3EEFA

Crystal structure of n-carbamoylsarcosine amidase from thermoplasma acidophilum
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
173
structure length
173
Chain Sequence
MKPALVVVDMVNEFIHGRLATPEAMKTVGPARKVIETFRRSGLPVVYVNDSHYPDDPEIRIWGRHSMKGDDGSEVIDEIRPSAGDYVLEKHAYSGFYGTNLDMILRANGIDTVVLIGLDADICVRHTAADALYRNYRIIVVEDAVAARIDPNWKDYFTRVYGATVKRSDEIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-carbamoylsarcosine amidase related protein
publication title Crystal structure and molecular modeling study of N-carbamoylsarcosine amidase Ta0454 from Thermoplasma acidophilum.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 58
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 3.5.1.59: N-carbamoylsarcosine amidase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3eefA00
1ILWA 1NF9A 4L08A 1IM5A 4H17A 2B34A 2WTAA 3IRVA 3TXYA 3LQYA 3O91A 2A67A 3O94A 2H0RA 3HU5A 4WGFA 3MCWA 4L07A 2WT9A 3TG2A 1YZVA 3O90A 3R2JA 3EEFA 1NBAA 3V8EA 3PL1A 4WH0A 1J2RA 3HB7A 1X9GA 3OQPA 3R77A 3OT4A 3TB4A 3O92A 3S2SA 1YACA 2FQ1A 3KL2A 1XN4A 3UAOA 1NF8A 3O93A
chains in the Genus database with same CATH superfamily
3CR3C 2V6FA 3MT9A 1UOEA 121PA 3WL5A 3E8SA 4FIDA 1WXHA 4YQYA 1MVLA 2G4LA 3W90A 4R2HA 3PQ7A 4M0DA 4ARSA 4FNAA 4M8KA 3E4DA 2RAUA 2BTEA 1SOWA 2TMDA 5C1DA 3NYQA 4EARA 5JFGA 5KI6A 3QHAA 2P68A 2B92A 2BHLA 2OV3A 4GSKA 2JJ8A 3GC6A 2JPDA 4DUYB 3QTTA 1Z2PX 4TGLA 1UWCA 1YJXA 3OEED 2G7MC 3DSRA 4BLSA 4PG4A 2BKVA 3GJ7A 3VSDA 3U4CA 5AVZA 4RGQA 3DOUA 4PWYA 4CVNA 4ZN6A 1QGUA 1M54A 4J7CA 5F5XA 1V2HE 2WG0A 1DS6A 5ALHA 3CLSC 1O08A 1WBBA 2HWUA 4D0NA 1YDWA 1BMQA 2BMDA 1SXIA 4UD2A 3VR6A 5BOSB 1MV5A 1X6VA 2O4CA 2ZAMA 3CRRA 1T15A 2ZE8A 3T1OA 4F9EA 1E92A 3OLVA 4WNAB 3R6WA 3CC8A 4X7BA 1GCUA 3H75A 1VYUA 4QYWA 2H5IA 4XIYA 4QUAA 3D8SA 5KB3A 4N6NA 3SPXA 3WA6A 4D0RA 5HGXA 3EPJA 3M6FA 1XCBA 2OL4A 3BD8A 1OI3A 1LPBB 3IBSA 3ITEA 1GPAA 1TECE 2M32A 4CGZA 4HI0E 5AKHA 3HUFA 1A2OA 1EDZA 4KW7A 1TYCA 2Q2VA 2KE5A 2Y68A 3E9EA 4TOIA 3AFIA 1TGVA 2PUVA 2AL7A 2VCYA 2AKYA 2CLDX 4JC4A 1U1FA 2IFTA 2ZZMA 3CF0A 2OQVA 3R7SA 1K6EA 1KXJA 4FEGA 5DPMA 4F3CA 2G80A 3EE6A 3JQBA 3FHCB 1N2GA 3PJFA 4PNZA 3TW4A 3WYNA 3W3ZB 2OQ2A 1G8KA 4DCUA 5LN1A 1L1EA 2Y1WA 5IFLA 3D3WB 3GXOA 1XMSA 2O07A 1NL3A 2YOFA 3B52X 3PDWA 2ODNA 3KWFA 5EQJB 2DWUA 2F1HA 1P75A 1VGVA 3GG2A 4RGVA 2R8ZA 3RK0A 5A03A 1X7YA 5FUQA 3ZD7A 1YJ5A 1U9CA 1O94A 3HJCA 1VP3A 2YHSA 4CR6A 3KTOA 2CLOB 3RVRA 2CNOA 2C1XA 1SUEA 4H9GA 1WWKA 2HBZA 4E5PA 1GDHA 5LP6B 2WTBA 1PR9A 3HM9A 1ZN7A 3OTHA 2LIVA 2VUSA 3DBIA 4TL6A 5CDYA 1TQ2A 5K4GA 2IH5A 3Q7SA 3PHIA 3QYAA 4G4SP 2DPLA 2JLRA 5CAEB 5FB3A 3OF5A 5A02A 5J4YA 5F1YA 1RP7A 4Q9NA 2GF2A 1TYEB 2O3QA 3B6KA 3PNSA 5F76A 4Z4CA 1L7DA 3PA8A 1V16B 3GBPA 2HXSA 2J9RA 3C1OA 3DULA 4FBMA 3RVNA 3T3EA 1EZZA 1ULSA 3U4AA 3PTAA 3WGYA 3NHWA 5EXTA 2ACEA 1XVVA 3ZDZB 1OA1A 1JQBA 3ZY6A 5JZOA 4L22A 1AGRA 3UO8B 3H5LA 4H35A 2AJTA 4DG8A 1KAMA 3ETGA 3VBEA 2PUCA 4FS3A 3P0IA 4KBFA 4W5TA 3LVFO 4LZAA 1SUBA 4PFSA 3A9SA 3CT4A 1UWLA 2ZS8A 3HACA 3NIGB 4JELA 3VX4A 4NCXA 3KYDA 4GEKA 3H1PA 2OILA 4IDOA 1AS2A 4B44A 2Z6AA 1H0KA 4Q9LA 2VHYA 5IH3A 1Q19A 4G0XA 4P4GA 1S7CA 4YALA 3R5XA 3GZ4A 4YAOA 1CHNA 3WSWA 3ZS9A 4DLKA 1O7JA 2I6FA 2QL7A 3F2IA 3ZS8A 4D82A 5K3EA 5KINB 1LNSA 4DUZB 5KX5A 3O73A 1B73A 2R7LA 3RHTA 4PVDA 3K1TA 2IELA 4GMKA 1EIWA 1YO6A 5FOQA 4WZAB 1SC3A 1Z4OA 4I50F 1GQRA 1UIRA 1OT5A 5JISA 2I4MA 4OAPA 3IDZA 3AHFA 1ABEA 1VMKA 5KKNB 4FR0A 3DQPA 1QTNA 5IYZB 3JYNA 3RS3A 2PWAA 4EEXA 1O94D 4RS4A 2ZB4A 1TM7E 3DL2A 5CEEA 3JWJA 1WV1A 3VC3A 1P2DA 4URWR 3HN2A 5CVDA 4LJAA 3SOZA 2FEAA 3ZNNA 4XR4A 4DWVA 3S1AB 2QX8A 3OM0A 4Q00A 2JGAA 3OZIA 3IAS6 3AF1A 5FOUA 3CB4A 5A6SB 2ORWA 2VHJA 5F1OA 4EKYA 4O29A 1CNEA 3PFNA 5LD2B 2CXRA 1YQXA 4PLZA 4DEYA 2J0EA 1NDUA 2QM7A 1TZ2A 4UC0A 3T3OA 1R0LA 2Q49A 1YAHA 3DNMA 2GBFA 2BZ1A 3CSDA 2ZUVA 3PI7A 8ABPA 3NOXA 2DPYA 2GCPA 1O6FA 3HLKA 3HBLA 3R9IA 4R1OA 4DLWA 4F2PA 4TRMA 1PR6A 1XG5A 1G8MA 2IZZA 1HDIA 1ZK3A 2XUPA 4Z7QB 3G2IA 5AK5A 2QVBA 5K5EA 1I10A 2HOQA 3O2JA 2Z04A 1G4AE 1G21B 1YT5A 2LRHA 4ZFNA 2Q4BA 2Q1XA 2QQFA 4WJZA 1O6GA 3OTGA 1SO8A 1GWNA 1KEEA 3PDUA 4K6MA 3UMYA 5DM1A 3RGGA 2HF8A 1I7QB 3HB5X 4B6EA 3DMNA 4G1FA 1D6SA 2RH9B 3GFTA 1I7PA 4PF1A 1W8DA 1NI4A 4Y2PA 4DF3A 4CIWA 1HETA 5BW8A 4FN5A 2N9UA 4JI1B 1F8YA 1P0IA 1Q3TA 2P9TA 3LCMA 2GUGA 3O4VA 5DE3A 3RVOA 3UH0A 4BGUA 4DMCA 3LTNC 2FE4A 1JQDA 5LB2A 3RK4A 4LCJA 4M7PA 3H86A 2HPAA 2EYQA 2LUOA 4RELA 2RK4A 3WTCA 4O0LA 4TTAA 2OZLB 2QK4A 5B58C 2QD2A 4KXYA 4RCYA 1EUCB 3CPSA 4ZQEA 3GMIA 4ND4A 1V1MB 4GQIA 3B6EA 1B7GO 2O48X 4I6GA 3N8DA 3M6WA 4FCVA 1HMYA 3ZE8A 2FUCA 1KDVA 4DLXA 1FDTA 1X39A 4O08A 4QFCA 3ZZ0A 1Y3DE 2QI9F 4TKZA 4MYRA 1VGQA 2D7JA 4P5PA 4D3XA 1YBMA 3BN3A 1BKSB 3DDUA 2RBEA 4JVLA 5KPJA 2XB2A 4C01A 3C8DA 1NVWQ 4CIDA 3M3PA 3BAZA 1T24A 4LF6B 4L07A 2YTZA 3BF8A 3EH1A 1ZA1A 3AGPA 2H7VA 3SNKA 1BW9A 3R6TA 4E2FA 1ND5A 1LW7A 1GM5A 1HDRA 4Q1DA 1YDEA 1QXSA 2ZJYA 4WXRA 3VV2A 4BFXA 1WUYA 2B30A 3DQZA 4ASUD 3U61B 3GGJA 4OBBA 5KU1A 3SF8B 2NO7A 3MOIA 3L0BA 2FE1A 4IICA 4N54A 2IHNA 4WDQA 2P35A 3P2OA 4MV5A 4RIGA 2P5TB 4D2IA 4RADA 3RLIA 2Z8YM 1HT0A 2OBMA 1NIJA 2I80A 3WMRA 1AK9A 1VBKA 1NZDA 4L9AA 2R8XA 2RGEA 1BU8A 1OPXA 3H6GA 3HZHA 1NQVA 2FW0A 3OPXA 1W85A 3JQ6A 4J91A 3WQSB 1U4SA 1U8EA 2VTVA 1UM8A 2VRWA 3UJHA 5ALIA 5D84A 5BN4A 1ZU4A 4B3BA 5JCOC 2PX8A 3W5BA 4GU5A 5BSEA 3F6CA 3BIXA 3LP6A 2XCLA 4NHOA 4ZK2A 1LI5A 1RLOA 1ILEA 1SWWA 4ON9A 1XPOA 3SEZA 1ORVA 2CB0A 3MSCA 1Z75A 4LY6A 4S24A 3N53A 1ZOSA 4FYVA 4ZC1A 4Q39A 2CC2A 3DLAA 3EC2A 5SY9A 1QIDA 1L8OA 2BR4A 2NU6B 3GQBA 1ZDMA 1Z0FA 4F2DA 4YRFA 5FIUA 4JBNA 3NG1A 1X3SA 2I7TA 2H5LA 1HNNA 4BWVA 1E3JA 2YJ6A 3BH0A 2AG6A 3CCCA 3A1NA 1ORRA 1DBWA 1V5WA 4LZZA 4PBRA 2FSVA 3CIFA 4YY3B 4HNTA 10MHA 3JD4A 1DXQA 2XCTB 5LFAA 1YR1A 3L6EA 3I9FA 3DPSA 1PX0A 3ITKA 4ZO4A 5FBHA 4HCJA 1AKUA 3V2UA 1IY0A 2O1XA 4BFTA 2Y6VA 3CEJA 4FBGA 1JBKA 1VKNA 5BV1A 3NATA 4LOLA 2DFDA 1IN1A 2FN8A 4HGQA 4J16A 2CT8A 3IIMA 2JBWA 1W4AA 2H2HA 1AS0A 2YBDA 3OVMA 1GD1O 4D8TA 2YW2A 1C4XA 1GQFA 4NG5A 2QW0X 5LYYA 3DVAA 3KCQA 4MGKR 3ROQA 4TSRA 3Q7QA 4S1TA 2IW3A 3ON5A 1Y8ZA 4YMSA 3EQ2A 3BZWA 4C6TB 1CUSA 5JD3A 2QRLA 4IS3A 4KAXA 3PDHA 5MN6A 3FOZA 2GF0A 3AI1A 1UBLS 5CVCA 1NVVR 3EG9B 4L7VA 4AX4A 5E95A 1CY6A 1BVHA 1VHQA 4ZDIA 4HGOA 3KL4A 1EWTA 1G5PA 5AO9A 4OV6B 4CLHA 3WLPA 3DTVA 1YD7A 1LLCA 3UANA 1P3DA 1T5TA 2ACVA 1T2FA 3A27A 3LDHA 3QBDA 3EDQA 5D1NA 4HEJA 4ED9A 1R3UA 2FPPB 3DV0B 4JUIA 3IE2A 4B1FA 4M37A 2I1WA 2RJOA 3I2JA 3ANNA 2A33A 1QH0A 1YHNA 1ZD9A 4BOYA 1MO3A 2GLTA 1VE6A 5BYKA 5K8IA 4KRFA 1S6YA 4LQDA 4BWYA 1PEDA 1IM5A 2HR1A 4F86A 3AINA 3E9RA 1QONA 1JA0A 3CZ4A 1GNSA 1AHPA 5AP9A 4PC1A 2O7SA 3SY8A 1NUTA 3DMGA 4O5AA 5ITWA 3HU2A 2WFLA 4MW5A 3V8NA 4MWSA 5MFZA 4Y6SA 2PSSA 4G89A 4W5NA 3EZXA 1ESMA 2REBA 3ZV3A 1YZFA 1CR6A 1KH3A 4BGVA 1OHHD 2HTFA 4N4AA 1BMTA 3H2YA 4BX0A 2WTUA 4ZPXA 1MOZA 2IPOA 3VI4B 4FYHA 2QX6A 3MB5A 4J3NA 4R31A 3AUJB 4E12A 2YIJA 2XUGA 1C7EA 2Q4TA 3WXMA 4F8YA 1QHIA 4M3NA 3I73A 5IHXA 1NUQA 2J3HA 4BO7A 3GU3A 1E2UA 1XJ0A 4U7DA 2R1TB 4BKPA 2XQJA 3I9KA 3HTXA 1OIVA 4Z4QA 3R09A 5FD8A 5CFZA 1R9MA 2ZYAA 5JO9A 4XB1A 3T4XA 3TRIA 3C74A 2CD9A 1DQPA 1YS4A 3B6ZA 3PHGA 3V4PB 4J29A 2RI1A 5JY6A 1BQEA 3DNFA 4P8RA 2O8NA 4Q01A 4N03A 1J22A 1PV2A 4UZSA 3BXFA 3AR2A 1XTKA 2ZGVA 3RANA 1NUSA 3PGMA 2H4WA 2JGDB 4AUEA 2PSFA 4CTKA 4KNWA 2EJCA 4FZJA 2VF4X 1LQTA 4MULA 5I7AA 3F73A 4E5YA 3R8XA 1CR4A 3BGVA 3O92A 4MA5A 4MKFA 4R8LA 3OQVA 3U80A 2GEUA 4CKBB 1DIGA 3D6UA 4XGIA 1MAHA 5K0CA 1H3NA 2VQEB 3S8YA 1ZHFA 1Y37A 2CFCA 4MS4B 1VDZA 4IGKA 2WUGA 2R6FA 4H60A 3H11B 1U0JA 3EXEA 2Z2XA 4EG1A 1YHZA 1FDSA 1O1YA 4TLBA 1NA5A 3VC7A 1KI6B 3MS2A 5EJEA 1N4DA 4TMKA 5AQ1A 4JLSA 5TQVA 5SZHB 5A62A 4RIEA 4XD7D 5F1KA 2ODPA 1US8A 3LQKA 2YUIA 1TJ3A 3N76A 1BVUA 3LT1A 5K3OA 4FSHA 4EJMA 4H4CA 3ILVA 3TLGA 3PRYA 4HK4A 3DMHA 1SBZA 3G5TA 3SICE 1H42A 1PJ2A 5JZSA 3CZQA 1TQDA 2ZS9A 3Q7TA 4GL2A 4I5IA 3HJNA 4WI1A 1N92A 4PSVA 2RGNA 5EVJA 2P9GA 2WTMA 3LLSA 1YJCA 5KYTA 4ERNA 1WSBA 3D7LA 4EECA 2ZJFA 2JFOA 3IAM1 4YAEA 1R5BA 4Q3OA 1TLLA 3G2KA 4BUZA 4KLCA 4ERXA 4ZGBA 4PINA 3BMNB 1HGXA 3BM5A 1SK8A 1AUXA 3IPLA 3EMVA 5AWFC 5HFNA 3MTAA 2PSDA 4KACA 1E1NA 5DEIA 1FQJA 1M2FA 2ZJAA 5JEEA 2UXBB 2R1VA 5B1SA 1KORA 4IIFA 2XDYA 5IF9A 2A92A 2O2EA 4R7GA 2VRCA 2WT9A 4JP8A 3BCSA 3R23A 2P9EA 1GRNA 3PHBE 4KODA 2PNJA 1CJBA 3ZCVA 5FA6A 3LP8A 2RH5A 2W8BA 3ZE9A 2JGMA 2D7DA 3IPCA 1X1QA 1TF7A 3NC1C 3FDZA 5CK4A 5AOVA 2WIDA 2H18A 1CUAA 4WINA 3SN6A 3U7JA 2PGXA 3E61A 4FR2A 2VJAA 4CM1A 5DO9A 3KQKA 2CNNA 2WJWA 1QJ4A 4DFDA 1MABB 2ZSDA 5IBRA 3I32A 5M04A 2QR5A 3CSSA 3Q41A 5LWHA 5IDYA 3PRKE 1T0UA 4ZMSA 2PK3A 1NW8A 4C5AA 2FDRA 2X6QA 4POAA 3RFXA 1GAQA 2IYTA 1BEUB 1SQ5A 1U65A 3KZ1E 3NGLA 3QMVA 3TZEA 4IDGA 4GPIB 4C0AC 2OA0A 2EAUA 2VP0A 1T2VA 1PAUA 1JYEA 3G13A 5E8RA 2ZCVA 3S8EA 4CUZA 1RKBA 2YINC 1KNQA 2CHVA 4M46A 4D9GA 2VBFA 4KI7A 1DCFA 2IZ6A 2DWPA 2GZRA 1DZIA 2Q2NA 4D74A 4L6AA 3DLHA 1LDMA 4KQCA 2ZIVB 2WF8A 2J41A 2JLQA 3R5KA 3ONWA 2AD1A 4RA6A 5EC8A 1JLKA 4JL8A 5K8JB 1HE2A 1ML3A 3O03A 4HGNA 4KXVA 2G67A 3ZBTA 2ZR9A 3TEJA 1NXOA 1U94A 4NCIA 2CL5A 1FXUA 3ME5A 2C57A 2MR5A 2JIMA 1WW8A 1H9BA 1MUUA 1LJLA 1RWMA 2VRNA 3DXZA 1LK0A 1Z0DA 2ZI6A 4IG9A 4YMWA 1FSFA 3WLEA 1EUDB 3H19A 4OP2A 2HRRA 3TJRA 5AQEA 4L9WA 4BGIA 5LP1A 3MZ0A 2QNIA 2QN2A 2IV3A 1FP6A 3N59A 1Z5OA 1OBVA 2IYFA 4MVXA 3P27A 5LNK1 2WJJA 1CY2A 3TAXA 1N5IA 1B41A 4KWCA 3CNNA 5IJ0A 3LX5A 1W49A 3NRBA 4YRLA 2V55B 1C30A 4ZVQA 2QJOA 5FWYA 1QC5A 2OFPA 2WUEA 4CT0A 3NQ41 4BV8A 5I8WA 3KSBC 2P78A 1M6NA 3RKRA 2JATA 1CE8B 1WB4A 2J6HA 3BOSA 4KYVA 4EJ2A 4GD3Q 1MXFA 4KUGA 1L5YA 4LEIA 4RXTA 2DUUA 5EGSA 4LJKA 1T5SA 3WGNA 1BX0A 4U0KA 2BGWA 2DERA 4G0NA 3EF1A 2I7XA 3L8ZA 1XIVA 2G4VA 3LY7A 4DLYA 3CWQA 3P9RA 5I7SA 3EFOA 1GPUA 1JIUA 2YQZA 1PS9A 4RF4A 2AV6A 4RPGA 1GZ7A 4PYKA 5K09A 3L0CA 4MYCA 3PSHA 1UP4A 3IP8A 2Q21A 1IB0A 3B1ZA 3C5WP 1NN5A 1MAAA 1TO6A 1UEIA 4O2AB 4RK1A 1P91A 4O1IA 2Q7OE 2ID7A 1I7DA 1CDEA 1JFVA 3C7CB 3FPFA 4C89A 1FNBA 1GV1A 2OHHA 3C0KA 2D4AA 4MI1A 3DHYA 2ATXA 2IYRA 1I24A 2XRFA 1QGAA 1RM5A 4L75A 4D41A 3BYZA 4N7RA 4BO4A 3H2JA 4XI9A 2GN1A 3TJMA 4F45A 3ZLTA 2QP3A 8ADHA 1D2EA 5D87A 2C7QA 1IBCA 2AUNA 1LJUA 2GKSA 3L8DA 4ND6A 4FCWA 4OUKX 4AJ4A 4HAXA 5AHWA 2QXUA 2FRXA 3GFFA 4EPXA 1NMZA 3C3KA 5E8JA 2ZUBA 3PXBA 4PZLA 2C94A 2VR1A 2CXTA 1VSQA 4PFKA 1D7AA 4JC8A 5C8YF 1Z56C 1DKUA 2VDKB 3U17A 1AV6A 3HKEA 2ECFA 2XZTA 2DUMA 3DXYA 2D1QA 2VQFB 2C4TA 4HEHA 4RHUA 2RGNC 5J1SB 1QCYA 2PO7A 3IUSA 4P0TA 5HF6A 3HKCB 2YZGA 4C7OA 1FFBA 2HIGA 3CLTC 3RT1A 2V6BA 4TLDA 5EWLA 2PVPA 3X1WA 5JVDF 4MYDA 4EM6A 1C29B 1TF5A 1WY7A 2RIRA 5EMKA 1L5GB 2Q8QA 3TLXA 5LJLA 5LQAA 2YWRA 3F6PA 3O4JA 4KXNA 3SMVA 3C1TA 3U3ZA 4BFYA 4EL0A 3T06B 2E9SA 3A4LA 1QGYA 4GQBA 4OLHA 2PXAA 2AGVA 3BXHA 5IKEA 5KC8A 3JR3A 5GM2A 3NORA 1F20A 1N2CA 1SELA 2IYYA 2PT5A 2VLIA 2I54A 3IVXA 5BWBA 3L01A 1JT2A 3LA8A 4K6KA 4Y8VA 3RABA 3SJBA 1RHMA 2B7BA 2DFLA 4YRZA 3C6ZA 3ABZA 2OC9A 3ELYA 3G1UA 4JB0A 1KO4A 4MRMB 4W5HA 3RYIB 3T7TA 3CVUA 4AKIA 3K96A 5CVUA 3B1YA 4E32A 4HVLA 2UYCA 2OV6A 3AERB 1D2NA 3EZFA 3OCZA 1H3EA 4H7PA 3E5NA 4NAUA 1P61B 2R84A 3NHFA 4MR8B 2YHUA 1MB0A 2AOXA 4X54A 1G7CA 5JWHA 5C7OO 4DZTA 1NXTA 4QXPA 5HCIA 3BRSA 2WJVA 3NKVA 2CHGA 3VU9A 4HBZA 3ZDDA 1U2GA 2AI2A 1KH1A 1AC5A 4KIFA 1E6UA 3NU1A 4F5ZA 5KIAA 5LZ9A 3LZ6A 1EXNA 4UHKA 5FTNA 4WY5A 1OWPA 4PVCA 5T3YA 1Q7GA 3B9PA 2G9UA 2IBMA 2QPAA 3OLXA 4DADA 4KLRA 1ENYA 1BQ4A 1THZA 3A7DA 5DIFA 1V41E 1I1QB 1Z8FA 3NETA 3OF2A 2X8JB 3CQ9A 2A2ZA 4OI2A 5K3FB 2F3SA 1ZA2A 2HU5A 2JAUA 3EIXA 4BQNA 3SVLA 2KW5A 3K05A 1SXJB 5E2BA 1EFDN 3X1KA 3I2YX 3HWX1 4II7A 2YWEA 5IDQA 1ZIYA 2P79A 1GILA 3KB2A 3VGJA 4LOKA 3F67A 3GUZA 4ZRDA 3PDIB 4Q9DA 3SIRA 1QIEA 2DWOA 4NESA 1DQRA 4IEFB 1P0CA 5FUWA 3BK2A 4HZIA 4YJ3B 3G23A 1KFEB 2O7VA 4I19A 4RL4A 3EW7A 3L43A 5DRTA 1JQ3A 4A8JB 4JIGA 1MIOB 1E69A 4IXWA 2DBRA 4ZVPA 3AZOA 4J1SA 1G16A 3DOEA 1IM2A 1KO7A 1EXWA 1G2PA 1KJYA 5CIQA 3ILSA 4YRDA 3TG2A 4B3RB 1QIFA 2P3LA 5A2GA 3VO8A 2A9KA 2E21A 2BAGA 3A6DA 3PPWA 2IUEA 3DVLA 3EVBA 4RORA 4IDEA 3RREA 5CA1F 4CODB 3O31A 2RGAA 5CEFA 2PZMA 1X14A 2E87A 2L18A 3W9YA 3WAKA 6ADHA 4ZTZB 3G0IA 1RZRD 3AKZA 5LWQA 5C7IO 1UKVY 1J9GA 5LYJA 2EZ4A 2P1RA 3EN0A 1I3KA 2O5RA 4N8SA 2ZTMA 1NVFA 1G9SA 3OOSA 5JLAA 1KSJA 1X92A 1OIXA 2E5FA 3W4JA 5F7OA 5JSUA 1FNMA 4DJFC 2AXEA 3UBMA 5A5GA 3U19A 1XO1A 4PNEA 3HBJA 821PA 4B4OA 1NW4A 1JALA 1JSXA 1NJFA 2PEYA 3BEDA 2RGDA 5FI1B 1X9GA 5G53C 3RF6A 2PV0A 4BV3A 4BO5A 2VFAA 4X7PA 1N0VC 4RSGA 4NWIA 4TMWA 2H48A 3KV3O 1ZG3A 3OLYA 3VU0A 3ZR4B 3AYZB 3ZCRA 4FFNA 1RNLA 1BN7A 1U8FO 1XFAA 2BGJA 3KXIA 4NJEA 2DWQA 3TNDA 4LX0A 1QBKC 4N40A 2JFNA 4PZDA 1T0PA 3PZRA 2JC3A 2QN9A 4KOAA 3PQ6A 1FNCA 4QU9A 1GADO 2PL1A 3VR4H 3ZWOA 3E9DA 3COSA 3V80A 1HLDA 2WSYB 1NXWA 3UAWA 5CBPB 3PHCA 2ZPTX 4Q1BA 2PYIA 2PSJA 3ZU5A 4N0DA 3GCWA 1MORA 2ZIXA 3C2QA 2QRQA 4OB6A 3D8TA 3ZNOA 3ZWWA 5BN5B 1H1LB 2D5LA 2R5WA 4GIBA 1MQAA 1BA3A 3AI7A 4I4LA 4Z9BA 1NUHA 5DIZA 2CZQA 3CJRA 3SNHA 4G0WA 5BNTA 1X0VA 4ARAA 2ZYIA 4NZYA 2B35A 3VZPA 5BMVF 3OA0A 2X2PA 1N6RA 2QLLA 1SCIA 3L9WA 4FFSA 4HO1X 4ZANA 4EVIA 1HLGA 5CGQB 3FWZA 5ED0A 1K7YA 1KKLA 1JILA 1FRZA 5FH9A 4XQEA 3I0ZA 1NFRA 3CRZA 2ZCUA 3JATA 4M9SA 3KB8A 3TUJC 3K5IA 3V1KA 1CUZA 1CVLA 3K94A 3GO4A 2DLCX 3OZFA 4OYRA 4LX8A 3HVKA 3HEBA 3CJTA 3QVLA 2C9BA 3OM9A 3P2IA 4O4HB 4FEAA 3U4MA 2ZTHA 2G83A 4CEIB 3KJHA 4XYGA 2BM0A 3T9EA 4F96A 3PDJA 3T9DA 5JPDA 3VZSA 1SUDA 4HF7A 4XJXA 4ALNA 4EBFA 2FRDC 4ES6A 3W5DA 2F3TA 2G36A 3RYCB 3U4GA 3TTYA 1VJ5A 1REQB 3JQ9C 4BPRA 1JEOA 1TJ4A 4OQPA 4W1SA 4Y1GA 4LFBB 3IXMA 1MGPA 4TV9F 2C7GA 4NOMA 5CLJA 3D7SA 5DNCA 4YR7A 1Q5PA 2X5KO 4LGMA 2H4JA 2FN3A 3QPWA 5DJ5A 1JQAA 2C3UA 2O3JA 1J2TA 4QHYA 4CEJA 3VR2D 4IJWA 1TA0A 1RT9A 2GZDA 3ZKWA 3RJZA 5HQ3A 1L7XA 3P20A 5HKLA 5BYBA 3AEXA 2Z8ZA 3LNTA 3MRSA 1UM9A 4GWKA 2AN4A 1TK9A 1YQQA 2QJTA 3FGPA 2JEYA 3I28A 3MERA 5HDQA 1X8XA 3NVDA 5FOTA 5JCPA 1JEYA 2JS7A 3ZJ4A 4DJDC 1FTWA 2G1KA 3UT6A 1PWYE 1QIIA 2Z2YA 3QPAA 2JIPA 4YGYA 3W3AD 5G1PA 4DILA 4KQIA 1M0WA 3BBPA 3BTSA 5A71A 3UGQA 1UJ5A 2ZTVA 1ZC3A 3MWLA 5ICGA 4HGRA 3MGGA 1MD9A 1RYHA 1M8PA 2W9XA 4L27A 4PG8A 1JEEA 3CUUA 4UTXA 2JI7A 4DQ0A 3ONDA 2AN3A 2EXXA 3LUDA 3G17A 5KVSA 1LQUA 4K81B 1P62B 2HY7A 1E61A 1R5NA 5WRFA 1A5BB 1FX1A 4DL9A 2Z98A 1X87A 3VHLB 3RIYA 3LDUA 3PEUA 3I9OA 1E79D 3C5EA 5G1NA 1IULA 1PJBA 2I4RA 3I62A 4QTTB 1DAIA 3RYHB 3WP0A 5ALMA 3TW6A 4BO8A 4C9BA 3B78A 5K8CA 3A4TA 2ZRQA 3KZNA 1GVNB 1SUFA 2EFHB 5EIWA 1JS1X 2I71A 1YC5A 3NXKA 2BFAA 3X1YA 3ORSA 1KZ9A 3BB3A 3N5CA 4KGDA 3A36A 4FX2A 4NNPA 1M2VB 1XRNA 3ZIAD 2A94A 3GV0A 2QYSA 5KPDA 1CUCA 1U1GA 3UIEA 5J43A 4IKOA 4K8RB 4EGQA 3SVZA 4MGIR 1D0IA 1Q1ZA 2OZVA 3MVEA 2ZJ3A 2NNLD 3N0WA 4NH4A 2NU8A 3IH5A 3MQ2A 1L1RA 3MQ4A 4TXJA 5ITZA 4HY3A 3OPMA 1NT2A 1Z08A 1WZUA 2PU7A 4JZYA 4CIYA 3HCRA 1O0SA 2B6HA 4IUCS 2XD9A 1CULC 2CVQA 3LKDA 1QRRA 1G19A 4YFVA 4F5EA 4FWIB 3ORQA 1AF7A 4NQRA 4Z9XA 2OVBA 2XEDA 4ZYWA 1XZEA 3MF4A 3WFIA 5LU8A 1Z0UA 4LQLA 2RHBA 3OHSX 5L3VA 2O3TA 3ETCA 5CB8A 4BZXA 4YGXB 4G0VA 2XNKA 1MDBA 2KX7A 1Y82A 4M9XA 1J8DA 1IJBA 4X71A 4GAEA 4OH7A 1EI9A 2A67A 4P53A 3TINA 2HYIC 4KPYA 2QN7A 3VJLA 4GR5A 3SDBA 5I51A 4U02A 1NMQA 1GGVA 3MJ4A 1DKMA 3ZGNA 2ZE5A 4X6XA 4I55A 4RWEA 4J75A 1GKLA 3P97A 2CZGA 2X13A 4HFJA 2V8OA 3A6ZA 5E3HA 3FSJX 4XM0A 5L7WA 3GLGA 4RBNA 2P11A 3ZVRA 4LI3X 3MC1A 4ONEA 1D5WA 1LGYA 1SRQA 2H6EA 2OWEA 3NT2A 3RASA 3UYLA 5I8ZA 2CCJA 2IZ1A 3MM4A 2B7LA 4PLYA 3U4QA 4C29A 2GBPA 3NKFA 1OAOA 4GOOD 5FA5A 4CMJA 2W4QA 4LYEA 2AE2A 3ZK8A 5C8VA 4ALKA 4MPRA 3DOFA 3ECCA 3ZZNA 4D1YA 4FW9A 4OH1A 3GBVA 5BQPA 3RT9A 5ES4B 3VMFA 3NDBB 1AHHA 1Y42X 5EINA 4Z1OA 1J39A 4EO4A 2HH9A 1PFVA 3RTGA 4TVSA 1TTTA 2C97A 3DBHB 2WTNA 4PRYA 3KWLA 4MWOA 2CMFA 1K4MA 2EX0A 2QRGA 1LC3A 4BTEA 2Q1WA 3OQOA 3QKTA 2QRVA 1J06A 4F84A 1DDIA 4ZK6A 2FW7A 4KK4A 3IHLA 4RQTA 1S8OA 4WZBB 1Q0HA 4IEEA 1Y5MA 4TTTS 5HKBA 1EQ2A 3PYXA 3GCZA 1Y8QA 1QPBA 4CV1A 1IXYA 3TRKA 1QB7A 4KXLA 4IIDA 3PL5A 5MDHA 2WNSA 4EA6A 2YWHA 3G02A 3AM4A 1NP6A 2ECQA 4RTMA 4R3NA 4R68A 4ZAZA 1YRLA 2XTJA 1B1CA 3C3AA 3KLNA 4EHIA 4UKDA 3IC5A 2HJ9A 4LXUA 4CI0B 3IEVA 4NENB 5EZYA 5LLSA 3SEAA 3L7NA 3X1ZA 2GEBA 1JDTA 2G76A 1BN6A 1DTWB 1TO1E 4KDRA 3X0DA 2G1PA 2IS6A 2DFNA 1S2NA 2XGOA 3AVQA 3O8OB 3F3MA 2WMOB 4OP1A 1DBPA 1XELA 2G5PA 1T25A 2QD4A 3GJZA 4YLYA 3V1LA 3UOAB 3W04A 2XUZA 2ZREA 1ADGA 2OHFA 2QN3A 4H17A 4WASA 3D7NA 3S1SA 1RADA 2AMJA 2GN0A 2RGYA 4OSPA 5KYNA 1WCV1 1CTQA 4WA7A 4P3KA 1P5JA 1BXGB 2D54A 1P4RA 2HXGA 3IELA 4KVAA 2C88A 4MW9A 4XQGA 4G1VA 3GFGA 2GXSA 3EZGA 4DBZA 1QH9A 2VK1A 1DKLA 2XW6A 5FPSA 4IP0A 1ZR2A 3LP5A 1PZEA 5A0FA 1B6RA 3AHDA 3AB3A 1P1CA 2B4AA 3HK2A 2C04A 1ZINA 3C43A 2IZOA 1OASA 4H7IA 3FN4A 4E46A 3KT0A 4JB2A 1EWKA 5AVWA 1U02A 1RQGA 5I7RA 4PXSA 1YJBA 4JBXA 1ESEA 1MB4A 1N6IA 1KJNA 3HUEA 1N8TA 2WAOA 1J97A 4Q34A 4OJQA 3FRIA 1Y3AA 4YLEA 1Z2DA 2O9JA 2Q3DA 5IZ4A 2XZOA 3SYRA 4MRPA 4V24A 2OGSA 1VPDA 3QG5A 2QUZA 1O9HA 2GAIA 3GRAA 3IAM6 2PD3A 2PKYX 1L1FA 1Z7EA 1BS1A 2X3UA 2R25B 2WWTA 4YT8A 4QYTA 4JLUA 4FB4A 4DR7B 1C80A 2ATIA 1QTIA 2KSQA 3KQHA 1QCZA 2P8JA 2J0QA 2FPXA 4GW3A 2XT0A 4LOIA 3LYAA 4M7WA 5EJ2A 2NU7B 4NKRA 5BUCA 3L7CA 4MQMA 4J3FA 5ILQA 2RGCA 1Y7PA 1GGKA 4MQ6A 3KZCA 1FS4A 1JG3A 1RE0A 1SUPA 2PKQP 3D2LA 3DB1A 1LBTA 2J9YB 5CH8A 2FFAA 2RHOA 4D8XA 4F12A 4GDFA 3AXSA 1R10A 3DUWA 5HX7A 2ZJZA 4KGZA 4PZZA 5BV2P 3U39A 4RQAA 4J0KA 4JJ4A 5GVRA 1RVDA 4G1UC 2FEWB 4KH0A 4TM8A 1L7NA 2MTBA 1J5XA 3NB0A 4OQXA 5ECYA 5FHQA 4CDRA 4OKIA 4RQUA 3HM2A 1AO3A 1TO2E 2QB5A 3ZLUA 2VPQA 4PPQA 1ADBA 5EL0A 1VPTA 4U1RA 3E6AA 1R4NB 1JA1A 1HQCA 2JLXA 5ALDA 1HTTA 4JODA 5CBKA 3EGXB 5T4EA 3S6JA 3KS9A 3BMOA 4R8VA 2F59A 4IFEA 2KHZA 1UBCA 1NF8A 1ZUIA 4K1LA 2WQ6A 3GLFB 5EP2A 4Z4GA 1X1CA 4LNAA 4QPPA 3ZGVA 1Z38A 2FPWA 4FJ2A 4BUCA 4FHCA 4FN4A 1FJXA 1FL9A 1E96A 1PVVA 2APJA 1EDDA 1MG0A 3ESAA 2PX6A 3CW9A 4MW6A 2QTGA 2PBZA 3HXQA 1N0HA 1W1WA 4BMZA 1XMOB 3L0YA 2WHXA 4GFDA 2XMSA 2Z2JA 3PUZA 1LNZA 3E8MA 5KNLA 2VDPB 2DCMA 2PE5A 3KT3A 4CM3A 1I2DA 3MW8A 1P72A 1AM4D 1ZMBA 3OZTA 3RV3A 3V9PA 5B55A 1EESA 4OHBA 4PHCA 5HNKA 5CJJA 3T3MB 2Y76A 1PT5A 4FYJA 2M9MA 1SKMA 5LNK6 1AV7A 1QFZA 1QV7A 1WPRA 1XZGA 2DPXA 1NRWA 2HLHA 3A70A 3BHIA 2A1TS 3LY9A 5LP6F 4JUBA 1SD5A 5KZMB 1AA6A 5GWXA 2EU8A 2HKIA 1EDOA 2Q6TA 5EJ8A 3FZEA 5CLLA 1EJBA 1XTBA 1KI4A 1Z4QA 2B4KA 2BFEA 2E0IA 2WBLC 5I47A 5HJ7A 2BMEA 1QYXA 3I6YA 3IERA 4FJ0A 2EZ8A 4HL6A 2HAEA 4EW6A 3CJQA 2ZCJA 5EZ5A 4F46A 4JGIA 3PHJA 1RRVA 4GYKA 1N32B 4KLZA 3K5WA 5TNXA 1KAOA 1ISHA 1J0CA 1NIPA 4EFMA 1U7PA 3ZUGA 1ZXBA 3AONB 3TZQA 4MVCA 2X0FA 1BCSA 3GROA 3LIIA 4X20B 4XUDA 1L5FA 3S70A 1CQWA 1RYEA 3KVNA 1X7GA 4POOA 2GAFA 3IOMA 2VSQA 2ZM5A 2MSLA 3DMTC 3URKA 4LJRA 5F9HA 2H5EA 5EFOA 3L6UA 4X63A 1S7GA 3H4VA 4C07A 4PAQA 4GGOA 1QF9A 2QD1A 3I64A 4TYNA 4UCWA 1SIOA 4L8WB 3EPLA 1RJ9B 3C3EA 1KMMA 3QW2A 2YFYA 3AJDA 5BW6B 2KB0A 4A23A 4WN9A 3SYMA 1XP5A 5T57A 1DC8A 1WY5A 4G8CA 3U0VA 6ABPA 4QVKA 2W2QA 2QY6A 4KE9A 1Z7GA 4L51A 4PY2A 4CNQA 4E30A 3WWYA 4FGKA 4IXMA 4BBJA 3QKWA 5B58T 3UMCA 4GS5A 2NSHA 4XOIA 1MAWA 5IYZF 4DJ5X 4M9UA 4WXEA 1NSYA 4NNOA 3BFXA 2RJ3A 1CUXA 2ZZKA 3SXUB 4U6SA 3DE4X 5GJVC 1RQPA 2I1QA 4F9TA 2Q6IA 3QE4A 2X5OA 1I01A 1SAYA 1SB9A 5JS7A 4JB8A 3PQDA 5DBFA 1GLVA 4BRSA 3AF0A 5ER6A 3IDOA 2QA5A 3L4BA 1V3TA 1RXEA 3II6X 1FDUA 3NHKA 3N8NA 4ROSA 5FPKA 1D7OA 5BSHA 4MJ3A 4M9CA 2FQXA 1L7PA 2F7SA 5BN3A 3H7AA 3V1YA 4HTFA 1JSRA 4ZYYA 1GXSB 2JBAB 3REQB 5CLHA 2IJGX 3N6RA 4CTNA 1JFLA 5KNBA 4CFYA 1EFVB 4JLPA 3BSYA 2BKUA 2YV1A 3GW8A 3OIVA 2IV2X 3EDYA 3EUAA 3AT1A 2AVNA 3G3EA 5COBA 1TDJA 4IYRA 3DJFA 4QTZA 4RH0A 1JDNA 2YJ3A 3ILHA 2VUUA 3O9ZA 2CK3D 5CDFA 2NZ2A 3HADA 4JR0A 2ZWOA 5F4ZA 2HUNA 2Q7DA 1DP4A 2Z2KA 1WU8A 4PX2A 1RWQA 3P0JA 2AFIA 1QS0A 4B3CA 4X94A 3ZHSA 3OIFA 3AUYA 4BWGA 4EUHA 3ZBUA 2E6UX 2XMDA 3I09A 5ADUS 1JP7A 1M0TA 4OX9B 4BP9A 3D4IA 4COKA 2OBYA 3K1ZA 4R7TA 4S35A 5LMUB 2XSZA 2CVFA 2COKA 2Q27A 2B4RO 1SUWA 4QBFA 1Q1QA 4ARUA 1K7FB 5JTUA 3I39X 3T3DA 8ATCA 3DBRA 3IBYA 2PRSA 2RHRA 4Q1AA 4URVR 2VJDA 1U99A 5KWJA 3MJVA 4NCBA 1PEKE 1LVGA 5F3WB 4Z8XA 3NAMA 5EPOA 3RO7A 1NX6A 2FTKE 1ZISA 3USZA 4ML3A 3PUIA 4RKFA 3HSSA 4HFNA 4INZA 1FFEA 3KPJA 1V39A 5E1BA 3RSQA 1SKYB 2I2DA 2IUYA 3KUCA 4KUEA 4PX3A 4E7PA 4OKSA 1AF4A 2PUTA 3E2MA 4D3SA 3DBOB 1JKJA 2PZGA 2ENUA 2WKSA 3BIOA 4WZZA 4L5AA 1H4QA 1IK6A 2XTNA 2YV5A 5A2QA 5HS4A 1Q7EA 1VIVA 5BV0A 3IKMB 1GUAA 2R7AA 2DXIA 2ERYA 4V3BA 1RRCA 2VWHA 2ZJ7A 1TQ8A 1CZUA 5ECGC 1DPFA 4Y6RA 1M6HA 1G3IA 1WCYA 1S96A 1JJFA 1WDMA 2KI5A 5TMDA 3FKJA 1P1BA 1J1ZA 3FY4A 3WBFA 2O4UX 1RLTA 1CS0A 3B12A 4E22A 1A71A 1BS2A 1N8NA 1TT7A 3CLSD 4ZYXA 2SCUB 1E2JA 1XCLA 5AM4A 5TQ2A 2A57A 1E62A 1P6UA 3A3OA 4U5QA 1CUEA 3PXDA 4IBOA 5ALSA 4AKSA 3PX7A 4C0WA 3CS3A 1KQFA 5LP6C 2I8AA 3MPOA 3IIJA 1GNLA 4MQ5A 3VZRA 3F6RA 3HVRA 1C14A 1E7MA 2WZQA 3AR5A 2B8WA 3JRXA 3RWMB 1OFIA 7ABPA 4DCTA 2FLVA 2OMKA 2YRFA 4BX3A 2XNCA 1KVUA 1DEHA 4AP5A 2G7ZA 3JVUA 1T1GA 4KKVA 3CX7A 1CQIA 1KYVA 1ZW1A 2AXQA 2QZ4A 3CINA 3KR2A 2PZEA 3CIOA 3KQVA 1WHTA 3EQZA 1F5NA 2PMCA 1NX9A 4MS1B 2QORA 1AD2A 1JAYA 4X95A 4AQYB 1ORWA 5EXXA 3A2KA 5ESXA 3AEZA 3F4BA 5B3AA 2ZI5A 3GNSA 3OCYA 4V03A 2DTEA 3QU7A 3LT4A 4HLUA 4HYTA 5DGHA 2W0MA 4L5YA 2FLKA 4YV2A 1TYZA 1ZQ9A 1MT3A 2F3PA 3QLVA 5ELLA 3IQWA 5EIOA 3RSGA 4JP3A 4C04A 2IHZA 4AS1A 5K3SA 2R9VA 5INTA 5K0TA 4LXGA 3R77A 1IN8A 4N8EA 4TUYB 4LXHA 3R3XA 2VCHA 4HG2A 2PR7A 2J7KA 1V1RA 3VVCA 4YMGA 3JQAB 2OKGA 2JFWA 3D0KA 3V00A 2A88A 4UE3S 3LI2A 3NV7A 2XOEA 3UAXA 1M8JA 4HXYA 2H65A 3UHOA 4GRAA 1SKBA 4EDFA 5JIBA 3MN1A 3N7TA 2VS1A 3ABQB 5IWCA 1HYQA 3FLMA 3ZWDA 1JIVA 3K8QA 1EWVA 3C3XA 4YNBA 4P86A 3I61A 3SKVA 3CVXA 5E7QA 1OV4A 3X2EA 1N6PA 3UW3A 4JJEA 3V7YA 5JDCC 4C2AA 3R2JA 4HX2A 4UUBA 1N6HA 2I7CA 4RK5A 4YK7A 4ZVOA 1W5AA 3ROTA 1TIBA 4PZ0A 3SMQA 2RHGB 4YUXA 4S2UA 1JA9A 1TFUA 2FPKA 2FSGA 2WDPA 2AHRA 5FI5A 4EOGA 4W5OA 1X2EA 3M1IA 4K40A 3MBIA 4JJKA 1WSWA 1VMEA 1QP8A 2W43A 3WZ2A 5I9LA 3L8MA 3X1MA 4KFRA 3I6QA 3PC7A 1WU7A 1G4UR 5EUCA 4XUCA 5NLLA 3TPCA 4V0ME 5HVNA 1S4QA 4FOLA 4YCDA 2GCOA 3D81A 4ETNA 4PCLA 3WGZA 5FI0B 4DKXA 1SM4A 2MIIA 5M7EA 1Q21A 5AW9A 1YS2X 2P9QA 3NOVA 4BECA 4EY8A 5ALZA 5EG5A 3UC9A 1FYWA 1G9TA 1LZLA 1NBOA 2NU9A 2OTCA 2NXWA 5LMCA 2KJQA 1EX7A 3C70A 3TSZA 1R0BA 5HRAA 3RVDA 4FYMA 4NBNA 1OX6A 1G60A 2E55A 1L8QA 1CZLA 2HCFA 3NM4A 3QMPA 5IAAA 1E1CA 1U8ZA 3QKUA 1USGA 3RUCA 4DM7A 3QIAA 2I65A 5PGMA 3H9GA 3PJRA 3G2NA 4D43A 1DO8A 2GUWA 2NYUA 4AO6A 4MS3A 2V9ZA 2VJNA 4CN8A 1RLIA 2BM9A 2PAFA 4FHZA 4XDHA 4YB8A 3WYDA 5FCDA 2WAMA 1FRFS 1HL3A 4MPDA 1KIFA 4QD3A 1NYRA 4IV8A 1FMLA 1ML4A 1KIAA 3WWZA 4R2LA 4BV9A 2D0DA 3S68A 1IAVA 1Y4AE 1NSTA 1CKEA 1FFCA 3H7IA 1SUAA 4NVRA 4R6WA 5DSXA 3RRJA 3E2IA 4X7RA 4ZVKA 1I6MA 4W1PA 2HIAA 3DDZX 5J2TA 3DF9A 5DOZA 2JA2A 1C3LA 2OECA 2PGJA 5FL7D 4D0SA 1SVNA 2RDMA 1YK0A 3GRRA 1ZGGA 1F6WA 3LC0A 4OSOA 3CG4A 4MWDA 2PQ6A 1Y1TA 4U8HA 3LE8A 1IM8A 4KXFB 4CEHB 4Q3EA 5CX1A 4TXLA 2QPOA 3PFFA 5ALUA 2CUTA 3R3JA 1LV8A 4B7XA 3AB7A 4M1TA 4MCJA 1XZMA 1GZSA 3BULA 3UMBA 4WCFA 1J2UA 2FWAA 2JI9A 4IIUA 3SXJA 2J0UB 4Y9UA 3DT9A 4DLAA 2LDXA 2YICA 5BNFA 5LC1A 3TTXA 1L5HB 1JLRA 2YMLA 3DAYA 1JPVA 2FY8A 2LKCA 3MTEA 3NYIA 2V7VA 3W5UA 4X92A 4BEJA 5BXYA 2VJLA 3RS7A 3AO0B 2QW1A 1FBNA 3GLQA 3RI3A 1DAMA 3UV7A 1CJCA 1PZMA 4CCAA 4AO7A 1KKMA 3WQRA 2A9RA 3WADA 3H5TA 3HCBA 4O3FA 3ZLJA 3KPYA 3IAUA 3ZDAA 2EC5A 3A14A 1OFVA 1G66A 1ZC4A 1Z3IX 2QVZX 3H05A 3OA2A 4D9MA 2MMCA 3KPWA 4AJ1A 4IX9A 2XAAA 2AN1A 2AQKA 3HA5A 1OYWA 4QULA 3QBTA 4Z3KA 3RTDA 2G04A 4L78A 2VAPA 2WABA 1L4MA 1YCHA 4GP6A 1ZK0A 2AMYA 4ECEA 2IEBA 4B0PA 2Y4NA 3TSWA 1SQSA 3H9QA 1GUDA 4UVHA 1Q95A 2O0HA 4DZRA 3DEHA 1RYNA 1YCGA 1LZKA 1GZ6A 4Q93A 5JYCA 5JHGB 3GRPA 1KETA 2IS2A 1GNVA 4GI1A 3VNSA 1FVOA 5D5QA 4MWZA 2LPMA 3IULA 1OYOA 1T91A 3KJGA 3LUGA 4BKQA 1UPCA 1IJFA 3DLIA 3SSNA 3ILXA 2BEVB 5SYMA 2OV8A 4AJKA 2QD3A 3KBBA 2ACKA 1ACLA 1SBCA 1N1EA 1N0UA 2OKCA 1QBGA 2BJWA 1GG5A 1MO5A 1XAIA 2NO5A 3A05A 1YWGO 3KJZA 4H31A 4B4VA 2X5XA 2CNBA 2XYGA 1E6KA 3L05A 4D9FA 5GVSA 2O59A 3RG8A 2HSDA 1JMYA 2K7FA 2PQ2A 2COEA 2P69A 4LHEA 5HE9A 4AZTA 1G8PA 4BDSA 2JCYA 4XVHA 2XT9A 1QDUA 4Q19A 1ZESA 3VDNB 4BLOA 2B5WA 3GYGA 5BR1A 1B16A 1L4EA 1MJGM 1EFTA 2JVJA 5JZBA 1N2CE 3D31A 2ESRA 2WIGA 1NYQA 2YY7A 5K0GA 1Y48E 2NPIA 3MWDB 4F91B 1DFGA 2HRBA 4DNPA 2C2ZA 4GBJA 2H7YA 5SICE 1WVGA 2W37A 4FBLA 4C76A 3GPDG 4ER5A 2P6RA 4OXXA 4BXOB 1IHXA 3PL1A 1Z4KA 1KBOA 4AJJA 5H8WA 3R24A 1T34A 2PX5A 4G84A 3DYBA 4UEOA 1BDMA 2G8LA 1T1IA 3P4UA 5KNCA 4YRJA 5CCXA 1J0XO 1L4FA 3ZWQA 1K7CA 3EVFA 2PCJA 3B2NA 4ESVA 2WP0A 4N7MA 4H7JA 3ND5A 2BWJA 1G8SA 2C2HA 1RQXA 4DY6A 3HO8A 4OBWA 1NZFA 1ZCJA 1WRBA 2C2XA 2PKCA 4IW3B 4Z0HO 3RVSA 5TLSA 3FYUB 4ZQIA 5JBNA 1V25A 3ROMA 4HAWA 4FB5A 1PWZA 5AM1A 5EHGA 4OHCA 1H9AA 2WJPA 1LPOA 3COYA 3LRTA 4N47A 1N33B 2X9NA 4KMSA 2IVFA 3LLMA 5H0IA 3T5AA 3CPEA 2QMZA 3B1JA 1V1JA 3RQIA 4B75A 3THYB 3VR5A 1YL7A 2P9ZA 1KF0A 4CTJA 4K3UA 4LJYA 4LNUA 5CDGA 2PL3A 4MUEA 1VFPA 1R3DA 3T5TA 4H16A 2MSEB 2CLKB 1UJ6A 1ZM2A 3KXKA 1S3IA 3LLVA 4KQKA 3K1AB 4JL5A 4IIHA 5EIAA 1YZYA 3SF0A 3KEFA 4NG4A 2R6DA 4Z7NB 4G07A 1NYLA 3OQHA 4HLQB 3GRZA 2QV7A 2AT1A 2ZWMA 3K35A 1TYDE 4U2EA 1IVSA 4Y1RA 4ZCMA 1B23P 2VT7A 1VBFA 1UDCA 2FPGB 5COAA 1AN0A 2EATA 3O4GA 4KQ6A 4MVJM 3RSOA 4BYGA 2IEGA 3W5IA 3DDHA 2GI4A 4NE7A 3HFRA 5K3BA 5JWRA 1ABBA 1WCXA 1K2WA 3AHCA 1HDYA 3QYFA 1O77A 1V4VA 1N3BA 3W7VA 4PRZA 1JKXA 3HI4A 4RNCA 1DMSA 1RR6A 1C8VB 2ZSKA 2UZ1B 1XI2A 3OX2A 1WLSA 4BBZA 3SG0A 2J3DA 4X3PA 3ILYA 1U1DA 3ZYCA 5I4CA 2GX6A 3GOQA 1VM6A 3CB2A 4ATNA 5HJEA 1P1KA 4O2AF 1Y9EA 1R18A 2B0CA 2REXB 5DSTA 4OXNA 4FGWA 2O06A 3GLRA 4UW9A 2OK8A 5IZCA 2HL6A 3CXRA 3F3SA 4NBUA 3E7FA 2J31A 4C7MA 3HO1A 5AI8A 5GADl 1N3LA 2B37A 1UBSB 3NIWA 4XYMA 4PLWA 3W8FA 2ENWA 1H4TA 1TUEA 3ETHA 4KXQA 2BFNA 4HN9A 2R3SA 2C5HA 1QR2A 3V2HA 4I6EA 4Q3DA 4L5IA 1X42A 3TDKA 3UJPA 3BGOS 1Z5VA 3MUNA 2QOEA 3K72B 3LA6A 3VNVA 1D6MA 4JQCA 4UXJA 4QLAA 5HZGA 4K28A 4ITRC 3SQDA 3ZDCA 1TYAE 2GN2A 3Q1LA 2VN8A 2WYIA 2FR8A 3AFOA 3TZ6A 1NI3A 4R51A 1ZCAA 1T9KA 2XUOA 2JI4A 1O6BA 2LDBA 5L9AA 4XIGS 5U9CA 3SIPA 3GGCA 2Y1KA 2I3GA 5F77A 5I7FA 2DWCA 4IIVA 3UB2A 2A59A 2D5BA 4I3HA 2I6GA 3EODA 5FF9A 1MO6A 3EB9A 4Z99A 2WJ4A 4EZIA 4C6RA 4PXAA 3FSGA 3BL6A 3MTJA 1K5GA 3HHPA 1DC5A 3N2IA 4M6WB 5FADA 5HIIA 3ER6A 3W5AA 4F21A 3K8OE 1WF6A 5AVYA 1N5KA 3LXUX 4JJ6A 3O75A 1I9CA 3ZH9B 3A6KA 1YULA 4JVMA 2DFKB 4OHWA 4WD3A 4Z3DA 1C7IA 3V7FA 4E31A 4HSEA 1DMRA 3B2QA 3EXHA 1KXZA 2VDWB 4TS1A 3FD8A 5DOVA 5IAJA 4PIMA 4PG7A 5CIWA 4BB9A 3PEWA 4P6VF 2X41A 4HNQA 1LS6A 3GDHA 3HI6A 5CYGA 1W0JA 2X1HA 1IK4A 1WBJB 3UHJA 2ANCA 2BMWA 4E6EA 3MWFA 3I53A 3IDQA 4D4LA 1FLNA 3WIOA 2PWPA 1F14A 3GRFA 3QA3E 1RBYA 3L8HA 3OKCA 3O3NB 1Q2UA 1YVUA 3O1JC 2JLVA 4QODA 2W22A 4HT3B 2AUTA 1R1DA 3RRMA 1O0CA 4E1VA 2CN1A 1G42A 2JGLA 2GYWA 4PGFA 3KTAA 4LY0A 4CR7A 3BS4A 1XXHA 4S1VA 2O50A 3QBJA 5C1IA 2OYRA 4JJAA 1LK5A 3VDRA 4HR7A 3ZN2A 5EP1A 3TIFA 3KOOA 5EPUA 4RD2A 5E6RA 5K0NA 4CDNA 5B7PA 3TKAA 1OY1A 1XLTA 1Z6PA 4D25A 2GM3A 1V96A 3IBCA 2OXFA 5B6PA 1ZJYA 2KM1A 2RK6A 5CB0A 1DXOA 1FYVA 5DX0A 1NAHA 3X44A 1GGFA 4GO1A 1VL1A 4RJ2A 2AW3A 3ZU4A 2WKRA 4ZHQB 1O2DA 3ITDA 5DHQA 4U7GA 5C5CA 3KBOA 2WIAA 4BO1A 4EFLA 3PCXA 1UAAA 3A6LA 4YJ3F 1GCAA 2A58A 1PUIA 1TCVA 3FSGD 4HB2A 4HQKA 4PCVA 2A9QA 5JZMA 3L7JA 3MRXA 2NAFA 5KOHA 3LX6A 2XMPA 2VO1A 5DB4A 1LBIA 3WMGA 1H6AA 3TLZA 2HO5A 1A50B 2OCKA 3OFNA 4ND5A 1QP0A 1H3FA 4ZCTA 1YB4A 1DJOA 3EOBI 1A9XA 4GHWA 5DYNA 1A9OA 1PGOA 2OLEA 2O2DA 4XJSA 1X15A 2XQIA 4NI5A 3SHTA 1W0JD 2Q6VA 4Y2RA 3NT4A 1MN6A 3QXGA 4JITA 3CW2A 5K0EA 2ZSHA 2UYHA 3HBFA 1XF9A 2I6UA 4P0QB 3C8HA 1X1RA 1ZH6A 2W8ZA 3J80A 2CUNA 2WUFA 1TX4B 4FD3A 4OGFA 4RESA 8AT1A 1RM0A 3EDOA 2RAFA 3F9IA 4HJRA 1KU0A 1HDXA 2FPMA 2GPJA 3ML1A 4FFBB 4OQEA 3DUFB 5BVGA 2FK7A 3TSAA 4ND8A 3LBHA 1PHRA 5F78A 2A14A 3ICPA 1MB2A 1UPUA 2XE8A 4AJIA 4MUIA 1ILWA 1NJGA 4QUBA 1G6Q1 1UPTA 3EC1A 1DARA 4I4TA 2GA9A 2GZ3A 3E4CA 4HDNA 1UBEA 1UIMA 2I0FA 2HEIA 1WKCA 3BWCA 3CNLA 3EQ9A 1J8FA 4PIPA 4Q7EA 4RVCA 5LZ8A 2OC4A 4CM4A 4F9GA 3R0ZA 3OZXA 4IF4A 1L0BA 5L3SB 2CF6A 2OE2A 1CZNA 4IGAA 1NJ5A 5EHNA 1R0KA 1VZ3A 2B1IA 2X9QA 1KSGA 2RKOA 1ZGHA 3O8QB 3NZEA 4GZ5A 1WZCA 4C0LA 2XIJA 4C4RA 3BFKA 3NTVA 5GGYA 1QR6A 1ZWLA 1YACA 2J3KA 2KLHA 3VPAA 3KWMA 1HMPA 1S02A 4YRPA 1KDRA 4CFZA 1CIVA 1P2UA 3FFTA 3QY9A 2VPXA 4L16A 5JH7B 2ZE7A 3DEFA 1K92A 3EPPA 2YUTA 5ADWA 2AC2A 1ZI9A 3I83A 2NTYC 1DX6A 3CX3A 1TJ5A 1IZ0A 5IDWA 3U4DA 1FTQA 1ZS9A 1HG0A 2C4WA 1M6VB 1N75A 2X7XA 1TM4E 1SY7A 4GXNA 3OFND 1YI1A 3AP2A 3EZ7A 3ZEIA 3L1JA 4WCDA 4EATA 4MUNA 1X1AA 2C8KA 3E9CA 5DXAA 1ZXLA 4WY2A 3RF7A 4A0FA 4U7HA 2FOIA 1EVZA 1RAEA 1YZUA 2EYUA 3A06A 3N3AC 2Q1YA 4R3UC 2C1EA 5ALFA 4MUXA 4V2IA 3RS4A 2ODAA 4PGHA 3K0CA 3A6PC 3KQYA 2GD1O 3VPBA 3U3KA 2E4AA 4BO2A 1N7IA 1C7JA 1Y8CA 2Y27A 3OEWA 3FIJA 8MHTA 3SJZA 4JT9A 4FGLA 5CLFA 5IANA 2CVOA 3WGUA 2OLJA 4K03A 3HCWA 4UBKA 3OCUA 3TH5A 3W2IA 3M5CA 3MMZA 4O4HF 3TIVA 1PQ4A 3BIJA 1N2IA 4EI8A 1JAXA 2QRZA 4PLGA 4Q4AB 5CH5A 5F3DA 1SIBE 1KC1A 3FGZA 3UHAA 3GYBA 3VTZA 1O6ZA 1B74A 3VYSB 5FLYA 5KQGA 1SHZA 2IY9A 3T94A 3AX6A 1OH7A 1K4KA 4JUDX 3L4KA 1FDIA 1OYYA 3ZE0B 4WK6A 3JU3A 4XVUA 3D7KA 5I9NA 1B00A 3M6LA 3AR7A 4HX5A 2ZBUA 3L1VA 4TWZA 4AMZA 4UTPA 3D1VA 2IXFA 5HFAA 5K6AC 3G9TA 3HYRA 4RGYA 4A0RA 4D92A 2PBFA 2PH1A 1M6EX 3GHHA 3EGIA 1Y9JA 2QSUA 1JDUA 3BQNB 1L9KA 3F71A 4AMUA 3F98A 1V7PC 4KIJA 4JI5B 3TSOA 4RVNA 4AL4A 1VJCA 5KKAA 2QTRA 1SQ0A 1YE5A 1F0NA 4DIDA 5DNEA 3FPHA 1PCXA 1KRHA 3OZRA 2PRYA 4MZXA 2G6BA 2D3WA 3ZI7A 3AVWA 3LECA 4N3AA 1UJ4A 2H52A 2CJWA 3MB8A 2HWYA 4K6HA 1VJ1A 3GDWA 4KO4S 5EJMA 5FBKA 1LTQA 2H7XA 1FOEB 3B53X 2QTLA 5KS2A 1JMKC 3UJNA 1J7JA 2BEUA 1MVOA 4FOPA 4HD8A 2HHCA 4MJXA 4XCXA 5DTJA 2IDKA 4UQOA 3TLBA 4F4UA 1QSGA 1CB0A 3G9XA 4PYRA 1SXJC 1XTRA 1NPDA 1FNDA 1P74A 3C14C 3FSEA 4O2BB 4A1FA 4YPVA 3B70A 1BROA 2XTAA 3LKVA 4D0GA 2M6LA 4RHEA 4K6OA 2Z3VA 4YT4A 3AEYA 3KLOA 1DO0A 1HZJA 1DQYA 1KJ8A 3DWIA 5A3SA 2H7CA 1L7MA 1MOPA 2IIPA 2V4MA 3T35A 3LBIA 3AR6A 4X1IA 1F2VA 5C1OA 5A7HA 4A8JC 2R6AA 2B8TA 3HZZA 2CMKA 2PFKA 3LUFA 4TWRA 1QRAA 5I7OA 2AN5A 4L4UA 4INAA 4TVOA 4BVGA 5GM1A 5EOVA 4HWPA 2NMVA 5JG7A 2X2FA 5A3VA 5EHZA 1J2EA 2X0NA 4YACA 4QT4A 4XW2A 1C0LA 3K2IA 2E5LB 3ZWYA 1OXUA 2E4ZA 2LWIA 1OE0A 3OLWA 4FFRA 1V47A 4I9FA 4IOLA 4JLNA 4Q7KA 1PDVA 4ZOAA 1GNPA 2VAVA 4UM9B 5LMZA 2W93A 3OPYB 2EERA 3NHYA 4W4TA 2AH5A 4BVJA 2B1RA 5TSDA 6Q21A 3KOYA 2F8SA 3CKKA 3ZU2A 2OCYC 1JEJA 1WW3A 2WJ6A 3O4FA 2M1ZA 1I8TA 2R8BA 1C3OB 4DQUA 1CF9A 2YW9A 5E1DA 3AEQB 4UNPA 3CEHA 5KYYB 3L06A 5ER9A 4CCSA 4C78A 3O7WA 3AXTA 4R98A 4UVIA 1W44A 3QX8A 4RKRA 5JXWA 4P22A 3B51X 1PFGA 4C88A 4B84A 2J87A 4B74A 2V45A 3CCBA 4M8LA 3RTAA 4P38A 4BP3A 1PGNA 2ZAOA 2GNAA 3DEJA 3H16A 3ESBA 3UICA 3D5EA 3PYMA 4H0CA 4WESB 2BF7A 4TXMA 3AOEA 2CMDA 3EQ8A 1HR0B 3DE6X 1F48A 5C8YA 1Z6TA 1LSJA 1UMDB 2LW7A 3OLQA 4ZD6A 3VHRA 2F2TA 4M0KA 4CF6A 3D8RA 4KWTA 3MJHA 1TEXA 2QNBA 4LVNA 2FZGA 2YV2A 3TNFA 3BCHA 2EKPA 1XL0A 3LT5A 2XOKD 1VSVA 1Y34E 2Y71A 1RCFA 1VL0A 1XZJA 2ID8A 2PLRA 5JSFA 5HZKA 1M2GA 1RAHA 2QDKA 3M34A 4MP6A 2AB0A 2VPTA 1WL8A 4LJ4A 1XYYA 5TC4A 4ENQA 3GL9A 5CXXA 1GGNA 3AU8A 4C4XA 2V7PA 4Y6OA 1SU7A 1EE1A 1Y7LA 5G41A 3VGPA 2AYYA 3DOCA 3Q6MA 5T4BA 2OXCA 4KQ9A 3I6IA 4MK4A 3WB2A 4LSZA 1QF6A 1UC5B 2VK4A 2BDUA 3DL7A 2PWYA 5MF6A 2AF3C 1DQSA 3A3KA 3CURA 4JUFA 3Q8XB 5JC1A 4XWYA 2AFHB 1J42A 3PUYA 5LA6B 2PRIA 4OX9Y 4PTYA 2W6MA 3IL2A 2HRDA 1NVGA 4YR9A 2A0UA 1SVSA 2W2KB 3AIOA 2DFVA 2ZIAA 3DCJA 3L92A 3IILA 4NABA 5IHPA 2MSCB 3JSAA 4NYMR 2V7XA 2NVUA 2YIDA 2O8VA 3SZGA 2PZ8A 5EIFA 1OGYA 2QW8A 1M2OA 4IM7A 2XY4A 2UVDA 4N3BA 3EUWA 4LYFA 3FHLA 2BLLA 4QNRA 3LOUA 2BEWB 4N8DA 1VKHA 3JYOA 4LC9A 3QVJA 4HMPA 1RYZA 4MKXA 3IP5A 1L5ZA 3KFXA 2GJ9A 2DETA 1S8FA 4JHXA 1BEEA 1RCUA 4GT1A 5F35A 2ADMA 5CJ2A 5H3HA 2HF2A 4PC6A 4RHFA 4CLRB 2HQSA 3HL0A 1IQRA 1CY4A 1DIBA 1ZRSA 2ZYSA 3F0TA 4M60A 1KP9A 1JJBA 3AR3A 1K7SN 3A9TA 3VO2A 2H00A 3IUNA 3L0ZA 1B8OA 1NKTA 1OU0A 1KI8A 3RHZA 2XV1A 4AUKA 5BY2A 2O8DA 2FPUA 2HK9A 4IG4A 4JH0A 2CHEA 2VHVA 3N8GA 4I8XA 4MWEA 5LQCA 1DELA 4J7AA 4E14A 3IP3A 4EYEA 2X1VA 2BFBA 3LPDA 1FIUA 1U0HC 1QRDA 4X3CA 2GK7A 2JGFA 1IVNA 2ZR7A 3JARA 4IFBA 3RIMA 2MYTA 4HQNA 4BAZA 5A9RA 1NP3A 4UMFA 2AMFA 2JFBA 5CA0B 4TM7A 1PJZA 2J9FA 5AOCA 1YRYE 4F04A 4YJKA 4FNGA 4REOA 4B2YA 4IWNA 3RKUA 2IYPA 4FXOA 1NNLA 2G82A 4R9VA 4EYOA 1KERA 1XTVA 2X7HA 2XKAA 3QEMA 4D9BA 4RTSA 3EPHA 3W9UA 3G0HA 1UZMA 5KNDA 5FOSA 3KT6A 3TRHA 5LZ4A 1C4WA 2BOVA 1ZAKA 2ZQ5A 3G2HA 5EZSA 5UKDA 4YASA 5L4NA 2ZFUA 3BXZA 3IAXA 4H4DA 4IHJB 3FUXA 2O1WA 3UCXA 1T2NA 5IKXA 3GPLA 1R6TA 3MD0A 1RM4A 2Q6OA 1PFQA 2GTIA 4CDGA 2VJMA 2VA8A 1UBFA 3W4IA 3RIEA 2BYTA 1VI2A 5DI9A 5IK2A 5JJBA 4HAVA 2V7GA 1UKCA 2ERXA 4L2IB 4ZEXA 4X1YB 1OWOA 4GMXA 4JT4A 4L4ZA 1UPBA 5EXDA 1LCIA 1FUEA 2FUKA 1Z5NA 3HXKA 3F6BX 1UMBA 4PGMA 4AIRA 2O8FB 4AN0A 1X80A 4DJAA 2C3OA 3R0JA 4B5LA 2IS4A 3LYHA 2O54A 3GDGA 2X4LA 4P4NA 1B0ZA 4QARA 4X6YA 2EBHX 2OP0A 4W1RA 3CN9A 4YRMA 4PX9A 4QU0A 5HBGA 1KK3A 4HATA 4PFJA 4DR4B 1X70A 1JTFA 1OMOA 1JG2A 5JR3A 5AICA 4H3KB 4MP3A 1YQTA 2VNHA 3EAFA 4PC3A 4XGQA 3TD2A 2X4GA 3KEQA 4CKCA 1VLVA 1I7LA 5CEJA 1EFRA 2FQ1A 1XUOA 1GPMA 1MJFA 4XSVA 2XRYA 3WY9A 4H59A 4ZYVA 3MJDA 1TMGE 4GM4A 5FPQA 3S44A 4MV3A 1RBQA 4CMEC 4ZVLA 4EA7A 4DZZA 1GLNA 1YBAA 3TMYA 4V2UA 2LKDA 1ZSNA 3LC2O 4KYUA 4FT2A 2HJWA 3O8DA 2CLFB 4J4BA 1H0HA 2CXHA 2ZJ0A 3HBAA 3U16A 1DKNA 1LPAB 1GTZA 1R12A 3DO8A 2HQRA 3Q15C 2FK8A 4H7KA 4PBSA 4ZYUA 1XQ9A 1NRIA 1Q0LA 2GPTA 2XADA 1KOLA 1OX5A 2CUKA 4QFBA 3RFTA 1MGOA 1U0LA 4RY8A 5GTDA 2F55A 4CQLB 1RHJA 1MZVA 4QLOA 4Q5IA 3JQFA 4G3XA 4GX1A 1XT6A 4TYPA 3WKAA 2QG9A 4MDFA 1XSEA 2V8BA 5G4KB 5I3ZA 1JHMA 3JQDA 2I03A 4QDKA 3AF6A 4A8HA 4AY4A 1WLYA 2RG7A 3NHUA 3NJRA 4HAIA 1QP4A 3ICEA 3H8VA 1NJ2A 1NR7A 1V6CA 3ENWA 1ST2A 1EUQA 5KO2A 3H97A 1PWHA 5DISB 1JFTA 3I9JA 3SYNA 4WBSA 3AETA 1B2LA 2FJPA 2L42A 3AWIA 3FUTA 2Z43A 1EK5A 2C59A 3L8CA 4QGHA 4TL8A 4CTOA 4F8EA 3K6SB 4EP1A 3PFKA 1Y6FA 1RBMA 3QF4A 4K6FA 2G5TA 4L3WA 5TY0A 3UVEA 1H66A 1O87A 3MWEB 5EEGA 2RC6A 3H0CA 4KXXA 3PWZA 4QYXA 5I9MA 3DZJA 2RG1A 3BWYA 4KU4A 3VYTB 1EFRD 5CVJA 3EK2A 1VE3A 4WW0A 1Z5PA 4BNYA 3Q12A 1BRTA 4H1UA 3M5PA 4MIKA 4TRJA 3H5WA 1YR7A 1EFPB 4I9UA 2HF7A 1R0CA 4DWJA 3U7EB 2A78A 3QFCA 2VF7A 4LTDA 2F48A 4LHWA 1MT0A 4F3YA 1G8JA 1M75A 3KYCA 4U8GA 5IPFA 1V5GA 1N2SA 3JASB 4KFSA 4KO3S 3ZK7A 5LPNA 1RYMA 4ZI7B 3K0EA 1RP1A 1X7WB 3NIFB 3QUBA 4HWSA 4LS3A 1BHJA 1FP1D 2ZYGA 4ZARA 3FPEA 5KDDA 1GPH1 3ZY4A 1ZHOA 4P5DA 1YIOA 4J0JA 3IVMA 3EA5A 3PQ3A 2K5UA 1K8XB 1KS2A 2QYTA 2ZVDA 4H4EA 5A7GA 5REQB 2NPFA 4DSNA 1G5TA 5JD4A 2RI6A 4F71A 3ZIDA 4DRXB 1SHKA 3GT4A 2H92A 5EUQB 1P2SA 2Z57A 4MLPA 1SULA 3NC4A 2AK3A 1ID8A 4G5OA 4Q4JB 1ORHA 4ZZ2A 5ILGA 1KIMA 1VJRA 2C98A 4ESOA 3BHJA 4ZCQA 5C35A 3E27A 2FHSA 3UT5B 3WIUA 1Z6ZA 4FDUA 2GBGA 1UJ2A 3RVMA 1O95A 4Z3OA 1YRBA 3ICQB 2VYND 3SHVA 1ITZA 3TLCA 3X1XA 3MWYW 2DCUA 2W48A 3BMQB 2XWQA 2BCGY 4WPGA 2VL7A 3DKKA 2C5EA 2BD0A 3EHEA 1Y89A 1EFCA 1V4BA 1JZTA 2GPAA 1EVLA 2V74B 2WE7A 1U3VA 1KFJB 1LLQA 2G5GX 1KEVA 1T4CB 4LGCA 2R5FA 1OH8A 3CWZA 2GS9A 3G1WA 3F6EX 3GZJA 4YDSA 4JEIA 4ZEVA 4UNSA 3DMFA 4RVOA 2JHCA 3RBXA 3QWHA 3ND9A 2IF0A 3E3LA 3MTGA 3OE7A 1FFSA 3PNLA 2P4QA 1SXQA 1GT91 3ND7A 4TV8B 4BMXA 5AK3A 4DHEA 3D4NA 4UM5A 3UKDA 3LW8A 4E0BA 4ENTA 3Q6IA 3LXXA 2R48A 1HQDA 3QKIA 4NICA 4G5XA 1XE3A 2IOFA 4NPCA 4YCAA 1FQOA 4ER7A 1T2CA 1G18A 1C1XA 1X74A 2R4UA 3F6YA 3U6BA 1WBDA 2Z9DA 4M1WA 3GNQA 1FTYA 1PKEA 1K89A 2JCVA 1VYVA 2A1IA 4EHDA 2Q6KA 1NBHA 1WMEA 1UT5A 3M1YA 4HADA 4LV5B 1DADA 5IP5A 1FA9A 1W88A 3GRUA 1CRLA 1T0IA 2CCGA 2PX4A 2V5AA 1NJ1A 2UYQA 4H3VA 2WFAA 1FQWA 3O0DA 4TTJA 5DLQC 4JCCA 4EB3A 2ZLBA 4URYR 2GZSA 2C84A 3FSRA 1KAQA 2IXAA 1ZVMA 1G2IA 5TMPA 2GXAA 1EEXB 3N87A 1Y1SA 5BXQC 4U9HS 3V3KA 9LDTA 4UQLA 1D8AA 1A98A 1DAPA 2F1RA 3IAAA 3OT1A 1XEXA 3UBTA 2GZHA 2VDJA 3K1JA 2XE7A 4RPCA 4UBNA 2VHUA 5AJZA 1SUSA 3AEUA 3CN7A 1E9VA 3L7MA 4UJ3A 3TW8B 2Q29A 1IXRC 4EGSA 4L8FA 4EG8A 2NIPA 4Z4HA 5JXJA 2UUAB 1JDVA 1X1SA 1HDZA 2EBUA 2WC1A 1QOQB 2LIPA 4RPLA 5E7MA 1LLUA 4IKEA 2PUEA 1PR5A 3B3GA 2W6NA 3JQFC 3LFUA 4HP8A 1WB5A 5GPBA 4Q4HB 4TL7A 3UJBA 3NUQA 1MO2A 3BIWA 5JCZA 5KKCA 4L6CA 1NVXQ 4DB2A 1Q7BA 2NV2B 2WSLA 4HNAA 1A77A 5A4JA 1PFKA 1U8XX 2CEKA 3V4LA 3LGAA 3I9V1 2R62A 3QF7A 3AVOA 3GFPA 4R05A 4UAVA 3TNLA 5DLEA 1VYHA 1T9BA 3NJ4A 3HLTA 2V7QA 5KAPA 4JI4B 1QKKA 3R41A 3CM0A 3EGDB 1XVIA 5CXQA 3D6FA 1G55A 1JL3A 1VKRA 2ZB2A 2XMZA 3USES 2XDQB 4ZI5A 4CQMB 3F97A 3OM1A 4MJ7A 4EMUA 2YX1A 3P9NA 2XUDA 1PSDA 2Z6VA 1IAQA 4NARA 2VQ3A 1JMVA 2PUWA 4Q02A 2J9ZB 3SM3A 4IDFA 4YMVA 3P0RA 4FE7A 4X1KA 3ROEA 5JQGB 2NUPB 4XFJA 2WTXA 1LV7A 1GRVA 2V0GA 1LSOA 4KITB 3OSUA 1W2GA 3RCBA 2DHRA 2BKXA 2FFBA 2BE9A 3I2HA 4JBYA 2B9EA 3V46A 3B13B 5AUPB 3ENKA 2WVGA 3BICA 3MXOA 5JRZA 1F0KA 1GG2A 1XRSB 2J4CA 2D2XA 2QN6A 3EF0A 5JZ9A 3W6UA 5ERXA 2ZJ5A 1SIUA 4N5IX 3SWWA 5JJLA 4MRNA 1AQYA 1L7VC 2ZJ2A 4BLVA 4F72A 1SUCA 1E9RA 1GGEA 3OHMA 1ULTA 1SG0A 4P7KA 2QTBA 3PF8A 2YYZA 3PWTA 5C34B 2XUIA 2YS7A 3MJCA 4TMYA 4BQPA 4RTRA 4WK2B 1ONOA 3AV3A 1J8YF 5C5EA 5JAUA 1SD2A 3I23A 1L5RA 2H08A 4TUYF 3JRWA 4N6GA 3LUCA 3OZVA 3D6HA 3COPA 2F43A 4XEHA 1VIAA 1DC7A 3SVTA 2D2FA 3I3SR 3KQQA 3U1VA 3ISVA 3FUVA 3ESCA 1T9CA 2VNIA 1XRRA 1USKA 2V7QD 1CZKA 1XD8A 2AOVA 3LT0A 4XSHA 3IKTA 1LPNA 5D2CA 2J9XB 2O3SA 4HRVA 3JD1A 1U3DA 4MV0A 1NG1A 2XGGA 1H4SA 1SBTA 2G6TA 2V7TA 3R3UA 4H7FA 5DNWA 4DR1B 1FBTA 3VRHA 1XLUA 4I2VA 1QGUB 4U2KA 3T15A 1QWSA 5HKAA 1S9DA 2BDEA 2ZAIA 2Q41A 3IOCA 5JPCA 1Q1EA 2YWFA 1Z74A 2HQ1A 4I81A 4TTSA 4Y2JA 1RJDA 3N0TA 3C39A 1LK7A 1NFFA 3P52A 3O3MB 2MHCA 4CKXA 2Q5CA 3I5MA 2JDID 3OZEA 3ABSB 2FUEA 5EWJA 3BFJA 2ONYA 4U2FA 2X8WA 4MO9A 1CFZA 1RQ2A 1IZZA 3W5JA 4AN1A 4P3XA 4BMCA 4BMVA 2NO9A 4JUCA 3O21A 3D2CA 1XZAA 3DDSA 2ZWPA 1FU8A 2H9YA 4U7FA 3RYFA 3MNFA 1SCAA 2CL6X 2J59A 1BJRE 3ID6C 4NPHA 4RIHA 1U3FA 2AOTA 2IPLA 3ED1A 3RAEC 1EQUA 3BILA 4HDKA 1CDZA 1I4DD 4I1OA 1PR4A 1E2FA 4RPIA 4YI5A 5BOSA 1M76A 2JCBA 3KK0A 1H0SA 2DECA 1MVNA 1M2WA 4IRUB 4UJ5A 4AMBA 3FPSA 5JS1A 1GPYA 3L6OO 5LVAA 3WK5A 4S05A 1RVV1 1A7AA 3JWGA 3VYVA 3HGMA 3BTOA 5GY7A 2NQ2C 1S2DA 1X7YB 2O6HA 1DRKA 1XWIA 3ZX4A 3DE1X 4DDKA 1A9SA 4EW3A 4DMFA 3OZ7A 5HF8A 1DTSA 1CJKC 2ZUSA 3QVWA 4D57A 1BSVA 1GFIA 4OK3A 2Y1LA 4Y1EA 1FP2A 1Q6YA 4G6ZA 3RJTA 3VR4D 3NFRA 2Z8YA 1BNCA 5ES3A 3G9ZA 3NH9A 3IXLA 3BJMA 3FTNA 3PP8A 1YAJA 1RMQA 1YQWA 2K2WA 3KLBA 4I5FA 4B09A 3BL8A 2BFFA 1CETA 1XDGA 2YZ2A 1C81A 3C6KA 4OHVA 5IVIA 4WVLA 4L3VA 2HV9A 2YHBA 2DPMA 1NVBA 1KPGA 2WA2A 1IN7A 2JFHA 1U3UA 4D8YA 2QS9A 1OXXK 1SXGA 4GX0A 1ZMOA 3CNQS 4QAQA 2OO3A 1JFRA 3ZVLA 4BTLA 3A3PA 3FCAA 5E6UA 5JJKA 5K0JA 3WB0A 4QOEA 1SQFA 1Y1PA 2Q6LA 1YR2A 2QZSA 4NBTA 1X7ZA 4BNUA 2BRUA 4WBNA 4X65B 3ZBPA 1XEAA 3SOPA 1QH1A 1D1PA 2VOEA 3NBKA 3R7DA 3BPSA 3EGEA 1CY1A 3C5CA 5G0WA 3V1UA 4C0XA 4LMRA 4C4ZA 4CT5A 3KYDB 4AW9A 3TTSA 4YV0A 4GR4A 4M8SA 1KFBB 4EY6A 5IS2A 5EIEA 1G7TA 1II0A 2FB9A 2P2GA 5JI3E 4N76A 3QKRA 2OFFA 2I3AA 3AF4A 3EJ6A 1POXA 2QEQA 4X85A 2EKBA 1Y8RA 4JJ7A 4Y0NA 1WMAA 4CM9A 5KX5B 1V6SA 4I1VA 5KREA 1A4RA 1KYQA 2DY0A 3KQOA 3K9FC 5JW6A 3GMDA 5KSYA 5KBYA 2OP1A 3PVZA 1NMYA 1E3WA 1WTCA 2NPOA 2FOXA 4JC5A 4TXHA 3GR6A 4U2GA 1Z7YA 2I6TA 1NR5A 2IITA 1ETUA 4ZODA 1GTJ1 1A95A 1TL7C 3OE5A 4IRXA 4LZWA 2EDAA 3JAWA 3K0FA 3PI6A 3U9LA 4L4XA 4CBVA 2ZBQA 2NO0A 1GZDA 1EP9A 3D8BA 3I04M 3QWIA 1H5QA 4HLNA 4C6SA 5IU6A 1GITA 4RZXA 3UG6A 2I55A 1K0FA 4RL6A 1K66A 4OG2A 4GPTA 3F9RA 4OHXA 5DN9A 4XX0A 5F5LA 1U9YA 1RRGA 1WD7A 4QVGA 3RW9A 2E4WA 1GOTA 4B2LA 2R00C 3QOWA 3B6JA 9GPBA 1G5RA 2VK2A 3IPYA 3AH8A 3S4YA 2C7RA 4OM7A 5KQLA 2CE7A 1K4YA 3JAKA 1ACMA 1A1SA 4J94A 1EVJA 5CM9C 6YASA 4M0UA 3DF7A 2ZSBA 3L46A 4ZT3A 4EA9A 4EHHA 2AWOA 4GZ3A 2NNWB 3A9CA 4GMFA 5GMOA 1T1EA 3FTQA 4DUPA 1U0NA 3ET4A 3BJIC 4B6QA 4FW8A 4LMPA 3L77A 1JH8A 4RD4A 2ZRAA 3HKBA 1J0BA 1U3CA 2ZI4A 4CG0A 1U5BA 2AEFA 3S2GA 4RVFA 2X23A 4MQUA 1B3BA 1MC8A 1PHPA 2MSWA 3O38A 3TPZA 4C3ZA 4BFZA 4IO1A 1GQSA 5D3ZA 3M70A 2F6RA 2C5LA 2N1BA 1KY4A 4MDYA 2DC1A 1KEEB 4L08A 1BU5A 4LDAA 4E2YA 5A4IS 3L84A 5AVTA 1MTZA 1QRTA 1ZCBA 3SKYA 4YP9A 1W2WB 2G9RA 3G6WA 1NI4B 2PZAA 2FZLA 2VDUE 3H0KA 4K9NA 4M1SA 4YAWA 1K08A 4YAJA 1QAOA 2F8MA 5FA8A 5AUQA 1ODIA 2ID9A 5ICSA 3CUKA 2HLDA 3GJXC 4IOJA 3NIBA 4QUIA 3DLPX 5K1ZA 5CFNA 2V4ZA 4JASB 3A6FA 5K9ZA 1CEYA 5HOEA 4D4HA 5JRJA 5BO5A 3WOVA 1CWUA 1XXHE 3D0OA 4PAOA 3U81A 2X8LA 3WTBA 3UA3A 1E4EA 1H05A 2GPWA 1MF7A 2C4MA 4ZREA 1W36C 3O1HB 5ED4A 4RLHA 1C1YA 2Q28A 3UUGA 1U7WA 1ZH2A 3KB6A 3ZKAA 1HZZA 3ORHA 1OJ7A 1SXHA 4O4LF 3ACBA 3FWPA 4PYNA 1XNHA 2ZPUA 2ZXEA 4WV3A 3T3GA 2W2OA 4KJXA 4LF5B 3W79A 5I3CA 2NZUG 1OC4A 4A92A 1ZEMA 4F3NA 3QOYA 5FTLA 1XEWY 3HA2A 4A6XA 4E94A 1Y3HA 1HDCA 4A0GA 1Z6YA 5IVPA 4B3SB 1QM5A 3SHWA 4QX6A 3KB1A 3JD3A 4BEVA 1HSOA 1OXBB 1CR2A 1U2DA 5BP7A 2P2DA 1BW9B 3HDTA 4LTNA 2F1JA 3ONNA 4FFDA 3GT3A 1E2NA 2XPCA 5BSWA 1WX1A 3T5GA 5AW2A 4QJ4A 2BBOA 2VSXA 3PNOA 4HXGA 2IYLD 3COJA 3PQCA 1JU3A 4XYEA 1JWBB 4LZNA 3HWWA 2OQIA 3QVVA 2R96A 4OLFA 2GM9A 1XMQB 4X97A 1YQEA 1KAGA 1H94A 2V4UA 3MTDA 3STUA 4OQNA 1YRQA 1ABFA 5KOIA 4JYZA 3C3DA 1OA0A 1W85B 3VUEA 3R6DA 1DKPA 4BNWA 1JHYA 4J90A 3BA1A 2GZMA 1D2RA 2ZRBA 5BN4B 4BC0A 3K8YA 2X19A 1QIKA 1CF4A 1DV2A 4IINA 3OPYI 5AM0A 5CPFA 4OP3A 5ITVA 3H8WA 4WNIA 4CIXA 5HDBB 1MR3F 3A1FA 3N2ZB 3QE0A 2ONZA 3TQCA 1L7OA 2YNMA 2XKBA 1NONA 3MWJA 4IMJB