1HYEA

Crystal structure of the mj0490 gene product, the family of lactate/malate dehydrogenase, dimeric structure
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
307
Chain Sequence
MKVTIIGASGRVGSATALLLAKEPFMKDLVLIGREHSINKLEGLREDIYDALAGTRSDANIYVESDENLRIIDESDVVIITSGVPRKEGMSRMDLAKTNAKIVGKYAKKIAEICDTKIFVITNPVDVMTYKALVDSKFERNQVFGLGTHLDSLRFKVAIAKFFGVHIDEVRTRIIGEHGDSMVPLLSATSIGGIPIQKFERFKELPIDEIIEDVKTKGEQIIRFGPAAAILNVVRCIVNNEKRLLTLSAYVDGEFDGIRDVCIGVPVKIGRDGIEEVVSIELDKDEIIAFRKSAEIIKKYCEEVKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the MJ0490 gene product of the hyperthermophilic archaebacterium Methanococcus jannaschii, a novel member of the lactate/malate family of dehydrogenases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Oxidoreductase
molecule keywords L-LACTATE/MALATE DEHYDROGENASE
total genus 106
structure length 307
sequence length 313
ec nomenclature ec 1.1.1.375: L-2-hydroxycarboxylate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1hyeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1hyeA02
1I24A 1BXKA 4CLHA 1G0OA 1CJCA 2Y66A 4OGWA 2OHXA 1SAYA 1L7DA 3U49A 3S2GA 5L45A 1TT5B 4UUOA 4Y6PA 3RFVA 5DBIA 3EVTA 4IDCA 1AN9A 4CLXA 3TOZA 1OZAA 2WEKA 4I5GA 2PY6A 3ITKA 5G0TA 6LDHA 3ETEA 3WDSA 2NADA 4YA6A 2OO5A 4J43A 4AJLA 1W73A 1KEPA 1Y8QA 3HJAA 4UVEA 4GQAA 3W6ZA 3PWZA 3B1JA 4ZN6A 1NWHA 2JCVA 1X0VA 1NFQA 1TB4A 3D3EA 2B4RO 1ULSA 3PIDA 4RPJA 2VOJA 4QECA 3LF2A 1MC5A 2J6IA 3BA1A 4W9NA 1JLLA 1KVTA 2FPGA 3DBRA 1ONPA 3GGOA 3JYLA 1UXIA 3ZWNA 3AOGA 3BHMA 2VWPA 3VVCA 3DQPA 3TWOA 1U4OA 4WLUA 5BNTA 4GLLA 1EQ2A 4N5LA 1QRRA 4NBVA 4CMBA 3QSGA 2AQ8A 3PJGA 2I9PA 2WWRA 1J4AA 3GLQA 2O48X 3LT0A 4DL9A 3JQEA 4I1IA 3KEOA 1R12A 5IZCC 5A06A 4RVDA 1P1RA 3ONEA 4ND5A 2X5JO 3PHGA 4EUHA 4HX5A 2RAFA 2BGKA 2ZB4A 5I9MA 2G76A 3OQ1A 4O6VA 1BW9B 4U5QA 2PKRA 4HFRA 2VCYA 4J1TA 3QWFA 4XJTA 3BMQB 5KIAA 4AJOA 3F46A 4BOYA 1ENYA 3K92A 1FMCA 1DOHA 5JE8A 4E13A 1F8GA 1LRLA 2P9GA 2ZJ0A 3AUUA 4KWIA 2ZB3A 2PTGA 1E3SA 2GCGA 2HQ1A 2JAPA 3RFXA 4B7XA 1Z7BA 4YAEA 5A4DA 4R1NA 3KB6A 2Y99A 1E3IA 4B4WA 3FN4A 5LDGA 4EJ0A 1QMGA 4YRDA 4IZIA 2EP5A 4QTZA 4XQEA 3IL2A 2PKQO 4WUVA 4ALNA 2WJPA 5COBA 4FIZA 1D7OA 3I52A 2HKIA 3RC1A 3K2EA 4DC1A 1M67A 3RKUA 1U3TA 3O8QA 2FR0A 1NWCA 1UXGA 4Z6KA 3PTZA 2YV1A 2J5QA 1U9JA 4O0LA 1IPFA 3EAGA 1GUYA 2VWGA 3SBOA 5A9RA 2X5KO 3BHIA 3ZHBA 4GPD1 4DA9A 3ZU3A 4A7PA 4CMIA 4PCVA 3V1UA 2BLLA 4LW8A 4XD2A 3PWSA 1N9GA 1WP4A 1UR5A 2CVZA 4CODB 1U7TA 4YJFB 4DLBA 4E33A 2VHXA 1KY4A 1UJMA 5AXCA 5EN4A 4J91A 3JQ9A 1VL8A 4EEXA 2AE2A 1W0CA 1EUZA 2NTVA 4DBVO 5HBRA 3RASA 3QLJA 4CL8A 3OIGA 4OQZA 1HZJA 2HLPA 4WASA 3VZQA 1NVTA 1E5QA 2HSDA 1BWSA 2QYSA 5A3JA 2DBRA 3Q0EA 3DAPA 2VZ9A 3HN2A 4IDFA 3ZV6A 4CMAA 1NBOA 2Q2QA 4WEOA 2YFHA 1SO8A 1BXGA 2V6FA 2D59A 1NQOA 3ULKA 4CM4B 4O63O 4CM3A 3L77A 5TGDA 2J8ZA 4P4GA 1LDGA 4F46A 3ZZNA 1X13A 3CMCO 1Y9AA 1NR7A 2VWQA 1ZXLA 3LT4A 4QFCA 4W7IA 3LYLA 1MA0A 1D1TA 2EEZA 2EGHA 2WD7B 4CUZA 3RJ9A 1HDZA 4CR7A 5MGBA 3VZPA 1UZMA 1GY8A 4B4UA 4BKRA 2GO1A 4PLTA 3ADOA 1YJQA 4LMRA 1V6AA 4WNCA 2X7HA 4XR9A 4YB8A 3G0OA 5KWEA 3SJ7A 3V2GA 4GL4A 5H83A 1YBVA 4IM7A 1CIVA 2B0JA 2O4CA 3I9OA 3WGGA 3MTGA 3GVXA 4Q3AA 1ISGA 3NGLA 1IHXA 3F4BA 3IMFA 1KOLA 2GN9A 3RROA 3AI1A 3PZBA 2Y67A 3WYCA 4A03A 3HUDA 1LRJA 1SOVA 3B1FA 1TT7A 3WGOA 1HKUA 2EWMA 2C07A 4QEDA 2X4GA 4E2YA 2PZLA 2YHUA 3MJ4A 4QFDA 4ALMA 1EMDA 3NJ4A 4IQ0A 5IZ4A 1PJQA 4KTTE 2Q2WA 2PZKA 2DQ4A 5C7OO 2IZZA 3PIIA 1TLTA 4N54A 1C0PA 1SZJG 4HUJA 3E48A 3Q9NA 1XG5A 3PQEA 3CH6A 2PD4A 4K6CA 4PLGA 4E5KA 1PZHA 1MG5A 4BNUA 2X0JA 1LSJA 1M66A 3NUGA 3HHPA 3EUWA 1PIWA 3ASUA 3WWZA 1YO6A 3OJFA 5JY1A 1Q1NA 4WOJA 1PJLA 1JKIA 3PHIA 1X1EA 2Q46A 1PGNA 5JLAA 4BNLA 1MC4A 4M87A 4WLNA 4DGSA 5B12A 2WD7A 3E03A 4GX1A 1TEHA 3VH4A 1KC1A 4L8VA 3B1KA 4R16A 1P33A 7MDHA 3DMTC 2X9NA 1R4NA 2DTXA 5T57A 3E18A 4BO3A 2FPIA 2X0IA 4J16A 1HLDA 4FFLA 3ZDFA 3WQSB 4YEDA 3L4BC 3VZRA 4L74A 4ITUA 3VPSA 1HL3A 4OH1A 4Y9DA 3DZKA 3FPLA 2AQIA 4ZQGA 3ZV3A 3EC7A 3WJAA 3FHLA 2XF8A 4QSMA 3TFQA 3KETA 1ZW1A 2C5AA 3FWNA 3KV3O 3FPCA 2NVUB 3QA9A 4BO7A 3D4NA 5EPOA 1E7WA 2JL1A 4PZDA 3PDJA 4PRLA 3ZWWA 2V6MA 1BW9A 4OSOA 3C1AA 3FR7A 1GTMA 1PGOA 2B37A 3GT0A 3SX2A 3W6UA 2O3RA 3FNFA 3UKOA 1QV7A 2D4AA 5I8ZA 2BGLA 1U8FO 3GR6A 1ISJA 1FDTA 3GOHA 4UUNA 2A94A 3UW3A 1KVRA 5G0WA 1LTHR 3INTA 4FW8A 3D3WB 3C7CB 1ZO8A 3PRJA 4GWKA 1KY5A 3ENKA 1P0FA 2PR2A 4J0FA 3A9WA 2PZJA 2QIOA 3KVOA 4MVJG 4FR5A 4A73A 1MB4A 2DT5A 3H4VA 4B8WA 1F8FA 3ONFA 3IP1A 2O3UA 4LVUA 4A0SA 5BNFA 4GVLA 3GMSA 5JAZA 2A4KA 2TMDA 5DULA 3I1JA 4IXTA 4YDRA 1GDHA 4FQ8A 4NJOA 1EDZA 2QRLA 1A7KA 2UV8A 3JQ9C 3OETA 5U1PA 1JVBA 1LUAA 3G79A 5LDHA 1XR3A 3PGJA 4ZD6A 1EUDA 1Y6JA 4U6QA 1YL5A 3ZI0A 3GVCA 1GD1O 1RYEA 1JWBB 4N5MA 1GYRA 1H94A 4IS3A 3ZNPA 4ZQFA 2WE8A 1JTVA 4Q39A 5JDIC 3OEWA 3ABIA 4RZIA 2D0IA 1NXQA 3N7UA 4JP2A 1I3NA 4XIJA 4R9RA 3TF5A 3ANNA 3NTOA 3QHAA 4KTVE 1O5IA 4DQXA 5CFZA 5IXSA 2X6TA 3Q2IA 1RPNA 1PJ3A 2B5WA 2CZCA 3GAZA 2WYWA 3OIFA 2QQ5A 2DPHA 3PHJA 3OBBA 3VH3A 4BO0A 4L0QA 2FOIA 2PGDA 2B83A 4G5HA 3GA0A 4IINA 4L9RA 1CYDA 4CLDA 3CZRA 3BMNB 1E1KA 3WBFA 4EJMA 1P3DA 1XGKA 3EVNA 1BDBA 2C7VA 4C4OA 2PLAA 4PLZA 4WECA 3QP9A 4YCAA 3ZHZA 5JAQA 3T7EA 3V2UA 3DBLA 2E48A 5IF3A 3S1LA 3KYBA 3GG2A 3FSRA 1MFZA 4NI5A 4ZU3A 2JCXA 2O7QA 2QZ9A 4PZCA 5THQA 3VC7A 4NIMA 4BL5A 4BS9A 8ADHA 3OH8A 3QVOA 1YL6A 1X0XA 5TJHA 4CM9A 4I08A 4C7KA 2YZ7A 3S2FA 4NG5A 2IEBA 1R6DA 2VHYA 3BMNA 4YAIA 1UAGA 3WYEA 3PFFA 2R00A 3Q6IA 4ALLA 1B2LA 2PD3A 5AQ1A 1PWZA 1HXHA 2BH9A 1PSDA 5TSDA 4NZ9A 4CM9D 4FSHA 1ZBQA 4J49A 1C0LA 2YYYA 5TNXA 2P4HX 3LT1A 4AL4A 3S55A 3NGXA 4MKRA 3NYWA 4N7RA 3OMLA 4W99A 1DB3A 3PJFA 3ROMA 4EITA 3FF4A 1Q0LA 4R01A 1QSGA 4BNMA 4L4SA 3WFIA 3S2EA 3H2SA 2VRCA 4AJ4A 2X1HA 1VI2A 3QWHA 3DTYA 3GZ4A 1GEGA 1XDWA 5IN5A 4B4VA 3F1LA 3IS3A 3WGQA 2YQ5A 3TZQA 4UUPA 1PQWA 4KQWA 3GRKA 1XU7A 1VPDA 3H3JA 1WVGA 3QVWA 3HDYA 5KJFA 1AGNA 3GMDA 2O7SA 1LDBA 3K6JA 1I3KA 1Y5MA 2IXBA 4UEOA 3DHEA 4QO7A 4XRRA 1NR1A 4DIFA 3HSKA 5H82A 5A02A 4AJIA 1KETA 2DLDA 3DFUA 1ENPA 3M1AA 3MJTA 1GZ3A 4E32A 3I4CA 3DBRB 5JC8A 3AUSA 4H3VA 3WSVA 5A03A 3AU8A 2VYNA 3E9MA 5FF9A 1E3WB 1ZJYA 4QQRA 4ZQEA 1C1XA 1I5RA 2H63A 3RUAA 4KZPA 3HDQA 4I5EA 4PLWA 9LDTA 4B79A 4E5NA 3GNQA 2OFPA 4BMNA 5L53A 5A3VA 2V6GA 3AM3A 2X58A 3WQRA 4FFRA 5DBFA 4NBUA 3WTCA 2A35A 4CV2A 2Q50A 2JFHA 4L76A 3U4DA 3X2EA 5CDGA 4HFMA 3BTVA 2YW9A 4PZEA 4DC0A 4EGFA 2NVUA 1DC5A 1TT5A 1H6DA 5JMPA 5DZSA 4J0EA 2CSUA 3U9LA 1GPDG 4WCFC 2O4UX 3I4FA 4ND3A 3C1OA 1SEVA 3WBBA 3R0IA 4K9DA 2EKLA 4XYMA 2RH8A 3DHNA 1LSOA 2IEDA 5KKAA 4U7WA 1GFSA 4FC7A 1WDLA 1YOVA 2P5UA 2VQ3A 3UICA 9LDBA 3U09A 5IDQA 1Y8RA 1NYTA 5DDIP 1FF9A 2FSSA 3ZHYA 2WTBA 2AQKA 1ISHA 1ZCJA 1TI7A 4ZHSA 1QG6A 3A14A 3ENNA 4XEHA 3CPSA 3GDFA 4CUJA 4NMHA 4J3FA 4MP3A 4R69A 1BDMA 5DCYA 5IXYA 4BGUA 4S3MA 1MV8A 1ZKMA 1G0NA 3O26A 5MDHA 1LC3A 2PH3A 3JQ7B 4XB2A 3BHJA 3P2YA 4OKIA 4FJ1A 2Q2VA 4Y98A 3C8MA 3DL2A 4YJGB 4IDGA 4CMKA 7ADHA 3CIFA 3KUXA 3GAFA 3UUWA 1V35A 3WJ7A 3L4BA 4FFNA 4HNHA 4TQGA 3AOEC 3ZU5A 3JSAA 1YQXA 2BFPA 2IYPA 4WGGA 4J6FA 4YVFA 4WOKA 1YGYA 3GDOA 5L7YA 5CEEA 1H6BA 4E5MA 3PVZA 1PJBA 1ORRA 3NT2A 3O38A 1HE5A 2IZ0A 1QYWA 2Z5LA 4Z0TA 5B37A 3A06A 4OOFA 1T4DA 2GGSA 2ZYDA 4QT0A 4D3DA 1NVMB 3AFNA 4NBTA 4HBGA 3PP8A 2ZTMA 2PA3A 1ULUA 2H9IA 4RORA 1N1GA 3MOGA 3U4IA 1CF2O 3D4OA 3RC9A 2EJVA 3WNQA 4E30A 3RIHA 5K6AA 1H6AA 1R66A 3M1LA 4RDIA 1GQ2A 4RF2A 4BNFA 1ID1A 1AHHA 1IB6A 1SCUA 1V8BA 2VRBA 5FYDA 4NFSA 1DAPA 4DRYA 3ZWXA 2HMSA 2PGJA 1NAIA 2DUWA 2DUUA 2PK3A 4RCVA 1ZK4A 1HETA 2YV2A 4QX6A 4BKPA 3LSYA 4J2HA 2YFQA 3JQAB 3BZUA 4F45A 1SOWA 3JQDA 3UGKA 4Q3DA 2VNSA 1XEAA 3WNVA 5I7SA 2GLXA 1ONNA 1U5CA 2P68A 3WOHA 1DLJA 2EERA 2I65A 4E5YA 5C3MA 4JNKA 3KLMX 1N7GA 1D3AA 1RM3A 2FN7A 2PGLA 3VKVA 3E9NA 4RL6A 1PJ4A 2Z1NA 4U0KA 4BHTA 5KJ1A 5HTOA 4TZKA 5HS4A 3UHAA 3ZW9A 3C7DB 5A5EA 4OKNA 2OBYA 1PR9A 1SBYA 4DMLA 1GQQA 1ARZA 2FZWA 5HA5A 3VTZA 4CM1A 1H2BA 1R4MA 1UP6A 3MWEB 1N1EA 4P4NA 1Q0HA 4D7AA 4Z3KA 2R6JA 3PGXA 3D5QA 3Q3CA 1G6KA 1DLIA 5FEUA 1EUCA 1PS0A 3PJEA 5DF1A 4GKVA 1I3LA 3JQGA 4BKOA 1JU9A 1GU7A 1R16A 4R1SA 4GI2A 3ZU2A 2Y1CA 2Y1FA 1VSVA 2D2IA 4YT2A 5BNIA 1Z6ZA 3DZFA 1V3UA 4ZJUA 4MIOA 2GZ1A 2VNAA 4A5OA 3AY7A 4BO1A 4CLRB 1LXCA 2YDYA 4GAEA 1FDUA 4H15A 3DBHA 2JD1A 2OP1A 4WLOA 3KM0A 1T2AA 4HNGA 2EG9A 1WNTA 4D46A 3ZWOA 4AJKA 1XWFA 3BYZA 1HE3A 2IODA 3I9MA 1IZ0A 1XELA 3OM9A 3W4KA 1E3LA 5H81A 5JAIA 2C2YA 5KJCA 1RM0A 4CMJA 3JQGB 3BMCA 4B7CA 1K89A 1ZSNA 5JCJD 1X15A 1DBVO 1IOLA 4CR8A 1PGPA 3KYDB 4I5DA 4KDEA 1HWYA 3P5SA 3NT5A 2W8ZA 1KC3A 4R51A 1XYGA 3ADPA 4XX0A 2E49A 2HK9A 3I6QA 3FTPA 2O2SA 4R1TA 4J7UA 1G1AA 3CKYA 1DHRA 2DU8A 4BNXA 2R00C 1GL3A 1ZSYA 1T1SA 1Z73A 4MVJP 1QLHA 3MJSA 2BHLA 2IE0A 3W1VA 2W4QA 5GZ1A 1CWUA 4TRJA 1K3TA 4GGOA 4M1QA 3VHRA 2QRKA 1DIBA 4YPOA 4KMSA 1YB1A 3D3WA 3PFWO 1N7HA 3ST7A 4XA8A 3EK2A 3UN1A 1JKJA 2R2GA 5DNAA 4JN6B 4PFJA 3JYOA 2G5CA 2EXXA 4RVGA 3K5PA 4IPTA 3WYBA 1YBMA 4Z9XA 3JQFC 5C7LO 4WCFA 1T2EA 3I3OA 3RU9A 4IQ8A 3VPXA 2HAEA 2IZ1A 3ON5A 1H9BA 1OC4A 2V6BA 3RJ5A 5EL0A 2CDCA 1Y8RB 1XCBA 3QVTA 2FR1A 4GGPA 1LQTA 3WWYA 4GSLA 4IDBA 4BNGA 4I9HA 1MXFA 4EJ6A 1B26A 2HO5A 2NVWA 4MDHA 4FC6A 3L9WA 4PLPA 1TA4A 4BV8A 5I7VA 4D41A 1U2GA 1ZK0A 2AA3A 4BIIA 2W90A 3Q1LA 1PQUA 2X0NA 5I9LA 1U28A 5FFFA 3UCXA 4OSPA 2BRUA 2C54A 1PL6A 4GX2A 4ZRNA 3TL2A 3ZNOA 3DOCA 5JO0A 3KSUA 4E31A 1DIHA 1E7MA 3AM5A 1C1DA 5U4QA 1CDOA 4G81A 1JVSA 1NASA 1PGQA 3GPDG 4A2CA 5ICSA 1ONOA 2VUTA 3ZV4A 1YB5A 2UUPA 2ZKLA 4YQZA 2NU6A 5JXWA 5TC4A 1MLDA 4FCCA 5FWNA 1ADGA 4AFNA 1ADFA 2QZZA 1YQGA 3WLEA 1DSSG 4YJHB 1IL0A 5TF4A 3GK3A 1NHGA 3GEGA 2FMUA 4YQYA 2GN4A 4KP7A 1A71A 1S6YA 4YRAA 5JNLA 4Z3DA 1HE2A 1T4BA 4JJFA 4ND4A 3AUTA 5EERA 2ZYGA 1LEHA 5BT9A 3A28A 4LRTB 1RKXA 1E6EA 3FWZA 2FY8A 5AXBA 2OOSA 4Z9FA 5T67A 5DOZA 3ZWVA 4BO6A 4MJLA 2DAPA 3BXXA 1E1MA 1T24A 4GWGA 1WMBA 3AM4A 4IDAA 4K6FA 2RH4A 3AY6A 4JROA 4PG4A 3KYCB 3Q11A 4LK3A 2ZB8A 1R0KA 4ONEA 4J4BA 4UVDA 3W8EA 3BMCB 5G0SA 3LVFO 2VUSA 1ZIDA 3TZKA 4CQLA 4NU5A 3G17A 1X14A 1DAOA 1PS9A 4HADA 3OQBA 1U2DA 1P1HA 3N58A 1OFGA 4X54A 5HS6A 3ZNQA 5CEFA 1J6UA 2GF2A 1ZUD1 1V0JA 1VL0A 4DIBA 4Y8VA 3GFBA 4E2ZA 3NTRA 1WAMA 5CHEA 4CUKA 1F0YA 3M2TA 2QX7A 3D5TA 1XKQA 4WEQA 5KVQA 4RPGA 5CDSA 3PEFA 4J90A 3D1LA 5KTKA 1DC6A 1EFLA 4CR6A 3OECA 4ALKA 1T2FA 1ZZEA 3ORFA 4Q3BA 3VH2A 3WR5A 4XDZA 4B7UA 4DLAA 4GMGA 1NPTO 3V8BA 3IIEA 1ISIA 2WD8A 1SC6A 2VRCD 4RVHA 4DYVA 4CM5A 5L40A 5DBGA 3OQ6A 3MEQA 2Y1DA 3FNHA 1HF3A 1P45A 1B8UA 4NNJA 2VHVA 4D3SA 4WNIA 4J4HA 3CEAA 3W8DA 4J9UE 2GDZA 4KOAA 2I66A 4A26A 5KKCA 3ZWPA 1K6XA 2AEFA 1YONA 4PVDA 3DWFA 1Z7EA 4GBJA 5JDCC 1KYQA 4K28A 3EZLA 2J3JA 3O03A 2BF7A 1ADBA 2CF5A 2CDBA 3MOIA 3QVXA 4IGFA 4I9UA 4C7JA 2OMEA 2G0TA 1ISFA 1MP0A 3LT2A 3H9UA 2C82A 3ZWYA 3QY9A 2CNBA 1EE9A 1HYEA 2G17A 3LZ6A 4MVJE 5BQFA 1GUFA 4OQYA 4A27A 3W4JA 1NPDA 1YWGO 3RQSA 3UAGA 2HMTA 3X2FA 5DN9A 3BMOA 5TT0A 4NHEA 2VN8A 3TDKA 1F06A 4AJEA 1A5ZA 1PJCA 3IUPA 3OSUA 3TN7A 4BUCA 3KSZO 1BSVA 4CM7A 4YWJA 1JDJA 2CDAA 4BB6A 1EZ4A 3R1IA 4TWRA 4PGFA 2O3TA 4XGKA 5DP1A 4Q3NA 1UZNA 3R3SA 4FGWA 1BRMA 3RVDA 2BD0A 1V3VA 5JDIA 4EI2A 2I99A 2EKQA 3PZRA 1SMKA 3ICPA 1EVJA 3GNSA 2H1SA 2WMDA 4PG8A 4BMSA 1I10A 3F9IA 2WYUA 4DQVA 3WGZA 4XR4A 1HE4A 1Z82A 5DOVA 4F3YA 4IJVA 4AJ2A 4BO8A 1WDKA 3E1KA 1NNUA 4DVJA 3PHHA 1AUPA 1NM5A 1Q7BA 3ZWBA 1M6WA 2Q1SA 3GEDA 3PLRA 4EEZA 2AG8A 3JQ8A 1SB8A 3AFMA 5F1KA 1F14A 5CDYA 1C14A 5GY7A 1RM5A 3GGGA 3GQVA 2C2XA 1P1JA 3RUFA 3ITDA 4S1VA 3WTBA 4DPKA 5THKA 4RZHA 1Y8QB 2IRWA 2AHRA 4UVIA 1PR3A 1R0SA 4M54A 3C85A 3ZWMA 1A4IA 1DJNA 3RBVA 3I9JA 3WIDA 1XA0A 1R15A 2DKNA 1LSUA 4MIYA 1LLDA 5T8KA 4WJZA 1FK8A 4PN3A 3PDUA 3RC2A 1NFFA 1K2WA 5T5QA 1HLPA 3DONA 4DWVA 2XAAA 1EVIA 4XCVA 1GEEA 3SVTA 3L6DA 4TKLA 1T2DA 4TROA 5CPFA 3RUDA 3EW7A 3KSDO 3P2OA 2EIHA 1PZFA 4IJUA 1HDGO 4OJNA 3WX0A 1YRLA 3CINA 2Y05A 2CY0A 1KBZA 4CL3A 3LF1A 4XGIA 4OOEA 4II2A 1LLCA 1S7CA 4MIEA 1VC2A 3WG9A 5DT9A 3TQHA 2CUKA 1ADCA 3FI9A 3JQFA 3ZV5A 4CLOB 5KJ6A 4WPGA 5J23A 1SB9A 4PLFA 2JFGA 4M55A 3MJEA 2JHGA 3B20A 2ZTVA 3HN7A 1T25A 1OOEA 3ASVA 4UREA 3D0OA 2DPGA 3INGA 4IIVA 1LLQA 2Q1UA 3L9XA 3M6IA 3OJEA 5GZ3A 5I9NA 2GSDA 4MP6A 6ADHA 3RUCA 3LC7O 2NNLD 4W6ZA 3ROQA 1UP7A 4JQCA 5KVSA 4NBWA 5ER6A 3BTSA 4TSKA 2Y1OA 3JD0A 3H5AA 1UH5A 4E12A 4YTEA 4H7PA 3F3SA 4D45A 1HSZA 1QKIA 1EK5A 1B0AA 3HDJA 3DBVO 4JIGA 4P8RA 3AW9A 3GVPA 1CRWG 3O4RA 1B7GO 3OICA 3PYXA 4UVGA 2H6EA 1YOVB 5EIOA 4ND2A 4L4XA 3DC2A 4AJJA 1A27A 1QORA 1O9BA 1B8PA 4JLWA 4O5OA 1Q0QA 4TMFA 3T4XA 2WDZA 1UDCA 4EDFA 1A4UA 2BFMA 4JBIA 1AXGA 4DIOA 2Q45A 1KVQA 5EMHA 3G49A 2NACA 1ZMTA 2EF1A 2DFDA 1NTOA 3FNEA 2DTDA 4D3FA 3GDGA 2A92A 4W9NC 4ZICA 5B4VA 4XGNA 1E3WA 4LRSB 3I23A 2Z95A 2VOEA 1OC2A 4G65A 5G0VA 4CMIB 3QVSA 1QYCA 4R68A 1MUUA 1DDOA 3DDNA 1VSUA 2DFVA 2HJSA 2V7PA 5A9TA 4XYGA 1U4SA 3DB2A 1Q7GA 3R6DA 3TJRA 4BQRA 2I67A 2G1UA 1P1IA 1WPQA 3C1TA 2C20A 3IKVA 3WSWA 4BNNA 1BGVA 3EGOA 2HJRA 4D42A 4IMRA 1ZNQO 5IDYA 5GZ6A 2IXAA 1H93A 4ID9A 3V1YA 2GN6A 5IZCA 4QO8A 1VKOA 5I8WA 1LDMA 5I7FA 1DRUA 2UYYA 3UFXA 4UVHA 1LDNA 2HU2A 1R0LA 3CUKA 2GYYA 4I5FA 2XPCA 1O0SA 2XOXA 5F21A 4XYLA 3CZMA 1GZ6A 1I36A 3GG9A 1AXEA 2YDXA 1A7AA 1BXGB 3G1UA 3LLSA 3QWIA 4HY3A 3TL3A 3WGYA 3TFOA 4J1NA 1N8KA 1E5LA 1YBAA 2VTDA 2XXBA 3OIDA 1M75A 4PG7A 4RF3A 4XB1A 2DC1A 1VM6A 2YUTA 3CSDA 3RCBA 1UP4A 1I2ZA 5G4LA 5KNLA 4M8SA 5EINA 2BI7A 4YJFA 1DIRA 2C7GA 4OXKA 5L4SA 1N2SA 1U7HA 2TMGA 2AE1A 3WQQA 4E6PA 4YYZA 4R41A 5IDXA 2ILTA 5EQDA 3TNLA 4WCFB 5K6AC 1QLJA 4JP3A 5HRUA 5AVOA 5AYVA 5TQVA 2HRZA 4L4RA 2YHIA 2AW5A 2EGGA 4ZGWA 3RUEA 4OO3A 3U62A 5HM8A 1HEUA 2I5PO 1PQPA 2NVBA 1U1IA 1UXKA 3H8VA 3KRTA 3OEYA 2VYND 4XDYA 2AXQA 5A9SA 1D4FA 4YT5A 2VUUA 2X86A 2E37A 5BSGA 3B6ZA 4CM4A 5FI3A 4NFHA 1ZK1A 3O8QB 4M49A 5L7WA 1JKFA 3CXRA 5FI5A 3EDMA 1QR6A 2A9FA 1HZZA 4NU6A 4MINA 2FSVA 4J9VA 5L7TA 3DAFA 1H6CA 5JPIA 2C5EA 3H7AA 4XIYA 3F1KA 1EQUA 4JJIA 3WMXA 4PLCA 1CERA 1Y5RA 3IJRA 3VOSA 2PH5A 1YKFA 3DZJA 3L6EA 3VZSA 4BO2A 1YB4A 1UXJA 2Q3EA 5BR7A 1ZSVA 4Y67A 2Y93A 1XHLA 4IGEA 4LN1A 3DEYX 1C0IA 3JQAD 4U0JA 4TVBA 5JAMA 2LDXA 2P5YA 4GVXA 4YAKA 4E2WA 2FR8A 1P9LA 1H2HA 3KBOA 4J1QA 3GGPA 1LDEA 4N18A 4U6SA 4HFJA 4NK5A 5BSHA 1RWBA 1H9AA 2NU9A 5ES3A 1O6ZA 5JC1A 4GX5A 1N9GB 1J5PA 4WLVA 1A9YA 4FD3A 1I32A 5DCUA 5ENVA 4GH5A 3K31A 3F5QA 4TZTA 4D79A 5TX7A 2QHXA 3K9QO 2OGUA 4IXWA 4NQZA 3ZU4A 1DRVA 3GRPA 3N74A 4BNZA 2CMDA 3LK7A 4EUEA 3AWDA 2W98A 4BO5A 2GR9A 1GPJA 3TSCA 1UAYA 4P4LA 3GVIA 1CQJA 3KXDA 5ENDA 1ZJZA 1YE3A 1B15A 4NH4A 2YJZA 1B3RA 4XQ9A 3U4HA 2ZTUA 3U5TA 1IY8A 4KUEA 4WCDA 5CEJA 3KLPX 3NJ8A 1CETA 5T8KC 1FXSA 2WSBA 3QV1A 3AU9A 4UEJA 4R5HA 3HADA 4IUYA 1J49A 1X7GA 1HSOA 3JV7A 3CTMA 4JJGA 3MWDB 4HP8A 4YAJA 2RBEA 1H0KA 2C29D 3GUYA 3ROKA 1NQAO 4BB5A 4E2XA 1LJ8A 2BGMA 3ZW8A 3EZYA 3HDHA 4B3HA 3RD5A 5T64A 3BMQA 2EJWA 4FJ0A 1I33A 3RC7A 4R5MA 3FCOA 1PZEA 4ND1A 1I30A 1VJ0A 2D5AA 3JYQA 3H9EO 3FR8A 1DIGA 1U3UA 2BMAA 5G2OA 5C37A 1YH3A 1H5QA 1E77A 3RBZA 3DZHA 1VLLA 1PS8A 1E3EA 2WE7A 2ZATA 3ETGA 3NDJA 3VVBA 3QJ5A 2J3KA 1YDEA 4BNVA 3Q2KA 4RVUA 4XRGA 1PX0A 3PYLA 4BMVA 4DPMA 2EW2A 3VTFA 1R4MB 3GHHA 4NBRA 5JBIA 2O50A 4XYEA 4D0RA 2YY7A 4FJ2A 3GPIA 4JGBA 2J5RA 3WIEA 2O3JA 1XIVA 4PG6A 4YT8A 4OHUA 1W8DA 5B4TA 3JYNA 4H16A 1UDBA 4ZRMA 3QWBA 5TJ9A 1HDOA 5TIIA 4D43A 1PU2A 5JYEA 4YBZA 2CVQA 2VYVA 1RYDA 3DR3A 5C5IA 2BELA 3GN2A 2Y0EA 2E82A 2BFAA 3DO5A 3KEQA 4BNIA 3QQPA 4EZBA 5EJ2A 1DFHA 1E92A 1Y81A 2BFOA 3GH3A 4FFPA 2PD6A 3A1NA 2OL4A 4CJXA 4JK3A 1GCOA 4A10A 4RDHA 1VKNA 5U9CA 3ZCXA 1HYHA 3M2PA 2HMUA 3ETDA 5I7EA 1JQBA 3JD1A 3G1TA 3JD3A 4E3ZA 4D44A 1DRWA 3GC6A 4DMMA 3LU1A 2GERA 2OXIA 4CMEC 2VZ0A 3FRJA 4JCOA 1ZXBA 5JCXA 1P1FA 2GZ3A 1C3VA 3TRIA 3NX4A 3WGIA 2B35A 4OAQA 1PJTA 1IULA 4QUKA 4IBOA 4RQUA 5CP8A 4TRRA 2CD9A 2GPTA 3E6AA 4WE3A 3C3XA 4JBGA 2B36A 1I0ZA 2I76A 2Q49A 3VDRA 1UXHA 3H6KA 5F1OA 4Z0HO 1PTJA 3QRWA 4TRNA 1ZVMA 2ZJ1A 4XQCA 3ZGYA 5F1PA 3NEPX 3GFGA 1X7HA 1EDOA 4AJ1A 4Y6SA 2X22A 1K0UA 1IUKA 4R54A 1ENOA 5G4KB 4CQMA 3DFZA 3NTQA 3DXFA 3A4VA 3K73O 2IDZA 4RV9A 4OIMA 3OJLA 3QE3A 2UAGA 5A05A 1BXZA 1Y9EA 2ZIZA 2H5LA 5KJEA 3UXYA 1GQYA 2B4QA 2P4QA 2Y1GA 1ENZA 3IKTA 2P9EA 4J7CA 3L0DA 1KVSA 3DZBA 3P7MA 4UAGA 3ONDA 3F5SA 5TLSA 2PV7A 3SC6A 3E82A 3D64A 1Z75A 2Z1MA 2Q4BA 3KZVA 1QYXA 5L3ZA 3DOOA 1IYZA 1DXYA 5IJZA 3V5NA 2B5VA 4HWKA 1GV1A 3P19A 1GUZA 4KWHA 1V3TA 3V1TC 3GVHA 3WXBA 5ILOA 1E0DA 4E0BA 1PL8A 3H3FA 1V9LA 4LCJA 1O94A 4GLOA 4I9NA 4O1MA 3SXPA 2HK8A 4LSWA 3S8MA 4J4TA 3PK0A 3RWBA 4R9SA 3BMOB 2NTJA 4RO0A 1OMOA 4W7HA 2X23A 5F3RA 2D3TA 3E5RA 4OL9A 3I6IA 3DTTA 4CLRA 1I8TA 1M2WA 5L9AA 4INAA 3D7LA 2GRAA 3JQCA 4RLSA 1LA2A 1PWXA 3JD2A 4GX0A 1NFRA 5CDTA 4OM8A 3IDSA 4PLVA 3AK4A 2DBZA 3SC4A 4MOWA 1DEHA 5COQA 1ZK2A 3NRCA 2BKAA 3MTJA 3VH1A 1ISMA 2Q1WA 1PEDA 2GD1O 2NQTA 1KEWA 1VL6A 5JY6A 1HT0A 4GKBA 4ESOA 1EEHA 1WXDA 2NV6A 4CV3A 3JD4A 2VHWA 1YDWA 4MKZA 4DLLA 2ET6A 3NV9A 5CG2A 4KUHA 3RKRA 2FP4A 4WLFA 3AOEA 3JTMA 1GCUA 3CMMA 4NR0A 4PLYA 4E5PA 1YQDA 3GUCA 3RBXA 5T6BA 3E5MA 3DZIA 2O23A 2O2YA 4L73A 1HDXA 1B16A 4BKQA 1VE9A 2X9GA 1UDAA 3HZZA 1E7QA 2CF6A 4BV9A 3INRA 3I9LA 1QYDA 4XJSA 1QP8A 4I8XA 4IJKA 2Y1EA 1DC4A 1W4ZA 1NAHA 1P74A 2JD2A 4FDAA 4PLHA 1E1NA 1MXHA 1YXMA 3MJCA 1D8AA 3S2IA 3FBGA 1F17A 4NDNE 3E9QA 4MP8A 1KEUA 3I9NA 4RPHA 1EVYA 1LDYA 4O59O 4DPLA 1WWKA 3MZ0A 3U3XA 1Y1PA 4ZA2A 2RHCA 1XSEA 3KOUA 4RF5A 2J5KA 1E7RA 1DPGA 4AJPA 4W4TA 2DTEA 1P31A 2GNAA 2OBNA 1XLTA 1JWAB 3HQ4O 2RHRA 1KIFA 3ZWCA 1GR0A 3QW2A 2GUGA 5IG2A 3PXXA 3JQ8B 3BAZA 1LBEA 4J1SA 1J0XO 3AI3A 5L51A 2W2LA 3H9GA 1M6HA 1MX3A 5JW6A 4WK6A 4FFOA 4MO2A 2AMFA 2ZCUA 4YJHA 2ZCVA 1X7DA 3WGHA 3ANLA 1HTBA 4URFA 2NQ8A 2YHIB 1WZIA 1I2BA 3AY3A 3PHLA 4U8GA 3UVEA 4JX8A 4XYBA 3OFSA 3HE3A 4BNYA 1CEQA 1HYGA 1ML3A 1IHYA 2C0CA 2Q99A 4PVCA 2QRJA 4BNHA 3DBHB 4K26A 4OMUA 2IYOA 3JYPA 4LVCA 4UULA 4B3JA 3OA0A 1DFIA 5IDWA 1KERA 2JKVA 2JAHA 3ZH2A 4HKTA 3TZ6A 1DFGA 1GADO 3EHEA 4WLEA 4BO9A 5ITWA 5L4LA 3WB9A 3FTNA 3IQDB 1WLYA 4DTIA 4B4OA 1NQ5A 1ZH8A 3H65A 2PKQP 2AQHA 2NU8A 3STHA 4MPDA 5JO9A 1E7SA 4YRBA 3KTDA 5L95A 3CE6A 2FHSA 4GMFA 2FPPA 3H2ZA 2OP0A 3SJUA 2VZ8A 1ZMOA 5TRTA 4NJMA 2P91A 2QYTA 4NFYA 4ZQBA 1L7EA 4ZQHA 3RFTA 1F12A 2JHFA 4AVYA 4RJTA 5A9SB 4LISA 1IE3A 3I5MA 4WKGA 5AXDA 1EBFA 3HFSA 3OF2A 1E3JA 1U5AA 3PQDA 4MVJH 5JYDA 3K8ZA 4P22A 1DIAA 2UUOA 2JFFA 5A5FA 1RM4A 1DO8A 2P2SA 4ALJA 4RF4A 2RCYA 4IDEA 4AJNA 1JA9A 3EY4A 3WFJA 4YJGA 1AE1A 1JW9B 4CMEA 1LLUA 4IJWA 1DC3A 3T4EA 4DQUA 3FD8A 2UVDA 1DJQA 2ZYAA 2PZMA 3C24A 2WYVA 1EK6A 1YS4A 3SLKA 3GZNB 3ROPA 5IFLA 4CQLB 5B4UA 5F5LA 1K6JA 5K0ZA 2J3IA 3U0BA 4AICA 3BTUA 3JQBA 3PWKA 3AJRA 2AEMA 3IOYA 5TT1A 3DHYA 3WS7A 4PG5A 5JCJA 4RVSA 2POQX 1C0KA 2DVMA 2VWHA 3LQFA 2F1KA 3HG7A 1O95A 3NDIA 3G3EA 5F5NA 1HDYA 2CFCA 4CLEA 1B14A 1QV6A 3K2BA 1JN0A 4LGVA 2CVOA 4K1LA 3TOXA 2I3GA 3DOJA 1T26A 4FPXA 3GNTA 1YVEI 1MFPA 4FBGA 2VT2A 4IQGA 3L6OO 5ADHA 2QG4A 2P9CA 5A1TA 1CQIA 3AI2A 4DBZA 1ZEJA 3DMYA 4TRMA 1SEPA 3ANMA 5L4NA 3RSHA 1JAXA 1P44A 1U8XX 1HDRA 5DP2A 4CPDA 4Q3EA 4XQGA 5JS6A 5JMWA 2ZK7A 1PJ2A 1BVUA 2FWMX 1LSSA 4CV1A 1C1XB 1T2CA 4M86A 4QXMA 2X8LA 2E4AA 4R1UA 3VPFA 1ZFNA 1M76A 3UH1A 5LC1A 3EMKA 2EP7A 1BVRA 5CAEA 4NJMB 4GSKA 1YL7A 3EYWA 1A9ZA 4YACA 5GMOA 5CPBA 4CMHA 1EE2A 3ZN2A 3BTOA 1B3BA 4II3A 5EESA 2VHZA 4IS2A 1WMAA 5KCZA 3SEFA 3TPCA 3ZWAA 4LSMA 1O89A 2X0RA 5C7IO 1EVZA 1OI7A 3RU7A 4CQMD 8LDHA 1EBUA 3NDRA 1NX6A 1C1DB 3QWAA 1KEVA 4J7XA 1I3MA 3KYDA 4B3IA 3F47A 1HRDA 4OXNA 1XQ6A 4OYRA 1ZEMA 4KDFA 1GZ4A 5KVVA 4NK4A 3K30A 4BNWA 2Y68A 3GN1A 1QXSA 4MVJF 2PNFA 4P38A 2YV3A 1ZK3A 3LDHA 3ZNNA 5IN4A 2G82A 4BNJA 3T7CA 4IY1A 4FN4A 2JCYA 4MKXA 3VPGA 2NTNA 4IDDA 4BGIA 2RIRA 2O3SA 1Q7CA 1YJ8A 3GEMA 3L4SO 1EFKA 2FRDA 2YQ4A 3ZHXA 1LQUA 1AHIA 2B4TO 2GN8A 4LMPA 4F6CA 4TVOA 3O9ZA 5KVCA 1BHSA 4Q3CA 4Y6RA 4RLHA 2SCUA 3RI3A 2W2KA 4BNTA 2VT3A 5COAA 2NSDA 4CLOA 3NT4A 5JSFA 4E21A 1W6UA 1PZGA 1IPEA 4FOSA 4PRKA 4RVFA 1TVEA 2ZQZA 3OJ0A 2ZTLA 4R3NA 3DZGA 4BGVA 1N5DA 3R3JA 3VPHA 3W4IA 4CV0A 1VRWA 5B1YA 1A72A 1E6WA 3DBLB 2HMVA 5BSFA 1IZ9A 4FOOA 3UOGA 3NKLA 3PPIA 1UUFA 2W2KB 2X9VA 5BSEA 1BG6A 4BNKA 2B69A 2OUIA 1FDVA 3JQ6A 3WLFA 5IAAA 3JQ7A 2JD0A 4TKMA 5G4KA 4CQMB 2HDHA 4ILKA 3L07A 3HFGA 2Y0CA 1KVUA 2AEJA 2HMWA 5AOVA 3VKUA 2GASA 2NM0A 2I3AA 2LDBA 4W82A 2WM3A 1P77A 1WZEA 1OBFO 3KHUA 2Q4EA 3OHSX 3UCEA 2J3HA 2EKPA 4HXYA 4MVJD 2VYVD 1D1SA 2NLOA 3RAJA 3W8FA 1I01A 1KS9A 4Z9YA 1GAEO 1WW8A 3WGTA 1PGJA 1U3WA 3RUIA 2ZQYA 4OXYA 1LU9A 3LC2O 3JCZA 4RPKA 2OZPA 4EYEA 5ITVA 5A04A 2AG5A 1P0CA 4DREA 4YXFA 3GY0A 3PQFA 4CM6A 1PJSA 1VJ1A 1OAAA 3TZHA 3QIVA 4J2OA 1Z74A 4XKJA 1XU9A 3MJVA 4DYDA 1E7YA 3ICCA 4JXKA 3VAZA 1N92A 4KQXA 4YJDA 1R4NB 3IAHA 1GYQA 1PL7A 1UZLA 4AG3A 3TZCA 2NU7A 2Q1TA 2UDPA 3WICA 3FBTA 3B70A 4BO4A 4R3WA 4L75A 2PWZA 4MVJI 1X1TA 2D1YA 2ZB7A 2HUNA 2JJYA 1BMDA 2DBQA 3HWRA 3OP4A 5HWSA 2OORA 2EW8A 3GHYA 4YR9A 5G0UA 3DAGA 4BGEA 2NUAA 4EUFA 2QW8A 3JQBC 5JFOA 1QYVA 2DBVO 1FDSA 4DXHA 1Q2XA 1LI4A 2X5OA 1LC0A 3F6YA 2EV9A 3K96A 3E8XA 3LC1O 4Q9NA 2VTEA 3COSA 1TXGA 4MVJM 4R4JA 2O3QA 3IC5A 3HB4X 4IMPA 3IJPA 4EW6A 1K5HA 4HV4A 1MGOA 2F00A 1T1RA 1NPYA 1GV0A 1MG0A 5K9ZA 3UCFA 2GZ2A 1LRKA 1LNQA 4FS3A 3JQAA 1NQTA 1Z45A 3V2HA 2BI8A 2PFGA 2Y0DA 3HB5X 1NVGA 3SLGA 3PYMA 5ER9A 3OA2A 4EBFA 3KO8A 3WMWA 4UEKA 5EQFA 5CG1A 3I9KA 2HCTA 3I83A 4XWYA 3H9QA 1R37A 4UUMA 4AJHA 1FDWA 4RGBA 3PJDA 5KOIA 4B8ZA 4FGSA 4IZHA 1E6UA 3AUAA 5ILGA 3PI7A 2C59A 1WDMA 2NWQA 2W2LD 1L1FA 4ALIA 4JBHA 4CM8A 4ZVVA 3Q9UA 4FB5A 1E1LA 4YT4A 3F4LA 3BIOA 1FJHA 1I2CA 4CMCA 3D4PA 3H5NA 3FNGA 4Z0PA 5JDCA 1P1KA 3LLVA 1BTOA 1VJTA 3OJOA 1K6IA 2I6TA 4HFNA 3RUHA 3H5RA 4F6LA 4LCEA 4MVJA 4E4YA 1U3VA 1RJWA 5DCWA 4BKUA 1NP3A 3U4CA 3HNPA 2V65A 4N5NA 1NHWA 2FZEA 4BVAA 5AXAA 1O8CA 4RQTA 2HRBA 2DM6A 4CM8B 2E6UX 1HDCA 1SNYA 4RPLA 4BQPA 4PIVA 3VDQA 1B8VA 3PLNA 3GF4A 3IUSA 3NAQA 4YAGA 4D0SA 1GYPA 5CDUA 2HK7A 4CMGA 5LCXA 4KUGA 1SPXA 3C7AA 4ROSA 3IP3A 5ICMA 4M89A 3DMTA 2D5CA 3UF0A 3KYCA 1Y7TA 5TS3A 4G2NA 4NPCA 3H9JA 1DHTA 1LX6A 4IIUA 4DUPA 4FFMA 1XQ1A 4XZ3A 2EHDA 3MCVA 1JAYA 2D8AA 2XXJA 3GZNA
chains in the Genus database with same CATH superfamily
2RGNA 1I24A 1O6BA 2M6KA 1JFSA 1YIOA 2GN2A 3GRCA 1CJCA 1C4OA 3L6UA 2OHXA 3QVGB 3U49A 3ZIAD 3NHKA 5DLEA 3S2GA 1N9ZA 1TT5B 2YJTD 1TM3E 2W2VA 3OCUA 3EVTA 2V0CA 4ZAWA 2JA2A 2WEKA 2WSSD 5ESRA 4KAAA 4AXBA 5ILQA 4PHCA 5G0TA 6LDHA 2ZBUA 5ALEA 2JAUA 1XTKA 5HKOA 5E6UA 3K71B 1KK0A 4J43A 1TUIA 1OI2A 4YPVA 1IWOA 2YOHA 4D4MA 1P4GA 1VHQA 2OTCA 1T0JB 4XARA 1PT7A 4FNGA 2JCVA 1NFQA 2ZI9A 1TB4A 4W5HA 1ULSA 3PIDA 1GZHB 2R8YA 1OBOA 4RPJA 5FA6A 3RYHA 1DT5A 4BFWA 4EGAA 5EE1A 1SA0A 4B3MB 5BRJA 4ZEMA 4MRPA 4M83A 9GPBA 5JWOA 4X1IA 1XLWA 3C3WA 4QDJA 3DE1X 1UXIA 2R66A 3JYLA 2ZWIA 3KCNA 2WUEA 3BHMA 1B42A 3OIYA 5K51A 3ZWNA 2R7LA 2ZBGA 5FRDA 2WB4A 4HSEA 4H7DA 5CURA 1WTCA 2WIGA 4I4TB 1E79A 4B7AA 2FJPA 1VTKA 4WJLA 1T2VA 2QJTA 3LP8A 3O8OA 4CIYA 4HMOA 2N9UA 1KDVA 3ZJYA 2ZR9A 3ZJ4A 4X66B 5AQEA 4NC9A 4U7FA 2SCUB 2BEWB 3GLQA 1OCEA 4H4CA 4JDPA 4EB0A 1YR2A 4MW2A 2X2EA 1QM5A 4PZ9A 4UMDA 1CDZA 1UANA 1XYVA 3AHHA 1NGSA 4QJ3A 1VMEA 4ZK2A 3CF4A 3JWPA 3QVUA 1P1RA 4KMRA 3ONEA 3H83A 4IG4A 1SKYB 3PE3A 2QBYB 1KI8A 1Z28A 4I3HA 4B81A 1TJ3A 1DO2A 1X80A 3UJHA 1ZGAA 1Q1AA 2V1XA 2J9RA 2PGOA 1JKMA 5DW3A 2I4NA 4EHKA 3O0TA 2RAFA 2BGKA 1N2ZA 1X7YA 3OQ1A 4YO7A 3UKDA 4RK0A 4HN2A 2HBZA 2WMNB 3HJUA 4DCNA 2K87A 4Q01A 4J1TA 1NSFA 4TS1A 4W5NA 2BEUA 5AJHA 4AJOA 5ALSA 1L4FA 1SK8A 4HTAA 3MAGA 3OPYA 4BOYA 3M34A 3NOVA 1YS6A 1N77A 2ZJ0A 4KWIA 2R60A 3W6PA 3Q10A 3ZGVA 3QNMA 4TL9A 1EDBA 4B7XA 3DTVA 5F73A 3VR4H 1TMYA 1RLTA 4RZ3A 3UIEA 3PQ5A 5CVUA 5MF6A 1KWGA 3QTBA 1EJ0A 2FSHA 3D59A 4M7RA 2WT9A 4U3JB 4IFEA 4JC8A 5ESDA 1CQXA 2HV9A 1WMEA 2Q8NA 4LV5B 4YRDA 4IZIA 2QR2A 1VFPA 1ATZA 2N75A 4M1OA 3UK2A 1U3CA 2FZ5A 4FK8A 4LZZA 4CFZA 4B2IA 2O8FA 4KXNA 5COBA 2MCFA 5IKOA 2VDKB 3EA4A 3WO0A 3K2EA 3WADA 4EELA 1US8A 1M67A 3HCWA 1U3TA 3IT1A 2P4EA 4RC9A 3VV3A 2FR0A 1NWCA 5TQ0B 3GJ3A 5AHRA 1LPPA 3BWYA 3W5BA 3EPJA 3FUVA 2FRVA 1SWWA 2J5QA 1CY6A 3GFQA 1B6GA 5JXHA 4O0LA 3W2IA 1IPFA 3GRVA 5DHRA 3SBOA 3H05A 3CKMA 5A9RA 2X5KO 5JMTA 3BHIA 3P97A 2PZBA 3IQFA 1WSAA 3D3QA 4GPD1 3HCAA 4DA9A 1EJBA 3LBAA 1BOOA 4LW8A 1ZWLA 3AF3A 2ECPA 2JASA 1WP4A 4U7GA 1UR5A 1KEKA 3R40A 2CVZA 3BG5A 5HMLA 1BQ3A 1A2BA 2WYOA 4YJFB 2WU0A 4E33A 2VHXA 4YS6A 1KQOA 1CDDA 5CX1A 5B36A 1KY4A 2HF8A 1UJMA 2ZUUA 1XA3A 5EN4A 3FOZA 3JQ9A 1VL8A 2XNDD 4EEXA 4P3YA 2P30A 3HJGA 2Y0BA 3O7MA 3A9SA 1BEUB 2B8EA 3HYRA 4IGAA 4L5BA 4LZJA 4UCQA 3QLJA 1BDJA 4V3CA 2O8BB 2JJ2D 3KQWA 3OIGA 1E1QD 1SD2A 2N47A 1QO9A 3QLEA 4WASA 3TGLA 4MYTA 3NM5A 1RFLA 1VYHA 4YO8A 4Z53A 1EUDB 1NURA 2FG7C 4CIXA 2OXEA 2A5GA 5CB4B 2DBRA 4QQFA 3DAPA 3HN2A 3TIFA 4IDFA 2R9VA 1RJDA 3I30X 1F5NA 2CJPA 2YFHA 4WEOA 3ADKA 1P2SA 4YRSA 2EDCA 2Y9PB 5CJ2A 1KIMA 1ONSA 3NAZA 4L7VA 5A4IS 3CO0S 2J3MA 4CM4B 3DEZA 4CM3A 1OW3B 1U94A 2ZBRA 1R3UA 1S89A 2HOQA 3LPLA 3O73A 5CW2A 3U13A 4YP6A 4S35A 1XC7A 3N75A 2VQDA 1Y9AA 1NR7A 1ZXLA 2JIPA 2IFTA 3HZHA 1NMYA 3L7IA 3LHSA 3LYUA 4QFCA 1CHDA 4PX5A 2CFSA 2WTXA 5H3CA 2EGHA 4E4RA 5I5GA 4DCOA 4HVAA 1SULA 1SA0B 5EIWA 3RJ9A 4ACBA 4AN0A 1FB5A 1U2PA 3NKFA 1NE2A 3IQZA 2D8MA 4M1YA 2VDMB 1GY8A 1OROA 4TV8A 3PQ6A 2LD4A 2W6OA 3NXSA 3JQQA 4KQGA 2IX9A 2IT1A 2LXNA 3ADOA 1H5UA 3KJXA 4R2WA 1H9CA 2XMRA 4HGZA 3SJ7A 2AT1A 3FJ1A 4GL4A 4X20A 3CF0A 3QKUA 4D02A 5E9JA 1Y33E 2A7XA 2B0JA 3NBQA 4KFSA 4W7SA 2DR0A 4BFZA 2DPLA 5DM2A 2YVAA 1QH8A 3NGLA 4I4CA 4RW0A 2VP4A 2B0CA 2B99A 1FYEA 1OLOA 3PR1A 3RROA 4M1EA 4CKXA 3WYCA 4Z54A 1PLLA 2O2DA 4O3FA 4RY9A 5HQTA 3GJTA 3IODA 1HKUA 3W6OA 2C07A 6REQA 1TMOA 3IE0A 3BD7A 1OFUA 3LDAA 3WLMA 1DI0A 1E2QA 3AIMA 3WLTA 3TK1A 3GLKA 1EMDA 1ECFA 4ALMA 3MFQA 4TT3D 4DQDA 1P2FA 1PZNA 1V4BA 3KJQA 2C2MA 2PZKA 1VYTA 1RLIA 1BFDA 2HL6A 2PT7A 5I9SA 1IMOA 1R4AA 4RFVA 1AK1A 4NAUA 1KJNA 3NYQA 4HUJA 2XIQA 2IYUA 2VZLA 4A0QA 1GFIA 1XG5A 4W9RA 4WV3A 2X8WA 4K6CA 4E5KA 3GZJA 4W8GA 4YAOA 2EZ4A 2XZDA 3MFYA 1Q7TA 2WSIA 1KYIA 4X20B 2H3EA 2X9LA 4JI7B 1MH9A 2D7JA 5M5BA 1HZZC 4PX2A 1P91A 3ASUA 1YO6A 4URHA 4IGIA 1Q1NA 4WOJA 3T3OA 4HXEB 3CF6R 1TQ8A 4ZT5A 1USKA 1XN1A 2Q46A 2IGBA 2JI9A 1ICIA 4M87A 4WLNA 4XWGA 5B1HA 3TKAA 5IC6A 4BNLA 2QN1A 3SG0A 4DGSA 2WD7A 3E03A 4RMJA 4WZBB 2A0UA 1YZUA 5TQ0A 5LOVB 2ZYHA 4R16A 2Y27A 1DJPA 2GMWA 1MO5A 5DGXA 3DMTC 2AN1A 3OLXA 4BYMA 2XJ9A 1OV6A 4PO3X 1R4NA 3KWFA 4NCNA 3E18A 5T57A 3LUDA 3W3AH 3AL0C 4KWCA 1JLMA 3O2JA 5E6SB 3B5JA 4OYYA 4HYTA 1KDZA 4YEDA 3GEIA 3MBIA 3RVSA 3T0FA 3WQSB 2G9NA 4FZVA 4KACA 3FZQA 3H19A 3VZRA 4EUSA 1YI1A 3MTAA 4L74A 3DZDA 3M49A 4JC5A 3VPSA 4EG8A 4F6RB 3E23A 3DZKA 3SOPA 2WF5A 3BPSA 3CNBA 4FX5A 4KH1A 5KBYA 1E0AA 1T6XA 2AQIA 4XVCA 3UV6A 1CXZA 1V43A 3WJAA 4V2UA 2JGDA 3FHLA 4I4IA 2XF8A 4KXMA 3TFQA 1T9GR 3FWNA 2C5AA 2H11A 4FBLA 4MWDA 3OPYB 4Q4AB 3TW4A 5ISMA 5EPOA 1JHVA 3BCRA 1E7WA 2JL1A 3PDJA 5CVVA 2XQIA 1ORTA 4G36A 4MLDA 5JWRA 1NKVA 3C1AA 4LGCA 1PGOA 3RLIA 2B37A 3U3DA 4M38A 3FNFA 1QX3A 2ZJFA 3KXLA 1U7UA 1TJYA 2D4AA 3LCJA 1ZMRA 2XQFA 1PVVA 3V6MA 4EAAA 5KTSA 4H1VA 3ZZ1A 2PO5A 2ZSEA 5DWDA 2BEVA 1CSEE 5KKNB 3D43A 5HDQA 1D6SA 1DCKA 3D3WB 1M34E 3R4VA 4FW8A 3ZTTA 4JOSA 3C7CB 1NMQA 1UQUA 2BP7A 4WXMA 4OHKA 4YUWA 2I6XA 2OSBA 3ENKA 1P0FA 4UQPA 2CKDA 5FOSA 1TF5A 3A9WA 1OFTA 4MVJG 4UBKA 1PI3A 2BSAA 2RH9B 3TW8B 1SUEA 3KJHA 1N2CE 1PW7A 4B8WA 1NOJA 1THTA 3IP1A 2PUGA 4REQA 3GGSA 3IOBA 1JBEA 1RYMA 2O3UA 2RGGA 3IDQA 1L4GA 1SCAA 1UFQA 2UVQA 3GMSA 4MMYB 1HYBA 5BNFA 4BBAA 3OY2A 5I48A 3QKWA 5DULA 3PRKE 2R62A 4IXTA 1NYLA 3K9CA 3NP7A 1PR4A 1NQXA 4YDRA 1GDHA 2GBCA 3JYHA 5DGHA 2NXCA 2A9RA 3JWJA 1EDZA 4HAOA 5LA6F 4EPTA 2ZSAA 4UEWA 1IH8A 1IY1A 3X1ZA 1AKUA 5JR3A 1JVBA 1GA1A 3G79A 2WAXA 1PBTA 2Y6VA 3T1QA 5IVPA 1M2OA 2J09A 5E9WA 1ODCA 3ZI0A 4GKJB 1ESCA 2CLIB 4PQGA 5TQ2B 2VTKA 3Q72A 2O2GA 4AROA 4L3VA 1UJ4A 4RX1A 3HNOA 1NJFA 5FBVB 5JHHB 2O8BA 4V0ME 1GYRA 1N57A 3D6FA 3A6LA 1PYOA 4QWWA 3ZNPA 2FWPA 4HQFA 2WE8A 1JTVA 3AEQB 2X8JB 4Q1BA 4OI2A 3ABIA 3KXPA 1FYXA 1QHGA 2R6FA 4PXSA 4RZIA 4JP2A 1EG7A 1I3NA 1WULS 2AUNA 2YS6A 4R9RA 4WY2A 2WJWA 3QHAA 3B60A 3EVFA 3OWHA 1RPNA 1T9AA 4Z4HA 2CZCA 4HL6A 1ZUNA 2D54A 2K6GA 3FGZA 3IVRA 3PHJA 2YXNA 4JB0A 5SZIA 3VKWA 1HA3A 4XUCA 3CZQA 3VU3A 2O54A 4CLDA 4YP5A 1CYDA 3E5NA 3Q7TA 2VDNB 2V9CA 1L5SA 4F3NA 3WLQA 1U8TA 1XGKA 2D0DA 2JLRA 3LYAA 1NRWA 1KO1A 3CC8A 4HN9A 2NPOA 4C4OA 3QPUA 4OIFA 1SQGA 4CGYA 4GOND 5GM2A 1SQ6A 4YCAA 1V95A 1WBJB 3T7EA 3QVKA 4PC6A 2W6NA 4J0KA 1QHXA 3C48A 3LNTA 2WOOA 3T38A 3CVWA 1MFZA 5BWOA 2QZ9A 4FNMA 4LZPA 8ADHA 2HW8A 1P61B 1NQWA 5AVKA 4P1ZA 1E9BA 3FA2A 4NZYA 3G0CA 1ZNZA 3REQA 1JJVA 4NG5A 3FUWA 2IEBA 1IHPA 3H7IA 3O1LA 2CB9A 3FSEA 5J2TB 4KGVA 1MTOA 1UAGA 2J4DA 2FPWA 1MRNA 3PFFA 1KFBB 2R00A 1FQJA 3IQXA 2VJPA 1BS9A 3F78A 3H87A 1KYYA 2XQGA 3F7OA 3Q6IA 5FH9A 2QN6A 4ALLA 2P69A 3TQFA 3P4XA 4IICA 2BH9A 1Y1LA 1PSDA 4CM9D 2WM2A 1WNFA 1K8YB 3FE2A 4MW4A 3RHFA 5IJ9A 4V0RA 4B4KA 2IHNA 1QC5A 1ORVA 1C0LA 2GZHA 2YYYA 3LT1A 3NNDA 4MQFB 1TAGA 3BRQA 4P81A 1DARA 3NGXA 3WRWA 4MKRA 4AL4A 2ZULA 3EODA 1SBZA 3OMLA 3B9RA 4W99A 5KPDA 4JJEA 2J0EA 2JGDB 1DB3A 2F1OA 4BFSA 1Q0LA 2ZI5A 1EXMA 5TMPA 3S28A 4IO1A 3TVDA 5F9MA 2PXAA 3S2EA 2UKDA 1BROA 4DDTA 1PFGA 1AN0A 3H2SA 4AJ4A 6CHYA 1M2FA 4TV8F 2OCGA 1GHTA 3TTTA 1AKMA 3IS3A 4M2LA 1SU8A 1Z0JA 1BJRE 4HYQA 2HCRA 2A0FA 1DOAA 3GRKA 1HQKA 5LZ5A 2J45A 1P73A 3H3JA 3QVWA 1KQNA 2ZZMA 2P0EA 5EJGA 3G8CA 3OUZA 1Y0BA 1WOYA 3GMDA 5G02A 1LFDB 2REQA 1E32A 1PFQA 4MXDA 4XRRA 2ZT5A 1YA8A 2P3LA 3T34A 1ZXXA 2A4MA 2WKQA 4QG3A 1X7ZA 1XZKA 3RVKA 1C7QA 4KFRA 3MJTA 3L0PA 3LHKA 3ZE0B 1L6IA 1Q74A 4LY0A 1H5NA 5JSHA 3ROTA 2D2XA 2JAWA 1SIUA 4H3VA 2IPAB 4PYMA 2QUIA 4Z7QB 1RYZA 3RUPA 4EH1A 1E3WB 1E63A 4YUXA 2WPNA 1C1XA 2FUG1 3P0RA 3OPMA 4H35A 3Q3HA 5EZ6B 1IN8A 2ZI7A 4RA6A 3RUAA 4QDTA 1GKUB 4Z4GA 1AK9A 9LDTA 2BDUA 5AM2A 3GNQA 2OFPA 3GLHB 4DQLA 5A3VA 3I39X 2V6GA 4ZA2A 4KQFA 4MWZA 4JR0A 5A7GA 1BJTA 4K9LA 5C2JB 3E27A 1G2PA 4HZGA 4YAUA 1C4XA 3Q3IA 4CV2A 1VKHA 2Q50A 2JFHA 2ZRQA 2ABWA 3C4VA 4JJ4A 3U4DA 3X2EA 2YW9A 1AKVA 4EGFA 2YJGA 2P9JA 1DC5A 5FWYA 1AGPA 1W25A 4J0EA 4TLBA 5DVZA 2A58A 3CEPB 2FEPA 3K5HA 3LUHA 2W43A 3GQBB 3WBBA 1L5WA 3SHVA 5HKKD 5FOWA 1HE1C 4GP9A 4R7TA 2B7BA 2TECE 4H59A 5CHYA 4UQLA 5IK2D 4FYYA 3EGWA 3JWHA 1WDLA 2EBUA 4IKEA 4E1BA 1KMNA 3UICA 4Q12A 2UXCB 3FKQA 4EJFA 1IEXA 2N1BA 3T5MA 1NYTA 2J30A 1FF9A 1JJIA 2FSSA 2FUKA 2YNMC 2ZT6A 3H97A 1T34A 3IAEA 4FR2A 4X7RA 3WMFA 5ITSA 4C0SA 4YJ3A 1L3IA 1TI7A 4EVQA 1QG6A 1UT8A 3PC4A 3ENNA 3FSGA 3CPSA 2YXPX 4NBKA 4NMHA 4OL0A 4CUJA 5AUPB 2I7DA 3TRJA 5DCYA 2TSYB 3O4FA 3O26A 5MDHA 1W75A 2K5UA 2QXUA 1LC3A 2GH1A 1ZD4A 3NI2A 2XMGA 4P0TA 2PH7A 4XFKA 5ALTA 5FULA 2Z3VA 1NW7A 4FXOA 4KZKA 4Q00A 5I9TA 4DIDA 1YFJA 2OKCA 2ECKA 1UBRS 4FJ1A 4NCHA 3G2OA 3P94A 4YJGB 5C8YB 3ZD9A 3CIFA 3GJ7A 2I3DA 3UT5A 4FONA 3GAFA 3PE4A 1V35A 4TQGA 2VFAA 3QBVA 4B5KA 3DWGA 3EIHA 3SZGA 1QV9A 4Z1OA 2PZGA 5JAOA 1YQXA 2IYPA 4WGGA 3PXDA 3OKCA 4RGVA 4WOKA 1YGYA 1G3RA 1MABB 3GDOA 1KDOA 4OQFA 3NO4A 1OH6A 2FMHA 2IZ0A 4Z0TA 1QYWA 4FS8A 1CR6A 2GGSA 2ZYDA 4FMCB 1TPYA 4HWSA 4JBWA 5GINE 1NVMB 5JSYA 2NYVA 1XV5A 4NBTA 4ZCQA 2PA3A 4LZOA 1MDBA 4BE7B 1XMVA 4RORA 1B6SA 1J90A 1NOIA 2V45A 2YN4A 3EEOA 3VVLA 3G5TA 2PU7A 2V7BA 4D26A 1CF2O 3D4OA 1QNLA 2EJVA 3IVCA 1UIRA 2FK8A 3L1VA 4ZEWA 4C05A 4E30A 4CEHB 2JC3A 3Q3VA 1XVUA 1R66A 1MNQA 1GQ2A 3OO0A 2VRBA 5FYDA 4YHHB 2QVGA 3P9PA 4EBBA 4LYYA 1CW2B 1SUFA 4DUGD 2RHMA 3MD0A 2YXLA 3FOEC 4MA5A 2QTZA 4I6JA 5LWHA 3DPIA 2WJ6A 3RVLA 3TM4A 2QRQA 4NXMB 4OHYA 2J9YB 2J9XB 3QU5A 3Q3GE 3R3HA 3NUZA 3BZUA 4ZZIA 3MQ2A 4OHWA 4XWTA 3LCMA 4X7BA 3U7QB 3QEBZ 2HA2A 4Q3DA 4YWHA 2F3UA 3UT0A 2WT4A 1Y8AA 5L3VA 4L5JA 5DIZA 3CLSD 4PC2A 2P4UA 1VIDA 2P68A 4EF5A 1QGUB 3OMWA 4WZAB 1BCRB 1DKPA 2I65A 3IVGA 3H8WA 1F3LA 4G0NA 4IOLA 5KDOA 1QZXA 4KQJA 3EGVA 5H8WA 1QGYA 4KV9A 5BR4A 3UUGA 2G5TA 1E6CA 2FW1A 3HKBB 3IAS6 2W2XA 2B1IA 4IIDA 4RDCA 2H5EA 4A8JB 4G1MB 3KQMA 4ARUA 4BHTA 4A2QA 5HTOA 1YU6A 4QPZA 1D1PA 3I04A 4IJMA 3UHAA 3ZW9A 3R7NA 1ULTA 4OKNA 5A2QA 4EFNA 4GRDA 1GQQA 3DG9A 3R7SA 3OOJA 4DMLA 4AS2A 1W9MA 2ZDGA 4C4PA 4EHBA 3EZNA 2XVZA 2PGIA 3WL8A 1GDTA 5F35A 3BWBA 2WICA 4D7AA 8MHTA 1JF8A 1EX1A 2PMEA 5KWSA 3QY0A 3LGAA 1W2WB 3Q3CA 1ACJA 1DLIA 4MW6A 4O8CA 4K88A 1PS0A 4QDZA 3ZQUA 2C1EA 1PVDA 4JKIA 2LIPA 4GKVA 1JNXX 2BHTA 2D0PB 3OLVA 1E2LA 1R16A 2PCLA 4IOMA 4GI2A 4IHAA 5EJIA 4BKOA 1SXJE 4H9GA 3BXGA 2Y1FA 4O8ZA 3OQHA 5DMHA 1KFEB 3FZYA 3JXEA 2GZ1A 3MCAA 3ZK8A 2VNAA 3OF3A 1NUQA 2H7VA 4MW0A 3AKZA 2P6MA 3C8HA 2G40A 1CUVA 3B1XA 4H15A 2H2GA 2JD1A 5J4LA 5KYKA 3KM0A 5AKLA 4HNGA 4MUNA 1CJBA 2C7PA 1R6VA 2DX7A 3WWOA 1V11A 5KEIA 1OQAA 1VPLA 1XWFA 4XJVA 3IELA 3VU9A 1HE3A 2QJRA 3QJYA 1XELA 1VG8A 3FLBA 3OM9A 3KPJA 4Y1GA 3W4KA 2NT3A 3NHFA 4B8YA 1FUIA 5KJCA 3KUCA 1E1CB 1JTFA 3WHPA 4BU1A 2DETA 1AVTA 3FRIA 4YN3A 2DQZA 4MWSA 3VR1A 1W96A 3DUFA 1SBTA 1NSYA 1QK5A 5LMUB 1Y5IA 4I4TA 2XDQA 2OHOA 4BTLA 3VR3A 4YJ2F 4IDPA 1YZYA 2NSJA 2W8ZA 4Q9IA 4KPFC 3QSYA 1KC3A 1XYGA 4F92B 2CXTA 3FTPA 3N70A 1CYEA 1F8YA 1CUYA 2VNHA 3E9YA 4J7UA 1Q1BA 4O4IA 4BNXA 2VHJA 3GT7A 3DLTA 4DLNA 4F1JA 4B3XA 1ZSYA 1Z73A 4MVJP 3FY4A 2AI3A 2O20A 1HBJA 2HLHA 3HCRA 3KLOA 5GZ1A 1CWUA 2L0XA 3OZEA 1ICEA 4Z9BA 3E22B 4M1QA 3X1YA 3OJCA 2ADFA 3QIAA 3ZGOA 2A57A 4P4SA 3WDMA 5AK6A 2WAAA 3OX2A 3U3ZA 1KO5A 1QB8A 5LLTA 3WYNA 3PFWO 4YHBA 1N7HA 3N0TA 1FOEB 1K8XB 3ST7A 4XA8A 5EHIA 3UN1A 5DNAA 3VR5A 2AFIA 3B13B 1K63A 5JCZA 2EXXA 3RHZA 1G3IA 1IJEA 3SIXA 1M34B 4P0PB 3G0IA 1QO7A 4IQ8A 2WINI 1FSPA 3J80A 1H9BA 3RJ5A 3JQPA 5EL0A 4EM6A 1U1EA 2CDCA 3W3AD 4HDCA 3TTUA 1YZNA 3F5FA 1IBRA 5C51B 3CB4A 3G2HA 2HNKA 4DLYA 3R3XA 4K05A 3IEUA 1NUTA 5AHOA 1H1LA 4FC6A 4G86A 4GKAA 5AKYA 1AUVA 1TA4A 4PLPA 2O52A 4TVSA 5I7VA 1QOZA 1KF0A 1TA9A 1U2GA 4I14A 1K8QA 3AHJA 1XMOB 3G9XA 2Q0XA 3BCUA 3CN7A 4XQ0A 4JVOA 1Y5NA 4EVSA 1XJCA 2X0NA 3CWQA 3HO6A 3K0KA 4NCIA 1U28A 4MULA 1DWOA 2DOKA 2O05A 3UCXA 4IV5A 1IVYA 5EZYF 2C92A 4OSPA 1Q0UA 1E2FA 3GP5A 2DQKA 4LVOA 4ZRNA 2W9XA 3W0LB 4B3FX 4O29A 3R4CA 2W2OA 1KRXA 1C1DA 1M0WA 2JGRA 1SVUA 4OGFA 5J59A 3FVQA 5U4QA 2PL1A 2P77A 5AKZA 1TTHA 3IYLW 3P9ZA 1FFAA 2IHYA 3GPDG 1GKIA 1P5RA 1P2GA 3ELUA 4GXRA 3UOWA 2QT0A 4NU0A 2ZKLA 4HPWA 2DSNA 2Z6AA 3K6SA 3I76A 3JTEA 4NYJQ 2HUPA 2NU6A 1ILWA 3OHPA 5CMLA 4QYSA 5KYNA 3S8YA 5HDBB 4WWHA 1NVWQ 1DKRA 3F71A 4C4TA 5FWNA 4JXZA 1YZHA 4MTCA 3QVLA 1RMTA 1VCOA 1DAFA 3ABZA 2R751 1UJ2A 4YJHB 1GARA 5TF4A 1U8YA 4A6DA 1KZYC 4YMVA 3E05A 4YQYA 3OOSA 2IIPA 4KP7A 1S6YA 4ARIA 1YB7A 4WKCA 2X0DA 1RWVA 2LCFA 5DXFA 3MJFA 4EG1A 1SK9A 2JRLA 2F55A 4ZP1A 2W2QA 3TJMA 5D84A 1E6EA 1QOQB 4FSXA 4XM1A 3SYKA 2OOSA 1XJWA 1S3SA 5T67A 1GPH1 3PIRA 4AZTA 1E64A 3P1JA 3Q2OA 4ZV9A 1ZRSA 3RQIA 1E94E 3W5HA 2QD2A 4MJLA 2DAPA 2WK1A 3WLRA 5BOSB 4TT3A 4QDOA 3BXXA 1E1MA 1FNCA 1O54A 1T24A 1YZ3A 2JIZA 3FG9A 3IMEA 4GWGA 4K6FA 1OGJA 3AY6A 1GPKA 1L7OA 2CCKA 2W0SA 3TS1A 1FCJA 3OPVA 4KAFA 1K4KA 3QE4A 3K4QA 4WBNA 1I1NA 1R0KA 2ZB8A 2PQMA 1HDIA 2AK3A 5DLPA 5G0SA 3H13A 1MA3A 1L3BA 4B73A 4DA4A 3M4NA 4X6YA 4AN4A 4NECA 3R7WA 4EMSA 2PUDA 2GARA 3G17A 2BZ1A 1JDPA 3I2YX 3EF3A 4ZVTA 1Z4JA 4C5AA 2BUBA 3GD5A 3OQBA 3N58A 1P1HA 3M5WA 1OFGA 2F17A 3O0DA 5AI9A 5HS6A 1J6UA 3UKJA 1ZUD1 2GF2A 1DP4A 4AECA 3S1AB 5LL6P 2ZM6B 3GFBA 1IHDA 1KGSA 2ZUWA 4FFVA 1YJ5A 1F0YA 1KEEA 2QX7A 4NENB 1KORA 1J0BA 2PL9A 4O2AB 4CQNA 1JILA 1N5LA 4X92A 4RSRA 4YRGA 4DQKA 4YPFA 4CR6A 2LWIA 1P0PA 3WVNA 1TCBA 5AWFC 4QXPA 4O25A 2XCUA 2O6LA 3WR5A 2J9FA 2WHYA 4QGAA 3ICOA 3H8JA 1QH0A 3LVRE 5I4CA 1TC1A 5BW4A 1ISIA 1SC6A 3RS2A 2JKZA 2VRCD 2WAYA 3MINB 5FFNA 5BN5B 2QUJA 4CM5A 4DYVA 4C43A 3OQ6A 3AB3A 1JIJA 2Y1DA 4PCAA 4Q7LA 1P45A 2R85A 3ETHA 1KZ6A 1B8UA 2ZIVB 4D3SA 4XVRA 4UU0A 1BGWA 3FDXA 1EM8A 1JT2A 4W5WA 3W8DA 2EC5A 1ULAA 5T41A 4JITA 1COWA 2GDZA 4GZMA 2P78A 3OFJA 3A6GA 4KOAA 4MQLA 3ZWPA 4ER5A 2BFBA 1K6XA 3ZIUA 2QTLA 4PVDA 3DWFA 4MV9A 4RD2A 4GBJA 1KYQA 4GD3Q 2JFVA 3JRWA 4N0MA 2OGTA 2JFYA 3WMEA 5LN1A 1ADBA 1GU0A 1L2TA 1UKZA 3QVXA 4IGFA 4I9UA 1DE0A 4L6IA 3MAJA 3U1VA 2ORWA 4C7JA 2OMEA 1UOEA 1J8YF 3FTDA 2G0TA 3N0XA 3B38A 3HXPA 3PHBE 4TM8A 1F2TA 2W8BA 3H9UA 1QCDA 4RL4A 4UHBA 4OB6A 3QY9A 4XPIA 3ZWYA 4EG0A 4MUKA 2G17A 1AQJA 2HC9A 3CLVA 3D8SA 5DGIA 1P1CA 1EUQA 1NPDA 4GLBA 5CBKA 4DV0B 1H1LB 1SBIA 2WIDA 1UBOS 3GJ0A 1MT0A 2CXHA 4QARA 2X8AA 5TT0A 2IU6A 3D6TB 1HDEA 1QOPB 4HB0A 4NCAA 3ONNA 3VRHA 3IUPA 3G0BA 3G89A 2VK1A 4BMDA 1J99A 2RAVA 4HNUA 5JHGB 1M2JA 2XF2A 3Q7QA 1VHTA 2CEAA 2F43B 3M5DA 5DB4A 3QYFA 4X0EA 4GBED 4BB6A 3CVXA 1IQUA 1QG2A 5A0FA 3EQ8A 3UMYA 1WZCA 5DP1A 4HVCA 4RK5A 2GYVA 2QRUA 4EW2A 4MYRA 3CLHA 4EI2A 2JGKA 3HFJA 1M2EA 4NMMA 4HEQA 5FD8A 3H2YA 2FFAA 2IYAA 2BFNA 1SM4A 2FFRA 2WYUA 2QZJA 3NEJA 1RMYA 3WGZA 3LUPA 4NZNA 1Y3DE 4CDGA 2FHPA 4FCVA 1E0KA 3N86A 4OP2A 3BJZA 5K3OA 1M1UA 3WRVA 1AM4D 1AB5A 4XFJA 2IEYA 2RIPA 1IJFA 1PSZA 1XD8A 5CNMA 1NNUA 4D9KA 3T15A 3T6KA 1H4SA 2HXYA 3QLVC 4R98A 3G1WA 1M6WA 3FYUC 3KZ1E 3URKA 4B4DA 4EEZA 4QBIA 3TLGB 1P29A 1G7RA 4AF7A 1ZMXA 2ZSDA 3HA2A 3LO8A 5F1KA 2QNIA 2XLCA 4DBLC 6PFKA 1RPJA 1GPAA 3OC0A 3H5TA 2YXDA 1C8BA 3HM2A 4B71A 2XMZA 2FDCA 1YQWA 2CZGA 2E2WA 1P1JA 2QROA 4FYPA 3I2IA 5EIXA 3H6GA 4I2NA 4UDYX 5EP4A 3O7WA 5JTUA 4DPKA 2H1RA 3GJRA 3E35A 4RZHA 3MS4A 4U2CA 1Y8QB 5KTPA 2KMLA 4NCKA 2JNWA 2AJ8A 3BFPA 3ZWMA 2R1ZA 1QAQA 2FK7A 2QN7A 5F12A 4IXNA 4ESHA 2JAXA 4KGXA 5AK4A 2VF7A 4F5WA 3MGKA 1LLDA 3BN3A 4M60A 5M29A 5T8KA 4HRAA 2ZS7A 1JSLA 1FSFA 5DDIP 1SCBA 1FK8A 4EOGA 3SNHA 4LVNA 4ZDIA 1V5IA 4JR1A 1NFFA 1HLPA 1E9EA 2ZCJA 3UTDA 4XCVA 1WEHA 2YUIA 1Q16A 2WU4A 2XADA 3N8IA 4MZXA 4TKLA 4QPPA 4Q4AA 5HJ2A 3K70C 3I8OA 3WK9A 2VATA 2EIHA 1E4VA 3U44B 3WX0A 4OJNA 4J0DA 1E69A 1FVOA 1YRLA 1SXJB 3VHXA 4GI3A 5C5EA 1T8UA 4N0EA 5EP1A 2G5GX 3G7UA 5JS2A 1ZCBA 1R3DA 2ZS8A 4OOEA 4II2A 2ECQA 1NNEA 3WG9A 3DMNA 1T5DX 3STYA 4Q9AA 1EWQA 2PBLA 3U6KA 3DAHA 1YZTA 1ADCA 4OP3A 4L78A 4JT4A 1CUFA 1J8MF 5T6MA 3WK7A 5DM60 4UTVA 2ZU0C 3ZV5A 1FBNA 4FE7A 2GTHA 2Q2OA 2IYFA 3KG2A 5JNVA 4GLJA 2G7ZA 5LIRA 1N6LA 3IAUA 3SZLA 2HR1A 1PNQA 4K9QA 4EAQA 4WDQA 3B20A 3ZD7A 2ZTVA 1ZGZA 4L0DA 4A23A 1T25A 5K3SA 1U9CA 4OFBA 4UREA 1YCDA 2CCGA 4G09A 1ECGA 4IYJA 5H4HA 3ZX5A 4R31A 2AC2A 3TF5A 3BHNA 3BK7A 2GSDA 5DI9A 1CDEA 1JEQA 3T1OA 5AW6A 1G5IA 4CN8A 3LC7O 2H8GA 2NNLD 2QT9A 3BSWA 3CZ4A 5IVIA 1UBUS 2ATVA 3FSGD 3NHLA 4N7JA 1RKUA 4MW1A 2Y1OA 4GPZA 1LX7A 1Q14A 4E12A 16PKA 4QFMA 3ZXSA 1Z4IA 3F3SA 1HSZA 2CLMB 1T5TA 1EK5A 3ILYA 1B0AA 4BBZA 1C9MA 3EWIA 2WAMA 3U4GA 4A6XA 3FOAA 1LH0A 1E9AA 3EXHC 4HRXA 3B9QA 3O4RA 2JGNA 2VJMB 1I13A 5KINB 5J4HA 1JFVA 2GAAA 2ZRFA 3I4LA 2GHTA 4G5XA 4AJJA 1JFLA 3G59A 3R20A 1JQJC 4XLLA 5HGXA 1O9BA 1Q0ZA 5C4IA 4JLWA 3JWIA 1UKEA 5IEBA 1JZSA 4D25A 3BXPA 3PEVA 4LDJA 2WDZA 3T4XA 3TSOA 4KQCA 3RADC 3HCDA 4EDFA 1VIVA 3DAYA 4GPBA 3U3OA 1YGPA 1AQYA 2Y3IA 3UAOA 3PFCA 1J9ZA 3RIXA 4ZAXA 3SKYA 4BMPB 2QT1A 6Q21A 4LIPD 5EMHA 5HJ7A 2QSYA 1Z88A 2EF1A 1NJ1A 3HVKA 3ZWKA 3QVJA 4UARA 3GDGA 5EA2A 4KRYA 3QU4A 5LXTF 1E3WA 5FBWB 2AYYA 3QYJA 2AOXA 1RXSA 4MR9B 1M1ZA 4G65A 3RRXA 2BFDB 1BHQ1 3QVSA 2WRZA 1DDOA 1ECPA 1WDWB 3DB2A 2BZ0A 1X1SA 2JCGA 4EFKA 2EX4A 3LI2A 5HX7A 2GOYA 3DKPA 5LZ4A 3V6LA 1R0CA 2BBOA 3EGOA 1M72A 2IPXA 3TIXB 4BVGA 4IMRA 4GF5A 5GZ6A 5IDYA 1H93A 4B0OA 1VGVA 3K09C 3N2YA 4ID9A 5AR1A 5FWDA 3V1YA 2KS6A 1BA2A 4NENA 1PG5A 1W88B 1DRUA 3E58A 4C4AA 2O8FB 2O8DA 3SC3A 2PZ8A 1H0SA 3ZBTA 4F2PA 3QELA 1ZG3A 1ESDA 1O0SA 3R6TA 4GO1A 2QZ4A 4XYLA 5HQ3B 1ODIA 3C5HA 1GZ6A 4DFDA 2AC7A 5BQFA 3LE8A 3K9GA 3M82A 4RYLA 3RJTA 1GUDA 2CNKA 4AMVA 3AR8A 4ZVUA 3E2IA 1DS6A 2W5UA 2WT8A 3FWPA 1SHUX 3IILA 3LLSA 4X7PA 1ZBDA 4LQLA 4AS3A 3EHDA 3QJGA 3HJRA 3L1KA 1X2EA 2AYXA 4RF3A 2FFHA 4GZ6A 2YRFA 4G23A 4BX2A 2UXBB 1VIYA 4LQCA 4RTPA 1E2NA 2DC1A 3CSDA 2RE8A 4Z1MA 3D3KA 5CR9A 1EXDA 1AMUA 1I2ZA 1GLGA 2VA9A 4NYJR 2LPMA 3LVQE 2OZKA 1JHAA 4KBYA 3SNKA 5FPHA 4R84A 5HTKA 2VP3A 5ADUS 2OC4A 2F9LA 3SS7X 1JGTA 1F3OA 2TMGA 2AE1A 4H17A 4HAYA 3KELA 5BQPA 4C0KA 2JCSA 3N6VA 2ILTA 1HV8A 5EQDA 3AZPA 1OV4A 3NOOA 5HRUA 4JP3A 5AVOA 2IL1A 4M0KA 1QVVA 1Z6YA 2ROQA 4WTOA 3LUJA 4NPAA 5TQVA 5FOUA 1SKUA 1TIKA 3BWDD 1NZJA 2GCOA 3R9IA 1NL3A 3HGQA 3VR0A 3FYCA 3FPAA 3A8TA 2QORA 5K8LA 1LY1A 1Z08A 3LXXA 5C5CA 2P65A 4BPRA 4AP9A 1IMJA 1VHJA 3AYZB 5HM8A 5LNK6 2AI1A 4DSAA 2FLKA 1U1IA 5FBZA 3D6UA 2UVPB 4QNRA 3RSQA 4PWZA 3C8UA 3VKFA 3WJ1A 3TG8A 2VYND 1WA5A 4J7AA 4X93A 1Z5VA 3R24A 2AXQA 4WY5A 3W2EA 5A9SA 3L05A 1VSTA 5CFLA 3NMUF 1L8XA 4GPIB 1XNHA 2VUUA 2E37A 3KDPA 1K7XB 5GADl 1X8JA 5FI3A 3DE6X 2YV4A 2X7XA 3CXRA 3EDMA 4FQ7A 3CYFA 4LGMA 2BCJQ 3E3OA 5IEJA 1IXSB 2LUOA 4QVIA 4S1TA 1LVHA 1C3JA 1M8KA 3F6RA 4CCSA 1V37A 4RPCA 1Q0PA 3OG9A 1SG9A 1D2AA 4TS9A 3EAQA 3CVJA 5DNCA 5AVUA 3O3NB 1E8DA 1JIKA 1FSSA 1FYFA 4M8LA 5JPIA 2C5EA 1IOVA 2E21A 2YCBA 5A4MS 1N6IA 3H75A 4JZKA 4M7PA 2P0YA 3NWEA 4JJIA 3LPDA 1W34A 2QVYX 2YWFA 4FFBA 2P0AA 2GCOB 2GD2A 3GUVA 3KWLA 1A0OA 4Q37A 1YKFA 3VOSA 5AKIA 3D54D 3VZSA 4PZAA 3UB3A 1UJNA 4GYYA 5F7OA 2CNWA 2JFBA 2VAWA 4LDPA 4O2BF 2P2GA 4EA9A 1GVHA 2Q3EA 3TLBA 2P3SA 4OJKA 2HN9A 1XRSB 2DBYA 3DHWC 5DX1A 1TZMA 1C0IA 5LBIA 5HPYB 1Q2UA 1T1GA 1TYCA 4UHEA 5FBRB 4QJ4A 1N75A 1SVKA 1I4WA 2FR8A 4R2IA 4E2WA 3OCXA 5B6IA 4TTAA 2X8JA 3FPHA 1O7JA 4FLMA 1P0QA 3UJPA 1JFTA 3GCWA 1RWBA 5BSHA 3FDZA 3ILHA 3PDIA 5E2AA 2G8LA 2J5XA 4N5IX 3F73A 4XGRA 1J5PA 5EEHA 5EMKA 3II6X 5DCUA 4GH5A 5FUWA 1FNBA 3N0VA 4AZ0A 1RAEA 1CK4A 4F4IA 5TX7A 3USES 1DRVA 4KQMA 1WLSA 5DGTA 1BC5A 3BICA 3H86A 4FOLA 3R0QA 3C1UA 3GARA 2RBGA 4XDHA 5EUQB 1GR1A 5K0BA 1UMDA 3DBIA 2R86A 2ZYWX 4BB0A 1RAIA 1CQJA 3G8DA 1JU4A 3KXDA 4Q0MA 4Q7JB 4D8VA 9ATCA 5AM3A <