 2Y8EA 4V0KA 5TV2A 3AB3A 3KP1A 3FB4A 1CXZA 1ZK4A 4N6NA 1MQ8B 1JAZA 1OTXA 3DMTA 1TC2A 3H2IA 3IO3A 3MCVA 3QEMB 1D0VA 2YV2A 4N47A 3UAGA 2PZAA 3A7EA 4UFPA 2BI7A 2L18A 1K6EA 1Q50A 1ZGGA 5A0VA 2L19A 3KPJA 4NZPA 3COJA 4IV0A 3IDSA 1B8UA 1RQ2A 1M2WA 2AOTA 1RKQA 4Q3LA 4J2HA 3FZQA 1R6AA 1S2MA 1TZMA 2IOHA 1W5FA 2CBZA 1RWOA 2VYQA 4TSFD 1BFUA 3Q2KA 2TSYB 3HGMA 2XQIA 1ZCBA 3PNSA 3RU7A 4Z4IA 1ZPDA 2YWFA 5FEMA 2D0PB 3HEMA 5JIBA 4AMVA 2QW1A 1MC4A 2MINB 3NBQA 1RPZA 4NYMR 1KZ7B 4TRNA 1NN0A 2A59A 1P91A 2RKBA 3AP2A 4N8DA 4N4AA 2VG8A 2J07A 3P2KA 4DCTA 4DT1A 3H1GA 3E9CA 2KSQA 2VEOA 4REQA 1XHFA 4ZOLA 1D4ZA 2BUAA 4JMPA 2P4SA 2O2XA 3QUCA 2WSMA 2VTBA 3UAYA 4UM9B 2YJGA 5DXAA 3LLUA 2GD6A 5T8KA 1DX9A 2QZ9A 3WNZA 3WR5A 2FWMX 3GGCA 3QX9A 1P6QA 1VTKA 1X7DA 2ZIXA 1L5ZA 1BHSA 5LP6A 1PFYA 3C14C 3EG9A 4KR3A 1RVV1 2OKGA 2VYNA 1DSSG 1LF0A 2Y1DA 4N12A 5FYQA 3QSYA 2B99A 1QZTA 2NUAA 4NMHA 2BKVA 3BA6A 3K4QA 4RLSA 3L0OA 4G63A 1IONA 2VCHA 5LZ7A 4F1WA 1S2DA 3DZFA 1US8A 3TTTA 4S1OA 4M0FA 3PFNA 4M0PA 4DDTA 1KFJB 5DGTA 2B61A 2PEZA 1N4AA 3U4MA 1U3UA 3BWBA 1U0OC 1OFGA 4AJIA 1TEXA 1QKIA 2XTZA 4S1WA 4HB2A 3U3KA 5ICEA 2GXSA 4FNGA 5ICGA 9LDBA 2BE9A 4ZMBA 2QTWB 2RBKA 3KVOA 2PY6A 3OT4A 1XTRA 4RWEA 3OCWA 3JY6A 4PINA 2C54A 4IMJB 3E5NA 4ITRC 5TF4A 2IV2X 1NYQA 4X9XA 1Q20A 1RS0A 2A9KA 4D2IA 4GSLA 3W4KA 3WOHA 3FFWA 1ES9A 3Q87B 1ESMA 3EDQA 4DXDA 1JHXA 1RWNA 1FE8A 4Q4LA 2FQXA 2BFBA 2QTAA 3STYA 3G2LA 5EIXA 1T2NA 2H5IA 3AI3A 4YCDA 4LJSA 5THXA 2VHJA 3GVHA 4Q6BA 1G8HA 2JJMA 3H97A 3PNQA 1KF0A 2V9CA 4LRYA 5FI3A 2FWNA 5DN9A 4EELA 1CY6A 4L78A 2ZYUX 3SEZA 3UJ6A 1SULA 1YQEA 2POCA 2YW9A 3Q9NA 5KC9A 4JVMA 3G88A 1HDCA 4L5IA 3UWPA 3BG5A 2O0LA 4JEHA 4XJVA 3VTFA 2IEDA 2O07A 5BMVA 2Y05A 5CHYA 1E99A 3BXEA 3GWGA 3K71B 4QARA 1HG0A 2FPLA 4NBVA 3ED5A 3MBIA 4KBFA 2VYCA 4DV0B 2A30A 2HRCA 1OLOA 3EXHA 3KLOA 3WJ1A 4ZGGA 2HO4A 5BVHA 2CK3A 2EV9A 4BNWA 4NOJA 3AETA 4L9SA 1ZLYA 4LNUB 3I30X 1L6RA 1AKQA 1O6CA 2I9PA 3KYDA 1QNFA 5HBGA 3AUUA 5HQJA 2DFNA 3BOSA 2EARA 3QI7A 1W93A 3GMTA 3HKDA 3P9YA 4WUTA 1P7CA 3FF4A 4X8LA 4AS3A 5CLJA 3ROQA 3EEOA 4F4CA 2GUGA 1AKVA 1SQGA 2N0SA 3BWDD 1FVOA 1TAHA 3MS2A 4ZMSA 3F3MA 3GAZA 2VF7A 4N0PA 4WECA 1L7RA 4CN8A 3BREA 4LY6A 3RS3A 1L4YA 1M1YE 1KFKB 1TUBB 2P5SA 3A1EA 4L7VA 1KDVA 3UMMA 3AH8A 3AILA 1KH3A 1KEWA 2ESRA 3AM5A 1QTRA 1E58A 5LJLA 1FIUA 4IZHA 1DXYA 3K0AA 2I76A 2JLCA 1GCOA 3I2HA 1X8LA 1I3NA 4K9QA 4U1RA 1VLZA 4DMMA 2VUTA 1SVLA 1T2VA 2GZRA 3A3PA 2C3MA 3AJRA 4JJ8A 3VR2A 3DP9A 3MPUA 5GJVC 4Y6SA 5GIOE 3H5WA 3GYBA 2I54A 4P32A 4BNNA 5F3RA 3FNIA 3PQDA 4BLUA 1Q5PA 3OLXA 1TUGA 4P4TA 2Z4TA 5DO9A 2CC2A 3CWZA 3SWWA 1SVUA 3H2GA 3RM3A 4L16A 2R11A 4ZALA 5AOVA 3VPDA 2I6FA 4PXAA 3IBCA 4NCIA 1OBFO 3MWEB 4YDHB 4WDQA 1ZK2A 5IKEA 3B6ZA 3UYLA 2SCUB 1R6BX 2P3SA 3GCWA 4P8RA 4WY5A 4ZYVA 3FYUC 4NMLA 3EIHA 5TLSA 1IBRA 2ZFUA 2APJA 2C2YA 3L4JA 3WL5A 2HN9A 4P98A 4C4YA 1R4ZA 2PX8A 3DZIA 1ABEA 5CYGA 1KQGA 1O0SA 1OH5A 3OQIA 1R0KA 3PUWA 3WK7A 1TF5A 1V43A 1ZIYA 4CCWA 1NXOA 1VB5A 1EFPB 4J0EA 4D99A 1MABA 2GLXA 3JQCA 4G5HA 1XTSA 4NFHA 3DO5A 3KZKA 4NJMA 1GPBA 2GZ2A 2NU8B 4E1AA 1BN6A 5FUMA 2OZLA 3CRNA 1KC1A 1B8PA 5M04A 1NG1A 2HLDA 5LYJB 4NXNB 1IQUA 1XEXA 2B0JA 3AUSA 5D7NA 1LBTA 2YIVX 3AL2A 5BV8A 5F7XA 1HL7A 2JGAA 4IIJA 3D6JA 4TXNA 1JHMA 3ZZMA 1PR5A 1RKUA 1DC8A 4X90A 4D4KA 1P2GA 4DC0A 3BCSA 3LBYA 3M1YA 2EHJA 4JWKA 4UZEA 4KLAA 4KPUB 1HPLA 3HG7A 5G0VA 1WSDA 5JRZA 2IPAB 4LDZA 4DYVA 1SQSA 2YS6A 4DR3B 3KWLA 1EJ6A 3I0ZA 1ZHFA 2WHXA 3ELUA 5FWYA 1CS4C 2QTRA 4DIFA 4Q16A 3VYTB 2JFYA 1KR5A 2XGOA 3EEBA 3LFUA 1WU7A 4KV9A 4AUNA 4KKXB 3A2LA 4TMVA 3HVHA 1T3LA 2BGTA 4L9WA 4YROA 1IZ9A 2XW6A 1DOHA 1O97D 1AURA 2FMHA 4BX2A 4XCXA 5EWMB 5AVOA 4ETWA 4Z1MD 1Q0UA 2AOUB 1L8OA 3IPXA 4V39A 4QLBA 5I8WA 1GSOA 3HO6A 4OBWA 5EY5B 4JJAA 1QGUA 1SBNE 2CNKA 4RPHA 5H4HA 4YNBA 3ZU5A 1UJ6A 3ZLTA 3B6KA 1JBQA 1SKAA 2WG2A 1MQSA 3CGWA 4N0MA 4N40A 3N2KB 3R6WA 1Y5IA 1QPBA 2ZYHA 2EKLA 4WESB 4C4XA 2FG7C 2RHTA 1Q22A 5B1EA 1IG3A 1YI8A 1YIAA 1JYEA 2WHRA 1KP9A 1RRPA 3N70A 4K28A 2B6HA 4LVOA 1BTOA 3O6VA 2GVDC 4NV1A 3DYVA 2VDKB 2GESA 1KOLA 3WIBA 4QU0A 2Z5GA 2LGJA 4P4SB 2PUWA 3T7AA 1NR7A 2PKRA 3BHIA 3K0FA 1F8YA 4PHHA 4R01A 4TS1A 1V35A 3KTAA 1FSZA 2VYFA 3ZDYB 4MRAA 4TZ6A 5BN1A 5E9JA 3S81A 1IIRA 2QMOA 1ZYUA 3B5EA 2GYWA 3BGSA 3GDOA 1NXVA 4ZT3A 5LA6F 3VHRA 4LF9B 1FU7A 5DIZA 2VRNA 2JC3A 4DVJA 1MA0A 1JLLB 1MB2A 3Q8WA 3B8EA 4U63A 3FLBA 3AXTA 5HIIA 4B45A 1KK0A 5A9SB 2JAXA 2JKVA 3IOCA 1Q2UA 1PTJA 5HOEA 1YB2A 2PU5A 2XCOA 3LD9A 2Q6VA 5HGJA 1JEQB 4KWEA 5IW8A 4A8JA 4K6FA 4HEA1 2TYSB 5B7NA 5INTA 4YIKA 1ODFA 1YR6A 3M34A 4MIKA 3CQ9A 3GYGA 4JLWA 4EO9A 1VRWA 1ID8A 3B51X 2JH8A 1ZK1A 5EGNA 4NG4A 4KE9A 4OFBA 4DSZA 4MO9A 1NMZA 2VZ8A 3WBFA 3ZNQA 4YMVA 3WL3A 2P2DA 1RI3A 2ZJ5A 1OTYA 3G23A 4QQ8A 4WZ6A 4YRDA 5TC4A 5M29A 1RLTA 5CA0A 5JVDF 1NQUA 2QQ0A 3ZZ1A 2IU6A 4PCUA 1PEDA 2OCKA 3SLRA 5JYBA 3H1EA 1CUSA 1A04A 1GSIA 3KV1A 1I5OA 3NH9A 4B71A 1HH4A 4PZLA 3UC9A 2QVYX 4M55A 1U8YA 2FPWA 5F76A 3G0HA 1AUOA 2Y0EA 2XTMA 3RTCA 2XE7A 3D7MA 3JVVA 5CW1A 3TFWA 3UW1A 4BO5A 8AT1A 3KAQA 1K06A 1J9EA 3ESCA 3AIIA 2GK3A 2PL9A 5B6IA 1JKIA 2PBFA 1PE0A 4OAPA 5FA5A 4O2AA 2Q9AA 5F64A 3CX4A 5DCWA 4DARA 1G7CA 3JQBC 3Q7SA 4FVTA 3DCIA 3TTYA 1DXQA 1AGNA 2VJKA 2X14A 2H4YA 1TLLA 1G18A 3PHIA 3KR2A 4HZUB 4KN9S 4BEWA 3HLTA 1H6DA 2B4RO 4MVXA 1C81A 2WIKA 3ZJYA 1GD1O 3A6ZA 2V65A 2XNCA 2J9XB 4JJIA 1TM1E 5GOZA 4PSVA 1JEYA 3WIEA 1S7GA 3F8WA 4Z4EA 3NIGB 4IKEA 1T8TA 2E89A 4J16A 2GILA 1MX5A 3PDUA 2V55B 3A4YA 1T0BA 3ZYZA 1CR6A 3EFOA 2P9QA 4LTDA 3WMEA 5CFLA 4OI0A 1V4VA 1XTPA 3TO5A 4GOND 3TUZC 3NEJA 4GLOA 5EFZA 3JRWA 3KT8A 2VNSA 4HJRA 2CXXA 5KDLA 2B0CA 3EUFA 4FGKA 2RHJA 3OPYA 5LB4A 4DLUA 1W0JA 4UOEA 2DQZA 3EZXA 3SK0A 2VJDA 3NHKA 5LLSA 5U1PA 4LWPA 1PV4A 1OLXB 3M4XA 3M3DA 4D98A 2Y1WA 1ZUNB 3L6UA 1QAOA 1AC5A 3TZKA 2RSLA 3U2QA 1ZJYA 5TXGA 1GZ6A 4OSOA 4JITA 4X7RA 1ZGBA 2HM7A 2PK3A 3QF4A 4JLJA 4KK3A 2J9FA 4XUGB 2QRJA 4CM9A 2QL9A 3ZU3A 2PUTA 3OE5A 1DBQA 1IK6A 4IZIA 4IBOA 3AVUA 1SOVA 1XCPA 2QTVA 4V02A 4AN4A 2HQBA 4H1VA 3F6YA 4M8KA 4N3AA 4RD3A 4FM9A 3DAYA 4RLFA 3T3HA 2W2TA 1MD9A 2RGXA 2IYXA 3A7DA 2AR7A 5DGDA 5FO0A 2IC5A 1NQVA 3Q7PA 3VNBA 3EQZA 3B78A 3WG9A 4B3DA 1NBAA 3ICWA 3NIDB 1HT3A 1J8FA 4MDYA 1W88A 1W47A 3FXAA 4P93A 3B9PA 1UFOA 7MHTA 1QB8A 3NDBB 1VHQA 2EW2A 4F85A 1XRNA 5MGNA 4ITVA 2G9NA 5JEEA 3N2GB 2G82A 2ZI6A 1TFUA 2CYAA 3BGWA 3UT0A 2PTGA 2JBAA 3GLGA 3O4HA 4MW0A 2ZUCA 4Q0MA 4A91A 2VOEA 2JW5A 4LBZA 1B15A 4Q4JA 4KSCA 5L40A 3OIWA 5MF6A 3GLIA 1LUAA 1BEZA 1N7JA 5AW1A 3O95A 2BFPA 2JEZA 1OFVA 3QIVA 3ET4A 1IY0A 1MOSA 4P7FA 1L8QA 4WT7A 4EGJA 3AFGA 1EZ1A 5G4KB 1IXYA 2PMWB 3OIDA 3DULA 4UVDA 5BSTA 3LVRE 1SVSA 1HF3A 1C3VA 1OSNA 4ID9A 2EFCB 2PL3A 3LGAA 4J76A 1T25A 1VL2A 2O1EA 3B6EA 1EHYA 2COUA 3PC6A 2R6FA 4FZ3A 4QXQA 3OTIA 4U7PB 1L7XA 3S7ZA 1XZCA 1EFCA 4CM4A 4L02A 2WQZA 2GASA 2HMWA 3PDWA 4FS8A 4L07A 1GN8A 2CEAA 1DQNA 1XVIA 3AFOA 4FW8A 4Q03A 5DN6A 3SD7A 3IOYA 3UK2A 5J4LA 2YWCA 1A95A 3FPEA 2OBYA 3T4UA 3QA3E 2BTQB 4PYMA 1DKNA 1J2UA 1JLKA 2X23A 4D57A 4S0ZA 5K8VA 3L9WA 3U9LA 1D1QA 3S1SA 4K0RA 1YD7A 5HM8A 1U0TA 5TEVA 4C5AA 3THXB 1D07A 3E6AA 1QK4A 2GEFA 4ENTA 2VHVA 3IODA 4HHEA 4NV3A 1Y1LA 2NT3A 1Y7HA 3Q3VA 2CFSA 2GPBA 3TBFA 4ZOEA 3H11A 3K5WA 2FDRA 4N18A 1A3CA 2QVXX 4G41A 4PZ9A 3GJYA 2VHEA 1C0KA 3BBLA 3YASA 4BMCA 4PFSA 1RYEA 3VU9A 1C4XA 4EB6B 4L75A 4DJTA 4F4UA 1HEUA 1NXTA 3PI6A 2VHWA 3IUEA 4XEHA 1P75A 4H7JA 3RASA 2I71A 2NVWA 1WW3A 2H4XA 3CN7A 3DO8A 4CL0A 4QKQA 2XSZA 5E9WA 4ZXPA 3WMRA 4GPEA 4R2LA 1X92A 3G2PA 1KBOA 2JGRA 3RDPA 4WL0A 1K89A 3K32A 3TXXA 5E3HA 2YQ5A 1H8ED 2ATIA 1MIOA 3JATA 3OAAA 1ATZA 5LD2B 1F2UB 1QP0A 1MAVA 3EGWA 1AHNA 3GGOA 1ZD5A 4TUYB 4Y18A 5HG0A 3S28A 4HG2A 4EBBA 2PS9A 4O8ZA 5C8XA 1MJGM 2AQKA 2OGZA 4IIFA 2Z83A 5GJCA 3U3OA 3ZK8A 3L77A 2CB9A 1A72A 4IVQA 3U1BA 5ALZA 3DMHA 1XEAA 2GN4A 2ODAA 2R96A 2HA3A 3QVLA 1IE3A 3MJDA 3P26A 4FFBB 4EHJA 3ICCA 1JFLA 4ZO8A 1S96A 1GAEO 1NG9A 2AJ8A 2CN1A 2XNDD 3ZGVA 2P6RA 1RCUA 1Y1TA 1YA4A 3ASYA 2XE8A 1HLGA 1ACLA 2RD2A 2H7XA 1KY2A 2ATEA 2FSUA 1QZXA 3DFKA 3BL6A 5JCZA 1E2JA 1TJ3A 3NRBA 2JATA 3U3XA 3KTFA 5F2EA 1JDVA 2BJWA 3IUSA 3EIUA 4NKRA 4C5CA 2WG0A 2PD4A 2QXYA 1YR2A 3BEDA 2OKCA 4GSKA 1B2RA 2VWPA 3P45A 5E0KB 1XZAA 5FTKA 1PCXA 1ZIDA 3VR4D 2A0XA 1MN6A 5EHIA 1M8KA 2JK1A 1IZ8A 4Y9SA 4XWOA 1EIWA 2C9OA 4EY6A 1H05A 1ZG3A 1ORWA 3JYQA 1GAWA 4J3NA 3ZR4B 1LSUA 5JSHA 1LCIA 3DNPA 2V3WA 2NU7B 5JS7A 2Y77A 4PG6A 3QJYA 4C0SA 2NQ2C 1AXEA 2VSOA 3GCXA 4PLVA 4ZVNA 2EYUA 4E4RA 1BMQA 3PGJA 3LFHA 4PLPA 1ODLA 5FULA 3IKLA 1M2OB 1JZQA 4HAUA 1Y6GA 4CFSA 1P44A 1OLUB 3VPBA 3DZ8A 5AOAA 2AXEA 3KXLA 1NUHA 1XDDA 2AFVA 2YWEA 5LCXA 3VR6A 3ND6A 2NU9A 4FBGA 4AJNA 3RUDA 4EG3A 3CRQA 1MAHA 3EUWA 3M4JA 4UTXA 1R9JA 4JQZA 1I36A 4I5DA 4I1OA 5JRJA 4NYMQ 2IGTA 3OZXA 4C5BA 3TR6A 3UXHA 1ORHA 5JH7A 1CFZA 3H5OA 2JLQA 1FXWF 1E3SA 3ITNA 1H94A 4B84A 3UBMA 2ZSIA 3IXMA 1QE5A 2I78A 4G1EB 1L7OA 3HJTA 2PNFA 3JW8A 4I50B 5LBTA 5AW6A 3KHSA 4ZVSA 3UT6A 2RH8A 2VNAA 4FHEA 3FGOA 1IOZA 3RUPA 3TDKA 1I4WA 1F20A 4HNQA 3LC0A 3U7IA 4AKGA 5I8ZA 2I3DA 3EZNA 1TJ5A 2FXVA 4YJ2F 4ME6A 1AD2A 3D3WB 2AN1A 2NP7A 4S1NA 2AIRA 2D5AA 3HCCA 3QVGB 2H52A 1RAFA 3CNOA 5AICA 4DGQA 1GU0A 3ETNA 2MYUA 3H75A 1ZD3A 1ZU5A 2ZRJA 3WYBA 1QLJA 2IYSA 1ZD4A 3R0XA 2VNJA 4I66A 1PL0A 1ZUD1 5HRUA 5A5GA 4ZCPA 3OZIA 1DDOA 2C31A 4C3VA 4CKYA 4EI8A 4LHWA 1W59A 2WW8A 4CCSA 3WLJA 4JQSA 1SCDA 3K8YA 2IF0A 2OFPA 1K6IA 1H3FA 5EE5B 1KTVA 3DV9A 4LOLA 4YRQA 3KKQA 1QFSA 4YYZA 3EGEA 2QQFA 4IQFA 4JI7B 1WZ2A 2Y93A 1UMKA 4CM7A 1RMQA 3VNRA 3IXQA 3PTLA 3ZCVA 3AUKA 5B1DA 1ETUA 4RJJA 1BDIA 2DQYA 1L8LA 3LQ2A 5BT8A 5BWNA 1FX1A 4YGXB 1WJGA 1ZK0A 3PG5A 2YJ3A 3T3OA 1U5BB 4E30A 3SHOA 5CT6A 4O3MA 2C95A 3FX2A 4Q3BA 4QECA 1SWVA 2OHFA 3ZHZA 1SOUA 1KFBB 1DNPA 1NXQA 2ID8A 4L0QA 3DFIA 3ENWA 4P35A 1ENOA 1D2HA 3LSYA 3UPDA 1JHPA 1I3CA 1JFRA 1M10A 1R0LA 1ZOLA 3G8CA 3ZE1B 1FFSA 3IBTA 1QRUA 5H70A 2GERA 2IXFA 4U2CA 2E4WA 4DUZB 1YBHA 3P2OA 1WF3A 2AD1A 1CZKA 5LXTB 1UBSB 5AT1A 1IU9A 4EP1A 1LRKA 1NM5A 1FFCA 3DOIA 5DASA 3PHLA 4N5HX 1GOTA 2IBMA 1T4BA 3IR7A 4BKRA 1Z8HA 3GLVA 1ZNZA 3EIFA 1MIHA 4PG7A 2QUBA 1N6NA 4V2UA 5EVCA 2ZYDA 1AZSC 3AG6A 4MINA 4RM3A 4WRRA 2C5HA 3A3NA 3CZ5A 1U7XA 5AIBA 2CVFA 2EERA 3AR6A 4Q9NA 1ABFA 4NVRA 1FLNA 2Q21A 4URUR 1U2DA 5D3QA 1DFGA 5KSZA 4KOAA 1ENZA 4W7SA 2WIBA 4U9IS 2JGNA 5FLXA 2BBWA 2B98A 1ZJZA 4ABTA 2Z4SA 3NXKA 1MX9A 3IV7A 2QRUA 3LC2O 2XRZA 2EL9A 4BN0A 1U8TA 2RGDA 3H9BA 4BVKA 4LHVA 2ONCA 1R1DA 2WWIA 1KNQA 4OP3A 3ER9A 1U8XX 2E7ZA 4UVGA 5HUHA 1WXWA 3U7FB 3AB7A 4O2BA 2VLIA 1LLQA 2EBWA 4KRYA 1RJWA 1T5OA 5IYZA 5C52B 4BN5A 3C8MA 3QV2A 4I3FA 4IH4A 2UUPA 3TAUA 5FV7A 1QRTA 2LTAA 5BR1A 2GTPA 1L8XA 3PNYA 3RVRA 1QMPA 2ZZNA 4BJ6A 3LY5A 2UZ1A 1J0AA 4I55A 4HVTA 2Q7OE 5AI5A 3WGHA 4DVGA 3KHTA 5C1BA 2FE4A 3LT4A 1O03A 4MW2A 2Q5CA 2C3UA 2NSLA 5CLQA 1H9BA 1R8XA 1RJ9B 4FTWA 4G01B 1JHVA 5DNAA 4LF4B 3KXIA 2HDNB 2K2QB 2Y1FA 5KVVA 5J3JA 2Z30A 4PONA 1GPNA 5JD6A 1SCUB 4F0JA 2QPAA 5L3RA 3D8HA 1ESEA 3DOFA 4K6MA 1G5QA 4UVEA 2CJXA 1SQFA 1XRSB 3GV0A 3L4EA 4ZDWA 4DLAA 1YASA 4QU5A 3F3KA 1LBQA 4KAFA 2FV8A 5IEBA 4P34A 4X85A 5DK6A 1N2SA 1SOMA 3BE8A 3ZLBA 2X2EA 3LA6A 3PQ4A 1U3WA 3DCYA 2AWNA 1XP5A 4RGQA 3ENKA 1WP4A 1Y0BA 4OHYA 1P4RA 4NENB 4EQ6B 2H7YA 2Z9DA 5FNVF 3RBAA 5HDQA 1RWMA 1N6LA 2COEA 2W43A 3ZLUA 4KJZA 3FD8A 1GEGA 3OP1A 1TJ4A 4TWIA 4BEVA 4ZYTA 3GRPA 1PWXA 5FHRA 3KQHA 1VA5A 3E70C 2HU8A 1NJ6A 3D6UA 3ZHVA 2IYQA 3TVYA 5JUWA 1BIFA 1RRFA 2R86A 4P86A 4B2YA 5HGXA 5IT9A 1I94B 4MDEA 2XVXA 3OEHA 2Q2QA 2ZVQX 4YJKA 1D0SA 3G0CA 3DAFA 2QLBA 1R0BA 3LHSA 2V7BA 3O94A 2B20A 3BSYA 4ZIRB 1JA1A 2B94A 3EVNA 3GEGA 3WDKA 3K6SA 3VH3A 4CKWA 3HXPA 3KOUA 1DXOA 4J8PA 4LJYA 3VU1A 4D4IA 2FCAA 1IHUA 2JVJA 4MQBA 4CM5A 4N54A 1Q0ZA 3K0CA 4YAIA 1Q17A 2JFOA 1B42A 1T9KA 1TU4A 2R7LA 1SU8A 2PYIA 2TRSB 2UV8A 3N7TA 3TNJA 3HJRA 2FPRA 1U2GA 3JQRA 2Q07A 3KALA 4MX8A 4B75A 4GECA 2XITA 5TIIA 4GE0A 1WB6A 2I91A 1Z7WA 5YASA 3QHQA 5SYMA 2RIPA 1F8FA 4Q3OA 1IOLA 1ZGAA 2YINC 3R0JA 4HY3A 3E3NA 3NCTA 4ND8B 4AY4A 3WDLA 2QR3A 1BDHA 1T43A 4KO1S 5F78A 1MRZA 4A36A 3D5QA 1QYDA 3MOSA 4Q7QA 1ID1A 4II2A 5SY6A 2YHAA 5TPWA 3EXIB 4BKMA 3CVOA 1E7WA 5EC8A 2IH4A 3QBVA 4OXKA 4B73A 3ABOB 5JALA 1CYEA 2C8VA 3EZ6A 1Q3TA 1SKBA 3EQ9A 1U9CA 2FLWA 1RXCA 2QLFA 5DJ5A 2QR5A 2B1IA 3JYLA 3CXUA 3BZWA 1CK4A 4K9KA 1CD5A 2WJYA 1C1YA 4DL9A 4EITA 1I2DA 3LM8A 1Y1RA 2V3VA 1ENPA 3FUWA 4QYIA 3NBKA 3DB1A 4NBNA 5DB4A 3RS9A 1GR0A 2FZLA 2VRCD 2MYTA 3TXAA 5KSPA 3HJAA 3WL7A 1CJUC 2QDXA 2QX8A 1DU4A 4MQ5A 3ZHSA 2EFYA 4OXIA 5JNVA 1YCGA 1HV8A 1G64A 1KO1A 4GX2A 5FHQA 5C8DA 1S0UA 1Z75A 1DKUA 1TVKB 5K0LA 2YHIB 3D3JA 3I58A 2IZ7A 4MJLA 4U5XA 3B3JA 2DPYA 5IBRA 3TX6A 1WUJS 4FFOA 3WRXA 1GT91 4BX9A 1I13A 4UMFA 4CI0B 1A50B 2R25B 2YN4A 4GO1A 3QYPA 3UXEA 2Y3IA 4OQZA 3MT9A 5DGIA 2TS1A 4LYGA 3RJ9A 2JVKA 2R62A 1C3OB 3K9LA 1ZA2A 1NQXA 4DA4A 1SKMA 1D2NA 1FNMA 5I3ZA 4JL5A 2IXBA 3MXTA 5LIRA 1A9OA 4OD0A 4P4LA 1G38A 2IITA 4RV4A 1GCGA 1WBJB 3LHFA 3GELA 3H1PA 3IJ5A 4RJLA 5JDCC 1NAHA 1RIIA 1U7UA 1V8BA 4DJAA 3IDOA 1EGHA 3DD1A 6NULA 1BH6A 2Z2KA 1JLSA 4A73A 1BU5A 4TQUS 1STOA 4RF3A 3WISA 4JR2A 2OAEA 4ONEA 4M2LA 5AJWA 10MHA 4EA6A 2H1IA 3TAXA 4ND4A 4WOCA 1NBMA 1ZUHA 4NDZA 3SIXA 3A26A 4L8YA 4R1QA 4QEDA 4Z7JA 3ELDA 5ECDA 1RHQA 4M1ZA 3VAAA 2ZU6A 1RFGE 3E7DA 3TTUA 3WIOA 3GLFE 3OPMA 3HBFA 2Y27A 4HXYA 4IDNA 4D8TA 3M1IA 4WOJA 3AERA 1WD5A 1NC3A 2M6SA 1JDBC 4J0QA 1QRSA 5F21A 3VNVA 4JC5A 3FCAA 4GC9A 4IDGA 2VEDA 4HXEB 1K92A 3GCZA 4G86A 4FGLA 2ODPA 1DUIA 2IYWA 3W34A 5GADl 2YYYA 2ACWA 2ZCUA 4ABYA 1JKFA 3HN7A 3FPSA 2I6SA 3FTFA 1Q1QA 4XD7D 4RPCA 2HU7A 3L79A 1XZPA 2HA0A 3TW0A 4B9EA 1V6SA 2WNSA 2HMTA 4BIMA 2HJRA 4ARCA 4KAJA 3UIEA 4BFVA 1X7YB 2DFDA 4M86A 2O8BB 1NZJA 2Y99A 4RNDB 3FUCA 3GHHA 1VL8A 1YS7A 4OXQA 3FSJX 1PT9A 2C9CA 4LHEA 3OTGA 3UJBA 1UUFA 1YB5A 4UCFA 3N6XA 5MFZA 3FDZB 4PYIA 3WWZA 4BX8A 2JLWA 1U0FA 3V1MA 3OKAA 5DOVA 1E2GA 3D8RA 3EFHA 2QNIA 4DA6A 4D9EA 3R7BA 4JQYA 1IBSA 1SK8A 3HBLA 4M8NE 2OCPA 7GPBA 4DZTA 2BUCA 3X1YA 3EGVA 4OQFA 5F51A 3K9WA 1GL3A 4BPRA 1YQGA 1YS1X 5DTRA 3L8EA 4HDSA 5CK4A 2H2WA 4CIBA 3D4LA 2ZBFA 4MTLA 4RORA 1JG7A 2BMJA 1UJBA 3NQ41 2FW0A 4DLTA 3K5PA 1Z0SA 3KOWA 3IQDB 4IGKA 3H1AA 3M7IA 3QQPA 3GROA 5CCDA 3VR0A 5BVGB 2Q3EA 2GYUA 2WPDA 3KJNA 2HLNA 3KOOA 2HJVA 4IJMA 4C0JA 3H99A 4BP8A 1PYGA 4L5CA 4ZU1X 5JADA 4EJSA 1A77A 2P65A 3DEYX 2VHXA 3OT1A 4MB2A 4EG4A 5HOQA 2D2EA 5SYAA 1L5HA 3V1YA 4B2LA 1T5TA 1DO2A 3VUEA 3D3NA 2XCLA 3CMMA 1ZEJA 1NW5A 2J3LA 4Y6LA 2DFVA 4HN2A 5CVUA 1QZZA 2Q5EA 3OLQA 4F7WA 3I23A 3BWXA 4LRTB 1ICEA 3RSQA 2VNKA 2C97A 3K9NA 1UKCA 3QG1A 3GLTA 1BWRA 4YACA 3VR5D 3L4KA 4A23A 3AO0B 2R1TB 3VO1A 3NC4A 1T5SA 4COKA 3R09A 4ILKA 1N5KA 1U0HC 3NANA 2FOLA 3CZAA 4B4OA 3IDAA 3CVYA 3REQB 2UZIR 5C35A 1WUTA 3CX8A 4IW3B 4PYQA 2J6IA 2F48A 1KI3A 5ITSA 3P0FA 4FWTA 1P61B 3FCXA 3I2GA 5HKBA 2J7KA 4C30A 3IQWA 3QK7A 1CP2A 1T5LA 4CDNA 1G5RA 1V26A 5DOZA 3OF2A 1IOVA 4HMPA 4JYBA 1NVWQ 4L2IB 4OATA 5TDHA 1XROA 1YAJA 2Q6IA 3PX2A 4HTFA 2R00C 4KVAA 3V8BA 4OSEA 1M6VB 3WB2A 3WGTA 2AUNA 1HEYA 4BFYA 5DXJA 1BDBA 1E3WB 3AEXA 4GNKA 2X5OA 1RQRA 4P0TA 2B9EA 2NTVA 3AESA 4JH0A 4K9DA 3ZUPA 4RFSB 1UOOA 1F2TA 2EXXA 4UEJA 4NPHA 2YKGA 2R6R1 5IDXA 1IEWA 4DLRA 5JARA 2OMKA 3ANNA 2PZEA 1OWPA 4LI0A 1KJJA 4AN0A 3A37A 1IZ0A 3IPLA 3WYEA 1VPLA 5K4GA 2QT9A 4LEIA 2RJ3A 3JQGA 3CW8X 2NPOA 3BTOA 3M49A 3WC4A 1KI6A 4NZMA 2KLBA 4KU4A 1J1ZA 4AC9A 1BNCA 3HB9A 3I4LA 1WUKS 4CF7A 2BFOA 4OLHA 4NHEA 3TCKA 1C29B 1U02A 1WMFA 2J8ZA 5D2CA 2Q2OA 2ZTLA 4FFNA 1XDBA 1XN1A 5SZIA 3U4CA 3SX4A 4RWZA 2Z2XA 2RGRA 3DZJA 5CB4F 1FFGA 2VDWA 1MO6A 5AJHA 2RH9B 3LUHA 2MSNA 4QYWA 1GZ4A 1O5OA 1P1IA 1X3SA 1Z5VA 1R9MA 1QQBA 2PX2A 3AGQA 2W42A 1V5IA 4X6LA 1ZOOA 3OZFA 6YASA 2J46A 5FPQA 1XNRB 1RWWA 2AMFA 4FEAA 4GGOA 4Q05A 1ZD9A 1J97A 4ARUA 4D9MA 4NBKA 5IM5A 4CL3A 1T0UA 3PHCA 2C3OA 4BE4A 1UT5A 2J87A 4KL8S 3T1QA 3PUIA 5C8VA 1IMJA 3LO5A 3IBGA 4MQEB 1ELOA 2JAHA 5ERYA 4V1CI 4N48A 2G9UA 1DPFA 3DNFA 3IHKA 3TKYA 1YFZA 2B8JA 1W4RA 4A2CA 2ZS7A 4NIMA 3RU2A 1QF7A 1GUFA 2ODWA 4W5QA 3MD9A 3S99A 1AMUA 4TWJA 5MFPA 3MAAC 1P4AA 1FLVA 4GPD1 2I66A 1QHXA 3EC2A 2QDKA 3P32A 5JLJA 4TZ0A 2Q3CA 2D00A 1QF6A 1Y5LA 3AXSA 5AP9A 4X20B 2FEXA 3ZHCA 4IWNA 2PUEA 1UMDB 2Y76A 4HPWA 2MR5A 1OIWA 2IBSA 3D8UA 3R44A 1QU3A 3DZGA 1H5QA 4FW9A 2QA5A 4E1BA 3F67A 4ZAXA 3KJEA 2X4GA 1FNSA 2FPUA 4MKFA 4RZ2A 4JP2A 2VWHA 2VP0A 4GS5A 4QREA 2Z5LA 4R05A 4V2IA 3DCJA 1TRHA 2BGNA 4YRLA 2ISQA 5AI6A 4NY1A 2WILA 1O94A 4DSTA 4E51A 4TKVB 5HTOA 1N2OA 1JLMA 3DVAB 3ZZNA 5KVSA 4O5AA 3R8CA 3DDHA 5EWLA 2G67A 1L7AA 3QVSA 2FMTA 3PITA 4KRFA 1PI3A 2Z6QA 4D26A 1E6KA 2IQIA 2YS7A 5F3DA 2XGGA 3RVPA 4O4IF 2CDCA 4B47A 5KOIA 3CNEA 2FSHA 4KDRA 1YHZA 1FXUA 2W6JD 3VSEA 1IHYA 1YGYA 4QXOA 4DEVA 1DHRA 1NMQA 1TI7A 4CUZA 4XIGS 2BHLA 2XDWA 1XALA 3BSSA 1SR8A 4JQCA 2ZCJA 3U61B 1QS0A 5I4CA 1LH0A 1NF2A 2I6XA 5KVQA 4ERXA 2GBPA 3LBIA 3VKVA 4G1UC 1QRDA 2NQTA 2P4QA 5KX5B 3T5AA 2NPIA 1V25A 2W6CX 2DZDA 3V7WA 1H5UA 3LUKA 3CJQA 4JBWA 3A9SA 3SEFA 2Q2NA 1K4MA 1H6CA 2P62A 2D0OB 2CXNA 2G9VA 3AY7A 1N0WA 4BQRA 4DCNA 3QUQA 3ZIDA 4C1BA 1SXJB 1IY8A 4KTVE 3U49A 5JAOA 3DV0B 5KOHB 4R3UC 1GFIA 3U7QA 3FNRA 4LQDA 3ENZA 4IIVA 3BSFA 2HT1A 1VQ1A 2ILTA 2VP4A 4UAGA 1B74A 3COSA 4H60A 4HNRA 4EBFA 3A6DA 2QZZA 2XCTB 2PD3A 2YTZA 5AXBA 1YUBA 4BUZA 1NUPA 3ZXXA 4BNZA 2WRZA 3IQGX 3PX3A 4D3YA 4TMWA 3TNYA 4E5SA 1DTSA 5DYTA 2NNLD 4LY3A 4TN1A 2WT9A 3RKSA 1OAAA 4PTYA 1UC4B 4YONB 4QDKA 4GLFA 2JLVA 1QYVA 1MVNA 2X9QA 1TJYA 2Q5IA 1OU4A 1BS2A 2NLOA 3D0QA 4R0NA 1G2PA 4ZXFA 4KRGA 2B5VA 3LLSA 1J6UA 2CNNA 5J63A 1OW3B 3JYNA 1LWNA 3BCHA 3OZEA 1RC0A 4LX0A 4KSBA 1Z12A 3ZWVA 1Z6QA 3QKWA 2RI0A 1MX3A 3E9QA 5CCBA 5I4IA 4HXFB 3B2NA 3GDWA 3EZLA 1XAJA 2VSFA 1G6Q1 2QZSA 4IOMA 2C0CA 3TX2A 1UMCB 3O1LA 2QRGA 3RFTA 8LDHA 2WLTA 4MW1A 1RLOA 2VKQA 4H7IA 1A1VA 3HLKA 1PNRA 1R5BA 3NFRA 1MJHA 2VDRB 4C76A 4C0AC 2O52A 4E46A 5JAIA 3NBFA 4AQDA 3KOMA 1T1EA 4ES6A 4BFWA 1B1AA 4UHJA 3AFIA 2JIOA 1C7QA 3AHJA 1TXGA 1E62A 4ICIA 3D4OA 1Z0UA 4QBHA 5GGYA 3T9AA 4XLLA 5F4BA 1KJYA 2JJ2D 1X74A 2K7FA 4CV3A 1KERA 1Z17A 5FIUA 3UFXA 1FP4B 1SD5A 2JIRA 3ANTA 2OESA 2FW6A 3F3SA 3LOQA 4YRZA 1ULAA 2YFHA 3OSZA 3U6BA 1UZNA 2UZ4A 2BBOA 1WVIA 3H16A 1JR2A 4I9NA 2JFGA 2P9HA 1UXKA 2PZ8A 3MSXA 4MI6A 4D9HA 3H8SA 3E4CA 3LC1O 5H7XA 2HREA 4HDMB 4CYMA 4B35A 3NBUA 4W9RA 3AC0A 4QBFA 3SCZA 4A1FA 5JJ5A 2FQWA 3RWMB 5B6JA 3FUUA 1IYZA 3O8BA 1AKWA 4US1R 1AN0A 2ECKA 4MTCA 2ZT6A 1FQWA 5KNDD 1VGRA 2XD9A 2VA9A 4K8OA 1VC2A 1IMOA 3A6LA 4LVNA 4BDTA 4BQPA 1ZCFA 3HCOA 1NVDA 1EUCA 2QN7A 4Y9TA 2ZT5A 2JFZA 3B3AA 5LIPA 3IUQA 4W1QA 3ZYCA 1OREA 1WKVA 4G1CA 1JP7A 4CL8A 2XNHA 3X0DA 4UDOA 3WLSA 4YR7A 1I7QB 3I2YX 2JDIA 2VBCA 2WVJA 2BE7A 1X1QA 2QL5A 1NE7A 3LY9A 1O4WA 1WF6A 3AFMA 1P17A 4XDYA 3RU3A 3WBBA 2I03A 5GAJA 3P5BA 3K1AB 1UP7A 3V9PA 3T1YB 3Q4GA 5J43A 1DLJA 4JCCA 1KY5A 2P7IA 3BJRA 1LDBA 2C9BA 1JMVA 3ORYA 1KA9H 4QVKA 4TT3D 3RRNA 4NCAA 3KU1A 1HL3A 3MMPA 4LE1A 5DSXA 3PXBA 1EBFA 1JTVA 2FWPA 4YUXA 5BXYA 1U0LA 1RC1A 3H8VA 4Z9BA 2ZBRA 3QU9A 2FJPA 2VDOB 3LIPA 1B6SA 1GPAA 2YWGA 2O4UX 4IGEA 4R1LA 4TXJA 1ZD8A 1XQXA 3EJWA 4FDLA 1PZXA 4ZDJA 1UR5A 5AVKA 3SLGA 1UBOS 2AI2A 2J59A 3U39A 2PKQO 1F4VA 1NYRA 1YA8A 2OPBA 2ZSJA 3MWYW 3OUTA 4MITA 2FW1A 5GZ1A 1NZDA 2BFFB 1E59A 2NXCA 2Z8XA 4FOPA 4IIUA 1A96A 1NVVR 3B2QA 1NW7A 2LCQA 5G41A 3GB9A 1SRRA 4B7XA 4KQWA 3PL5A 2QT1A 2X8JA 2IHYA 4IXDA 4KQ9A 3QMMA 1Z88A 4FT4A 1X87A 4HC4A 5FR1A 2YJ6A 1JG2A 3ER8A 3ZWAA 4OLBA 3R8XA 1QWOA 4MKRA 4JLKA 4Q93A 5AO9A 4J1TA 5J4KA 4N5DA 1WKCA 4QYSA 3I9NA 3WA7A 2PZLA 2C42A 1B8VA 4JT4A 4DXHA 3QKSB 1TEZA 4FJ1A 4D5EA 5IH3A 4ACAA 4CMIA 3E1GA 4C7JA 1M6EX 3FLEA 2AFIE 3JZIA 5BR7A 3KX2A 4DLVA 4BS9A 2W83A 1K8YB 2GN6A 1SM4A 2FFJA 2GT1A 1T9DA 2HH9A 2GO1A 3KVRA 2BGUA 4YAUA 3WNQA 2A5YB 1AUVA 1Q3HA 3H18A 5D1NA 5JZBA 1FZTA 2BDUA 4C6TA 4XGNA 4P31A 4P08A 4BOYA 3OIGA 1V5EA 2AF3C 1U8AA 3HYLA 3AQIA 1P7PA 1IN6A 1QQ5A 2PZKA 5LLTA 1Z8FA 5DWDA 2IY7A 3BZUA 2OK8A 3TGPA 1VL1A 4Z4CA 4WBNF 3JXEA 3BTUA 4EG6A 2H00A 3ZHTA 4HJXA 1GU7A 4YMWA 5HE8A 2F3SA 4G5XA 2BGLA 3CUEF 4QD3A 1YNOA 2VR1A 5LC1A 1XXHE 4MMYB 3SYLA 4AMGA 2GK7A 5EHXA 2AEEA 3O8OB 4LQCA 4OB8A 1S1CA 5T64A 2NUTA 4H7KA 3TQIA 1ZRMA 3JX9A 2VF8A 2OXTA 2RK6A 1JEJA 1L4LA 2QAGB 3H2KA 4ER0A 1OHHA 4RA6A 1Q92A 2HRZA 2WJHA 5B2FA 1OLSA 3GRKA 4BJ1A 4M0CA 2EJBA 1AKEA 2OO7A 4LHZA 5BRJA 3ZCXA 3DOUA 4Z5XA 2XE4A 4QAQA 4ZHQB 5F7JA 2H1LA 3DLAA 5IM4F 2ZAGA 1X1AA 3A1NA 4KXUA 3FPAA 2PKWA 4W99A 3RGGA 5DHTA 3UHOA 2DR2A 3CN9A 3W6OA 1VG9B 2QKYA 3RGWS 1ZJWA 4AY5A 1DBRA 4LGYA 4DBZA 4LWOA 2E21A 4XIYA 2CFCA 4G9GA 2HCRA 4J7AA 4RX1A 1E5XA 2CXQA 3CCBA 4INPA 2IKSA 4FWIB 3GP3A 4I1RA 4NCHA 4MQMA 3OVMA 1YMUA 5FBZA 1KIAA 2WUWE 3QI2A 4PYOA 1Y8RA 5HVNA 5JAPA 3C8DA 1PVOA 4KIFA 4HDCA 4YH1A 4QFDA 3QNUA 4JLMA 4K2AA 1DEKA 4X7BA 3OFND 3OM1A 4NCKA 4UFOA 1M1YA 2FFQA 3F5FA 3T7DA 2HLHA 2R48A 3UJ7A 1Z74A 3PDJA 5IARA 2OV3A 3I6YA 3VAYA 4OGFA 4W1RA 4LOIA 1QZUA 2A5LA 2CLFB 3L8GA 1WP9A 3RNLA 2ZJ1A 4EEXA 1L5FA 1Z39A 5CCXA 2IHBA 1IB6A 3LY8A 4OVKA 5ECGC 1KARA 3FWHA 3HFGA 1Z6XA 2WI8A 3L2OB 3N2IA 4MA4A 1JAIA 4WUVA 3HXMA 3TECE 1CY8A 1G5TA 3NNNA 5ER9A 2QUJA 3WNVA 1YRWA 2F4NA 1GZUA 4D92A 4ER3A 1Z9BA 3FCCA 4OAQA 5BORA 2YV4A 5FOQA 1CJKC 5MDHA 3ADPA 4UXJA 2PSFA 2UYQA 3A4VA 3A6KA 4MKGA 4U8GA 2FRDC 3WDSA 1JKJA 2PN1A 4I1UA 1P60A 1SG0A 1HNWB 1S2OA 2B1QA 2BC9A 4DWVA 2Q7XA 3E1KA 3NHFA 2ASEA 2H5JA 4UNNA 3S5UA 1KL7A 4WFJA 5SZKB 4ATNA 4G2TA 5K0FA 4YCCA 1D3AA 2J09A 2HCJB 5JSFA 4P82A 5CG1A 1OZFA 4A6EA 3HM2A 4BFUA 4BV9A 3G17A 5ILQA 1E3LA 5DISB 3HJCA 3FYTA 4FE7A 3D5TA 4MIYA 1M6YA 3SOZA 2BKUA 2CFTA 2X1HA 3CF4A 1P80A 2Z5FA 3UG6A 4FIZA 4CV2A 5BR4A 3WYAA 1P4HA 5CAEB 2HK6A 3GMSA 4HZGA 4ZU6X 1C7IA 3U26A 4Z99A 4FQ5A 4IDDA 4OBBA 2BFEA 1MP0A 1X0VA 4HQKA 3OJOA 3R9IA 3UT5A 3UV6A 3KB1A 1JR3E 4FN5A 1XNQB 2YW2A 3D4PA 3KKPA 4Y1EA 1W5AA 2FMXA 3TZQA 1JV2B 1S4QA 5BQXA 4DUYB 3HWX1 4TGLA 1VJDA 2G5CA 4LZLA 5DNYB 1MDFA 2E48A 2D1QA 2V5AA 5K8IA 1C9JA 1FDTA 1EFVA 1SC9A 3AM3A 2FJ0A 1NXWA 1TM7E 3NC1C 5B3JA 1GUYA 4IFEA 4GGPA 2VK4A 2ZKLA 2W22A 1OPRA 2PLRA 4DNXA 3T95A 4BIIA 5KUTA 4LJ8A 2CF5A 1N7HA 2VS1A 1Y8QA 5GOTA 4XPIA 3V2IA 5P8WA 4HTAA 8OHMA 3TE7A 4EG1A 1PFVA 1QP8A 3MG9A 4L3OA 1V3QE 1N25A 3R7DA 3W6PA 2DBRA 5B7PA 5U9CA 4TLEA 1N57A 2QXTA 1ZOIA 3IMFA 2DPLA 3JZMA 3KEOA 4KGZA 4M1KA 2VNHA 4XB1A 1L4NA 1T1JA 5G02A 3RYFA 3CRZA 3VVLA 3CUYA 3Q8MA 4DKXA 3U31A 4KOEC 1MNAA 1P0QA 1V11B 2JFFA 1AGYA 5JCXA 2ONYA 4Q39A 2Z04A 5EUQB 2BFMA 4EW3A 1WO8A 4DR4B 1BX3A 3NS7A 5CPBA 3W2EA 2A5DA 1NAIA 3UV7A 5HM6A 4QICA 3QE4A 4MAMA 1HGXA 3TFOA 4ZTBA 4JEUA 4KIUA 2OV6A 4QAJA 5BQ3A 4X3CA 5JG7A 4PZPA 2YOHA 4XJXA 3ZVMA 1C9EA 3TZCA 4Y6PA 1HUQA 1U94A 4DLXA 1TAUA 5CXUA 1T4DA 4XM2A 1XD9A 3UO8B 4DBLE 4D9IA 2H51A 5CVCA 4QG3A 2INGX 5KYYB 5E38A 1RLMA 1V8OA 1SG9A 4EY4A 3T4PA 2FUKA 3L1JA 2AFHE 1V3VA 3LKBA 3VI3B 3KXKA 3SM3A 4PTLA 4B3SB 3UG7A 2H2FA 2XF2A 4HQLA 4IIYA 3QFFA 1KJ8A 2JIMA 3C5CA 4A6DA 3E18A 4PO9A 4E5PA 4YV1A 1XL1A 1I5RA 2O2ZA 1C0EA 3I01M 4IX9A 3DT8A 4ID3A 2AZXA 4C05A 2EBFX 4P81A 3KQNA 1I0ZA 1MJ5A 3AF4A 3GQBB 3GFQA 2EYQA 2QU7A 1Y3CE 1ZO8A 2L0XA 3U7RA 2DR0A 3LLCA 3PNLA 1TIBA 4HS4A 3FCEA 4KP7A 4QSMA 3SSAA 1AZLA 1T5IA 5KYUB 5IKXA 3ST7A 4JU9A 2HXYA 2W58A 3CX7A 4H4DA 5B3AA 2J0QA 5F2KA 3CJRA 4Z2AA 2HFKA 4BJHB 5D51S 4D9BA 1A27A 1J99A 4TV9B 4YLEA 3EZGA 2E0IA 3AF0A 3T3GA 4IDPA 4Y6RA 4BO9A 4EDFA 3KJQA 1WX1A 1OWOA 3NTXA 2CMHA 2ZJ2A 4PIMA 5H0IA 2E37A 2MHCA 4A5SA 5LLDA 2VDQB 4RKEA 4HDOB 3RU9A 2CHQA 3EVBA 4WSOA 3UKOA 1FMFA 2YUTA 4GP9A 2Q1YA 1ESZA 1K5GA 4KO3S 2AT1A 4LX8A 4OJQA 4ON9A 5I7AA 4BASA 1XKXA 5HK9A 3ZTTA 5ECYA 1EFDN 1EWVA 3EGXA 1VPVA 4Z9XA 4D8WA 1DWUA 4MRSA 5C3MA 1LDEA 2Z8YA 4DG9A 1HBJA 1QC5A 1CF9A 2Z1NA 1JH8A 2DT5A 3W6UA 2CDAA 4DSAA 3D6VA 1ZVJA 2ECQA 4UQLA 4B46A 4GZ6A 4WZBB 1S1MA 1SC4A 5CIQA 5CM9C 5DLPA 1H4VB 1P1HA 1D4OA 1DQSA 3ZVKA 3TB6A 3GLUA 3OJCA 1IM2A 1UM8A 4PRLA 1BA3A 2VWQA 3DMTC 2AG5A 1UKZA 5TQ0A 4M6WB 1UODA 4PAQA 2IODA 1NOJA 5HP4A 4KXMA 4XWKA 2BFWA 5CBPA 3ECSA 3PKJA 3Q3EA 3T3DA 1N3YA 4WLVA 2CJPA 4BQQA 2P4EA 2GPJA 4WI1A 2NV2B 4ZVUA 1UBNA 1T4CB 1GQSA 3N74A 3QE9Y 2O8FA 1HYGA 2YIJA 4P5EA 5JNUA 4JGGA 1PZMA 3JR7A 4EZIA 1PAUA 5C1DA 1KZHA 3FTDA 4ZOQI 4DR7B 5A4IS 1N9GB 3JD2A 3GXOA 3C7TA 3EB9A 1YQ9A 1M74A 3SQDA 5EMNA 4R0VA 2IYVA 3S44A 4U3JA 1Z5ZA 2QQ5A 3HSYA 3N5CA 3WXBA 3D4NA 2ARKA 3KO8A 4EAQA 1CY2A 4TL9A 4OIMA 3E9NA 1H1TA 1CVLA 1MORA 2GB4A 3OJEA 4WXMA 2PNJA 1YL7A 2GRJA 3D7RA 5EEGA 4FOLA 3T3MB 5FOSA 4TLBA 2NSJA 1BCRA 3OFKA 4UHHA 5T8KC 5AVVA 2SKEA 1H23A 1P0FA 3CUVA 3GZTB 2GNAA 1XCLA 2Q8QA 2ZWPA 4BATA 2BFCB 4PLTA 2I80A 3OY2A 5LP6C 4C43A 1U7TA 4KQ1A 1UL1X 5KYWA 3NHWA 3MT8A 4N7JA 3WLIA 3DXYA 1F8UA 5M34A 4JI2B 1PD1A 3FBTA 2R7KA 5EZSA 4FFPA 5EUBA 3D8TA 5B30A 1JDSA 2FX2A 1CF2O 3U9SA 2IJGX 4L6CA 4YY3B 3AJAA 5EIHA 4A6XA 3MTQA 3CX6A 5CVVA 3WTCA 4EKEA 2O1SA 1KOGA 2GLUA 3ZDFA 1Z28A 2PWZA 3CFYA 2HBYA 4U6SA 3RF6A 5ICMA 1XOIA 1E1NA 3O8DA 4I5GA 5A5FA 1M5UA 1OGYA 4IGIA 1EFKA 4PN7A 5ILGA 3NWPA 5A5EA 1SHUX 1XYYA 1UK7A 2O06A 2QMUA 2Y1EA 4G5OA 4I9UA 3TW6A 3BPSA 5EJ8A 1JVNA 2PFKA 5DTMA 4ALNA 3OEYA 4DPLA 3HL4A 4HEQA 1WCIA 3MJHA 1J24A 4NLLA 5GPBA 1P3JA 1MB9A 3IPCA 4L8GA 4Y6GB 4RV9A 4G1MB 2R5FA 2HF2A 2Z4RA 4U2BA 4EKNB 4YRBA 1LVUA 3ND5A 1R00A 3NNDA 3ORRA 4F97A 7ADHA 1WV1A 2CVZA 3GPBA 1P6UA 5AHRA 1I7DA 4IRXA 1R6DA 3L9XA 1SH7A 5UKDA 4E09A 2ERYA 4X1KB 1OZAA 3VVCA 4JP3A 1KOFA 1UKVY 3DVSX 3OQVA 3PIRA 1KDYA 4CM6A 4PNHA 1FMLA 4Y8VA 1C7ZA 3O93A 1I1HA 4X6XA 2Z6VA 4XR9A 2ZU0C 3DMDA 1JWLA 3A6EA 2G0TA 3SDSA 1M6NA 1P33A 2E4UA 2OBBA 1O96A 1JHQA 2QRHA 2VWGA 4IJ5A 4XOUA 5EJAA 1YZQA 5JBIA 1JQAA 3U40A 1U2RA 1ZWLA 4MJ7A 5F4ZA 1WDTA 1YRHA 3EXHC 1JG4A 3FHJA 3VR4H 4AKSA 1SB8A 2COKA 1XJWA 2E5FA 3GL9A 4RA9B 4ZAWA 1SBCA 4HR7A 4YUVA 1WNFA 2V7QA 1PO7A 2ZJBA 5C1PA 2WD7A 1QIMA 1ILWA 2P2GA 3KPYA 4S1PA 3VC2A 4QYMA 3P2IA 3C3XA 3KNZA 1Q0QA 1J8MF 2YZ7A 4M0UA 3SMQA 3WKEA 1VM6A 3FKSD 3HABA 3I52A 1PT8A 3C1AA 1ILEA 3ZIAA 2HBRA 2ZSKA 3KCQA 2YQ4A 4RESA 2X6TA 1OXMA 4MYSA 5EJGA 1WSBA 1UPXA 2CMDA 2YICA 4V0ME 2QSJA 2CXTA 1Q84A 5JYDA 4MCJA 4MUEA 1RYMA 4BYGA 2WVHA 1WKBA 3QP9A 1CZHA 2OXRA 2PKEA 2PGNA 4V3CA 3D81A 5BQPA 1YFKA 5EJEA 2JLZA 2C7QA 3IMGA 5FWNA 4AURA 2BMFA 1EZZA 3ICVA 2BEUA 2ST1A 4RIIA 3ORFA 5FP0A 1FUEA 3OE7A 5JCOA 4H7FA 3AR7A 3VZPA 4C08A 1ZM2A 4O4JA 3TGWA 3HHEA 2F62A 2GZDA 4QUGA 3DW1X 1YB1A 3ROKA 4TLAA 3QTBA 3BB1A 2G07A 3ZQUA 4RE5A 4CQLB 1DGQA 1W52X 1WS6A 3ZX4A 4MVJP 2D1YA 3PXEA 3TLJA 4F71A 4ZQHA 1KPIA 4BP3A 1UIMA 1OI2A 1VI6A 5DGCA 3T5BA 5KS2A 4BB6A 1ULSA 3SSOA 1BE8A 1C80A 4UCQA 1GNSA 3A9WA 1JSXA 2Y0BA 3ZC3A 3EYAA 1KO5A 2J3EA 1WHTB 3CS3A 3IUYA 4DFDA 1KK1A 3ML1A 3K6RA 3KKKA 2JI6A 2C2MA 3H3FA 3NDIA 3PRYA 4M76B 3RIGA 4YJ3F 4C1NA 4JJFA 1NVFA 4PQFA 4E03A 1QHYA 2GJ8A 1L5MA 3WHPA 5JXGA 2XMQA 4Q1CA 2WHPA 1YR1A 3GZNA 4LYAA 4X3OA 4DJFC 1A4XA 3ABZA 5GM2A 2NGRA 5KOJB 3ZD6A 4WLUA 4GW3A 3I9FA 3QWFA 3V34A 3OZ7A 4JLSA 2CUTA 1NWHA 1WSWA 4LYYA 3FTPA 1NJGA 3V8NA 3STWA 4H6PA 4DA8A 4BNUA 4B7CA 2VF2A 4M21A 4KMRA 1C8LA 2AI1A 2ANBA 1D1SA 5JS2A 5IYZF 4DHWA 3SHFA 4ZEMA 1I6MA 3BE6A 4OJNA 3F5SA 1UXIA 4RANA 4FC7A 3ZH9B 4G0WA 4K6OA 1BX0A 1VCMA 1DFHA 1BKYA 3RT1A 2H4FA 1EJ0A 1U99A 3OQ1A 4CEJA 4GVXA 1EUQA 3QTTA 1MFZA 1LBSA 1MT3A 3GJ0A 3VZSA 2ZTVA 1AH2A 4MVJD 5LQDA 5J4HA 1F60A 4EG7A 2WTEA 2IXDA 3L7BA 4UUMA 1QHHB 2I1QA 3HMQA 4DQLA 1LZLA 3BXFA 2PO7A 1RW4A 2WFLA 1G5FA 2O2EA 4FNMA 4GOLD 3M83A 3ROGA 3S40A 1YDMA 2Q4RA 4X5OA 1ZAYA 4B3RB 2O2CA 1OFUX 3WRVA 3HPRA 2BMDA 3K94A 4HFNA 5EHGA 1W5SA 3FYSA 3JYPA 2ZT7A 1G0OA 1SCJA 2DERA 3DC2A 3FNGA 4J7UA 1IZ7A 5JE8A 1O7JA 1B41A 4IUCS 2JFBA 3NDRA 5EPOA 1CZNA 1QYRA 2NV0A 1NBOA 2F3PA 2QVGA 3RADC 1I3MA 2ZCVA 4P4NA 1FQOA 5BRNA 1EVQA 4ZCRA 2P27A 3BKXA 3EZ2A 4NARA 3RPEA 4DLSA 1Y6FA 1VPTA 2AXNA 3ZY3A 4GI3A 3C5WP 3GLKA 4BP9A 3GRFA 3A14A 1H1LA 3BRCA 1ZU4A 4EVQA 3W6ZA 5C8ZA 2XGMA 1I2AA 4IVRA 1PJ2A 3OEWA 3NU1A 3N8KA 4JJKA 4HPXB 2XQGA 3MYYA 4E88A 4HI0E 1RE1A 4RJIA 2ASVA 2OR3A 3WJ7A 1PTJC 2A33A 2FPPB 3ZGXA 5C7OO 4A8JC 3OEED 1SZCA 4GL4A 2BEVB 2CB0A 4QOSA 3IC5A 3GBSA 4IQGA 3GBPA 1Z37A 2Q0SA 3T12A 1NFQA 1JPVA 3HWWA 4F5ZA 1BSVA 3RAFC 2BELA 3Q7TA 3UF0A 4MMZB 2FZWA 1UDXA 3D6MA 3ZKWA 3GGJA 4KRXA 1Y82A 1NBHA 2Y0DA 4YAOA 1H0KA 5LOVA 4XOIA 1CVIA 5BXQC 3TLZA 2DLNA 3PGVA 1EWKA 1XPOA 3WA6A 3IELA 4ENSA 3TLBA 3HFJA 4R8SA 3BS4A 3IXLA 2B1JA 5REQB 4DY4A 4HUQB 3L8ZA 3EMDA 1IXZA 2YCBA 3PWSA 5LNK6 2A7XA 2OXEA 2RDMA 1GVNB 5E7MA 1R6UA 3DE0X 4G5YA 4TLMB 1U63A 4YPFA 5CMLA 3GW8A 1E0KA 1BXGB 3RS8A 1IOWA 1UEIA 3CLHA 4R40A 1QAMA 2JH3A 2B7CA 4Q21A 1WM1A 2IIPA 3AW8A 5AM1A 5EVJA 4EHHA 4GD3Q 3E15A 3NBAA 4WX2B 2ZJ0A 4L51A 1FP7A 1TKBA 3WIUA 2LXNA 4YTEA 1VB3A 3VR3A 2ORYA 5AJTA 1G20E 1KI2A 5CT4A 4KG7A 4CG1A 1KAEA 1EB8A 3H04A 1YMVA 1PNOA 2CMFA 1O6GA 5AUOB 2DFLA 5BNIA 1RAEA 5EKUA 2HRRA 2PMKA 5FL7A 4IWYA 4HV4A 1O8BA 5I9NA 3COZA 1ADFA 5JC8A 1DIOB 1PVVA 1UPFA 1V3UA 4J16C 3T1NA 7MDHA 4MRMB 1GNQA 1N5OX 3X43A 1D2EA 3HJGA 1CUVA 5DNWA 3ESXA 2XAUA 4HH3C 4H18A 4BMYA 2DP4E 2ID4A 1QIGA 1H2WA 4JSYA 4QQNA 1X7GA 1F6WA 3A1VA 3L43A 4J75A 4MS1A 3EIWA 1TW2A 4D3SA 4X3PA 5AKGA 5K0TA 3D4IA 1PR9A 3BGVA 4XAQA 3T06B 5AW4A 4KQFA 2O6HA 4J03A 4C88A 3WLNA 1JJVA 2X0NA 4IZOA 1RWKA 1C3JA 5HK8A 1RU3A 2C58A 4LFBB 1T36A 6REQB 1XWWA 3W77A 2H4JA 5HBRA 4W1SA 1E7QA 1CU1A 2AKAB 1J06A 4FUQA 3REFA 2P41A 3CC8A 2I6UA 4YCMA 3GP8A 1V5GA 4WINA 2GF9A 2YWHA 3VC7A 2FZ5A 4QL3A 1EGMB 1EWYA 5G0TA 1YI0A 3SYNA 4BTVA 2O3TA 4F8JA 4N0QA 4CUJA 1NW8A 1UBCA 1FA9A 3Q7QA 2WJPA 1NRXA 3IEXA 3N3BC 2GCPA 3O3CA 3W2FA 3ZW8A 1AQIA 1TQ6A 3B89A 5DBEX 2X5JO 5IXJA 2DGDA 2IYPA 4FHDA 3A3YA 3EASA 1QYXA 3L05A 2HF8A 4Z0TA 3ER6A 1O58A 1Z2NX 2XB8A 1Z3IX 3ZWDA 1XQ9A 1UPUA 1A7AA 1VBFA 2Q5FA 4FINA 4RCVA 1WLSA 3PJGA 1X15A 2Z2YA 4R9UC 3LTNC 1U3CA 3FHLA 1KI1A 2XLBA 1XMXA 3U1TA 1MLDA 2EWVA 3DM5A 1OJ7A 4AJOA 4GRAA 4U39A 4K9LA 2X1LA 1NDUA 2N42A 3SZ3A 4B4WA 4YV2A 8ABPA 4PZ0A 4KODA 3WJ2A 2CUKA 3N59A 2GCGA 1MC1A 2D62A 3GAFA 3M6VA 4RM2A 1Q3KA 1NF9A 5EESA 4LBWA 3RS5A 4D43A 4HK4A 4X1IB 4EHNA 4KZPA 1EX7A 1KEPA 3E9DA 3KFXA 1OB2A 1DLIA 2F1JA 2O8DA 4I1IA 3LAWA 3KR9A 3ZE0B 2QUHA 1AGXA 4I9GA 1DAMA 4AZSA 4Y0NA 3OIUA 1Q6ZA 1PTKA 5FTNA 1X1SA 2CLKB 2VP2A 3C6KA 2Q45A 4PIPA 2XWQA 5K8JB 1ADGA 3T9BA 1DIHA 3LCRA 4B8WA 1ATIA 3OT5A 1EMDA 2VYND 2A1TR 4GX0A 2Z6UA 1NLUA 4HNUA 1J8VA 5B12A 3J81A 1F51E 4ARZB 4UNRA 4Y1RA 1DB3A 4CEHB 1CQJB 1T9GS 1SEVA 1DEXA 1E94E 4J9UE 2AC2A 3PQ3A 3FPFA 1WZNA 5E8RA 1DJQA 4L1KA 1HRDA 4JBNA 1I51A 1U1EA 2P6PA 3GI1A 3EXEB 4JI3B 4S24A 5FUWA 3UCEA 2XF8A 5T4EA 1DV2A 1MEOA 3PKZA 2C2WA 4ZC8A 1I4DD 3LCUA 4BO4A 3GCDA 3H5AA 1DKLA 4OH7A 1CX9B 5FPPA 1X7XA 1OX4A 2V7VA 4UE2A 3TOXA 4FEGA 1HZJA 2VBGA 3LOPA 3TSCA 4NYJQ 3R3HA 1FRVA 3MIIA 5L7YA 3C15C 4CVNA 3NTUA 4UQOA 1YL5A 4B7AA 3ROMA 5D1HA 1Z26A 2VFAA 2JAWA 3GT0A 2O8CA 3REOA 3SXUB 2IYNA 3ZU4A 1GPKA 2QRVA 2CD7A 4RADA 1JEOA 1W4AA 1PHPA 4JUIA 3A1SA 4YDSA 3D43A 3BL8A 4WCFB 5EZ5A 3RTBA 3UW3A 2P8JA 4IDEA 4BWYA 5IK2D 2YNMA 4IJVA 3R0ZA 4TWRA 5K3CA 3RUFA 1VRCA 1E5DA 4YRAA 2PDAA 4RVGA 4DADA 1RHMA 3AKDA 4JMLA 3VO9A 1QIDA 4AJ2A 1EK2A 4KN5A 2RGYA 2GZ3A 3IAFA 1JILA 1RWXA 3PQEA 4YEDA 3HO8A 1LF5A 2ZBPA 2JGMA 1XJQA 3ZU6A 13PKA 2G8NA 1K8XB 3EGDA 3A2MA 3SVLA 4IJ6A 1FP2A 2H1SA 3Q0TA 3X1JA 3TVTA 2BRUA 4L0MA 2DHRA 1P2FA 2PGOA 1H8HD 3KBBA 5AK3A 1YMQA 3VSCA 2OBNA 3HKBA 4OJTA 2P9YA 4L4RA 5FTJA 2WT8A 5GONF 5CXQA 1LNQA 2ENUA 4QPCA 4R31A 5L3QA 4P0PB 3RBXA 2IEYA 4BNHA 3MRVA 3A1FA 3NNSA 2VK1A 1WOYA 3NKLA 1GTRA 2YVUA 3KQVA 3U1VA 1IEQA 4G0NA 3K6KA 4G5GA 1KYQA 4EUFA 3V2GA 2VPZA 5IASA 5LQMA 3VZCA 2HJGA 3UM9A 3OLYA 4IHQA 1I32A 1R3UA 4Q4AA 5TMBA 3ELYA 4IO1A 4J4TA 3ND9A 1U0SY 2QN3A 2XDAA 3OX3A 3QELA 4HDQB 1VJTA 5GV8A 4R0MA 4H0CA 4KAAA 3VH4A 1K6MA 3OH8A 3IKTA 3UH1A 1LFDB 1ECPA 4JB2A 1P2SA 1Y3BE 2P69A 3LU1A 4E22A 4MVJM 4NU6A 4BC0A 2NYVA 4B4KA 1VIAA 3LKZA 3WGUA 3R9XB 3OKPA 3E81A 2ZI4A 1O2DA 2GPNA 2G4LA 3O91A 4P2GA 5FAXA 5HS6A 3ZV7A 1NNEA 1WW8A 3AL0C 5F7OA 2C5LA 4NJOA 2XZOA 1S3GA 1B0ZA 1JDJA 1UM9B 2F9MA 2O3RA 2QD5A 4MWZA 1U0GA 1FMCA 2C9MA 4JL6A 1OKKA 1UAGA 3AR4A 4GIBA 4LDPA 4RVSA 2KPOA 4MUKA 3MOGA 3SZMA 1JG1A 5E95A 3JSAA 2V9ZA 1O4VA 4MCAA 4AYXA 4G4SP 4QXPA 2R8YA 4H4EA 3BD6A 1EFRA 1L7QA 5JQWA 3W5CA 4M8IA 2V6JA 4JI8B 1EUZA 1P81A 1FS5A 2DSNA 5TQVA 2C94A 1MU0A 2JD2A 2CUZA 3BAZA 2OWDA 4GWGA 2HMVA 1P3DA 1ZI9A 1R0SA 2XVMA 1XVUA 3RSCA 1A9YA 1X7ZB 3W1VA 3U44A 4GXTA 1Z45A 2NSYA 4PG4A 4V03A 5CTJA 3DEIA 3FGNA 3OZGA 3OCCA 2AZDA 3S55A 1U2TA 2OBMA 1HKHA 3NYWA 4YRFA 5HYVA 1ISRA 3QW4B 4PW0A 1VP9A 3MUEA 1ZL0A 1Z2EA 1VCIA 2FEMA 4K2HA 2D2VA 4H7HA 4HP8A 4Q82A 1F2VA 3IT2A 4DAEA 1ZVMA 2Q4BA 1YUMA 2B7BA 1YGPA 3AUJB 5JNTA 4JJZA 1NOKA 3EVAA 3SEAA 1AK9A 1UANA 2GPWA 4XYEA 3K5HA 4TRMA 1FDOA 1Y7TA 3EH1A 3LUBA 4JODA 2WJ6A 4DDHA 3B3QA 4DG5A 4MVJF 1ONOA 1VIVA 3AEQA 3H5VA 4GKJB 4QUHA 3OX2A 1N6PA 2BM9A 3O2JA 5I7EA 2DBYA 2HW8A 3A3KA 2NXEA 2ZWMA 1Z0DA 1U6JA 1XEWY 3I0MA 1LBHA 1PV2A 5JD5A 5LDDC 1NVKA 3AEKA 3AVVA 1KMQA 3GN1A 4KFCA 3SZRA 4L4XA 1MZVA 4MS3B 5AJYA 2V96A 1AV7A 1U2SA 3DBHA 1TUIA 3ILVA 1KE1A 2JIPA 2A7QA 2H5EA 2FFAA 4LOHA 3Q10A 2QVCA 1KR2A 2XB4A 2OCYC 4JKYA 4BUJA 2IDJA 1OGJA 3V48A 4DM3A 2Q29A 2YV1A 2ATXA 2OQ2A 4WJLA 2CYCA 3FCOA 1NVXQ 1N0IA 1Z0FA 2TECE 3I9KA 4H1TA 4QOGA 4NICA 1JECA 2F7SA 1DV1A 2YIMA 3WRWA 4BTEA 4Y2RA 2DPHA 1RMTA 1Y4AE 4I4TA 2FDCA 1GSHA 4M7OA 2HCFA 5EFOA 2ECOA 3EIXA 4FFSA 4B43A 4F21A 4WERA 1HDXA 2WOOA 2JA2A 3Q2IA 4X6UA 3RG2A 2NZ2A 1U3FA 5CPFA 1WXFA 4L4ZA 2R6HA 4D9GA 4ZK2A 2XNSA 1PVDA 5A4FS 4N1AA 1NM5C 3G13A 4IS2A 2BGMA 4GI7A 4EKDA 2VF5X 5C81A 5FD8A 2WYVA 1JQDA 1M7HA 2AE2A 2CF6A 2WJ4A 3OZWA 3PC2A 4GR9A 3TZ6A 3UWSA 4X64B 4F45A 1N2EA 4MR8A 2D7JA 1BQ4A 3ENNA 1IUKA 3T7EA 1UFVA 2EKPA 2GK4A 1NXPA 2QNBA 2V58A 1U2DC 5LZ5A 1ZIPA 2YUIA 4EGAA 1SXHA 1EINA 2GEVA 3I37X 2VRWA 3QEMA 4PLCA 4PPFA 2CXRA 1HO3A 4ZOBA 1TDJA 1T2DA 4XIIA 1N6OA 1RQPA 1XTKA 4NZ9A 4KUHA 1MV8A 4QTXA 1NATA 4WZAE 3VOTA 1FP1D 4GUAA 4YV7A 1FJGB 1QU2A 3DYIA 3LXXA 1T5HX 4HDAA 5DRTA 4CW7A 1X2EA 2PEYA 2BF4A 5HJ5A 4LN1A 4EYGA 3WICA 3R24A 4CLRA 4C9BA 1M1XB 1T1GA 3PC7A 3Q8KA 5ALTA 3L0CA 2HSWA 2RGWA 3CNBA 2BMVA 1D03A 1AGPA 2DQSA 2MINA 2C4TA 2SKCA 4W7IA 1Z22A 1QJ4A 5GY7A 2I8AA 5JC1A 3T5CA 1KMHB 3NT5A 5JWHA 1Y5NA 1HORA 1QGAA 4DUGA 5KTKA 4D42A 3KAKA 4FMDB 4GMGA 2LKDA 1IM8A 1LI5A 3OIFA 2Y71A 3QMPA 4MOWA 5ALRA 4FDAA 1ECLA 4HNVA 4ZDKA 5I9IA 2DH6A 1FUUA 1ZISA 1YA6A 4ENWA 1UFQA 5J2UB 2JAQA 2FRXA 3U3MA 4CRWB 5ES3A 5K9ZA 1KK3A 1GZ5A 2NADA 4FLEA 4YK7A 4A82A 1B93A 4MYUA 4D3DA 4DZRA 3FSGA 1BFDA 1B43A 1UXJA 3CUUA 3NCHA 3RCBA 3P4XA 4Y2PA 2G08A 3OQOA 3UJPA 2JGIA 3P4UA 2H7CA