1HYEA

Crystal structure of the mj0490 gene product, the family of lactate/malate dehydrogenase, dimeric structure
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
307
Chain Sequence
MKVTIIGASGRVGSATALLLAKEPFMKDLVLIGREHSINKLEGLREDIYDALAGTRSDANIYVESDENLRIIDESDVVIITSGVPRKEGMSRMDLAKTNAKIVGKYAKKIAEICDTKIFVITNPVDVMTYKALVDSKFERNQVFGLGTHLDSLRFKVAIAKFFGVHIDEVRTRIIGEHGDSMVPLLSATSIGGIPIQKFERFKELPIDEIIEDVKTKGEQIIRFGPAAAILNVVRCIVNNEKRLLTLSAYVDGEFDGIRDVCIGVPVKIGRDGIEEVVSIELDKDEIIAFRKSAEIIKKYCEEVKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE/MALATE DEHYDROGENASE
publication title Crystal structure of the MJ0490 gene product of the hyperthermophilic archaebacterium Methanococcus jannaschii, a novel member of the lactate/malate family of dehydrogenases.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Oxidoreductase
total genus 106
structure length 307
sequence length 313
ec nomenclature ec 1.1.1.375: L-2-hydroxycarboxylate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1hyeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1hyeA02
5DZSA 4D44A 4G2NA 4CM9A 1I33A 5CEEA 5JCJA 2ZTMA 2VZ9A 4YAJA 3NKLA 1DIHA 4JP2A 2AXQA 2YV1A 3M2PA 1M76A 4G81A 3KBOA 4H7PA 5JXWA 4Z3DA 2Q3EA 3ETDA 2BGKA 3GVIA 5JAZA 1HE5A 1GYRA 1AUPA 3CE6A 2IODA 3V2UA 2PD3A 4B79A 3RUCA 2Y0CA 1YOVA 1DEHA 2BF7A 3F5SA 4D3FA 4S3MA 1GCUA 5A9SA 1PQUA 1Y7TA 4OAQA 1SB9A 1PJCA 3BA1A 1A9YA 5HS4A 3U5TA 3E5RA 3GLQA 3GRPA 4DMLA 2B4TO 5CPFA 3KVOA 4AJ4A 5BSFA 2ZB4A 4RZIA 2F1KA 3JSAA 2ZTLA 4JBGA 4XR9A 5CDSA 3DBLA 4A10A 5TIIA 1W4ZA 3GHHA 5C7IO 4PIVA 5L53A 4IS2A 2FOIA 4CM3A 3EVTA 3UW3A 1QR6A 1WDMA 2VNSA 5THKA 3RUFA 2NADA 4Z0TA 1ZIDA 4RJTA 3PYMA 3OECA 3RROA 4B4UA 1ADGA 2NU9A 4IDGA 2YW9A 2EV9A 4HKTA 1JN0A 3E82A 4PG6A 4D7AA 4EGFA 3SJUA 1HDOA 4W99A 2DTDA 4ZN6A 3A1NA 4GSLA 1DAOA 5KJEA 3OF2A 4MVJE 4RVUA 4FGSA 3RIHA 3SC4A 3ZU5A 3KYCA 3JCZA 2BFPA 3OIDA 2HCTA 2X0JA 3JQ6A 3NDRA 4BGIA 3PIDA 1X13A 1FDSA 2BGLA 1PJQA 3HB4X 2BRUA 4XQGA 1X7HA 6LDHA 3EGOA 3L9XA 2Y1FA 2ZIZA 2WWRA 5EQDA 4FJ0A 4A2CA 2R6JA 1JW9B 1MGOA 1E77A 2QIOA 4IMPA 1KEPA 2V7PA 2VHZA 1XG5A 5CHEA 1WP4A 1NHWA 1LXCA 1ZMTA 3EZLA 5TSDA 1GCOA 4AJKA 1Q0LA 3ZI0A 2NU8A 3C24A 4F3YA 2A4KA 1E7SA 2BMAA 3FPCA 3I6IA 1QKIA 2VHXA 3JD2A 4W4TA 3JYOA 1NVTA 3TL3A 1PU2A 4M1QA 5F1KA 1ZK0A 4E2XA 1JDJA 4Z9XA 3M1LA 1DIRA 4I9UA 4FB5A 3NJ8A 3RI3A 1W8DA 1QLJA 1M67A 4B4VA 1WNTA 2IYPA 1KBZA 3DXFA 4K6CA 4PFJA 4UVEA 3QLJA 3RVDA 4XYLA 1FDTA 3D64A 2A92A 3AY6A 4NPCA 2O4CA 1ISIA 4QUKA 4A5OA 4JN6B 3ENNA 1NQTA 4BL5A 2YQ4A 4UVGA 3JQ7A 3EW7A 1YJ8A 3KYDA 1MFPA 3K9QO 4B7CA 1ZW1A 3AWDA 3STHA 1Q1NA 2BI8A 4KP7A 4PG7A 5EMHA 1UDAA 2ZQYA 4CR6A 2NU6A 3OIFA 3BHJA 3KUXA 3V5NA 4AFNA 3TZ6A 2GLXA 2Y05A 2DFDA 3IL2A 4IXTA 1BSVA 3BZUA 2FR8A 3CSDA 1GV1A 3ETEA 1N5DA 4L8VA 1R4NB 1EDZA 2OOSA 5T8KA 3SX2A 3UHAA 4XQCA 1W0CA 3ZWAA 2E6UX 2IXAA 4P8RA 1QXSA 5COQA 1YH3A 3ZU2A 1P74A 1XYGA 2BFOA 5FI3A 4FOSA 2J8ZA 4I08A 2X9NA 1ISHA 5DCYA 5TLSA 1E7WA 3I52A 1HKUA 3WGTA 1WDKA 2Q4EA 3W8FA 3B6ZA 2EIHA 1OBFO 3AW9A 1BG6A 4GLLA 4E2WA 5L4LA 1WPQA 3H9UA 1UDBA 4IM7A 4PLPA 3H5NA 4ZQEA 1NR1A 3RUHA 3T4EA 4F46A 4TRJA 3MOIA 1ENPA 3TL2A 4YAKA 3INGA 4KDEA 3VZQA 1YDWA 1U4OA 3F6YA 4MPDA 3W8DA 5CDGA 2ZATA 3WFJA 1U5CA 1ZO8A 4XYGA 4GPD1 5KNLA 1DPGA 3HFSA 3L4BA 2BHLA 1VM6A 3QVTA 5IZ4A 1CIVA 4LRTB 4UEOA 4AVYA 5IDXA 5MDHA 5ILOA 4R9SA 4BKOA 8LDHA 1E92A 4MVJI 1PR9A 3DBHA 1DIBA 1ZCJA 2DLDA 4CPDA 1I0ZA 3NEPX 3QVWA 2C0CA 2OHXA 1A27A 1NFFA 1PZFA 3IUPA 4WEOA 4DWVA 4CLXA 3K5PA 4YAIA 2OZPA 4DREA 4K28A 4BO1A 4YTEA 3EY4A 3AU8A 5BR7A 3TSCA 5KCZA 1NNUA 4GVXA 1DC4A 2H6EA 3GG2A 3H9JA 3OQ1A 4AG3A 4XB2A 5A03A 2DC1A 4IY1A 3DBVO 1EUDA 4M54A 4EI2A 4G5HA 1PWXA 1MFZA 4GX2A 4W7HA 1NVMB 1XHLA 2O3SA 1YQDA 2OFPA 1PJSA 2P9GA 2YUTA 2ZTVA 4GVLA 1SBYA 2DBVO 4RF3A 3VKVA 2YHUA 4XDYA 3G1TA 2W2LD 1FK8A 1ZMOA 4N18A 1ISMA 2EJWA 3SEFA 2J3IA 2D0IA 1AXGA 3ITDA 4FGWA 4ALKA 1GYPA 2ZB3A 4K26A 3BIOA 1PTJA 5ER6A 9LDBA 3W4JA 5TT1A 1WW8A 4ZRMA 1T26A 3QV1A 5JMPA 1EEHA 1B8UA 3WGZA 3L6EA 2X86A 1LBEA 2YFQA 5IDWA 1GZ3A 1DDOA 3HFGA 3LLVA 1VKNA 2B69A 4N5LA 2A35A 1HZJA 2Q1SA 2Y99A 4DPMA 1GDHA 1XR3A 1O89A 1GYQA 2C07A 1TA4A 4L74A 5DCUA 1D4FA 3N58A 2NVBA 4YRAA 4GBJA 4P4GA 1K89A 1IZ0A 3MOGA 5DBFA 3AOGA 1PGPA 2DFVA 3FF4A 3FN4A 3DZBA 4GGPA 5HRUA 4E33A 1YDEA 1XSEA 3D3WB 4ALLA 2I9PA 1K6XA 5AXAA 4XYMA 3PLNA 1MB4A 4MVJD 4WLFA 1LC3A 2PV7A 3QVXA 4E5MA 1C1DB 2NACA 3NTOA 4K6FA 1Y5RA 3OM9A 3QE3A 1SEPA 1B26A 5G2OA 2W2LA 2FRDA 3IKVA 4JLWA 4XEHA 3GZNB 4CMJA 2C2YA 1KVTA 1E7QA 1GUZA 4ID9A 1UXGA 4WNIA 5GY7A 4DGSA 4D45A 4LISA 3OEWA 2IEBA 3DO5A 1F8FA 3K73O 2W8ZA 4AJNA 4R5MA 3WYBA 3VDQA 3AK4A 3DMTA 4IS3A 1PJLA 2I6TA 5BNTA 4PLHA 2PY6A 3RFXA 2B5WA 2RCYA 3VTFA 5A1TA 4A27A 2RHCA 3RFTA 1ISJA 4WLVA 2ZYGA 4J1SA 1E5QA 5T8KC 1B2LA 1V3TA 5I7FA 1E1MA 3M1AA 3GFGA 2EG9A 4NFYA 3UKOA 3IUSA 4J6FA 1VC2A 1ZXBA 3DEYX 4MVJA 1VJ0A 1UP6A 1ZBQA 2Y1DA 5I7EA 4AJIA 3KLPX 3MJTA 5AQ1A 4RV9A 1I2CA 2POQX 3GUYA 3H9EO 4O5OA 4ZQBA 3ZNOA 5DN9A 3UN1A 3OJOA 3V1YA 2GUGA 4IIVA 1KVSA 1UZNA 2EJVA 3X2EA 3HSKA 5DNAA 1F8GA 2XXJA 3I9NA 4BMNA 1ZUD1 2IYOA 4DIOA 2GN9A 1HDRA 3WMWA 4IZHA 3WWZA 1VE9A 3NGLA 1V0JA 2FSSA 3L4BC 2P68A 2C20A 4CMAA 3EDMA 3NDIA 2D8AA 1DIGA 4OXYA 1QYXA 4U0KA 4E21A 4J7CA 4IIUA 3F4LA 1S6YA 3AUSA 4U7WA 4YPOA 5A5EA 4I1IA 4L73A 5CEJA 1LRKA 2VHWA 1NQOA 2P5UA 3CINA 4MINA 4RVSA 2Q1WA 1PR3A 2BLLA 4MVJF 4E12A 1ONOA 4TKLA 4FFRA 4PLGA 5IFLA 2VCYA 4D43A 2LDBA 2VYVD 4CV1A 3WOHA 2IRWA 2IZ1A 3WR5A 3WSVA 5FYDA 4BO3A 1I5RA 3GDGA 3GHYA 3TZQA 1LQUA 2Q1TA 1XU9A 1HYGA 5GMOA 1PS9A 4OKIA 4RVHA 4OYRA 3GAFA 2QW8A 3TZCA 1J6UA 3NYWA 2VYND 3I83A 4E5PA 3WQQA 2WSBA 5JFOA 1GADO 2EXXA 3JD3A 4QFDA 1TT7A 4FFMA 3B1JA 1E3WA 2VT2A 4D79A 1X14A 1KYQA 3HDYA 3RAJA 2DU8A 3OBBA 3OMLA 1EK6A 2HK9A 3L6DA 2ZYDA 1BXGB 4P22A 2HAEA 3SBOA 3PWZA 3FCOA 5TRTA 3NDJA 1MXFA 2WD7B 1GZ6A 3QSGA 3LZ6A 5ENVA 3BMNA 2ZB7A 3FI9A 4Q3AA 3BTVA 5IDYA 4EEZA 2UUPA 3DAPA 4EYEA 2VUSA 5CEFA 1HEUA 2Q4BA 2X0IA 1NAIA 3EC7A 3I9MA 1R0LA 2C59A 1ZXLA 5I8ZA 4ALIA 4AL4A 2CDAA 4O6VA 4J16A 3EMKA 3MTJA 4HBGA 1Y6JA 3MTGA 3B20A 1E7YA 2AQHA 4EJ6A 2YJZA 1X1EA 4YVFA 2EKPA 3H2ZA 2VYVA 1WZIA 3R6DA 3JQEA 5CDYA 2DBZA 4DPLA 4Q3BA 4ILKA 4WOJA 2CVQA 4R68A 3C1TA 3GMSA 2DBQA 4CL8A 7ADHA 1PJ4A 2DUUA 2IZZA 1E3EA 3GGPA 2EKQA 3F1LA 4Y98A 1YOVB 3PK0A 2VYNA 5DCWA 2B4RO 4XDZA 2DBRA 5JNLA 4MP6A 3I6QA 1DO8A 2Y66A 3FBGA 3RJ5A 5F5NA 1U28A 2RIRA 4TVBA 3OJLA 4J1QA 2DQ4A 3GRKA 4MVJH 3QVSA 2H1SA 4ND4A 4BIIA 2QG4A 1JLLA 1SOWA 1T2EA 3BMQB 4BQPA 3GGOA 3ENKA 2XAAA 1BVUA 4J0EA 4JXKA 3LF2A 4Z6KA 3DBLB 2X5OA 3WGGA 4J4HA 1PL7A 3HN2A 1H0KA 1GU7A 4XA8A 4WCFA 4GH5A 4XB1A 3JTMA 1T2AA 1E0DA 3FNGA 4W7IA 1LDGA 1LUAA 3GG9A 3S2GA 5KJ6A 3DMTC 5FF9A 4XGKA 2HK7A 1PGOA 3RWBA 2P4QA 3AFNA 3Q2KA 1AE1A 5G4LA 4CR7A 1B3BA 4B3HA 5TJ9A 3LYLA 2UAGA 1EQUA 1PIWA 4WLEA 2OUIA 2QZ9A 4JX8A 3V8BA 3WMXA 4YR9A 1A9ZA 3MJSA 5DBIA 1V9LA 1DXYA 1AGNA 1H6BA 3UXYA 2C5EA 5A3JA 3KYCB 1NFQA 3K2BA 2VZ8A 1KS9A 4XQEA 1K5HA 2EW8A 4RDIA 4LGVA 1NWHA 2HJSA 2BKAA 2GZ3A 4BNUA 1FJHA 1PGJA 1V3VA 5FFFA 5HTOA 1B8VA 1BXKA 4KUEA 2GZ2A 5BSEA 2XPCA 4FFLA 1PGQA 2J3HA 4FFOA 4H3VA 3ZWWA 3AUUA 4L4SA 1IY8A 1I01A 4EUEA 1YQXA 3QQPA 4WEQA 1NBOA 1P44A 1U3VA 4WGGA 4CQMB 4IDEA 1YRLA 3TOXA 4CV2A 1DRVA 4H15A 3DMYA 5DULA 4AJJA 3DWFA 4F6CA 4D3DA 4KMSA 3MJ4A 4H16A 4QQRA 4UVIA 3NAQA 1X0VA 5EIOA 2Y0DA 1GEGA 1LSSA 4GI2A 4KWIA 4TSKA 3VZSA 4EW6A 3KEOA 4NBTA 4O0LA 3E48A 1JAYA 2Q45A 5A5FA 3IDSA 2I5PO 5TJHA 5L45A 1QV6A 3BMOA 4YBZA 5CG1A 3UAGA 1YL6A 8ADHA 2PKQP 2FN7A 3GQVA 4F45A 2OO5A 4MIYA 4BGEA 4GX5A 3ADOA 1UR5A 1OZAA 4XGNA 3VOSA 4Y67A 2ZJ0A 4Y8VA 4HXYA 1H94A 3PXXA 4IQ8A 4CM7A 4ALMA 3WBBA 3OETA 2GZ1A 3S2FA 2I3AA 3LK7A 3DFZA 1EFLA 1T4DA 1HYEA 2X4GA 1PJBA 3RU9A 1SAYA 1RM3A 5A3VA 2VHYA 3ON5A 4R16A 4K9DA 1RKXA 4TZTA 1YVEI 1E1KA 2ZYAA 1B8PA 1D3AA 3KYDB 3O8QA 3GNSA 4OGWA 5EJ2A 4HFRA 4DQVA 4PLWA 3Q11A 4IGFA 4U6QA 4A7PA 1VL6A 1XU7A 1YO6A 3IMFA 1YB5A 4R1NA 1IYZA 2WE7A 1EZ4A 5LDGA 4DYVA 4EEXA 3GAZA 1EBFA 4YJFB 3UCEA 3GFBA 1ZFNA 4L9RA 1I3KA 2AQ8A 1EUZA 2BFAA 4L4XA 1B16A 3ETGA 4BNKA 3QP9A 2RH8A 2GPTA 4CLOA 2RH4A 4BGVA 1MX3A 4BMVA 1W6UA 5HBRA 5LDHA 1PZHA 4UUNA 1BVRA 3RC2A 3T7EA 2Z1MA 2NV6A 4B8ZA 1H6DA 1FF9A 1DIAA 2QRKA 4YJHA 1ZJZA 1QYWA 1QORA 1I30A 5KJ1A 1IUKA 1EK5A 3GR6A 4OOEA 4I5EA 1KEVA 1XQ6A 3W6UA 3JYQA 5U9CA 3LC2O 4PVDA 3D7LA 4EUHA 3ZHZA 3QWIA 1AHHA 1LSJA 1U7TA 3QJ5A 3H5RA 4RVFA 3NRCA 1N8KA 1F14A 3ZWPA 3IC5A 1OI7A 2V6FA 4QTZA 1VRWA 4AJOA 3OJEA 2GN4A 4CJXA 3DBHB 5JYEA 1ADFA 1ZZEA 3WGIA 5ICMA 1L1FA 4BNNA 3OHSX 1DLIA 4YQYA 4BVAA 4UVHA 1PZEA 1U7HA 4MDHA 3VC7A 2D4AA 3GF4A 1QYCA 5JW6A 5IF3A 4E4YA 3DHYA 1EFKA 4JBHA 1F06A 2NVWA 4WCFC 1ZSVA 3WYEA 3EAGA 2FHSA 3RUIA 4YAEA 2FPGA 1NASA 2ZCUA 1Z75A 4RL6A 4YT8A 4NBRA 4WJZA 2HRBA 4J4BA 3NGXA 4BKPA 2PKRA 1E6UA 1KY4A 2OP0A 3IJRA 1I10A 1E1LA 4RPHA 3Q6IA 4XD2A 1XWFA 1EDOA 3DL2A 4ZQFA 1C0LA 2NSDA 4ND3A 3PQDA 4J1TA 3U4HA 2PD6A 3FD8A 1Z45A 3QWHA 3MZ0A 2PD4A 2Z95A 4B7UA 2E48A 1H6CA 1RYDA 4MP3A 1Z73A 2FPPA 2NVUA 4ROSA 3WQSB 4ND2A 3RU7A 2BD0A 5DDIP 3CKYA 1EQ2A 4JIGA 4Q3NA 3F46A 1ZH8A 4RF2A 3ZV3A 1ISFA 4OHUA 3U3XA 4EUFA 3ZHXA 3UF0A 2FR0A 1U2DA 3IAHA 2VT3A 3TFQA 1LEHA 4TVOA 2QX7A 4URFA 3A4VA 3PLRA 3MWDB 4GSKA 2WDZA 3KM0A 1Q7GA 2NU7A 2O2SA 2Q46A 4PCVA 1QG6A 1KOLA 1RPNA 1KVQA 3NTQA 4MP8A 5JAQA 1K6IA 4E6PA 3ZW9A 2Z5LA 2HLPA 2PZJA 3WLFA 4E2ZA 4DPKA 3D0OA 5IJZA 2PZKA 4O1MA 3HNPA 2G17A 2O7SA 3RQSA 3WIDA 3GDOA 4X54A 5A4DA 1VJ1A 4WK6A 2Q2VA 3PHJA 4CMIA 3L0DA 1YGYA 4JNKA 1W73A 4FS3A 1HDZA 4HFNA 4J2OA 5JDIC 3A28A 3JQ8A 3EVNA 2YY7A 4IDBA 1XIVA 2J5KA 3LF1A 4XKJA 3D5TA 5DOZA 2W4QA 1LDNA 1I36A 4BNWA 3TRIA 4RPLA 4PG5A 4ZICA 1UH5A 3IOYA 3COSA 2YDXA 3EYWA 4B3JA 3MJVA 1YXMA 1QV7A 1YBVA 2VTDA 3FNEA 2CUKA 3U4DA 1PZGA 2PFGA 2W2KA 3RBVA 2O3QA 1LA2A 3CZMA 1T1RA 2CSUA 1E7MA 2O50A 1G0OA 2EP5A 3BHMA 2DKNA 3DZFA 5L95A 5TS3A 3D3EA 3HZZA 3WGHA 4ZA2A 4D3SA 2B0JA 1X7DA 1R15A 1EVZA 2R2GA 3W4IA 3KYBA 1KC3A 2EF1A 3FBTA 4IDFA 2V6GA 3WYCA 3ZHYA 1MA0A 1PGNA 2NQTA 3CH6A 3HQ4O 2A94A 4BUCA 2AEFA 1UDCA 4XRGA 5JC8A 4IINA 1Q0HA 4WASA 1O9BA 4N7RA 4JROA 1MP0A 4AJ2A 4CMGA 3E03A 4WLNA 3DBRB 3K31A 4Y9DA 3OICA 4XIYA 3T7CA 1GZ4A 5I9LA 4BNGA 1M2WA 4KZPA 1MLDA 3GPDG 1U4SA 4Q3CA 3E9NA 1Y8QA 2VUTA 4N5MA 3Q2IA 1J5PA 4YT2A 2FPIA 3ZWYA 2X7HA 5KIAA 3DC2A 3QY9A 1C14A 3VDRA 2G5CA 4BO5A 3OEYA 3GDFA 2Y0EA 3ZNPA 4E2YA 5JPIA 2D5AA 1BRMA 4RF5A 3DTTA 1V6AA 1YS4A 1Q7CA 1A4IA 1O6ZA 2EHDA 3O03A 2G1UA 5CDTA 1ZK4A 4XJSA 4BB6A 4ZHSA 3I5MA 3PHLA 1L7DA 5C7OO 2TMDA 1C1XA 1CERA 2NQ8A 4LK3A 2OP1A 1HE3A 1RM4A 1I2BA 2DT5A 5EERA 1ZK3A 4BNXA 1RM5A 2OGUA 3ROKA 4C7KA 1JVBA 2WJPA 3PHGA 1NHGA 1Z7BA 2EWMA 4E13A 5C5IA 3I3OA 1H2HA 4CMKA 5DP2A 1LDMA 4MVJG 4J7UA 3DQPA 5CPBA 1T4BA 1ID1A 2EKLA 4PZCA 1GY8A 5BNIA 1Z74A 4OIMA 1T1SA 5G0TA 1JU9A 4M86A 2XOXA 1ENYA 4C7JA 3GC6A 2CY0A 3W4KA 2J5RA 4CODB 3ASUA 4NU6A 2C5AA 3WSWA 4E31A 4MKXA 5KOIA 1HETA 3PIIA 4FC7A 1E3SA 4CM8A 1E3WB 4GKVA 5F21A 3AU9A 3H6KA 1HDXA 3L77A 4WKGA 3VTZA 3ICCA 1YKFA 4XQ9A 4OXKA 4NJOA 2WMDA 3W6ZA 2WE8A 3K96A 1YE3A 4ESOA 1IULA 4YQZA 4HFJA 1R4MA 3BMNB 3MJCA 3F5QA 2IXBA 3GH3A 4A0SA 2Z1NA 4LCEA 1OMOA 5EQFA 3WGQA 3AJRA 4BNTA 3GVXA 1XLTA 1CYDA 4DQXA 4M49A 3GGGA 1DC6A 1A71A 3LU1A 1HF3A 4OKNA 3E1KA 5H83A 1EVJA 4DQUA 4OM8A 4YCAA 3BYZA 3PDJA 3DHEA 5I9NA 3NUGA 1F17A 4NU5A 2JHFA 1GFSA 2QQ5A 3TNLA 4FFPA 1VSVA 4II2A 4J1NA 3Q1LA 3P2YA 1YONA 3O9ZA 3TQHA 4CV3A 1V8BA 4NMHA 5ITVA 2EERA 3K8ZA 2JD1A 5EESA 1HDCA 5GZ3A 4E3ZA 3HB5X 3FNFA 1NPYA 4NH4A 4R51A 1BW9B 4II3A 3HUDA 1A4UA 2JAPA 1T2CA 1XELA 1B0AA 2O3TA 4BNLA 1PX0A 2PGJA 4UULA 1CRWG 4Z0PA 1CJCA 1YJQA 2X8LA 3S8MA 2ZJ1A 1UAYA 3WG9A 1NQAO 3FTPA 4PG8A 3DZGA 1JKIA 4DC1A 3G79A 1NYTA 3IP3A 4KDFA 2YYYA 1TI7A 2VTEA 1O8CA 4IJVA 4BO7A 4WCFB 3M6IA 1FXSA 4E5YA 3TOZA 1HE4A 1ONNA 1CEQA 1UJMA 1OOEA 1Q0QA 4TZKA 1NVGA 4PLZA 1C0PA 2QRJA 4LVUA 4OQZA 2H9IA 3ZWXA 3PPIA 4HWKA 1LX6A 3KXDA 1G1AA 4BNVA 3SC6A 4OSPA 1MXHA 4ZD6A 1UUFA 1ADCA 1Y8RA 1PL6A 3ZGYA 4CUJA 1Q2XA 1HT0A 5BQFA 4IDCA 1BDMA 2DVMA 3JQAB 2OBNA 2V6BA 3QWFA 2VRCD 1X7GA 4P4LA 1JAXA 3D4OA 3ANLA 4IQ0A 1V3UA 4N54A 4BQRA 4HFMA 5ADHA 3FWZA 3ZU4A 2JCXA 4CMEA 4D41A 3LSYA 3CZRA 3LT4A 1QMGA 2CF6A 4GAEA 3WQRA 3ZNNA 3U62A 2HMWA 5AXBA 1P9LA 4BO4A 3ZNQA 3ZV6A 1WZEA 1ISGA 2HMVA 5H81A 3KSZO 3BMCA 1PJTA 4D42A 4CLRA 1QP8A 2SCUA 4ND1A 5T6BA 1Y9AA 3MCVA 4GL4A 3H7AA 3I9OA 3ROPA 4Z3KA 4CM4B 4DL9A 4DA9A 4NK5A 5L4NA 4J3FA 5BSGA 1VL8A 3K6JA 2OXIA 1UP7A 1P77A 4KQXA 4DRYA 2HSDA 2PH3A 3BMOB 4ONEA 1P33A 1E6WA 1T2DA 1VJTA 3ANNA 4TRMA 4OH1A 3VHRA 4A03A 2I67A 1ENZA 3G3EA 1QSGA 2JFFA 4WE3A 1EBUA 4U8GA 4NI5A 3QA9A 4CUZA 4BHTA 3EK2A 5JYDA 2GN6A 1ADBA 5G4KA 2VRCA 3BHIA 1ZJYA 1RWBA 1IOLA 2B36A 4IMRA 3C8MA 5G0VA 4L4RA 2VWGA 3KSDO 1GV0A 2FR1A 1NP3A 4R9RA 3RSHA 1P1KA 2X9VA 1NWCA 3DOOA 1ZVMA 3HG7A 1DJNA 1DLJA 2ET6A 3EUWA 4RGBA 4Y6SA 3ZV4A 3O8QB 4RQUA 3GOHA 2AG5A 1P31A 3NX4A 2VNAA 2Y68A 1NXQA 5ES3A 1I3LA 4LCJA 3E18A 5DP1A 1GQ2A 1HLDA 1D1TA 1LSOA 3N74A 5MGBA 3PTZA 2X9GA 4BNFA 4YXFA 2UYYA 4RQTA 1QYDA 4BOYA 5ITWA 3KLMX 1DB3A 4OL9A 1H2BA 4RLHA 2YQ5A 1UP4A 4NG5A 5IAAA 1J4AA 1LDYA 5IN5A 1BWSA 4KWHA 2AEMA 2IDZA 4CLOB 1PSDA 1SCUA 4BNIA 3MEQA 3D4NA 4G65A 5AXDA 3LC1O 1S7CA 4GX0A 2ZTUA 3PGJA 1DRUA 1HZZA 1O5IA 3Q0EA 1O95A 2G82A 4YJHB 5JO0A 3A14A 2V65A 4QT0A 4YDRA 4ND5A 2JFGA 3P19A 1PQPA 2B5VA 1SOVA 3I4FA 4FOOA 1LLCA 4R41A 5IZCA 3DDNA 3TDKA 2D3TA 2FMUA 1CDOA 4R1TA 4DLLA 1JWAB 1YWGO 3PFWO 2JJYA 3C3XA 2JL1A 3KSUA 5JBIA 1U2GA 2O3UA 1YB4A 2JKVA 5A9SB 1ENOA 1H9BA 4ZU3A 4FSHA 5U4QA 1ULSA 5ILGA 3PJGA 4BGUA 3C7CB 2WYVA 1WMBA 3W1VA 4D0SA 4NBUA 1OAAA 2ZKLA 3JQFA 4JJIA 5KJCA 1CF2O 5F3RA 4XRRA 4BV8A 5B12A 3VKUA 2GGSA 3KZVA 3F47A 3PFFA 4NFSA 5GZ6A 1P0FA 4JJFA 4OOFA 4DIBA 5L7TA 2OORA 4B3IA 3GNQA 5CDUA 1H9AA 4NFHA 5J23A 1ORRA 4Z9YA 5IN4A 1R0KA 4FJ2A 1IHXA 4CL3A 3CEAA 1DHTA 2VN8A 3VZRA 3BAZA 4XGIA 3PQFA 5AVOA 1DOHA 1N9GA 3UICA 3BTUA 3P5SA 3ZWBA 3OFSA 1EE2A 3DAGA 3V1TC 5T64A 5IXSA 4NZ9A 3PQEA 2X58A 3ZH2A 3D4PA 3OSUA 3DOCA 4OQYA 4ZGWA 2DPHA 4CR8A 3ZDFA 3PZBA 3WBFA 2P91A 2NVUB 1DBVO 1DFHA 2ZB8A 1ONPA 2ZQZA 1CETA 4CM1A 3VH4A 4CMEC 5ICSA 1NR7A 1JKFA 1YQGA 3LT0A 3K30A 3WLEA 2G0TA 3D1LA 4DLBA 4YYZA 3O38A 5BT9A 1DAPA 1TT5A 2AG8A 1A7AA 4P4NA 5B4TA 3KOUA 4R54A 3C1OA 2PGDA 4YWJA 3F4BA 5JY1A 3QWAA 3C1AA 3SVTA 4HNGA 3PHHA 1K3TA 4Y6PA 1WLYA 2J3JA 4FC6A 1JQBA 3AM3A 3GUCA 2GN8A 1GTMA 3JYPA 3MJEA 2CVZA 4PLFA 1BTOA 2VZ0A 5B37A 3GA0A 4FD3A 2CD9A 3IQDB 4N5NA 5G0UA 3RFVA 7MDHA 5CP8A 1HDGO 4W6ZA 1EVYA 4IJWA 3H65A 3U9LA 4CMIB 4PLYA 1I2ZA 1LC0A 3PHIA 2YHIA 4PLTA 4ZQGA 3ORFA 3JQ8B 3HJAA 1P1HA 3I23A 4AJ1A 5JY6A 1ARZA 3H8VA 4J9VA 5JAIA 1NTOA 5G0SA 1PJ3A 5JDCA 1DHRA 2B37A 3DZKA 2CZCA 1I24A 3DONA 5IXYA 1KETA 3E9QA 4FFNA 5BSHA 1JTVA 4ZJUA 1P1FA 1U3UA 3OJFA 1VSUA 3U09A 4O59O 3Q3CA 3SLGA 1UXIA 5JCJD 1KVUA 2HO5A 3H3JA 3JQ7B 4TRNA 3NT5A 2WD8A 3WS7A 3ZCXA 4RDHA 4JCOA 1K0UA 3JQBA 5JC1A 3PI7A 1YL5A 2E82A 2GSDA 4E32A 5B4UA 3R3SA 5DF1A 2AMFA 1HYHA 5B1YA 1A7KA 1CQIA 1FDUA 1SEVA 1U9JA 2ZK7A 2B83A 4M55A 4CM6A 1R0SA 3INRA 3JD1A 4IQGA 3ONFA 1LTHR 2FY8A 4IPTA 3PJDA 2GASA 1U3TA 2D59A 2FSVA 3WNVA 2GERA 5L9AA 3PRJA 2JCVA 4KUGA 5A9RA 1IB6A 2CVOA 1I8TA 2EGHA 2RBEA 3AI3A 3GK3A 1DSSG 1GPDG 2PK3A 3RKRA 4J90A 3OH8A 1RJWA 1RM0A 2OMEA 3GVHA 3P7MA 3IS3A 5BNFA 4HADA 3KO8A 1DFGA 4GGOA 4FQ8A 1EUCA 2P9CA 2VOEA 3R0IA 3U0BA 5IG2A 5B4VA 1XCBA 5C3MA 1HL3A 4W82A 1HLPA 2WD7A 5IZCC 5JAMA 1GUYA 3AI2A 2IZ0A 3U4IA 2AE2A 4BNZA 1Y1PA 2X6TA 2J5QA 4RCVA 4YJDA 1WMAA 3R1IA 3E8XA 2C29D 2CFCA 3LLSA 4XYBA 3WWYA 3ZN2A 1WWKA 3DR3A 4JBIA 5TGDA 3ZWNA 2HDHA 3HDQA 1JA9A 1PWZA 2PTGA 4JK3A 5T67A 4GX1A 4NQZA 5TT0A 4UUPA 3NV9A 2I76A 2UDPA 4FBGA 3RBZA 2BI7A 3CXRA 1O0SA 3RUAA 1WVGA 5TNXA 2UUOA 1C1XB 3JQFC 4Q9NA 1CWUA 4RLSA 5KKCA 1PS0A 4R1SA 3PWSA 4GMGA 2DAPA 3AY3A 2JAHA 1H5QA 1Y81A 3P2OA 5COAA 3L4SO 3WDSA 2E49A 3OIGA 1UXJA 1GAEO 2HRZA 1FMCA 2EP7A 2YFHA 1LLDA 2PR2A 4CQLA 3KETA 3RUEA 4YRDA 5CAEA 3BMQA 3N7UA 4GLOA 1LDBA 2NM0A 4PRKA 2C82A 3DTYA 4CQMD 2VWPA 2AHRA 4ZVVA 4Y6RA 5FEUA 3CMMA 3BTOA 4P38A 2C54A 3FWNA 5CG2A 1O94A 1T24A 3H4VA 4CM8B 1C3VA 1Y9EA 2O7QA 2GD1O 3L07A 3UGKA 3UUWA 5L4SA 4IGEA 3JYNA 1PEDA 2VWQA 1P1JA 5EN4A 1PL8A 3HE3A 3KTDA 1KEWA 1GEEA 4FPXA 1I32A 2TMGA 4EBFA 4Z9FA 2I66A 4XR4A 1NFRA 3PGXA 3IJPA 1R4MB 1F12A 3BXXA 3JD0A 3E5MA 4GKBA 5G0WA 3I9JA 3O4RA 1HRDA 2WM3A 3G1UA 3A9WA 4FCCA 2PLAA 3UOGA 4EJ0A 1PJ2A 4CLHA 5A9TA 3ITKA 4UEKA 4J2HA 3VAZA 3B70A 4WNCA 3ONEA 2DTEA 1NQ5A 1R16A 3GY0A 3X2FA 2J6IA 2NTNA 2O3RA 2JFHA 3CMCO 4MKRA 1H93A 1K2WA 3QW2A 4M89A 4BKRA 4Z0HO 2ZCVA 5K6AA 1G6KA 1M75A 1B15A 3MWEB 1D1SA 1HSZA 3I9LA 3WJ7A 4CQMA 2YDYA 4R3NA 3GT0A 4IUYA 4AJEA 3ST7A 1KY5A 1IL0A 2OBYA 4YA6A 2Q49A 4B4OA 5C37A 5JDCC 3TZKA 1E3LA 3WICA 2P4HX 4R01A 3UFXA 4DBZA 1SO8A 3ABIA 2VWHA 1R6DA 3GN2A 3SLKA 4L75A 4HY3A 3LQFA 1MV8A 3ZU3A 1EMDA 3DOJA 4RVGA 1GUFA 2BGMA 5A05A 4HP8A 2Q50A 2QRLA 2BH9A 5L3ZA 1N7GA 2IE0A 4CM5A 2R00A 9LDTA 1M66A 3S1LA 2AQIA 3JQBC 4ZRNA 2NWQA 4S1VA 1TB4A 4GQAA 2FP4A 3WFIA 2C7VA 1R12A 3WXBA 5AYVA 1SZJG 3B1KA 4NJMA 4DBVO 4LMPA 1IHYA 2I65A 1C0IA 3B1FA 2AEJA 4LSWA 3WJAA 4WOKA 1Y8RB 4J43A 2PZLA 5I9MA 3GVCA 1LJ8A 2Y1GA 4TQGA 3DB2A 3RBXA 5HWSA 4XJTA 2QHXA 3ADPA 4QECA 4YRBA 5LC1A 2DM6A 3JQGA 3HHPA 3I9KA 5EL0A 1E7RA 3CIFA 3SXPA 4CMBA 4YAGA 5HM8A 1TLTA 3FTNA 3H5AA 4J9UE 4PG4A 4CMHA 1ZSYA 2HQ1A 1SB8A 4R69A 5JSFA 3C7AA 3GEGA 4YJGA 1I3MA 1HDYA 4YJFA 2A9FA 4WPGA 5I7SA 2J3KA 1Y5MA 3G17A 3AUTA 4PVCA 2X22A 4QXMA 3RASA 3FR8A 3ULKA 1T2FA 2VRBA 5FWNA 4MIOA 3VH1A 2HU2A 2EEZA 3BMCB 5JLAA 4I5DA 4FW8A 4CLRB 4I5GA 4YEDA 1HSOA 4JJGA 3BTSA 3DZHA 5T5QA 3GNTA 4RF4A 2EGGA 2V6MA 3JQ9A 3LDHA 4J49A 4EITA 4A73A 3LC7O 3PDUA 1BXZA 4YACA 2O3JA 4FN4A 2H5LA 1A5ZA 3IP1A 1WXDA 5TQVA 4NR0A 1FDVA 3FSRA 2F00A 3QWBA 5EPOA 2PZMA 4BO0A 5G4KB 4OMUA 1U5AA 3RC9A 1KC1A 4ALJA 1B3RA 5CFZA 3OA0A 4E5NA 5TF4A 3WIEA 5F5LA 5JCXA 4M87A 1XA0A 1SPXA 2Y1EA 3G49A 4RVDA 3K2EA 2RAFA 1AXEA 1LSUA 1GL3A 1ULUA 4TMFA 1MUUA 1F0YA 4WCDA 3AFMA 2P5YA 4BKUA 5C7LO 3I4CA 3AY7A 2FZEA 4PRLA 4MOWA 3VPFA 2FWMX 1HWYA 3JQCA 1FDWA 3A06A 5ENDA 2Y93A 2C2XA 4UUOA 4IBOA 3Q9UA 2H63A 1E3JA 4MKZA 3E6AA 2O23A 3RKUA 2DPGA 4RPKA 1V35A 1J49A 4RPGA 4BO2A 3WGYA 3WX0A 3RC7A 3S2EA 4PN3A 2GRAA 3INTA 4LMRA 3RC1A 4U6SA 2QYSA 5K0ZA 1N7HA 2HK8A 5AOVA 3RUDA 1MC5A 5IDQA 1A72A 1R37A 2GYYA 3VPGA 3PJEA 3ZHBA 4HV4A 2Q1UA 1BMDA 3QIVA 3VZPA 4QEDA 1SC6A 1LDEA 1E5LA 2X5JO 5K6AC 1LNQA 3V2HA 1DC3A 2Q99A 5AXCA 1NPDA 4ZQHA 4GMFA 5A04A 3IIEA 3TWOA 3GMDA 2Y1CA 4DYDA 2VHVA 3DZIA 4EZBA 5JE8A 4I5FA 4TWRA 3F3SA 4HNHA 2HMTA 3JYLA 4BB5A 4BNJA 1LI4A 3NT2A 1N2SA 4NHEA 1BDBA 3ZWOA 4CLDA 5EINA 3JQDA 5GZ1A 1ZKMA 2PKQO 3JV7A 2PH5A 1ML3A 1UXKA 3RD5A 4UUMA 4FIZA 3VPHA 4DTIA 1SMKA 4CLEA 5KWEA 5TX7A 2R00C 3CTMA 3L9WA 5DOVA 1LRJA 3AOEA 1E6EA 4DUPA 5HA5A 5ER9A 5LCXA 5HS6A 3ROMA 1VL0A 3CPSA 4R5HA 2O48X 5THQA 3WTBA 2CNBA 2PWZA 3D5QA 2D5CA 4R3WA 1IPEA 1G0NA 1Z7EA 1LLUA 4UAGA 4YT4A 5FI5A 4BMSA 2P9EA 4EJMA 4XCVA 1VPDA 3E9MA 2UVDA 1N9GB 3OP4A 4FDAA 4TRRA 4E5KA 3FNHA 2B35A 2AE1A 4I9NA 4LW8A 2JHGA 2Q2WA 4EDFA 1TXGA 1XQ1A 2QZZA 4FR5A 1H6AA 4LN1A 4NK4A 2PGLA 1LQTA 2HJRA 3PWKA 2QYTA 1ZEJA 2WTBA 2C7GA 3UH1A 3OJ0A 3GVPA 3HN7A 2NNLD 1QYVA 1U3WA 2PNFA 3HWRA 3Q9NA 4MJLA 1UAGA 2NLOA 2GDZA 3PYXA 4U5QA 3H2SA 1LRLA 1R4NA 3ONDA 2NTVA 4INAA 1TT5B 3KRTA 4ITUA 4R4JA 4DLAA 1E1NA 5F1PA 2CDBA 3GZ4A 3PJFA 1DFIA 4J91A 1PS8A 1XKQA 4K1LA 4KQWA 3K92A 5I8WA 2I99A 2AA3A 1ZK1A 3V1UA 1IE3A 3EHEA 3ROQA 4E0BA 2HKIA 2NUAA 3SJ7A 2DTXA 2IEDA 3WB9A 3WTCA 1NPTO 2D1YA 3EZYA 3DBRA 3VPSA 3CUKA 1N92A 3JQ9C 3S55A 1B7GO 4BNMA 5L40A 1OC2A 1SNYA 4W9NA 4ALNA 4OJNA 3TJRA 3QRWA 4TKMA 4Q3DA 4TROA 2WYWA 1D8AA 3PYLA 4LVCA 2BELA 4MVJP 2YHIB 4BO9A 4C4OA 1XEAA 3ZV5A 3M2TA 4I8XA 1BHSA 2HMUA 3FPLA 2I3GA 4L0QA 1HE2A 2VOJA 3AM4A 4OSOA 3JD4A 2Y1OA 1JWBB 1XGKA 1UZLA 1MC4A 3AUAA 4U0JA 1K6JA 4LRSB 3T4XA 5L51A 3OQ6A 3ZWVA 4DVJA 1PQWA 1U1IA 3G0OA 3ZZNA 5A06A 4MVJM 2AQKA 4BS9A 4CMCA 1IZ9A 2JD2A 1DC5A 1B14A 2DUWA 3FHLA 6ADHA 3F9IA 3VVCA 5KVSA 4D46A 3H9GA 1DJQA 2CF5A 2O4UX 4NBWA 1WDLA 4WLUA 2LDXA 4OXNA 1VLLA 4J0FA 5T57A 2GCGA 1Z6ZA 3C85A 5H82A 1UXHA 4WLOA 1J0XO 5DT9A 2ILTA 4IZIA 2E4AA 3WGOA 4XX0A 1IPFA 1I3NA 1LLQA 2WYUA 4AJLA 4DXHA 3TFOA 4BNYA 5KTKA 1MG0A 2NTJA 3TPCA 2WEKA 3VH2A 3VVBA 1RYEA 3H3FA 3KV3O 3PZRA 2GNAA 4R1UA 1P3DA 4L76A 4E30A 2D2IA 2X1HA 5L7YA 1C0KA 4NIMA 4PZDA 4RORA 4MIEA 4LSMA 3UCXA 1M6WA 4IDDA 1P45A 2P2SA 4QX6A 2AW5A 4XWYA 4CV0A 1GD1O 2B4QA 1R66A 2E37A 4B7XA 4XZ3A 2XXBA 2CDCA 4OO3A 4NBVA 1ZNQO 2EW2A 5COBA 3DHNA 3VPXA 4UREA 4I9HA 1X15A 1Z82A 1U8XX 4DC0A 4DIFA 1CQJA 3JQAD 3D3WA 2X0RA 3ASVA 5KVVA 1WAMA 1N1EA 1XDWA 3UVEA 2YV2A 4BKQA 1JKJA 1AN9A 3WNQA 1C1DA 1HTBA 3ZWMA 4J7XA 2W90A 3AOEC 1BW9A 1X1TA 4CUKA 3LT2A 4Q39A 4QO7A 1N1GA 4KTTE 1YBAA 3GEDA 3NT4A 3GZNA 4CQLB 3PEFA 1YBMA 1ZSNA 3ANMA 4F6LA 1GQQA 1AHIA 3O26A 3QVOA 1YL7A 5U1PA 3ZWCA 3NTRA 4A26A 4M8SA 1OFGA 2YV3A 3FRJA 4B4WA 4IJKA 5A02A 3OA2A 3HDHA 1QLHA 5TC4A 2HMSA 1EVIA 4JQCA 3DAFA 1U8FO 2VQ3A 3LT1A 4BO8A 5KVQA 1VKOA 5I7VA 2GO1A 2Y67A 4FJ1A 1LU9A 3ZW8A 1QRRA 3U4CA 4GWGA 4PGFA 3PVZA 2JD0A 1NX6A 1KVRA 4D0RA 5KVCA 3LVFO 3DFUA 1HXHA 3KHUA 3W8EA 1E3IA 4B8WA 4DMMA 5JMWA 1NM5A 3JQAA 3FR7A 1Q7BA 3V2GA 5KJFA 1JVSA 4Q3EA 4NNJA 3R3JA 5JS6A 2Q2QA 5F1OA 4QFCA 3S2IA 3C7DB 4KOAA 4BV9A 4AJPA 3VH3A 3AM5A 5L7WA 5KKAA 3GPIA 3DZJA 5DBGA 2JCYA 3IKTA 1NAHA 3I1JA 4YB8A 4XYEA 1KEUA 1BGVA 4W9NC 1EE9A 1YB1A 3KB6A 4YT5A 4HX5A 2FZWA 4IDAA 2VUUA 2GF2A 3L6OO 4CM4A 4J4TA 2PA3A 2XF8A 3TF5A 1GR0A 3NJ4A 1T25A 4BO6A 2YZ7A 4RO0A 4KUHA 4PZEA 1KERA 2X23A 4AICA 4CM9D 1DRWA 1ZK2A 4RZHA 3RJ9A 3ICPA 4O63O 4XIJA 5JDIA 4UEJA 3H9QA 2W2KB 3PP8A 4NDNE 2HUNA 2O2YA 2UV8A 1OC4A 1X0XA 3UCFA 3HDJA 2CMDA 3HADA 4NJMB 4PLVA 4RPJA 3OQBA 2W98A 4WECA 2X5KO 4HUJA 1TEHA 4UVDA 2OL4A 1GQYA 4JP3A 3GEMA 3AI1A 4AJHA 3KEQA 3GN1A 4WUVA 3TZHA 3U49A 1D7OA 4GWKA 4IJUA 4BNHA 1L7EA 3JQGB 2G76A 5K9ZA 4QSMA 2RHRA 1KIFA 4MO2A 2GR9A 4IXWA 4JGBA 4KTVE 3F1KA 1ZEMA 4QO8A 3RCBA 1BXGA 1P1IA 1P1RA 4YJGB 1MG5A 3TN7A 1TVEA 1UZMA 1GPJA 5JO9A 1Y8QB 2X0NA 4PLCA 2BFMA 1VI2A 1M6HA 3QHAA 1P0CA
chains in the Genus database with same CATH superfamily
5DZSA 3W2HA 4U9UA 2Q8QA 1NUSA 2KBFA 2G71A 1EFTA 1RQGA 2GVDC 4RWZA 5AJHA 1O6BA 1IDOA 3NYIA 2ENUA 4LZJA 1NG1A 5ALZA 2VZ9A 1NXTA 3FCEA 3SHTA 1TQ6A 4HLQB 2VK4A 2XUHA 4M8LA 5LM3A 3DGEC 4DSNA 3IMEA 4QM6A 1T10A 4ZHQF 5A2GA 2LVBA 2XKAA 4RGYA 2YBEA 2YYZA 4KK4A 2QUZA 4IV0A 4YP6A 4AJ9A 4C22A 1Y63A 5HK8A 1G18A 4NYIR 3ZCRA 3FLEA 3IVAA 1W4AA 1QHFA 4J0HA 1GYRA 1ZRNA 4QAQA 3R6TA 5T6MA 4LYJA 3IEVA 1TRKA 2OD7A 1KMNA 2BF7A 1WVIA 3F5SA 3GGCA 3TAXA 5SZJA 2WPDA 3W90A 2JBAA 3R09A 4NCJA 1PQUA 5J47A 4OAQA 2V0CA 1PJCA 1EI9A 4PSKA 1A9YA 1DCMA 4RMIA 2G72A 2IYVA 2OCYC 1G21A 4ZIRB 4UMDA 4UARA 3ICOA 4OXIA 1Z0IA 1F38A 1CDEA 2PM8A 2Z5FA 4LSGA 3KVOA 5BSFA 2FETA 1CUGA 1L7AA 4RZIA 2F1KA 2ZJYA 3JSAA 4POAA 1C9DB 1LB1B 1J2RA 1XWWA 3NHMA 5CNMA 3DBLA 2O1EA 3BF7A 5MHTA 1W4ZA 1WXEA 4QBFA 5C7IO 3NIFB 4B80A 1FW6A 2I6QA 5JZOA 2PXAA 4RVCA 4OHFA 3AETB 4YMGA 5KNDD 2O8FB 4M0EA 2GPNA 3R7WB 2WTXA 2ZRFA 2ACVA 4FOPA 3MWFA 3PPVA 3SM9A 2PUAA 2F8LA 3DP7A 4XOIA 2SKCA 1Z7WA 2NADA 4CKCB 1OT5A 3ZI4A 2DECA 1XXHA 4XWGA 2QL7A 4RJTA 1Z0FA 2MT9A 5CDHA 3OECA 3RROA 3MB8A 2WFLB 3DYVA 1LBQA 3P45A 4B4UA 1Z29A 1ADGA 1G8JA 1YJXA 4LZLA 2EV9A 5CD9A 1L5HA 1JN0A 1SUDA 4IV5A 4PG6A 3BQMB 4D7AA 3SJUA 1T6XA 3E4CA 3DCYA 4W99A 3OQJA 4LA4A 2DTDA 5I6DA 2AS0A 5KJEA 2DSTA 1NM5C 2RGCA 3RIHA 1Z06A 3SC4A 2DH6A 4AURA 4Z3OA 3JCZA 1E94E 1TM7E 4PR0A 2Z4TA 3GUZA 4HZIA 4EW1A 3G59A 4RA9A 4TWAA 3OMXA 4V1CB 1X13A 4J7AA 3H87A 4D8YA 4UTZA 1FLAA 3OSZA 2M98A 2BGLA 5FRDA 3GJRA 2V59A 2BRUA 1A8HA 2JGDB 2X8WA 1U9CA 1X7HA 4XQGA 3W9YA 6LDHA 3IAAA 1G8MA 2Q9AA 3K7EA 3MJHA 1DIOB 4G5RA 5DVZA 2GXUA 5C80A 3PVSA 4HDSA 3CLTD 4N12A 1ISRA 1M5UA 3I3SR 5I9BA 3OJCA 5KC9A 1C3EA 1XVVA 2IIVA 1OX4A 1E77A 1KJZA 1GRQA 2V7PA 2VHZA 3IH5A 1XG5A 4ZOQI 5KDDA 1CJSA 1P5RA 1WP4A 3KQNA 2R47A 1EDEA 1NHWA 4EQZA 1VTKA 3KBBA 3FMPB 1LXCA 1F4VA 5KNDA 3HI6A 5AHXA 3MCTA 3TSOA 5EZ5A 2FZVA 5HGJA 1TC2A 2BMAA 3A4TA 2JFUA 2YOGA 3K4QA 2Z83A 3I6IA 4HXFB 5KQMA 3RSGA 1C7EA 2PR7A 4M1ZA 2EFDB 4RA6A 1U3CA 1N6OA 2VHXA 3JD2A 4QUBA 4C4SA 1YNOA 2OXEA 3AQIA 3P4YA 4P36A 2PSDA 1DJOA 4M1QA 1ZK0A 3O4GA 1HG1A 5IAEA 1JDJA 4FCVA 1QZTA 4NAHA 4E2XA 3AIOA 2E21A 3KSBC 2XYGA 2R1TB 5CT8A 2IH5A 2XYVA 2H2WA 3QLUC 3M6XA 4B4VA 1WNTA 3H11A 2PRZA 1KBZA 4FMCF 7AT1A 2R8PA 4K6CA 4OLJA 4RPIA 1D6SA 2C58A 4C0AC 5JNWA 4UVEA 1DQPA 1C9NA 3T9CA 3ZLJA 4AYWA 1K2VN 4C4ZA 2EDCA 4EZIA 4LDAA 4JOBA 5ANRB 3D64A 1B2RA 1V95A 4NPCA 3RSZA 2I6SA 4JN6B 4OQMA 4WN9B 3REGA 2ZAIA 1PFKA 1PZXA 3O8RA 2YQ4A 5CYPA 2JJQA 3RPEA 4BYMA 1VGVA 2QUKA 2WU8A 2FW1A 4EVRA 1UBLS 4JGIA 5ECWA 3VKFA 3UWMA 2NO9A 1ZLXA 3M9XA 1ZC4A 2HC9A 4DR7B 2Z43A 5FKJA 1DKNA 1EX1A 2P3QA 3FFWA 4B7CA 3DE3X 4CFSA 1P4SA 3STHA 4HDMA 3UEOA 4A5SA 2NU6A 3OIFA 3U3RA 4EIWA 1VSQA 1GGVA 2YWEA 1T8UA 3ME5A 4MCAA 3EXEB 1UBRS 2X1MA 3IL2A 1ZU4A 4IXTA 1TX4B 1BSVA 2QTVA 3K5WA 3OFND 3OZIA 2FR8A 2HTEA 2QLNA 4FE7A 3WGLA 4I55A 1N2HA 1XCGB 1M34B 3SX2A 1D4ZA 1M1YE 3A7EA 3UHAA 1BD3A 1FNBA 1UPTA 2NW6A 1QXSA 2H2HA 4OMDA 2C3UA 3SHVA 3NHAA 3QMVA 1WV0A 1NJ8A 4JT9A 5K3FA 3UNXA 2PQ6A 1JG4A 3HMQA 4TLBA 3ZC3A 5JFTA 1XQXA 3THOA 2X9NA 1SG6A 4E7PA 3OFVA 3W34A 4YYEA 4UE6A 5AJXA 2NUAB 1E7WA 1GZ7A 3I52A 5ALNA 5HUJA 3C16C 1NC3A 2ZM5A 5EI5A 1B6TA 1KJ9A 3TDMA 3EWSA 1FX1A 2EIHA 1Y1QA 1BG6A 3K0FB 4E2WA 1Y80A 2HU5A 3H9UA 3RUHA 1XDBA 5DT2A 1XZDA 1NR1A 5E9QA 3HA3A 3MOIA 1ENPA 3VX3A 3EQ6A 3D1VA 3CM0A 3MXTA 4YAKA 4RULA 3W8DA 5CDGA 2XMPA 3WFJA 1ZO8A 2DFPA 1XTVA 4F0JA 1ZKDA 3HFSA 4E46A 1R0WA 3N86A 3JZDA 3GH1A 5CJPA 1LI7A 1GPH1 5FV4A 1Z28A 4PYNA 2ZAMA 5ILOA 4KPYA 2VSQA 4BKOA 1DMSA 5F4BA 4G4GA 4C2TA 1QCCA 1YI0A 2YWFA 2ZSBA 4GT1A 4AW9A 5JPCA 4RTRA 2PUEA 1MJNA 5H7XA 4D02A 5K51A 3QVWA 1A27A 2ODAA 4JU8A 3FTQA 3O8OA 5CIWA 1OFVA 2O7NA 2OZPA 4DREA 2ACEA 4DXAA 1TJ5A 5BUZA 1HPLA 3K70C 2WSLA 4UM9D 1IZ7A 3X1JA 4DFDA 2G3YA 3U26A 3EY4A 3C5VA 4NCXA 3HCNA 2MJLA 5JZSA 1P6QA 2B20A 2PT6A 4WXRA 2RD2A 3GG2A 3H9JA 4L4YA 2R6DA 3LJKA 5KNDH 1X86B 3GRVA 1H0HA 1G4UR 3I42A 1BEUB 1GPLA 1E5VA 2ZIUB 3PGA1 4TMKA 5GWXA 4NU0A 4PW0A 1VJRA 4W7HA 5ALRA 5EQTA 1XHLA 1J8MF 2W2PA 5ALHA 3HVKA 4QREA 2P9GA 4WY2A 2YUTA 2ZTVA 4GVLA 3G0BA 2XUIA 2G5TA 4RPCA 2DLNA 4N0MA 4PXAA 3LBIA 4FS8A 2FZGA 4L6CA 5EXXA 3VKVA 1QJ4A 1S4MA 3G1TA 2W2LD 1V8OA 4XDYA 3ZTYA 1MH1A 1YQTA 1T4CB 2HJGA 3M1YA 1S8OA 3SEFA 3C98A 3LHIA 1F2TB 2ST1A 4UTVA 2N1MA 1FFXA 5ICFA 1U2RA 1GYPA 3TLCA 1I2DA 2ZB3A 2BCJQ 2IFTA 2BRUC 3SLRA 3W4JA 1UOEA 1Q74A 1N7IA 1NXXA 1MX1A 1JTFA 4ZRMA 1T26A 2HIAA 3C3DA 3I04M 3F2IA 3KTOA 4U3JA 5DNYB 1JECA 1B8UA 3GMIA 4BC1A 2H4YA 2DY0A 2X86A 2YYSA 4ZCSA 2YFQA 4MV6A 5JD4A 3HFGA 3OD5A 1BJKA 2W48A 3ED5A 2YASA 1P61B 2A35A 4B3DA 4EHAA 5B3LA 4NRDA 1O89A 1GYQA 4X71A 1R9GA 3OZCA 3HZOA 5ALVA 1M2NA 4N3NA 5DCUA 1D4FA 1XFAA 4L5AA 4LC9A 5E9AA 2R7NA 4MEAA 3NRBA 5ECYA 5LU9A 3C8DA 4CKBA 1IZ0A 5T3UA 5B64A 1NULA 5DBFA 1C41A 2HF8A 3GT4A 3Q8LA 1PK7A 4E33A 3VU0A 1XSEA 2W8BA 3F98A 1MB4A 1Z3IX 4RKYA 2QR3A 3SSAA 4IILA 1JKJB 4L4UA 3EVEA 2HWKA 1XFDA 2H16A 5F98A 1INLA 4AF6A 4DLNA 4B84A 1H2FA 2ZJ4A 2V5UA 3ANSA 4NE2A 3WIOA 5CBPB 4F93B 5FT9A 1Z7GA 1XAJA 2W2LA 2V4UA 2XQFA 3L7LA 2GJKA 4PSDA 1KVTA 4KLZA 4OX9Y 3LCUA 4FU0A 4FILA 4BEVA 3AM1A 4WNIA 5GY7A 4QUEA 5BO5A 1IAQA 4UFNA 4JBWA 3RW9A 3OEWA 3DDSA 3BDIA 5ELXA 2QTWB 3EQ7A 5FI0B 3D59A 4R5MA 3WYBA 3VDQA 4BBZA 1T0BA 3EVFA 1PJLA 4CCAA 2X15A 3KTAA 3A4IA 4BRUA 2MYPA 3BBPA 1GTJ1 2PY6A 2WT8A 5EP2A 3ERCA 3BT7A 2QVYX 2YINC 3L8HA 4QHTA 4WERA 4UNSA 3MYRA 1NC1A 3WRVA 1WDWB 1ZNXA 3QOWA 4LRQA 3H16A 4Z0NA 2RHCA 1X7YB 3HM2A 3N5KA 1NVXQ 1E5QA 1V3TA 1A9XB 1G9XA 3B7PA 5JEDA 3M1AA 3I76A 2XTMA 2OGTA 1OLUA 1QHEA 3SYKA 5I4KA 2R4UA 5EZSA 2EG9A 1HEYA 3W5JA 2IVZA 1QF6A 3HGMA 3QLTA 4J6FA 1PV2A 3DEYX 3R5XA 1YU9A 4OHOA 2C2MA 2JFBA 2O0KA 1B1AA 4BXOB 5I7EA 1USGA 4X85A 1PT9A 3KLPX 3AB8A 1DKUA 3IEMA 5DI3A 3K53A 4DA8A 5J4KA 1NR5A 4C01A 2GHRA 2G25A 1EK1A 1ZD3A 2PPVA 2V74B 1V8ZA 3A3NA 1MPTA 3UN1A 3CQ9A 4LEIA 2F4VB 1WXXA 3X2EA 1IK6A 2C5FA 2HL6A 2PUJA 4P31A 4QBTA 1E6CA 5DNAA 3VYRB 4D8VA 4OYYA 3D81A 1JEEA 2IYOA 5CT9A 2WLSA 1CEYA 2I22A 1GPAA 4IZHA 1RWXA 1YF3A 3V97A 4ID3A 1GIAA 1VYVA 4M1KA 1V0JA 3AGPA 3OP1A 4HLDA 2QRHA 3NFRA 1HH4A 1AKMA 3COVA 4X6LA 1E2DA 5KU7A 3EDMA 3NDIA 3EFOA 5LP1A 5DM1A 1QYXA 4U0KA 5ES4B 2GJAA 1E2MA 2WQZA 1S6YA 3AUSA 3F4LA 4LV6A 4AUMA 3EDRA 1SY7A 5CEJA 4DUYB 1T91A 1OFTA 4B3FX 2EW1A 1NQOA 1R0BA 4CNQA 2P5UA 3CINA 1ITZA 3AF0A 5DMHA 5J4LA 3WBJA 4G89A 4Q24A 1PJRA 1W19A 2A2ZA 1ODSA 1HRKA 4FFRA 3PXUA 5IM4F 4JLUA 1ABBA 1M6NA 4IJ6A 4OQQA 4BMDA 2G8NA 2R25B 5BVGB 4W5WA 3WOHA 1L5LA 3ES9A 3HABA 4Z1MD 3GDGA 3GHYA 5EGNA 1THGA 1LQUA 1NJSA 4FD2A 5AKLA 3NC1C 3ZJTA 3E7PA 3BVPA 5HIKA 3KDSE 1EU1A 4HAUA 4Y0NA 2ECKA 1ILWA 1PS9A 2XE4A 1FUKA 3GELA 4JSTA 4AMZA 3PDHA 3WGVA 1VRCA 3JRWA 1EFHA 1QRTA 3FY4A 3NYWA 2WTUA 1MT3A 1PBNA 3X1YA 2FOXA 5B7QA 1PNOA 4L16A 1IY2A 1M2HA 3DW3X 4H1UA 4WZBA 5TDHA 5DM60 1YVPA 3U6KA 1OV6A 3MLEA 5JBQA 4FFMA 4A1OA 5JQGB 2BHTA 1XZIA 2A9QA 2JIDA 1GUDA 1G3UA 2EIXA 2A33A 1WUKS 2VT7A 3MCUA 4GNRA 3RAJA 3L6DA 3TIVA 2ZYDA 1I4OA 3QTBA 5HXAA 1JHVA 2HAEA 1YOBA 3CX3A 3SBOA 1A9OA 2VDOB 1SIUA 1HDIA 3K9BA 2GM5A 3GAMA 4A0RA 1GZ6A 3QSGA 4HYEA 1DKQA 3LZ6A 1V2HE 3FI9A 3NBAA 4YRTA 1F5NA 1V5IA 1JG6A 2VUSA 3E9RA 3I9MA 3MCAA 3G0IA 4KQMA 4ALIA 4M9CA 5JIBA 2J9XB 2RMKA 1CRPA 2QL6A 3ICEA 3MELA 4DCJA 4HBGA 1UDXA 1PVDA 2IBSA 5HX7A 3MTGA 4B40A 1II9A 1TPYA 4QELA 1ZH6A 4EJ6A 5FL7A 1KRXA 4RXMA 2VHUA 1QZ3A 5H3HA 4DCGA 2RAPA 4O2BF 5AW2A 2VDQB 3QBDA 4FMBB 4QUAA 5C81A 4Z1MA 2P2DA 3HR7A 3R6DA 4U7TB 4X3OA 2WBLC 4MGEA 3B3FA 3R0VA 2NUPA 4O2RA 4ESEA 4TWJA 4EY6A 3T1OA 4UEQA 2CVQA 2DH5A 1YMQA 4K86A 3MUNA 5F12A 3R74A 2C2OA 1T6NA 3PQ2A 4AG6A 1T0JB 1E3EA 4BZXA 3C6QA 5HKBA 1KTIA 3F1LA 4IRMA 1VKZA 1CUVA 2Q3DA 3BGOS 3OIWA 1RJDA 5CA1A 2B4RO 5M5BA 1XZHA 3V00A 2JBAB 1I1OA 1XZLA 3WGNA 3GFSA 3OJLA 2GCEA 3PC2A 3C3WA 3ZEIA 4E03A 3QVSA 5MF6A 1G21B 2VDWA 1TIPA 5ALDA 4X93A 2Y0PA 2V5VA 4URWR 1JLLA 4R8LA 2ZYWX 5CAEB 4ZQIA 1SOWA 3BMQB 4DCTA 2VNHA 4KW7A 1Y33E 2ZRLA 4J0EA 5CW1A 1BMFD 3DBLB 1QUEA 2QN8A 3MRSA 5EZYF 3TQFA 1Z2OX 1B42A 3K70B 4Z1OA 4CF5A 2I1VB 3HN2A 3LGXA 3LXMA 1GU7A 2XGSA 2Y76A 3Q3EA 5ICEA 5IJ0A 3JTMA 4ES6A 3FNGA 1YDMA 4XGQA 4RTNA 3QSYA 1U6IA 4IDNA 3K1AB 1AZLA 4BRZA 1HQKA 1SHLA 1TOAA 1XXHB 1IY9A 3AFNA 1AE1A 3P9YA 3Q2KA 3UTCA 1DT5A 3BEOA 1L3IA 5TJ9A 1RT9A 2BMFA 4ENUA 2UAGA 4YR9A 2HNKA 4JX8A 2CMFA 3RLIA 4N6GA 1WB4A 4DV6B 1ZVKA 1WKVA 1L5HB 1V8DA 1J5XA 2J9GA 2MOKA 2YV4A 3MJSA 2OZVA 1AGNA 1YS6A 2IOFA 4NULA 3B48A 4N65A 2B5OA 1DV2A 1NFQA 2WWWA 3U81A 1G4AE 4CYMA 3FOCA 3N2EA 5DI9A 2CBXA 1T2NA 4RA9B 4WACA 4E3WA 1JAIA 2ZUUA 1B00A 4IIJF 1Y3FE 3R3VA 1QIHA 5B1EA 5KYVA 3C41J 3UGTA 1FJHA 1V3VA 5FFFA 1YFLA 4IV8A 2D5IA 4KUEA 1EG2A 4K9OA 1PGQA 4FFOA 2R751 1GAQA 2BTQB 1N5OX 4HDSB 3RIMA 4TS9A 4L4SA 1I01A 3HLYA 4MLZA 4C3OB 3EZ6A 4EUEA 5CBKA 4WEQA 1NBOA 3F6EX 1NT2A 1W2GA 4MB6A 3NHFA 5DULA 2J7KA 3UAWA 1X8KA 3I61A 3DWFA 3W9SA 1DWPA 3UJNA 4IUBS 1ZOLA 2H0AA 2OB2A 3PQ5A 2QK4A 1X0VA 2BEVB 2AZDA 1CRLA 1G8AA 1RCUA 2GVNA 1GEGA 3NAQA 2JI8A 4B6EA 1R7RA 1Q84A 4EG8A 3B3GA 4Y2JA 5FA8A 4NBTA 4KYTA 5A5FA 4RA6B 2CLLB 4J6EA 5TJHA 1TGYA 5L45A 1A3CA 1QV6A 2A57A 3ELDA 2EJBA 3SDBA 3QPAA 5JXGA 3ILVA 4Q16A 4LZOA 2FN7A 1UPUA 3E4DA 2CCKA 5B1IA 4BGEA 4CNBA 1CK4A 1FVOA 2QT0A 3ADOA 3E70C 3OU7A 4FGJA 2CJFA 4RACA 3H04A 5AM5A 2C3YA 2ZJ0A 3H11B 4Y8VA 1SR8A 4IQ8A 4V0OA 2ZIAA 1VJGA 5ALQA 2HSGA 4CCSA 3UB4A 4MQ6A 1NJ2A 2Q2NA 3DFZA 3UMBA 4E1AA 1HYEA 3RJTA 3S99A 2X7JA 4P53A 1UC8A 4ZOLB 1SAYA 3RANA 3UENA 1XMJA 3JALA 2CV2A 3EMDA 1FC0A 4MJXA 4ML3A 1OX5A 1RKXA 1RPJA 3QKRB 4JP8A 4K9DA 3VSDA 8GPBA 5AOCA 3OCXA 4PYLA 3HNRA 4H6WA 1ZL0A 3TTYA 4QUDA 3R0ZA 3R44A 1FS4A 3IB6A 4HFRA 5IP5A 1Y48E 5JZBA 3Q11A 3D2CA 2VHJA 2AYZA 3FHJA 4HDMB 4UMVA 5IMBA 1YSCA 3P4UA 4EATA 2J33A 2NU6B 1KYYA 1PW5A 3AGQA 3LPLA 2YOFA 4XFDA 1IYZA 4L0DA 4L27A 2EU8A 4CDMA 2CVFA 1D6NA 1D0IA 1SHKA 1V1RB 1EBFA 1SBNE 3BJIC 3GFBA 2G7ZA 4I55B 3GDHA 1QHXA 4L9RA 1Y8ZA 2JRLA 4G4JA 3OE5A 3EIOA 3H4MA 3GIDA 5F7XA 4ETWA 3G2IA 5K3FB 4Q3OA 1ZDMA 2GXQA 3A6ZA 3K94A 2FMFA 2BZSA 4C4TA 2WKRA 4BCBA 1RC1A 3ORHA 1JDNA 2QPLA 4EGAA 2C84A 1TRHA 3FRHA 5HBRA 4BV3A 4IDQA 4XW2A 4MUJA 5HPYB 5KU1A 2VJLA 2Z1MA 2MSKA 2ZR7A 2G77B 1LBSA 1OY1A 1T3HA 3C43A 3CVJA 2IYAA 2JGFA 1QYWA 4YJHA 5K2MA 4NESA 4DMGA 2QVBA 1EK5A 4EB8A 2ZW9A 4YFVA 3WL3A 4FM9A 4C76A 3DDHA 3BILA 3MPUA 4MWBA 4UKDA 4KWTA 5KHOC 1F3LA 3QWIA 3STTA 3KQKA 2ZJ2A 1W6RA 1ZGZA 4HF7A 4KN9S 4FQ7A 2K5UA 2XQGA 1F14A 4ZEOA 3ZWPA 1SPBS 4QOIA 5CJ2A 3OOWA 3P20A 4QTZA 3KQOA 4AJOA 1Y3IA 1FU8A 1BYIA 5JYEA 1ONSA 3O1JC 1ADFA 5IF9A 1VMEA 4YAFA 4RV5A 5DXJA 2KYRA 3D4LA 5DW0A 5ICMA 5GJBA 1GNVA 1FQOA 4URXR 3GUUA 3O8OB 1T1GA 1CZRA 1PZEA 2OHHA 3KJEA 4A36A 4D9MA 1XE3A 4OU5A 1J00A 1X87A 1WCIB 1JHPA 2CLSA 3GF4A 5K8JB 2BN4A 2Q7XA 3CGGA 4G5FA 3DHYA 3EGCA 3RTDA 1F06A 5NLLA 4MB0A 1OI3A 4ZI7B 5IK2D 4UTOA 5LQAA 1Z6XA 1P4AA 4M1TA 1L3BA 1DE0A 3IMCA 3KS9A 5B6PA 3R75A 1Z75A 3DAYA 3SX0A 4WJZA 3EZFA 3QVMA 4J4BA 4GP9A 3NGXA 4BKPA 4W6QA 2IOHA 1KPIA 1EBBA 1JHUA 2OP0A 3IJRA 2I4TA 4OAOA 5JH7F 1M0TA 1NJGA 3KQHA 1E1LA 2EEPA 3Q6IA 2QD5A 4RPHA 1ESMA 5E0OA 3H1BA 4R6WA 5CLQA 4ND3A 3VDMA 3OOJA 1B41A 1NUAA 1QHIA 2IY9A 1U0LA 3D7MA 3H05A 3T1NA 2I4OA 3WKDA 1KR5A 4E5SA 3ZVMA 3KZ1E 4BTVA 1SCKA 4UHEA 3MZ0A 3NPAA 3PX7A 1RYDA 5EJ5A 3HBNA 4HTFA 5FNVA 2FPPA 2ZYIA 1FFXB 2VQEB 3RU7A 2R6CA 3FIJA 3CKYA 4JIGA 1D09A 1GPKA 2BGRA 5LZ8A 3MGCA 2ZU6A 2JFVA 1TA0A 4LWOA 3D5EA 3ZHXA 1OAOA 3G8YA 3OD1A 3IAHA 3FTFA 4U3JB 1R6AA 4N8DA 3SZOA 1P80A 1XKLA 2ALJA 1Z5ZA 1XVLA 5F7ZA 5BSKA 1FMFA 1GSHA 3P96A 2NYRA 4PCVA 3UGQA 1Q7GA 1QG6A 1KOLA 4KJXA 1BJTA 4XDHA 3CISA 3NTQA 4K40A 5J59A 4RIHA 4EYSA 4K9KA 5JAQA 4E6PA 4M7WA 1T5TA 4H1WA 4ZCIA 4I5IA 4MWGA 3IPYA 3B5JA 1UC4B 4LQ4A 3WLFA 3UJDA 3K0KA 3L4KA 2E1RA 4BFWA 4CKBB 1F2UA 4FFDA 4JXXA 1XNRB 2QDXA 1RP7A 2XNDD 3ZD6A 3LO5A 1W85A 1WXFA 3WIDA 2W8BB 2BFWA 3FHOA 2JLRA 1YRQA 3OLWA 4R1OA 2HA6A 3LFUA 8ATCA 3SQOA 3L0DA 5D5HA 1LVHA 5HSGA 5JDIC 4HFNA 4J2OA 3CG0A 5BQ5A 3P27A 3V4VB 2PQ2A 4DIEA 3EVNA 5KOJA 2FX3A 3S3TA 4IDBA 1IB0A 1XIVA 4AXXA 3PD7A 3LF1A 4FUTA 4XKJA 4DDHA 2QYHA 2QTMA 5A2QA 3KQUA 5FOTA 1NBHA 3MTDA 4BNWA 2WKQA 3RB8A 2NYUA 4IQ4A 3TRIA 2YVLA 4PYMA 4RPLA 3WY9A 5LUAA 5KAMA 1KSGA 3FVRA 2GM3A 3IVCA 4B3JA 1P4GA 5BPHA 1ZGAA 4FCTA 1OR8A 1BS2A 1YXMA 1RWWA 2CL7X 4H7DA 3ZDAA 1OU4A 2VTDA 1DGQA 3FNEA 3PUKA 2ZUEA 3RSLA 3PEYA 1PZGA 2QU8A 3FNBA 3LPNA 3RBVA 4N9WA 1UKBA 5KWSA 1NVKA 1BDJA 1T1RA 2CSUA 2QD4A 4HB0A 3KTAB 3KVYA 2TSYB 1E7MA 1AT1A 1G0OA 1XTZA 3DZFA 3UUEA 3C7TA 1RAGA 5TS3A 1MEEA 3HZZA 2OFFA 4ZA2A 1ZNYA 4HS4A 3HCEA 5J63A 1EVZA 2HCRA 3W4IA 5LZ4A 3KYBA 3FBTA 1H69A 4YRNA 2FF5A 3BIFA 5J3JA 3DA8A 1P19A 4NCAA 3SYLA 4PNHA 1OLUB 1XZPA 2GFHA 2IE8A 4HQRA 4MPRA 4RV4A 3BQ9A 1RAIA 2H2IA 3UK0A 2NQTA 3EXAA 3LUAA 3NIDB 1E79D 1Z5NA 3A1UA 4XRGA 5JC8A 4EUNA 1Q0HA 4N7RA 3L6RA 3SF8A 2IYEA 4PBTA 5ULLA 4B6QA 4CMGA 2A0WA 2GYWA 2IPLA 3TLGA 3ZZMA 3ZWDA 4WLNA 5KAPA 5H1YA 1UBUS 4QYWA 4X7MA 3T7CA 2BYTA 2HRCA 5H0IA 4TL9A 3HSYA 2GAOA 4A0GA 5LDDC 4KZPA 1Z6PA 2XUGA 3O8LA 3GPDG 1LV8A 2Y6VA 4NBSA 2P8SA 4ZRDA 1Y8QA 2VUTA 5B2FA 1G7RA 1LVGA 1OB5A 1PX2A 5KYUA 1FJXA 2AH5A 1H5NA 2J6HA 2H1CA 4RFSB 5HK9A 5CLFA 4TV9F 1V71A 3VDRA 3PXCX 2HFKA 2I80A 1AKWA 4YRCA 4CTKA 3A9UA 5BPFA 1C4WA 3A32A 3HA2A 3QPVA 1JFFA 2X2OA 4QPPA 2XRFA 4LG1A 3QJYA 4OFXA 3ZNPA 2P9QA 3S1SA 4RTJA 3AFIA 2QV7A 5JPIA 5CX4A 5FTNA 3HCOA 4DR6B 1AURA 4TKZA 2W4IA 5LXTA 1NNSA 3DTTA 2RGRA 1YAJA 1JKXA 1IC6A 1V6AA 3CVYA 1JPVA 1NW6A 1JTEA 1RRPA 1Q7CA 3O03A 4D82A 3FNRA 1JR3E 3GLIB 4BB6A 2JAWA 5AVJA 3D8HA 5GADl 2TMDA 1VFNA 2NQ8A 2Z09A 3G9XA 2OP1A 3M4YA 4LK3A 4QRIA 5EERA 1ZK3A 4BNXA 1RM5A 2XEDA 3JWHA 2FSFA 5FADA 3ROKA 3ECAA 4YQFA 4ZYVA 2FSHA 2WJPA 3PHGA 2Z2JA 3VR1A 4E13A 1KJYA 1U9IC 2JFWA 4JIMA 1QTNA 3HB1A 3OX1A 3CLHA 4GOMD 3VR2A 4L5BA 3NORA 1E79A 1QM5A 1VBNA 4D4KA 1G3IA 1ID1A 3Q7IA 4BJHB 3NVMB 4HL6A 1E3DA 3Q7QA 3TPZA 4CIDA 2NG1A 2CV0A 4B3TB 4BQNA 3IPRA 1CY7A 1L1QA 5E6SA 1JBKA 3BGIA 3MRXA 1XPOA 2XOXA 4LQLA 4WZBB 1E2GA 2DULA 2O1WA 1ZZGA 3Q7TA 2VF7A 3HYNA 4QATA 4QDTA 3QG1A 5EHNA 1W581 4NU6A 3BPSA 4TX1A 1E2BA 2BFBA 3PIIA 1ATZA 5DGCA 1T13A 1Y9ZA 1Z5OA 1RLMA 3W5UA 3H6KA 3PF9A 4WKGA 3F3YA 2AOWA 3BZBA 5AVWA 2UYCA 4NLLA 5C52B 2CWDA 1EWKA 2P1ZA 3KEMA 3W6ZA 4F85A 5EJ8A 4PNEA 3P9ZA 3U39A 1YMUA 2AB0A 2WE8A 3K96A 5FLEX 4ESOA 5JANA 3GCZA 4HQLA 3MJCA 3EPPA 4WXEA 3WKEA 1DELA 3GH3A 4A0SA 1OAOC 3CONA 5EQFA 2WSIA 2UVQA 3T06B 1E6KA 1ZH0A 2ODWA 1S96A 1G5IA 1E9SA 4G2TA 4DQXA 3GGGA 3IEKA 5C34B 2NPFA 4JFRA 4DQUA 3RGGA 2NOAA 4K03A 1QDUA 2W6CX 4NC9A 3NUGA 2J87A 2EKBA 1F17A 5HVNA 2JHFA 5H70A 3B1VA 1JL3A 2B1RA 3S2UA 3W2EA 3PFHA 1ZD2P 2GVZC 2NUPB 1VSVA 4JASB 4II2A 4WXMA 3ABQB 3Q1LA 4RGVA 4XH9B 5EMJA 1N8NA 4ZXPA 2HHCA 4V24A 1Z0UA 4CV3A 2G4CA 3O75A 4NMHA 2FK8A 1PT5A 1WMDA 3GZJA 4MRSA 2WP0A 1Z07A 2Q3MA 2WJ3A 2E87A 1TTQB 1VL1A 3K16A 4YJ3F 3HB5X 1I3OA 4NH4A 5GZ3A 4II3A 1A4UA 5DRTA 1T2CA 3SHWA 1DU4A 5JAOA 1C4KA 1ODJA 2VDWB 5AM1A 2DXIA 1E2IA 3TNFA 1L1EA 1JLLB 1YJQA 2HWWA 4FEAA 4RKQA 1B1CA 2VSYA 1W9MA 2FEOA 2PUVA 3GWGA 2ZJ1A 4XOUA 2YZ2A 4W5TA 1NBWB 1NQAO 4YMIA 5DRYA 1QO7A 2C78A 3E15A 3TCXB 1MRZA 1J20A 1JXAA 2VHTA 4K2HA 1Z17A 4YI5A 2VTEA 1O8CA 2H51A 4S0XA 4P4SB 3UKDA 3OHMA 2VUHB 4EFMA 2WIFA 5JASA 4UPVA 2WKSA 5IJ0B 4AUNA 4AMGA 2IS1A 1CEQA 1CV2A 5JYBA 2MSDB 1I94B 5KNCH 2IITA 2PL9A 4MICA 2O8EB 5HEKA 2XT9A 1C0PA 1CQZA 2LKDA 3ACDA 4KYVA 3ZWXA 4AUEA 1S0UA 3ZEAA 3M6LA 5BWMA 1A2BA 5JCOC 3PPYA 1WW3A 4IOJA 3KXDA 2WA2A 3M5PA 2G09A 4JBXA 4OSPA 4FZJA 3AH8A 4ZD6A 2OQRA 3VYSB 4M0MA 1YQEA 3QEJA 4CUJA 3DE7X 4PC3A 5BQFA 5CMLA 4IDCA 3S8EA 3EULA 3L6BA 2XRZA 3D6JA 4TTIA 1WSAA 1JAXA 3TNDA 1XVUA 4N54A 2PQMA 4BQRA 4D98A 2R8OA 3ZU4A 2ZTHA 4AX4A 3LSYA 2GBPA 2PSHA 2QRUA 4EI7A 1Z2PX 1ZJ4A 1O6GA 4ZT7A 3X2SA 4I1SA 1V8PA 1VPTA 3U62A 2Q0HA 3SDSA 3ZNQA 1S2LA 3P97A 3ZV6A 1ISGA 1J8VA 3VISA 2X9LA 5EIBC 5LKAA 2PS3A 1G3QA 3BMCA 3MS2A 3E0QA 3OQOA 2XTJA 4CLRA 1AHNA 1E58A 1MDBA 4MA0A 2PA0A 4ND1A 1OVGA 3MHTA 1CF4A 2BM1A 3Q7RA 4QDZA 4Z3KA 2Z9CA 5L4NA 1JE1A 3ZU6A 5F7OA 1FQJA 5I8PA 1AKQA 1IEQA 2B0CA 2P9HA 3SZRA 3UWKA 3OE4A 4PSCA 4DRYA 4LX0A 4US2R 5IT0A 4ONEA 2XY4A 1IN6A 4IYJA 1P33A 1VCMA 2NXJA 3O2SB 2P9TA 4GOND 4QRDA 2CLDX 1Q0UA 1J25A 2AFHE 2ODPA 2Q5LA 3EUAA 1YA4A 2HT1A 3VHRA 4A03A 4PO8A 4EQ6B 1PJZA 2ZPAA 5DU2A 5LWQA 1Q50A 3ZBQA 3ODGA 2WHPA 1E1DA 4N0DA 3G9UA 3UMCA 1P60A 2XOEA 4A6PA 4NI5A 1QFMA 2HHLA 5D2CA 3E23A 3EK2A 4RHEA 1ORWA 4IIXA 3UHFA 2GFIA 4MW4A 4TVKA 4ZCPA 2L82A 1ZJYA 4H2DA 4P3PA 3BXEA 1FP4A 1ECBA 2D1RA 2GZDA 2VCEA 4KFSA 3DVRX 3F7OA 4L4RA 3UPDA 1U3FA 2QJWA 3EAFA 4G4IA 4I4CA 2EARA 3JALB 1W8IA 3OIYA 1GTL1 3OJWA 4I8IA 2ODBA 5HIIA 3ZKWA 4ACBA 2Z3WA 3KDPA 1ZVMA 4Y6SA 1DJNA 5D3QA 5CB4A 1A50B 1M0EA 3G6KA 4AAYA 5JLJA 3A9RA 3W79A 4F5EA 3EC2A 5EZ6B 4L57A 4NSNA 2DF8A 1NATA 4RQUA 3ETHA 1H2AS 5EWMA 1I1NA 4RCZA 5L3QB 4BY9E 2D00A 5AK5A 1JSLA 5EJGA 2Y68A 3OEHD 1TYEB 3EJWA 3NHYA 1AZWA 1GQ2A 3EXG2 4WOJA 1OZ0A 1YC5A 3V7YA 4Z2AA 2MYUA 1RPZA 2X9GA 2RK4A 1XAGA 2AD1A 4L6AA 4TTQA 2C2WA 5D87A 5I7UA 1BGWA 4OHPA 4QVIA 1L5OA 5LA6F 2P6RA 1J4AA 1LDYA 1I7LA 1WF6A 1BWSA 2AXNA 4KWHA 3J81A 2H1IA 2IDZA 2PFSA 2WJWA 2QE6A 1SCUA 2XUAA 3A1DA 3JZAA 2NXNA 4MYUA 5FA5A 4BNIA 4DJDC 3CRNA 5EIEA 2OYSA 3D4NA 1QVRA 1NJ1A 1ZNWA 4GX0A 4JLPA 3VX4A 1DRUA 2ZULA 3Q0EA 3OX3A 2XV1A 4QXAA 4YJHB 3AO0B 4EHDA 1ZONA 4M9SA 4DWOA 2P35A 4G8BA 9GPBA 1NBIA 2FA9A 1ZM2A 4UD6A 1TYAE 1PQPA 4UM8B 5BR4A 4JI0B 1N2BA 3UAXA 4WZAA 2FMUA 1M5RA 4BP9A 1BQ3A 3BD6A 1A2QA 1QAQA 1XZCA 2JJYA 5KX5A 3HJRA 1N9ZA 4JQZA 1Y4ZA 1WY5A 3PVCA 4AY6A 2H57A 1U2GA 2H65A 4P3YA 2WIAA 3PNLA 5GVRA 2FFQA 4QPZA 3IR7A 1FZTA 1QBGA 1QANA 3MTIA 4D1YA 1H9BA 4CU5A 1PHRA 4DLXA 1ULSA 1KAOA 1ZMRA 3FYTA 4BGUA 3LIPA 3RIGA 1WMBA 2YWHA 3SBDA 3T5PA 2O05A 3W2TA 5EUBA 4D0SA 1JA1A 1KFBB 3WDLA 1BD4A 2RGXA 1D6JA 1E0KA 2I2XB 3KLBA 5E1MA 3MMXA 2R11A 1MJGM 1OAAA 4Y2TA 1KZ1A 1JDVA 3VPDA 3NBXX 1NN3A 4JJIA 3L46A 2RHBA 3WL7A 2RK3A 2FSUA 5F3RA 4EFNA 4QPNA 2LUOA 3T1YB 2JGJA 2GGSA 3KZVA 3LDFA 2C9BA 3NASA 3PFFA 3RAEC 4F3NA 4Z8XA 1Y8AA 1WG8A 1JEQA 2VATA 2OORA 4DSTA 4B3IA 3GNQA 2L18A 4OF4A 1T4MA 4XSVA 1E4VA 3R3UA 1F4PA 4FKBA 4O3FA 2BUBA 3PQ4A 5J23A 1EHCA 1R0KA 4BATA 2ZLBA 1N8SA 4EJSA 1DHTA 1V5EA 3ESBA 2VP9A 3BAZA 1A95A 2OA0A 2N42A 2JLAA 1E64A 1WXWA 2JPDA 2P1RA 3O7WA 1TM2A 2J45A 4OHWA 1N9GA 4L9AA 3DE2X 4XD7D 3GJTA 4Z2YA 5KSZA 1F7UA 1EE2A 2P11A 4YJ2A 4A2QA 2G1JA 2X58A 3AESA 3T7JA 1K27A 1RWMA 3OTGA 1DX9A 2XWSA 4PQFA 5F76A 2NSYA 3D4PA 3HZRA 4P93A 4R8KA 4BCDA 4X66B 1ELOA 4CR8A 3QJGA 4Z7NB 2AVDA 3FOWA 3PZBA 5B3AA 3U7JA 3WBFA 4F72A 3GJ8A 4HTFB 2P91A 2FPPB 3BWCA 2FWBA 5FNVB 3UJ7A 2ZB8A 3DFFA 3N0XA 5YASA 3NVKI 4IIYA 5G3ZA 4U7DA 5ICGA 1VRVA 3IUJA 1UDRA 5TVGA 3J81k 1T5SA 1SXGA 4NARA 3O9MA 4YP9A 4AKIA 1ORDA 3RS9A 1EVEA 1KRWA 4YT2A 4CWAA 1QFSA 3Q4GA 3OLYA 2FI1A 4HAXA 5DX1A 3WV4A 3FCCA 3N2LA 4YWJA 3F4BA 1LBHA 2G6TA 3SY8A 4LMBA 5JY1A 4E70A 3CUUA 4L7VA 4KU4A 4KRYA 4RXTA 1A96A 2XCLA 2Q29A 2RGBA 5CFNA 3V7UA 1ECLA 2NIPA 4FC6A 2LBPA 4UW9A 5CXXA 3AHHA 2Q2OA 1GTMA 3FKSA 3ACCA 4UUBA 2O52A 2VFAA 3QEKA 1F2UB 1DTSA 1Q1ZA 2PEYA 2BMEA 2GK3A 3K3PA 1W85B 3WB0A 3UMGA 2GZSA 1R74A 2AKEA 1PHPA 1W1UA 4MULA 1M2EA 1YRAA 1I4EB 3DHVA 3MT0A 2PSSA 4H0CA 1PT8A 1I2ZA 2YWJA 4XD7A 1NVFA 3ORFA 5KOJB 2VK2A 4R2HA 4AJ1A 1XCLA 3H8VA 3GLFA 3AYZB 3EPHA 3MB5A 3N59A 4M1SA 5JDCA 4QPCA 4C5CA 3DZKA 1A9QA 3LOUA 1SQFA 3ZY6A 5BMOA 3E9QA 5GIOE 2OGSA 1K97A