3S5JA

2.0a crystal structure of human phosphoribosyl pyrophosphate synthetase 1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
304
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ribose-phosphate pyrophosphokinase 1
total genus 97
structure length 304
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3s5jA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3s5jA02
4RABA 1A96A 1QB8A 1ZN9A 1P4AA 1DQNA 1ECBA 1UFRA 3GGJA 2FXVA 1GRVA 1TC2A 5HIAA 3OZFA 1MZVA 4PFQA 5IAOA 1XTVA 4TWBA 1OREA 1JLRA 2JKZA 4LZAA 1G9TA 1QK3A 5KAMA 2IGBA 4P81A 1ECJA 1U9ZA 1XZNA 4JITA 1G2QA 3N2LA 3GEPA 3M3HA 1D6NA 3MJDA 4RACA 3ACBA 1DBRA 2H06A 4FYMA 4F8EA 1I13A 3EFHA 4LYYA 1A98A 4QYIB 4RHXA 5K51A 1U9YA 1ECCA 4RHUA 1QK5A 1A3CA 1I14A 2YZKA 4M0UA 4RADA 2PRZA 3O7MA 1IBSA 4RQAA 4MB6A 4LZOA 3LPNA 5ESWA 4X44A 5BQOA 2C4KA 1AO0A 1HMPA 2JBHA 4OHCA 3OZGA 5JSQA 3MBIA 4WN3A 1V9SA 5BRNA 2H07A 1BD3A 1QK4A 1J7JA 2AEEA 1OPRA 1WD5A 5HKLA 1BD4A 1R3UA 1HGXA 3OHPA 4LYGA 5IPFA 1ZN7A 1O57A 1LH0A 3S5JA 2GEBA 1FSGA 1G9SA 1GPH1 3HVUA 4M0PA 1QB7A 1A4XA 1JLSA 1ZN8A 1P17A 3H83A 1DKRA 1Z7GA 3GGCA 5EUCA 1BZYA 2E55A 2WNSA 1NULA 1PZMA 3DMPA 4RV4A 5KAPA 1VSTA 4X45A 1O5OA 4IJQA 4RAQA 1XZ8A 1ECFA 4WMLA 2P1ZA 4P86A 2HCRA 2DY0A 1L1RA 1UPUA 2VFAA 1VCHA 1G2PA 1OROA 1NONA 1VDMA 4Z1OA 1I0IA 1QCCA 3DAHA 4P80A 5ESXA 4P3KA 2JI4A 4RAOA 1ECGA 2EHJA 1A97A 4KN6A 4RANA 4P82A 1XTTA 4LZNA 4RHYA 2JKYA 3G6WA 5BSKA 1STOA 4P84A 1L1QA 5E38A 2PRYA 1QCDA 5BQPA 1UPFA 2XBUA 3ACDA 1I0LA 3DEZA 3LRTA 1A95A 4JLSA 1I5EA 1P18A 3ACCA 3NAGA 2H08A 3QW4B 3KB8A 4RHTA 4ZFNA 4QYIA 1DQPA 4PAWA 4RQBA 4M0KA 1CJBA 1P19A 4QRIA 5JV5A 4S2UA 1YFZA 2PS1A 1Y0BA 4P83A 1XTUA 1W30A 1DKUA 1TC1A
chains in the Genus database with same CATH superfamily
4KXWA 3QVOA 1FJXA 5KX5F 1F8YA 2YY7A 3EZ7A 1CDOA 2G8LA 4D96A 1BXZA 1JDTA 2B5OA 2I4MA 2W4MA 1LBIA 5KNCH 4OCZA 2I0FA 1M3SA 1RWVA 3HPRA 1C0EA 4L27A 4JXXA 1M5TA 5I9SA 1HEUA 4IH1A 3TBKA 3VR0A 3ZE7A 4MYRA 1XU4A 2JJ8A 2J3JA 3E8SA 4BV9A 1THTA 2BDUA 4UD6A 5D84A 1J00A 3AVPA 4LY3A 4HNSA 4BO6A 1F2DA 1BWQA 4JLDA 4RDIA 3W8NA 4XJSA 3T34A 1V8OA 4ZI2A 3H2JA 2IH4A 1B2RA 1OTXA 1ZM2A 2X9LA 1GQQA 4N5IX 4EW1A 2P7IA 4UARA 3CLUD 1Y9AA 1Y1TA 3ZWPA 2X3YA 1KJJA 4ZXPA 2YZKA 2ZBGA 4Z7JA 3ZV3A 2FH5B 1ZUIA 3KQOA 3ETLA 3HY3A 3OTWA 1BE1A 4KO2S 1HKUA 2KS6A 3BIOA 1WDWB 2I4RA 2EATA 2XD9A 1WZIA 4NBVA 4F6LA 4OB7A 4QTTB 4HDNA 1KTVA 1HMPA 2OESA 2OBYA 2FZCA 3I5AA 5CVVA 4QATA 2PE5A 4OQXA 3U9SA 5IUJC 1BXRB 4LV6A 5C3MA 1YB2A 2VHVA 5CXXA 5A5GA 4IH9A 1PEKE 3P2MA 2V7QA 2JHAA 4K6FA 4O4HA 3FJ1A 4U7WA 5ESRA 1AM4D 1XQWA 3R0XA 3CSUA 2ZYIA 3IXQA 4W9MC 1IVSA 3TLZA 1TJPB 3LDHA 2XV1A 3P9CA 4OEHA 1OXUA 3LUJA 4WOCA 4RU1A 4P4NA 1OFHA 1QF9A 2QYHA 4WSOA 4ZT2A 2J3QA 3ET4A 3HNOA 4KUHA 4ETWA 4JLWA 5BYAA 1ZN8A 3LGXA 4OMCA 1PJSA 1LJ8A 1N2BA 1CPYA 4B83A 2NO5A 1XIVA 1T5BA 4V3CA 3KQLA 2Q5JA 5KWEA 1W6RA 1H1LB 4K40A 3INGA 3WK6A 3CVVA 1E5DA 2I4NA 2PEYA 4BZXA 1I7SB 1D1TA 2DBYA 4YAOA 4GX2A 1F2UB 2WINI 4HAVA 1XN1A 1QYWA 2BRUA 2AXNA 4Q7JB 1XZQA 2V5UA 2AFHE 2OCBA 4I50A 2IYVA 1EVJA 1IC6A 4DQ0A 3U0BA 4CUKA 1E2GA 3QPBA 4FN4A 1EAMA 3R9IA 3T95A 5F5LA 3UA4A 3WMFA 5LLDA 2WQ6A 4YRQA 2GO1A 1PUXA 1IIBA 5GTDA 2A0KA 1BGXT 1A1VA 1RHJA 5CK4A 3DBLB 1CBUA 4WY8A 4CLHA 2QD4A 3GLTA 1PT5A 4HAWA 1Z2CA 3FUTA 4OUKX 5HPYB 5CIWA 1F9AA 3DXXA 4Y0NA 3N2KB 4CR7A 3BN3A 1W29A 2C1EA 1L4HA 4I81A 2YX1A 3P45A 4JYCA 1C2TA 2FPGB 2AJTA 2ACVA 3BJEA 3HHEA 1MO6A 3L79A 3OLQA 4ZANA 4CJXA 4EPXA 5A4DA 4C2UA 1UKEA 1R0XA 4JSTA 5KOJB 2ZW9A 3TGWA 3VPFA 1QP0A 1F5NA 1DTEA 1W4BA 2BGLA 1TU4A 1VFNA 1JMVA 2REQA 4WNYA 4ZEWA 3C6ZA 1L7VC 1N5DA 3GG2A 1T15A 1PJZA 1MIOA 1KIMA 3HJRA 2H9IA 3OLZA 5FI5A 1RMYA 5HK8A 3RRNA 2BVNA 4B1FA 4LJKA 4EECA 2PKEA 1GUDA 3KPWA 3DEKA 2FEMA 4EVRA 4C7MA 2QTZA 3R6TA 4HJRA 3STYA 3GIWA 3RK4A 3R24A 4QU0A 4DDMA 2ORIA 1SQ5A 1OE0A 4AP6A 4JB0A 2XF2A 1D6JA 4ZVVA 1WHTB 2R6JA 2WP8J 4WK0B 3FF1A 1TQ8A 1NOKA 3DQQA 4KXFB 4N5MA 3K1YA 3GNSA 1ZVMA 2H2FA 3A58B 3TLJA 1KYVA 2J85A 3FLAA 1IAVA 2AJCA 3CVUA 4DLWA 1H4TA 4UM9B 4KYTA 2HQRA 3AF5A 1DDOA 3HCPA 1Z0AA 5DSXA 4YAKA 4LF5B 1B3BA 1V5EA 4ND1A 1VIYA 5DTJA 4CM8A 5JASA 2W6JD 1IBMB 4LISA 4DZZA 4CU2A 3MXOA 3ROEA 3EMBA 1RPNA 1XZCA 3VR4H 5E6UB 3FETA 4J1SA 5LIRA 2A33A 4XX0B 1JKJB 3L40A 3O03A 4DIOA 1LQUA 4XA8A 4Y2HA 3RHFA 3ZGVA 1XI2A 3PQEA 1UKCA 2Y9MB 4ZTZB 3I12A 1H05A 3H2SA 3FOFC 1ISIA 1L5WA 3L7LA 4YT2A 2C4VA 1F6WA 1PK9A 4FK8A 4ABYA 4D4MA 1FU4A 2CD9A 5C52B 3GOQA 1EP2B 3A14A 4U7PB 3ILXA 3NATA 1I30A 2OL4A 3GZNA 3PZRA 5FOXA 2E21A 5K0BA 1MDBA 4LVOA 4LYJA 3RDPA 5EE3A 3TEFA 1DV1A 4EG3A 3PC4A 3LRPA 3NIBA 2BM8A 1GZ5A 2EEPA 2AMVA 3H11A 4M1ZA 2J8ZA 5E3IA 5TB5A 1WBJB 3GP3A 3LCMA 4D0GA 3CLUC 1G1AA 1X2EA 2XCIA 2CNDA 2GNOA 1Y4AE 1RWBA 3DC7A 3ICCA 1OI4A 1Q0PA 4IDFA 5H9WA 2ZYHA 1GITA 2YR0A 3ZU2A 4U1RA 1JHRA 1KRHA 1Q1AA 4N82A 4XWYA 3DHWC 3B9QA 1EIZA 5HCIA 5C5CA 5KHOC 1JHUA 1RHMA 5EWLB 1RXYA 2PX6A 2FZGA 3LFHA 4LOJA 5LP6C 3OM1A 1QPGA 2A5YB 2QLMA 3PVSA 2ZJAA 3DB1A 3TZLA 3T0GA 1CUCA 1Z12A 4AK9A 3D8SA 2JL1A 1A9YA 3DLCA 3M0EA 3QBDA 1NMZA 2ZQ5A 5E6SA 3V8BA 4V0OA 3QOFA 4X6XA 2AHOA 4H4DA 2D2XA 1FS5A 2ID9A 4NDZA 3SHQA 5KNBH 1SWVA 1BWRA 4M1MA 3PXGA 1UBGA 3I9FA 3DFMA 1YAHA 1FVXA 3PPYA 1XTTA 1S89A 1A77A 1IM5A 1BHQ1 2HPVA 1G6HA 2WJ6A 5IT9A 5BQPA 4QODA 1Y8ZA 1J42A 4TVKA 3EYWA 5C3UA 5JSFA 3MUFA 3HJNA 4NJEA 3BB4A 2CJPA 3OOWA 4YJ2B 1KDZA 1M83A 3FZEA 3SS9X 1N3BA 1V41E 4Q66C 1Z4OA 1DEAA 2B1IA 2FQWA 2F3PA 1CS0A 1RLIA 1SVSA 3E82A 4P1ZA 4EOGA 5KQSA 3K5PA 1U6IA 1JHQA 3V6LA 1MOQA 1SUWA 1VJDA 1RIIA 4OKSA 4Q3CA 2XE6A 1NVBA 1VHJA 1C9DB 3BDAA 3VNBA 1GU1A 2CWDA 2YZMA 1PWYE 1YAJA 2Y71A 3PKIA 4Y1RB 3DMFA 1NW8A 2V7BA 3GGJA 3BTUA 2VDRB 3H5NA 2VHQA 4HVAA 3AIKA 2QN7A 3FGZA 3NP7A 2FXIA 5E6SB 5IAOA 3K70C 2VHJA 4YJ3F 5A1JA 2GK4A 2GKSA 1NMXA 1NMQA 4TLDA 2C4HA 3WRXA 5DNCA 1FMTA 3CA8A 1UBNA 2DR3A 4BNTA 4E4YA 5BY2A 3KXDA 3TMKA 3L1JA 4RPIA 1N6PA 1YDEA 4OUDA 2JD0A 2PGAA 3VH3A 5F23A 1V8DA 1OR8A 1OI3A 1FRNA 4XQ0A 3IAEA 1H8EA 1UODA 1M5UA 2YFYA 3FAZA 1GCUA 4R8MA 1VMEA 3WYAA 3W2TA 2E37A 1SK9A 1JAIA 2WICA 3A2NA 4V1CI 2FPOA 3VMMA 2JLYA 1XRPA 5KDLA 3FHTA 1NW5A 4TKUB 4AKSA 3TAXA 2AOUA 1N9GB 3QKUA 3UK6A 1FJHA 3DCJA 1YB4A 3FVQA 2PSEA 2QMEA 1WZCA 2XJ4A 4KWEA 3R7LA 3X1ZA 3M9LA 3N8HA 1IZZA 2LIVA 3IT0A 5D5HA 4BTVA 1N9GA 1SKYB 3HS3A 1ZVQA 2VNAA 2Q8PA 5ALKA 2G5PA 2H1CA 2IQIA 3U31A 4FP9A 4AJHA 2CHFA 1WDMA 4DSZA 1P1FA 1QFSA 1Z2PX 1NXQA 1THZA 2J3HA 3E1KA 3NHLA 4NESA 3I72A 4HQOA 2ONJA 4JBWA 3VDRA 4BVLA 2VTBA 2Q1WA 3DL4A 4IZIA 3DKIA 2IFTA 3RSFA 3EGIA 3UWPA 3IYLW 3FWNA 1BFDA 3PKZA 4JCOA 4PZPA 5K0CA 3C3DA 4LYGA 2HWKA 2QZZA 4EYEA 1FFEA 4G3XA 3RYFA 4QELA 1J06A 3D31A 3NB0A 4PLHA 2D0OB 1REQB 1NIJA 3SZOA 5C7IO 1L4MA 3BD7A 4V1CB 2Y77A 1X2BA 2GEDA 1UMDA 1DQRA 3KT3A 1E7SA 2B8WA 4DRXA 2HJGA 1PYDA 1KNQA 1VJ0A 2BFPA 1G20A 4NZ9A 3TKLA 2YHIA 1CR1A 5A02A 1O0BA 1BU5A 5TT1A 1IATA 1AXRA 2RHWA 1Q91A 2FWPA 2EJTA 2YL2A 1IL0A 1FNSA 2CMHA 1N4DA 1COZA 1ZZGA 2W5UA 2AHRA 5A5DA 4IKOA 3DC2A 2ODWA 3BSSA 3MMNA 5FYDA 5TMPA 2WM8A 2NPOA 3P2EA 4I3HA 2RG1A 3KVNA 3THWA 3D7RA 5H3CA 4J7UA 3U80A 1JILA 3MA0A 2ZBUA 3IB6A 4AQDA 3O73A 4G5OA 4ECEA 4TQAA 3ZVNA 2IKSA 3QELB 2VK2A 2AN9A 1JQJC 4JHLA 1V37A 3BMOA 5IW8A 2IUSA 2WT9A 4J1QA 4MIEA 3UBMA 5K0SA 2PPVA 2J32A 2A7QA 3P0RA 1PZNA 5REQA 5BPFA 4N18A 1FVFA 3CZPA 4GP9A 3I34X 3TIGA 2QTVB 1XXLA 3DMYA 5BNZA 2X2FA 4WBSA 3RGGA 4QXOA 1P18A 2ZYRA 2FUNB 3T4PA 4YMVA 1U0GA 3F98A 2HSWA 3ILHA 4AO8A 3RVSA 2B7LA 3TEMA 2F3TA 1AC5A 3ZE0B 2JCGA 1MX1A 4IVPA 4L8LA 5IN5A 3SJ7A 4JI5B 1OU4A 2HJSA 3L4SO 4NBWA 5J43A 4IUBS 2A9KA 2AN5A 3LL7A 1N77A 2O2ZA 3OOJA 3EJ6A 5AM3A 4URUR 2UVDA 1FVHA 1Y1LA 2WQZA 1J90A 3PUVA 4ALNA 4TLMB 3VI3B 1EWQA 1DQNA 1E2MA 3C98A 4NBRA 5HIAA 4LY9A 2IDMA 3LP8A 3R7DA 1ATIA 1HKHA 2EQAA 4IV0A 3DBIA 4MPDA 3ZEIA 1LVUA 4TUYB 3AQIA 3D5TA 2ZBPA 5GJBA 3QYPA 1G9TA 2C7RA 4BX8A 3W4KA 3BHMA 3E9CA 3TD2A 2J1LA 1AGYA 2YWFA 1OAKA 1MO3A 3DE0X 2JJ1A 1PE0A 3DW3X 3FYTA 2Y93A 2MYUA 4H27A 3VR4D 1B6SA 3IEIA 4LF4B 3OQJA 1L7RA 1XVVA 3QF4B 2JHFA 2PGXA 5HG0A 4CCWA 4CL2A 5L3QB 4Z4FA 2ZWIA 1SBQA 5LP6B 3IAFA 4PN3A 5K6TA 4L08A 5ES3A 4RQAA 4EJ6A 3LIPA 4C07A 2WWHA 4H4EA 2OYRA 2CBXA 4GMGA 4PSVA 3ETGA 3BL5A 1CHNA 3UJBA 4DILA 3CPSA 4GF5A 4YIHA 1E4OA 4AX8A 1WAMA 1N7JA 1NF8A 4HEHA 5ALTA 1VJCA 3TLBA 3PC8A 1D6MA 1JW9B 2JLAA 3Q5DA 2LTAA 3KDPA 4YRDA 1Z68A 3PEVA 1NP7A 4KO4S 1DIBA 2CXXA 3SCZA 1M2FA 4RNDB 4UUBA 3TLYA 4XRRA 4GLBA 2GPJA 1UJ4A 2BTQA 4HGPA 1YNOA 4HVCA 3KUKA 4B35A 2DY1A 3IH5A 5C53B 2VWPA 5I8WA 1RWNA 1RU3A 3LPMA 4U8GA 4TM7A 1K3FA 4ZU3A 2J6BA 5CDGA 5HQTA 1P80A 3IPXA 3VPSA 4BGUA 1CFZA 1GPH1 4QARA 3INYA 3ASUA 4KLAA 4ZHQB 2ZT7A 2WJIA 1GT91 4OP2A 4P3YA 1UBEA 2JGDA 2UUBB 4NOLA 3G0BA 5EUBA 1FB5A 1XCOA 2R48A 4CIWA 4DRYA 5E95A 4MA4A 3W34A 2X3UA 3N53A 4NIMA 3U4IA 2C9OA 1V3TA 4U4AA 4M1KA 3VJKA 4CMJA 5EMJA 1FFXB 3HR4A 4D45A 4URVR 3AZPA 4G1BA 4MTCA 1QRSA 1MC5A 3EQ9A 2XDAA 3PEWA 4CG3A 3PZBA 1AF7A 4NZZA 3F5QA 4IJVA 3RYHA 5HQ3B 2ODQA 3AI3A 1L8LA 2QHXA 3G2KA 3TXYA 5JDIA 3UUWA 1LV7A 3CLRC 3WAJA 4C14A 5FBHA 2P4QA 1TW2A 5H70A 1D7AA 2VATA 3ELWA 4JROA 4BIMA 1X7HA 3CZAA 2OFOA 2HBQA 2ONKA 4P8RA 4OAQA 4C29A 4KHZA 4IO1A 1RKUA 3H7IA 3B13B 3CC8A 2AFIA 5CYPA 5G40A 3T5MA 1K06A 4L28A 3Q2OA 4LOHA 3AVWA 2DETA 2FGJA 5IX8A 4W9RA 4UEQA 2D5AA 3TI7A 1JHOA 1E3JA 3B8EA 4YJKA 1SVNA 4N39A 4QEZA 4HWGA 5AUPB 4RXTA 2HBZA 1JR3D 2O8NA 3LVRE 4D44A 3WIBA 3EIFA 3UKOA 1FQOA 3P0EA 4TZKA 4CLRA 1Z6YA 1DCMA 4MR7A 1DKQA 4WCFB 4A5OA 1BOOA 4ZOLF 4ZDWA 2JLXA 1K8ZB 1KMIY 3QUCA 2ZWOA 3VDNB 1VXRA 3FXAA 5CEEA 1QAOA 3AO0B 2XNHA 2FQYA 3PHCA 3GEMA 1F60A 5TQ2A 3OIWA 2W42A 3G2OA 2X4DA 4RX1A 1LI7A 1N1GA 3IB3A 5EQTA 1ZH6A 2PJDA 3OE4A 4HDQB 4JZKA 3IC5A 3SC4A 4LXYA 3IMCA 1SBZA 2QVBA 3C5WP 3ONVA 4JI6B 4DMMA 2BZ1A 5CDHA 1TX4B 1FDSA 2X4IA 5IRCD 3Q41A 3CRZA 4ALKA 3K2BA 3NS7A 4JJIA 5KTSA 4DEXA 3OQIB 3OM9A 2FEKA 3BHNA 3H2KA 1F0PA 2HKIA 2QJFA 3HDHA 3ZWOA 4AS3A 1XPUA 2ZSIA 5AM4A 1F48A 5DI3B 3NNNA 1YKSA 3OA2A 4IHJA 4COKA 5I47A 1E94E 2ZJ4A 3D4NA 4PX5A 3ULKA 4DARA 5EIAA 2IP1A 3A3KA 2CNLA 2VDQB 3DEAA 3PQFA 2BMDA 4O2LA 2PBZA 5EYPB 3MOIA 1PJLA 1QZXA 2H59A 5E9QA 4DJDC 1G0OA 1F6BA 3IALA 5KYYB 3PXXA 5C1IA 2XNSA 1XZFA 1AQNA 4INAA 2W58A 3GUVA 4PZLA 4DVGA 1P5HA 3RAPR 2NM0A 2GCGA 3SFVA 2IYFA 3AUAA 5EWLA 3WB9A 4KXXA 4N01A 4S1VA 3I9V1 4E70A 5K05A 1P73A 4P0QB 2GASA 2FSUA 2A94A 1UXGA 1H5NA 4ZVMA 5EFZA 4BLWA 2X7JA 1LRLA 2I6SA 4N3GA 3WWDA 1FPMA 1VDZA 1DARA 1QV9A 2JFZA 4RCVA 2QS9A 3N3AC 1G8KA 4FZVA 1GKUB 3EOZA 2PKXA 2PY6A 3BJIC 3C70A 4AO7A 5HIKA 4P3NA 2O48X 2IXAA 1PRYA 1EA7A 1NYRA 2C0CA 1SVUA 3EZXA 4U7FA 2QBYA 1DBIA 2JGKA 4R9RA 3AIMA 5CHEA 5BW8A 1A69A 3Q12A 4NEQA 2IXEA 1IOLA 5IH3A 4BFUA 4BX3A 4QC2A 1B73A 3BIWA 3D59A 5ALDA 4QUGA 1TADA 4UBLA 4ABTA 5E9WA 4YV2A 1LW7A 3PFCA 5EIXA 1IHYA 2HT6A 3GEGA 3T7JA 3W2GA 5ISMA 3H6KA 5I7SA 3WGJA 2QRVB 1GY8A 3RTEA 4C87A 4XEHA 2HTEA 4TVSA 2IS2A 1L4GA 1GD1O 1T9GS 3H1BA 5JZBA 1Z3CA 1M1XB 2EYUA 2HMYB 4J3JA 4G89A 2BD0A 2IV7A 4AYXA 5K09A 3SDSA 4RKQA 1K89A 1F5SA 2YMMA 1DE0A 1K63A 1YZHA 3OJOA 2A35A 4BCDA 3ACCA 2OO5C 1FE8A 5F21A 1FRFS 4M9QA 3NHSA 2HIAA 1AB6A 3GJRA 4AMZA 5EE1A 1AV7A 3V8RA 1QO7A 3VVBA 1QG6A 1U4SA 2IYSA 5AJTA 1M67A 1E32A 1N3IA 4B0OA 4C7OA 1TQ6A 3HZOA 4GOJA 4LEIA 4G1UC 3JPWA 1Q95A 2SHKA 3F96A 4ZU6X 3W04A 4DV2B 1SUFA 3ESAA 3USZA 2YJ6A 1T4BA 3EY9A 1EVEA 4JSRA 4J16A 3ELUA 1VIVA 2A9JA 4R9VA 3RVJA 3DE3X 4EO9A 3NANA 4IICA 2WKQA 4B3TB 4PGMA 1X14A 1Y3HA 2Q8NA 3DDHA 2W2VA 5AKYA 1KGDA 5G02A 1B76A 1WB5A 3OT1B 4G5GA 5LLSA 3ZCTA 4PW0A 3B70A 4H0CA 1OXTA 1BQ4A 3P4XA 1SIOA 4IQ4A 2PX8A 5CDFA 2GYVA 1W0KD 3D02A 4PFSA 5I7UA 1Y9ZA 1NGSA 4FHEA 2FMUA 3M5DA 1DQZA 2VXBA 3OAAA 1KI9A 4F5EA 3EIHA 3NAZA 1XO1A 2NUPB 4O5AA 3D1LA 4URWR 4UTNA 2VUSA 3JWEA 4J91A 3RT7A 1JGTA 1GADO 2PYZA 1X13A 1P3DA 4LY6A 4RD3A 2IPXA 1Y1SA 4JOCA 1B00A 5LXTA 3LSTA 2GUGA 3AR5A 4NARA 2DXIA 4X85A 1VRWA 4YMHA 3E3MA 3B3AA 4RY9A 2ZXUA 1IUNA 5K8LA 2QE6A 2NO6A 4HGRA 4ZEXA 4FWTA 2QQ0A 1GTL1 4O2AA 4ZO9A 4GE0A 5EMMA 1ZAYA 2PX0A 4JJZA 4P35A 5K4AA 4E2ZA 2GXAA 1FDIA 2QYTA 3R4CA 1HQYE 3U4GA 4QJ3A 3ESCA 1ZW1A 3L4KA 1GOTA 1KORA 2XAAA 2H48A 1OX4A 2DLNA 1UZLA 1X39A 2Q3HA 5JMWA 1VMKA 1XEAA 5AYVA 3SQDA 1PFUA 1Z26A 4I4CA 4YALA 3U37A 3ZHYA 1DB3A 1OZHA 1QO0D 1L7NA 3L77A 1SHZA 2FETA 1YUNA 4U9UA 5LZ5A 3CHYA 2P62A 4P6VF 4OGFA 1SKQA 1T0HB 2I03A 1FZTA 1RAEA 2FPXA 1GT6A 1MT0A 3D2CA 4YK7A 4F97A 4MW6A 1PWXA 3KAKA 4D8TA 3H4IA 5FUMA 4FHGA 5FKJA 4EM6A 1KOGA 1KQOA 3HN7A 2NVWA 3LQ1A 3W5BA 1WUTA 3WI7A 2GHTA 2RJ3A 3ND6A 3WMEA 1AU9A 2H0QA 1VDMA 1NF9A 4YT4A 5BN4A 1N1EA 4OQFA 1PS0A 3Q4GA 1Z8FA 2YHAA 1QAMA 5COQA 3N70A 2CLFB 3PL1A 3L84A 4CLRB 2JAXA 2F1KA 3PRYA 4JBNA 2FI1A 3HBFA 4KXQA 4CE6A 1X8KA 3ASYA 1AX9A 3C24A 2HPAA 2W71A 3ZJVA 3NWEA 5K3CA 3NKLA 3H0KA 3HVRA 2MWMA 4ARBA 4S1NA 1RM0A 5M34A 2IHBA 3U6BA 1IMOA 4HMQA 2ZRHA 1T24A 3L4BC 4JZYA 1E79A 4MYDA 1ZD3A 3NAGA 3D4OA 1LQ2A 3LHKA 2NGRA 1RHRA 2AMFA 4FI3C 4Q1EA 1QR6A 4U7GA 2KE5A 2HPHA 1LGYA 3PE6A 3Q5GA 3RSZA 2LVBA 3ONNA 4EG5A 2XWBF 3BJRA 4XCQA 1PV2A 3T9FA 2G0TA 1Z0UA 1GDDA 1TMYA 4Q4DA 3UHFA 4L78A 2Q41A 4P83A 4B6RA 4X1YB 4HQLA 3W7AA 1Z7YA 5CW2A 4CGZA 2HIHA 1JECA 2QXTA 2IIQA 1S01A 3AP1A 4JAVC 3OCWA 1HYQA 2E49A 3O3OB 3CJTA 3E48A 1CUFA 1UFRA 3I9KA 3TIVA 4LVUA 2C9MA 1Q3HA 1RHQA 4TS3A 1LPPA 4DCMA 4IS2A 4TRRA 5DRYA 1VG1A 1JU3A 4JL6A 3BOSA 1UJCA 4P38A 5EPUA 2V0GA 1UCFA 1IMJA 3LXRA 4NYMR 2IUUA 1FOEB 1R9GA 1XKTA 3KKZA 1GDHA 4IG9A 4B74A 4UU1A 4UM7A 2P9GA 1EWVA 2JLUA 1A71A 3LCRA 4RESA 1Z6PA 1IHPA 2FHSA 4HPWA 4B5LA 4UOEA 1QTRA 4NWIA 4MARA 1QO0A 4GGOA 3RRZA 4B43A 5KYKA 4FLMA 1KY2A 1KH1A 2LD4A 4IILA 3GNQA 2PFSA 4ENRA 1TKCA 1K7CA 3PV0A 4B46A 2P6NA 2A3RA 1AQYA 1A9SA 1GZ6A 3EFBA 4Q9AA 5TXGA 3N8KA 2IY9A 5A6VA 4E15A 2AQHA 3OPNA 1PQWA 1H6CA 2B83A 2NYRA 1CG6A 3IJPA 4NFLA 4YP1A 4Q01A 5DM2A 2ZIAA 4B7ZA 4DJFC 3ERCA 2EKLA 4AJIA 2XNKA 4DTCA 1EJ0A 4UTZA 4D3ZA 1ULUA 4YCAA 5DDIP 2X0DA 3LYHA 2O54A 4HEJA 3EIQA 5DM60 1GFZA 5C80A 5BNFA 2GEJA 4AJ4A 3KJZA 1M2JA 2NQ2C 4MR9A 1FTSA 1MQ8B 4OU5A 1ZXXA 1H66A 1IEQA 4WZAA 4XW2A 4G25A 1P4JA 3T38A 4MUMA 3K6RA 3LLUA 5IPFA 1TJ3A 1PU2A 2CL5A 4JT9A 3L7IA 1ZD1A 1QHSA 4QQKA 1BCSA 3K0AB 1YA6A 1OLXB 4G4JA 4BZPA 4TSKA 2HLDD 2EZUA 4D25A 1P1JA 1PJRA 2VNKA 1WLSA 1IZ8A 5FXMA 2RHHA 1AKYA 3H83A 5JI3E 3AJDA 1ZA1A 4BLVA 1GA1A 5JAHA 5FOTA 4OHRA 4DR3B 1YR6A 3D8UA 1N8KA 1Y42X 1POXA 4NJOA 5IWCA 2WKPA 2OD2A 1GLNA 1QHNA 2RGDA 3O9ZA 2J6HA 4A2CA 2XADA 4H35A 4Q3OA 4UUQA 1XQXA 1CZOA 4FKMA 4L51A 4WZAB 4NSNA 4YRRA 1BJKA 3PNKA 5JVDF 1E0JA 3JZIA 4S1WA 2I7DA 4RVOA 4MIKA 1I3CA 3PPIA 2HV8A 2IZ1A 3S4YA 3JPYA 4MA0A 3RKRA 3RVOA 3IP3A 3TLGB 4OPMA 4CODB 2C3OA 4L5YA 1FXSA 1QC5B 4TSRA 4AC9A 5CT6A 4AQ7A 3O3CA 3WMXA 1NBEA 3TLCA 3VTAA 1OB2A 1NP3A 3A8TA 2PS0A 3I28A 4I9FA 1XZEA 2HNKA 5U4XA 1WSAA 4BB5A 4NJMA 5JPIA 4QDZA 3ZU3A 1YZGA 5JS1A 5CCXA 3DEZA 3NI2A 1Q83A 3T1YB 5M29A 4ZCPA 3O83A 4LJAA 5JHGB 2VHYA 1K66A 4KGZA 3RBVA 2K4MA 4Q4CA 1FDOA 4B48A 4ENSA 2J48A 2R6R1 5FPHA 3IQWA 5HM6A 2GF2A 2E18A 5E3JA 3OQ1A 3FX2A 1Y6RA 2W2XA 1RWQA 1ZUNB 5DBEX 1S4QA 3NFYA 3FDFA 3PCRB 1SIWA 3IA7A 4ZYUA 3L6UA 1MJ5A 2V7GA 2PH3A 3LKVA 1WF6A 7AT1A 5C1DA 4A0GA 4P54A 2AYXA 1CRWG 5LQSA 4KRXA 3K3PA 5EJ8A 2HF7A 4GM1A 3EB9A 2C92A 1EPUA 2GZ2A 2XR1A 3LBYA 4AZ0A 3SZRA 3OZFA 4L85A 1HSZA 4F6RA 4AS2A 3HG7A 1E1MA 2XVMA 3IA2A 2PSJA 1XLVA 3DZIA 1U0NA 1LPBB 2P30A 1XOIA 3AF6A 3ZH9B 5BSHA 1U2DC 2PWZA 1MW8X 1GDTA 1JX6A 2Y1XA 3P1JA 2BONA 4YMSA 1C80A 1EWRA 1X80A 3KOOA 2LV8A 4X5OA 1C8KA 4O33A 5EESA 2REXB 3E9MA 4EYSA 4HKTA 4XR4A 5H5JA 1SBTA 1Z9BA 2X3FA 5EVJA 4TRNA 1LPOA 4ILEA 2JFOA 5LOVB 1SBCA 2Y27A 5LFAA 3WGQA 5LP1A 1J0DA 3TTYA 4P3XA 3E0QA 1QPZA 4Q4JB 1O3YA 4WASA 1O95A 4U5XA 1A2OA 1FP4A 1RQXA 2G83A 4FYVA 3UJ3X 4FB4A 1GZSA 3O21A 1B74A 2FOXA 2GAOA 2VPPA 1FLNA 1P2DA 1E0KA 4HWSA 5DN6D 3JQ9A 2CGEA 1FNMA 2EX1A 1NXPA 2B78A 3V2GA 3EPHA 1B6RA 1OCEA 3SJBA 1YQEA 3D6JA 2J30A 1PVVA 2WNIA 4OMDA 2GCEA 1ZGBA 3ZGNA 1TEVA 1RXSA 1TAQA 2BTOA 4X1OA 3M89A 2NT3A 1L5KA 1OWLA 3GBPA 4FEEA 5F3DA 4E2XA 1JZSA 3PE3A 5H82A 1DWQA 1LS6A 3IV7A 5IAGA 5T4FA 5IDQA 5DISB 3HDVA 4KWCA 2JJMA 2EQBA 1UBJS 5F7XA 1C0LA 1H4QA 2XRZA 4OXYA 4RF4A 4HCJA 4IH4A 4UBNA 1QYVA 3G2MA 3ZXSA 1M72A 3VOTA 5DT2A 5J1SB 1VSTA 2WJ4A 1Z08A 1N2JA 4UNSA 2YHBA 3QVWA 1O77A 2QUZA 3PPXA 3W1EA 3EXHB 3VU9B 1HEIA 1N36B 1EK2A 2WUFA 1GGVA 2X23A 3LDAA 3NVDA 1QO9A 4NYJQ 4UPEA 5JW6A 1C7QA 4RSHA 5T6MA 1EFUA 4EB8A 2AWNA 4HGNA 1R74A 5KKAA 1YFLA 2FK7A 1ULZA 3GFTA 4BRZA 4HUTA 7YASA 5JD4A 1FJGB 2ZI6A 2ZAOA 1QVWA 3OCXA 1A8SA 3LWZA 3SKVA 3OX3A 3W3AH 2O3JA 5U1PA 4F92B 3U5TA 1K7EB 1GUFA 4HXEB 4L3VA 3GCDA 2L0XA 3KELA 4ZI7B 1E9SA 2VA8A 2ZQZA 2DG2A 3CR7A 3NQ41 3MSCA 2CXSA 3H5AA 4GPTA 3RG2A 4EBBA 5JPDA 2EAUA 2IU6A 3I5YA 1ISMA 1IRIA 2D6FA 1G8SA 4FFSA 1N8SA 1DBQA 4YFVA 4BZZA 3CX8A 5KHAA 5SY6A 5HSGA 1WNFA 3INTA 3M8KA 1G55A 1N0VC 3IP6A 2LCFA 4XTRA 3U56A 2CXTA 4DLPA 5C1BA 2DH6A 3FCXA 3HP4A 3H1TA 1ORDA 1YACA 4G8DA 4LJ5A 4P3OA 2WMOB 4KK4A 4ZAFA 1VMIA 2ZJ1A 4N6NA 4Q1DA 3LX8A 4G0WA 1R37A 1ZC3A 3DV0A 5BSMA 2M6KA 1DINA 3QKWA 2K2WA 4R3NA 2ZS7A 3R6GA 4X20A 4GQBA 2IY7A 2VNJA 4CKWB 1RXEA 3O2QB 5I3CA 2PWAA 1T8PA 3A11A 2AYYA 3GLIE 1C8LA 2PD4A 2UZ1A 3ZS9A 4OB8A 4Z5XA 4JX9A 1AE1A 2KSQA 1R0LA 1WKVA 4FBMA 2YXDA 4B7UA 2J0QA 5EP1A 3GEPA 3HCRA 4F11A 3JTMA 1L3CA 3E2IA 2YICA 3P4YA 3QMVA 4F21A 4DR1B 1IXZA 2H8GA 1I2ZA 2IY8A 4O4IB 2CWWA 2R1ZA 2C5HA 1HE8B 2CJWA 2CEAA 3FLMA 3TB4A 3VPBA 2WR8A 4REOA 4Z99A 2D5LA 5C8DA 1ZI9A 2CL7X 2XB2A 3VJRA 1I2BA 4HLCA 3GLFA 4MXDA 4KXUA 1E5LA 3LPAA 4X63A 4B3RB 3G2NA 3K15A 1KO5A 3JWIA 4PC1A 1K7FB 5IDVA 4J4BA 4P9NA 1L7QA 4EHKA 3G2IA 3VNQA 1W36C 1WQ1R 4B3XA 2EF1A 1B0AA 3SNHA 1XTBA 1B0PA 1FQWA 1KEEB 1N8TA 3DAOA 4ERXA 1DFGA 1GGKA 3TUZC 2I22A 4RTRA 4CFYA 3DLTA 1EE9A 1KJIA 2QUHA 4GVXA 4L4YA 2HDHA 1P6QA 5ERGB 5FJIA 4J7AA 1PG0A 1B8NA 1W4RA 4HN2A 1B14A 3HDYA 3AP3A 4QNMA 4B4KA 1UR5A 1G1MA 1NNLA 3MG9A 4AYWA 5D3MB 4XSVA 1RQLA 5DYNA 1PN3A 2BFEB 4MRRA 5JDCC 3EG9A 1O94D 2E7ZA 5LSAA 5AJWA 2EIXA 4XUCA 1QRAA 1USKA 1GYRA 3PWZA 4BBZA 4II2A 1UBHS 1Z2EA 5IARA 1E9EA 5KSYA 5ESDA 2HMVA 1Z2OX 4P2BA 1PZEA 4XD7D 1TZJA 2C2HA 5HBGA 1Z06A 3WL3A 5FYQA 5KTKA 1WBBA 2HYDA 2QY6A 4IDAA 4QE3A 2Q1TA 1ND6A 5FLKA 2DTDA 1WY7A 1N75A 4OLFA 3LSYA 1KJ9A 5JAUA 2H63A 3VHXB 3WNQA 2Z2YA 4HZGA 4W7HA 4R31A 3BPSA 2P2DA 5L3SB 3L7YA 1USIA 2BGWA 4I7EA 4OYRA 4XM2A 2QRMA 1A5AB 4UATA 1KDPA 4FMBB 2BTEA 4D4KA 1WD7A 3H2YA 2IXTA 4GUAA 1ZK4A 5KYNA 1V4NA 2V6GA 2BT4A 1Y8RB 2Z1DA 3E05A 4P3KA 3UKJA 1NVAA 2BFNA 1MIOB 3KYCA 5DGCA 3AHDA 3TRIA 4P82A 3UICA 2VYNA 1J22A 4LZNA 4M83A 3WGLA 2PBLA 4CM4A 1CQZA 2FW9A 4B7CA 1J0EA 3PFBA 2O8EA 3QTLA 2OZLA 3EDCA 3B3GA 1P0FA 3OFSA 2QAGB 5HF5A 1NDQA 3E18A 3QYJA 4G8JA 5JSZB 1OYOA 3IT2A 2Z57A 4OQQA 2Z4RA 4RO0A 1B16A 1MB0A 1DEOA 1EU1A 1GPAA 1QGOA 1EGQA 4LBZA 3OPMA 2NADA 3WV4A 4C06A 1NPDA 2A9OA 2FFRA 3G88A 4B6EA 5IFLA 1I1QB 1Q17A 2DUNA 3PGXA 1SGWA 2BMWA 3DZBA 1AUOA 3H5OA 2MSEB 3GNLA 1ZK1A 3WRWA 5BV7A 4M1QA 2QQ5A 1FF9A 2IEAA 4TWJA 4EFDA 4F4HA 2X8WA 2HPZA 4Q3LA 5JMTA 1CB0A 4K6HA 3NORA 4PYMA 3QKSA 1HTWA 1CQJA 3HDGA 5H83A 3FY4A 2BBTA 3PQ4A 5K0TA 3DFFA 4IEIA 4OHKA 2WFLA 4DPKA 4UEKA 5FOQA 5IF9A 4R2IA 3I1IA 5EWJA 4EHLA 1KQNA 3KHSA 3G49A 1N6LA 4CW7A 3NUQA 3UG7A 4M0DA 3N2LA 4JXJA 3ZJ4A 3NDPA 4KIFA 4AJPA 3EX7C 2LRHA 1J9GA 4C3OB 4IIUA 5K0ZA 2VJAA 2EFCB 5I8PA 2ZRIA 3E15A 1GO2A 1BN7A 1JZTA 1P2FA 2GPYA 2XY4A 3NG1A 1YJBA 2HWUA 3P9XA 5FRDA 5T8KA 2ILTA 3UCXA 3DWFA 1Y1RA 2PEZA 4U8HA 4M0UA 3BKXA 3EXHC 2JH8A 3A10A 4D0RA 1CP2A 3LRXA 5H4HA 1MNQA 5LU8A 4AG5A 1E6CA 2X0KA 4YJFB 2CNNA 3AFNA 1HE5A 1ZX1A 3CBGA 3PDJA 2OHVA 2VWHA 1NY6A 2H5EA 2O1WA 2HHHB 4RS3A 1M0EA 2KQUA 2VAWA 4OHCA 2V59A 4UVHA 4MW9A 5KOYA 1P5JA 2EW2A 1TQHA 2HCTA 2VRBA 4GEKA 3UAYA 3F71A 3TOVA 3B7WA 3KAJA 3DXYA 3BCUA 2H18A 1W5TA 2APJA 4J0KA 1P1RA 4WFIA 2VZ8A 1X1DA 4AG6A 1F2VA 2QRJA 3OX4A 5JD3A 5C8ZA 5JXIA 3CRMA 4XVUA 1UJMA 1OA0A 2VKTA 5EE5B 1TVEA 1TU0A 3K5WA 3AILA 4XM0A 3NWOA 4GX1A 2BJVA 2JK1A 4O8CA 2G1AA 2Q5CA 3DE5X 2ISCA 1TKAA 1DRVA 2P9TA 4KYIB 3CGGA 3AJ9A 3FBTA 2C58A 5FWAA 2A5JA 4QT4A 1QWSA 3Q9UA 1NJ2A 2W43A 4WLNA 5JLAA 4D2IA 1VCNA 6GPBA 3ZV5A 1CYDA 1VMDA 2C42A 4H4CA 4LYAA 1LY1A 2PIDA 2R8ZA 4U02A 3FYSA 3TW6A 1JWLA 1ZH0A 1O9GA 2EZTA 4BO3A 3RS5A 5J47A 3RU2A 2B4TO 1EVKA 2CFSA 2H3EA 3L4JA 5JDCA 7MHTA 2ZDGA 1ABFA 4F60A 5LQRA 1KYXA 4LTMA 1Z6GA 3F5MA 3K0KA 3GLVA 4MVCA 4R0VA 3RFCA 2JI4A 1G8JA 1WW8A 2OCGA 3IDQA 4Q1AA 2OD9A 1JG4A 4P7JA 3E2MA 3W9SA 1ZD2P 2X5XA 4I6JA 4LQ4A 5IM5A 1Z4JA 4M1SA 2WIFA 2Y0PA 4QFCA 1E79D 3ZG6A 5HGXA 4IV8A 1IJEA 2QG6A 4IJKA 3HL4A 3C3AA 3H9UA 1UBLS 2FLWA 4KMSA 2NZUG 2YRFA 2VHTA 4NS4A 3X3HA 2RARA 4YRGA 3AUJB 4K88A 4CM7A 1X86B 2ZOSA 3FCUB 3U60B 3ZY3A 4YQYA 1RRGA 2O0HA 3KQPA 3EQZA 2B2XA 3Q87B 1ZQ9A 5BP7A 5MFZA 4GOND 2CJFA 2ACWA 3K1AA 1Y6QA 1W36B 3C3WA 2JFVA 2M2IA 1YFKA 3CRVA 4EGCB 1SCQA 2AOTB 4Y7DA 4B6GA 4DMUB 3HSKA 5DCYA 2MU1A 1AG9A 3TO5A 3WIOA 3ZLJA 1TA0A 3EZ2A 3KAPA 1XB2A 1Y3IA 4JN6B 3WDSA 3E9YA 1ADFA 4DT1B 3W8RA 5JE8A 2K87A 3T5DA 1AN9A 3RHZA 2WIBA 4M8IA 2HRDA 3FFBA 1CXZA 2WJWA 4GVLA 5JG7A 2AE1A 3ZZMA 5A4AA 1EVIA 2QYSA 5EI5A 3ZCSA 3L6DA 5JANA 3JAKA 3VO9A 3NO4A 1ZJWA 3HWRA 1N7HA 2AN3A 2J9YB 2Z04A 3RBAA 1FNBA 3S99A 3SSOA 1K0UA 2R00C 1ZWLA 5HZGA 3HV2A 4WLUA 4FFDA 5IJ9A 4YCSA 1D6NA 2RGRA 1WS6A 1FJ2A 3TN7A 5JMOA 4DJTA 5CW1A 2VPQA 1FP1D 1EHYA 2Y1WA 1Y8CA 8LDHA 2FFHA 2JJ2A 4LK3A 3U3OA 1K6IA 3Q9LA 2RD2A 2JFYA 1VCMA 3LBAA 3B1ZA 2QVCA 3G2QA 4LSGA 4Q4AA 4RM3A 4XLLA 3LO8A 2VF4X 1MA0A 1SA0A 2Y67A 3AFIA 4YT5A 4DLBA 1ID8A 3LAWA 2FR8C 2V4MA 1PJBA 3B8HA 1FFDA 3MHPA 4OJQA 1E2NA 1HFJA 2EIHA 4QWWA 3H9GA 3MLAA 3CMCO 1J2YA 4F45A 3X44A 5DFAA 5BRAA 2PGJA 2FUKA 2WVAA 4K3UA 3QELA 4FE7A 1GZ4A 1Z0FA 2PRJA 1D5CA 1S2MA 2C61A 1H42A 3S2IA 2WFAA 3QA9A 2I7XA 5G2OA 2J9FA 4RPCA 1G21E 3QVMA 4ZXFA 3OH8A 3O93A 4MYUA 2D0DA 4DMFA 5LN1A 1YVEI 3I6ZA 4I4NA 2ZWVA 1NR5A 1A72A 4MQLA 4PBRA 5CGZA 1J1ZA 3EZLA 4F84A 2Q5EA 4IHKA 4EKYA 9GPBA 2OHFA 3O0TA 3B20A 3AC0A 4HNTA 2AWOA 1SU4A 5AHWA 1CJSA 1PJ4A 2GM9A 2Y6VA 3KOMA 3GUCA 2QZSA 3PFNA 2ISQA 1NXVA 4R98A 4EDHA 5IM4F 1ZMOA 3EIXA 3I5UA 1V6AA 3NEAA 5FA5A 5A4JA 5JXJA 4REQA 4FDTA 2DTEA 5EPEA 2ZXEA 1T43A 1LW6E 4WRRA 4MJ7A 5CBPA 4LC1A 5DXJA 5JISA 1HY3A 3WRYC 4Z6KA 1D9ZA 3DKVA 2BUCA 2Q8QA 3EVAA 3HJAA 3K0HA 4Q03A 3UB4A 1Y6FA 4BO0A 3W3AA 2W6ID 4BASA 3M6WA 2Y92A 5HKKA 5HOEA 2PQ0A 3LX6A 1K4YA 1BMTA 5J4VA 4BMCA 2HWYA 2Z8YM 1I3MA 5TGDA 2JAUA 1E5XA 1GPLA 1U0LA 3TYXA 3NJ8A 3K71B 4LWPA 3E7XA 1PSWA 4MUYA 4OP3A 4PZAA 4YQZA 3B48A 4F72A 3QE0A 1X77A 1YOBA 1ZI8A 3QGMA 2GHQA 2YZ7A 4TUYF 1RPZA 4OAOA 5K01A 2RHRA 3KZVA 3ZHRA 4WESA 1I6MA 3NR2A 4OIFA 2H31A 3AFGA 1W36D 3FCYA 4N41A 3RFFA 3FMOB 4HPJB 2AOUB 4U7JA 1FTGA 3KJQA 1BOFA 2J7PA 1UBUS 4M88A 3K9GA 4K8RB 3PQCA 4ER7A 3QXJA 4FHDA 1AZLA 1HDCA 1P39A 2OAGA 4H6VA 1Q22A 1SB9A 1V43A 3AEZA 3FCCA 3MT0A 2H5LA 3C43A 1FUKA 5FBRB 1ZGGA 3VBEA 2C20A 3L93A 2VHXA 4WK4B 1JDBC 5D5QA 4QUKA 4Z3DA 2RHTA 1CRLA 4ZJPA 5LP6F 1W1IA 3AEQB 1U9JA 3B1KA 2GBGA 1X1QA 1EG2A 3ANTA 3PUXA 4IFEA 4PR0A 3L0OA 1CJKC 3DR5A 3LZ6A 2JLCA 1C9MA 3BX1A 4S12A 5AM0A 4U6NA 5LYJA 5BPHA 1QB8A 4UU8A 3IURA 1CDEA 4F4JA 5B7PA 5BSRA 1JEYA 4QGSA 2B35A 1EGVB 1LF0A 3EUAA 2I8LA 1QIEA 3A6DA 3FPEA 2P0YA 3FDXA 3MWFA 4MGHA 3CG4A 5FPTA 4YI3A 5KB3A 1QMGA 2H1SA 5FBWB 5JAOA 4NYJR 3H2ZA 3Q8KA 4A91A 1PHRA 1RKVA 5JY6A 3LI2A 2O14A 4ZO8A 2PO7A 1ZBDA 1Z0KA 5LMUB 3SBXA 3JALA 4EO4A 3KR0A 2Z6AA 4FIZA 4A0RA 5AUOB 1FXWF 1G2QA 3H18A 2VBCA 5EJ5A 3ZE2B 3JS5A 3D3QA 3WICA 1E6LA 2XQJA 4JT2A 4OATA 4FR2A 2G80A 4NCBA 2JG3A 2NNLD 1CS0B 4N3BA 3T54A 4CLXA 5BXQC 2OPBA 2YV5A 2JK0A 4Q6WA 4Q7QA 4R71A 3JX9A 1H2FA 1FP2A 4RV5A 3I53A 3MJEA 3ZHTA 1RYBA 1QZ3A 3GDOA 1SUPA 2FMKA 2BMJA 1JQKA 1BW9B 5LA6A 1G8YA 3VISA 1UBRS 3KEFA 2SKEA 4G4IA 5AW0A 3WAGA 5MGNA 1NQ5A 5D3MA 1PGOA 2YKGA 4WZBB 3HJFA 5KSZA 2RE8A 2J0EA 3QLUC 1SEVA 3WL4A 1VPVA 4B4UA 1Q0ZA 2QLLA 4TSFD 2XB9A 2WSLA 4LFBB 3HVIA 3HLYA 3OO0A 3BJZA 5MF6A 3NZEA 2OYSA 3CH7A 3P9SA 1QP4A 2COUA 1SXQA 3RWBA 3NM5A 4MEAA 1SOWA 2W0SA 3UK0A 4RY8A 3U09A 2Z8XA 5G1OA 4P5PA 3CCFA 3SF0A 1N5LA 2VRCA 2CV1A 4NH0A 4DKXA 2TSYB 1VLLA 4ZYZA 4O6VA 2VDUE 2BR3A 4QPJC 3P2KA 4FZJA 5FPKA 1JB9A 1C41A 1XWFA 2JLVA 3O8CA 1JEJA 1VL2A 1N1MA 3I32A 3AYZB 4G0OA 4G5YA 5KSOA 1CQJB 2VPIA 4ZYVA 1I6WA 3D3KA 1LLCA 1NVUQ 2PSFA 4Z7QB 3H11B 3M81A 4XPIB 5K45A 3O31A 3TPFA 1KEPA 3TW0A 3QXGA 5ED4A 4ZVLA 4TTTS 1T5SA 3VR1A 3FKSA 5KKCA 2C7QA 3BZUA 1M2VB 1ZIPA 4BFXA 3P9IA 5DN9A 2P6MA 1VIMA 2IOFK 3AUYA 3SQOA 1U02A 3X2FA 1QFZA 1ONOA 3MOSA 4DQXA 2Q45A 4LNUB 1CUDA 1QHHA 3TFQA 3V8PA 3EGWA 1RJFA 3DV0B 5I7HA 5K0GA 1UIRA 4B8YA 3KKLA 2CXQA 3C4VA 3AOEC 1JVNA 3G5TA 5I7WA 3AT1A 2O8EB 3ESXA 5REQB 3TQFA 3RB8A 1YR8A 2V8OA 4UXHA 2Q6VA 2OO3A 5CLIA 4IHJF 3ACDA 2ATCA 3TQRA 4EHIA 1E77A 2I3DA 3KB6A 4I4IA 3GPBA 4YRFA 1I3LA 1W85B 1SRRA 3ZGLA 4ZREA 2A92A 4KMMA 1IRXA 5G1NA 1NI3A 2HR1A 4GHWA 2PL1A 4R1OA 1OXBB 2Y1EA 5EAIA 4ZI7A 1JSXA 4Y2YA 3RF7A 1WZUA 3L49A 4QQRA 4RBNA 4ZODA 4C7BA 5DYWA 4LSWA 4DDWA 4L95C 2FLVA 4A8JB 1D4ZA 4NK4A 3B6MA 4K9NA 3VTFA 4DIBA 5ALHA 4QWMA 2XYQA 3HYNA 2JGIA 1E18A 4HJXA 2R8BA 1P4AA 3MRTA 3MS7A 4HK4A 3QX9A 2ZVQX 5EZQA 3GRVA 1G5IA 4ODIA 1H5UA 5BR1A 1EK1A 2Q07A 4QHTA 5DOVA 1RAAA 2W0MA 5HR5A 3KQKA 1G4UR 5CXQA 1X1CA 2AOWA 3OPVA 4P81A 3UWMA 2KJQA 1NLYA 1KS9A 4HATA 1UJ5A 2C4NA 2X4LA 4M9RA 1D0IA 3M1IA 1DC6A 4C6TA 1XG5A 4X1IA 5BW4A 1M75A 2QLFA 2IHJA 1AS2A 1QQBA 3W1VA 1QV6A 3SIPA 4YYZA 1UZNA 2XUHA 3B3FA 2F3RA 1WOMA 4FYKA 4HB3A 4N8SA 3VAYA 3Q88A 4BQIA 4NHOA 1VYHA 4ITUA 3J80A 5JWRA 1E3WB 4MINA 13PKA 3UTCA 2P2YA 2QT0A 3QXHA 2B5WA 2N47A 4MEJA 5KCZA 2B94A 2DKNA 4X44A 4E6EA 4US0R 1V2HE 2C4KA 1R0BA 1BN6A 3IUSA 5BQOA 4FFRA 4TKUA 4NCJA 1ZU4A 1KK0A 2PRIA 1NT4A 3ZE6A 3A70A 4UZSA 4B40A 1QLJA 2FP4A 4M1TA 3A25A 3W0LB 2PXHA 3FAKA 3LQ4A 3IT1A 4MYCA 3LBHA 4Y2VA 3QBEA 4N7RA 4K6MA 2W93A 4UNRA 1P1CA 4A10A 1WHSB 1KHHA 1O57A 3JATB 3R5KA 1ECPA 4B3GA 2JJQA 1SR8A 2ZRLA 4QTYA 4WNIA 1R27A 4O4IF 2V65A 3GVIA 4IIXA 3SVZA 3TQOA 2J08A 1JDBB 1U8AA 4J07A 4JL8A 5J9FA 1G18A 3ODGA 3LW8A 4MMXB 1GG2A 4QPCA 5IKEA 4MUEA 1UADA 2WF6A 3GLGA 1Y8AA 3ZDRA 3JQPA 1QJCA 5C4IA 3NM6B 4OX9B 3GR6A 2B20A 5ILQA 4K6GA 4QGFA 4YAUA 1IDN1 5CTJA 1JR2A 3WKEA 1NX9A 5FAXA 3MTBA 4UEJA 3LCVB 1GUYA 2PN1A 3L0PA 4U0JA 2XGSA 2FMIA 1WTCA 3ZXYA 4GRAA 2WAXA 4WBNB 4CIAA 2IYPA 5AVSA 5KTTA 2EJCA 4DM3A 2Q2QA 2WPNA 4M7WA 4BN0A 1J56A 5EZ6B 3PC8C 2X8AA 3OLVA 4UNNA 2H5JA 1D2HA 4OSOA 3R09A 4UOQA 5GMOA 2CNBA 4UFPA 4DDTA 4MSUA 1RD4A 1GQ2A 4MWBA 2QVZX 3PHBE 2ONZA 3OHMA 3QQ5A 5A9SA 1G8AA 4LZPA 4NVRA 1IHXA 1EFCA 2MR5A 4R5HA 3L05A 1A5SB 1E5VA 5K3BA 4AN1A 1MGOA 2DUUA 4HN4B 1N4AA 3ZVRA 4B3FX 4B7XA 2VP0A 4MOWA 4KBGA 4RHTA 4B5KA 4B7AA 2JDID 4DMGA 5I48A 2F43B 1XUOA 1EK5A 1MV5A 1JXMA 2WJAA 4NI5A 4TWIA 4WZBA 5T7BA 2FW7A 3JQFA 4OQYA 4OSPA 2IPAB 1BWSA 1ONSA 4JJ6A 1JAYA 3E9QA 4FN5A 4TLEA 5FULA 3VZRA 3D1JA 3GCWA 3RC3A 2HIGA 4P22A 4WDQA 3BC1A 3FPJA 4FNMA 1KR5A 4HEA1 5L53A 4K1LA 5EJ2A 3OT4A 2CFOA 1GR0A 1NRJB 2ANCA 4IL5A 4R8RA 2QGFA 5DNWA 4S35A 1FMFA 1Q3KA 4NEGA 5H4GA 1N6HA 1EI9A 3L46A 4Y9TA 1T9KA 4TROA 3L6CA 3RK1A 1V35A 3BRWA 3UWDA 4DWVA 1XFDA 2FQQA 2K5UA 1B8PA 2PA0A 1YJXA 2VZEA 2XYPA 4DV3B 1A0OA 3BGWA 2PGLA 2KM1A 1YHYA 3EPPA 3UAXA 4ZJZA 2DMRA 3R7FA 3I5XA 1QGZA 1FFSA 2Z56A 4GNRA 1QYDA 2BFDB 3K31A 4OQDA 4Q21A 4DY6A 3GLGB 2QR2A 3EA4A 5CA0B 1OFGA 2VZLA 1M2NA 4GP7A 4LJSA 1WPXA 4D4IA 3JQ8A 4ZRNA 1I33A 1E2UA 2EFDB 2YTZA 3HLTA 2QL9A 5EZYA 3HFSA 4JVSB 1OLXA 2QM0A 3PRKE 3PUKA 3Q0IA 4FR0A 4O59O 2VJDA 1J8FA 3JYHA 4QFBA 3UXHA 4A5SA 2ENWA 1P3JA 4QGGA 4DR2B 1FP4B 1T8YA 2YYYA 1XNRB 4YLGA 3WL8A 1E64A 5IXYA 2X5KO 2KBEA 3DOHA 1I3NA 1N32B 3E84A 1PSZA 1P0PA 3IEMA 1ZCFA 3F7TA 1W34A 4DABA 3EVGA 3GH1A 3GN2A 3KT0A 5EOVA 1BJTA 2FKNA 1E9RA 2XAUA 4OBXA 1CEXA 4TQ9A 3AKEA 4AZSA 5LOVA 4TLBA 2HK7A 1KZ9A 2C31A 3IOCA 3JD0A 3N0VA 2IU4A 5LXTF 3WXMA 1K88A 1TGYA 5MFPA 3TG8A 3J81k 1W2WB 3B89A 5I01A 1B0ZA 1ZEMA 2VT6A 3UPTA 3SHFA 4MW4A 2H1FA 4V39A 1U2DA 2PU7A 1B0UA 3PUYA 1QCYA 1QHGA 2VQ6A 4QUHA 4EHAA 3FI9A 3CSDA 1DWUA 2WAAA 2Q2NA 4FCCA 4PYJA 3H17A 4YP7A 3R7WB 2PV7A 2C82A 1OXKB 4OGLA 1T4CB 4EGFA 4NQRA 2A4KA 1SZDA 3S40A 1V1JA 2E5LB 2DQZA 3AFHA 4P4SA 2ODTX 2XKBA 3L8EA 4US2R 4O3MA 4ARZB 1C14A 1KSFX 1I4TD 1WV1A 2O0JA 4QXPA 4G1MB 4YN3A 1M1YE 3AHEA 1NQAO 4WERA 4ETNA 3K9FC 1PT8A 2JAHA 2HBRA 2Q9AA 4ND7A 5C31A 2L82A 1UT8A 2P9BA 2J0UA 3LOQA 4G5RA 3E7PA 4G97A 4PO9A 5CXSA 2AL7A 1DXHA 3S6JA 4C21A 4IW3B 4EKNB 1FXUA 3O90A 1U3FA 4XGQA 4CIDA 4MUBA 1QOPB 1EP9A 1KZGB 2OZPA 2P6OA 4RD4A 3EY4A 3S2UA 4DVJA 3CZ5A 1BVHA 3AM3A 3FB4A 3LC0A 1BE6A 1HDXA 3IQFA 3SI7A 3DTVB 4XB6B 2EYQA 4P31A 3S8EA 1HTBA 2XZOA 3OFVA 1U6KA 3S2SA 3SX2A 4R4JA 1GPBA 1OX6A 1LS1A 1P9RA 3KUDA 5NULA 4LXHA 3R9XA 3V2HA 1LFDB 2E5WA 1KZHA 5BNWA 3MJFA 4BEWA 3U3JA 3UPUA 2F1HA 1I0LA 1BE0A 1DX6A 1VP9A 2FPMA 1Y7TA 2VP3A 1M1NA 4GM4A 1QYCA 1EX1A 2MMCA 3IDSA 3AWIA 3KLMX 3AM4A 4L7QA 2X42A 4MQBA 2H1VA 2P4EA 5G41A 3STWA 4LF8B 1Y9EA 2O2CA 2VP5A 1TRKA 4QFDA 5I9LA 1YA8A 4L8YA 4ZAYA 2AFHB 1DKNA 1LSSA 3GHYA 4EGJA 3ENQA 1QFYA 3FTQA 2JH9A 4GG1A 1KAQA 1XF9A 1R0KA 4E5DA 1T0IA 1VG9B 1NP6A 3FPSA 3OT1A 3TZHA 3UOGA 2BYTA 4KKXB 2Q4OA 1M2OB 4X54A 5AI6A 3U81A 1YQQA 3V1UA 3GQBB 3LC1O 3P9QA 1LBHA 4IIFA 5C37A 2G5GX 4OJYA 1U8CB 3CB4A 3TIIA 3U40A 4CF6A 5E8JA 4D0NA 1LRJA 1MJNA 2FKAA 2OV1A 2Q4DA 3OLCX 2ABWA 4J9VA 1IN5A 4F9TA 2VT7A 3JV7A 4IIDA 3DYIA 1U2TA 1Z35A 2EG5A 3Q7PA 1IONA 1X92A 2Y1FA 4NPCA 1JJ7A 4XB2A 4XR9A 4UCFA 4XTCS 1GPJA 3WFJA 1E2QA 2EC5A 4BO7A 2HMTA 4PU0A 2DSNA 5HRUA 1CF4A 4LCBA 4NMLA 2NTYC 5A2QA 1W1UA 4FYMA 1T6YA 4JB2A 5BOVA 5CAEB 3EDYA 3QFRA 2Z9CA 1U9YA 3KHKA 5FOUA 3HFRA 2VZ0A 2UXBB 4M6WB 4TN1A 2FMTA 1UXKA 1QORA 2H2GA 1MUUA 4J94A 3IQEA 1DC5A 1MIHA 1U3CA 2ORVA 2QE7D 3EF1A 2NX2A 3IPAA 3SEQA 2ZIUB 2RBGA 3FTPA 3PICA 1X7DA 2BLLA 3EVBA 4UCWA 5BN1A 4J03A 2HQSA 3GPCA 1VRCA 3V1KA 3AEUB 5AKHA 1RYFA 4NBTA 1A9RA 1VC2A 3RTBA 1FMJA 1ID1A 2OQIA 3RUAA 5AK3A 1YZQA 2G1PA 2BE9A 3HZRA 3M4NA 4M8SA 4PANA 1R18A 1X1BA 4WE3A 3RNLA 1Q7GA 4EG7A 1F3OA 4KPEC 3TSCA 1GUAA 2Q5LA 3PCXA 4LVCA 1V4BA 3RTCA 3FJOA 3JYLA 1AHIA 3LDFA 3OHPA 1NZDA 2VK1A 5GV8A 3A1EA 3KL4A 3RVRA 3F5SA 3HADA 5AVZA 4KQXA 4D4JA 1KY3A 2HLHA 5TEWA 2RC6A 3LUBA 2O57A 4TRMA 3RROA 1JWAB 3OE7A 1D4OA 3PQ5A 4L8GA 5L8VA 2Q5QA 2REOA 1QG0A 4PX9A 2ONYA 4JI2B 5A7GA 1GU0A 5I3ZA 4EHFA 5AKEA 1OPXA 2P5UA 2ZBDA 3NHFA 1T0JB 4MV3A 4JODA 3TL3A 3F74A 4DKJA 1ITZA 2IV2X 3V8MA 2ZYSA 1NKTA 3AETA 4X1YA 1PLLA 5BMVA 5BN5A 4BXOB 3D8BA 3ZOKA 2PUAA 4PWZA 3N5KA 1BH6A 3HYCA 3OKCA 3UWOA 1UBMS 1Z3IX 3AW8A 2V7UA 3T99A 2ZLBA 1SULA 3QNUA 3A2LA 4QLAA 1GQOA 2G9QA 3PX7A 2WG1A 4M4SA 4PCVA 3C1TA 4IHJB 1HH4A 2EKDA 4YP6A 4CLOA 4PY2A 1P5FA 5HXAA 1AKTA 1T5LA 2R25B 4LXXA 1USGA 2QPLA 3C16C 2C03A 3NC1C 1XTSA 3ZWXA 4GI5A 2HCJB 1XMPA 5FWXA 4MR8B 3RUHA 3R8CA 3HO6A 3LPDA 3K92A 1FA9A 4CHTA 2R4UA 2XRMA 3V32A 1GG8A 1BYIA 4QYIA 5IH7A 4FGWA 2YFKA 3LA8A 5DBIA 1RAFA 3C48A 2RCYA 3DUWA 1RC8A 4R1NA 3G8CA 1W581 5ECGC 1U0JA 2V54A 1Y4ZA 4ADSG 4I1PA 1IPFA 1YMQA 4B3IA 2GBLA 1NA5A 1NLFA 1JMYA 4GYJA 2HQBA 3NBXX 4ND8A 4PGAA 4XYMA 3RUCA 3WOHA 1KOJA 1AK9A 3QV1A 2C2BA 2XT6A 2F7SA 3GDHA 3K0FB 5AM2A 2VBIA 2W6MA 4BMOB 3MGBA 1FLVA 3E5MA 1B42A 1JJVA 2AC2A 5A05A 1DLIA 3OESA 5DBHX 1P7VA 1Y3FE 3IIMA 5JZMA 4EQ6B 1RABA 3H3FA 2ADOA 4GGPA 3RU7A 1QWOA 4FFOA 5IAKA 2HI0A 1WMBA 2VDNB 3MUNA 4RZQA 4AJEA 2BY4A 3U1BA 5CCEA 1QHFA 4JQOA 4XCVA 5ERXA 4HL6A 5KVAA 1H0HA 3M3HA 1KERA 4TUYA 3O9VA 3V4FA 4PFJA 3ENWA 5KI6A 1IIRA 4HS4A 4F4CA 1EE1A 1GZHB 3OFJA 3PEUA 3V4PB 1NW3A 1U1IA 4M53A 4BP3A 2G72A 4IIBA 3IDZA 3SZGA 1M6NA 3IBYA 1PYGA 1T8TA 1BAPA 1H5QA 1W9MA 2CDCA 3PQ3A 1DAPA 4O63O 3UN1A 4DNFA 2OAQ1 2BMAA 2DH5A 1RJEA 2KLHA 4M98A 4YRTA 2P6UA 2ONCA 1LLDA 2A14A 3IMEA 2GZ3A 4ISCA 3ZWNA 4CMCA 4DBVO 4DM7A 3QSYA 3AR6A 1VLVA 1KETA 1O54A 5FBLB 1GPNA 5FB3A 1PFVA 2QG4A 2C78A 3JD3A 3UMCA 4B2PA 4KXVA 1ZDMA 5EFOA 1DMSA 1LCIA 1L7PA 4JGBA 1P61B 4QYXA 4DCNA 1I7QB 1P4GA 1M7HA 1HLDA 3UUFA 4A2QA 2ZB2A 1DELA 1YRWA 4JYBA 3HWWA 3MUEA 3DE6X 4YVFA 2FLKA 4IZ6A 1T10A 1FFXA 2XNDA 3NWJA 1N0UA 3GV0A 3RUEA 4U7DA 2X5NA 1HGXA 1P44A 2CXRA 3SC2A 1A5ZA 3IBFA 2BCGY 3KYCB 2JANA 3PRJA 3K30A 3E1GA 3Q3VA 3BVPA 3BTSA 4IKPA 1UBKS 1W0JD 2ZRMA 5DBGA 4B80A 3GGSA 5C0OE 3EPRA 4CTKA 1RAGA 5LA6F 4Z0TA 4F86A 4YNBA 2HSGA 1MH1A 2RJOA 2ACEA 5DE3A 1H2ZA 2BHTA 3G9ZA 4JGIA 2M1ZA 4DCUA 2R5NA 4AZVA 2H1LA 1AV6A 2WYOA 1UMCA 1Q16A 2JARA 2OD7A 3LM8A 3PNVA 3G0CA 4MGYR 1H6DA 4OLAA 3B9BA 1QHYA 2ALJA 2DX7A 3NT2A 3ROXA 1X9IA 4KNVA 2BGRA 4OK6A 4F1KA 2O7VA 4MPRA 4U2EA 3C3EA 4QUIA 4FYWA 1EB9A 4KAJA 2R86A 3MAJA 1YR2A 1TCBA 1TYEB 2R00A 3BGVA 4KQ1A 2FV8A 1YONA 5FLXA 3VR3D 1MG0A 4LXIA 1XZGA 4FFWA 2AR9A 2IUTA 1J9ZA 2OBFA 2VWGA 3G9XA 3E6AA 2P4HX 2YWEA 4DIDA 1DEHA 4R1MA 2ZREA 2Z2KA 1TFRA 2AK3A 2F67A 3A4YA 1VTKA 1YJAA 1PP4A 2E48A 2YW2A 4IG4A 1O6GA 3ER9A 4HY3A 3T1HB 3IJRA 5F9FA 2N1BA 4TYNA 1THGA 3VDMA 5SZHB 1II8B 4B34A 3F7NA 1B41A 4TT3D 3EA5A 2C1XA 1A76A 2ZPTX 1WCWA 5FPPA 5HDQA 2BBOA 3JQ8B 3GN1A 3SG0A 3EMDA 4Q37A 1ZLYA 5AVXA 1C50A 1NIPA 3LZCA 1JR3E 3QPAA 3MC1A 1T9AA 1Y9JA 2Z5VA 1E63A 1T4GA 2X77A 1T26A 3AG6A 4MS3A 4ZRDA 4BAGA 1AXGA 1G17A 4J6EA 3BD9A 3KOUA 4OMFG 4HD8A 1XTRA 1G4HA 3COVA 2GTIA 2G76A 4TPKA 1W19A 4CR8A 3SNKA 1NV9A 1GL7A 1P5ZB 1TM5E 4BTEA 4ROSA 2CXHA 2CNKA 3FTCA 4BNJA 3LKDA 3WKBA 1IN7A 5DB4A 5KYXB 3VH2A 5D51S 1OYVA 1MORA 2JIZA 2YC4C 4OXQA 3BRCA 2V45A 2NP7A 5E1DA 3HWX1 1L7AA 1GCGA 2WIAA 1EFTA 4GR4A 1G3MA 1KZ6A 4OU4A 3TAUA 4HXGA 4NENA 2FDCA 4ZK6A 1ZJ5A 4MQEA 3FMGA 3IV6A 5NLLA 4KDEA 3UCEA 3FNQA 4HX2A 2RHGB 1V4VA 2XYGA 1PDOA 2J41A 5DHFA 4HI0E 3HGTA 5H59A 1NG9A 4JQYA 1KEWA 4D9JA 3LUKA 1QMPA 2AG5A 1G2OA 4PINA 4NMXB 1HZZA 4CCYB 5CA0F 4B3SB 2G04A 2ET6A 3CNOA 4AZTA 4EH1A 2G09A 2FZWA 3CEPB 3WLPA 4IGIA 4UVIA 5AH0A 2AXEA 4W5WA 4UHDA 3GCGA 3ZW7A 1JAHA 1T36B 2YNMC 2SCUB 4CKEA 2ZAGA 4UQPA 4R69A 3MWLA 2Y1LA 2Z2JA 3GFSA 4Q1FA 4DV5B 3CU5A 1LNSA 1U90A 1YS7A 3NCTA 4LOLA 1YDGA 1F20A 2C1ZA 1M1YB 1T2EA 3I3OA 4FDVA 4UVGA 5DTQA 3RKUA 3IUQA 3PJEA 4XLTA 2CW5A 4YRLA 2X40A 4PFKA 4AECA 3U6KA 1C9KA 2PZMA 1DTSA 2FG5A 5AXAA 1TZCA 3KKMA 3MWJA 3N76A 1AZTA 4RJKA 2GM5A 3H42B 5T4HA 3RC9A 4MGIR 3TW8B 4ZMBA 5BXYA 5LMNB 3OWXA 5BNIA 5K20A 5F7OA 3F9IA 5JVDA 2G6TA 4HC4A 1AIPA 1CZLA 2IODA 2GEKA 2QW1A 3KO8A 4MAMA 3RT9A 1IUPA 4FGUA 3QQPA 4RGYA 3PPVA 2FY8A 1R4MB 3SDZA 4IVNA 4GO1A 2ZUSA 1ONPA 4XEUA 4QGHA 4WZ6A 5EUCA 3IBTA 2WNSA 4V1CA 5HW0A 4OH1A 1NM5A 3KE8A 3WSVA 1N2SA 3UK2A 1QIGA 1E8NA 1TJ5A 3TZCA 4CDNA 1DQYA 4MI3A 5H0IA 5THXA 4BC1A 1WCIA 2WHYA 2OP1A 2Q7DA 1XZLA 4RA9A 2WFLB 3G5LA 4C1NA 2XOXA 1WVGA 4N9WA 4Q12A 4URZR 1KMNA 3UGTA 1GTZA 4OXRA 1DV2A 4W99A 3N2EA 1NN1A 1T5OA 3AVOA 4F96A 5ESXA 4N9QA 1Q15A 3EYAA 1G3RA 3H13A 3UKDA 3V5NA 2DHQA 4Q3NA 2ZYTX 4ILKA 3VC1A 1ZWKA 2WIDA 3CF0A 3IMFA 1JKIA 4GZMA 3CVWA 3BBPA 1UP7A 3HNPA 1U8UA 2ZUBA 1J4AA 4YH1A 1C7RA 2PRYA 5E38A 1NMSA 2GOYA 2W8ZA 4UXIA 5HJ2A 4DB4A 2Q6LA 1L4KA 1CUYA 1W6UA 1UANA 1PWEA 1TCAA 2W83A 4JLSA 4CG0A 4CMGA 1J25A 3FPFA 3Q7EA 2PZFA 4BO8A 121PA 1S9HA 3QMWA 4R2LA 1UM9B 1ZG3A 5DM4A 4B3BA 3T7TA 1UXOA 2BSQA 4P0PB 3I04M 1IK4A 3GYBA 4IXNA 5JSZA 4DV6B 3GPIA 4J43A 5CG1A 1JFFA 3B51X 1V7PC 1ZOLA 1BJRE 1SUIA 4IPTA 4L2IA 1IZ0A 2HB6A 2WLSA 4QHYA 1C3XA 3K4HA 1R3DA 821PA 2ZJ8A 2R6AA 1TM7E 2Z9DA 4KSCA 2BM9A 2QX7A 4TWZA 2N1MA 5CNMA 3W4IA 1JLLB 4D8YA 3B1FA 1XZJA 1A96A 2AJLI 4KXNA 5I7RA 3ZD9A 1Z88A 1A2KC 1Y82A 1SB8A 3EWAA 2EDAA 3NDJA 4R9SA 2DWCA 3QFFA 1I1NA 3A4LA 5L4LA 3P2IA 1GFIA 4M8KA 4UFOA 2WU0A 2BMFA 5EHQA 2RI0A 4E14A 1U4NA 3RIHA 3KX2A 3T6KA 5D3KA 3EIUA 2IEDA 1DG9A 1JSLA 3D4IA 2JZNA 4MULA 4OYYA 2QTHA 1E4EA 3NHYA 4RLHA 1ZXLA 1EUYA 4F6RB 3SR4A 2I9PA 4X0EA 4TMKA 5CUQA 4IYJA 1T4DA 1ZL2A 4MKRA 4F8EA 2WABA 4P53A 3C1UA 1YV9A 4EYQA 1T0PA 1I94B 3DAGA 3H8WA 1KP2A 1XRQA 4C3UA 1IM8A 3L8YA 1A8UA 3IRUA 4F0JA 2B9EA 1X38A 1SJ9A 2BZSA 5A4KA 3ZXUB 3GZ4A 2ATVA 3E3LA 4QOFA 3RU3A 4L2IB 1Z73A 4Z8YA 5AESA 3SE7A 2O3SA 4JLAA 3NYIA 3KVVA 4NZYA 4ZTBA 3R8FA 2FSPA 1NTOA 5C5EA 4ZQGA 2I3BA 5F4BA 3AW9A 1EGAA 1YKFA 4HYQA 1A9ZA 1KIFA 1TAHA 1W8IA 2V6FA 3REQB 3RYIA 1AQIA 4FMDF 4NBUA 4CPDA 4CDRA 4QUAA 4YCNA 5EINA 2BHLA 5H81A 1GYQA 1PD0A 2X9NA 2BC9A 2ZAMA 4CQMD 2P77A 1G63A 2A59A 2RK3A 5CMLA 2JFXA 5J58A 3RVQA 3DGEC 3ZYCA 5B7GA 1S2OA 1DUSA 4NENB 2UZ4A 3L1HA 2AV6A 3LHIA 1XXHB 4PYIA 3PCTA 1ZJJA 2ZJZA 4KI0A 4EJ2A 2YHUA 3PR3A 1RC1A 2ZIEA 3C7TA 3KUUA 2NU7B 3DCYA 2JD1A 3ZZ0A 2D00A 1GEEA 3WLTA 3OC0A 1M34E 1Z5UA 2YFHA 4BC0A 5JNSA 1DWOA 2OOSA 1DJOA 1VP3A 5GM1A 2XB8A 1KVRA 4Q9NA 3TS1A 5JBNA 1NVVR 3WGNA 1P62B 3L6OO 3QY0A 3VPXA 3EK2A 2JGMA 3EXG1 4RGVA 2D59A 2JBAB 2KHZA 4A2WA 1HX7A 4NE9A 4QPDA 1YE3A 2VJLA 3RYCA 4C6HA 1B6TA 1H9AA 2LUOA 2RGCA 5LB2A 3ZDXB 1R4MA 3OLWA 1KPGA 1V3QE 3A1VA 4HLDA 1UT5A 3K0FA 2ZETA 2HJHA 3HNRA 1QNFA 4MJXA 4NOJA 3RC2A 3BSWA 3Q7TA 4IFTA 1H9BA 3OZRA 3UATA 3TIXB 1KH2A 2CY0A 1TYCA 2OE2A 4H60A 1L5QA 2DE0X 4IDNA 1ZNQO 2CNWD 4NCHA 3IKTA 4LX8A 4WI1A 4NDNE 3ZI7A 2GJKA 4BNNA 3IQGX 2BELA 3T7CA 1XJQA 5L7WA 4KJZA 3D2AA 4QDTA 3KC2A 3WGUA 3ET5A 1ESZA 2FPKA 2NSLA 4OTZA 3WGTA 5KYWB 2QJWA 1JFRA 1NBMA 2QDXA 2DFDA 2DR0A 4QO7A 2B4QA 4LRUA 1XYGA 5DBOA 1SQFA 1SHUX 4LHXA 4XGIA 1DC7A 1TW3A 2A9VA 2WAYA 3MELA 2CBZA 5JCJD 5EE9A 1KU6A 5MN4A 2VJBA 2GETA 2XWQA 3L7CA 2P8JA 5TJ9A 3BQMB 4J6FA 3TDMA 3V80A 5IM4A 3CGWA 4HGQA 3G23A 4PRLA 3JU3A 4CLEA 1F4PA 4WKBA 1Y7LA 1RBQA 2I3GA 3ANSA 2JH3A 2YN2A 4HBZA 4Q9LA 4BXOA 2VF2A 4BWFB 2NIPA 4YUXA 2BR4A 1X7WA 2OQRA 3UM9A 1YZTA 4UUMA 3V33A 5LMCA 2Y9PB 4ASUD 3TJZA 4K28A 1E1CA 1MEOA 1O97C 4B75A 1C0PA 5KQPA 3K35A 4CQNA 1DIAA 5KYXA 3K0SA 3K4PA 3D2LA 2WTNA 4RACA 4ZEOA 1DBRA 4N6GA 4RORA 3JSAA 5EERA 3K5IA 5AW2A 1HBJA 2R6DA 2PUDA 2X7HA 5AI9A 1JIIA 4MS4A 5AI5A 4ZCLA 3WYCA 2AMLA 1J2EA 4BP8A 2AN4A 2QP9X 3CG0A 4EJSC 3PGKA 1XTKA 2ZTSA 3L01A 4U7TB 3ZU6A 1FBTA 1X8XA 1JTVA 1HE1C 4Q1VA 5CIQA 1F14A 4KC0A 1XVIA 2JHGA 4FGLA 3Q3CA 3INRA 5TLSA 3HBLA 5H16A 3IVXA 2O1EA 4HVLA 4EY6A 4ZAXA 3ELBA 3ABRB 3WB1A 1CUUA 3JZMA 3OPQA 4QDXA 2OLKA 1KAEA 5KOJA 4RMGA 1GV1A 3L02A 3KJIA 3IUBA 1M6VA 3G2LA 4HGYA 2ZBFA 1TD1A 1KPIA 1NJ8A 1TDJA 3HHPA 4V0ME 4KPUB 1MH9A 2DHRA 3W7BA 5F1KA 3ECCA 3I01M 1K1EA 3N3BC 1ZKMA 4G37A 5DHUA 2PTHA 1ZCZA 5CFMA 1E2BA 2OC4A 2O5EA 1BXGA 1XD8A 3IOYA 1NAIA 2O2SA 2C54A 3PFGA 1IXRC 2WTBA 2Y76A 4JASB 4OBBA 3TOSA 3WZLA 4QJIA 4Z49A 3B6IA 2QWXA 4YGXB 2PT6A 1SIBE 3SR3A 3DM5A 4U63A 1MOPA 2I91A 4ZOCA 2FJUA 3KU1A 1M2GA 1UEXC 5T64A 5ALFA 2JGEA 1GARA 2HBYA 1TZBA 3OSZA 4MIOA 4EI7A 4AZ0B 5G0SA 1T35A 4HDCA 4OKIA 1H3NA 1VL8A 1A7AA 4R1PA 3E3AA 3IP9A 2J5XA 3MILA 3DHEA 5E4TA 1CERA 1HURA 4IOJA 3TZ6A 3WLQA 3VU3A 4IDEA 1EFDN 3R44A 3N7TA 1A8IA 2D06A 1ADCA 3K6KA 3TIFA 3DG9A 4BMZA 2JFBA 1OXXK 1UZUA 3ECSA 1W4ZA 2PJRA 3R3XA 3S7TA 1I01A 5ALEA 5EJFA 3GFOA 1L5OA 2NSDA 5GAJA 3RW9A 2XUIA 1L5VA 1WETA 4HXYA 2QSZA 2FWMX 5JNUA 2WJHA 3R4VA 3EXG2 1KYTA 2IF0A 2WSSA 4AAYA 3B1XA 3K70B 4BFWA 1Z4NA 3EXFB 3KHTA 4LRWA 5JAZA 4E94A 1U7WA 5E2AA 4TLCA 4I1VA 3LPCA 5HTOA 1KAGA 4ZO7A 4PG5A 2RHOA 2YOHA 3KPYA 1Y1KE 2PS1A 3WIUA 2QRPA 5L4NA 2GHRA 2GN1A 3WSWA 2ZP1A 4TOIA 3JD4A 5LVAA 2ZI3A 1YHNA 3I9LA 2QN1A 4J3NA 2H9AA 3NBUA 1EFKA 1Z33A 1PGPA 5T3YA 2PT5A 3ZD8A 4AY3A 1NUSA 4EFLA 1DIOB 1QHXA 3AJRA 3UH1A 3UJ6A 4KTTE 3PDCA 4ND4A 5BVHB 1MRSA 3H4VA 4Q4HB 3W6PA 1NQWA 5JAQA 5ILOA 3KSMA 1VE9A 1FQKA 4RM2A 5FBKA 1YI1A 2QRNA 3K1ZA 1QBGA 4KN5A 3T1VA 1PFGA 421PA 4MS3B 5AVWA 1CSEE 1EEHA 4I4TF 4JDPA 3S68A 1O89A 1G5QA 2AJ8A 3FFWA 3UJ7A 4Q05A 4JVOA 4ZZIA 4BP9A 4Q3AA 3A6PC 1U8FO 1QDEA 1HEYA 2VDKB 4K03A 3GLKA 1QOZA 4Y8VA 1H6AA 3LYUA 2A5GA 4F06A 5ICMA 5DYTA 1ZZEA 4FYXA 1RBMA 4MDYA 2GZHA 4G0YA 5TNXA 2C07A 1MC4A 3PD0A 3RH0A 1R8SA 4RDXA 3SM9A 3WNDA 3AY0A 4AWAA 2ZGVA 3KR1A 4D8XA 1THMA 2WUWE 1XZAA 1MT3A 5DNUA 5ER9A 1RR6A 5BWBA 2HF2A 3MBIA 4FFMA 1KI4A 1ULBA 3ILSA 1QYXA 3WR5A 4DIEA 4TXLA 4ATNA 3AQ4A 3G7NA 3GW8A 3M1LA 1DO2A 3GUYA 3RNOA 2RGYA 3NHKA 2XE7A 2ZAIA 2F8SA 2J9RA 1ZM4A 1ZR2A 4DE5A 1Z29A 2QZPA 3C3PA 3F4KA 3BE8A 1B1CA 2C97A 3FNHA 4MQ5A 4CLOB 3ZVMA 2WI8A 5BV2P 2KMLA 1C1YA 1C8VB 1FFGA 3TTTA 4Z53A 3M2TA 2XMBA 4N65A 1KY5A 2DAPA 2IDZA 2HRRA 1NXWA 5IVIA 4WKNA 521PA 1JT9A 2VRCD 4JLUA 5IEBA 1RWMA 1R15A 3C41J 3I6YA 2R65A 2EHDA 1EWYA 2GAAA 2X9GA 3IHLA 4L9WA 4YRSA 2D0IA 1V1RA 4A8JC 3A4IA 3CISA 4IRXA 4UKDA 2IIPA 1G3IA 5K6RA 2CDRA 3PS9A 5FUQA 1XZBA 3F6BX 4FNGA 3JYOA 3H5RA 4IR7A 1AZWA 3M6XA 4NONA 4OHFA 3ZZ1A 1HDEA 1RS0A 2NLOA 3F6CA 2NQ8A 1W49A 3MWEA 4IDHA 1PQYA 4Q4HA 5AQEA 3RSCA 4BLPA 1VPTA 4RWEA 4KV7A 3HXMA 3L6BA 3HA5A 8GPBA 2VAMA 1SD2A 4CTMA 4MITA 4G23A 3DQZA 4FYIA 3I5MA 3DOFA 2R62A 3PEEA 4FEGA 4YY3B 4ZC8A 3CN7A 1U7UA 1ORHA 1R4AA 2RB4A 5GOTA 3D54D 1W5EA 4TLAA 5FO1A 5HF8A 1UXIA 1G8HA 2TMYA 2OT3B 4XSGA 4EATA 1NW6A 3KLBA 1ESEA 1BKDR 1S8AA 3K70D 4IWYA 3GVPA 4RMIA 1E6EA 2O4UX 3HGMA 1MGPA 4YT8A 4ZYWA 1R8JA 5HWSA 1JIXA 1H2HA 1RPTA 1EDEA 1VGQA 3HBJA 3OQHA 2P3OA 4ID9A 4S1OA 3QIAA 5F1OA 3UQYS 2UYCA 3G0HA 2UXDB 4PAWA 4XUEA 5K8IA 3DXFA 4YA6A 5I9MA 5AVYA