1HYEA

Crystal structure of the mj0490 gene product, the family of lactate/malate dehydrogenase, dimeric structure
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
307
Chain Sequence
MKVTIIGASGRVGSATALLLAKEPFMKDLVLIGREHSINKLEGLREDIYDALAGTRSDANIYVESDENLRIIDESDVVIITSGVPRKEGMSRMDLAKTNAKIVGKYAKKIAEICDTKIFVITNPVDVMTYKALVDSKFERNQVFGLGTHLDSLRFKVAIAKFFGVHIDEVRTRIIGEHGDSMVPLLSATSIGGIPIQKFERFKELPIDEIIEDVKTKGEQIIRFGPAAAILNVVRCIVNNEKRLLTLSAYVDGEFDGIRDVCIGVPVKIGRDGIEEVVSIELDKDEIIAFRKSAEIIKKYCEEVKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-LACTATE/MALATE DEHYDROGENASE
publication title Crystal structure of the MJ0490 gene product of the hyperthermophilic archaebacterium Methanococcus jannaschii, a novel member of the lactate/malate family of dehydrogenases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 106
structure length 307
sequence length 313
ec nomenclature ec 1.1.1.375: L-2-hydroxycarboxylate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1hyeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1hyeA02
2V6GA 4HNHA 2YHIA 4MIEA 3UUWA 3IIEA 4HXYA 3RFVA 9LDTA 5MGBA 4CL8A 1U5CA 1NFQA 4TRMA 4CM7A 1ULUA 4BKPA 1KOLA 1YONA 4Y9DA 2WE7A 1BXZA 3CSDA 4PIVA 1XEAA 1X7HA 3AOEC 4KDEA 3E5RA 4CLXA 3VKVA 1B8PA 1SBYA 1UDAA 2HKIA 3QY9A 5EN4A 3RU9A 4RPGA 1KETA 5IJZA 3JV7A 1G1AA 3QWIA 4O6VA 5F5LA 4CM9D 1A7AA 2J3JA 5DT9A 1QYXA 1KERA 3KZVA 3P2YA 3U4HA 1RWBA 1WZIA 1NVMB 3UFXA 5A9RA 2LDXA 2G5CA 1PJSA 3MJTA 1H9BA 3ZHZA 4BMSA 3RCBA 1XYGA 1IPFA 1LC0A 2GZ2A 4FW8A 2OXIA 1PIWA 3AOGA 4EI2A 1VL8A 3D1LA 4K26A 2YV2A 3PGJA 2YHUA 3O03A 4XIYA 2I67A 4J1SA 4GMFA 1GQYA 4HP8A 2FR1A 3ONFA 2A94A 1LSJA 4XYLA 2HRBA 1LRJA 3DMTA 5DN9A 5F21A 5TS3A 4WCFA 1LQUA 2W4QA 2RH8A 3UGKA 1I5RA 3AY6A 5JCJA 4FGSA 3PIIA 1RM4A 4IZHA 2IODA 4JNKA 1CF2O 3GMDA 4BKOA 4CJXA 1H6CA 2X0JA 3KLPX 4MVJH 4ROSA 5G0SA 3TFQA 3TL3A 1A72A 1HZJA 4MIOA 2B37A 4JGBA 2BGLA 3EVTA 1HKUA 5G0WA 4FOOA 4XGIA 5AXCA 3FNGA 3DBLA 3H2SA 5CG2A 2VZ9A 3LT1A 3H5AA 4QO7A 3OJOA 2WWRA 5TIIA 5G4KB 2PR2A 3A06A 1TA4A 9LDBA 1FDSA 2VT2A 4YDRA 3SX2A 2W2LD 2J3HA 5GZ6A 4BGUA 1ADFA 1B16A 2GZ1A 3O8QB 4EJ0A 1KVQA 3PTZA 4N7RA 4RQTA 1DPGA 4KWHA 4LSWA 2RH4A 2C59A 2BH9A 4LRSB 4HY3A 5AXAA 1Y9AA 2X6TA 4BNJA 3GN1A 1GZ3A 2P5YA 4IUYA 4ZRNA 1ULSA 2YQ4A 4NFYA 4AJKA 5BNFA 2QRKA 3BTUA 4CM5A 4E33A 2PD3A 3GF4A 1QR6A 5KVSA 1EVZA 2VT3A 5B37A 2QW8A 4BNLA 1GR0A 3AI3A 1C0KA 3DHEA 4FFNA 5HTOA 1I8TA 1M6WA 2AG5A 3RUDA 4EYEA 1GZ6A 3GQVA 4YYZA 4JIGA 3PIDA 3PJGA 4U0KA 3INRA 4R4JA 2DAPA 1GYQA 1X0VA 4CV0A 4J7CA 3VZQA 1HDCA 1AE1A 4R68A 3WXBA 2YHIB 2DBVO 1BWSA 4I1IA 1WW8A 4RLSA 4RVUA 4KOAA 4LVCA 2G17A 2VHYA 4W99A 4B4UA 1HDRA 1G6KA 4F6LA 1AXGA 5KVVA 1UH5A 3O4RA 3F4LA 3C24A 5EESA 4A2CA 4DL9A 1AN9A 4L4SA 4CMGA 1K0UA 4G2NA 1ENZA 3W8EA 4PLCA 4MVJP 3L6EA 4XWYA 2ZJ0A 2P68A 3GZ4A 1VKOA 4J1QA 3WGQA 3ZV3A 2GN4A 1YQGA 1GUZA 3Q9UA 5I7SA 3GAZA 1ONPA 3COSA 3NRCA 4RDIA 4ESOA 3EVNA 1ZNQO 3KYBA 3AY7A 3V1TC 4RLHA 1B26A 3O26A 4ZU3A 3K8ZA 4YAKA 1FDWA 1W8DA 5JBIA 1FK8A 4NBVA 2FMUA 1TI7A 3HJAA 3JQDA 1SB9A 2VWQA 2XAAA 3VAZA 1ZK2A 1JVSA 1U4SA 2HK8A 5A5FA 2OO5A 3GUYA 4Z3KA 1ZZEA 2NVWA 3DMTC 1Z82A 4WCFC 4PZDA 2EKQA 3A4VA 4WCFB 2RCYA 3NTOA 1I3NA 5A9SA 4WGGA 2AQKA 2I9PA 4IDBA 4M89A 4DIFA 3B6ZA 1QXSA 3PI7A 4TRRA 1LDGA 3V5NA 1XQ6A 2DLDA 4RQUA 2B35A 4TKLA 1F0YA 1Q2XA 4OIMA 2ZCUA 3L6OO 1NVTA 2J5RA 2VRCD 3BTOA 5EJ2A 4BQPA 4CUZA 2EV9A 1P33A 3DBLB 4PFJA 1Y5MA 4D0SA 4FOSA 1ZBQA 4BNTA 3Q1LA 2O2YA 4UUPA 3QIVA 1DHRA 3VC7A 1ZH8A 3BMCA 3KYCA 4BV9A 1O5IA 3LT2A 4B3IA 1U2DA 1V3UA 4Q39A 1C1XA 4NPCA 4DWVA 4PG6A 1PGJA 3GNQA 2C2XA 2Z1NA 3U9LA 1U2GA 3MOIA 3CIFA 1E1KA 2BELA 4ND3A 4OOFA 4BKQA 1KEUA 5A05A 1VC2A 4IM7A 3DB2A 3IDSA 3LZ6A 4IPTA 3GZNA 3NDRA 1U1IA 4U0JA 1EQUA 4RL6A 3I83A 4MVJI 3ADOA 4QSMA 4I8XA 4B7UA 3UH1A 5I8WA 1E0DA 3G1UA 4R1SA 3GOHA 1DRUA 2Y0CA 2WJPA 1JTVA 1ZEMA 4DUPA 4A0SA 5DF1A 3WOHA 2HMTA 3AW9A 3JQFA 5AYVA 3JYLA 4PRLA 5LCXA 1P0FA 3L9XA 4F46A 4HADA 2YUTA 2D2IA 1UAYA 4BKRA 3IP3A 3UCEA 1HDZA 2GN9A 4U6QA 3UHAA 2Z95A 5A9TA 4L8VA 2RHCA 3WGYA 4BHTA 1N9GA 2O7SA 3L9WA 4A10A 2HMSA 5JMWA 5JY1A 1E6WA 2GR9A 4PG5A 5FEUA 1MV8A 3KYDA 5L53A 1R0KA 3OIDA 2OP1A 3ZV5A 4YT5A 4LISA 4Q3NA 4ZRMA 3UN1A 2D5CA 1B3BA 3OF2A 3MOGA 4ILKA 1IPEA 3OIFA 2Y68A 1QV6A 4FC6A 1KVUA 4NFHA 4OGWA 3ULKA 4YT2A 3EDMA 4EGFA 2NVUA 2PKRA 2JKVA 1DDOA 4BO5A 3BMOA 3IQDB 3GG9A 1EUDA 2VHZA 4CMIA 1QYDA 1C0PA 3FWNA 1F8FA 2R2GA 4EDFA 1MG5A 1GEEA 2BFAA 4DPMA 3HDJA 3X2FA 1V3TA 5AQ1A 1PGOA 1LDYA 3WGTA 5CDSA 1E92A 2CDAA 3DBRA 3LYLA 2QZZA 3BTVA 4D46A 1KY4A 5HS6A 1R12A 2CDCA 4Y6PA 4NZ9A 4YEDA 1HTBA 1SMKA 4JJFA 4WLFA 4ZD6A 5A9SB 3ETEA 3GG2A 5IDXA 3RUFA 3WDSA 1EDOA 1X7GA 3PGXA 1OOEA 3IKTA 4FFMA 1U7TA 3NGLA 3DEYX 4E13A 3E6AA 5B4VA 4FJ0A 4J6FA 1Z73A 3IKVA 3PPIA 3KRTA 3FN4A 5IXSA 1P1IA 2JJYA 3DOOA 2C54A 1ZK4A 3ZW9A 3NEPX 4BV8A 1DO8A 5K9ZA 4R3NA 2YYYA 3VKUA 1Q7GA 3GGGA 3MZ0A 5JS6A 4RORA 3RJ9A 1T2FA 2DM6A 2IZ0A 3BMCB 3KYCB 1R4NB 1Q0QA 3KOUA 1ONNA 1SO8A 3D4OA 3MJVA 5CFZA 4R3WA 1C1XB 4QECA 4GWGA 2YDXA 4PG7A 1GZ4A 1B7GO 1UAGA 1D1TA 5KJ1A 2D8AA 4PVCA 1C0IA 4I08A 4Q3DA 1KVSA 1W4ZA 3L4BC 4YVFA 2E48A 3C7CB 3KETA 1PGPA 3GZNB 4NH4A 5CPBA 3ROKA 3L77A 1YE3A 4TMFA 3W8FA 1NBOA 2NUAA 4DBZA 2AQ8A 1VJ0A 3JTMA 2HMWA 4U8GA 3GN2A 1O8CA 4L9RA 2H6EA 3SBOA 2IRWA 2Q46A 4B7XA 2TMGA 5JCJD 3QRWA 3PQEA 3LC7O 3TOZA 2PGLA 4J3FA 4R5HA 3AI2A 2J3KA 2Q99A 2EHDA 1SEVA 5CEJA 5L40A 2Q2WA 1OC4A 3GVCA 3EMKA 1CEQA 4EUHA 4Z6KA 3RU7A 3VH3A 4GSKA 1P45A 4DQXA 5IDQA 2Q1WA 1EUZA 4GX2A 1PWXA 3QE3A 3JD3A 2I6TA 1R15A 1FXSA 1E3EA 1N9GB 3K6JA 2BMAA 4GGPA 1ADCA 1BMDA 2HK9A 1ZK1A 5F5NA 3STHA 3E18A 3KYDB 6ADHA 4II2A 1CRWG 3ASUA 5JAMA 4J9VA 3WJAA 1E77A 2NQ8A 3P5SA 4D0RA 5T5QA 1E1NA 1AXEA 1DFHA 1E6UA 1HSZA 4Z0HO 4CM1A 1N1EA 3AU8A 2NVUB 4A27A 3BMOB 3TNLA 7ADHA 1CDOA 3AFMA 4CR7A 4CV3A 1O6ZA 1U8XX 4NDNE 4TKMA 4TZKA 4Z0TA 5FYDA 4Z3DA 4CMIB 4XR4A 1I10A 4I9NA 4YAEA 2B4TO 5TF4A 4M87A 3ZNQA 1IZ9A 3FF4A 3OA0A 1B8VA 2XXBA 1H93A 4DTIA 3ANNA 3OQ1A 3DBRB 4M49A 4DIBA 1Z7EA 2DQ4A 1JA9A 3TSCA 2P91A 3V2UA 1QYWA 1XDWA 3PJEA 4ID9A 2PGDA 3NAQA 1TVEA 2HJSA 3E9MA 3L07A 3ZNNA 4I5EA 4Q3CA 3TPCA 3HB5X 4HNGA 1M75A 4J0FA 4WJZA 4D3FA 2B5WA 4BNXA 4PG4A 2Q1TA 4CMKA 1QORA 5BR7A 4UVDA 4NU6A 2X7HA 1Z7BA 1HXHA 5JFOA 1C1DA 3GVXA 3LC2O 5ENVA 3TZKA 4DC1A 3S2GA 1BXKA 3KEQA 4AJ4A 1NHWA 4M55A 5A5EA 3PYMA 5H82A 3QWHA 4AJNA 4JN6B 4MVJE 2AEMA 1UDCA 3FD8A 4KTVE 2IZZA 2Q45A 4NFSA 3RUHA 5JC1A 4TZTA 1IOLA 3LC1O 4KQXA 4BGIA 3PK0A 3F1LA 1N7HA 1GPJA 2EXXA 3EUWA 3GT0A 1P77A 2VQ3A 3RJ5A 3EZYA 1E3SA 3FSRA 1H2HA 2GO1A 2GPTA 2EJWA 4IDDA 1UP6A 1E1MA 5JC8A 4ZQFA 3PXXA 3WQSB 1ML3A 4E3ZA 4Z9YA 4OSPA 1C0LA 3B70A 3FNHA 5EIOA 1K5HA 2GGSA 5A03A 4XYMA 3ZHBA 2UAGA 4D79A 5JY6A 3IJPA 2QQ5A 1TT5A 1Z6ZA 1Y1PA 1T4BA 3ZWAA 3RKUA 4ALLA 1UP4A 1E7QA 2VUUA 1JWBB 1PQWA 1XELA 4FCCA 1MLDA 1XHLA 1XR3A 1K6IA 1P31A 3C1TA 3E9NA 3JQ9A 4JBIA 1YH3A 3IP1A 4IGFA 4FIZA 3P19A 3LF2A 3FPLA 1JKIA 1ISMA 4TSKA 4XD2A 2AQIA 3ZCXA 5TNXA 3F5SA 4D3SA 3VPHA 4R41A 4AJ1A 4DMMA 1T1SA 2BKAA 3K5PA 5EERA 2E49A 1N8KA 3KBOA 4CLHA 2BF7A 4J16A 4NI5A 1N92A 3KV3O 3PHIA 1LRKA 3AM3A 5TJHA 2GDZA 1YJQA 4NIMA 3LQFA 5ILGA 3GEMA 4E30A 2NU8A 4FJ2A 4N5NA 4G5HA 1ZIDA 3LT4A 2PH3A 4ZJUA 2JCYA 2IYPA 3I3OA 2VZ0A 5I8ZA 2D1YA 1IYZA 1TXGA 4ZGWA 3DHNA 3WTBA 3D0OA 2ZYGA 1I01A 4NU5A 4WCDA 3VVCA 4K9DA 5KJCA 5L45A 2AG8A 4E5KA 4GAEA 4BGEA 1I0ZA 3SJ7A 3PVZA 1HE5A 3W6UA 2ZTVA 4MVJF 1H6AA 3EY4A 4BB5A 1PR9A 5JPIA 4WE3A 2OOSA 4GH5A 3NTQA 5IFLA 3DHYA 4BNYA 3VZPA 3ADPA 3HADA 3I9OA 1SZJG 1M67A 3GDFA 2HJRA 1C1DB 4PN3A 1H0KA 4UVEA 2EF1A 3AM5A 3PHGA 3DZJA 2EJVA 4RPKA 4G81A 3DZKA 2NV6A 3CXRA 1O89A 4D41A 3JSAA 4J91A 1BRMA 1SEPA 3D4NA 1GCUA 3OIGA 4FPXA 1BTOA 5T8KA 4UVGA 2NACA 3KSDO 2Y1DA 5JAQA 3R3JA 5IDWA 3EGOA 1SC6A 1LLQA 2QRJA 4S1VA 3WBFA 3E8XA 3AFNA 2PA3A 4I5DA 1C3VA 3OM9A 4IXTA 4M86A 3ZWCA 1LC3A 2WD8A 5ES3A 1CETA 3ZW8A 4A73A 4YJFA 3T4EA 3VZSA 3KSZO 3WS7A 5JSFA 1HLDA 1PS8A 1UR5A 1NWCA 2FPIA 1ZSYA 4R54A 4J4HA 4PLYA 4E2WA 2VYVA 3N7UA 2ZKLA 3I4FA 2FZWA 3RUIA 1HRDA 1TT5B 1YVEI 3CE6A 5L4SA 5L51A 1X13A 2NSDA 4FN4A 2AEJA 2NNLD 2DPHA 2NTJA 4PLWA 1D7OA 2CSUA 1CJCA 1XG5A 4PVDA 2CMDA 3K2EA 4QUKA 4Y98A 1ISIA 3RC1A 4DXHA 3JQ9C 2G0TA 3I23A 2CFCA 4E2YA 2ZIZA 3GRKA 1DJNA 2W8ZA 1DC5A 1X1TA 3BXXA 4WK6A 3WYCA 5KJFA 3ROPA 5K6AA 2O23A 2DVMA 3EZLA 4GMGA 2NTNA 3PJFA 2FHSA 1JAXA 5HRUA 8ADHA 2H63A 1MXHA 2OL4A 3E82A 4OXYA 4XQ9A 5LDGA 4LN1A 3U4CA 3Q2IA 3HUDA 3WNVA 3WYBA 4RCVA 3BTSA 1EUCA 3I9NA 4YACA 5KCZA 4XDZA 3C8MA 3JQBA 3JQEA 5AOVA 1OC2A 1YBMA 1X15A 2G1UA 2NWQA 4R69A 1PR3A 4AJJA 1UXHA 5G4LA 1PZFA 4JJIA 2AE1A 4BNVA 2TMDA 3B1FA 2JL1A 3DTTA 3W8DA 2YJZA 1YRLA 4AG3A 1HDOA 4B4OA 4DC0A 2NU7A 1N5DA 3NUGA 5DBFA 1PJCA 3V2GA 3W6ZA 2PZLA 5THKA 1V0JA 1U3UA 2NU9A 2R6JA 4EUEA 4CR6A 5F1PA 2VNSA 3M2PA 1NXQA 4R9SA 3SLGA 5GZ1A 2DPGA 3ICPA 2DUWA 3RC9A 1BG6A 1UXKA 1KIFA 5I9MA 5F1OA 3W4KA 1U3VA 1ZJYA 1Y81A 1GV0A 4YBZA 2NQTA 4PLPA 4GVXA 2J8ZA 3GMSA 2Z1MA 3TQHA 2GCGA 3VZRA 4DGSA 4K6FA 4MVJG 4U5QA 4D44A 1PQUA 5ICMA 1GPDG 4AJHA 1K3TA 2UUOA 1LQTA 1MX3A 2Y1FA 1RM3A 2Q50A 3WJ7A 4CMEA 4I9HA 2CNBA 2EW8A 5L9AA 4CMBA 4MINA 2BLLA 1XKQA 5G0VA 4EEXA 1KEVA 1MP0A 3IS3A 3D5TA 3VDRA 3ZWOA 4CQMA 3RBZA 1LDMA 2H1SA 3PYLA 1P1JA 1F14A 5JYEA 4XQGA 3BHMA 2X58A 5T8KC 1DLJA 2FSVA 2VHXA 1LXCA 4L0QA 3WIDA 2QZ9A 4KP7A 3KEOA 3JQCA 3D7LA 3PEFA 4BO2A 4RPLA 4XZ3A 3DZGA 3H7AA 3TL2A 1HYGA 3DO5A 4YJFB 4KQWA 1DBVO 5HM8A 1ORRA 4JBHA 1NQOA 2VUSA 2PY6A 3PDUA 4RO0A 3W1VA 3RI3A 3WLFA 1GADO 3H8VA 2RHRA 3GVIA 3I1JA 1RM0A 1OAAA 3UICA 3W4JA 2VWGA 1GCOA 3AM4A 3H9EO 3GUCA 1MB4A 1ZUD1 5KKCA 1Q7BA 3KM0A 3WWYA 1AUPA 1G0OA 2IXAA 1N2SA 1XQ1A 2G82A 2X5JO 2WSBA 3ROQA 2HAEA 5C5IA 4B3HA 3DR3A 3E48A 3ITKA 5GZ3A 4FFRA 1TT7A 1E3IA 4CM4A 2Q49A 1HZZA 4R1NA 2C5AA 5K6AC 1W0CA 3ONEA 5JLAA 2VCYA 1PGQA 4XR9A 5L95A 1PL6A 3U4IA 1WP4A 2HO5A 3OQ6A 4J43A 4MJLA 5G2OA 4R5MA 4YJHA 4MOWA 2VTDA 2LDBA 5BNIA 1DC6A 2EP7A 2IZ1A 5FF9A 3UOGA 3QV1A 3DL2A 3QVWA 5DCYA 4W7IA 2WYWA 3QWBA 4D45A 1P3DA 2I99A 1YBVA 4B4WA 2YDYA 2V6MA 2A92A 4NK4A 1IY8A 2BRUA 1H9AA 2FRDA 4DIOA 4P4LA 3WFIA 3WICA 2IE0A 1DSSG 4O0LA 4W9NA 1J49A 2FP4A 2W90A 3VPFA 5I9NA 5DULA 3GHHA 2D59A 4PLFA 5HBRA 1GUFA 3A28A 1HWYA 4UULA 3B1KA 4OAQA 2ZB4A 4K6CA 2IEDA 1T2EA 2C7GA 3I6QA 4OYRA 4ZHSA 2WMDA 4RDHA 5IZCA 3PJDA 1LDEA 3ZU5A 3WBBA 1K6XA 4E6PA 4BNFA 3FTPA 4K28A 4YB8A 3I9JA 4ITUA 3GEGA 2JHGA 4URFA 1GD1O 1YO6A 3F46A 4LCJA 2JAPA 4CMEC 4NBWA 5MDHA 5L4NA 3RROA 1XU9A 1PJQA 1VL6A 1I30A 4YJGA 4BO8A 1FJHA 2GRAA 4XB1A 5TSDA 1U7HA 4UUNA 3WGGA 2QHXA 4CQMB 1OFGA 1UP7A 1P1RA 4DLBA 3M1AA 2F00A 3MTGA 4BO9A 1IHYA 5KKAA 1O95A 1R4NA 2VZ8A 3K31A 4B79A 1P0CA 4C7KA 1ENYA 3SXPA 2WD7A 3WWZA 4TROA 1YL5A 3V1YA 1E5QA 4YRDA 1O9BA 5T64A 3TOXA 1PJ3A 3CZRA 3DZIA 5IDYA 4E0BA 2SCUA 1TLTA 2E37A 4BO1A 4F3YA 3RBXA 1ADGA 3TJRA 3FNEA 4CM8A 1LA2A 1IHXA 2PNFA 4QXMA 1GYPA 3ZH2A 5HWSA 4CM3A 2HU2A 5HA5A 2JAHA 4OH1A 4P8RA 4CV2A 1G0NA 1LNQA 2DBZA 2FR0A 3GY0A 2DTEA 3I52A 3M1LA 1YKFA 3WX0A 4CMHA 2UYYA 1PWZA 5CEFA 2I3AA 3RWBA 1WVGA 2HDHA 1Q0HA 1MG0A 1KYQA 3D4PA 1DIRA 2C82A 4XCVA 5KWEA 2JFHA 4OM8A 4MP3A 2X9VA 3QW2A 4YA6A 1OBFO 3ZWNA 3RASA 2BHLA 3D3WA 4BNKA 1Z74A 3G1TA 3ZV6A 4RVSA 4GWKA 4CM4B 4ZA2A 4BNWA 1GY8A 3ZWXA 4CLRA 5TT0A 4YRBA 2NTVA 4E5NA 2VWPA 2HCTA 5ICSA 2R00A 1ARZA 4L75A 1LEHA 2Y99A 4GL4A 2POQX 4J4TA 3RSHA 4F6CA 2UDPA 4I5GA 3HG7A 1GL3A 4QFDA 4UUOA 3FBGA 4YJHB 2PKQP 4NHEA 2H9IA 4HFMA 2VOJA 2FY8A 1QKIA 2HLPA 4KUHA 3AUSA 1NASA 3LDHA 2Y1GA 3UW3A 3WSVA 4F45A 2O3QA 3KLMX 1M76A 3ITDA 5ER9A 4OMUA 1HDGO 1P1FA 5IG2A 2C2YA 1EEHA 4LCEA 5JMPA 3UCFA 3ZZNA 4IBOA 1I33A 1EE9A 2VYVD 4BGVA 4UEKA 3TZQA 3U0BA 4PLGA 4RJTA 2P4HX 1XCBA 1GUYA 3OHSX 4W9NC 3I9LA 4A03A 4PLZA 2PV7A 4UVIA 5JCXA 5BSHA 2WE8A 1ZK3A 3DC2A 4FGWA 3CPSA 5TGDA 4I5FA 3AY3A 2O4UX 4K1LA 1DXYA 2UUPA 3AUTA 3QP9A 1MA0A 2YW9A 3DBVO 1X0XA 1HYEA 3SC6A 3DZFA 3OSUA 2J5KA 5DP1A 1P1HA 2V65A 1VLLA 1PZEA 3VTFA 4YXFA 1ZVMA 1L1FA 1MC5A 4Q3AA 4B7CA 5F1KA 4N5MA 1R66A 2C5EA 1Y8RA 4YJGB 1IL0A 3DMYA 3H65A 1PQPA 3B20A 4UEOA 1IUKA 3EK2A 2ILTA 5FFFA 4ALMA 2ZB7A 1LJ8A 2EEZA 4J2HA 3E9QA 2VYNA 4JROA 2VUTA 2WD7B 4AJIA 3F3SA 1HF3A 2GNAA 1UZLA 4HKTA 4RVHA 4GKBA 4FFLA 2Q4EA 4XKJA 4BUCA 4FR5A 5CAEA 1GU7A 3K92A 4CM8B 3PHJA 1P1KA 3KO8A 1SB8A 4DYVA 4LVUA 1ADBA 3IC5A 4A5OA 4IY1A 5B12A 5KVQA 4AFNA 1ISJA 3DWFA 1U8FO 2I66A 4DMLA 4IDCA 3JD1A 2HUNA 2V6FA 1NWHA 1LDBA 3WFJA 1ZFNA 3LU1A 1EQ2A 1MFPA 2C7VA 3I5MA 5H83A 3TN7A 4BO7A 5A3JA 3H9JA 1UXGA 1E7SA 2ZK7A 3A1NA 3C1OA 4ALKA 1VE9A 4NR0A 4CUJA 4IZIA 3T7CA 5IXYA 4BNHA 1R0LA 1WMBA 4QO8A 5A4DA 1VJ1A 3PYXA 3ZI0A 1SNYA 3JQFC 3D3WB 4ALJA 3ZDFA 3PWKA 4CLRB 1AHIA 4UEJA 1RJWA 3VH1A 2D4AA 4M1QA 4OSOA 2C29D 2AEFA 2O3JA 3QQPA 3A9WA 4CLEA 4CQMD 2R00C 4E2XA 2C20A 4JLWA 3TFOA 4L76A 4XGNA 4OJNA 2B5VA 3GA0A 4FD3A 4WOJA 2BD0A 1JVBA 3AI1A 3U5TA 3NV9A 2AE2A 4XYBA 3IUPA 3GFBA 3IJRA 2RAFA 3WIEA 1IB6A 2X5OA 4E5PA 4NQZA 5DCWA 1VPDA 2J3IA 4MDHA 1ZXLA 5DDIP 1JWAB 3NT2A 3DZBA 3UKOA 3RKRA 1WDLA 1BDMA 4O63O 4C4OA 3R1IA 5I9LA 2X22A 5G0TA 3D64A 4BVAA 1HYHA 4XJTA 3PFFA 2CVOA 2O3SA 3GNSA 2ZATA 3BHJA 3M6IA 4N18A 4G65A 1CERA 1YQXA 3UVEA 2OZPA 2XOXA 4ZQEA 3TZCA 2ZTLA 1I3LA 4D3DA 5ITVA 1LBEA 3HN7A 2FN7A 3V8BA 3ZN2A 2XXJA 3C85A 4EITA 1PS9A 1Z75A 4EEZA 1IULA 3U49A 3ICCA 4RF3A 3VPGA 1I2ZA 4EJ6A 4B3JA 3PWSA 4U6SA 4RVFA 4BS9A 4CMCA 5JYDA 1JKJA 3CUKA 3LVFO 3DTYA 4IQGA 1NHGA 3ENKA 3GH3A 1GV1A 2WTBA 2YQ5A 4HV4A 1LTHR 4BOYA 1Y8RB 3RQSA 1BVRA 2UV8A 1FDTA 1D4FA 4XYGA 1E5LA 2FSSA 2EP5A 3MJ4A 4HWKA 4PG8A 5TRTA 2DC1A 2RIRA 3KXDA 1U4OA 4P4NA 4HBGA 2B4QA 3K2BA 1EVIA 2EKPA 3MWDB 3GDGA 3U3XA 2GD1O 4PZCA 1ZXBA 2FZEA 3N74A 4GVLA 5DOZA 1ZSNA 3Q6IA 1U9JA 1HDXA 4JQCA 1A27A 3AK4A 4ZQGA 4R01A 4AJLA 1M6HA 3TZHA 5L4LA 5HS4A 2BFOA 3FBTA 5ITWA 4IDAA 2IYOA 1BGVA 1UUFA 4EUFA 4LK3A 4XYEA 4RGBA 4EJMA 4BMNA 2OFPA 4BNIA 3GHYA 4E12A 3NDIA 2GN8A 3EAGA 3WGZA 2PH5A 3PZBA 3ZNPA 3BMQA 3S2EA 1DJQA 2VOEA 2Y66A 4NMHA 1YWGO 3PQDA 1U5AA 4Q9NA 4AL4A 2PZJA 3I9KA 3CZMA 2O4CA 4XQEA 4E21A 3OJEA 1PGNA 1MFZA 1NR1A 1NQAO 2YFQA 4JP3A 1F8GA 1OMOA 3GVPA 1YB4A 1QYCA 2NADA 1U28A 2OBNA 3VOSA 3HN2A 4CMJA 5KOIA 1JDJA 2OBYA 3H9QA 1DC3A 2AQHA 2Y67A 4TQGA 4ZQHA 5CDGA 4IJUA 5C7IO 1C14A 1EVYA 2RBEA 1DAPA 1B14A 1RYDA 2EG9A 3IAHA 4PGFA 1LSUA 3WMWA 4WLOA 5J23A 1X14A 3PHLA 4BNUA 1R4MA 1S6YA 3MWEB 4Y6RA 3DBHA 4DPLA 1PS0A 3RBVA 1T24A 4CM6A 3F4BA 1XA0A 2P2SA 3GNTA 3MTJA 4MVJM 3X2EA 4W82A 2BFMA 1VSVA 1YB1A 1ONOA 5B4UA 5FWNA 4GI2A 1WDMA 1YXMA 5EINA 3AOEA 4MIYA 5DP2A 2J5QA 1F12A 1EK6A 1Y6JA 3JD2A 1WPQA 1OI7A 4MP8A 3S2FA 1Y5RA 1XLTA 4MO2A 5A06A 3DZHA 1MC4A 2B83A 1ISHA 2D0IA 2O3UA 5LDHA 4WNCA 4RPJA 4P38A 4J1NA 2PK3A 2X86A 5L7YA 3GEDA 3HZZA 4HFRA 1KC1A 3DAPA 4Y8VA 4DA9A 4RF5A 2YY7A 3ZWMA 1WZEA 4XIJA 4IDEA 4JP2A 1I3KA 5C3MA 1GAEO 3P2OA 1PX0A 1XU7A 1T26A 2BGKA 4TVBA 5TLSA 2FPPA 4BNMA 3K73O 5JW6A 2HSDA 1ZW1A 5DBGA 3GRPA 5A04A 5COQA 1LSOA 2QYSA 3N58A 2EIHA 2VN8A 1GTMA 2QRLA 4WUVA 3OBBA 1IE3A 3WQRA 2GASA 1JN0A 1UZNA 2GF2A 2YFHA 4DBVO 1Q7CA 3B1JA 4S3MA 2OMEA 2ZQZA 5BSEA 4GBJA 4IJKA 2CY0A 1Y7TA 3ASVA 3NJ4A 4E4YA 1HDYA 1O0SA 4CLDA 4R1TA 3HDYA 4IJWA 5TX7A 1JLLA 4YWJA 1JKFA 2OHXA 3WGIA 1B15A 1YL7A 2EGGA 4MKXA 4N54A 3JYNA 2VTEA 1NFFA 3PFWO 4GSLA 4OQZA 1E3JA 1UZMA 1V8BA 4NJMA 1QLHA 3EW7A 4ZQBA 3BMQB 4KUGA 4Y6SA 4BMVA 1RPNA 3TWOA 4AICA 3L4SO 4R51A 4XRGA 1B8UA 4LGVA 1K89A 4LRTB 1B3RA 3G3EA 3PLNA 4Z9FA 2DUUA 3NT5A 3MEQA 3WGOA 3ZNOA 2Q1UA 4KTTE 4BIIA 5DZSA 3QWAA 1E7WA 4R9RA 3SJUA 1WNTA 2QIOA 3HNPA 1LX6A 4MKZA 3QA9A 3SLKA 5BSFA 2X8LA 5BQFA 1I32A 2X0IA 3F47A 4ND5A 5U9CA 4PLTA 5DCUA 3UXYA 1MUUA 4H16A 2P4QA 2VYND 3F5QA 3JD0A 3RD5A 4WLEA 5EPOA 4YQZA 1WXDA 3AUAA 3K9QO 4EZBA 1R4MB 1ZK0A 3L6DA 1DB3A 2DU8A 3DBHB 1Q1NA 4XJSA 3D5QA 4IMPA 3QVTA 3FTNA 4Y67A 3C7DB 3SC4A 1RYEA 1QSGA 1EK5A 1P44A 3WTCA 2CVQA 5BSGA 3ON5A 3Q9NA 1PZGA 1NYTA 4DLLA 2IDZA 4YTEA 2Q2QA 4BNZA 1JU9A 1EFKA 4OHUA 5JNLA 4J1TA 5EQFA 4YT4A 3MJCA 1I24A 1ZSVA 1P74A 1A4IA 1Y9EA 4XA8A 1JAYA 5KTKA 2XF8A 4HFJA 4MKRA 3QSGA 4E5YA 2ZB8A 3JQ6A 2BI8A 2JD2A 5I7EA 5TC4A 3HB4X 3HFSA 4W7HA 3WGHA 3DOCA 2JHFA 4WKGA 5AXDA 2ET6A 1T4DA 3ETDA 4IDFA 4TRNA 3MJEA 4DLAA 1LU9A 5AVOA 3JYQA 4Q3BA 4AJ2A 4BL5A 5I7VA 3P7MA 5C7OO 3HSKA 2OUIA 2GLXA 3Q11A 4B8WA 4HFNA 3AU9A 6LDHA 3RIHA 3DFZA 2O48X 4RVDA 4AVYA 3GDOA 1KY5A 5GY7A 3BMNA 3D3EA 2Y0DA 1A9ZA 1V9LA 4LSMA 2PLAA 5EQDA 3S2IA 4GX0A 1DC4A 1EZ4A 1LDNA 3BZUA 3W4IA 1P9LA 2Y0EA 1WWKA 4NBUA 3TZ6A 3QVXA 3PP8A 2P9EA 3T4XA 1FDVA 4CPDA 5GMOA 2X9GA 1YDEA 3G17A 5CG1A 1DOHA 2CDBA 4J7XA 1CWUA 4LMRA 1ISGA 2A4KA 3LSYA 5ILOA 1NP3A 4JX8A 2ZTUA 4YAGA 1W73A 4UVHA 3BAZA 4KMSA 1LI4A 1Q0LA 1PTJA 3V2HA 4NJMB 1DFGA 4WLVA 1QMGA 3SEFA 1IZ0A 4FJ1A 4ONEA 5CPFA 2P9GA 1CQIA 1HLPA 3CMMA 3GFGA 1NX6A 1PJ4A 4OXNA 4NNJA 4H15A 3DXFA 3G49A 1SCUA 1KEWA 4BNNA 3DAGA 5CP8A 3TF5A 3OICA 4WPGA 4NG5A 3CINA 4XGKA 3U4DA 3OEWA 3PHHA 4DREA 4YCAA 3ROMA 4EBFA 1V6AA 3UF0A 5JDCA 2Q3EA 1GQQA 3Q3CA 2OORA 3NGXA 7MDHA 1HETA 4ND2A 2O7QA 2I3GA 3JQBC 3PWZA 3FR7A 4OQYA 3ZHYA 1VKNA 1VI2A 3EYWA 2NM0A 1J0XO 1M2WA 3T7EA 3OP4A 2AHRA 1KS9A 3C1AA 3WR5A 1O94A 3MCVA 1UJMA 4Z0PA 1YQDA 1VM6A 2P9CA 1QRRA 4MVJA 2H5LA 1E3WA 1KBZA 1T2CA 3QWFA 4AJEA 3R0IA 4IDGA 3C7AA 1QYVA 3GC6A 5T57A 1A9YA 5IN4A 3BA1A 3L0DA 3ETGA 3TRIA 4ZN6A 3F9IA 4FSHA 3QLJA 3F6YA 3GGOA 1Z45A 4J4BA 1YB5A 4KUEA 4OXKA 3H5NA 1FF9A 4ZVVA 1PL8A 4FQ8A 1HSOA 3FHLA 4XB2A 1DIAA 2C0CA 1I2BA 2X23A 3PRJA 3UAGA 3V1UA 2GN6A 3LLVA 4OKIA 5C7LO 4FS3A 3UCXA 5KVCA 1H94A 3GGPA 3JQAA 1NR7A 2FR8A 2NU6A 3IL2A 3BMNB 3QJ5A 5CDTA 2PD4A 2AA3A 1HE2A 2DTXA 3CKYA 4C7JA 1A71A 1MGOA 3QVOA 1NPYA 1PEDA 1J4AA 4NK5A 2JCVA 4WASA 2HRZA 5TJ9A 5JDIA 3I9MA 2PWZA 1T1RA 4D43A 2G76A 4HX5A 3GPDG 1YGYA 1ZKMA 2WYVA 1BHSA 2HMVA 3QVSA 3LF1A 3PQFA 2VWHA 4XDYA 3VH4A 3K96A 4FFOA 1PJ2A 2WYUA 1EE2A 4MP6A 3MJSA 4DVJA 3OQBA 3AJRA 5K0ZA 2VNAA 3OJ0A 1YOVA 3VVBA 3JCZA 4WOKA 4A26A 4BB6A 3L4BA 4M8SA 3DFUA 3JQ7A 2CF5A 1VSUA 1HT0A 1LRLA 3DOJA 2DBRA 3ZHXA 3RAJA 5COAA 3ZU4A 4AJOA 3GK3A 4FDAA 4JK3A 1PJTA 1EBFA 2PTGA 3WSWA 1NQ5A 1E6EA 1NNUA 1YBAA 3FWZA 3NX4A 3OA2A 4O5OA 5ADHA 5JDCC 1T2AA 1ENPA 1RKXA 5JO0A 3F1KA 2DBQA 5U4QA 3GLQA 5DOVA 4CV1A 2FOIA 2W2KA 3PZRA 4OL9A 4QX6A 3ZV4A 3OJFA 2JD0A 1VL0A 2E82A 3AUUA 4YR9A 4D7AA 4E31A 1NM5A 4H3VA 4IGEA 3Q0EA 5IAAA 4PRKA 1E3WB 1RM5A 2DT5A 2X4GA 3SVTA 1VRWA 4IXWA 2GSDA 1DHTA 2IXBA 2WDZA 5KIAA 5AXBA 4IS3A 3NKLA 2JFFA 3EC7A 5IZCC 3OH8A 3GR6A 2Y1CA 4KZPA 4AJPA 3Q2KA 1BSVA 3E03A 3RFTA 2B0JA 3JYOA 4CR8A 3VDQA 3KHUA 4ALIA 4YJDA 4J2OA 3ZGYA 4P4GA 1KVRA 3U09A 3CEAA 4YT8A 1GYRA 4RZIA 2O2SA 2PFGA 1LLDA 3ZU3A 1NFRA 1PJBA 3ZWPA 4J9UE 4BO6A 1W6UA 5A1TA 3JQAB 3NDJA 4E2ZA 4JXKA 1B2LA 4JCOA 1E1LA 4DYDA 2CUKA 4GLLA 2O50A 1KEPA 4N5LA 3GAFA 1AHHA 1DIBA 4L4XA 5A02A 5LC1A 2YV1A 1SAYA 2VHWA 4B4VA 5JO9A 4L73A 2PD6A 3ZWYA 2E4AA 4BKUA 4UREA 3WNQA 5CEEA 3HWRA 4RF2A 5H81A 1ENOA 1AGNA 5JDIC 1HEUA 4YPOA 5CDYA 5DBIA 4BO0A 2Q1SA 4IQ8A 2HMUA 3OMLA 2CD9A 2FPGA 4GX1A 4JBGA 1R16A 3LLSA 3M2TA 1VJTA 1E3LA 2PZKA 4CL3A 2D5AA 2EKLA 4PCVA 3S1LA 2EERA 3KVOA 4UUMA 1ID1A 1GQ2A 4Q3EA 2QG4A 1UXIA 2F1KA 1TB4A 4OO3A 1YL6A 3H5RA 4GQAA 4WEQA 3JYPA 4CM9A 2EGHA 3H2ZA 1CQJA 1QV7A 2A35A 3EHEA 1YOVB 2HQ1A 3FNFA 4IINA 3JQ7B 1LLCA 3RUAA 4O59O 1CYDA 1WDKA 1R6DA 4XX0A 2YV3A 3ZWWA 4XEHA 5TT1A 1WLYA 3K30A 4LMPA 1WAMA 4DQUA 5COBA 1BDBA 1A7KA 1T25A 4CLOB 4H7PA 2X1HA 2V6BA 4Z9XA 4CMAA 1A4UA 1D1SA 1H6DA 2QYTA 3ORFA 1UXJA 2C07A 3GVHA 2DFVA 2ZCVA 4J7UA 4QFCA 4NJOA 2WM3A 2W2KB 3CMCO 4W6ZA 3RC7A 4CQLA 2PKQO 1E7RA 1ZMTA 3JQ8A 4MPDA 3U62A 2X0RA 1PSDA 1XIVA 3CH6A 4ZICA 3KSUA 1DEHA 4ND4A 5ENDA 4RV9A 1BVUA 4TRJA 1GEGA 1ZJZA 1MXFA 3E1KA 4WLUA 5THQA 1M66A 3HQ4O 2W2LA 4J90A 4YAIA 2J6IA 4KDFA 5JAZA 1SOVA 3RUEA 3ANMA 2YZ7A 1QG6A 4GLOA 1A5ZA 5KNLA 3OECA 5L3ZA 5KJ6A 3BYZA 4QQRA 1HE4A 2JCXA 4QEDA 2BGMA 3G79A 5BT9A 4YAJA 2EWMA 1J5PA 4X54A 3H9UA 2ZQYA 4WEOA 1FDUA 1LUAA 5TQVA 3IUSA 4NBRA 4J0EA 1NPTO 1DIHA 2CVZA 4PLHA 1B0AA 3GPIA 1PU2A 3OETA 4ND1A 3O9ZA 2FWMX 4B8ZA 3H4VA 5EMHA 3IMFA 4BO3A 2DFDA 1H2BA 1DIGA 1XGKA 3HFGA 4PZEA 1NTOA 2OP0A 3PLRA 5C37A 3OFSA 1ZCJA 3PDJA 4RZHA 2P5UA 3R3SA 1QLJA 3LK7A 4ALNA 1ISFA 3FR8A 2DTDA 2AMFA 4MVJD 1LLUA 2BI7A 2Y93A 1CIVA 3DDNA 1NQTA 2UVDA 4GX5A 2Z5LA 4RF4A 5FI3A 1EVJA 1K2WA 3INGA 2AXQA 1Y8QA 1V35A 2W98A 4IIVA 5T6BA 4RVGA 4RPHA 4NBTA 3G0OA 1X1EA 2JD1A 3INTA 1YDWA 2X0NA 3KTDA 2GYYA 4DPKA 4O1MA 2I65A 2X9NA 3NTRA 1GDHA 5DNAA 1I36A 2O3RA 3DAFA 5IF3A 1BW9A 3ZU2A 2A9FA 1SOWA 2BFPA 1J6UA 4TWRA 4IQ0A 5CHEA 1YS4A 4IJVA 2O3TA 4XQCA 4LW8A 5EL0A 1V3VA 1NVGA 4CUKA 2GZ3A 4INAA 1KC3A 3E5MA 3JQGA 4E32A 3JQAD 1DRWA 1NPDA 1I3MA 5L7TA 2ZJ1A 5B4TA 1BXGA 4TVOA 1XSEA 1SPXA 3BIOA 1PZHA 5A3VA 1D3AA 1ZO8A 5B1YA 1E7YA 4DQVA 4PLVA 4BO4A 1F06A 2JFGA 3NYWA 3KUXA 3TDKA 3IOYA 4D42A 3ONDA 3VPXA 4BQRA 5I7FA 3QHAA 3DQPA 3ZWBA 1GFSA 3LT0A 3RC2A 3S55A 2I76A 4CQLB 1JQBA 4UAGA 3ENNA 2Y05A 1DFIA 2VRCA 4W4TA 1UDBA 2DKNA 3JQ8B 2Y1OA 3NJ8A 1HE3A 1T2DA 4IMRA 3A14A 5IZ4A 2V7PA 4KWIA 3OJLA 5L7WA 5ER6A 1QP8A 2B4RO 4EW6A 1LSSA 1NAIA 3H6KA 2ZYAA 3CTMA 4P22A 1ZMOA 4IS2A 1DAOA 1F17A 1H5QA 2CZCA 3VPSA 5KJEA 3WG9A 1EBUA 1KVTA 2B69A 3FRJA 1S7CA 4GPD1 3WB9A 1EDZA 3FI9A 5BNTA 4BNGA 4IIUA 4J49A 1D8AA 3AWDA 2Q4BA 2VRBA 1E7MA 3ZWVA 1WMAA 1PJLA 3DONA 1YJ8A 2IEBA 5G0UA 1NAHA 2ZB3A 4R16A 3RUCA 3H3JA 3OEYA 4OKNA 2Y1EA 2GERA 3ANLA 1DRVA 1R0SA 3HHPA 3BHIA 4HUJA 1ZEJA 2E6UX 2ZYDA 1R37A 4II3A 2PZMA 3FPCA 4JJGA 3O38A 5F3RA 5CDUA 1OZAA 2NLOA 1JW9B 4QT0A 1EFLA 2AW5A 4XRRA 3HE3A 4E5MA 2XPCA 4A7PA 3R6DA 1Y8QB 5G4KA 1L7EA 3I6IA 4QTZA 3RVDA 2WEKA 2I5PO 2Q2VA 2ZTMA 4WLNA 3HDQA 3RFXA 1EMDA 3I4CA 3O8QA 2D3TA 2NVBA 1N7GA 4FC7A 3WMXA 3C3XA 4L4RA 3JD4A 5FI5A 3ABIA 1BW9B 3WLEA 2CF6A 4YRAA 4OOEA 4GKVA 2B36A 5U1PA 3VHRA 4U7WA 1TEHA 1XWFA 2EW2A 3NT4A 1N1GA 2X5KO 3HDHA 4WECA 3VH2A 1FMCA 1PL7A 2HK7A 2GUGA 3ST7A 1H6BA 2QX7A 4DRYA 3VTZA 1I2CA 4FFPA 4CODB 3JQGB 2OGUA 3H9GA 4FBGA 1X7DA 2VHVA 3WYEA 4M54A 4YQYA 5IN5A 1BXGB 4I9UA 2PGJA 1HL3A 3KB6A 5JAIA 1L7DA 3FCOA 4WNIA 1DLIA 3H3FA 4GGOA 8LDHA 4CLOA 3WQQA 3S8MA 1U3WA 1U3TA 4L74A 4R1UA 5JXWA 4FB5A 5T67A 1K6JA 5JE8A
chains in the Genus database with same CATH superfamily
4WESA 2BIFA 5G02A 2CHEA 1SBQA 2HHJA 4NF2A 3UUWA 3HVHA 4YCSA 3MLEA 3HXPA 2FI1A 2GM5A 4IX9A 9LDTA 1Y6GA 5MGBA 3SHVA 4GRAA 1QFZA 1KOLA 3NTLA 1FQJA 4Q9KA 1U8YA 2XMGA 1MAVA 1GT91 1BXZA 2WE7A 2Y1WA 3CSDA 4IX1A 4IJ5A 3Q3EA 3RLIA 4F9EA 4PFKA 3WB1A 3ZD8A 4K6GA 2HKIA 3QY9A 1Z4NA 1J1ZA 2X2OA 3GGJA 5EN4A 2F64A 1QH0A 1T8RA 3PF9A 5CT8A 3BEDA 1R1DA 3RV3A 3KOXA 3DEIA 3COZA 1A7AA 4U7PB 1J5XA 4PGHA 2EATA 2I8AA 3MOSA 1QYXA 1B0UA 3OPMA 3PI6A 3WDKA 3I0ZA 1MT3A 3HUUA 3P2YA 1RWBA 5E6UA 2GYUA 5EWLA 2VQFB 3D31A 3QVKA 1VLJA 1GXSA 2H2GA 4WQMA 5EWMA 2C9ZA 2QPTA 4KV9A 1IXKA 1ZUNA 4HD8A 1LC0A 1PIWA 1YZKA 2X3FA 3D1LA 4L78A 4Y30A 5EXTA 3CX7A 4IWXA 5CFMA 5AT1A 5AW5A 3PGJA 4HQ6A 4D82A 1OHHD 3DBIA 3A1VA 4C4RA 2PZEA 1CUEA 4J1SA 1GQYA 5LU9A 1TQ8A 2FFQA 3BSSA 3CCBA 3ONFA 3TR0A 1LRJA 1TU4A 1ZGJA 2JHPA 2RH8A 2W4QA 2C4TA 4EYQA 1IXZA 4G0QA 4M46A 1B6GA 2FN4A 3AY6A 1W36D 2QMYA 3L7IA 4FGSA 1ZIPA 3PIIA 3RRXA 1UM9B 2IODA 2BUCA 3JQPA 3F4KA 4BKOA 4MVJH 4ROSA 3LWBA 3FOCA 5EYPB 1SXQA 1UT5A 2DQKA 2UU9B 1NXOA 1G8KA 4MIOA 1M2NA 5LZ8A 4RZUA 5G0WA 4B2IA 2FSIA 4H3SA 3HZHA 2O0JA 2VNKA 1O08A 3FNGA 4LZAA 5CD9A 2ZIUB 4Q1CA 3LT1A 2WBLC 4QO7A 4C6TB 5A3RA 1P5HA 4M0CA 5TIIA 1T1EA 2O8BA 4EKDA 1CRQA 3A06A 4COOA 1H5UA 1GPH1 2GD6A 3G7UA 4QPDA 4YDRA 5HE8A 3SX2A 2PCLA 1JR2A 4BGUA 2PUTA 1SCJA 2ZS9A 2IS1A 3O8QB 2BEWB 4GNRA 3TGWA 4ZJYA 4OD0A 4R98A 1KVQA 3ANSA 3E15A 3M8KA 1DPGA 3R6GA 4KWHA 4HWPA 5G1OA 1YA4A 4M9QA 4LRSB 4OFZA 1XVUA 3BOSA 4MW0A 2HB6A 1TAQA 3CX4A 1NJSA 1Y9AA 2CKMA 3Q6MA 3FPKA 5AXAA 3T1VA 3TTVA 5BV0A 1GZ3A 1FP4A 4BVFA 1BIFA 2WHRA 4ZRNA 1CF4A 4P3XA 1ND5A 4CM5A 2EGUA 3OKFA 2PD3A 4HEJA 4RY8A 1E4OA 1ZCAA 2EFYA 2M98A 2QW8A 2XEXA 3AT1A 4FE4A 2F48A 3SKYA 1KDZA 4BNLA 1VMDA 4XLLA 2GEBA 1AU9A 3LQYA 2CNWD 4KK4A 4DR4B 3RTDA 1JMVA 2YZGA 3AHGA 1WOYA 2XMPA 4F12A 3INRA 4WBXC 3SFTA 1MAUA 5F98A 1GYQA 1X0VA 4WX2B 3VR5D 1K8YB 3F67A 3PNKA 1CUBA 1AE1A 1HDCA 2H59A 1V47A 2P7IA 3JU3A 2I1WA 2YHIB 1I2DA 5EVCA 1WW8A 3IOMA 3ZVLA 4CDGA 4KOAA 2QR2A 4QD3A 1L3BA 5EZSA 4W99A 1RZUA 3PSAA 1AXGA 1Y4AE 2O0KA 3OCYA 3A1WA 4UDNA 3BCRA 5A4KA 3IT0A 3F4LA 4DLZA 1G55A 1JSZA 1GN8A 1TAHA 1AN9A 4HDRA 4B3RB 4CMGA 2LGJA 4G2NA 1C4KA 4Q4CA 1ENZA 5FD8A 2WG2A 1DUVG 1C8KA 3CM0A 4PLCA 4O4JF 4DJ5X 2LXNA 3N8KA 4J1QA 2G71A 4N65A 4NU0A 3ZV3A 2ZAGA 1YCFA 5EUCA 4FNAA 2GN4A 4GWLA 4J1TC 1F60A 4BQEA 5I7SA 2VYCA 1O58A 3COSA 3GAZA 3PEUA 4JUBA 1ZNQO 4OH7A 4HNSA 3V1TC 1PVVA 3RVQA 1RXWA 2DZDA 3GYGA 3RKSA 1DAMA 3ZK8A 4UTVA 4ZU3A 2BFNA 3K8ZA 3MJDA 3NALA 4MS4B 1W8DA 4K88A 1DOAA 5JBIA 4FGKA 3MTBA 3BC1A 1Q0ZA 2FMUA 3AXSA 4AF7A 3B89A 2IWHA 4LJYA 3OCZA 6REQA 2QQ0A 1WHTA 1LJUA 1SB9A 1K8XB 3LX6A 4F3KA 2EARA 1NF2A 3ZXSA 5EG5A 1SOMA 1U7WA 3LUGA 2PMEA 3VGPA 1ZZEA 1JG6A 4HB0A 4AMGA 3FKQA 1K7XB 3C45A 4I50A 3KWMA 5J2TB 3LE8A 2EKQA 3A4VA 4JUDX 4NWIA 5C0OE 5JZVA 4W5NA 3UAYA 2AB0A 2J6BA 2RGUA 3HBLA 2AKEA 2AZTA 1RR6A 3WJ2A 3LPMA 1G21E 2WICA 4OHBA 2GUWA 3KXKA 1ILEA 1P61B 2OSBA 3NQ41 3ZBUA 3V5NA 2A59A 4F72A 3WLNA 2Z8YM 1V43A 2QBYA 1NVTA 2BKVA 4E3WA 2WJJA 3OUZA 4BX8A 5EJ2A 1J0BA 2Q1YA 2GPWA 4BTVA 4CETA 1CR4A 3DBLB 3D7MA 4BNTA 2ZZKA 4BX3A 4JYZA 2O2YA 1RWOA 3FFBA 2FG6C 3S0JA 3LW8A 4UUPA 5IT5A 5JHGB 3LDAA 2X8JA 1ZH8A 2ZWIA 3OLWA 3KYCA 4BV9A 5LSAA 1Z0KA 3SR0A 2FE1A 2PL3A 2OVFA 2QL9A 1RMYA 2VRNA 2FQYA 3FZQA 3LT2A 4EPRA 3CEJA 2ZDQA 1V3UA 2MSNA 4Q39A 3CKLA 1C1XA 2FQWA 4GBED 4DWVA 2HA0A 2WWHA 2GAAA 4DFDA 4U2BA 4OI4A 3GNQA 3G6KA 1NF3A 3U9LA 4IYJA 3AG6A 2GOYA 4R9NA 1FYWA 3WNZA 4ND3A 4ZI2A 1KEUA 2CNOA 5HOEA 3SZGA 5A05A 2PGOA 3E84A 3U3OA 3FCYA 3LZ6A 1UANA 3GZNA 2VK1A 4O4HF 5KTOA 1M8PA 3MC1A 4IRUB 4U0JA 1RFLA 1P18A 2J9ZB 4HLQB 3I83A 4MVJI 1EP1B 4RL6A 3QKUA 4QSMA 4XUCA 4GYJA 4B7UA 3UH1A 4G0NA 1GGHA 4U7JA 1E0DA 5I8WA 2VDUE 2UUCB 1PEAA 5LPNA 4R1LA 3EDRA 4TLLB 4RMGA 1SIWA 2C42A 1DRUA 2ZIWB 2AYYA 3ABOB 1RI2A 2BFFB 4YMGA 1J5EB 1ZEMA 4A0SA 4I3FA 3I2HA 4G85A 5DF1A 3WOHA 2HMTA 3GA5A 4LYDA 3CBGA 4YNBA 2J9XB 6ABPA 5KOJA 4PRLA 1KYVA 1P0FA 1W0JA 3R3HA 4F46A 4HADA 3UXMA 5KSWB 3H5WA 5DJ5A 2ZJYA 1VPWA 2XJ4A 3IP5A 3IP3A 3Q0TA 2H7YA 2QRQA 1L7AA 1OYYA 2NIPA 2R6FA 2Z95A 3HXTA 4V24A 4ZCLA 4BLTA 4QFMA 4L8VA 2RHCA 4PC3A 1EP3B 3WGYA 2G25A 2O7SA 3L9WA 5JMWA 3KT8A 2C8KA 5AKGA 3SHQA 3CPEA 3TW8A 2WU8A 1ZD5A 5HKOA 4HDKB 3KYDA 5L53A 1R0KA 1JDNA 2OP1A 3OIDA 3ZV5A 4A92A 1B76A 1X7YA 3UN1A 1CIJA 3UWKA 4FQ5A 1MD9A 1M1YB 3AL3A 3BWBA 1Z39A 3QELA 1RJDA 3BMXA 2BDTA 3OESA 4YT2A 3COYA 4OGWA 3EDMA 4EGFA 2JKVA 5MN5A 1MO2A 1KQOA 4CMIA 1A9SA 1QYDA 2ERYA 2WZDA 2B6HA 1DG3A 1NMXA 4GZMA 1RSZA 2R2GA 3PC3A 4EDFA 3C3MA 4GLFA 2C77A 5LD2C 4Q3LA 2WUFA 4DPMA 2AG6A 3KBBA 3KTAB 1P9RA 4F4HA 7YASA 3OEEA 1V3TA 4U2CA 1PGOA 3Q3JB 4ND8B 1E92A 4D81A 5CDSA 2TSYB 5EJ7A 3TH5A 4C05A 1IONA 1J0AA 2EFEB 3NBZC 4O2AA 1Q74A 4W8HA 5H02A 5H68A 5E2BA 1U2ZA 3K8QA 2VDJA 2W7TA 1HTBA 1SMKA 1IFXA 2KYRA 1QH8A 3QSYA 3HA5A 4FKBA 3HDVA 3BEOA 5KTRA 1ZI6A 1PJAA 3MMPA 3EB9A 1X7GA 1XDSA 3UXHA 3W7BA 2WT9A 3IKTA 3KB1A 4LK2A 2O8FB 4LSZA 2QJTA 4OM7A 3R75A 4LDZA 4KK3A 1XJWA 2XGGA 2IBSA 3FN4A 3LRTA 3AQIA 4OATA 4S1NA 1T9KA 3FH0A 3PNVA 5FAXA 4HQNA 4KLCA 5ALPA 4Y1EA 3CRW1 3E61A 1QFYA 4QDZA 3TNDA 2FPKA 3U61B 1B00A 2YYYA 3VKUA 3U19A 3GGGA 3B1YA 5EA2A 3UOWA 2YYZA 3P9PA 4AD8A 3BMCB 5J4YA 2DRIA 4C0JA 2J9RA 5FOUA 1Q0QA 3KOUA 1ONNA 1SC3A 2CL6X 3BE5A 3E8MA 4RADA 5KNDA 2J9YB 1KH2A 1IBKB 4UM5A 3JRWA 2H08A 3ZCSA 5IAJA 3KJFA 1NLMA 2YDXA 1S1CA 5F35A 4W5TA 4RHEA 2XX3A 1GZ4A 3I0MA 4MLPA 4D4JA 2R6R1 5A6VA 1ZX1A 1D1TA 3C3EA 1X86B 2H52A 1VLHA 2ANBA 4DBLE 2P0YA 4WY8A 4I08A 3ZXXA 3F6PA 5J2UB 4J0QA 1KVSA 4L5AA 3R0ZA 4X8OA 3D9QX 4JT8A 2Y3IA 3C7CB 1DADA 2JC3A 3KDPA 1PGPA 3IV9A 4FWBA 4C0HA 1CY1A 1FFGA 1C0EA 3BGWA 3WL4A 1NBOA 1K0FA 1B6RA 1NW5A 3FUTA 3JTMA 4XFJA 2VCHA 1Y8ZA 1O8CA 4L9RA 5K09A 1J70A 4UTRA 4V0LA 1NQUA 4PIPA 3V7FA 3ZGZA 4ZEXA 3H05A 1F5NA 4NJEA 3TOZA 3MLAA 1Q50A 1VI5A 1FRZA 1QHXA 2NZUG 2J3KA 4KV7A 3PEEA 1SEVA 3FVTA 3EC1A 1N3YA 2VPTA 5IJXA 5BV7A 3BHNA 4J3NA 3B3FA 4BBPA 2OR3A 1RI4A 3EMKA 2ATEA 1RPZA 4JC8A 1U0SY 3OZDA 4P0PB 1BD4A 1SXIA 1YFKA 1VL2A 2N47A 4HH0A 2J0VA 3TKLA 4DLWA 1KORA 4ZJZA 5JRZA 5LP6B 2JFVA 3QE3A 3F3YA 2WVJA 1R15A 4RYLA 1N9GB 1V71A 3K6JA 1QE3A 1XDBA 4GGPA 4MI3A 4IO0A 4X60A 2HK9A 5J40A 2QI9C 1L7MA 4EQ6A 5LLSA 3S2YA 3B48A 4F8JA 6ADHA 3V8VA 1NNLA 3IIKA 4FHZA 3V32A 3B7GA 3K53A 4MGIR 5PGMA 3HXLA 5K0FA 4KNWA 4JXKA 1QTNA 5HILA 4J9VA 2QRVB 3BWCA 3P5SA 1L5QA 4G5RA 1OTYA 1E6UA 2I2AA 2W93A 4Z0HO 4ZMRA 2F4VB 5JWHA 1AIPA 3T3NA 1TKRA 3BMOB 2QTAA 3AFMA 2UZ0A 4NDNE 4TZKA 5JJBA 3SS9X 4N0PA 3KQOA 3HDTA 2PYZA 4L5IA 5GV7A 4EW2A 1G4HA 2W71A 4I9NA 4X3CA 1XZGA 2V45A 3MMNA 3L79A 3OC6A 3OQMA 1IZ9A 1E9BA 3SIXA 4OREX 3AKZA 3TBHA 4GE0A 3KXPA 3OQ1A 2EOAA 2ZS8A 3DBRB 4M49A 4P34A 4QDXA 1AZTA 4GSYA 3ABQB 1LBSA 1R4AA 4RGVA 2HREA 3FMGA 4JGGA 3EEOA 2QRPA 4D8XA 3I39X 1XDWA 2JGAA 1O77A 3PJEA 1PG2A 1VZ3A 2OHJA 2PGDA 2FXVA 4KKVA 3ICQB 2C4VA 4I5EA 2XVMA 5KAMA 3TPCA 3THXB 1M75A 3OQJA 4PSCA 4CG2A 2XT9A 2B5WA 2BFEB 4PINA 5FCDA 3D4LA 1WDWB 5KREA 3D3JA 4Q9AA 4ZP1A 4CMKA 3OX1A 4RW0A 1RWQA 3X1MA 4UVDA 2ZR7A 3L8HA 4NU6A 4YLYA 1L7NA 1U0FA 1WQ4A 1F38A 1WB9A 4LF5B 4HDNA 1HXHA 1A5AB 1E2DA 4X1YB 3U44B 4KGZA 4AWAA 1PK9A 4URVR 4ZHQF 4LZOA 4M55A 3NONA 5JATA 5H82A 2VDWB 3QWHA 5HJEA 2B1JA 5B3KA 1U1DA 2IZZA 5JC1A 1P4HA 2A57A 3VSCA 4BLQA 4LFCB 1DXOA 2EXXA 3O0TA 5CLHA 1S3IA 1DU4A 1X80A 4RIHA 5LUAA 3G0CA 4EGAA 3DEKA 5ALVA 3EUWA 1S2GA 2VQ3A 4MVYA 1PFKA 3UK7A 4IFIA 5CGZA 1RAFA 5K20A 1G64A 3Q7IA 1WETA 1VSQA 2QUAA 3AEUA 4IDDA 1ZM3A 3UMJA 1E1MA 3CF4G 4MRRA 2HADA 4ZDWA 3OOWA 2J0UB 5AP9A 3QE0A 1TX4B 1VA5A 1NJ6A 1KEEB 4ZYUA 3K9NA 2C4UA 2GCEA 4UNPA 1GZ7A 2OV1A 5CLJA 5J4HA 5LQAA 1W85A 3IXQA 1EQAA 3ZHBA 2UAGA 2XB4A 5JY6A 1NN0A 3IELA 2QQ5A 2WJGA 4YCNA 2DQSA 3EAQA 1UP4A 4AZ0B 2CHQA 2HXGA 3S7TA 1WXQA 3FYUC 2VUUA 3IMKA 3QEAZ 3KD3A 3GZTB 4A6XA 1MLDA 3WRVA 1IOZA 1XR3A 4AN4A 1E1YA 3C1TA 5DBOA 2VDLB 1QQ7A 4IGFA 4FIZA 1NVVQ 1RPTA 1W4LA 3DOHA 3LF2A 4WK0B 1UC9A 4XD2A 3X43A 3ZDYB 4Z8YA 3M49A 2H4ZA 4D3SA 1O7JA 1DWPA 1YC2A 2BKAA 3K5PA 4H7IA 4WXRA 3CKKA 5EERA 5FR1A 5JLJA 4L9SA 4TUYA 4GM0A 3KBOA 5G40A 4YXWA 5LOVB 3LGXA 5LZ4A 1MORA 5J5VA 1LRKA 3AM3A 1XPOA 1KJ8A 4HXEB 4ES6A 1C7RA 1MIOB 4PGGA 4WN9A 2OD2A 2C4NA 1KJQA 3GEMA 3HJGA 4GVPA 4E30A 4FJ2A 4KRYA 4A73A 1ZUWA 4FFVA 3J80A 4BATA 4OI1A 3CVVA 4ZJUA 3BZBA 3I3OA 2ZIXA 3MINB 4NCHA 1L1QA 2XD4A 3PG5A 3RANA 3X3HA 1N32B 5CXUA 2ZJ4A 2ZXEA 3SKVA 1I4WA 1IYZA 1TXGA 3S1AB 2PXCA 2OPBA 2XKAA 3BJIC 3FLAA 4KXLA 1A9PA 2CE7A 2G8LA 4I5IA 3B36A 5TR9A 1N1MA 2QJOA 3F0TA 3F7OA 4OX9B 1N2XA 2PUCA 2RAPA 4WCDA 4K9DA 3H19A 2AG8A 2BLNA 3HM2A 3QJGA 3OZUA 1AOXA 1JEAA 2Z8ZA 4ODIA 2ZTVA 3Q9SA 3F8WA 3IBFA 1RDFA 4A6EA 4FMCF 4IWNA 1VBFA 4ERXA 5CBKA 2AV6A 3Q5DA 4YRGA 5JS1A 1QX3A 4MITA 2VC2B 3ZW7A 5IMSA 2LBPA 1NMZA 4DA6A 2JFWA 4GH5A 3NTQA 2I4MA 5IFLA 2X6RA 4WNAB 3IPCA 3W2IA 4KRXA 3P94A 3SF0A 2QPAA 1SZJG 1RJEA 3GDFA 3IDAA 1WW3A 4PN3A 1TZKA 4KQ2A 4B48A 4WBNA 2EF1A 1T36A 3PHGA 4RPKA 3KQMA 4CEHB 3QG5A 3CXRA 3UWSA 4EVRA 1HY3A 1O89A 2CCJA 4TL9A 4D41A 2MYTA 4CKBA 1KI7A 1BRMA 1UEIA 3D4NA 2O54A 4DNFA 1RRGA 3L7CA 3SPXA 4G6ZA 1C2TA 4UVGA 5FFNA 2WWIA 5TEVA 5IDWA 1KQGA 2BHTA 3EGOA 1OYOA 1MC1A 3RS8A 4WA7A 3CT4A 3QA3E 3TE6A 5FWAA 3NM5A 3KVYA 2RGNC 3JQQA 5CIWA 2ZWOA 5ILQA 1CQZA 1C3VA 3NH9A 2DUNA 1PZNA 2J9GA 2OZEA 3HCAA 5JMTA 4GMXA 3CUEF 4X7BA 1CETA 1L5YA 1TPZA 2ID8A 2HHHB 3DB1A 5K0NA 1AS3A 1D2EA 5EJ5A 3OG9A 4OQLA 4B5LA 1PS8A 5KTYA 2FPIA 1UJ2A 3NASA 2NZXA 1ZSYA 1T3LA 4J4HA 3B7PA 3P4UA 4TWBA 2GEFA 3Q7SA 5BOVA 3RUIA 3KPUA 4JBYA 1O97C 1W9MA 1JPJA 5F51A 4GDFA 3DE6X 3NBMA 5IJWA 2NSDA 1XA4A 2AEJA 1OLUA 2AR7A 2NO7A 2AN5A 2NTJA 3DGFC 4PLWA 1TM4E 2B4YA 2CSUA 2XCLA 2XLBA 5JVDA 3K2EA 4XPIB 3W9BA 1FSSA 3RJZA 1ISIA 3RC1A 3IAS6 1DKQA 2BBOA 5FUWA 5FYQA 2CFCA 4E2YA 2ZIZA 4NCKA 2NO0A 4IG9A 3BXXA 1KZHA 1DC5A 4P5DA 5KJFA 4WK6A 1R6XA 1QWOA 3KQSA 3COPA 3OZBA 2O5RA 3PRKE 5F78A 5LB4A 3ROPA 4COKA 5EJ9A 5K6AA 3C74A 4M7WA 3AF3A 4B3MB 1J99A 2QMQA 2RHTA 3F6RA 3G9QA 3HKCA 3PJFA 3SNHA 5HRUA 3CVWA 1MXHA 1RP7A 1XZAA 2A84A 2D3WA 2QNIA 2NZYA 2JFXA 2BEVB 3LKBA 4KXYA 3D6UA 4NOJA 4LN1A 5LDGA 3W5JA 3W5HA 4UDXX 4MYHA 4GOOD 2D74A 3I9NA 5BQOA 1JFTA 2IXFA 4XDZA 5D00A 1C7ZA 1XZHA 2F9MA 1X7ZA 5GIOE 5FUBA 2XBLA 1X15A 1WRBA 3B1WA 2D54A 1UDXA 2JATA 5G4LA 2XDQB 2TMDA 3HEMA 5J9FA 2VCEA 1ZP6A 2W6ZA 2ZPTX 3IKLA 4B3FX 3W8DA 3BD6A 2YJZA 2ZYHA 1HDOA 2NU7A 1MJFA 1N5DA 2WYOA 2WPDD 3NVAA 4MQEB 1PJCA 5DBFA 3V2GA 2PZLA 4GMHA 5THKA 1KEKA 1M1UA 4I8IA 2DECA 4CR6A 4UHJA 1FFDA 4YMLA 2Q4OA 4NCJA 1NXQA 2ZREA 3CCCA 4A8TA 3V3TA 4BIMA 1ZVQA 2WIGA 3ICPA 1UXKA 4HYEA 4X8HA 1CJSA 5K45A 1XA3A 2YZKA 1EU1A 3EXFB 3R2JA 1Y81A 4H35A 1DC7A 3BE4A 5M3BA 2NQTA 3RWOA 1T0HB 5J5CA 3WA6A 4KR6A 3FGPA 2FF5A 3LUCA 3V8MA 3F6BX 3BBPA 4AQYB 1S96A 1Z29A 5ALUA 3BGIA 4BE9A 3TE7A 4KNYA 2Q0HA 4HJRA 4OP1A 4H7EA 2CXPA 4Q03A 1I4TD 1W8IA 3FTDA 3ODGA 2FEXA 4D44A 4LY6A 1M1NA 4KLNA 1K3TA 4HAYA 1LCIA 1MX3A 2M9MA 2YASA 3F78A 4M0UA 2Q50A 1US8A 4CMEA 3EQ8A 5I3ZA 2CNBA 4DM7A 3M6LA 3I1YA 2BLLA 3ED1A 3A6EA 3HU5A 4OTZA 4EEXA 3IS3A 1T9GS 4FP9A 1LDMA 3C3PA 3CLSC 4LOJA 1P1JA 4CCYA 2I78A 1F1JA 2VYFA 4BDSA 5ULLA 2HPHA 3WKDA 1QJ4A 1NF9A 1NJ1A 4QHTA 4KSCA 5FTNA 1DLJA 1NW6A 1Y7IA 5HCIA 5LMCA 3RS4A 3CW2A 2JLWA 3RDPA 1C3XA 4QUJA 1PLKA 2HDNB 1RC1A 1VKZA 3I1IA 4DA8A 3ICEA 2GTPA 1SVWA 2UZ1B 5BURA 2DQYA 3R7WB 3T34A 4F71A 1QC5B 1IN4A 2QJRA 3DZGA 5FI0B 3ND6A 3TVYA 3DO5A 5DHAA 4YJFB 2DPMA 2OK7A 1DBVO 5HM8A 1SKQA 1DARA 4ENVA 4WZZA 2VUSA 3HVIA 5AJWA 3Q7QA 3L8ZA 1U0TA 4QVIA 1GADO 1N6RA 2PKYX 1GL9B 4PZ9A 5ADUS 3V9PA 4BU0A 2G7MC 1RM0A 2PRZA 1GCGA 1Y3DE 2MR5A 4QJ4A 3UICA 3W4JA 1E1DA 3WBJA 3D1JA 4KG7A 3KM0A 5KQSA 3WWYA 4NNOA 1EESA 2IUYA 1GLVA 2X5JO 4I4CA 2HPVA 5AR1A 3ETCA 2HAEA 4RZQA 3QXXA 1TT7A 3R24A 4OU4A 2EWWA 3UAWA 3DP9A 1C1HA 1ZS9A 2Q49A 3Q12A 1D8TA 2PMDA 4Q0MA 4UU8A 1ZH2A 1UBEA 3D5EA 1HZZA 3A31A 4JT2A 4C4ZA 1L5HA 4X97A 4N8DA 4D5GA 5K6AC 1FRVA 2DQZA 5CW2A 3ONEA 3QNWA 1P4AA 2IP4A 3FNQA 1KJJA 4RIEA 3O8CA 3ZD6A 4HCJA 2VCYA 2D6FA 1AS2A 2XMQA 4HWSA 3LBFA 5L95A 1Q91A 2PSDA 3CUVA 4J43A 2PZAA 4QLOA 1JHMA 1MR3F 4FOPA 3OE4A 4N3NA 4RKYA 4CHGA 2PT5A 2J07A 3ETHA 4R6XA 1PZXA 3RARA 1YR2A 3BRQA 5BNIA 2EP7A 1DJMA 4H59A 3PNSA 3QPWA 3SHFA 2QOEA 1U7PA 1VBNA 4WZBE 2RJNA 2WYWA 1A98A 1QHEA 3U4MA 4LX8A 4YJ2B 2AFHE 2E3JA 2XE8A 1AQNA 3C5WP 3H4TA 2WJ3A 3L49A 4DSNA 1YBVA 2CXRA 3IPLA 2A92A 3U6BA 4ILEA 2PLNA 1AK9A 2BRUA 1E3DA 1Z6PA 1WSDA 4R2XA 4ZVSA 4DIOA 1KZ4A 3WFIA 1DC8A 1W88A 2G80A 5JFTA 1KO7A 3P27A 4CTJA 4HB2A 4PBTA 5IKPA 1J49A 2NU9B 4D4KA 3UTDA 4H7JA 3ZDCA 4LECA 3HPRA 3WFZA 2Q5IA 2BGTA 3G2JA 2AN4A 3E9CA 5HBRA 1GARA 2AJTA 4ZI3A 5CH8A 3O3CA 4AZ3A 2ZULA 3B1KA 2ZB4A 1T6YA 3PX2A 3HFRA 4K6CA 4MCIA 3SYMA 4B33A 2KQUA 2QQEA 2WMDA 4ZHSA 3PJDA 1E2HA 1N2CA 3V3KA 4HQOA 2G6TA 3EEFA 1XF1A 4R2LA 4JJ4A 4MCHA 2IXGA 4QOHA 5C8YA 3VSDA 3IV7A 3NOOA 4YB8A 4EJFA 3V4LA 4ITUA 5IH7A 4ATNA 4NC9A 4UZEA 5H0IA 1A0OA 3G5TA 4URFA 5GJCA 1GD1O 2IEGA 3F46A 4LCJA 2JAPA 4CMEC 1TLLA 9MHTA 2B2NA 5ABPA 3CG0A 5L4NA 1U8CB 3EGIA 4W5WA 1VL6A 2ZJ3A 1I30A 4JYMA 4YJGA 1B8NA 1VE3A 3QEOA 2FGJA 3OEHD 3WGGA 2QHXA 4FTWA 1AZSC 1UADA 2OE2A 4CQMB 2XXAA 2VXBA 3ZZ0A 1ZOSA 2YXNA 4RTOA 3O1JC 3MTGA 3L0SA 4PN7A 1IHYA 3LUJA 1CUZA 2A7XA 1O95A 3BBLA 3MT9A 2VZ8A 3DT6A 1OZ0A 3NP9A 2VATA 5HQ3A 3ECSA 5IXJA 1P0CA 4C7KA 2JLRA 3SXPA 3VC1A 1Z5PA 4CKEA 1E5QA 3DMRA 3GOQA 3TOXA 3DZIA 4LX0A 2SCUA 3AONB 1TLTA 2IHJA 4P83A 4O4IB 4K8OA 4BO1A 3PGMA 4TMTA 1J07A 4WKBA 2REOA 3OM8A 4Y2RA 1ADGA 5CXSA 4F4FA 2GA9A 3LMKA 4FEGA 5ITZA 3HKBA 1LA2A 1GHTA 4P4SA 4QXMA 4TN5A 1SC1A 4JNCA 3Q5EA 4MR7B 4QRHA 3UHFA 4MEBA 1HEIA 1KRWA 4CV2A 1V8PA 2NYVA 2V6IA 3Q2OA 3T99A 3THWA 1LNQA 4L02A 4CMHA 3KZNA 5EJ8A 4LDQA 2AG0A 1PWZA 1UWVA 2DULA 2I3AA 3QVGA 4G1EB 4R7TA 3RWBA 3V8QA 1NVEA 1TF7A 1YSCA 1YDFA 4C2BA 5IABA 2RGCA 3SEZA 5FLXA 4PWYA 1OSNA 5K0TA 4O8CA 5BNZA 1ZR4A 2Q5LA 2O9JA 3GRRA 3KIPA 1W5TA 4L5JA 1G8MA 1Z5GA 2GFHA 1LF5A 4XCVA 4QIHA 5DYNA 2XVYA 4GM4A 3W6PA 4A36A 2X9VA 3N59A 3QW2A 4ARZA 1OBFO 5DISB 5EQTA 4EI7A 4BNKA 1KO8A 2ZGVA 5HG0A 3U17A 4CM4B 4GWKA 4EJ2A 1RBQA 1DEOA 2VBIA 2YVLA 1HZZC 2CXSA 2NTVA 4EA7A 3R76A 3NTUA 2ZRJA 3GLIE 1RRMA 5ICSA 1W46A 2JGDA 2HRQA 3E9RA 4HNAA 1Z0SA 4DKJA 1ARZA 4AAYA 1PT9A 3DMNA 3QBTA 1LEHA 1D5WA 4J4TA 2POQX 3RSHA 4F6CA 2OB1A 2UDPA 3UFBA 3VPCA 2V5UA 4I5GA 1XBTA 3L46A 4DR2B 2R47A 3DJFA 3FBGA 3LPDA 2PKQP 3W8NA 1JALA 3I5XA 1QCCA 2HFKA 2FY8A 4HFMA 4RA6A 2HLPA 4I4TB 4XUGB 1NASA 2FWIA 2WU1A 2FEMA 3UG7A 5CFOA 4GDMA 3WSVA 2HN9A 3ID6C 3ITDA 1PV2A 4OMUA 3PUVA 4ZCQA 1P1FA 1ISRA 5JQGF 2VPQA 5JMPA 4MW4A 1U7OA 2I87A 5BT8A 2BRUC 8OHMA 4DM4A 5DLPA 1I33A 2C8LA 1EE9A 4FONA 3LG2A 4M0MA 2Q27A 3U0BA 2XH8A 1LH0A 3OHSX 3OIWA 2ZRFA 5CTJA 4D9FA 4CFSA 5HVNA 1R9GA 3N2KA 1QG4A 3KK0A 3EAFA 4A03A 2AUMA 2OO5C 3CQ9A 3N2IA 2OBXA 3NU1A 1KMMA 2RK4A 4MUEA 4TTVA 3ZE0B 4F56A 2ASVA 3W5CA 1BMFD 3DC2A 1OVMA 4BV3A 3N6VA 3TO5A 5HCUA 2A5DA 4K1LA 4DAOA 1G42A 4UD2A 3IVGA 5JMOA 4YMIA 1KSGA 4K9MA 1RLJA 3LFHA 9ABPA 1NUTA 1O57A 2YW9A 3FHOA 1X0XA 4JXXA 3R6LA 4KYUA 1AHNA 2PJUA 2ZXFA 3PHCA 1TK9A 3DZFA 3ZTTA 2JLZA 4C30A 5JI2E 1NBWB 1UBRS 2GRUA 2C9MA 4N41A 3IDOA 1GRCA 1Z2CA 4JA2A 3SZRA 5KU7A 1P1HA 1VLLA 2QTTA 2V65A 5D01A 3STYA 1ZVMA 2XCUA 5TGZA 3T15A 1Z07A 4FU0A 3ZOKA 5EWJA 2ZWVA 4TL6A 1TUIA 3K5WA 5F1KA 1HDIA 1OFUA 4X61A 5BUQA 4UFPA 4GR5A 1SWWA 1D2AA 3PB3A 4MQUA 2QTNA 3AHJA 2FJ0A 4RMIA 5FTWA 1ONSA 3LW7A 4YQZA 4EDHA 1H69A 4RZSA 3LFTA 3EK2A 2IEZA 4BMPB 1U8TA 1B41A 1CUSA 2PVPA 3WIBA 1O95C 3IESA 2FYTA 2EEZA 2QRZA 2QVGA 3E9QA 3QMMA 1EJ0A 2GJ4A 4KPUA 5AM3A 2XF2A 4LWOA 1QHFA 2UXCB 3MMXA 3VNAA 3OAAA 4RHXA 1AV7A 2FP3A 3QEKA 3Q8KA 1KZ7B 1NVKA 3DV2A 4HKTA 1A3CA 4RVHA 3T9FA 1J33A 2IHBA 3G5AA 3WWOA 4BAGA 4YCLA 3GGCA 2WNHA 4FFLA 4ZVOA 4EB6A 1V16A 4BUCA 2JKZA 4FR5A 5BMVB 3PFKA 1GU7A 4CM8B 1FNDA 2GBLA 2HJGA 2NPOA 2WF9A 2AMYA 3QKRA 1SB8A 4DYVA 1Q0PA 1JIUA 1ADBA 2XRMA 4A5OA 1CQPA 2ZWPA 5DM2A 4AFNA 3MF4A 5B5SA 4KQEA 1U8FO 3LBYA 2PUHA 1I6MA 2F90A 2H0QA 2H51A 2YVQA 4HYQA 2WM9B 4ML3A 1TPYA 1Q92A 2HUNA 2ONJA 5B7NA 3TRKA 3HRKA 3BULA 4ER5A 1MFPA 5H83A 5LXTF 4R8VA 2WHYA 4INPA 1AUVA 3COVA 3H9JA 1UXGA 3LNTA 4AF6A 3KT0A 1GZSA 2HIAA 4K6KA 1VE5A 1OXTA 4P2GA 4XDHA 3S29A 4KQCA 5IXYA 4BNHA 4MV0A 1EVQA 2AGVA 5CLQA 2C7PA 2IQIA 2WIDA 3PYXA 4XLZA 4I66A 2HXSA 1NE7A 2EDCA 3D3WB 4V0ME 3RGGA 4HDOB 4K0RA 4OHVA 3ZDFA 4CLRB 2ERCA 1XEWY 4QDJA 2Z9DA 5IK2A 3GLFE 4CLEA 1FDIA 2I0FA 1NUUA 3H2KA 2QN8A 1FS5A 1YQTA 3ZQ4A 4QKQA 3ZHCA 5K6RA 2NG1A 4M9SA 3ZWKA 5KTTA 3KQNA 2B5VA 1Z8FA 3TPFA 3ZY6A 4IHJB 2BD0A 4PO3X 5KQGA 3AI1A 3MRVA 1M0TA 3NV9A 3OCWA 4LXXA 3PX3A 4W8GA 3BXEA 3X44A 3VZCA 5TQ2A 2VJYA 5JANA 4E5PA 2ZRLA 4NQZA 3URMA 1VPDA 3G9ZA 4UATA 1SKMA 2V9CA 3PU6A 1N5IA 4KN9S 1JWAB 3LECA 2HM7A 2XJ9A 1B93A 2VBGA 3K5IA 4JLNA 3DF9A 3SYTA 3IP9A 1FMJA 3NT2A 3TK1A 1WDLA 3KJZA 3O47A 4XSHA 1BYUA 2XMCA 4WVFA 1BDMA 4O63O 3R1IA 1X7XB 3OLQA 5G0TA 2ZYRA 3UMBA 4ZT2A 5I9LA 3D64A 5K2MA 1HM5A 3E81A 3ESRA 3VU9B 2YHBA 3VO9A 2CVOA 3GNSA 1MX5A 2ZATA 3BHJA 5LLTA 2F8LA 1CERA 4G56A 4LZLA 2K2QB 4CZ2A 2XOXA 4ZZ2A 4ZQEA 3KJHA 5LDDC 3DKRA 3FSEA 3O83A 2HHLA 4IG4A 3OJWA 3LLUA 4RACA 5EJEA 3ZXUB 1WXWA 3T5DA 2XSZD 2FN7A 4MUBA 4IR7A 3ZN2A 2JFNA 3ICCA 4EJ6A 3CVYA 4P3KA 3AR8A 2J6HA 4QT4A 3KUDA 5DM60 4D57A 2HWXA 4F2PA 5IBRA 2JEZA 3X2SA 4X66B 1U3DA 5HUHA 4UM9D 1X6VA 2QD4A 1U81A 3EA0A 1AXRA 3ND5A 4JBWA 2P3LA 1C29B 4ZKDA 3E3MA 2QMHA 3GH3A 4L8LA 4RC9A 3V8RA 3L18A 4HV4A 1WG8A 2OZKA 1S8OA 2B98A 3BCUA 5MFPA 1LQ2A 1Y8RB 3RQSA 3E3OA 4BOYA 2OSVA 4D74A 1M33A 3DHWC 4L16A 1CNFA 3A6ZA 3L7YA 3M1IA 5K8CA 1NW7A 4NCAA 3VYRB 3T7SA 2DC1A 3EOZA 3KXDA 1U4OA 3D8NA 3K2BA 3UUEA 1S7GA 3BK2A 3MWDB 1Z6QA 3L02A 3FDXA 4QC2A 3N74A 4NMMA 2PUJA 4O4HA 1ZSNA 5TGTA 1U9JA 3ZLVA 4BX9A 2E4UA 4OX9Y 1UKEA 2PTHA 4M6WA 1UK7A 3UJ8A 2IOFA 2ZIVB 4HMQA 3X0DA 1E2IA 2G0NA 1N6KA 1M6HA 3A32A 1G38A 1K4YA 2GBLC 3H84A 4FYKA 2AUTA 3CUWA 1G3RA 2Y6VA 4YN3A 1FU8A 5HS4A 5L4LA 2PEZA 4BVBA 3DDHA 1CFJA 1JYSA 2W00A 4BNIA 3L82B 4NS1A 2HBRA 4BMDA 3B60A 3EAGA 3LPLA 4K9RA 2PNJA 1KFKB 1Z13A 4JFAA 1WXIA 1DJQA 1GQSA 3MBIA 3MJFA 4G5QA 1YWGO 1DKRA 4Q4JA 2EYUA 5K0LA 3EX7C 3PQDA 3SQNA 4Q5IA 1MTZA 2Q29A 3TEJA 3CO0S 2CB9A 1VECA 5CVTA 4TKVB 2IHKA 2L17A 1Y6QA 2B4AA 5HTKA 4IFBA 2POCA 1BHJA 3LT5A 3L0OA 1U28A 1NV9A 2VDVE 3VO2A 1DC3A 1XRNA 1AY0A 1ZPDA 2CLIB 4IIXA 1J42A 1GAJA 2RBEA 4YV0A 3U7GA 1H05A 1RYDA 2REXB 4PGFA 3V7NA 4Y2QA 4DILA 2QT9A 4N6GA 1G21A 4X6YA 2NX2A 2Q3HA 2RI6A 2AXEA 4E5DA 6NULA 1EFAA 3RB8A 1R4MA 1S6YA 4Q47A 1QGUB 4C7VA 1JHRA 1HT1E 4DPLA 4QM6A 4PQGA 2J0QA 4G5YA 3UB3A 3K6SA 1T24A 2W6JA 1YRWA 2I7DA 3GNTA 3MTJA 5AW3A 4GZ6A 1VSVA 4EVIA 2CJWB 1H3NA 3V1LA 4HPJB 4FT4A 4M88A 5K0EA 1WDMA 4IFTA 1YXMA 1C7FA 3AOEA 3AERA 4AYXA 2EBUA 3LXRA 1RIIA 1MJGA 3FB4A 1ORDA 2VHTA 3MIIA 1U1EA 1EK6A 1Y6JA 3EVFA 5AHRA 5EXSA 4ZU6X 3VYTB 4KX3A 2NAFA 1SKYB 2NSYA 1V4VA 1OLXA 3BXHA 3DZHA 3LBHA 2QU8A 3IE2A 2I1LA 1ISHA 1QIJA 3T41A 4LNUA 2D1TA 3GRVA 3ESQA 3T5AA 5JRJA 3C16C 4W7SA 3VDMA 5FUMA 2PK3A 2Z09A 3HKEB 4MLDA 5KQLA 2RGGA 3RIGA 1HOXA 1M73E 4B8YA 4CL2A 4UBNA 3UPDA 2L0XA 4Y7DA 1WZEA 5AW7A 1I3KA 4G1MB 3U5ZB 5H8WA 1FQOA 3P2OA 1T8TA 3PNPA 2IU4A 2Y71A 3D7NA 2VF4X 2C96A 2O6LA 3KJIA 4MHOA 1P4JA 1TC2A 4XIGS 3UHOA 4CCWA 1I9GA 2QJWA 1XVVA 5H3LA 1TAUA 5LUBA 5K0JA 4U7GA 1ZHOA 3IAS1 2HSDA 4QBHA 5EZYF 4B44A 3QPVA 2R97A 1N75A 3TINA 1EFPB 3T52A 4PY2A 3PUZA 3CF4A 2EKBA 5T4EA 3WHPA 1OA0A 2L42A 1FU7A 1EHIA