1HYEA

Crystal structure of the mj0490 gene product, the family of lactate/malate dehydrogenase, dimeric structure
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
307
Chain Sequence
b'MKVTIIGASGRVGSATALLLAKEPFMKDLVLIGREHSINKLEGLREDIYDALAGTRSDANIYVESDENLRIIDESDVVIITSGVPRKEGMSRMDLAKTNAKIVGKYAKKIAEICDTKIFVITNPVDVMTYKALVDSKFERNQVFGLGTHLDSLRFKVAIAKFFGVHIDEVRTRIIGEHGDSMVPLLSATSIGGIPIQKFERFKELPIDEIIEDVKTKGEQIIRFGPAAAILNVVRCIVNNEKRLLTLSAYVDGEFDGIRDVCIGVPVKIGRDGIEEVVSIELDKDEIIAFRKSAEIIKKYCEEVKNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE/MALATE DEHYDROGENASE
publication title Crystal structure of the MJ0490 gene product of the hyperthermophilic archaebacterium Methanococcus jannaschii, a novel member of the lactate/malate family of dehydrogenases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Oxidoreductase
total genus 106
structure length 307
sequence length 313
ec nomenclature ec 1.1.1.375: L-2-hydroxycarboxylate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1hyeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1hyeA02
3DTTA 4U6QA 3FR7A 4BO1A 1DLIA 1HSZA 3PP8A 2AG5A 1DRVA 3CSDA 3HDYA 2IE0A 3HFGA 3GN2A 3OM9A 4FPXA 5JMPA 4O63O 1G1AA 2YDXA 1B15A 2D4AA 1IZ9A 1VJ1A 1DIGA 1TEHA 5H81A 1EVZA 4BNVA 2VT3A 2AE2A 3UCXA 5KWEA 3JYPA 1ISMA 4ZRMA 3P2YA 2I66A 3KLPX 4MVJP 4FC6A 1FDVA 1UAYA 2FWMX 2Q2VA 4U7WA 1KEWA 4ZA2A 3AM4A 4G65A 1KIFA 1DIBA 3R0IA 4PLYA 5F1PA 3RFVA 2ZIZA 3L9XA 3OSUA 1XR3A 4JIGA 4U6SA 3QV1A 4AJJA 4OM8A 3ZU2A 1LEHA 4WLFA 1LDBA 4U8GA 3MWDB 3VH3A 2UAGA 3G1UA 3HZZA 1ULUA 1NQTA 3AOGA 1BXGB 3NTQA 5CPBA 4L76A 3OJEA 5L45A 2J3IA 3OA2A 2YFQA 1A7AA 4YCAA 3RCBA 4EI2A 1LDEA 5JDIC 2NU6A 4URFA 4J7XA 4FR5A 4H15A 3I83A 4S1VA 5ILGA 1E3WB 1VPDA 5G0UA 3HDQA 3G79A 5IN5A 3TNLA 3WQRA 4BMVA 4BNTA 4BGUA 5CDUA 4IZHA 4ZJUA 1LSOA 4YJHB 3ZWBA 3A14A 2IEDA 3KYDB 1UJMA 3Q9NA 3JQGA 2PKQO 1HLPA 3LT1A 3DB2A 4U0KA 1NVTA 3RKUA 4CM4A 1BXZA 3FF4A 1PSDA 3DZHA 2C5EA 3KO8A 1PGOA 2HO5A 1ISFA 3GVPA 3TFOA 2P2SA 2CUKA 4DL9A 4II3A 2PV7A 2NTJA 1HYEA 4BGEA 1YDEA 2HMSA 3JQEA 4XWYA 5TLSA 1NX6A 1GYPA 4FFMA 2G17A 3OQ1A 1NR7A 3VZPA 3MTJA 2X9GA 1HDCA 5U4QA 5KVCA 4B3IA 2X8LA 4YXFA 2WD7B 4WNIA 2W2KB 2FHSA 5IN4A 4F46A 1MFPA 1ISGA 4IM7A 3LQFA 3ZU5A 3LLSA 5EERA 2HRBA 4TZTA 2CY0A 3RD5A 4RJTA 1QR6A 2NACA 1BDBA 1LSSA 2HMVA 3INGA 2BGMA 1MGOA 4IQGA 5G4KB 1VE9A 1NNUA 3SLGA 1O8CA 3TL2A 4DREA 2EWMA 2QX7A 3O8QB 4E4YA 2FRDA 5T5QA 1HT0A 1GDHA 3QWIA 1JN0A 5K9ZA 2JHGA 4BKPA 3WLEA 3JQ9A 4BGIA 5G4LA 3GHYA 3OECA 2B0JA 2CFCA 2X58A 3H9UA 3GOHA 3WLFA 3S55A 4II2A 2X1HA 1MC5A 2WDZA 1NFRA 4XX0A 3DBLB 1TT5B 1XA0A 4B8ZA 1F0YA 3AM5A 3K73O 4RZHA 2QYSA 1LDNA 4WGGA 1LQUA 4JP3A 3FNHA 4R3NA 2Y05A 5A4DA 3G49A 1ZZEA 4ITUA 5I9LA 2AQKA 2C5AA 2DC1A 1UXJA 5DOZA 5JPIA 3RBVA 3JV7A 4J90A 1PS9A 2DFDA 4DLBA 1HE3A 5T67A 4XQEA 2ZB3A 1DHTA 4GX2A 1Q7GA 4BV9A 2J5RA 2QW8A 4AJ4A 2ZK7A 9LDTA 4FJ1A 1GY8A 2UUOA 5JXWA 4BL5A 5TQVA 1Q0HA 3WGIA 2GUGA 4CM9D 4ZICA 2X7HA 4XIJA 3U4IA 3BIOA 4L4RA 3ANNA 1PL7A 3RU9A 1ZK4A 3G17A 1X1TA 1OOEA 2OGUA 4E2WA 5A1TA 4BO0A 2GERA 3NGXA 4FB5A 4TRRA 1ARZA 4CQMD 2QHXA 4IDFA 3V5NA 1GZ6A 3WFIA 1WAMA 1U7HA 4J4BA 4NFHA 1QYWA 1BSVA 2IDZA 1N2SA 1X7GA 1NAHA 3M1LA 5CG1A 5B1YA 1LC3A 1C3VA 2NV6A 4GKVA 2ZYAA 2C7VA 2FZWA 5K0ZA 2YHUA 4CLEA 2OZPA 2VCYA 3GAZA 4CLRA 3AJRA 1O6ZA 1I24A 3NUGA 3DOJA 2NU8A 3M2PA 2RH4A 3GVCA 1D1TA 4PRKA 1B3RA 1SMKA 1ZEJA 4J49A 2AMFA 2EJWA 4LISA 3JQFC 2WSBA 3PJFA 4D7AA 3U09A 4G81A 3UCEA 4HNHA 1K3TA 4LCJA 1A7KA 3CEAA 3ORFA 4QFCA 4BKQA 5A06A 1Z6ZA 4MVJI 1BXGA 4YJFB 3D4OA 5HWSA 3S2GA 3PTZA 1N7GA 1O5IA 3K2EA 2CSUA 4NG5A 1GADO 3GY0A 3KVOA 1PWXA 3NT5A 4PLZA 1YJQA 3WNVA 4RVSA 1I2CA 3CTMA 1E3WA 1ZNQO 3DZFA 5BSFA 1H6DA 4J9UE 4Q39A 2GCGA 4FJ0A 4BO8A 1QP8A 1YL7A 5KJCA 1E7SA 1U3UA 3D0OA 4R16A 2FSSA 1I30A 1R0KA 3FBGA 1KEVA 4K6FA 1VL0A 4CJXA 4XYBA 2C2YA 2VYVD 4BUCA 1XQ6A 1IULA 2B4QA 4ALJA 5A9SB 1SC6A 3PWKA 1T24A 2JL1A 2Q50A 1U1IA 1I3KA 1PJQA 3H5NA 3BMOB 1HE5A 1ID1A 1PU2A 2PWZA 1XIVA 4R9RA 4Y9DA 3UKOA 1YBAA 2D5AA 3SVTA 2AHRA 2WD7A 1SEPA 1CDOA 2LDBA 2W2KA 3KSDO 3ZW9A 1HYHA 1ZKMA 4OAQA 1YJ8A 1E77A 2ZCUA 1HF3A 1YL6A 3COSA 4J16A 3KYCA 3GDOA 1ZK2A 4CUZA 2IRWA 3GR6A 4LRSB 5ER6A 5G4KA 3VDRA 4J0EA 4RO0A 2EGHA 4YRDA 5FI5A 4PLHA 1NPTO 1BW9B 1JWBB 3PRJA 1H9AA 3FPCA 3PGXA 9LDBA 5K6AA 4AICA 3QSGA 4FFNA 1D4FA 4JLWA 4PG5A 3MOGA 3I9OA 5KJFA 3D3WA 4KUHA 1HDYA 1GZ4A 1P44A 4LMPA 3TN7A 3H9JA 3NTOA 2P5YA 2XF8A 3C7CB 4OJNA 1WPQA 4CL8A 4I8XA 4RQTA 3IP1A 4OOEA 2ZCVA 2OOSA 2Y93A 3DBLA 4ALLA 4L4SA 1TT5A 5AXCA 4E5NA 3IQDB 4M1QA 4I5FA 2X86A 3NTRA 3JQ7B 5JBIA 2DPGA 5JW6A 3DBHB 2W2LA 4NBRA 2C7GA 2X0IA 3EZLA 1ISHA 3GUYA 3RBZA 4ESOA 4YRBA 4XDZA 1I5RA 1LDYA 3I9JA 3L9WA 2VZ8A 3AUTA 3M2TA 2NADA 1LC0A 1CQIA 2JFFA 1OBFO 4Z0PA 1LBEA 1FJHA 3ASUA 3ZWVA 1F06A 3OA0A 3WNQA 1OMOA 1O9BA 3X2FA 1YXMA 4TQGA 4QQRA 3BMCB 4HFRA 4UVDA 1MXHA 3CUKA 3ZNOA 4D3FA 4WLEA 3TZCA 5L4NA 1SB8A 1XLTA 4IIVA 1U3TA 4RGBA 4EUEA 3W8FA 4NFSA 4CM8B 4ID9A 1AGNA 3T7CA 2DBRA 4MP6A 2I3GA 5JCXA 3JD4A 3GVHA 4CMCA 3I6QA 4ZRNA 3QWAA 5L95A 4JNKA 2NVBA 4FCCA 4DLAA 1P1RA 5U9CA 3C1AA 1DAOA 5DP1A 1PZHA 4FJ2A 5KVVA 2FR1A 4FOOA 2OHXA 3INRA 3W4JA 1N1EA 1LRKA 3DEYX 5TS3A 1RM3A 1ZUD1 4AJHA 1QORA 3K9QO 2H63A 3ZWAA 5ENDA 4AJIA 1H2BA 2AQHA 2P68A 1A4UA 4K26A 5JAIA 1QLJA 4LSMA 3JYOA 1UDCA 5KTKA 4D43A 3VVCA 4IXWA 4J1QA 5ICSA 1KBZA 2ZTLA 2JFGA 3NDIA 4J1TA 4YJFA 3QWFA 4M8SA 1HETA 4W6ZA 4YT2A 3KYBA 4HFNA 4WECA 4LRTB 5JDCC 3RC7A 4EYEA 1KVRA 3C7DB 1F14A 3FTNA 4EEXA 1DJNA 2DBZA 4XGIA 2BKAA 1NP3A 3TZ6A 3B70A 3JQ6A 2HMWA 4M49A 3WYBA 4FIZA 4GWKA 4Y67A 5KJEA 3VAZA 3FTPA 3VPGA 4CR7A 2ZJ0A 2JD0A 3AUUA 1R4NA 3PDJA 1SO8A 1SAYA 5DCWA 4OKNA 3DMTC 3S8MA 1UH5A 3LU1A 5F21A 2Y1FA 3RROA 3PFFA 2O23A 2UVDA 3L4BA 1DIHA 4M86A 3WXBA 4R41A 5A9SA 1JTVA 4FGSA 3NT2A 3BMNB 5DF1A 4PLVA 5F3RA 2E37A 3VTFA 1YB4A 2O48X 5ER9A 4BO3A 5BSEA 3ZWXA 3DZBA 4XQ9A 4RPJA 3BMOA 4BB5A 2DUUA 1J4AA 2O3UA 3WGQA 3C24A 1XYGA 3BTUA 3DMYA 3H2ZA 4XYMA 1EUCA 4RF5A 4KZPA 2H9IA 3EW7A 1ENYA 4BMNA 4U0JA 5DCYA 2EXXA 1IL0A 3E1KA 4YWJA 4YT4A 1UZMA 1AXEA 5JCJD 2HK8A 3ZW8A 4W4TA 1CQJA 4DQVA 1DOHA 1EEHA 3DZIA 5JYDA 3H7AA 4QO8A 1CF2O 2HU2A 4K1LA 2XOXA 4JN6B 1QMGA 3JTMA 1BW9A 5DN9A 3ZDFA 1WXDA 5EESA 1NQOA 4J4TA 2FOIA 1HDRA 1GQQA 4RVGA 3AOEC 4I1IA 1E6WA 2QRJA 2ZB8A 4GL4A 1LQTA 2X4GA 4OOFA 2WWRA 5A04A 3VH4A 1WDLA 1LU9A 1ISJA 3HJAA 4WUVA 3W8EA 2PK3A 4M89A 4BQRA 5JC1A 2CDCA 1A9ZA 4PG4A 1T2AA 3UAGA 2PFGA 2W4QA 1O95A 3ZV5A 5IDWA 2CDAA 3CXRA 3DBHA 4LN1A 2PKRA 1AN9A 3K30A 4JBHA 4NFYA 4K6CA 1GL3A 4O0LA 2YYYA 3EYWA 2I99A 2NVUB 5A03A 2DFVA 3CMMA 2X5KO 4PFJA 2RCYA 2I65A 3DQPA 3I9MA 4KQXA 1B16A 3AY3A 3U4CA 3HFSA 1N5DA 1DJQA 2RH8A 4CMKA 5GZ6A 3GZNA 3PIIA 2GZ1A 5L51A 2VN8A 5I9NA 3PVZA 3ASVA 4FC7A 4WK6A 5TF4A 3H65A 2O2SA 2J3KA 4CM8A 1HRDA 3IP3A 4DC1A 4OIMA 3WB9A 1HDZA 2RBEA 3DWFA 2OO5A 1QRRA 3EC7A 3BZUA 4Q9NA 4A7PA 3MJSA 4AJOA 3GNTA 2D5CA 3DZKA 1JAYA 1M6WA 2V6MA 1U7TA 4NZ9A 4ZD6A 4UUPA 3WICA 2Z5LA 3WMWA 4GLLA 2UUPA 3BYZA 4IBOA 3A9WA 3UVEA 4Z9YA 3WTCA 1ZFNA 2PLAA 1NPDA 3RWBA 1T4BA 2NSDA 4RF2A 3I9KA 4ND3A 3S2IA 1ML3A 3JCZA 1KY5A 2Y1EA 1JLLA 1SOWA 1JDJA 4PCVA 1R0LA 4ZQEA 3I52A 1AE1A 2NWQA 1YL5A 2Q45A 2Q3EA 3UUWA 4I9NA 3TPCA 2XXBA 4AVYA 3V2UA 1CRWG 1W8DA 4R51A 3Q9UA 5IZCC 2BFMA 4MVJM 4YAIA 4RVHA 4HV4A 1I3LA 3GPDG 4BVAA 4JJFA 4W9NA 2VQ3A 3ITDA 3NX4A 4OQYA 2O3QA 1H6CA 3MJ4A 2YW9A 3NRCA 4TZKA 3JQAD 4PIVA 3ZHYA 3SBOA 1FDTA 1NHGA 1Z75A 3DFUA 1Z7EA 4J2HA 4QUKA 4CLDA 3D7LA 3LF2A 1OI7A 3TFQA 2X0JA 4J43A 1JKIA 5CEEA 1IZ0A 1GAEO 1T25A 1YQGA 3GFGA 2VHWA 4ZGWA 2P4HX 3PHJA 3FNFA 2IODA 2TMGA 4WE3A 4I5GA 4AJ1A 1OC4A 3Q11A 4WKGA 3DAFA 2PH3A 5JS6A 3ANLA 3RJ5A 2Q1WA 1P1FA 5T8KC 2P91A 3ZHZA 4JQCA 3I9LA 4YA6A 1UUFA 3DR3A 2FR8A 4RPHA 4B3JA 4UEJA 5CHEA 1QYCA 4Z3KA 4BNHA 3IJRA 1W0CA 3EZYA 3AU9A 3PWZA 2O3JA 2X0RA 3FHLA 4B3HA 5IXSA 2CVQA 5F5LA 3OIDA 1ZXLA 3ONFA 4J6FA 4EUHA 5AOVA 2B36A 1UAGA 3KSZO 2DTDA 3L6EA 5FI3A 4DYDA 4YR9A 1PQWA 4MINA 3SX2A 2PA3A 3D3EA 3U9LA 1ENOA 3ZHBA 2Y0EA 3WGGA 2FPPA 2GYYA 3P7MA 1V0JA 3PLRA 4IJWA 5I7SA 3K92A 4GBJA 1PS8A 3VVBA 2ZB4A 2GR9A 3O03A 2NU9A 3IIEA 4PRLA 5TRTA 4MIYA 3WR5A 3FWNA 2HJRA 1MA0A 4CMAA 4NBTA 4EJ6A 3MJTA 4ND2A 4EEZA 2X9VA 2BRUA 3A4VA 3H2SA 1HYGA 4TRJA 1ZO8A 1N92A 3OIGA 4B4UA 5T6BA 2F1KA 3BMQB 3PZRA 5JO0A 2NUAA 4XR4A 1A9YA 3TF5A 3MJVA 1NHWA 4TMFA 4WLUA 4DGSA 3I23A 2AEMA 4IGFA 4OGWA 4CM9A 3F5QA 2R00A 2WYVA 3CIFA 5TC4A 3GVXA 1QKIA 1X7HA 2DT5A 1ZK0A 2VTEA 1P3DA 4CLRB 3HDJA 4PLTA 4CQMA 2CVZA 3K8ZA 1X0XA 4FOSA 2NVUA 3DBVO 2IZ0A 4IPTA 1UZLA 3SJUA 3F4BA 5I7EA 3TSCA 2WM3A 3EAGA 4JGBA 1HDXA 3EGOA 1NR1A 1H6AA 3H9EO 4W7IA 4AJNA 3RC1A 1YQDA 4D46A 1YONA 3A28A 2AW5A 1WVGA 3FPLA 2B5VA 4BMSA 4DTIA 5ITWA 3GEDA 3GA0A 5G0TA 2Y1OA 1RJWA 3ZWNA 4EZBA 1YS4A 1E7RA 2CNBA 3P19A 3L6DA 4NU6A 1PQPA 2VYNA 4R5HA 4UUNA 2DTXA 2B35A 5L4LA 1DDOA 3ZNNA 4ALNA 1IHYA 3QVSA 3WTBA 3EUWA 5I7VA 3LT2A 4XIYA 5BQFA 4QSMA 5EQDA 4DLLA 5G0VA 3IKVA 1E1NA 1GCUA 2WD8A 3T7EA 2ZATA 1V35A 2VHYA 1PX0A 1ENZA 3ZWOA 1PZEA 1YDWA 5KCZA 4INAA 2WMDA 3FI9A 5KKAA 1RYEA 4LK3A 4F6LA 1XWFA 1NTOA 1F12A 3W4IA 4OXYA 4E2XA 4KP7A 3ROKA 1YH3A 4JCOA 5DBIA 3RUAA 4MIOA 1ADGA 3VPFA 1DO8A 4UEKA 3GDGA 4W82A 3WS7A 1PJCA 1Z74A 1ZCJA 3WGZA 3JQBC 3KETA 1T1RA 3F9IA 1ZK1A 3N7UA 5B4VA 3JQFA 4IINA 3IUSA 1SZJG 4PVDA 3LT4A 2IYPA 4NJMA 4E6PA 1LI4A 2VYVA 4HFJA 1Y8RA 3I9NA 1I36A 3NJ4A 3H5RA 3KYCB 1LDMA 1ZMOA 4CMIA 3SXPA 4F45A 1DB3A 2Z1MA 1K6XA 4BQPA 5HS6A 1S6YA 4XD2A 1IE3A 2BH9A 3D5TA 1PGPA 1ZSNA 1Y8QB 1E5LA 2O3TA 3IC5A 3OEWA 4TWRA 1ZIDA 2ZTUA 1IUKA 3D3WB 3IUPA 1E3SA 8LDHA 5HRUA 1EFKA 3VOSA 4X54A 5I8ZA 1LA2A 1IPEA 1C0KA 3Q1LA 2GSDA 3FNEA 1KVTA 4J1NA 3PK0A 2EP7A 1XSEA 4R54A 4YTEA 2C07A 3QRWA 2DUWA 4IJVA 2YDYA 2D8AA 5DBGA 1ZJYA 2IYOA 3FNGA 3HDHA 3FD8A 3WJ7A 2W98A 3UN1A 3RUFA 2X22A 2YZ7A 2DKNA 4E5YA 3KRTA 5HS4A 2E82A 3STHA 1KYQA 1TI7A 5L3ZA 4N5MA 3GG2A 2BD0A 4ZU3A 2YV3A 1M75A 1GPJA 3TJRA 1X0VA 3U5TA 4NR0A 1ISIA 5TGDA 1GTMA 2A94A 1CERA 1PJ4A 4WPGA 4BO2A 1Y81A 4CPDA 1AHIA 4MP8A 5I7FA 3TWOA 2YHIA 4ND4A 3DXFA 1VI2A 3NDRA 4JJIA 3BMQA 3TZKA 3B6ZA 3PIDA 5JAMA 2GPTA 4BHTA 4GH5A 3CH6A 3ANMA 3ICPA 4L9RA 4P8RA 4RVFA 5CFZA 3AFMA 3OP4A 4KUEA 4OXKA 2VWHA 1DIRA 1R15A 2JCVA 3MJEA 1H2HA 1PJSA 5T57A 4I5DA 5CEFA 4ONEA 4XQCA 4UVEA 3BTSA 3QLJA 2GNAA 2JHFA 1W6UA 1VSVA 1SNYA 3C7AA 1ZBQA 4GSLA 4FBGA 4RZIA 3FRJA 1RM5A 4AL4A 4IGEA 4E31A 2VYND 3GGPA 4BKOA 3S2EA 3GN1A 1X15A 4O59O 4Y8VA 1HWYA 4ZVVA 2AG8A 4E3ZA 2NU7A 1LUAA 3F6YA 3RUCA 2IXAA 1JVSA 2J5QA 5HM8A 3H4VA 3PJDA 4GI2A 4IS3A 4L0QA 3RI3A 2V6FA 4HXYA 5IXYA 2BLLA 4OH1A 1PTJA 4R01A 3ONDA 4UVIA 4N7RA 4PZDA 1PJ2A 4B7XA 1U3VA 1TB4A 1W4ZA 4N54A 3QP9A 4WOJA 4KUGA 4LGVA 4PLWA 1E1MA 5JLAA 3WYEA 1Y9EA 4E2YA 4D3DA 1E3JA 2VTDA 4XR9A 1RM4A 3RSHA 4MVJE 1UP7A 5BNIA 5B4UA 3L0DA 3HUDA 1R4NB 2QG4A 1I0ZA 5BNTA 4Z3DA 5JC8A 1IHXA 4PZEA 2HSDA 4CMEA 3NJ8A 2BFAA 2CF5A 4YAGA 2VWGA 3MOIA 4JK3A 3RQSA 4YT5A 3N58A 5KOIA 1DXYA 2X5JO 5KJ6A 2Q1SA 4Z0HO 1BDMA 2RHRA 2BFPA 1Q7BA 1ZSVA 3HN2A 5EJ2A 3E18A 2BGKA 3JQ9C 3UW3A 1LTHR 1I2ZA 1GV0A 2PZLA 3DDNA 1I8TA 4XYEA 3DOOA 6LDHA 3PYLA 2UYYA 1EBFA 4Z9FA 4DRYA 1NYTA 3N74A 5B4TA 2OBNA 2EGGA 1EVIA 1PJ3A 3UHAA 1D3AA 4FFRA 1U28A 1P74A 2H1SA 4IIUA 1XGKA 2NQ8A 2EKLA 3ITKA 3X2EA 2FMUA 2GF2A 4BNMA 2Y68A 3FSRA 4HX5A 4IQ8A 4MDHA 1Q1NA 4QTZA 4CODB 3BHIA 2WE7A 1XELA 4WOKA 1NPYA 1Y8QA 4NBVA 1UDAA 3PXXA 2YQ5A 3W8DA 4IJUA 5JCJA 1KC3A 2QZ9A 2D1YA 3B1FA 4OKIA 1QYDA 3WFJA 3IL2A 1YVEI 1H6BA 1PJTA 3GRKA 4MP3A 3KEQA 3UXYA 1Q0QA 1DBVO 1Z7BA 5BT9A 3WDSA 5B12A 4PG6A 1DIAA 4XRGA 1NASA 4CLOA 1H5QA 3DAGA 4XDYA 3OQBA 4CM1A 1TT7A 3OFSA 3ZWPA 4BKUA 3WYCA 2V7PA 3EY4A 3VPXA 1GUYA 2XXJA 1EK6A 1E7WA 4JX8A 1MC4A 3KLMX 5A5EA 4KTVE 4MIEA 4R1SA 1YGYA 4XYGA 2X9NA 4NBUA 5H83A 2Y0DA 4EJ0A 3I1JA 1Q0LA 5FFFA 4AJPA 1WDMA 2W8ZA 3IMFA 3QVXA 1LJ8A 2DAPA 4R69A 3NKLA 1ZK3A 3QVOA 3WWYA 1X7DA 1R12A 3LLVA 3JD3A 3QVTA 1CETA 3GZNB 1BXKA 4J3FA 1FXSA 1R37A 1ZMTA 2QYTA 5DCUA 3GVIA 2O7QA 2OMEA 2I9PA 2O7SA 2EHDA 2Y1CA 4B8WA 5ITVA 3K31A 4ZN6A 2HK7A 4XB2A 2DPHA 4MPDA 2XPCA 5GZ1A 3H9GA 4R1NA 1R6DA 1IY8A 3U49A 3ZU3A 2B83A 4YACA 5DT9A 1J5PA 2HUNA 2C0CA 2O3SA 2GD1O 2EIHA 4OXNA 2J3HA 1DC4A 4YQZA 3JD1A 4CM5A 1ORRA 1Y5RA 2X0NA 2FPGA 3DO5A 4AJEA 4BNKA 5EINA 3HE3A 2J3JA 1WWKA 4DA9A 4BNGA 4FFOA 5JE8A 4BB6A 5IZ4A 3G3EA 4JJGA 3WJAA 3GPIA 4Z6KA 2NTVA 1EVJA 1P1KA 4J0FA 5J23A 1HE4A 3DZGA 1E6UA 4FS3A 1Y6JA 4JROA 3UH1A 4EITA 2E6UX 4M55A 4QXMA 4S3MA 4W99A 3ROMA 4A0SA 2C54A 1U5CA 2FR0A 2PD3A 4UAGA 1CIVA 3V8BA 1DPGA 3KXDA 3TL3A 4YAJA 1XU7A 4HWKA 3DTYA 3Q3CA 3KV3O 4IMRA 3V1YA 3GDFA 1YB1A 3ZZNA 1T2EA 3GK3A 3LT0A 4IXTA 2VUUA 5DULA 4D41A 3ICCA 2OORA 4XQGA 1X14A 1F8GA 3JYLA 3LVFO 4TVBA 4WCFA 2HMTA 4HADA 1P1IA 3LC1O 5AXBA 1BG6A 2PGDA 3PEFA 1E6EA 3H3JA 2D0IA 1NFFA 3KEOA 3JQAA 3WQQA 1V3UA 1E3EA 3B20A 4R3WA 2G1UA 2P9EA 1U2GA 5K6AC 3GRPA 3DFZA 4RVDA 4P4NA 1C0PA 1GUFA 1FK8A 5A3VA 3L4SO 4E5KA 3C1OA 1UR5A 3FN4A 3RKRA 5BR7A 5KJ1A 3VPSA 1PL8A 1WZEA 3TRIA 4UULA 2PGJA 2I6TA 4MVJH 1E7YA 2VRBA 2Z95A 4RLSA 2EW2A 2ZB7A 4DC0A 2FPIA 1LDGA 2O2YA 4J7UA 4NMHA 4E21A 4J91A 3KUXA 1HEUA 1GCOA 1C1DB 2P9CA 4UEOA 2PGLA 3AI2A 1XEAA 4UREA 5TIIA 3BTVA 5T64A 1WDKA 2VUSA 1P77A 1HDOA 3WGTA 3ST7A 2CF6A 4QT0A 1XDWA 4I08A 4E2ZA 1HTBA 1YWGO 2VZ0A 4PGFA 3G1TA 4BNIA 4CV1A 1FDWA 5GZ3A 4PVCA 1V3TA 4DIOA 2B4TO 4RV9A 1P31A 2OL4A 3ZWMA 4CR8A 4CMBA 1H9BA 1I3NA 1O0SA 2PNFA 4J9VA 3GNSA 4WLNA 2NLOA 4GSKA 2R6JA 1DFGA 2C29D 3WGOA 4DYVA 1E3IA 2DU8A 4DBZA 4IY1A 1H0KA 1UXIA 2GGSA 1HZZA 1PIWA 1LLQA 1EE2A 1QG6A 2A35A 1WMBA 4NQZA 3ZI0A 1UZNA 3PHHA 3EDMA 3PQEA 5DBFA 3K6JA 4CMJA 3PHLA 1UP6A 3DBRB 1WP4A 4XYLA 4NIMA 1YBMA 1B0AA 5A9TA 4CQMB 1T2FA 3ULKA 1EBUA 2ET6A 1I3MA 2BF7A 5G0WA 3PJEA 1PWZA 4BO9A 4J2OA 4FFLA 5GY7A 1DC5A 3GLQA 3E9MA 1Y1PA 1G0OA 3PHGA 4CQLB 4GLOA 5HTOA 4L4XA 4CMHA 3E5MA 3R3SA 1X13A 3LK7A 1QV7A 4GQAA 4I9UA 4W7HA 3OETA 4AJ2A 4E13A 3RC9A 3LZ6A 1LSUA 1LX6A 1E1KA 5JYEA 3U62A 4HNGA 1N9GA 2AEFA 4L75A 5IFLA 3AM3A 3E82A 4UUOA 4A03A 3K2BA 4BNUA 4EBFA 5KVSA 3RC2A 3V1UA 5ENVA 3F1KA 1YE3A 4B4OA 2Y67A 4D3SA 1PGQA 4JXKA 3HG7A 1VL8A 3GUCA 3UF0A 3MZ0A 1BGVA 4E32A 4LCEA 5COBA 5L7TA 4EJMA 4AG3A 7MDHA 2POQX 3OJOA 4EW6A 2OP0A 3KZVA 1P45A 3AY7A 1GQ2A 4Y98A 1B8VA 5DDIP 1C14A 2WJPA 3F47A 4R1UA 4RPLA 1RYDA 1JQBA 4MJLA 1I33A 3L4BC 2OP1A 1BRMA 1ZH8A 1QSGA 1KC1A 1ENPA 5DNAA 1NBOA 4P38A 4HUJA 4XJSA 5CP8A 1HXHA 4FW8A 2CVOA 3K5PA 4AJLA 4ALMA 1FMCA 2BGLA 3EVTA 3PI7A 2GASA 5L4SA 4NJMB 1VM6A 2ZTVA 3T4EA 4DVJA 5CAEA 2AEJA 1CYDA 1Y8RB 2JCYA 1DSSG 4NHEA 4XGNA 1ONNA 4CMIB 1WNTA 5FWNA 1TVEA 2VNSA 3F3SA 2AA3A 2Q2QA 3M6IA 5JDIA 1E92A 4PZCA 3JYNA 1UP4A 2EJVA 1ONPA 2C82A 4PLFA 1E7MA 3ZV6A 5IG2A 2I67A 4BS9A 3QIVA 1WLYA 3BXXA 4HY3A 3IS3A 2DM6A 3CZRA 3QQPA 2ZQYA 5LCXA 4IJKA 2D59A 3NYWA 4E0BA 3VHRA 5L7WA 1HDGO 3ZHXA 3MTGA 1FF9A 3TZHA 3WIEA 1EQ2A 1GU7A 3AY6A 1C1DA 5ES3A 1ZEMA 1O89A 2AQ8A 4HP8A 1I2BA 3RBXA 4F6CA 1U8XX 2VOJA 1E7QA 5BSGA 1MV8A 4RQUA 1YO6A 2WTBA 4CLXA 2HLPA 4GMGA 2Q4BA 5C7OO 2YUTA 2VT2A 1M66A 4O1MA 1LLDA 4YB8A 1G6KA 2OBYA 1V3VA 3JD2A 1Y9AA 1IPFA 1B3BA 1B7GO 3UGKA 5FF9A 3T4XA 4A26A 1HL3A 5AVOA 2BI7A 4BNNA 2GZ2A 4Q3NA 2Y99A 2YHIB 4P4GA 4Q3BA 4D42A 1XG5A 2I76A 3B1JA 4D44A 1N8KA 2ZKLA 2Y0CA 3UICA 4IQ0A 1AXGA 4YQYA 5JAZA 3EK2A 2JFHA 4MKRA 2JD1A 1QYXA 3GG9A 4R4JA 5CG2A 3CE6A 5U1PA 1W73A 3LC2O 2Q1UA 5A3JA 1JKJA 3NGLA 2EV9A 1UXKA 3PZBA 4DPMA 4YRAA 3DBRA 4DMMA 2QZZA 3ZWYA 2GLXA 3O38A 2YJZA 1K6IA 1QXSA 4K28A 4FN4A 1R66A 1U8FO 2A4KA 4GWGA 4D79A 5JFOA 1R0SA 4A2CA 3ENNA 4CQLA 1P1HA 3TDKA 5ICMA 1EFLA 2B69A 5JNLA 5ILOA 5C3MA 3VZSA 4GGOA 1GEEA 3E8XA 2LDXA 3BAZA 1YKFA 1X1EA 2H6EA 4KTTE 5CDSA 2BMAA 3CKYA 4RDHA 4E33A 3OQ6A 4XA8A 4H16A 1L1FA 5DZSA 4RPKA 3CZMA 4R9SA 1B2LA 4IUYA 5IDQA 5IF3A 1FDUA 5A05A 2IXBA 1LLCA 4W9NC 1MB4A 4MVJD 2HRZA 4DIFA 1VRWA 4NNJA 1GR0A 2YQ4A 3AUSA 4G5HA 4XGKA 3ETDA 2C2XA 3FBTA 2Q4EA 2PH5A 4DPKA 3ADPA 3VZQA 1LRJA 4R68A 4B7CA 3O9ZA 4Z0TA 1PL6A 4UUMA 3HN7A 3LYLA 4OSOA 4Q3DA 1N7HA 2XAAA 5TJ9A 5EPOA 1JKFA 3FCOA 2DBQA 1PR9A 2O3RA 3GGGA 4A27A 1SB9A 4XKJA 1I01A 3U4HA 3JSAA 4BNXA 3ROQA 3EHEA 1DLJA 5TJHA 4NK5A 4JBIA 2ZYDA 1Q7CA 4MVJF 1SOVA 3LDHA 2V6BA 4UVGA 4WCDA 4QFDA 1M76A 1YQXA 4NDNE 3ZWCA 3DONA 3GGOA 2D2IA 4GVLA 3MJCA 1JU9A 1F8FA 1E3LA 3SC6A 1IB6A 3QHAA 2P9GA 2WE8A 1VJTA 2PZMA 1PJLA 2VRCD 4RVUA 1ONOA 3C3XA 3KTDA 3TQHA 2E4AA 2UV8A 1U4OA 3UCFA 3DHYA 4M54A 1M67A 4ND5A 2AE1A 2Y1GA 1AUPA 3JYQA 1PJBA 1U3WA 3NEPX 2GRAA 5FEUA 4DQXA 4BIIA 1P33A 4CLOB 3ADOA 4IDGA 1GZ3A 3W1VA 2OFPA 1PZFA 1GUZA 1P0CA 3L6OO 2R00C 1YBVA 4A10A 3P2OA 3DZJA 3I4FA 1DC3A 5KKCA 4TKMA 3Q6IA 2EERA 2G5CA 3TOZA 4NPCA 3D64A 3OJ0A 4NBWA 2PR2A 2HAEA 3IDSA 4RPGA 2NTNA 4CV3A 1C0LA 1XU9A 2FZEA 1MG0A 3E5RA 2O4CA 3QVWA 4E12A 3WOHA 3WGYA 1KVQA 2FY8A 4J4HA 3JQDA 3HNPA 1NAIA 1MX3A 4EDFA 4YEDA 4F3YA 3UFXA 1OZAA 1RWBA 2DTEA 4KWHA 1TXGA 1YOVB 3W6UA 4IDDA 3RUDA 1R4MB 1NXQA 4CLHA 4RORA 3Q0EA 1NWCA 1N1GA 4KDFA 4B7UA 1BVUA 1EMDA 3GEGA 4FQ8A 1E1LA 3E9NA 1NVGA 2GDZA 3GQVA 2G82A 5BSHA 3IJPA 1GYQA 2HJSA 5MDHA 3C8MA 4BO6A 1BMDA 1JAXA 1KVSA 3JD0A 2UDPA 3O26A 3ROPA 1ZVMA 3E48A 1SBYA 3D4NA 3F46A 4DXHA 1D1SA 3PYMA 5ADHA 4J7CA 1ULSA 4XRRA 2VOEA 3TOXA 2JD2A 4XZ3A 4FSHA 3QY9A 1Z73A 1D7OA 1U2DA 2PZKA 5AXAA 1RM0A 1ZJZA 3GMSA 2I3AA 1U9JA 2EEZA 4HKTA 5TSDA 5CEJA 3PQDA 4FD3A 3PDUA 1H93A 2HCTA 3I4CA 5A5FA 3MWEB 3AI3A 3QWBA 1CEQA 3LF1A 4E30A 4ND1A 4OQZA 5EN4A 3ABIA 2J6IA 1J49A 4EGFA 1LNQA 2CDBA 3GH3A 3H5AA 3RU7A 5THQA 5JSFA 4DUPA 1VLLA 3VPHA 1M6HA 3PQFA 3OIFA 3JQCA 3H9QA 2ILTA 4GMFA 1UXHA 4WCFB 2VUTA 4UVHA 3UOGA 2VNAA 4XJTA 3H8VA 3ZU4A 1DHRA 3BHJA 3OJLA 3NV9A 5JO9A 3JQAB 1K0UA 3HWRA 3D5QA 3GMDA 3GC6A 4PLPA 4H3VA 1NFQA 1SPXA 1EZ4A 2BI8A 5I8WA 1HZJA 1CJCA 2EG9A 2PY6A 1ZW1A 2Q99A 4TRNA 4LVUA 4YJHA 3GEMA 4P22A 4K9DA 4DWVA 3KYDA 3INTA 2CD9A 3R3JA 2SCUA 1EDZA 3I5MA 1KVUA 4IDBA 3HSKA 2QIOA 2BELA 5AQ1A 3RJ9A 3DOCA 3RAJA 3ONEA 3KBOA 2GN9A 4GGPA 4D0RA 3PPIA 2TMDA 1EDOA 2RAFA 4KWIA 4B4WA 4GAEA 4IDAA 5JDCA 5C7LO 1A71A 4IZIA 2B4RO 4N18A 4DPLA 1DRUA 1GFSA 1BVRA 1A5ZA 5IDYA 1NQ5A 4B79A 4LSWA 1EUZA 3IOYA 4OL9A 1Y5MA 4YJGB 4BNFA 1J0XO 1VKOA 1VSUA 1NVMB 2X5OA 4WJZA 1NQAO 3RIHA 4A5OA 4BNZA 3V2HA 2QRLA 4GVXA 4RDIA 3JQ8B 5EL0A 3DMTA 3PWSA 4KMSA 3F5SA 4NJOA 3PGJA 1DC6A 1HE2A 1T1SA 2EP5A 1IYZA 3O8QA 4WASA 3IAHA 3PLNA 2DLDA 4YDRA 5JY1A 5B37A 1GEGA 2Q49A 3GAFA 3U0BA 4BO7A 3WMXA 3WX0A 3HB5X 2IEBA 2DVMA 5G2OA 3ZCXA 1A27A 3WWZA 3RASA 3QA9A 4ALIA 1LSJA 4PG7A 3Q2IA 2HQ1A 3V2GA 4YVFA 3CINA 3DHNA 2VZ9A 2CMDA 3G0OA 7ADHA 4WLOA 1U5AA 5IJZA 5I9MA 4CM3A 4ZQHA 4CV2A 4L8VA 4WNCA 1KY4A 6ADHA 1HSOA 1K2WA 4WEQA 3SJ7A 5MGBA 2VHVA 4RF4A 3OICA 3L07A 4AFNA 1T4DA 4M87A 4TKLA 1YOVA 3VC7A 4Y6SA 1KEPA 1N9GB 3QWHA 1R4MA 2NM0A 5F5NA 1ZXBA 3AFNA 4MVJG 3AOEA 4WLVA 1T2CA 1DFHA 3ON5A 4Z9XA 5AYVA 3WSWA 5H82A 4KDEA 1Y7TA 5L53A 1F17A 3F1LA 5TX7A 2Y1DA 1R16A 3W6ZA 1YB5A 4ROSA 1OFGA 5C5IA 4BOYA 2B37A 5FYDA 3KB6A 3GHHA 5DP2A 1A4IA 4BNLA 2WYWA 4XEHA 1OAAA 1Q2XA 3NDJA 3E03A 1DAPA 2JJYA 5KVQA 4CMEC 2P4QA 3O4RA 1H94A 2FN7A 3VZRA 4DQUA 1PZGA 2D3TA 1ADFA 3QE3A 3R1IA 1O94A 1LXCA 2RIRA 4O6VA 3V1TC 3OHSX 5JMWA 1VC2A 4IMPA 4C4OA 3CPSA 3ETGA 1KERA 1JA9A 4B4VA 3FR8A 4H7PA 3AU8A 1L7DA 1MUUA 3U3XA 4Q3AA 1VJ0A 2Q2WA 2G0TA 2EW8A 4P4LA 4R5MA 5LDGA 3NT4A 1NM5A 4YPOA 3IKTA 4I9HA 3DAPA 2H5LA 4KOAA 3QW2A 1T26A 3ZV4A 2C20A 2X23A 4WEOA 3D1LA 3CMCO 4CM6A 2G76A 4OMUA 5A02A 1PEDA 4NH4A 1E5QA 3RUHA 2OXIA 5A9RA 3KM0A 4N5LA 2PTGA 1P1JA 4ILKA 5DOVA 5CDTA 1LLUA 1P0FA 2X6TA 3WGHA 5EMHA 4MKXA 3WBFA 4CR6A 1PQUA 5L40A 3HB4X 1MP0A 3PHIA 5KIAA 5KNLA 1QV6A 5L7YA 1JVBA 4L73A 3KSUA 4C7KA 3SC4A 4AJKA 1B8UA 4MKZA 1GQYA 4JBGA 5THKA 1JW9B 1HKUA 1E0DA 2BFOA 5JY6A 5TT1A 4YYZA 5IZCA 4I5EA 3BHMA 3VH2A 1KOLA 3KOUA 5F1KA 4DIBA 2O50A 4RF3A 3C85A 4QX6A 4FDAA 4BKRA 5C7IO 3AI1A 1K5HA 5TNXA 1I32A 1EQUA 3AW9A 2A92A 1SCUA 2QRKA 3DC2A 4O5OA 2HKIA 3VH1A 3W4KA 1OC2A 1GPDG 4YJGA 5G0SA 2P5UA 4YAKA 4IDCA 5EQFA 1C1XB 2GO1A 3AWDA 1U4SA 4OO3A 3RFTA 2VWQA 4DMLA 1UDBA 2WEKA 5EIOA 3JQ8A 2VWPA 2R2GA 3GZ4A 1MFZA 5CPFA 1JWAB 3OBBA 5LC1A 2IZZA 3RUIA 3GFBA 1XQ1A 2ZQZA 4CM7A 2DBVO 2GN6A 1EE9A 5T8KA 4JP2A 2NNLD 2HDHA 4D0SA 3EMKA 1EVYA 4RCVA 4TVOA 4QECA 2PZJA 1KETA 2W2LD 1PR3A 3S2FA 1PGNA 4PLCA 1A72A 2PD6A 2YV1A 4Q3EA 1RKXA 4FFPA 1ADBA 1B8PA 4GX0A 1YRLA 5F1OA 1QLHA 1PS0A 3B1KA 3A06A 3OJFA 2EKQA 4N5NA 3VTZA 4E5PA 3F4LA 3ZV3A 1K6JA 1V6AA 4BNWA 2A9FA 4OHUA 4QO7A 2V6GA 3GF4A 4TSKA 3OEYA 3VDQA 1ZSYA 4BGVA 3ZGYA 3JQ7A 1B14A 4R1TA 2PD4A 4LVCA 4XCVA 1V9LA 4BO5A 4A73A 1VKNA 4G2NA 3RFXA 3OF2A 4RL6A 1PGJA 5COQA 1V8BA 1MXFA 1NWHA 5CDYA 1GV1A 1D8AA 3HADA 4CMGA 4IS2A 2RHCA 1BHSA 2V65A 1RPNA 4GX5A 1UXGA 4J1SA 3Q2KA 3C1TA 3NAQA 1C0IA 3LSYA 1KS9A 3PFWO 1DFIA 3QJ5A 4RLHA 2HK9A 4ALKA 1WW8A 4HBGA 2Q1TA 3PJGA 3BMCA 4MOWA 3MEQA 3HQ4O 3A1NA 3U4DA 3WQSB 2WYUA 4FGWA 4LMRA 1IOLA 3MCVA 4WCFC 4GX1A 3L77A 5L9AA 2ZYGA 4YJDA 4MVJA 1LRLA 3S1LA 1WMAA 2EF1A 2E48A 1J6UA 4CUKA 4DBVO 4YT8A 4PLGA 2NQTA 2ZJ1A 1KEUA 1Z82A 3FWZA 1L7EA 5BNFA 4EUFA 1Z45A 5JAQA 1M2WA 2FSVA 4TROA 1HLDA 1GYRA 3JQGB 2CZCA 3GT0A 2E49A 3ZNQA 3H3FA 2VHZA 3ZWWA 4CV0A 2OUIA 4CM4B 5CDGA 5GMOA 2JAHA 3WSVA 2NVWA 4ZQBA 2PKQP 4BO4A 3H6KA 2GZ3A 4KQWA 4MO2A 4PG8A 4CUJA 4NU5A 2JAPA 3WBBA 2EKPA 5TT0A 2AXQA 2YY7A 4Y6PA 5IDXA 2JKVA 3OH8A 4ZQGA 3KHUA 4NI5A 3M1AA 4Q3CA 3WG9A 2GN8A 3SLKA 4QEDA 1XCBA 4Y6RA 1T2DA 3LC7O 3ZNPA 4HFMA 4ZQFA 1BWSA 2F00A 3RVDA 2W90A 4PN3A 1S7CA 2DQ4A 1CWUA 1DRWA 5LDHA 3ETEA 4IDEA 3AUAA 3R6DA 2FP4A 3WIDA 2IZ1A 2VRCA 1SEVA 4L74A 1TA4A 2J8ZA 3DHEA 5C37A 2Q46A 3E6AA 2Z1NA 3AK4A 4BNJA 4E5MA 3E9QA 4C7JA 2VHXA 2Y66A 3EVNA 3RUEA 1GD1O 2QQ5A 2YV2A 5COAA 2JCXA 5HA5A 2ZTMA 3BMNA 4OYRA 3PYXA 3JQBA 3I6IA 4NK4A 1ADCA 3VKUA 1EUDA 1FDSA 1QYVA 2BHLA 3K96A 3OMLA 1BTOA 3DL2A 1K89A 3BA1A 1B26A 4ZHSA 5AXDA 1DEHA 2GN4A 5IAAA 4D45A 1WZIA 1VL6A 2HMUA 3ENKA 4GPD1 2YFHA 4BNYA 2J5KA 8ADHA 4GKBA 1G0NA 3SEFA 2I5PO 1C1XA 1XHLA 3HHPA 1I10A 4OSPA 4LW8A 1MG5A 4U5QA 3TZQA 1TLTA 2O4UX 3BTOA 3P5SA 1MLDA 1XKQA 4CL3A 4TRMA 4YAEA 3ZN2A 1EK5A 2C59A 1AHHA 2B5WA 3GNQA 4BV8A 4YBZA 5HBRA 1P9LA 3D4PA 3ZH2A 3VKVA 4XB1A 2AQIA 3I3OA
chains in the Genus database with same CATH superfamily
2NMVA 1T5DX 3DTTA 3R6LA 4U6QA 1F2DA 3FR7A 3UEOA 4ER5A 5JSUA 3SZ3A 1H2RS 1HSZA 3K9WA 1FYXA 1VHDA 3ZD9A 4LHEA 3T7TA 1TVKB 3HDYA 5FWXB 1E2UA 4Z7OB 3OM9A 1G42A 2C58A 2Z98A 4OP2A 4O63O 3ZBTA 1G1AA 3ET5A 3EZ2A 3VDMA 4DG9A 4KAAA 4ED9A 1VJ1A 1FBNA 1TLFA 3AKYA 1EVZA 3O84A 1AGPA 2AE2A 4PRYA 1A5TA 2GBCA 3JYPA 1A0OA 3D6UA 1V8DA 4ZRMA 3K70B 3P2YA 2I66A 1Y4UA 4H7KA 1UAYA 2FWMX 1Z5VA 3C3DA 1KP3A 4MLZA 2VDNB 3AM4A 5JASA 1JEQB 1YZQA 3R0IA 4MUBA 5F1PA 4WFQA 2MYNA 4JU9A 3RFVA 2YINC 4N6NA 1RYYA 4CEHB 2A9RA 3GRRA 5F2NA 4GP9A 1MAHA 3QV1A 1EG7A 2PLRA 3CF4G 1LEHA 4US1R 4KEAA 4LJ4A 5JCOC 3HLTA 1LDBA 3U19A 5B3JA 3GJXC 4EY7A 4M0EA 4NABA 5E1OA 5JS8A 5JAHA 2QF7A 1AH2A 4GWLA 2JI8A 3MF4A 2W93A 5KC9A 3ZHTA 1BGXT 3ELYA 4OHZA 5L3VA 1T36A 3HJHA 3OX2A 4YCAA 1Q0ZA 4LXXA 3H8SA 3Q7RA 5JDIC 4URFA 3G2OA 3WP1B 4FR5A 4JHXA 4ETNA 4TV8A 1VI5A 3BBLA 4C2BA 5ILGA 1Q12A 3OEED 1VPDA 5EP2A 4ZYXA 1WB4A 3WQRA 4E08A 4BGUA 1I2MA 5CDUA 3GLFB 1TO6A 4IZHA 3S6JA 4YJHB 2OXCA 4RH3A 3GUHA 4UNSA 2WDPA 3KYDB 1JYEA 1UJMA 5LUBA 4MA5A 2VXYA 2OFWA 3R3HA 3QVLA 2MMCA 4LZJA 1DZ3A 5HBGA 3JX9A 3H6HA 4A6DA 3RKUA 3FF4A 3IJ5A 4CKEA 4MHSA 2ATIA 1PGOA 3G2JA 1XDDA 4HGOA 4A0QA 3WBKA 4BFXA 5JISA 2D54A 2P2SA 1SRQA 3CLRC 5P21A 1R9NA 2ZS9A 2J87A 4BGEA 5BP7A 3DE4X 2IYAA 2VK1A 1YDEA 1DC8A 1WVIA 3JQEA 5EXXA 1Y48E 2HBYA 1JBEA 3OQ1A 4MHTA 1G2IA 2XD4A 4Y2GA 2WZQA 3V8EA 3UJ8A 4TLAA 4LKRA 1NR7A 4KE6A 3VZPA 4AQYB 5KYWA 5CURA 4YIHA 5EJFA 4OQDA 3VR6H 2QPAA 2I29A 4NENB 3HXKA 4E7PA 2KSQA 4HHEA 4MS1A 4Z3OA 5TQ2B 3UHPA 4EABA 3CE9A 4A6PA 4I0WB 5IN4A 5F3DA 3JU3A 3LQFA 3FMPB 2LIVA 1JIXA 2L19A 2HRBA 2H1IA 1C9KA 4TZTA 3RD5A 2FLVA 1NW4A 3HYNA 4BX0A 3INGA 3NONA 1N2CA 1EVQA 3CNQS 4IICA 1UC5B 1QDLB 1SKYB 1VE9A 3Q3IA 3QUTA 4H17A 4RD0A 3KP1A 1O8CA 3JZFA 2ZROA 4TWZA 3O8QB 3M8KA 2OBMA 4ARAA 5C18A 5JXJA 1EXVA 2DSNA 2DPMA 5ICEA 4TUYA 2Y92A 3NDBB 1SD2A 3KZNA 3WXMA 3DL4A 1ZJ4A 2CFCA 2PPVA 3OECA 4E88A 2GFIA 2ZRGA 2Z30A 1YTUA 2XIQA 1NFRA 4KMRA 3HMQA 1N4DA 3EUAA 1GITA 1U04A 1UBHS 3RC3A 1AVTA 4QGFA 1BROA 2Q5QA 2FQQA 4B8ZA 2ADFA 2GKOA 4M1YA 4CKBA 4DLSA 1UBLS 4IAOA 1C1YA 2ECFA 2FQXA 2QMYA 5KU1A 4WGGA 1FL9A 4PTYA 2RGCA 4RJJA 4URYR 5EPEA 5H70A 3GAAA 4AF7A 4B82A 2YMPA 1X8JA 1HO3A 3O1LA 1ZCAA 3ONVA 4P7FA 3G49A 1ZZEA 3GFPA 4ITUA 3RH0A 1L7RA 5I9LA 1EX6A 1U7WA 1I9CA 2WJ4A 5SZHB 3BK7A 4O1HA 1XZCA 4CTNA 2XWQA 1KDRA 4NONA 4V0QA 4GX2A 1Q7GA 2H5EA 3NHMA 3VV2A 4JT8A 4EEKA 1QPZA 3NDPA 3NHPA 1W5SA 2L42A 4AJ4A 9LDTA 5IABA 4FJ1A 3RK1A 2JCSA 2XYRA 5KS2A 3A6PC 1VGRA 1Y4SA 4QJ4A 4WK0B 4CF6A 4S24A 2CLLB 4QJ5A 4BZQA 1EWRA 4DCVA 2MJLA 4ERNA 2PLWA 4ZICA 5BMOA 3K9BA 1JHXA 1FP2A 1JRLA 1RQ2A 3QYPA 4L4RA 4URZR 1ZK4A 2DQSA 4PNEA 1X1TA 1OOEA 1SVUA 4E2WA 3UK7A 4BO0A 2GERA 2R66A 3BPSA 3K6RA 3OY7A 4LA4A 1ARZA 1V16B 2HJVA 4OK3A 4DJEC 2QHXA 5KDLA 4ABTA 4BE4A 3UAOA 3WFIA 2OV1A 3ZLUA 1XKLA 5T3UA 4RDXA 1BSVA 2IDZA 3M49A 1XMVA 1Q1GA 4K0RA 5CG1A 4R2HA 1LC3A 4DNFA 1AMNA 4B73A 1G18A 2PMKA 1CY8A 4IIYA 3TVTA 3GLGB 5B36A 4CLEA 4CLRA 5F7OA 1GUAA 4IJMA 1GPAA 1Y82A 5FFMA 4EVSA 2RGNC 5FT9A 3UMFA 5EHNA 4CE6A 2TECE 3L6UA 1DJLA 2JVJA 4J49A 2VJLA 3CS3A 1NVUQ 4DLRA 1GZHB 3PJFA 4GI1A 4HDQB 4XQ0A 1Y7LA 1V43A 1ZOSA 3G6KA 2OBFA 3B85A 2P2YA 4YXWD 1M7BA 3LPLA 1ZAKA 4R3UC 3K15A 4EA9A 3IE1A 1GZSA 4BKQA 4IEEA 2NP7A 1ZN8A 1MEEA 1U2EA 5EZSA 4B6SA 4KE9A 2B4YA 1E4YA 1QUEA 1O5IA 3KD2A 3PTZA 4HNVA 4NG5A 1H0RA 4HQ6A 3PNOA 3CKLA 2XUHA 3GY0A 4JNCA 2ODBA 2P78A 4QYSA 1UJ2A 2FMHA 4UM8B 3CR8A 3FGPA 2ZE7A 2IUFA 2E55A 1I2CA 4XFDA 1JMVA 4F5EA 3P2MA 2WIAA 3R9XB 2HXSA 2DECA 2PBLA 4CIXA 3OG9A 4FJ0A 3L05A 5HKOA 1ESDA 4BO8A 3UV7A 4WY2A 1JLHA 5KQRA 3K9NA 1S8FA 3Q0IA 4LXIA 4RKFA 4TXMA 1WUIS 2YN4A 3GJ5A 2R60A 3KAQA 3G0CA 1G20A 1BE8A 4R1OA 4TLDA 3EIFA 1X9IA 4UTZA 5SZIA 3LBIA 3OCCA 3NP9A 1MT3A 2AFVA 2QXUA 2Y6UA 3FBGA 4H1UA 3KPVA 4TV8F 4C0QC 4M7RA 2GEKA 4CJXA 4ZCTA 4M9CA 2A57A 2P8JA 1MO3A 4IH4A 1RLTA 4UFNA 1GOTA 1U65A 3TGWA 2AFIA 5AVVA 5AW1A 4EFNA 2UZ4A 1P60A 1XQ6A 4LF8B 1G38A 3PFIA 2JRLA 3QI2A 3GO4A 1G8SA 1V1MB 1WCIB 4K1XA 3AR9A 4RTMA 2IV3A 3ND9A 1HE5A 4MVCA 1ID1A 1PU2A 3R0VA 3UKOA 3E8SA 4H6WA 4JB3A 4Y9DA 4G8CA 2D5AA 4J8PA 4KITB 4BMZA 2WD7A 4JJ4A 4S12A 3I42A 2BSAA 2QZSA 1CDOA 2LDBA 3RYIB 5HYVA 1R6TA 4F6RB 1HYHA 5ULLA 3IUMA 2IEYA 2V6IA 5JAOA 1FFDA 1O87A 1WUTA 4LTMA 2BFBB 1YACA 2WVHA 2OV3A 3COSA 1JI0A 3E4CA 4HJRA 4CUZA 1JL3A 3KPYA 4IJQA 3KVVA 4QUBA 2X2OA 4P0PB 1LQ2A 1ULBA 2XTZA 4YRDA 5FI5A 2A6PA 1NPTO 1N1MA 2NZWA 2Z8YA 1JEOA 1YF3A 4YECA 1MJGA 1VBKA 3DMGA 5IC4A 1I7LA 5EQTA 4JLWA 3TGPA 3NFRA 2H2IA 4M1TA 1NBEA 3FSGA 4KUHA 1MX9A 1HYQA 1P44A 1SVSA 1PD1A 2XKAA 4IHQA 4LMPA 3NTOA 3TN7A 3C1UA 2XF8A 4OJNA 1FY2A 4RQTA 4GXRA 3NATA 1W5FA 2JLVA 4OOEA 3NC1C 3UA3A 2AC7A 3D3JA 1XD2B 3KEGA 2XNDA 1W93A 3D8SA 3DBLA 4TLBA 5DW0A 4AIIA 3OZBA 3PD1A 5EOVA 4R2KA 2K7FA 1B23P 4I5FA 1IVYA 3Q7SA 4QICA 1DMRA 4B6RA 3MYRA 3DDOA 1DBQA 3JAMA 5EP4A 3HCPA 1L7QA 2DPGA 4YLEA 4FN5A 1MH1A 3DBHB 3A4TA 4AG6A 1SVOA 2YHSA 3TQOA 4RY8A 2XB2A 2C7GA 3CSSA 1ISHA 3PSAA 1H1TA 3DWGA 3IFSA 4B17A 1A9PA 4YRBA 4XDZA 1I5RA 2M6RA 2O8VA 3NOXA 2JGFA 1MIHA 2AR7A 3CT6A 1Z2DA 3M33A 3O6VA 2WIDA 1CQIA 1O6FA 1O4VA 2E1PA 2WAMA 4PHFA 3T35A 3VISA 2EARA 3ZYZA 1KWGA 3EFHA 1U9ZA 2VP4A 4C0HA 4IIBA 1FJHA 4FFVA 4QDUA 1NVBA 4KNYA 5AI6A 3OA0A 1EFUA 4LWQA 3OLVA 4B34A 3ZDDA 1P0PA 1WNFA 4TQGA 1H8HD 3ZPXA 1NQVA 2I4LA 5DXAA 3BMCB 4HFRA 5ELMA 3CUKA 3HY6A 4D3FA 1V3QE 2I03A 1TM7E 2NSYA 2FEKA 1UMCA 4ASUD 2O8BA 2PQ0A 3W8FA 4Q4DA 4ZZ2A 4ID9A 3ZXXA 4B6JA 2ZZNA 2EFYA 2BIFA 2LWIA 4KIWA 5K99A 1K9SA 1KSHA 1PL0A 1C8KA 3GVHA 3EWAA 1S2MA 1SBHA 1XYVA 3I6QA 4KXVA 5AW8A 2V9ZA 1V26A 1P1RA 2WWYA 3EG5A 3X1JA 4PO1A 3KOMA 3C1AA 2J0VA 3KWLA 5AMXA 3CW2A 2XZDA 1Y9JA 3VHLB 4XOIA 1ZUD1 1QORA 2ID4A 2BEKA 3U81A 2RHJA 5ENDA 3SOZA 5TQ0A 3V97A 5TDHA 4ZVQA 2ZR9A 2Y0PA 2P68A 1A4UA 4K26A 1OWOA 2OCPA 1V11B 3AIKA 3DMHA 4K7JA 3UXHA 3VGJA 3ZZ0A 5KTKA 4FCVA 1YVPA 4IXWA 3WMRA 1IM5A 1MQAA 1Z2EA 2NTEA 2ZTLA 4UOEA 3L4KA 1UK9A 1UQUA 1HETA 1L1RA 5H3LA 4CKXA 4HFNA 1BHQ1 1PW5A 2JFBA 3UO8B 3WV5A 3EGEA 4LRTB 1T10A 5FUMA 5IVPA 4EVIA 3U60B 4BE9A 4YHHB 5DN6D 3FTNA 2DBZA 2Q3CA 2FXIA 3FOFC 3EQ2A 3KT8A 4LRWA 5BN3A 1G8FA 1SKAA 2I54A 2YICA 3HRKA 2WSSD 5LP6C 3GRUA 3NALA 1SIBE 2B8JA 4A1FA 4X6LA 3RADC 4ESHA 4IVPA 2BONA 4RULA 5BWLA 5C80A 3PDJA 4D9JA 5EAIA 3FPFA 4AW9A 1AURA 3RVOA 3ZQKA 3LY7A 4QM7A 1X19A 1N6NA 1XD9A 4HQNA 4M22A 2O23A 4PICA 1AKVA 5AOBA 3V8VA 1DBSA 5ERXA 3X1YA 3L4BA 4GXTA 1DIHA 4PQFA 3RWOA 1JJIA 1DMSA 5JLJA 2RHHA 2IE8A 4G89A 1OJ7A 1DRJA 2NZ2A 2QTAA 3M6AA 4FGSA 4U5XA 3U3KA 3MELA 1KEEA 4BO3A 2H4XA 2QVCA 4FYMA 4XQ9A 1OLOA 4UDYX 1G21B 3BMOA 4FZRA 4L8GA 2D5IA 2O3UA 1D6SA 2Q07A 3C24A 4GNRA 1CEEA 3BTUA 2VDJA 3H2ZA 1DG1G 4RF5A 4DR4B 4KZPA 2OBLA 3KQVA 2H9IA 3DFKA 3RS8A 2CVPA 4I3FA 1WOYA 3BIFA 4IG9A 5B6IA 2VDWB 1EFVB 2SKDA 3E1KA 4G84A 1RMQA 3RS2A 1HR0B 1HMPA 4C20A 1JDSA 1Z63A 3PDHA 4WNAA 2RGXA 4BQOA 4LVNA 2CFTA 2JFNA 4DQVA 5JYDA 3I12A 4RUKA 1N34B 3WLJA 1CF2O 3IDOA 3UK0A 5MF6A 1PWHA 5DN9A 3U9SA 3HSYA 1WXDA 1NQOA 2R1VB 1IBKB 2FOIA 1U2TA 3R3VA 1JHDA 2MSWA 3L82B 3SNKA 2JIZD 2J4FA 4ROTA 5REQB 2QWXA 1E6WA 2XCUA 3DXXA 3EODA 3SM9A 4HGPA 4XASA 1CUEA 2BEJA 4LI3X 2KJQA 3ABOB 2X4GA 3ZW7A 5EFOA 3RC8A 3GJZA 1LU9A 2CMKA 3HJAA 4WUVA 3OCUA 5GJCA 2O2GA 2W0SA 4M89A 4DMCA 3CWZA 2AOUA 2EATA 2F1RA 1T2AA 3EXHA 3GRYA 3LOPA 2QOEA 3R6GA 5AT1A 4BDSA 1A8IA 4AS1A 3EDCA 2W4QA 2ONCA 3ZOKA 1G5FA 3R0JA 4XTRA 3UK6A 2XODA 2G1JA 5HUJA 2CDAA 3CXRA 3SSMA 4DB4A 2PGAA 5M2QA 1Y9ZA 5K01A 1PI3A 1GL3A 2VAXA 2YVAA 2YYYA 4GQBA 3K6SB 2I99A 1Q6YA 5C0OE 4N65A 4OYLA 2DFVA 4HDCA 2HQOA 2H0AA 4CW7A 1JG4A 3TLCA 4B5LA 2LPMA 2MCFA 2ID8A 3FTCA 1L7BA 2P0YA 2QUJA 2FZ4A 3BXZA 4KQXA 1B16A 3FSEA 3AY3A 2YY6A 3U4CA 1FVFA 1JR4A 4LY0A 4PINA 4BP3A 3EFEA 3HFSA 4BLRA 2XXAB 3PPVA 3W2FA 1AO3A 4OHBA 4PY2A 3EXIB 3PIIA 3CJRA 3TSAA 3O8BA 3F0TA 2GAIA 3IKLA 3WLSA 1GKUB 5CXSA 5E4YA 4HVLA 1A9RA 3IBYA 4WK6A 4KK4A 3H65A 3HWSA 1Z6PA 2O2SA 1VECA 2J3KA 1GFZA 4NV1A 4JMPA 2WB2A 1CR2A 1U9IA 4OAOA 4ZTZB 1XVAA 3VPDA 3WB9A 3TE6A 1Y7IA 1IB0A 2OO5A 4LC1A 1KSJA 2QGNA 4UCFA 2G9UA 2ODNA 4L07A 1K08A 4AJOA 2D5CA 1VDMA 3DZKA 4A4DA 2VP6A 4YALA 5LKRA 3NB0A 3OQNA 3CUWA 2FFJA 1N5JA 2ESRA 3EVEA 3I6MA 3O1JC 4J76A 2WNSA 4PC2A 4DQ0A 3UUEA 4AP5A 2I62A 1ZVQA 3AVTA 1V39A 1KYZA 1ZFNA 3HM2A 2PLAA 1ZH4A 4I6EA 4ND3A 1DE0A 4XUDA 3JCZA 1L7NA 3I9FA 1JSCA 2HLDA 5SYNA 3KQOA 3ZY6A 2G1PA 2XLCA 3KU1A 4DC9A 2FXVA 2Y1EA 4PQGA 5DBOA 4JLUA 5K8LA 4KX3A 4PCVA 1AUVA 2XMPA 3EEFA 3Q98A 2NWQA 4DM3A 5JBNA 3H16A 2EBWA 2Q45A 2Q3EA 1G55A 4I9NA 4S1NA 4UDNA 3UUWA 1D5CA 4AVYA 1W0KD 3P0FA 4UE6A 2R6ZA 4Q16A 4R51A 3Q9UA 4ZVTA 5KWVA 1PNOA 2GPSA 4HV4A 1HG0A 3IURA 2CUTA 1KORA 4JJFA 4KLCA 1SJ9A 3HZHA 3ITDA 4KDRA 4HAVA 2O3QA 1H6CA 3RS9A 1TJNA 4TZKA 3KJQA 3CYFA 3QUBA 4L6AA 1D03A 4PIVA 4ARBA 4B3MB 3ZHYA 1NY5A 4KBYA 3SBOA 5KNBD 3DFIA 3DFUA 4KXWA 4LHYA 4RHXA 3COWA 4R98A 5LMZA 5LA6A 1GIAA 2Z5GA 4P7KA 5K0ZA 5CYPA 3AFIA 2XB6A 1QGDA 2X0JA 2WYHA 5F7ZA 4P7JA 1JKIA 3RTCA 2PTHA 1YQGA 3I76A 4FR2A 5BNWA 1W85A 2MSNA 4ILEA 2MSCB 4NBLA 4EG5A 1XCGB 1F0NA 1M10A 3EF0A 5JBQA 3FNFA 2PU5A 1FA9A 2M9MA 2QVBA 4NDAA 5ALPA 2NYVA 1GR1A 1CUGA 2YWJA 1CUSA 5JS6A 1HQCA 1A77A 2XBMA 3NNSA 2Q1WA 5T8KC 3RJ5A 2YJNA 3BK2A 4PFSA 3I9LA 1K4KA 1JDTA 4YA6A 1KAOA 1G16A 1DEOA 5A71A 3DR3A 5LD2C 2FR8A 3H3XA 1MB3A 2C5FA 5KSPA 2YC2C 4Z3KA 4BNHA 3EGXB 4WZBE 1QNLA 4F86A 4IO0A 3R9IA 4ENWA 3QBJA 1ZOLA 3EZYA 3HV0A 1XROA 4HGQA 3PWZA 1KZ7B 2IEGA 4B3HA 2O57A 3FHLA 1J9EA 1TYBE 1I6MA 1BYUA 4KMOA 2Q8QA 3DE2X 5AOVA 2B36A 2WM9B 5FI3A 8MHTA 1TL7C 1S01A 3PLAE 4B3GA 1PQWA 1O08A 4I4IA 3C4JA 4ENSA 2PA3A 3C6BA 2J9GA 4YR7A 2VPIA 3K0KA 4N0DA 3U9LA 2WFAA 1W36D 1L5SA 2OLJA 1USIA 3WGGA 4B2LA 1OUMA 5EYPB 3ZE1B 1AKEA 3ILSA 1ZD1A 1XTZA 4DV4B 3OPYB 4HVTA 4QJIA 3S4YA 3IIEA 3PNKA 2H18A 3LH5A 4MIYA 5EHQA 3R09A 3WGJA 4MYHA 2CB0A 2XMDA 4AMYA 3LZCA 4X5OA 3AEUA 4HS9A 2C77A 1NW9B 1W48A 4TRJA 2V45A 2IBSA 1QQ5A 4M9SA 4G8DA 5JO0A 1QPBA 2NUAA 5LBUA 3TF5A 1UBEA 2C3OA 1OZFA 4P86A 3A25A 4WLUA 1WRBA 1D0SA 2AEMA 1KXZA 1XTTA 2BHSA 2E87A 2WFMA 4IGFA 3ZQ6A 2VPXA 4AX4A 4BYGA 2HHJA 2R00A 3I28A 3LRPA 5JSKA 4D3ZA 5DXFA 2XV1A 2RE8A 1KMHA 3NTUA 7MHTA 4OB7A 1TCBA 2OZLA 2YNMD 1EJBA 3C74A 4LTDA 3K8QA 5HFAA 2NU8B 1KMMA 1TCAA 3BEDA 1X0XA 2FU5C 1CY2A 3AO0B 2IZ0A 4IPTA 4M8NE 4X6XA 3F4BA 3AVYA 3EGIA 1W4LA 2BFNA 2O2EA 4OF4A 2IYVA 1MF7A 3LUHA 1NR1A 1H6AA 3H9EO 3KDSE 3J7AC 4N03A 2W6IA 4EG7A 2IS6A 1YONA 2UVPA 2AW5A 2JI4A 1WVGA 1T8RA 1DWUA 3WO0A 4LNUB 4V0OA 5ITWA 1PDWA 1RWMA 3GEDA 3N8HA 3ROGA 2R8RA 2ATCA 1SOUA 4I99A 3MWLA 4Q37A 3ZWNA 4NBKA 2XB9A 1THTA 4QPPA 4BJHB 1LY1A 3IAFA 4YJKA 3E2MA 4H18A 3H05A 1PQPA 4R5HA 4UUNA 5K3BA 3W04A 5LU9A 1DDOA 2HY7A 3ZNNA 4CNQA 1V8ZA 2IZ7A 5FAKA 4HLQB 1QRAA 2X8JB 5BT8A 2C7RA 4XIYA 1D4ZA 1HT3A 1UPBA 2C4NA 3LPMA 3QU7A 4QSMA 3PNSA 5D3ZA 4DLLA 4Z7NB 4JYZA 1K7FB 1NLFA 1Z8FA 1V35A 1UM9A 2VHYA 3AR2A 5AM3A 1YT5A 1SR8A 1JNXX 1SIOA 1IXYA 1R6XA 1W75A 2R8OA 4INAA 5BWCA 3WK5A 2WMDA 3SN6A 5B3KA 3H1EA 5C8YB 1TZ2A 4LDNA 4MWSA 5KYUA 4BV3A 4S0XA 1SHLA 4LK3A 1H4SA 5FPQA 2W42A 2ZRLA 1DU4A 3HU5A 1NTOA 5KOJB 2OHIA 1F12A 3UTCA 3NVDA 2OAQ1 4FK8A 2XE4A 5EIFA 2YWCA 4JCOA 5LNK1 3A1VA 2ZWVA 4G5RA 1UKVY 2C0PA 3GJ7A 1SWVA 4MIOA 4RMGA 4W82A 1PJCA 1QGED 1E1YA 3DNFA 3FZQA 3KSMA 1HK7A 1WOMA 1ZCJA 4GNKA 4JL6A 4OU4A 1FP6A 1ADYA 2AJDA 1ZK1A 2QD5A 4FEGA 3ZWKA 5B4VA 4AT1A 2I7TA 1G2OA 2VPTA 4EB6A 1ABFA 2GK6A 2VF5X 2IYPA 3LT4A 3FB1A 2D7CA 2CLSA 4NJMA 5CVCA 1RXSA 1SHUX 2K2WA 4N0EA 1UK8A 1A9OA 5FPSA 1TX4B 2ZR7A 2MWMA 3IE0A 1MX5A 3LKDA 3OPMA 1MX1A 5HMMA 2XOEA 2OBBA 1ZNZA 3DO6A 4FHEA 5JQGA 2GB4A 2H5JA 2ZTSA 1LDMA 3EVGA 3TIGA 4F45A 3W90A 1O5TA 1S6YA 4QDTA 3CVVA 1XJWA 2IYLD 3PNQA 3U56A 3RV3A 4TYWA 4OI4A 3WDLA 1ICEA 1Y8QB 4DBLC 1E5LA 1EJ2A 2B94A 3IC5A 2O2XA 4WKPA 4EHDA 1JMKC 1Q6ZA 3GROA 1VBMA 3NM4A 1TEVA 4GG1A 4IKEA 3VAYA 3W5HA 5JNSA 1GPWB 5IM4A 3LUPA 5H8WA 2JLUA 1V7PC 1GL6A 1V4BA 1GCIA 2NNWB 5CK4A 8LDHA 5IT4A 5HRUA 1M5TA 3MWYW 1Z2NX 2BEVA 2IPLA 2WG2A 5HZKA 1IZ8A 1BOFA 3T34A 2NAFA 3TKLA 1STOA 3H8JA 3OLWA 3SJZA 4DHWA 4G2TA 5EZYA 4IIGA 1CG6A 3J81k 4CL0A 2C2OA 1KVTA 2XGGA 4QRIA 3SYLA 4AIRA 4B46A 1XSEA 4KGVA 2OD7A 1Z6AA 2DUWA 2YDYA 3EPPA 1V96A 4DILA 1P2SA 2ZI6A 3K09C 3N2KB 2XT9A 1GHTA 1NMZA 3R7NA 4GKAA 4YJ2A 1G8KA 3UN1A 2YZ7A 4U2KA 5B1IA 3KRTA 4LOAA 2E82A 5HS4A 4MUYA 1KYQA 2OV6A 3MRTA 1UC9A 2D1TA 2CNNA 3GLHA 3ABRB 4ZU3A 2FMKA 3TJRA 1X0VA 4B6QA 3N2LA 1ISIA 2PWPA 1GTMA 2A94A 4BVLA 1OFTA 3QKWA 4DWWA 1CERA 2GA8A 2FQYA 1SRRA 5BV8A 2QV0A 2VH2A 3DEKA 4NKRA 1EWQA 5KNCD 1TUGA 2R4TA 2VPZA 4C04A 3IXMA 2PZ8A 3KFXA 5CJPA 2YHIA 1DADA 2Q9AA 3A1WA 3NDRA 3Q3HA 3BMQA 1CLEA 3B6ZA 3PIDA 2EOAA 4BHTA 3FWPA 4GH5A 4U3JA 4D9MA 3ICPA 2QXTA 4RVFA 1OROA 3QI7A 5EUBA 4YPFA 2YS7A 3ZVRA 2VDLB 2C9OA 5CFZA 1JLKA 2B1QA 1FZTA 3OP4A 2C2ZA 1DIRA 2JCVA 2JEYA 2VWHA 3VQTA 4BVKA 1X38A 1S3GA 4ZMBA 4XVQA 5T57A 4I5DA 2CE7A 5CEFA 1XZQA 3WISA 2WM8A 1G60A 4RJLA 4PYKA 2VJKA 2VO1A 1RWOA 1SNYA 3C7AA 4JQOA 4RLFA 3FRJA 3GEEA 1ZI9A 3IKMB 4R0NA 3RIMA 2QQEA 4AL4A 2QPTA 4IGEA 4E31A 3JARA 5LKAA 2HJHA 2XCLA 2VNHA 3BE8A 3GN1A 3PNPA 3F8TA 1HWYA 2AG8A 1ZPDA 4E3ZA 5IS2A 1U8ZA 2ODTX 3F6YA 2IXAA 3QKUA 1QR2A 2OGTA 3U13A 5HM8A 4I55F 5AUOB 1IDN1 2CLHB 3PJDA 3HDVA 4MGEA 3GLIE 4IS3A 3FUTA 4ZAXA 1V6CA 5C2JB 4PBTA 4P4TA 3RLIA 2B8NA 1TJYA 2V6FA 3HXTA 4KO3S 4QNNA 4RMJA 4RBNA 5IXYA 3HACA 1RXIA 3HXPA 2VCHA 2WJGA 4MUNA 4RIEA 4LQCA 3HM9A 2VT6A 1SBQA 1SXGA 2SICE 1XZKA 3PRYA 3V7YA 2JZNA 5FRDA 4MR8B 4KUGA 1E1MA 3WYEA 3LE8A 4A8JA 1GGMA 1Y9EA 1I4DD 3P45A 1FE8A 1OW3B 5KYXB 1X1AA 2WU1A 1T5OA 4EHAA 4IW3B 1JAZA 1EU1A 2OBXA 1YU9A 3HUDA 3L0DA 5IBPA 4B7AA 4EMBA 5GAJA 3R7DA 3S7ZA 2WK1A 4PF1A 3NJ8A 1XNHA 2JJ2D 3QLEA 4OBXA 4QKQA 4F1WA 5HM6A 1G5QA 3FUUA 4P08A 1KJYA 3BWMA 3RQSA 4ON9A 1WF6A 2CXUA 1DXYA 1SUFA 2YV4A 3JR7A 1N6RA 1BDMA 4BVFA 2CLCX 2ISQA 1LS6A 3HN2A 4FVTA 3DL7A 5BVHB 4HDNA 3W5CA 3SIXA 1VE3A 4IIJA 3NXKA 1LTHR 1O97C 1ZITA 1OSNA 5ILQA 4EQ6A 4XYEA 1J5EB 3IOBA 1Z0JA 2BTQB 2IBMA 1HKHA 2HHAA 2XZPA 3OE7D 4YRCA 5JJIA 4DLPA 3U80A 4G1EB 1NI4B 3ZHQA 5F4BA 2LGJA 1DQNA 1KOFA 3N74A 3PRKE 2P9FA 4OH7A 4WZZA 5B4TA 4PWYA 4JX9A 1U2ZA 4CT0A 1J56A 2XDYA 1NI5A 5JZ9A 1PJ3A 1IOVA 1D3AA 2EX1A 2XRYA 4O2BB 5FWYB 5IUNC 2R8XA 1P4JA 1W0JD 4FSDA 1NRIA 4TTRA 1WUJS 4V39A 3V6LA 2EKLA 1ND6A 1HX7A 3ITKA 1OB5A 1N78A 1ODSA 3EFOB 5FO0A 4Y2QA 1T9AA 1Q1NA 5J2UA 1C9EA 3BHIA 4MWZA 3U1TA 1XELA 4WOKA 5EJMA 4LJ7A 2D0OB 1YMQA 1I4LD 3IEPA 3MIIA 3W8DA 3Q3EA 2Z5VA 4IJUA 5JCJA 3WP0A 4PGAA 3W3AA 2X5XA 1NW6A 4H9GA 5JQGF 1OFUA 5FL3A 1J9ZA 2G06A 5E9WA 3WFJA 4ZPJA 3QX7A 4L8YA 1XN1A 3UXYA 1W76A 3V4FA 2R1TA 1RAIA 1M8KA 3AR7A 1EM8B 3M5PA 3MN1A 1S1MA 5D3QA 5B12A 2BAGA 5CB4B 2G8LA 4KGDA 4MRVA 4C0LA 1NASA 3HJGA 5EPUA 3ZIAD 4D2IA 3O3NB 2EVWX 3L7AA 3T61A 1QBGA 1ORVA 3JWJA 1ZGHA 2P67A 1H23A 3C98A 4BKUA 2ZZKA 2JFXA 3F97A 1OXKB 4CM1A 4YRZA 4GKKB 3BS4A 3WYCA 1CUCA 5ALKA 3UJAA 3VPXA 2QMQA 1ABBA 1RWWA 2P40A 4AZSA 1E7WA 4JX8A 4ER3A 4DIKA 3KLMX 4KTVE 1K27A 1OV4A 1C7JA 2J6BA 3STWA 2RGRA 2A7QA 4XSHA 5CDHA 1U0RA 2Y0DA 2BUCA 1RQLA 3PQ4A 4YRJA 1M34E 2GXUA 4RTRA 4AJPA 1U0JA 1NLMA 4K2HA 1WDMA 1XDGA 3QVXA 1Z0DA 3MA0A 1LJ8A 1J25A 1GL9B 2DAPA 1WCV1 2R1UA 1XZIA 1KZ1A 2R47A 2Y2VA 3L7NA 4IV0A 4Z8XA 3AY0A 2P8SA 4LQ4A 4YDSA 1CRZA 1ESMA 3AERA 3BRSA 1A50B 4KKXB 5EP3A 4OHKA 3QVTA 3AUXA 6REQB 2GD0A 3MINB 3IGFA 1KR5A 2QYTA 1UQTA 1E1CB 4JQZA 4BVBA 2HYDA 4LUCA 1EVLA 3UTDA 4V0ME 1C9JA 2EHDA 3B8EA 3QITA 4B8WA 2ZWPA 5EHXA 4YRNA 2H4WA 4HWGA 1ZL2A 3SMQA 2VVTA 2X3FA 4G0PA 2HK7A 3X1XA 1YMUA 2RGBA 1U7DA 4MPDA 3A7EA 2F4NA 2VUHB 1R6DA 2ZWMA 1B00A 2BTOA 1ZD4A 4JDUA 3TLGA 1J5PA 4DNXA 2O3SA 2W6CX 3AJ8A 3TZBA 4WH0A 1QIGA 2J3HA 3T5GA 4BLWA 3AP2A 2DOKA 2CK3D 4K0KB 3COZA 3UJHA 3DT6A 1UT8A 1XJCA 1FSZA 1IZYA 1PYDA 1Y4AE 4BNKA 5B1EA 5ALZA 3S81A 5EINA 1CB7A 3HE3A 4FFBA 4WHMA 1CR4A 4B81A 2V98A 4RPCA 3CG4A 1QH1A 1X1RA 5I7WA 1RCFA 3ZI4A 4MR9A 3MT9A 4J0FA 4Z6KA 5J23A 3EGDB 1X7YA 2FWBA 2PFKA 2VJQA 1P2TA 3QNWA 1GTRA 5AW0A 3FMOB 2F3RA 3M70A 2BTEA 2E6UX 4S3MA 1N3LA 4UTXA 1YASA 2C54A 3K94A 1U5CA 2PGOA 2LTAA 4EDHA 3Q7QA 1F48A 1Q84A 1XZAA 1ODLA 1IXKA 1CIVA 1DPGA 5LZ8A 3TL3A 4YAJA 3L7BA 1ID8A 3BH0A 1MORA 4F92B 1XU7A 3EXFA 5KYNA 3JYHA 3OF5A 2C9ZA 3PITA 4DLVA 1QTRA 3KV3O 5EIBC 1EBBA 2V9PA 3ES9A 4NICA 1S3SA 3H8WA 1T2EA 3GK3A 3DV0B 4ESVA 1FSFA 2VUUA 4IXTA 5CGQB 1KZHA 1KAEA 4D41A 4MWGA 1GTVA 2OORA 3BKWA 4QEZA 1XWIA 4R7TA 4XQGA 3VR4A 4B80A 4CL2A 1B74A 4WCFA 2C7OA 1EFCA 1GKLA 2HMTA 4HADA 1QS0B 5KU7A 3LC1O 4EHIA 1OBOA 1OGIA 3PEFA 2DWOA 2A9QA 2D0IA 3KEOA 4JBYA 3WQQA 1TTTA 2HHHB 2JS7A 4G5SA 4HX9A 3S27A 5JRDS 3E5NA 3JQRA 3PD0A 1U2GA 5K6AC 2PMWB 5BSTA 5TGZA 4QJ3A 1FK8A 1JVNA 5KAPA 5ALQA 3MERA 1UR5A 1ECPA 1GZDA 3AF0A 3VMFA 4PSUA 5HOQA 3Q9SA 1E4VA 5B1HA 1ZVJA 4YS6A 2VH5R 3AHJA 2I6TA 4TTTS 3OCYA 4MVJH 5DYGA 1E7YA 3ZGLA 4FNMA 2JGMA 4RLSA 3D02A 3K5WA 3OY2A 1WY7A 2XQJA 4EGQA 2H1OA 5AVKA 2FPIA 3O8CA 1LDGA 4GEKA 3WLKX 1ZS9A 3KQTA 5AVXA 4N47A 4A82A 3VBCA 1QV9A 4QA9A 4UEOA 1IZ7A 2PGLA 2PWBA 2H06A 3S7TA 3MTEA 1XEAA 4Y2JA 5KPJA 3C5CA 2ZRBA 4EECA 3BTVA 3NWEA 3HA5A 4IH9A 4IH1A 4JBLA 1TNDA 5T64A 2BZSA 1P77A 3OEHA 2JBAB 3GRZA 1L4YA 4JENA 4O1IA 1JR2A 2A1TS 4FYXA 4HPJB 2CF6A 4KLNA 3T7JA 2X0DA 3CFYA 1IRIA 1TM4E 3QVMA 4OCZA 4QYTA 3D0QA 3WIOA 4BNIA 4CV1A 4INPA 1N2CE 4EY4A 3L1KA 7YASA 1R4ZA 3F71A 2X19A 2ARKA 3TQCA 5KWSA 1IZZA 2XW6A 4RV9A 4E7OA 2ZT5A 1L7AA 4KNWA 4CMBA 2BKLA 1I3NA 1O0SA 2PNFA 1QK4A 3CW9A 4Z4GA 5DV9A 1CJMA 1P72A 2CVFA 3R9WA 4YCMA 2CYBA 1DFGA 2R6JA 2XRZA 3OCWA 3T0IA 3A9VA 2OG2A 2NUBA 1XEWY 2ZWIA 2A5LA 4IY1A 2YZKA 5CK5A 1O5OA 3A8TA 5J2TB 1Z37A 5HIMA 4L0CA 3RSOA 1PIWA 1G2QA 4KVAA 4C9BA 1LLQA 3AFHA 1Z5OA 1EE2A 1KBOA 2BGNA 2E89A 2FH5B 1NF3A 3HB1A 3PHHA 1Z07A 3T9AA 1JDBC 4Y6LA 1U9CA 3MJFA 3OIUA 4EO4A 1HE8B 4NIMA 4LGYA 1SELA 3VNAA 1M2FA 5KBYA 1TA0A 1XLUA 2A5JA 2NPOA 3PJEA 5DYWA 4J2OA 1P9RA 4WL0A 2UZAA 4QFMA 1HYBA 1DC5A 2WICA 5GY7A 1CHDA 3PHGA 1G0OA 1I5OA 3N7AA 4B6GA 4GLOA 2XUJA 1Y0BA 3ESAA 5LNK6 1XXHB 4Q4JB 1QV7A 4NV3A 1FVXA 3H11A 4EPWA 1JDVA 4OTZA 5J40A 4WUTA 3WB1A 4BCCA 1KDOA 2G0AA 2WW8A 5AUQA 1WZ2A 2H0QA 3RYHB 1LX6A 1MO2A 1RLUA 5TMDA 4YCDA 4JXZA 1YR2A 1E1KA 4YRSA 4RE6A 3NS7A 3P9XA 3U62A 2YRWA 2FPKA 1N9GA 2FPOA 2RDMA 5IFLA 1K0FA 3KR2A 3NTLA 5D01A 4QD3A 4A03A 4Q19A 2IYEA 3IHWA 2BWJA 5EIHA 4AY4A 3OF3A 3RC2A 3V1UA 4ENPA 5ENVA 4WGFA 3F1KA 1T4CA 4Q4HA 3DPUA 4D3SA 4L9SA 5CNIA 3R7WB 4DLYA 1Z5NA 4JXKA 1K7EB 2CL7X 3NPAA 5GGXA 4DEYA 4QODA 3MZ0A 1ZJJA 4KYUA 2C4KA 1BGVA 4E32A 1ORDA 2VHEA 5COBA 1TMYA 4ABYA 3IDQA 5C81A 3DLTA 1NLYA 2J59A 4QGHA 1QAMA 5ECDA 2ATVA 2Z2ZA 2W70A 4AF8A 2HT1A 2HPHA 1OD6A 2V7UA 2A2ZA 1RTTA 3OJOA 4EYGA 5K8TA 1B8VA 3Q7PA 1C14A 4RPLA 4NE9A 4J0QA 3H97A 1SQ5A 1DAFA 3F6PA 4OIFA 3SG0A 5J43A 4JJEA 1BRMA 1E96A 4YH1A 1TYDE 1KC1A 3TLBA 2HYIC 5DNAA 4P38A 4ZAGA 4XJSA 3F8WA 3BJZA 1XVTA 3ODGA 4FW8A 1IBMB 2RAVA 1C0EA 1I80A 2BGLA 3U7QA 3AJEA 1N75A 1TQ4A 2GN1A 4RPIA 4JC4A 1Z4PX 5ALLA 2HNKA 1WJGA 2AEJA 4ENTA 5KNDA 4BAUA 4L6CA 3EUFA 1JEDA 2C9YA 3A10A 1ZGJA 3ESXA 3QOXA 2EBHX 3NGMA 1HQDA 1NDQA 5LBTA 4ZCPA 2A5DA 1U8EA 4UBJA 2CNDA 4CMIB 3CNHA 5FWNA 2VNSA 3AFOA 2CHQA 3L84A 4JVMA 1F5NA 2GK4A 2VQDA 1P4GA 3M6IA 4WSOA 4F71A 4QHTA 4GRDA 1RAFA 1C3OA 2BF4A 3STYA 3ZE9A 1GRNA 4A92A 5I7UA 3TNDA 3I34X 1EI9A 4BX8A 1UKYA 2GFQA 5J4YA 2QTLA 3MPUA 1E7MA 4GEGA 5ECYA 4U1RA 1G20E 1I6LA 2ZI5A 2JATA 1UF9A 5KTMA 3BXXA 3ROEA 3C6QA 4HY3A 1M2KA