3EEFA

Crystal structure of n-carbamoylsarcosine amidase from thermoplasma acidophilum
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
173
structure length
173
Chain Sequence
MKPALVVVDMVNEFIHGRLATPEAMKTVGPARKVIETFRRSGLPVVYVNDSHYPDDPEIRIWGRHSMKGDDGSEVIDEIRPSAGDYVLEKHAYSGFYGTNLDMILRANGIDTVVLIGLDADICVRHTAADALYRNYRIIVVEDAVAARIDPNWKDYFTRVYGATVKRSDEIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-carbamoylsarcosine amidase related protein
publication title Crystal structure and molecular modeling study of N-carbamoylsarcosine amidase Ta0454 from Thermoplasma acidophilum.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 58
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 3.5.1.59: N-carbamoylsarcosine amidase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3eefA00
3OQPA 3HB7A 2FQ1A 1ILWA 2H0RA 1J2RA 1X9GA 3R2JA 1XN4A 1IM5A 3HU5A 3V8EA 3R77A 1YZVA 4WGFA 1NBAA 4H17A 3O94A 4L07A 3PL1A 3KL2A 3MCWA 2WT9A 2A67A 2B34A 1NF8A 2WTAA 3LQYA 4WH0A 3OT4A 1NF9A 3TG2A 3S2SA 3TB4A 3UAOA 1YACA 3O93A 3O90A 3EEFA 4L08A 3IRVA 3O91A 3TXYA 3O92A
chains in the Genus database with same CATH superfamily
4RQUA 4WWHA 1TC2A 1VG8A 4K8RB 4RD4A 4F9FA 3FGOA 2YNMA 3LVBA 4RCYA 3VYUB 1N6PA 1N0UA 3NNNA 4MLCA 2Q3FA 4M55A 3VPDA 1ZKDA 2WIJA 3OTHA 4J0CA 3X1ZA 5JU6A 1UK6A 3W8DA 2VRCD 2UVPA 4QGAA 1XMSA 3LGSA 3PPVA 5J9FA 3M5PA 2HF9A 2GDZA 4LZPA 4ZO4A 4DC9A 5CA1A 4H1HA 2IF2A 1MR3F 2ID7A 1J0CA 3CCFA 3O2NA 4UOQA 5CM2Z 3S8MA 2I8AA 1CUGA 3KKOA 3SOPA 3J81k 2DKNA 1KAOA 5DHPA 4PHHA 3FTQA 3MLAA 5IBCA 3C5EA 1ONPA 1NBHA 1QYDA 3H4TA 3TOVA 1BCRB 1QH8B 1XTIA 5BYBA 3ZDXB 4B2LA 1JLKA 1ZGZA 3KKLA 2JGNA 1M72A 1G18A 3FNRA 4ADSG 1CQJB 1VSBA 2ONYA 4L4UA 2YFYA 1PWEA 5AJYA 3AF1A 1VKRA 5DCWA 3ESYA 3CVVA 3T1TA 2PV0A 3PQFA 3FOCA 1Y8AA 4RVOA 4XKJA 5F7JA 1NW8A 1XZCA 3KOWA 4R54A 5DLDA 2G0AA 5EXPA 5B1SA 4CKXA 2E1RA 4EZBA 1IQRA 2FEOA 3MD9A 4IIDA 5HZMA 3HCWA 1BKYA 1PGJA 1TZMA 2YWDA 1GKLA 3K5IA 2C59A 4C3VA 3QBJA 3V8PA 5BO5A 4H4CA 4MWBA 4OEHA 4WBNA 4N41A 2GXSA 4IGEA 5LBIA 2ZRFA 4ZJPA 3F7MA 1OFHA 4MKIA 5BSRA 5IS2A 4BN4A 4YV7A 5DW0A 5HE9A 3L0ZA 3QLJA 2QL7A 5BRNA 4B2IA 4XRRA 1B6GA 3T5DA 4KQXA 4RLQA 4X7PA 3UWPA 2DLDA 5BMVF 3KJIA 1RWKA 4URVR 3K20A 3HB7A 3IHWA 4BO2A 1T9DA 4L85A 2QENA 2ZBQA 1EK0A 2XB4A 4BO1A 2A1TR 5HP4A 1O6ZA 1ZL2A 4HQKA 4LI0A 1SQGA 2LWIA 1IATA 4OXYA 3WRVA 3W2FA 1CDOA 4FQ5A 1CQPA 1Z08A 2K4MA 4G4SP 4XM2A 5EE9A 9ATCA 4OXQA 4RABA 1QQAA 2BHSA 2ZT7A 2B1GA 4YX9A 1CDZA 4FFLA 2I6QA 1RWMA 3BMNB 3QQPA 4JZYA 5H83A 3QKTA 1NONA 4WFQA 9LDBA 2R8XA 3HDQA 3ZDEA 5FBWB 3L4SO 1UZMA 2IY8A 2W71A 3B2QA 3M4JA 3UIEA 1GLNA 5K0CA 3I52A 1V45E 2GBFA 4PG8A 2CUNA 2P1ZA 4JYZA 3SXPA 4B1FA 3DT9A 2XHEA 2XXAB 2PMFA 5INTA 3BGDA 4G5HA 4AROA 1JBKA 5ALTA 1R4NA 5JDCC 4L8YA 5BMVB 3FFBA 1OIVA 3PU6A 3UUWA 1X7XB 3ZIDA 4E12A 3X3HA 2CXPA 3FIUA 4RQAA 1QIEA 1N25A 3N0RA 1LUAA 1Y3AA 2I3GA 3MMXA 3PNBA 1KYYA 1CQWA 1E5QA 4OFWA 5TNXA 1KEZA 4I5IA 3SC6A 2ZCUA 4ILKA 2Y99A 4G5FA 2ZBFA 4TLEA 3LUKA 2YV3A 2QLMA 2VDUE 1J2EA 2I2BA 4L72A 3L8YA 4PCUA 3CH6A 3LOPA 4PSDA 4JBWA 4Q02A 5T4HA 3IQDB 1KOFA 4QTXA 4JLAA 2VHJA 2DX7A 4NRDA 3W90A 3GIDA 1XP8A 5B3AA 2W58A 4QM7A 4IF4A 2QRKA 3IQXA 4RV4A 1N6KA 4GYWA 5TLSA 2VP0A 3IT3A 4CMCA 4DRXB 1C0EA 2YC2C 2H6EA 1EFLA 1W5SA 4GDMA 3NIGB 2XUPA 4MRVA 2CDBA 4LGYA 3EVEA 4WIAA 2HMTA 2CNLA 4X92A 5HF9A 4TKLA 4QVIA 2YZNA 4PXSA 2ZJ4A 3VAAA 5TGZA 1YZKA 2X7HA 4DMUB 2E5FA 1M1YE 3DZIA 4PLHA 3OIUA 3OT1B 4GPIB 1W85B 1XQ1A 4TVKA 3DLAA 4CLRA 4D43A 4XR4A 4LWPA 4YPOA 1HE8B 4CLHA 4ALKA 3OJFA 3WZLA 1KMNA 1HOXA 2PD6A 3CPHA 1Q6ZA 4KX3A 1A4UA 1TIPA 2QZJA 3O73A 4JFRA 4GD3Q 4CMAA 4WW0A 5AJZA 1R6DA 1FFYA 1FVHA 4UNQA 1FE8A 2D5BA 2R25B 4HT3B 4JI7B 4N5MA 3COJA 5K3FB 4KIUA 4X7BA 3HBAA 3M6UA 2YL2A 4J2TA 4OLBA 1Z26A 3HYRA 3KDPA 1YWGO 4HS4A 2DEUA 1U1FA 2FE4A 2ZB2A 1QTNA 4ZGGA 1HV8A 1NRIA 4Z4QA 4BX9A 4ZI2A 1QQBA 1IZ7A 1UM9A 1MEEA 2CLDX 4O63O 3QNMA 4K2AA 4OGLA 2C96A 4OHUA 4TWZA 4UHCA 4YALA 1CUSA 3VPAA 1SCNE 3AZOA 1HG0A 1PSDA 2BTOA 4ZEMA 3OCUA 1W25A 4JU9A 2EQ5A 3GAAA 3K94A 3L93A 1U1GA 1SXJD 3KOUA 1VM6A 4E09A 4JVSB 4OXRA 1FUYB 1D4OA 1PX0A 2OQ2A 3TW4A 1DCMA 3TIGA 2ODWA 2W0SA 1J23A 1GCOA 2VBCA 2ZYDA 4QOEA 3Q5EA 3AF2A 3WHPA 3AJAA 3S7TA 2VJPA 3MUNA 5DEOA 2X8LA 4YP9A 3NP9A 4QPCA 2HPZA 4RK6A 1WOYA 2BMJA 2Y1DA 4TMVA 1XXHE 1X2BA 3DGEC 5D6NA 1PNOA 2I9PA 3E15A 5A3RA 5J2TA 1CP3A 2X9LA 1UT5A 4LY3A 1G3UA 4DNOA 3ILSA 1UP4A 2PZLA 2AK2A 4ASUA 4OYLA 2JGIA 1X8JA 2UZ3A 3JX9A 1C2YA 5DGIA 1JB9A 4FNAA 5EFZA 3V4LA 3LQKA 3RUFA 3R20A 4HXGA 2QL5A 2YTZA 1M9NA 3E58A 2C9BA 1CP2A 2PZJA 5FWXA 3AFIA 3UAOA 3IKJA 2XOEA 4K87A 4KBGA 5HZKA 3PLNA 4KXYA 3IRVA 5I9IA 3IPCA 3ETLA 4HS9A 4RE6A 4JLNA 1PUXA 1VXRA 1S8OA 4FHEA 5FR1A 3MTDA 5TPZD 3AVOA 1QO0A 1YK1A 1I32A 2L0XA 4KQ9A 1FRFS 2NU9A 2OZVA 1EAMA 1U02A 3A9UA 1E7SA 4LYHA 3H2GA 4NJMA 4OLHA 4RIEA 5AI0A 3ELUA 3EXHC 1VXOA 4UU1A 2V5AA 2JJ1A 1ZUNA 4Y1EA 2C5HA 1T3GA 2AEMA 2GAIA 1ZWLA 2W5UA 1M34E 1GQOA 3E03A 3SJBA 2XVYA 4JY7A 2YZGA 4PINA 4HVLA 4RTKA 1T15A 1Z0KA 3JZFA 1P62B 2IYYA 1D4ZA 1OWLA 4IAOA 4AL4A 1JFFA 1FC0A 5FUWA 5CDFE 2YRFA 4GWKA 1ZOLA 2Q1XA 1YJCA 3P32A 4BWGA 4CODB 5EWJB 3IP7A 4X1IA 5D85A 1XOIA 2GXQA 3FYHA 1DAEA 3KXDA 4PFSA 4UCXA 1QH0A 4A2QA 1QONA 1X77A 3B2NA 2QD3A 4AKIA 1M5TA 1STOA 4JB3A 4Q05A 4EB0A 3WWOA 4F6LA 4B43A 1O3YA 2FWIA 1V6AA 4WTOA 1DIAA 3B3GA 3DNFA 3K4HA 5KVAA 1PJCA 1P29A 4GOMD 4RF3A 5D6OA 3V34A 3V1UA 2N0SA 5JEDA 4EHDA 1YZUA 2WIBA 3ZE7A 3IB6A 3CEJA 2IYFA 4DCOA 2FMFA 1L4MA 3L41A 3WJ7A 1Z3CA 5FNVA 4RTOA 3TWOA 2BM1A 2IYAA 3ISJA 3JD1A 3JV7A 2EYUA 2ID8A 4U2EA 521PA 3C4VA 1Y3CE 4AK9A 5A7FA 1L4UA 2V9PA 5CTAA 6CHYA 1A96A 4F7WA 1PI3A 5A71A 2JCGA 1G5HA 3RLIA 4M88A 2C3YA 3NM4A 5CLHA 3TR5A 3QWAA 3LU1A 3O93A 3B6IA 4FHCA 4NBVA 2PX6A 4RZXA 5F77A 4XGNA 3QKRB 4TTVA 2CFIA 3RK1A 4Y2VA 3FJOA 5TEVA 2GN9A 1Q3HA 1UKZA 3BPSA 1TM5E 5ESWA 1L9KA 1IMJA 1IEWA 2WLSA 4IV5A 1E3EA 3MEQA 2RGUA 3PQ6A 1HKHA 2AOVA 3F6SA 1JSCA 3IEVA 4RHYA 4XPIB 5GINE 3HA7A 4HDNA 2IYEA 1XYYA 2EKBA 1EWVA 2VPQA 3I6IA 4AWAA 5JH7A 3FCUB 4MAMA 3RLFA 1DRJA 4NBWA 1AZTA 3EIUA 3HM2A 3UG6A 3SLRA 2I2XB 5HIIA 5BQOA 1OT3A 4I0WB 2HK6A 4JI2B 1L7NA 4J0EA 5KHOC 1KMHA 2AJBA 1YZQA 3NYWA 1Z28A 1N1DA 1FTSA 1Z5GA 2ZDHA 4DG9A 2NNWB 1CY1A 1GTRA 3KDAA 1RJ9B 4J4TA 2JBWA 3EC7A 2CNWD 1C9DB 2PG3A 3NEPX 4IMRA 5IT0A 2W2QA 4GBJA 4CEJA 2NTEA 3LUFA 3LT5A 4CM9D 2DWQA 2GBLA 2EIHA 3ZWVA 4YV2A 4LNAA 4C6TA 1E5XA 2WZBA 4R0NA 1HRKA 4PYIA 4RBNA 2P40A 4D1YA 3SU8A 3ZJYA 4L16A 3U7FB 1OH7A 4B8ZA 3GLIE 3WBBA 1WUHS 1XPJA 3ZPXA 3EISA 4IDEA 5G53C 2WJPA 3JALB 1YNSA 3FUVA 5KYNA 3NT4A 3ECAA 1AM4D 4JOSA 4RKWA 1Q44A 3I62A 2B92A 4EEXA 4EKNB 3DP9A 2WINI 4NOJA 1MB2A 4O1HA 4Q3LA 4DLWA 3OKAA 2Q0XA 4MW0A 2MMGA 1JHQA 3BD7A 3Q0IA 4GS5A 4AM8A 4PHCA 4C4OA 1NVTA 3PGXA 4Z2AA 1DLJA 3CZRA 3DE5X 4J0KA 3GMTA 1ZGAA 4R1TA 3WGQA 1RFLA 3R3XA 1LVHA 5EINA 3ZGLA 4F4UA 3DMHA 4GSYA 1NBME 1EE9A 2B99A 2V7WA 1VLHA 3TFWA 4R1QA 2ZZKA 4GI5A 4KR3A 2FZGA 4ZVLA 1MOPA 4DMKA 3ANTA 1PRYA 3GLUA 1IN1A 2GM4A 3DBHB 4U6SA 4G5OA 3MHPA 2JG3A 3AONB 2ISSD 2NO1A 3ZKAA 3QBDA 3CVYA 1GRQA 2DUMA 1HORA 1QPBA 1ZMXA 2ZRDA 4TKVA 3H04A 1L1FA 3QMPA 1QFXA 1QRDA 2DBRA 1MABB 5ITVA 1ZJ5A 5EQJB 4A26A 1D2MA 4CV0A 4ZJYA 4NOLA 4US2R 1X7YB 3AM4A 1COWD 3DAGA 4Q82A 2AH5A 3C3XA 1BQ4A 3HY4A 2N3ZA 3MMZA 2Y1OA 1DZIA 4WJKB 5IAEA 4CQMA 5JS7A 3IAXA 3DDZX 3RS3A 3QKSA 2VHUA 1JYFA 2OHIA 2OFPA 3FG9A 3OEHA 4FYIA 3ZU3A 3R7WA 3HXOA 2P68A 2YIJA 4KR2A 3I8OA 2KPOA 1WZIA 3L1IA 5C5DA 3KYBA 3NJRA 1HTBA 4HATA 2H48A 5C8DA 2CXHA 5CNJA 4ZEXA 2AG1A 1JQLB 3AI7A 1UAAA 3A1SA 1JFVA 4Z6KA 5A3QA 3KR2A 2FETA 2CDRA 3J80A 2Q2NA 1U4NA 1R9JA 4MKGA 1PZEA 3BM5A 4ZV7A 5FOXA 1SMKA 3V4OA 1VI5A 5BYKA 3EQ2A 1FMFA 1L8QA 2EDCA 1ZI9A 2AWOA 3PR1A 4R2HA 3S70A 1N2ZA 4DDTA 5G41A 1IPEA 3OEWA 3V5NA 3AR8A 4RKQA 2G3YA 4H7EA 1QJ4A 5C8YA 5KJFA 4L8GA 5EP4A 4F56A 1JFRA 2VYCA 3D64A 1DDGA 4MQEA 4XZ3A 4CIBA 4OGGA 4W5WA 2QOEA 3ZCQA 5JNVA 3PSHA 1NUSA 1F0YA 2XXBA 3CX8A 1PZXA 1E6MA 2G8NA 3KC2A 1MOZA 1N2SA 1NQOA 2AJTA 2G1AA 3D02A 2VXBA 3SXUA 5BN5A 1CF4A 1R4MB 4MKHA 1U1EA 4ZVVA 3COSA 3PNSA 5DBHX 1IDN1 4GT1A 2BEJA 4C0HA 2PUTA 2PS9A 1E2LA 3K6KA 3LRPA 2Q2WA 4LZLA 4XEHA 1Z2CA 4TXJA 3TXYA 1ZHOA 3C5CA 4Z4GA 5LDDC 3INNA 3TNFA 3G9QA 4OVKA 2X2FA 4TYMA 2IOFA 2VG8A 4BJ6A 4AIIA 3KYCA 3WR5A 5BNTA 2ES4A 3KHKA 3QGMA 5JT1A 2BM9A 1FDTA 1G21B 1L7DA 4EAQA 3QENA 1S01A 3DZCA 4G0QA 3KOMA 1G64A 4POAA 1MNQA 2E37A 4XD7D 3M3DA 5KVCA 4KO4S 1PL6A 3IRUA 1NMZA 1HPLA 4O4HA 4Y6QA 4EGSA 2CCKA 4GZLA 3LUHA 4IDHA 4J6FA 1AS0A 4MB6A 4L7VA 1E9EA 2GYYA 1DJNA 5NLLA 3BX1A 3O3OB 2AK3A 1VIVA 1URPA 2GWRA 1N5JA 4KIGA 2PJDA 4DG5A 3AX6A 4KI0A 5IUNC 4DB4A 2C42A 3N75A 1CHNA 2QGNA 3FVQA 4QOFA 4RH0A 1SQFA 3ETJA 2WNIA 1IWBB 4DR4B 3P94A 1KIFA 5FKJA 3ZV6A 5DNCA 4QOIA 2QWXA 4MEBA 2HHCA 1NNUA 2XA2A 3QG5A 2VP5A 1GZVA 3Q5GA 1PS9A 3ZJ4A 1DOAA 1NFQA 3PHBE 3QVXA 1W8DA 2PSDA 3AERA 1MX5A 3BKXA 2DETA 2R1VB 1V47A 3FYDA 4WA8A 1NG9A 1M1NA 3GGSA 2F6RA 1KKUA 5B7GA 1QTQA 3I28A 1SQ5A 3FGPA 4UQPA 4UUBA 4FSDA 3E35A 1I9CA 1Z22A 1QG4A 3I3OA 3NHRA 1TPZA 3NC1C 1B16A 1HC7A 3UQZA 4X60A 1U80A 2XECA 2KWIA 2XE4A 4PRKA 1SWWA 1UIMA 3MMNA 3RFUA 1M5RA 3OQ1A 2IX3A 4IO1A 1CB7A 3O8BA 4REQB 1Z0SA 3UKDA 3WZMA 5IZ4A 2JLXA 4EZEA 4HAOA 3AF3A 3D6VA 4XGRA 5IWCA 2G77B 3DOOA 2OXRA 1V6SA 2QTCA 1DC6A 4PG7A 4JBYA 2EGUA 4U0KA 4UZFA 4YJDA 3C74A 1ID8A 1W48A 1R0SA 2IJGX 4J90A 1FQOA 4YDHB 1OE0A 1NXWA 2ZFUA 3V2IA 4EH1A 3DLPX 2VZ9A 3B52X 2C2MA 2R8OA 4IG9A 3KQKA 3PV0A 3BMQA 3QVJA 3OZ7A 1GNSA 1VLZA 2CD7A 1IL0A 1ADJA 1N5LA 3E5NA 3SBXA 1OBFO 2BFFA 4M0EA 2CD9A 1BD3A 4RPKA 3UJDA 2VKTA 2G9NA 1RWQA 4K0KB 4HDCA 3VZSA 1LK7A 4ZARA 4CKYA 2HU7A 1PO7A 5IKEA 1B6RA 1TZCA 2HUPA 1VG9B 4YUVA 3OX3A 5EZQA 5KTRA 3CSSA 3RGGA 1IBRA 4FS8A 1T5BA 4NMLA 5LCXA 2CCGA 1T8UA 1U31A 2JIPA 2CNNA 4QWWA 1OB5A 2VDOB 2JLCA 4FDAA 5HS4A 1YRLA 3P2KA 1P4JA 4H0NA 4XSVA 3ZHOA 3P2YA 3LPMA 2WD8A 2XAAA 2EKLA 2MCFA 4JLOA 2QUAA 1BAPA 2AGVA 2AOXA 1G8AA 2L17A 3NJ8A 4XX1A 1ZESA 1DKRA 3CZMA 4HZUA 1NY5A 1YHNA 5G4KB 3L4EA 3GLGB 1M10A 1I6LA 1QIMA 4GLFA 4QPNA 3KQQA 4Y9SA 1YOBA 1DC5A 3T3IA 2HL6A 1OGIA 1T91A 3T0IA 3WADA 1GPUA 4QFDA 3MPOA 1JHVA 1B4DA 1LI5A 1P17A 3GFGA 1YF3A 2GETA 1O8CA 1XAGA 1GN8A 3FTDA 1RPJA 3A1EA 1Z83A 1VGRA 2PSEA 5DX8A 1B6SA 4G9BA 1VZ3A 3HKBA 2BFCA 4XQ0A 4FYJA 3VC7A 1QQ7A 2QBYA 1B42A 1TJ5A 2VQDA 5BV0A 1WDWB 1IVSA 1MTOA 4P8RA 1RZRA 4F60A 3CQ9A 4FE4A 2Z4RA 1F3OA 3I92A 2KI5A 4BVAA 2RGRA 4RWZA 1ZHFA 3I34X 2H1SA 3L1KA 4OREX 1Y7TA 2RC5A 2WIGA 3LDAA 5EXSA 1L8LA 1TLTA 3P9RA 3IQFA 2OBBA 3PEYA 3RRBA 2LZ0A 4OJYA 3QLUA 2HLDD 4TSFD 2WIKA 1II0A 2DH6A 2X0KA 5B3LA 1MO5A 4E22A 2DPXA 3A3NA 4ZHSA 1AMOA 2FZLA 3V1TC 3O4GA 4AUNA 4BXOA 4JH0A 1RQNA 1PR4A 2H1WA 3AW9A 5F7XA 3H16A 1DAPA 2Z58A 5K0JA 2XR1A 4QJ4A 5TF4A 3AIMA 2E85A 4WECA 4QAJA 1B43A 4R16A 1SCQA 4L1KA 2V3CC 2D6FA 3R3YA 1NJ1A 4YEDA 5HTOA 3UJBA 2Y27A 2B2XA 4BMCA 4MUMA 2G7ZA 4G0MA 1JMVA 5AHKA 1YR6A 4OX9Y 3FWNA 4ZDJA 2FW9A 3RC7A 2QTVB 4C0SA 2DLCX 3VJLA 1FRNA 2XDAA 3ZNOA 3BGWA 1JLLB 1SD5A 2C4VA 2C3MA 3GFBA 2O19A 4PZ0A 3H8SA 1JDUA 5I8PA 3FR7A 4GP6A 4DMLA 1SXHA 3ZQ6A 4LNUB 1NBOA 2AOWA 2WDZA 1W87A 3GHHA 3VPFA 4LX8A 3DV0A 2RJNA 1X74A 4RTJA 1HWYA 3T4PA 2HM7A 4JXJA 3WXMA 1Z39A 4K86A 1IQ0A 4M1ZA 5CYPA 2A33A 3H5AA 3WP0A 4E08A 3OURA 4Z5XA 3I83A 3LQQA 3THYB 4JDUA 1O4WA 3ZN2A 1GRRA 3DV2A 5G3YA 4W5NA 4AMBA 2SKDA 3K8QA 4V0KA 2BP7B 4F8EA 3E53A 3Q0EA 2QTHA 3PFCA 2HMUA 2VQEB 2D1QA 3HHEA 2JIMA 3Q0TA 2PLRA 3BB3A 4N76A 2O8FB 5EKDA 3UVEA 1LDBA 1Z07A 2IDMA 4G8CA 2OORC 2HZBA 4Y7CA 3CEPB 1FZQA 4WA7A 4AZ0A 1ORRA 4C4RA 4YJFB 3HDHA 3G49A 3OPYI 3SYNA 2GF9A 1MC8A 2VTVA 3LKDA 2RKBA 4MP3A 4YHHB 4KFTA 1ST2A 1OWOA 4KFSA 3HXTA 3KLMX 4XUGB 1XEXB 4Y9DA 4OKSA 4YCNA 1IWPB 2P5SA 1F5NA 4ONEA 5CNMA 2Q7OE 2NVUA 3IXLA 4J1TC 2H4JA 1AQYA 4PN3A 3O38A 1BMQA 4GI1A 2I91A 2MR5A 1E3JA 1NW7A 3VPGA 1Q14A 3EWSA 1NQWA 3ZV5A 3HE3A 5KOHB 5T3YA 4JELA 1ULBA 3M3PA 4FCVA 1YRYE 1BX1A 1GGHA 1WVMA 3DEHA 3DQZA 4X7RA 4Z1MA 2GN0A 2QLLA 3L7LA 4M1KA 1XHEA 5SZIA 3WP1B 4D8YA 2J4CA 3TVYA 4BQRA 4XJXA 1TECE 3OQPA 2Z3ZA 3CPSA 1EDEA 4CW7A 3AGQA 1JAIA 1QMGA 2EVWX 2VYQA 4RQBA 3RFTA 3WWZA 5CM8B 5IJ0B 1EAYA 3BTVA 5GGXA 4KH1A 1DBPA 3WBFA 1WVIA 1FUUA 5KYUA 2DPHA 4BNNA 3OCVA 1R9NA 1D2CA 2MSCB 1ECBA 4BMNA 5EHXA 3ZDBA 2O8BA 4QARA 1FMJA 2O7VA 1HLPA 5F64A 5JADA 3OPQA 4U1RA 2QYSA 1OREA 4F9GA 4JCOA 1KMQA 3Q7RA 2PZ8A 3QE0A 1T2NA 2VDWA 4H7KA 2VPWA 3UMBA 1U8AA 3HKCA 4ZVPA 3CXUA 4F9EA 3RKRA 5A4KA 2HHAA 2C4UA 4FFMA 1NRXA 4NZMA 3DNMA 5B1IA 3ET4A 5B4UA 3DKPA 4KK4A 5EHZA 4NH4A 4C4PA 2PKWA 3GRYA 4TMYA 2RI0A 2YYSA 2XT0A 2QR5A 1P0FA 1YA4A 1ZM4A 4YIHA 1K6XA 1IBSA 1JSXA 2XYPA 2RGAA 3RWOA 3WDKA 3N05A 4EP1A 5LMZA 2OYRA 4U5QA 3VU8A 2G1UA 2WWFA 3RUCA 1H6AA 1P2VA 4C3ZA 3D3WA 1Z68A 2AZTA 3EFBA 3L04A 3LXRA 2Y9PB 4ZQGA 4MVWA 5FL3A 5B5SA 5ALGA 1E9FA 2ZVJA 2DFLA 1N6LA 3H1BA 3JZAA 4NV0A 4BB9A 1Z15A 2VSXA 1LLCA 4EMBA 3MCUA 1SOAA 4J9VA 1VDMA 4N5LA 3TDNA 1PD1A 2IHZA 3VHLB 4BNWA 3EIXA 2RD2A 1MXHA 4Q1EA 1TAHA 2YNMC 4JVOA 4PAWA 1I6KA 2W4QA 4DSOA 4PNHA 2FMUA 1PJ8A 3QXHA 4MUBA 3RRFA 2CFSA 3WMGA 1ADCA 1SCAA 2DKFA 4HAWA 4DG8A 2Z4TA 3C45A 4DREA 1GCAA 3P19A 4LPKA 5JO0A 1X8KA 3H13A 3UOGA 1NA5A 5BUCA 1Y4AE 1QP8A 3AB8A 3BD9A 4H7HA 1K63A 3V4FA 4TQ9A 4L07A 1BROA 1RAIA 1X92A 1S0UA 3E3NA 3L7DA 1OCEA 4D99A 1ISSA 2P9ZA 3PC6A 5J40A 4ESVA 4CU2A 4QDKA 5KX5A 3TZHA 2OCIA 3P2JA 2W2KB 1ZD4A 3SYKA 4IKOA 5KSWB 3MRVA 1S2OA 1D5WA 5G02A 1DMSA 1YQ9A 3V4VB 4DZZA 4Q9HA 1R3UA 3MGBA 4HDSB 5IEBA 5KQPA 3MM4A 3ZWBA 3HADA 3AEYA 4BASA 1UQUA 4RFVA 1T1JA 2H1CA 1NI4A 4KWTA 3SWWA 2ZROA 2P8JA 1HK7A 2O7QA 4TZKA 4EG0A 3L0BA 5EJ5A 1D4AA 3DQQA 3GLRA 5I9MA 1N0WA 1EFAA 3D8HA 1NVXQ 4Q7LA 4DDUA 2CMKA 2RBEA 5K3BA 1TNDA 4OMCA 1EJBA 3EK2A 1THGA 3GJTA 3ZEAA 2Q2OA 5I5EA 2ZYRA 2ZE5A 3OO0A 4WZAE 3EGXB 4YRJA 4DDVA 1P33A 2PPVA 2V7BA 3UBMA 1VMKA 3WGKA 2EZTA 3DPIA 1RPNA 4ZOLF 2X8BA 3CTMA 4GRIA 4YRAA 4UNPA 3GPBA 1RC1A 4IDOA 4HJRA 4LPSA 1ZC4A 4DHWA 3F5FA 4RA9B 1Q7TA 1KR2A 2VXCA 2WA1A 3FMGA 4BO9A 3IL2A 1WBBA 5CP8A 2OG1A 3N53A 3N8DA 4NMMA 3VOSA 4E6PA 1DXYA 1UEIA 4M1SA 1FEZA 1PJ3A 1JXMA 3I73A 4E3WA 1RWPA 1Y7IA 2NUPA 2VNHA 2FG6C 4JOCA 2HBYA 3CLTC 1NVFA 3AL0C 2ZETA 3JAMA 3LQYA 1I3CA 1NF8A 2JBAB 2LCFA 1U0TA 4ICIA 3HU3A 1QGAA 3HCRA 2GGSA 4EY4A 2PBRA 1NMYA 1TJ4A 4QTTB 3S44A 1JI3A 3DVRX 1MJ5A 3U7EB 5DYNA 3GNLA 2KE5A 2IV2X 2UUOA 1GSOA 4OQDA 4O4LF 4RPCA 3VI4B 2PGOA 4F5YA 2CJFA 4YFYA 5G0UA 4IIVA 3F97A 4F9TA 2FX5A 4YV0A 1DQSA 1EWQA 4X8MA 1BVRA 1R5NA 1ZNQO 3H0KA 3M6VA 3B3JA 3BIOA 4CKEA 1ZM2A 1JVNA 3A6JA 3JQQA 1BHO1 1B76A 1KVRA 1OZGA 1H8HD 3MUEA 4JLBA 2VTBB 3RUIA 1SUEA 5FWNA 4LZZA 4ZOLB 2VHWA 3BJEA 3V2UA 2IELA 4MW4A 5LZ9A 1DIBA 4WNIA 3T7IA 2VC2B 3MUOA 1SUIA 2LPMA 3K9LA 5LZ8A 1QGUA 2WTUA 1SUWA 3GEBA 4IX1A 1KDRA 3GAMA 2A3NA 1U8TA 3EZNA 3PQ3A 3LVQE 1NOKA 1G5FA 2JFHA 1FQJA 3GGOA 4Q4CA 4R9NA 4I1OA 3BCSA 4R0VA 4MPJA 4RH3A 1JALA 4PYJA 4JB8A 4P3KA 3CV3A 3GFTA 5HILA 2D0PB 4C3UA 3G9XA 3ANXA 4O4LB 4Y1RB 1JJFA 2A2ZA 4DQXA 1UM8A 4B9AA 4J1NA 3CLUC 1IK6A 1EUDB 5LB2A 3DWEX 2EHDA 1M2JA 3UHJA 4RJKA 4Z7OB 2PYDA 3CJQA 3DEYX 2IS4A 1Z38A 5ER6A 5A9SB 3DNPA 4ZV4A 3C48A 5K51A 3DTYA 5KQLA 4S2EA 1PW7A 3BXGA 4URWR 3KVVA 1QIDA 4HX2A 2O2IA 3SIXA 3VKFA 3E0XA 5E95A 4OJKA 4GMXA 2FW8A 2Z6AA 2E48A 1GWNA 1VMAA 2W48A 3HR8A 3MINA 4I1IA 5CX4A 3MJSA 1F8UA 4Q1BA 2GA8A 3CPJB 5LZ5A 4B71A 4OY3A 5GVSA 3NTQA 4WJLA 5DYWA 1NX6A 2JL1A 4ZZ0A 1BU8A 2PWZA 5JRZA 2F9FA 1U9YA 1V4VA 2WJHA 5AYVA 3WDSA 4IV8A 4XIGS 2ACWA 1JSLA 1XBTA 4ZANA 3DULA 2ZK7A 4ARZB 3T0FA 4BNDB 4JI4B 1GNTA 3R0VA 1ACLA 4QYIA 2V6MA 1I0LA 2WMOB 4V1CI 2LCIA 1KRWA 2PL5A 4I4CA 2X0JA 4EGQA 2ANBA 2O6LA 5HA5A 3T5TA 5A5GA 1E5TA 3WL4A 1PJ4A 5IMBA 1C1DA 1E0AA 2FXVA 5TS3A 1EGVB 4GP7A 5HQ3A 4XPZA 2O8CB 4P5EA 1W0CA 3NVMB 4AS3A 1UC5B 5BXYA 1CY2A 3CRMA 2AJDA 2WB4A 2SKCA 3PXUA 4QRHA 4B3TB 2IYTA 3ZD8A 3CF0A 1ONNA 3OA0A 1DQNA 2SCUB 1N1MA 1Z25A 5JAUA 2GPJA 5HDBB 1M34B 3AWIA 1W0JA 4HRAA 1J7KA 1EK6A 2HA5A 4ENWA 2ZRKA 5EIFA 1T3SA 2Q4DA 2RJ3A 1MJFA 2ZBGA 3TPZA 4MQUA 1SKYE 2ZJBA 1CBUA 1DZ3A 3FF4A 4AUKA 5F3WB 2FZ5A 4JJ4A 4JL8A 3RNLA 5GZ6A 3K9WA 4MS1B 4UM9B 2H4XA 5TT0A 1CJVC 1OYVA 2AR7A 2R5WA 2C92A 2CE7A 2VCYA 2I7TA 3WL5A 4DHEA 1R64A 2WPDD 4NYJR 4MWTA 4JB2A 2C7PA 1KJIA 2JD0A 1OVMA 4HD8A 4IUCS 3U5TA 4RF5A 4D3SA 4Z9YA 3H17A 2J9YB 2FY8A 2AVDA 3R23A 3CSDA 4B3IA 1FDWA 3C7CB 1T9BA 1TF5A 2D1TA 1AX9A 4J49A 4O33A 5IN5A 2R84A 3V42A 4F5DA 4XRGA 5E2IA 4CUJA 1RP1A 7ABPA 2XQVA 2XLCA 3OP1A 2QQFA 3C3PA 2X3UA 3FFXA 4L50A 4AJJA 1Y8QA 4FFRA 5THXA 4DT1B 5HCNA 5BSHA 3ORFA 2I6UA 3U81A 2D59A 5BSTA 3AT1A 3CZ5A 1SOUA 3LZ6A 3BF8A 1XDDA 2GBIA 2O8NA 4IWNA 1IG3A 2IP1A 3DMFA 3EVDA 4YRFA 3PUKA 5CURA 3RKSA 3FPFA 3ZCXA 4PRYA 2VBIA 3PD0A 1SEPA 1TO6A 1U6IA 2UZ1B 4MZXA 4JLMA 3PC8A 1JYEA 2PU5A 4MVJD 4H1TA 4KQKA 5COBA 3GUVA 5A6SA 3QVKA 4EHLA 1M5UA 1TUBB 4QATA 3P0HA 1AB6A 1K9VF 2Q5IA 4FILA 1N2CA 1YDEA 1QK4A 4PSVA 2ZT8A 4PVDA 5DMHA 4DE5A 2OWEA 1E9RA 4FKBA 4IHJA 1XDSA 2ZR7A 2DY0A 3LMKA 1RYEA 2MSWA 2J3JA 2Y0DA 3EMDA 1FU7A 4RM3A 1W8IA 4OSOA 5GGYA 1P80A 1V8BA 3DVSX 2WHXA 3WGUA 2V0NA 5CU7A 1LBQA 4YRMA 5KWJA 5KU7A 1SURA 4IBOA 4Y6GB 1E5LA 3CR8A 4Y2YA 3REQA 1EBFA 4X84A 3W9YA 1DFHA 1Y5NA 3ROMA 1ZCZA 2R62A 1OLXB 1G1MA 1KA9H 1GY8A 3LWZA 4RTNA 4RSMA 4IJMA 5CH3A 3UXEA 3SDBA 3OTOB 3M6AA 2IH5A 3WGLA 4RHXA 1SHKA 2ZWPA 2VHVA 3AP3A 3C8DA 3F2IA 3ER6A 2IFTA 1DAKA 2NSLA 2QQGA 3AKDA 4YN3A 3I01A 4RK0A 1YKGA 4YHBA 4MGZR 2K87A 3N8GA 3MLBA 3GDWA 1S2NA 4G1VA 4V3CA 5KC8A 4PWZA 3SNHA 1SUFA 3ZXIA 3TTXA 2ONZA 2CNDA 2A7XA 1XA4A 5ANRB 5T8KC 1Z4LA 1DCTA 5BR4A 2QTWB 4MWDA 1XLTA 4HQFA 4JBLA 2C0QA 1BGVA 3TBKA 3RS9A 4CM7A 1ECCA 3ZDCA 1PQWA 5DTQA 4J6EA 3QW2A 4J07A 1EWRA 2J31A 2ZM6B 3SAJA 4MS4B 1CUCA 1QUFA 1Y81A 3BE8A 3BREA 2P2SA 3OUUA 3I9KA 1NW9B 3R6DA 4DCGA 4IGKA 2HEGA 3RYCA 3UAYA 3BF7A 2QVZX 3WB0A 3N8HA 5KAPA 5K8IA 1SKQA 5THKA 2J32A 3KJXA 1BVYF 1D9XA 5CBKA 2UVQA 1CF2O 4OK5A 4UDYX 1WWKA 2GCOB 3KPYA 4UHJA 2PA0A 3RH0A 3SG0A 2GBLC 1W4ZA 3I2HA 2I78A 4PPQA 4GX5A 3TRJA 4U7GA 1YDMA 3ZZ1A 1RLMA 1QTRA 3BS4A 4ARIA 3DL2A 4J0IA 3VISA 3O3NB 2WM3A 4A8TA 3VNQA 2E2WA 3CUUA 4N5IX 4GR9A 1BVHA 1E1MA 3X2EA 2Y0CA 4YJ3F 2M98A 2XYVA 4WLOA 4IILA 5EMJA 3NHWA 4WESB 4AICA 2FHSA 1NW3A 1WSBA 1WW2A 2CJWA 2OAQ1 2J3IA 2ZJ5A 3G9ZA 3VSEA 3DP7A 1QAQA 2RHHA 1Q95A 3SD7A 3SZRA 5MGBA 1OPXA 2LCQA 4D4GA 5JPCA 2QX4A 1K27A 1U8YA 1Z4IA 1ZSYA 3TQOA 3R6TA 4HKTA 3JQGB 3CWZA 3R7BA 2IXTA 2MSKA 4TYYA 2FUCA 3QVLA 2I65A 5FTNA 1SK8A 4W82A 4R7GA 3IAS1 1Y8RB 3QY9A 4Y8VA 4HNVA 1OASA 2C2KA 4ZCRA 2ZEJA 3VZCA 2LNDA 1X0XA 3NNSA 4K6GA 3SIWA 3K9GA 1BEUB 6LDHA 2QVGA 4JJEA 5KU1A 3QVMA 4JOQA 1PWZA 3MTIA 1HFKA 3EXHB 3KZNA 4HWGA 5P21A 2CB9A 4JT4A 3KKEA 2RAVA 3JPWA 3ELWA 5F5XA 4YJ3B 3R7FA 3NUQA 4BO3A 1X2EA 1FNMA 5IFKA 4YI5A 1AG9A 2UVDA 3FPLA 1RJGA 1U0FA 5FL7D 2PSJA 3PXDA 3IUJA 4TQUS 1ESZA 2BFDB 2P2CA 3K7EA 1BWQA 2DFTA 2OZEA 1WABA 2YN2A 3QMWA 1ULUA 1SQ0A 2NIPA 2R8BA 3W3AA 3WIUA 3IIEA 3A1DA 4MINA 3H42B 1KY2A 2N75A 5AT1A 1Z75A 5CJPA 2BY4A 2FQXA 5HKKA 2WT9A 3DMTA 5KNBH 1E98A 2A5YB 2MYPA 4OYYA 3DOEA 1HDCA 1FMCA 2WJJA 2YH2A 2PO5A 1R8YA 1OV4A 1V5FA 3FSGD 4ES6A 4RC9A 4TROA 1YU9A 3AUJB 3FI0A 4L6CA 2V9ZA 4LW8A 4MGYR 4HV4A 4DLXA 3KPJA 4QDTA 3M82A 5FDFA 3ROZA 1XCLA 1X7DA 3AU9A 3NBMA 2R0QC 7YASA 6NULA 4G0UA 2O57A 5JSZB 4L75A 1TM2A 2PA3A 1C3OA 2RHJA 2ZRAA 3AXSA 2JFWA 2GESA 2NZVG 5DP2A 4Y3UA 3W6UA 4EY6A 1MFPA 4BQFA 1SCBA 1T35A 3MERA 5K4GA 4AKHA 1N2OA 4CJXA 3CW9A 1RRKA 4WKPA 4H3SA 4LJSA 1JI0A 2FHPA 2Q3BA 3LG2A 3LVRE 4UU7A 4JXZA 2KBEA 4O1IA 1EXNA 1Q21A 5EVJA 1NLYA 5DMXA 2VK2A 5JYBA 1KQGA 3AF6A 1GTMA 2PJZA 5AVRA 2HJVA 3NGXA 2ENUA 3EXG2 4WXMA 3AR3A 3EIWA 4P58A 1WP9A 5IT5A 4P38A 1UJNA 4XR9A 5TPWA 1X0VA 2NSJA 4H16A 1DHRA 3X2FA 5EPOA 5ADVA 3NOQA 3F73A 4EL0A 4FWBA 2HLPA 1C7JA 5DCLA 2YASA 1MGPA 4K1XA 4YAWA 3VYRB 3LLMA 3ZVKA 1MJGM 1X80A 3AHGA 2PTHA 3JATA 4BVLA 2F9LA 3W8EA 5M29A 4LF5B 2AN4A 4B4OA 5FPQA 1YS9A 3RRMA 4IL5A 4A1FA 4FOPA 4DA6A 1W9MA 3DXFA 3U3JA 1K08A 5H7XA 1KEKA 2R97A 3Q9UA 1G8FA 5TARA 3HYTA 2H54A 3QE4A 1XTBA 4FBLA 3TF5A 7GPBA 1FP4A 5TXGA 2D7JA 4W5JA 5CB8A 4I5EA 4HWOA 4ZVQA 2ZQYA 1LK5A 3F6PA 1OTHA 5DYGA 2EG5A 2FI1A 1NL3A 5BN4A 1YL7A 3N5CA 5HBRA 3HL4A 4QLOA 1FYXA 3LDGA 3F9CA 1KOJA 3R77A 3TVDA 1R74A 4BX3A 3E5RA 2JJYA 5SICE 4KGZA 2WTBA 4HDMB 4RUKA 2X22A 3ESQA 4LDQA 8MHTA 2NTYC 5AM4A 2Z09A 3FWHA 1CJMA 2CMDA 4L6IA 2IXBA 1Q0LA 1U65A 4E5DA 4JSTA 5EKTA 3GVPA 4FQ8A 1EQAA 1RTTA 3X1JA 2F1OA 3O26A 1WLYA 2HAEA 4Y0AA 3D4NA 4D9FA 4ESEA 5ED0A 5JSHA 2ZM5A 1Q7RA 4RAOA 1ZGJA 1F8XA 2WEKA 4C9BA 5AFSA 4O3MA 1IEQA 2GK4A 3R0IA 5DIZA 1MEOA 4O8CA 1HRDA 1QHHB 3LP5A 3CISA 1IPHA 3DPSA 4M89A 4MYDA 2EWWA 5TB5A 4BMZA 2RGNC 4DYVA 4JJGA 1YZNA 2FMXA 3KK0A 3PCXA 5KHAA 1ZAKA 1IDOA 3VSBA 3NS7A 1RXEA 2VPTA 3VVBA 2BBTA 1ZXXA 1JKXA 3G0IA 2I87A 3WDMA 3CBQA 2IU0A 1H2AS 3CLVA 1SG9A 1T9HA 4GZMA 3ZIUA 3K6SB 5B3JA 2QMUA 3BZBA 2VN8A 3EVGA 4WH0A 3HXQA 4H4DA 2POQX 5IT4A 4ZAGA 1NX9A 1PJSA 1E1LA 3KCNA 5DZSA 1XLWA 1B00A 4YMHA 4ZYZA 1JN0A 5C32A 2GEBA 2RG1A 1RAHA 4Q3AA 2C0CA 5CAEA 4PVCA 3LIIA 5GADl 1WCV1 1QANA 3QQ5A 5ARBA 1QCDA 1T5SA 2GFHA 1YS6A 1CZLA 4RHTA 4FE7A 3NHAA 4V02A 1FW6A 4CR8A 1V8DA 1JX6A 3EDYA 2IXAA 2ZWOA 2AJLI 1D1PA 2G80A 5EJ9A 2V3VA 1SCUA 3FTCA 4I8DA 4WHMA 3UK2A 1GTVA 4L22A 1UBEA 5BOSA 4WZBA 4UHDA 3T1HB 3W7VA 1J5EB 3IPYA 1TZ2A 1TYDE 1LBEA 3SC3A 4Q0MA 3VNRA 2Q5HA 5H4GA 3L0YA 3DUWA 2Z6UA 1PQPA 1MX3A 4R2JA 2A0KA 2HUNA 1G2PA 1IIRA 2DHEA 3L8CA 4AYTA 4WERA 2OHFA 2R6CA 1G19A 2J7PD 4B34A 4HNGA 4LJ4A 3CIOA 2C7QA 1QXSA 1Q57A 3PF8A 3R0JA 1J9GA 2PZKA 2C5SA 1YQQA 3N5KA 3K35A 5DX1A 1USWA 3AHIA 1JE0A 1PEKE 2VA9A 2FW7A 4N6GA 5AM2A 2IPMA 5IDWA 4LAFA 4EY8A 3KQOA 2PIDA 4LJ7A 4LOLA 4MROA 1JVSA 3CVJA 4KAAA 1PK9A 1QFZA 1G2IA 5CJJA 4TTPA 3TBHA 1A7UA 4G63A 3WWCA 5H3CA 4NQZA 2XNSA 3LPDA 5DB4A 1L5GB 4M6WB 3QLVA 4E15A 5AW2A 1RYDA 4BLOA 3A8TA 1Q77A 3QLUC 1NQ5A 1T8TA 3KQTA 4R1OA 4MUNA 2IS2A 4PICA 1I4OA 1SNYA 1RKQA 3AILA 1P19A 2BSAA 2EZ8A 3BH7A 3M4ZA 3EHDA 4KC0A 5C2JB 3ZC3A 4WUVA 2FEKA 2BHRA 1Z45A 3GEEA 4HFRA 1B15A 5CW2A 2VXYA 5F5NA 1GXSB 4TV8F 2IV3A 2HSDA 2VATA 2YQ4A 4ZRMA 4OB8A 3FWKA 1YB2A 4WOCA 4IQ8A 5CG2A 2QLJA 2OKCA 1UPBA 1QWSA 4YLGA 3IPLA 1C0PA 4P6VF 3AB7A 3HDVA 4FD2A 2DQ4A 4IZOA 2WD9A 2Z98A 4KGVA 2HJGA 1O95A 1XCOA 3SKVA 3ZWCA 2H0QA 1C3EA 4HDKB 2FUG6 3TNLA 3JQBA 1FX0B 2PBFA 1E3QA 4XASA 1U8FO 1YVRA 3GF4A 2IS1A 3GY0A 1XC7A 3ECSA 5DGCA 1W94A 1SBZA 3LK7A 3N2GB 2FV8A 3ASUA 3OETA 4DDKA 4DQ0A 2C95A 3IDSA 2BGRA 1E3TA 2MINA 3EXEB 3EVTA 2GT1A 5AVQA 4CDMA 4F3RA 3SVZA 4ZI7A 3NONA 3K1AA 5LQSA 4FFDA 4O08A 3T34A 4NU6A 1QYVA 5E7IA 2DCMA 1TUIA 4R8MA 2BEWB 4Q4HB 1M67A 4R2WA 2OOSA 4TV8B 3DB2A 1QF9A 4QBIA 3QEMA 3KFXA 3OFJA 4ZD6A 4AQYB 1E94E 3UAXA 5LJIA 1U9CA 1Y6GA 2BM0A 3TZ6A 1Z56C 4HADA 2FPMA 2BFAA 3QY0A 1RVV1 1RYNA 3LSTA 2XZTA 1E18A 1TZKA 1UZAA 1GZSA 4L78A 1SM4A 2HA6A 5CBPB 1UQRA 1E2EA 1KPGA 1OX4A 1Y5LA 2WJWA 4WADA 3ZXUB 3GLFA 5AK6A 1TTPB 4JJFA 4UU8A 1B0UA 4IIYA 3SF8B 3G2IA 2YXPX 1R8QA 3D0QA 4C6RA 1DKNA 3Q8LA 1U3FA 1RIIA 3RE1A 1HA3A 1G3MA 2WF7A 1O94D 3QE3A 5F5LA 3B9BA 3QV1A 1MEJA 2COUA 1QZUA 1T1RA 1VBMA 3DBOB 3I9JA 4IS2A 3AUUA 5ARDA 2ZT5A 3ZHSA 4FX2A 1GCGA 3RAEC 1AKNA 4DWWA 5B55A 1SBTA 2FPPA 3NAMA 1N7HA 3Q8WA 3VPHA 1ECFA 1BNCA 1RU3A 2DQZA 3MIIA 3PXBA 5B7PA 5KDLA 5B37A 2B35A 3PVSA 2Y68A 1QOPB 2GAFA 5ALFA 1ODTC 5JQWA 1XZBA 4Y0VA 2YV2A 1PTKA 4RPGA 4YT5A 3VC1A 5ALQA 3ETGA 4R3NA 4E2WA 1US8B 1E1CB 3F4LA 3U7IA 4NCXA 5BR8B 2HFJA 1UOOA 2XE6A 4BMVA 1QS0A 3OE5A 1R7RA 1R6AA 1ZWKA 4ND8A 2ZIGA 3A4MA 4HVTA 2D2VA 4DZTA 1AK1A 3H2BA 3HN7A 2WUVA 4BMPB 3BL6A 1TM3E 1GPMA 2PL1A 2IHYA 3N0WA 2FSHA 1BFUA 1CIJA 3QFCA 2PYIA 1GFSA 4K3VA 1HLDA 5CEJA 4NH0A 2G82A 5K3EA 1JG7A 3TW8A 2H7XA 5EHQA 1YIOA 1O7JA 1ZD1A 2HA0A 3R5XA 1Z29A 4E1BA 5ADHA 3D8RA 3PEWA 3ZGZA 4YCLA 4UCWA 1KYTA 2O2YA 2DT5A 1TOAA 1T2EA 3TL6A 3B1YA 3DHVA 1JT9A 3PLRA 1Z0JA 1YGYA 3KVRA 3JAWB 4KW7A 4U7FA 3KE8A 5FT9A 4AKEA 1DQZA 4MP6A 2PXAA 3THXA 1X7ZB 1ZUD1 1CUYA 2ZI4A 2YICA 5L3SA 2OGUA 4RGBA 1FQWA 4P4TA 1XLUA 2QT9A 1O5OA 3E70C 2JIDA 1ZU4A 2H57A 4L3WA 4ED9A 3NVAA 3Q8KA 1Y4UA 1NP7A 3C8MA 4XI9A 2H31A 4YA6A 3ZXSA 1ULAA 5HXAA 5DEIA 4LBZA 4U7DA 4D3YA 4EA9A 1VJ0A 3PGLA 1DL5A 4XWYA 4C43A 8OHMA 4DIDA 4P4NA 3IFSA 5TQ2B 1GU0A 1V1RB 3QUCA 3UAZA 1XRRA 1DLIA 2PH3A 2VQSA 1M8PA 2VYFA 2YR0A 3ZWOA 3ZVRA 1MPXA 1O0SA 2PH1A 2WYVA 4RH1A 3LDFA 4MIEA 4TQGA 4NBKA 4AG3A 3KELA 2X6RA 5LXTA 3I0ZA 3IERA 1A97A 5EJ6A 2WAOA 3RYIB 1OY1A 1WG8A 1X1SA 4H6XA 4QQKA 3H84A 3ABIA 1V11B 1A9XA 1ETUA 2HSGA 1XNRB 1AB5A 1UP7A 1ZY2A 3PIDA 3PQCA 2B82A 3QXJA 1QNFA 1E2HA 3BE5A 3I76A 2FEWB 3P8ZA 3A4TA 1XCGB 3L7OA 3CUVA 3FPJA 2P65A 1V43A 1VPTA 4GRDA 3ZNNA 1FNSA 3SBDA 5JATA 2CK3A 2GCEA 3OEYA 3QVWA 4XUCA 3AVUA 2X1MA 1BS1A 2Z5LA 3KSRA 3NYRA 4UEJA 3B6JA 1XNHA 1DXOA 4ZZ3A 3CF4G 3RS4A 1RQ2A 2IE8A 2YJ5A 3ZCSA 4GXQA 3G0HA 1LPOA 1CE8B 1J33A 2HSZA 2Y3IA 1IY1A 3SGLA 3X43A 4J0FA 1O96A 3KQWA 1GUAA 5HR5A 4A15A 5E8JA 3IUEA 1YTLA 2MT9A 3BC1A 4A6DA 3S2UA 2H9AA 4D81A 4ER0A 2FDCA 2W7TA 1U3CA 5AI4A 5J5CA 2PV7A 1QR6A 4YY3B 4BVBA 4WKNA 5DRTA 3WK5A 1Y3HA 4MRPA 3G2JA 2C78A 1ENPA 5T64A 1L4EA 1VYUA 1FBNA 2W0MA 3OTGA 3S27A 1JBEA 1GAJA 1U11A 1XHFA 2OHHA 3DDHA 3OSZA 4G2TA 1E59A 4JP8A 3ZU5A 3DTTA 4GBMA 4CKBA 5AHXA 5AW3A 4AJKA 1H6DA 1QRRA 2CKDA 2VDQB 1ZGGA 2FW1A 3MG9A 3V1LA 4N1AA 1LF5A 2GZ1A 2ESRA 3A1UA 3B12A 3D8UA 4P22A 4RA6A 3L02A 4ZT2A 4A0HA 1PV4A 4HFJA 2B8EA 4P0QB 3U19A 2RHLA 4DMFA 2Z08A 4U7TB 1AUOA 3NR2A 3O0TA 1K4KA 2HBQA 4KDEA 4I9GA 4QUHA 2PGIA 3M6FA 2QM0A 4KR6A 1LVGA 4DJAA 5IEJA 1JJ7A 3BQ9A 2EWVA 3IR7A 4XQGA 2IU4A 1NUPA 4MV6A 2YYZA 3LNTA 1KAHA 4TMKA 4WBXC 2OCYC 3ZHYA 3BMOA 3R5HA 3TX2A 3EFOA 3ROEA 1UBJS 3KT6A 8LDHA 3GDGA 1ILEA 4RADA 2D4AA 2VT3A 5DTEA 2J4DA 5DWDA 5BNFA 2DT8A 4HRVA 2EKDA 4O6VA 5ILOA 2OC9A 1CX9B 5JQGA 1V2GA 1RYYA 2HLHA 2LR0A 1L7AA 1N6RA 2PMWB 2VDMB 3AC0A 4NYMR 4PGGA 1BDHA 1T25A 4TZ0A 1CC1S 4WMLA 1V1MA 1N0HA 2F1HA 3U4AA 2OYCA 2J46A 3VKWA 4DV7B 3HSYA 2XUJA 5HOEA 2CZCA 2XQIA 1P9NA 5IC6A 3RFVA 2WLTA 4BGVA 5CA1F 3TMYA 1LS6A 2ODNA 4A1OA 4M9SA 1DRWA 1LW7A 4BKRA 1JEQB 2O9JA 3HJCA 4NBTA 4J7AA 3H6GA 5AVJA 1QDEA 1JWAB 1A1VA 3GFFA 3P2OA 1OBHA 1K98A 1Z6TA 3FNFA 1FUKA 3LOQA 2C9YA 4XLLA 2OMEA 5SYAA 2FSGA 1TVKB 1Y7LA 3R3UA 3B20A 3A1VA 3HZOA 4GPTA 5AI8A 3V9PA 2JI8A 1GEEA 5IM4A 1ZJ4A 2AT1A 1ZD8A 1PVVA 2QRQA 5BV8A 2MTBA 4X66B 1YR1A 1ZZGA 3UO8B 3TUIC 4QOGA 4RMJA 3ZZUA 3QPWA 5IK2D 1NQVA 4HAZA 3CINA 3KB1A 4A3SA 1JTVA 4M1MA 1A69A 2BI4A 4EEKA 2VEDA 3PTAA 4LVNA 1H5NA 3K92A 4WBNF 1ACJA 1VMDA 3EEBA 3HCAA 3PKJA 5EE3A 1A71A 1BHQ1 2FUKA 2GI4A 4AG6A 4B84A 1WF6A 2QNRA 2XAUA 5CA1B 1FFCA 5M04A 1IXSB 4MW2A 3VHRA 5K1ZA 2DE0X 4M8IA 2YV5A 3FTNA 1ZLXA 2BHTA 1IUNA 2FP4A 2Q07A 1JQJC 3JPYA 3OECA 5LL6P 2DBZA 2A78A 4URHA 2XGSA 2ISQA 2BW0A 3CF6R 4C0KA 1Y9DA 4MAFA 5F2NA 1AZWA 2IZOA 3W5UA 1JKFA 2VHZA 4XDHA 5EXXA 1V9CA 3MJVA 3COWA 1SKYB 3CXRA 3B5JA 1KHHA 5EUQB 4ZRNA 4O2BF 4PZPA 2F59A 4JLKA 4Q1CA 4D9GA 1VCIA 2RGXA 3NBAA 4QD3A 3I39X 4ZZIA 1XA3A 4PS1A 3PITA 1LXCA 2VQ3A 4ND6A 4WL0A 3ZS9A 4C4SA 4DFDA 5IYZA 4ARAA 4WBNB 3FCEA 3N8IA 4HGPA 4ZCTA 2HJWA 2QD5A 1P4AA 2BFPA 3NBQA 4JYBA 4R8RA 3N7TA 2NP6A 5EIBD 3ZV3A 1YCDA 2ECPA 2X15A 4K6OA 4YXWD 4DV6B 2MSEB 1CVRA 2RHOA 4GLLA 1GR1A 2XSZA 2YN0A 3OQBA 4WCVA 3RUAA 3KZVA 4C06A 3OY7A 3EEQA 3LGAA 5AKZA 4D4IA 1JHPA 3GMDA 4DXAA 5KOJA 1WDKA 2PQ2A 2X1HA 3LLCA 4S12A 4C4XA 4BV3A 4XIFA 1OXSC 4IIHA 1M7BA 4KXXA 4PX3A 5K0ZA 1RM5A 2DWUA 1A8HA 1N9KA 3G0OA 4ETMA 1PD0A 3B6ZA 5K9ZA 3M33A 4K5QA 4N8SA 5CEFA 3PNQA 3AEQA 1BKDR 1JR3A 1QYXA 1DP4A 2VPXA 3CZ4A 3IAM1 3PC2A 4O2BB 4TZTA 4AJNA 3OX2A 3K9HA 3BKWA 3RYFA 3ZV7A 1K5GA 2AA3A 2C84A 3GVCA 4YREA 5AOBA 4AJIA 4LZNA 2IBSA 2Y1WA 4MUXA 1JIJA 2CEKA 2V7UA 1PR5A 2EF1A 4Q24A 4Q15A 4YQFA 4RELA 4KQ1A 2BI8A 3USES 2AXPA 3ANMA 5EGSA 2C8LA 4PC7A 4DBZA 4E5VA 4BY9E 4B8WA 1R4NB 2CHGA 1EP3B 2WMDA 2X5OA 4OA5A 4YQZA 1H8ED 1WXQA 4HPJB 1DSSG 4KR0A 4E88A 2PHZA 3AG6A 5KNDA 3HZZA 1WUTA 2OCAA 1KI7A 3H2IA 3IA7A 2YV4A 3PC8C 2IZ5A 4KIFA 4X95A 4C1NA 4AWBA 1XYGA 1JQ5A 1EFPA 1KAEA 4MCHA 1SY7A 3A6ZA 1ADFA 1KEPA 1H69A 2Q4OA 4S05A 1RBMA 3EOAI 5JRDS 1CQJA 1HEYA 1IH8A 3PKIA 2JAOA 4GPEA 2VAXA 2ZUWA 1XTSA 4UHBA 4DUGA 3S40A 3NOVA 1MGOA 2PANA 4HAYA 1WB5A 5IJAA 4XWKA 5BW5A 2JIZD 2BF7A 3QIAA 4E2XA 3DLTA 3OIWA 3F5DA 3HPQA 3CH7A 4Q9KA 2DUUA 4BX0A 3D2LA 3VR4H 5JCZA 3O8NA 4B48A 2ETVA 3W9BA 3VPBA 1NNSA 3STUA 4GUDA 3O8CA 3PNPA 4XYBA 1Q0HA 3GCGA 1ODSA 3DZFA 4QBTA 3VR2D 2ON6A 3SLGA 1I2DA 2QL6A 4CLRB 4JBXA 1NUHA 4Y2UA 4ZO9A 1N78A 1U2EA 1W73A 3PFKA 3Q12A 1U98A 4NPHA 1YASA 4AO6A 1YTUA 1QQTA 1G5IA 1I7LA 4UE2A 1JG2A 3C98A 2P9CA 4PGMA 1HDGO 4LC1A 3SJ7A 1PHRA 1RNLA 3V8MA 1R6VA 1U6JA 4R69A 4EI8A 1F6DA 1YHYA 2RC6A 2DHCA 1ZMTA 2UZAA 1XLTC 2P9QA 3K0EA 3SYLA 3TIVA 1D3AA 5I4CA 3W5AA 4KN8A 2BRUC 4YBZA 4DN6A 3MTBA 4ZVMA 5J2TF 4XH9B 3ANYB 2ZR0A 2EFHB 1UMCB 4B3HA 4X61A 1HNNA 1I1HA 1UFQA 4PLYA 1V9LA 3QA3E 2J9XB 3FDXA 3FRHA 3ZGNA 4CWAA 5IVPA 5FFNA 1UM9B 4OP3A 2HHJA 2O0KA 3L43A 4C0AC 4Z53A 5ECWA 1DBVO 2RI1A 3JAKA 1H1LA 1E5DA 4P5DA 1GG9A 5I01A 1W30A 1S3IA 3U4QA 3ON5A 3QH4A 2GCGA 1ODLA 2GRAA 2QTBA 5DBGA 4BMOB 4BP8A 2DQYA 2QN1A 3DEFA 2YWHA 1U28A 3PDUA 5BP7A 1GL6A 4QHSA 3RS5A 4UM7A 2YIDA 3UC9A 3P97A 3IQHX 3ID6C 5JFGA 5A9TA 4XB6B 3EG9A 1XCMA 4XE5A 4CM6A 3GUUA 1Q1QA 2GN8A 3U60B 1T2DA 4NEQA 3MJDA 1AKTA 5J2TB 3GWZA 3LHIA 1IOZA 3MWKA 4M46A 3KJGA 3U39A 3I53A 5EE1A 3ZBPA 4BGDA 3DJYA 2GA9A 1XKLA 3GCXA 4RESA 2ZIXA 4HNAA 2VZ8A 2XZDA 3HL0A 5TMPA 5FWXB 1ZN8A 1ZISA 2P3LA 3AY6A 2KM1A 4K46A 4M1OA 4M83A 4RS3A 1SBNE 3H8VA 3DMGA 4DBLC 3C1AA 4TS4A 4EA6A 5FUMA 3AP2A 4B09A 5JNTA 3A6EA 5IKXA 1IFXA 1U99A 4UBNA 3GIWA 3D8BA 1I51A 4TTSA 4ZZ2A 4XCQA 1W85A 4C76A 3O9VA 4NJMB 3VTAA 2NX2A 1CRWG 3M89A 3ANLA 4Q21A 4TL8A 1R0LA 5IM5A 3WQSB 1QGED 1OA0A 4DDMA 4JWTA 1ZUNB 4G65A 1VYTA 4WUTA 1J0XO 3ZYZA 5T5QA 1JT2A 2WE7A 2RGWA 2RB4A 1C4WA 3UGJA 2XNHA 4Q9IA 2J3DA 4I3GA 1JFFB 4O29A 4QDUA 3ORRA 4RXTA 4X1IB 5DT2A 4RZQA 4AKTA 3V4RA 1XUOA 4U3JA 2AVNA 1V5WA 3U80A 1W5AA 2B3DA 4AXBA 4DCPA 4G4SO 3HGTA 3P71T 2HU5A 3MN1A 1RM4A 3WLHA 1M2WA 5ALWA 1J2YA 1E66A 3CE9A 4D7AA 2X0DA 4EJSA 3DMTC 4ZJUA 1Z5VA 1TK3A 2PRIA 1NJ8A 3OUTA 9ABPA 2FJ0A 5JAIA 1BMFA 3L79A 4NICA 3TCKA 5JH7F 3QOYA 4QX6A 3FZEA 3MCAA 2XNJA 1YS4A 2QX7A 3BL5A 1Z6GA 2AJCA 4G24A 3CLSC 1IAQA 3IELA 4JR2A 1BDIA 3RPEA 4UEWA 1IY2A 2I54A 2JNWA 1NV8A 2V03A 5FFFA 1U0SY 4XOIA 4DVJA 5KVVA 1IU9A 2I29A 3RVDA 1XV5A 2W8ZA 4QG7A 1FYWA 4CIAA 4YAFA 3BYZA 5IMSA 1XZ8A 3CG4A 3KQVA 3L6RA 4I66A 2OO5A 1YS7A 3QW4B 2FX3A 2H92A 3TZLA 1E1QD 1PBNA 2Q46A 3VOAA 1DS6A 1AH2A 1E1RD 1IEXA 1EVZA 2O48X 3PFNA 3UOWA 5DI3A 3WRYA 3HH8A 1JQAA 3LHSA 4NS4A 5AKYA 1DRKA 4BVJA 4XFJA 4EW6A 1MENA 1QBKC 3PVZA 4ZK2A 4X00A 4V3BA 1UDCA 2CY0A 3DMYA 4HDNB 3A6GA 4GVXA 1D04A 1MT3A 4UD2A 2R6AA 5JH7B 2HJ9A 3A3OA 2YUIA 4XM0A 3WE7A 4CTMA 4AO8A 3C3BA 1CUWA 4IMIB 2AR0A 3TLGA 4A8JA 2I2WA 8ATCA 1Z4PX 4PZCA 5AH0A 3NWEA 2VWPA 1F12A 3AHEA 4JI3B 5MGNA 1LDEA 2QIPA 4F93B 3FPBA 1MV5A 1KMHB 2IVFA 2W37A 4KQ2A 4ZYLA 1C0LA 1I7SB 3Q7QA 1LTQA 2QN6A 1GUDA 1ILWA 1ECLA 4IOLA 3BAZA 4NP6A 2HN9A 4DANA 4HQOA 5IXSA 1QF6A 2Q5FA 4L5CA 3NDJA 5AK5A 3VI3B 4YR9A 4RMNA 3IOYA 3HR4A 3DMNA 2EC5A 1EJ6A 2GD2A 4B87A 1Z6AA 3E5MA 4Q18A 2QSYA 4C6TB 1TGVA 2BISA 1G6HA 3S1AA 5JJKA 2IGTA 2QW1A 3EBLA 1I0ZA 1PFGA 1M0TA 1W0KA 4QOHA 4DCJA 4EY7A 3GUZA 1UBCA 1HLGA 4BPBA 1SKAA 3HXMA 2AXEA 4RHUA 4D4LA 3ZWNA 3WWPA 4LFBB 2EAUA 1VIDA 2BLLA 3ZK7A 2WYOA 1OTYA 4NQRA 4IZ6A 4OV6B 3F74A 5EE5B 1UK9A 1TYAE 3JXEA 2EWMA 4ARUA 2IHKA 3CM0A 4ZXPA 3RI3A 4A23A 1FTWA 3QYAA 4LSMA 3WQBA 5K20A 3CZQA 2VSOA 3I32A 2YFHA 3VO2A 3I6ZA 3KTAA 1GNLA 1UT6A 4UFPA 4ZVKA 2FGJA 3AK4A 5KPJA 4V0QA 1G60A 4MCAA 4B6JA 1Y4DE 1YFLA 1EA7A 3K8YA 1T13A 1ZH0A 1UANA 1XZQA 3CNNA 2QN2A 5G3ZA 1LZKA 1ZNXA 1DBRA 2I6FA 1OFUA 2ZBRA 1NE7A 1XHLA 4P3NA 2CHQA 5JWRA 1XMVA 3PQ5A 1BXRA 3FSEA 3GZJA 4KX5A 4QO7A 4TKVB 1KIAA 3G7SA 2JFXA 6PFKA 4BNMA 1ADGA 3O92A 1E4OA 1WO8A 2QM7A 3DEAA 5C8YF 3LCUA 4FI3C 1P1IA 1WXIA 1EXDA 2QRGA 4GKKB 2WQZA 1RLOA 5E38A 4JVLA 1L4FA 5IJ9A 3Q7IA 4EYOA 4H60A 4S2UA 1T36B 2Q6KA 4AF8A 1N2JA 4ITUA 4BP9A 1IZYA 4CQMB 1AQUA 3GBPA 1EMDA 5B3JC 8ADHA 4TPKA 2JGLA 2K5UA 3OQJA 3QKSB 4ZQIA 2WT4A 1UWLA 2UXCB 2GEVA 3M1AA 2A8YA 5DHUA 4GLJA 3R7WB 4DBLE 5L6MB 4F2PA 1P7YA 1H3NA 1OF1A 2Q1SA 2E0IA 1WXEA 2RHWA 1EHCA 3ELDA 2BZ0A 4IYRA 4CE6A 5B64A 1PJZA 2YZ2A 3D59A 4B3DA 2OCLA 1CJCA 1M8FA 1USKA 5IKOA 4BKMA 2J1LA 4TLCA 3QEOA 4K9SA 5DPMA 2Y0PA 3UA4A 1KO7A 1UXGA 1RR6A 3VVLA 1X1BA 1YBHA 4JJ8A 4O4HF 1FNNA 3M6MD 5C8YB 5AI6A 3D6TB 4GMGA 3BDIA 4MQEB 3LX4A 4PHGA 1KSJA 4KBYA 2W00A 3G6WA 4JVNA 4OO3A 2EQBA 4UREA 1GARA 4L3VA 1SUPA 1QP7A 1BEZA 4KP7A 3G0DA 1J56A 3F3KA 4OPMA 4JI1B 1A4RA 5BN5B 2QNBA 1F6BA 1E2QA 2CL0X 3SXUB 2PGXA 4A0SA 1P7CA 1G7RA 4GNKA 4LV6A 4CI9A 1JG6A 1SCJA 1G2OA 4C7BA 3DEJA 3BVPA 5KSYA 2B1JA 2JI6A 4LHXA 5HK8A 2QMZA 4IO0A 3TZBA 4Q4LA 5LR6A 1P1JA 2NTNA 4TMZA 4C89A 4C78A 1QYRA 4H27A 1EG2A 3LJKA 5BT8A 3ZY3A 4A4DA 4J4HA 1Z47A 3KYCB 3N7AA 1ULTA 1XU9A 1QHXA 2Q6LA 4OMDA 3G0GA 3B6EA 5DX0A 3T1NA 3DZHA 3ZVNA 1II8A 4MKXA 4NCJA 1IHPA 1PFQA 1TW3A 2IYOA 2P62A 4ZYXA 4RD3A 1W36C 4NAVA 3HS3A 3NKLA 4X93A 4O4HB 2WF9A 1X8LA 1AVTA 3MRXA 3G5MA 3D8NA 3KQMA 4PRLA 1KP2A 3FMVA 3N87A 5CDUA 121PA 3O74A 4DSNA 5LMUB 3UN1A 3HR7A 5EUMA 1SVOA 3HJNA 3NG1A 3UB4A 1HX7A 4HLCA 4TM8A 2ATIA 5HRCA 3LI2A 4HMPA 1JSRA 2RKWA 1X42A 4LE0A 2PK3A 5FUQA 1F1JA 3BEOA 4U2KA 3M1IA 1L8OA 4E46A 1MVLA 2HKIA 3Q1LA 3U16A 3QU5A 2JGEA 3E8XA 1F14A 1O95C 2JGJA 3IVAA 3P2IA 4L5BA 3RAPR 4ZU6X 3T3EA 3UGTA 3WA6A 3LC7O 1HQKA 1R16A 8AT1A 2P6NA 4ZO8A 1HDYA 3GEMA 4G0YA 3UT6A 1OC2A 3WSTA 4YMGA 5KNDH 3LHDA 2C4TA 3AERB 3TB6A 1THMA 4G84A 1Z8FA 4CCYA 1H23A 2Q2VA 5LJLA 4HOYA 1WR8A 2I0FA 1QK5A 2DFKB 1X13A 4YFVA 2JFOA 1KBOA 1YE8A 3QFTA 2QGFA 1GA4A 1KORA 2LKDA 1LPPA 4O3FA 3VZBA 1W7AA 3LZCA 2CXNA 1PEDA 4TTJA 3VR5A 4UUQA 1U5BB 3BHMA 4DB2A 2SKEA 3K8OE 3QWBA 5CLIA 2HZ7A 5DGXA 3ZIAD 3THOA 4JJZA 1KARA 2Q29A 1O2DA 1SHZA 3C3YA 2FPLA 1CS4C 2AC2A 4Y9UA 1F8YA 3FGZA 2E1PA 2ABWA 3F4KA 2HRDA 1OKKD 2BR4A 2A5LA 2H9IA 1JIVA 1GRCA 2IUSA 1A5BB 2WJGA 2YJGA 2V74B 1OBOA 4GGMX 4LXUA 1ZH8A 2ZAIA 1IY9A 2I71A 1UKBA 2HIMA 2YY6A 4UMDA 4FGJA 5KTKA 4COKA 4QM6A 4R5MA 3ZHBA 4HGQA 4K28A 5HHTA 1HE3A 1P2TA 4RGVA 1P18A 1DRVA 4F5WA 3BMQB 1XRJA 2JFVA 1XAIA 1QVVA 4LXTA 2BFFB 3R3SA 4L4RA 4LMAA 1OT5A 1PT9A 4G5GA 4EHJA 1PZHA 3P5BA 2JLQA 4HLQB 4XGQA 2NUAA 1XRMA 4W8HA 3FYTA 3EDMA 4PQEA 3UAVA 4WLFA 3H5LA 1N0IA 2GPTA 1ZKMA 4ZVNA 4KR9A 4I9UA 2RIPA 3LO5A 1VRWA 4KIWA 4L57A 1U8EA 4KMMA 4P36A 2VRCA 2ZR9A 2YJ4A 4HZGA 4FM9A 1SVKA 2BZGA 4CFYA 1UZLA 3N9IA 2NW6A 1Z0DA 4G67A 4I1YA 4L27A 3S5UA 1SC3A 1JHAA 2XYQA 3GGCA 4DSTA 1UIRA 2O7RA 1EQ2A 4YUXA 5K0BA 4MIYA 1BXGA 2YOFA 3NDPA 3GDHA 3IHTA 4RK4A 4ZICA 1E2IA 4QQNA 1AK9A 2VHTA 2DQKA 4HZUB 2AOUA 4MDYA 1T4CA 3R4VA 2JATA 3OPNA 2WSMA 1G0OA 3BGSA 3ROQA 4HTFA 1JH8A 2B4YA 3H9GA 4I4TA 3RANA 5I7WA 1UBMS 1NNLA 2XMQA 1UADA 3C7DB 1JH9A 1BMDA 1ZD3A 2X7JA 1DQPA 2JIOA 2R1VA 3IP8A 3KD2A 4IIGA 5TVGA 3T5GA 1ZA1A 2XCSB 2WSYB 4KR7A 1CCWA 2X4GA 1SOVA 4YB8A 5JTUA 3HKBB 5DHSA 2BFCB 3NHKA 2QBYB 3LVFO 1MXFA 4OB6A 4OHWA 4ZCLA 3G17A 4F8YA 2XWPA 2VNSA 2XLBA 4TT8A 4RXUA 4WZBE 1JVBA 2C2GA 4V39A 4Q37A 4D96A 3KAPA 3NIDB 3HFRA 4J3JA 3LF2A 3VZDA 4AZVA 3IIMA 3E9YA 2WWHA 1PFWA 1CFJA 4GQBA 5HJ2A 2FR0A 3CKKA 4MI9A 4UCFA 4Z4IA 3A26A 4J2OA 3KKMA 4NEGA 5CM9C 4CM3A 2YHAA 3IDFA 2QD4A 3NFYA 5CDTA 4IRUB 4W9MC 1CZRA 3CE6A 3UB3A 4KIJA 1SBIA 1KH2A 1IBLB 1XTTA 1Z4MA 4WFJA 1ZGHA 2O8EA 3FKJA 1T9ZA 3GT0A 1Q15A 5JDIA 1Z73A 2GFQA 4BXOB 4ZAXA 3OIFA 4M0PA 1NPDA 1O5TA 4WV3A 4P32A 4XX0B 2X9NA 2IBTA 4PR3A 3F7NA 5LKRA 1GPNA 1RM0A 3JQPA 1ZXBA 2P2GA 3GJ4A 2ASVA 5DCUA 5SZKB 2NO7A 1G8MA 2WB2A 3C97A 1QF7A 2JH8A 4PW0A 3QUTA 4EYSA 1EWYA 2A0FA 4NCKA 1QFJA 3R6LA 3WYAA 1AZSC 2WW8A 3IE2A 3L7IA 2R6GA 3EJ6A 3PGVA 4EMUA 4TYWA 1A9OA 2PH5A 2ZG6A 4GEGA 3R8XA 3JWJA 1G41A 2SECE 4BYMA 4OX9B 2AI2A 3TGPA 3QLEA 4NE2A 3Q10A 4ROTA 1ZM9A 3F7OA 3GX1A 4D98A 1ZK0A 3JQFA 2BCJQ 5DN6D 1L4NA 3U1BA 1SUSA 3DYVA 1A7JA 2P2NA 3QBVA 3WL7A 1RHUA 3L0OA 3RJZA 3DV0B 2Q5OA 3SR3A 2NU6A 2WJ3A 2HV9A 2AFHE 2VZ0A 4G2NA 2B2CA 2H4ZA 2QSUA 1H93A 1HR0B 2OLJA 5FWDA 1TCUA 4U8GA 1QG6A 2A7QA 2AF3C 3GLGA 1J20A 2P9TA 4Q9NA 2J5QA 2UYOA 3FSRA 4Q3DA 4TS1A 4JX8A 4E11A 1M7GA 4FONA 2WFMA 4PYMA 4G25A 2WKRA 2QRPA 1H1TA 3RHFA 3DMPA 3IP5A 3LC2O 2R65A 3RC3A 4WFKA 1TTTA 5B1HA 1VJDA 4GF5A 1AS3A 3AWDA 2Z30A 2OHOA 1LF0A 4LRUA 4KJXA 4LWQA 4R1SA 5DHQA 1VQ1A 5F51A 3SNKA 4AZ0B 4CUZA 2XTNA 4GPD1 2I7CA 3U44A 4GDFA 2WYIA 1NPYA 2BDTA 1DC7A 3O4IA 1E9VA 1OZFA 2PR2A 4EG7A 2II6A 1YB4A 1USGA 2PUCA 1L5MA 4MUYA 3OWOA 3GJSA 1Q3KA 2PT9A 1V16A 2NVUB 2QXUA 3C6ZA 2XMBA 4A10A 4BQNA 10MHA 3LWDA 3ZV4A 2QP3A 1XPRA 4E5KA 1RXYA 4AJ1A 3DFUA 1Y34E 3DFFA 3H11A 2ZWMA 6REQA 3K53A 1VBKA 3GN1A 5A3SA 1ZBDA 5L9AA 3TSOA 3GLFE 3EBOA 1OWPA 4K1LA 4EMSA 1M6VA 1JIUA 2V8BA 4N7RA 4KQCA 4FE3A 1GG8A 3ZR4B 3II6X 4UAVA 3WB9A 3UMRA 2ZI5A 1HBJA 4U8HA 4LBWA 1RXCA 4B7UA 2GYUA 4JEMA 4P7FA 1VL2A 3H6KA 4LQCA 2RHDA 1C8BA 4G41A 1SXJA 5BQPA 5KYUB 1ZK4A 1JEOA 4EJFA 3NH6A 1Z6PA 5AHRA 3PWZA 2EG9A 2O8BB 3ME5A 5BSUA 1W5EA 1WEHA 2UZ0A 1ZYUA 4ABTA 3PGKA 1KVQA 2VDWB 3C6QA 5JCOA 1CDDA 2FK7A 3PNOA 3HKCB 1AA6A 3M81A 1L7QA 1RXUA 4LNUA 1INLA 4CNQA 5IC5A 1BE1A 5BWNA 1GRVA 2VH2A 1ZIOA 2FQ1A 2QK4A 2XDQA 3BSWA 3OFKA 3QPVA 3R1IA 2G06A 2ZOSA 1JHMA 5K8JB 5JI2E 2EKQA 3F3MA 4K03A 4W1SA 4K6MA 3RBVA 4RKFA 3G1TA 1ABFA 3JWEA 5KX5F 4QECA 5TJ9A 2V7XA 4HFMA 2NVWA 3GH3A 1FRQA 3OM1A 5TS2A 5I3ZA 3D3WB 1R18A 4YT4A 4ZAZA 3J81A 1EP2B 1L3IA 3NQ41 1G3RA 4I08A 4QUKA 4V24A 4KE9A 1B7GO 1U5AA 1L5OA 2HQRA 4IYJA 2A4KA 1ORHA 5TPZA 2FN7A 3LT1A 3ISTA 4RSRA 1F38A 4BE4A 3HTXA 2P3QA 4YT8A 1CEEA 4MTLA 1IZ8A 3B5IA 3AVQA 1H9AA 3ESRA 4J0QA 3W4IA 1EVKA 2R8RA 2X0IA 4I2NA 4M0DA 5F35A 3VU9A 2F1IA 3SF0A 3GZNA 5EFOA 4KN6A 4QUEA 5JHGB 1O6BA 4AG5A 2OE2A 5LYJA 4MSUA 2N47A 3VAYA 4QYWA 1HYQA 3LYAA 4H1UA 1EVEA 4K8OA 4MI6A 1MD9A 4Y2QA 3ABZA 4QAQA 3UTDA 1QFMA 2DXIA 1B93A 3C1TA 4TTTS 3B3QA 1Z7EA 3IMFA 4OKNA 1TGYA 3L92A 4M8KA 2JLZA 1TEZA 5KX5B 2CV1A 1JNXX 2UYGA 2Q41A 2OXEA 1UH5A 2ZPUA 3ELBA 3N86A 1MHTA 1OFUX 2FSFA 5L45A 3KZMA 4L9SA 2JRCA 3O0DA 2XF2A 2ZE8A 1Y33E 2Y1EA 5K3SA 3X1MA 3KFLA 1DEAA 1P6UA 4BRWA 5LDHA 1O97D 3LHFA 4ZU1X 2XZPA 3IJEB 1A8IA 2JD1A 1FVOA 4G0ZA 5KOIA 3AUXA 1NI4B 2IF0A 3I5MA 3KQYA 3AO0B 2JCSA 1JHUA 1UFOA 1I1OA 2I8LA 3OTWA 4OD0A 3JYLA 5DWQA 2YKGA 2VUIB 1ODCA 3L1UA 5FPPA 1RLTA 5L4SA 2QT0A 2GX6A 2IPXA 1CWUA 3QSGA 1QHGA 3IEPA 3LECA 4CETA 4QODA 1JTFA 1N5KA 2HYIC 1O9GA 4N6NA 3EIEA 2VJBA 5JNWA 2BIFA 4OLJA 4BHTA 2HTEA 2PZGA 3BHJA 3HJGA 3HQ4O 3OU7A 3D6NB 1PR1A 1X70A 3F1LA 2VT2A 1TVEA 3IDQA 2DTDA 1DE0A 3TLZA 2GBCA 5DHAA 1SOWA 4HJXA 4ND2A 4D5GA 2FW6A 3PSAA 1KMIY 2MYTA 5ENVA 5A4JA 5M5BA 2GVZC 1WXFA 1ZAYA 2OM2A 1FS4A 1CEQA 2XNDD 4AYWA 5CCBA 2YYAA 1YBMA 5F2KA 5HFNA 2DFNA 4H18A 4RV9A 1E61A 2P4QA 4IVPA 1MQAA 3LT2A 4X9XA 1YVPA 1PN3A 4INJA 5HQJA 1XMOB 2WPNA 4KNWA 2V6FA 3KTOA 2NUPB 3PYLA 4GOOD 2GB4A 3UYLA 4KN5A 4YMTA 3DO6A 3O4JA 2B3TA 3RRNA 5BV2P 2NU7A 3LUCA 3ND9A 3QVOA 4GZ5A 3M70A 4IGFA 4PLCA 2BKLA 3PDJA 5LUBA 2W6ZA 4LJ5A 2KSQA 2WG1A 3E9RA 1GRNA 3CEMA 4J1QA 1RYZA 2M6KA 2G9UA 2R8PA 3EMBA 4C22A 3JQAD 4W99A 2CNWA 1P2BA 2C2YA 4W1QA 2R9VA 1NNEA 1TLLA 2D5IA 4KWCA 4BNYA 1XAJA 2W6MA 4DIEA 3KB6A 3PICA 3UV3A 1K6MA 1EI9A 4HCJA 2NZ2A 2VJLA 4ZI5A 4CKEB 1PR9A 2AF4C 1LBSA 4CM9A 4ZKDA 5FP0A 5TF0A 3P45A 4G0PA 2VF8A 1DOHA 4ZA2A 1QZXA 2IEZA 3R5SA 2O1SA 2OSBA 4HLUA 1KOLA 3PX7A 2DHRA 2BFMA 3KU1A 1SXPA 1QGUB 2IQIA 2M6SA 2WWRA 1FJGB 3F78A 2Q9BA 2JJMA 1N1EA 4YNBA 5EVCA 3C14C 3STYA 3TD6A 1L8XA 2FFQA 3MJHA 2NQ8A 3GXBA 3KLOA 5BUZA 1JR2A 1Z33A 2R6HA 3THWB 5DP1A 4LBVA 3S2GA 1HETA 3ITDA 5BMOA 3I5XA 2PXCA 3K70C 2XRFA 3B36A 1XRQA 4G81A 2PUFA 4ISCA 3UJPA 4ACAA 1RKXA 2J5BA 2Y9MB 2ZKIA 3WYGA 1YJ8A 1KSFX 4WKBA 1FPQA 1HT1E 5C18A 3SHFA 2D62A 3D2BA 1E7YA 3CRVA 3HBFA 2SHKA 2XJ9A 3FVWA 3U40A 1NQTA 1R6TA 3L8DA 2WHYA 1OZAA 2NOAA 5JAMA 2Q5EA 5B2ZA 5C31A 1JPNA 1P44A 3Q8XB 4JLDA 1NT2A 1PFVA 2MYUA 5F1KA 4B82A 1NQXA 1E63A 1BXZA 2QLFA 2QR3A 2QRJA 2Z2IA 3DOIA 4M37A 4B4UA 2XMGA 2BFBA 5KTOA 4XVRA 2BOVA 4NECA 2TMGA 3FY4A 1COWA 1XLVA 1CB0A 1OPRA 4GQIA 3B1WA 1PKEA 2BFOA 3NBUA 1E2FA 3VTKA 5K2OA 3CRZA 1VMEA 3MINB 3FPAA 3AUSA 3C6BA 2TMYA 1DDIA 4E03A 4YAKA 4QXQA 3K9FC 1PL0A 4G5RA 1C0KA 4PC3A 1GSAA 2Z3WA 1PSWA 2E3JA 1WVGA 4HXEB 4OUDA 1XQVA 1ORTA 4JT2A 2R96A 2W2LD 1P2SA 3O1IC 1HTTA 2AW5A 2NO4A 4P81A 3UJ9A 1AK2A 4QYIB 5KVSA 1DC3A 5T57A 2Q9CA 3H5VA 5I7FA 1U28C 1P3JA 1A76A 1I7DA 1KYXA 4OFXA 2AZ4A 1C1DB 4PM4A 3T7TA 1JAHA 1XMJA 2H1IA 3GYGA 1B3BA 1RHQA 2XMRA 3UKOA 1U3DA 1GNVA 3BK7A 1M75A 5CCDA 5BWBA 2B1IA 4K7JA 5HQ3B 1M1YA 3QJGA 5LP6C 1JAYA 3KJQA 5KBYA 3WQRA 4N5DA 3W4JA 5CG1A 2FLVA 2J0VA 5JS1A 3DM5A 4NJOA 3SOZA 1NI3A 5J4LA 5FOTA 1VB3A 3WXBA 4UCQA 1RHMA 2EBFX 1GA6A 3IOCA 1K4YA 3Q3EA 4HDAA 3TAUA 1GNRA 4YMIA 1R88A 2PUJA 1FRVA 1XZMA 2Y1GA 4LYDA 5COQA 4A0GA 1VKOA 1JLHA 3D1LA 4PCAA 3V7WA 4IVNA 3K09A 4F92B 1AKVA 4GM1A 2PX4A 3DAYA 2ACEA 5ALHA 5JXIA 2DVMA 2Z95A 3D7NA 1YL6A 4IKEA 4IDPA 4B85A 4BVEA 1Z4KA 2JIRA 2OD7A 3B70A 3E4DA 3LQRA 1WTAA 3LUJA 4KRYA 4WXRA 3VYWA 5KYKA 2J3QA 2OUKA 1P3Y1 1X94A 1PJRA 1FFXA 1T6YA 2IOHA 3BDAA 3K2QA 3QVGA 4Q1FA 4ZCPA 2B37A 3L6BA 3RAGA 4IHJF 3VJKA 4EARA 5E9JA 2BV3A 1Z37A 4HVAA 1VPEA 2P67A 4XD7A 3I30X 3T7EA 5LPNA 1MOSA 3FE2A 5D1HA 1WMFA 3I6BA 2GASA 3Q3HA 4Y2RA 3FNQA 4YCMA 3OKFA 4LYYA 2OCBA