3EEFA

Crystal structure of n-carbamoylsarcosine amidase from thermoplasma acidophilum
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
173
structure length
173
Chain Sequence
b'MKPALVVVDMVNEFIHGRLATPEAMKTVGPARKVIETFRRSGLPVVYVNDSHYPDDPEIRIWGRHSMKGDDGSEVIDEIRPSAGDYVLEKHAYSGFYGTNLDMILRANGIDTVVLIGLDADICVRHTAADALYRNYRIIVVEDAVAARIDPNWKDYFTRVYGATVKRSDEIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-carbamoylsarcosine amidase related protein
publication title Crystal structure and molecular modeling study of N-carbamoylsarcosine amidase Ta0454 from Thermoplasma acidophilum.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 58
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 3.5.1.59: N-carbamoylsarcosine amidase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3eefA00
1IM5A 1YACA 3IRVA 4L07A 1X9GA 3V8EA 2H0RA 1NF8A 4WGFA 1XN4A 2B34A 3TB4A 3HU5A 1ILWA 4WH0A 3PL1A 2A67A 3S2SA 3R77A 4L08A 2FQ1A 1NF9A 1NBAA 3O93A 3UAOA 3TG2A 1YZVA 3OQPA 3R2JA 3MCWA 3EEFA 4H17A 3OT4A 3HB7A 3KL2A 1J2RA 2WT9A 3O90A 3O91A 3O94A 3LQYA 3O92A 2WTAA 3TXYA
chains in the Genus database with same CATH superfamily
1IN1A 3JQCA 2YZMA 1QF9A 3QIVA 3WHPA 5KKAA 2HBYA 2O1SA 5ETJA 3PCTA 1UDCA 3VX3A 2HF2A 1OLXA 3NTOA 4M76B 3GDWA 4L8FA 3I8SA 1A82A 7MDHA 5K0TA 3ZU5A 4CKCB 2DHDA 4NZMA 5JS8A 4E94A 3TQQA 3VYVA 4OV6B 2L69A 2B99A 5EJ6A 1MABB 1CYEA 4B0PA 3AILA 5JPIA 1KK0A 2ZU6A 2VL7A 3CKMA 3K2QA 3ZK9A 3B85A 3D7MA 1EX1A 2F48A 4II3A 1XMVA 1SEVA 3O94A 4RA6A 3A6EA 1R15A 3C7TA 5KHOC 4C0BA 2J33A 4MCHA 1X70A 5A0TA 1ZS9A 2YXBA 3CC8A 4PR0A 1CZNA 4ETIA 3L0PA 1PL0A 1J22A 3W34A 1P9NA 1KK2A 2AK3A 1NLYA 3OJEA 4V3CA 1W36D 4QOHA 1VPTA 3K72B 1BXZA 3JCZA 3LGXA 3KXPA 4N5MA 4QX6A 2HREA 1TJ4A 4WUTA 5F78A 2A33A 3W77A 3QV1A 2LKCA 4BGDA 1QGZA 3I28A 5HXAA 1LVUA 2WICA 3CKKA 4YRBA 2QSUA 4HAZA 2NLOA 4FONA 2FPPB 2YC2C 3C6KA 3QNUA 1ZC3A 3G7UA 4ZV4A 2WYWA 1JDJA 3V4OA 1QBGA 4JJFA 5EE1A 2PR7A 4Z8XA 4FIDA 4OQZA 4B71A 2QJWA 4MSUA 2QTVB 2RIPA 2RHGB 1MVLA 3IAFA 3MOSA 1XI2A 4I1IA 2C9YA 4MLPA 3LG2A 4NBLA 4RMHA 4DEVA 5FBVB 2ZCUA 3JQQA 1GGNA 1K7SN 5ECWA 5T41A 1ISSA 1IJBA 5JCPA 1WVGA 3DVAA 3DZJA 1AQUA 1WCV1 1GNRA 1XQ6A 1ZVJA 1XAGA 1MQSA 1RWPA 4K7JA 4L85A 4CUKA 4H4EA 5B3JA 3HACA 3C6BA 4HEA1 2R6FA 1JKFA 2XXAA 1BYUA 1C3LA 2VNAA 3WB9A 1FRZA 2EIHA 2NPOA 4H7HA 1PGOA 5J1TB 3D3WA 4Z53A 1WA5A 3MELA 2WDPA 5EVJA 2WE7A 3RT9A 3RU2A 5B6PA 1SBYA 1V0JA 2WUEA 2CT8A 4JR1A 5B1DA 3VPBA 4E2WA 3GFPA 2ZUFA 4NU6A 2ASVA 4PW0A 2E4VA 3H1FA 1B73A 3PXAA 3K09C 4CIAA 4X71A 3OTHA 3QY9A 1EIZA 3R0XA 1LTHR 1V48A 2QYHA 4YJKA 1N57A 2CMHA 2J30A 4DUPA 2DUJA 1N2XA 1P2TA 2P2YA 3I23A 5FWDA 4DZRA 2CXTA 4GPIB 1AHHA 1ZBDA 2I22A 2BPOA 3TK1A 5KTSA 1T1EA 3QXXA 1L8LA 2P9TA 4YRGA 4NMLA 3CLHA 3DPIA 4P3YA 4EHAA 1T8YA 5COQA 2FP4B 1VPLA 1DX9A 5IU6A 1KEEA 2BP7B 3D8RA 4KXWA 4TZTA 4BPBA 2JCSA 5DBOA 2I0FA 4WA7A 2X3FA 1GILA 5J5CA 1AU9A 1QF7A 3GJ7A 3RIHA 2CYCA 3OZBA 2XIQA 4Q7LA 4AUNA 1KS2A 4EKNB 2G7MC 1AKUA 2D7JA 3OFSA 3PQ8A 1G20E 4LDJA 2ATXA 4J0QA 2RH5A 1ZK4A 2QTWB 4RD6A 1WV1A 2C9DA 3B5IA 3FNHA 3L4BC 3FJYA 2GZMA 2JAHA 1E3MA 1KMHA 4LOIA 5AKJA 1NF8A 4MCIA 1CZLA 4XX1A 3ZTYA 1GSIA 4A27A 1NYLA 2OC9A 1ZVMA 4OLJA 3WOHA 2Z3WA 3T12A 1TVMA 2QRQA 2XNDA 3GDFA 3OE7A 5CX1A 3V7NA 2CBGA 4HRYA 4BNKA 3OPYI 1P1RA 1U0LA 2PMEA 5G02A 3GEBA 4Q4HB 2BKXA 1T29A 3CH5A 4Z9YA 5J3JA 4NE9A 3UYLA 1PUXA 4TXMA 1NTRA 3A26A 3TJZA 1U1GA 3PU6A 4BY9E 3O8QB 2HTFA 4BP1A 5K8VA 4HL6A 4UU8A 2IUYA 3C8MA 4ZCTA 5IT4A 4YS6A 1MAWA 4KMOA 1X7GA 4KYUA 4Q3DA 4TRRA 4C0KA 2A58A 1HOTA 2Q8QA 2G6BA 4K6MA 4CKEB 4LXIA 3HXTA 1HK7A 1KEZA 5EQFA 1QS0B 1ZYUA 2BHRA 2QR2A 3L1VA 4R69A 3CCCA 3HYLA 5F1YA 3GRPA 5MGNA 3U61B 3OFKA 4MP3A 3ER8A 3PFIA 3R3YA 3U3MA 4XIGS 2NG1A 4GXNA 1SZCA 4REQA 1ZH8A 1AQ6A 4LBWA 1XO1A 4N7MA 2ANBA 3HWWA 4HRXA 2M6RA 4NPAA 4G8BA 4N54A 3IUNA 4ZAXA 1HEUA 3ZWYA 2WHEA 2CY0A 4ZXPA 1JAIA 1ZNZA 2CLOB 3EEQA 5AVWA 4M49A 3DDUA 1Y1KE 3MRVA 3S2UA 1DKLA 2VF5X 3BYZA 3IXQA 3MYYA 4S0XA 4UVGA 2E1PA 3RRFA 5GINE 1CHNA 1DO0A 2RK6A 5DM70 1QLJA 4PCLA 4Z9XA 1LH0A 1ML3A 1PG0A 2CHUA 2H5JA 1HTWA 2YXEA 3CINA 4GGOA 2PT7A 4KWCA 5DTIA 3D7SA 1YQEA 1PV4A 2BEVB 3ICCA 1OYVA 4L0DA 4C29A 5ICSA 3GMSA 3OA2A 5COAA 3B3FA 2YV2A 3JU3A 2ZE8A 1IG3A 5BRJA 2PBRA 1JQEA 1K5GA 4ZEXA 2PUFA 1ZEMA 2FXIA 5JAOA 2CCKA 2IV3A 2WJVA 2JGIA 2FZEA 1CX9B 2GI4A 3FWHA 1GL9B 3ZWMA 2PO5A 5M2QA 5C18A 2QBYA 3T7DA 1YDEA 1ZD5A 4IUYA 4FHEA 1H05A 1RM3A 3OOSA 4TTRA 2R6HA 1B0UA 1FLAA 1Q92A 2A3RA 2Q2QA 5ALJA 4CIBA 4TYNA 9ATCA 4EHKA 4LF9B 2I4IA 1SKQA 2I1WA 2QORA 5CVEA 2X8BA 3IA2A 3KDSE 1TD9A 2CLDX 1QH1B 3QPVA 4LNAA 4XARA 3UXYA 4UBMA 4BNUA 4DHEA 3R7WB 5EPUA 2ZYUX 2YMLA 5JMPA 4E46A 3IUBA 2XA2A 4R01A 1ESMA 2CLMB 1LX7A 4DSTA 1H2BA 3GJ6A 4WNAB 3N3AC 3GLQA 1L7QA 1TUBB 1ZMTA 4D4KA 1T36A 2D5IA 3CO0S 3I3OA 1E2DA 4ZZ2A 1NWHA 1VLVA 3PD7A 3CHYA 2XOKA 3PT5A 4WCDA 4HEQA 2GJ9A 4HLNA 2XWPA 3ST7A 4JEIA 2QZ9A 1H8EA 1B3RA 5HUJA 1XVTA 3MINA 1LSSA 4P92A 3OT4A 1M34A 1NVMB 1RBMA 4Q3OA 2BM9A 3AF2A 1NP6A 4JLOA 5KX5B 2UUBB 4MUIA 2D1FA 3MHTA 1CR0A 2GD6A 4KGZA 2OGSA 3MZ0A 3WQBA 3OT1A 2CBZA 1U2DC 4YRMA 1J8VA 1OZGA 3H1PA 4IIJB 1QAOA 4IRUB 1OH8A 3H0EA 1ZD3A 3DB2A 4W1SA 3QSYA 1P2SA 3AP2A 1U2ZA 3QLVC 4XFKA 4D3XA 4DG8A 1P33A 1EA7A 2VJBA 1VSUA 3VVLA 5E1OA 1Y0BA 2HLNA 4EYSA 1E20A 4O4HA 4A2PA 4A82A 3HKDA 3LBYA 4X1YA 1XKXA 5F2OA 5JSKA 4CZ2A 4E2FA 5A3SA 2OCBA 2VDKB 1RWNA 2J59A 1A5SB 1GT91 4Z7JA 1E61A 5A9SA 4KWIA 1PQPA 3MAAC 2O0KA 3OI7A 5KREA 3J7TA 1MENA 2JA1A 4KRFA 4G0XA 5KSZA 3H97A 4G23A 3WTBA 1IK4A 2HPAA 2ZSUA 1PR4A 4MWCA 3IR6A 4TS1A 5H81A 2AZXA 2G07A 4I4IA 1KMNA 4F2WA 4E7PA 3CLSC 2GK3A 4FDAA 1F2UA 4TYPA 4PZPA 1H4VB 3AO0B 1FXWA 2RK4A 4CLDA 2RHTA 4OP2A 2F3TA 3DV0B 2BFDA 4R81A 4N6OA 3L0BA 3D7KA 1VL2A 3URMA 2HY7A 3T1OA 5B58C 1RXIA 1BW9A 1O6CA 1VBKA 1NASA 3OKAA 2AG1A 4MOWA 3RFVA 3AZPA 3Q3VA 2VN8A 1HFWA 1GL3A 3F8WA 3KUCA 3C70A 3RE1A 5E8JA 1M9NA 4FCWA 1A9XB 4A8TA 4FPXA 2EAUA 3PFNA 3ZWVA 4ME6A 4HAXA 4NJMB 3RC9A 4CM7A 4XVQA 1WSDA 2RHOA 3SIRA 1UZLA 3CUYA 3OZDA 1ST3A 2V0GA 1FFHA 4LYGA 1NBHA 4HEA6 4J0FA 4MO9A 4NFLA 3I9V1 4IDCA 3IAXA 3NHUA 1NY5A 1RWVA 1EUZA 2GNOA 2YV3A 2ZWPA 3Q7QA 4GOXA 2OZKA 3C3YA 5FBZA 1YS9A 2J45A 3O4VA 3UM9A 1YMUA 4S1OA 3EVBA 1N3IA 4F2HA 1IZ7A 5JATA 2RHDA 5JSQA 1CRLA 1Q7BA 2H1HA 3KOWA 4QNNA 4BJ3A 1DHTA 2IQ5A 2QDKA 1YA6A 1CRPA 4RCYA 1VHDA 3C4QA 3OKCA 4MUYA 2PD4A 3NJRA 1EFKA 4KQIA 1PTJC 4TWBA 4LX0A 3AEUA 3TPZA 4LTNA 1R6AA 4JOSA 3O90A 1H8HA 2VRBA 1WNFA 2Q1XA 5I9SA 4D8TA 4GL4A 2IYFA 4KIFA 4ZODA 4F5WA 3AFHA 4KDFA 3VO1A 5J2UA 2VHZA 1U7UA 2SKDA 1QQ5A 3L9WA 4OAPA 4B44A 3THXA 1BWQA 1RJGA 2JFQA 5JXIA 3KUUA 2GEBA 3PHGA 5J59A 4WBNB 1W2HA 4MMZB 4F93B 1QDLB 2ZRPA 4AQYB 1KDOA 4FJ1A 5E9AA 1N5KA 4M8NE 4UUPA 1ZUNA 2JAOA 2XBLA 4UEOA 5CDHA 1V9CA 2IUTA 2V7QD 3TLMA 3D4LA 3PGXA 1Z13A 3TIXB 4JQSA 1OC4A 1G8AA 1N3BA 2QLJA 4RY2A 4MEAA 5JPDA 3F98A 3HCFA 1B7GO 2AFRA 1H9BA 1NHGA 1WE2A 4HUQB 4EW2A 3A1FA 1MV8A 4V02A 2FCRA 5EHIA 3F8SA 2ID9A 1VJDA 1IBRA 2EF0A 4ZGBA 4DR3B 4ND8A 1FMFA 3BC1A 3WJ7A 4PZZA 2BKAA 1AZWA 2YOHA 3OZRA 3DMFA 4J0KA 1U7DA 2WNIA 3K0EA 3VAAA 4A5OA 4HMQA 5CB6A 1XPOA 3JQ6A 2IY9A 2CMKA 2Z6AA 5IFKA 3ZBTA 2CXHA 2Q3FA 3GZTB 5A7HA 3G5UA 3JR7A 2Z1NA 4J91A 1DV1A 3K35A 4U9HS 4EHDA 4HD8A 3VU9B 3LA8A 4V0ME 4BB6A 5AJXA 3CTPA 5IJAA 2K87A 5JVDB 4UQLA 5I7UA 2PEZA 2Z2XA 4QPCA 4CW7A 5KQMA 5AJWA 3O4HA 1RHKA 2ZTMA 4I50A 4BKRA 3T4UA 2VS1A 3GG2A 1G0NA 3MHPA 4DCNA 5FUYA 3OOEA 2PX3A 3KBOA 2DQSA 4FR0A 4TKUA 4B2YA 1SZDA 1YI1A 4Q9LA 2YHIA 1W76A 1R2QA 1J6UA 4Q18A 1R0XA 3D7LA 3E15A 4Y98A 1O7JA 3DFMA 4UZFA 4XQ0A 3KOYA 4WOCA 4YJFB 4IDQA 4HAOA 3ACBA 5AW8A 4JC0A 2P6OA 1XJWA 5FL7D 4O1IA 3PKZA 3TR6A 1A8PA 2GNAA 4F6LA 5BPHA 2A0UA 2YUIA 4WDQA 1BCSB 2BFOA 3OFNA 3MTBA 4OJMX 1WY7A 3L0OA 1QHEA 4FMCB 3RD5A 4AMYA 1P7YA 2P0AA 2IYVA 2VDLB 2GEJA 4ZYTA 3IVMA 5BN5B 4RHYA 2FMKA 5A0FA 4AZTA 3O2NA 3KE8A 4PS1A 2B36A 5BNWA 2NX2A 1IJEA 1K5DA 1R4MB 5FH9A 5FADA 4CE6A 4E5NA 4YIHA 3ENVA 3Q10A 1REQA 3NWBA 3F47A 4IIHA 2HWWA 4UATA 1S7CA 1JPJA 1A4UA 2CNOA 4W7HA 4YNBA 1BTOA 4Y1GA 1Z0UA 4LCBA 5ALTA 1RCUA 3B1ZA 2CLEB 4IS2A 3D4BA 2EFCB 3IOBA 1GTZA 2ZJ0A 4WIAA 5HKKD 1COWD 1GGHA 2WT9A 3QE9Y 2QDXA 1RQNA 2HMVA 4N3BA 4DSAA 3NIBA 5KPJA 4HTFB 1DZ3A 1E3QA 1JVNA 2Z2JA 2JL1A 3HJHA 2ZIUB 4L8WB 3LI2A 4QTZA 2MINA 1LFAA 4V2UA 3WK6A 4ITUA 5JRJA 3DBLA 4M1WA 5H3CA 1JWAB 4F3NA 5LZ5A 3T1HB 4LF8B 3ETNA 4FMCF 3M5PA 1QDUA 2O3TA 3PRYA 3E84A 2PJRA 2PUEA 2LIPA 3GMTA 1RWKA 3DULA 3OMXA 1EM8B 2QTNA 4OAQA 4BFCA 1P19A 5C32A 1RRKA 4OXKA 3QEBZ 3WMGA 3N0RA 3U7RA 2G4VA 1CY4A 2DTXA 2TMYA 4QBIA 2XE7A 3I2KA 5ALHA 3VNQA 1PG5A 1YQQA 3MXOA 4H35A 4HNAA 4B32A 4R1LA 1PJBA 4XWOA 5AJUA 2B35A 3VSEA 4H77A 2XWBF 5CB0A 3EOZA 3NH9A 3TINA 2ZQZA 3FHLA 4RORA 1WXGA 5JFOA 2OUKA 3L0CA 4U7FA 1YDHA 4DNFA 1QB7A 4PVCA 3LT0A 3GLUA 3DLBA 1JJ7A 1QYDA 3LHKA 4D9MA 3ITNA 3O75A 4ER3A 1CF4A 1EP9A 3WLNA 2VSFA 2O07A 1DIAA 3MGBA 2HQOA 3N6RA 2DXIA 3BMQA 2G1PA 1B8VA 5LXTF 3THRA 3FPJA 1VJGA 5CDUA 2O2IA 3OKPA 4A8JC 1EJ0A 4OJTA 1XZNA 1YVUA 4B84A 4TYYA 4QA9A 2OO7A 2QL5A 4PE5B 3QMVA 3ZDEA 4KGXA 3U4IA 1VP9A 5CYGA 3UFXA 1EXNA 1M2VA 3LBIA 1VGRA 3GXOA 1D7OA 1E66A 4OYYA 2L0XA 3D8BA 4AZ0B 4BNGA 3CX3A 4MHTA 1T8PA 2QUIA 2UZIR 4NQZA 4ZVNA 1JFTA 3H2GA 4EG0A 1JFFB 3OD5A 5IJZA 3OE1A 1R66A 1GRRA 2QGNA 3T5GA 4B17A 1QKKA 3RC2A 1WS6A 2C2GA 2O23A 5ESXA 3DKPA 3W90A 2CYAA 3PF9A 4LDZA 5PNTA 4DPLA 4V03A 1VCMA 2ZVJA 3DE3X 2XVAA 3L2OB 4F96A 1NX6A 5F3WB 1JXMA 4KYVA 4KR6A 4MQMA 2GN4A 4K6GA 2GX6A 4D2IA 1GDHA 2AX4A 5EXDA 3RROA 4BLVA 3RO7A 1KRXA 4HTAA 3AXTA 4KKVA 3KQKA 1DRJA 3WYNA 1VDZA 1GWNA 2F59A 1KY2A 1KAMA 3KQSA 4L9RA 4W99A 4NJEB 4EARA 2O7VA 4P93A 1FTWA 1KBQA 2Q4RA 4X63A 3NB0A 1MO2A 4B2PA 5G3ZA 1NFFA 3U4MA 4RWZA 3K1AB 3ELBA 1T35A 1ZAKA 4LMAA 4YDQA 5ICMA 4DMFA 4M1SA 4DC1A 3L0ZA 2NUTB 1C7QA 2GZHA 3R44A 4HGQA 5DHFA 2XMSA 2Q6TA 4KR9A 2R44A 3P19A 3SICE 3HVUA 5KBYA 1GXSA 3IPYA 3KB1A 2Q1UA 3WRVA 4UD6A 2HEIA 2EKPA 3I9FA 2FY8A 3JVUA 3RB8A 3ZDFA 5C1BA 3HU2A 3GJYA 2KYRA 4TV8B 1PZFA 2IHNA 2SKCA 5D2CA 3A27A 3ETJA 1K7CA 3KOUA 4MYCA 2GM9A 5FIUA 3WMWA 3N39C 1U8UA 1XNHA 3BQNB 1RWWA 4NAHA 5CUQA 5IS2A 3O73A 3ISVA 3G68A 1R4AA 1JDBB 2O3JA 3KZ1E 4OMFG 3CF2A 5D5HA 1Y82A 3V42A 4Z49A 1QTNA 3H5WA 3GGOA 2YY5A 5DBGA 2O5CA 3VKGA 4MW0A 2W8BA 2HF7A 3M82A 1Q2XA 5GPBA 1OFUX 4JGIA 5EUMA 4ENVA 5BYJA 2RGNA 3IBSA 5KVQA 4LJKA 1FMJA 3VTZA 4BQQA 3T4XA 4W5TA 3GA5A 3C7KA 4EKYA 5CK4A 1J2TA 4Q3KA 3TNJA 4AP6A 3D8SA 3P26A 1H2XA 5HIIA 3AUUA 1P7PA 4INJA 4QU5A 1HTTA 3VM6A 3V8RA 2QTZA 1U6JA 3U9SA 4CQJA 4HFMA 5BN3A 4RGYA 5DVZA 4YCCA 1XZJA 2IDMA 4IOLA 5L3QB 3VNSA 2X22A 4DG5A 1NDQA 4BVJA 4G4SO 4HAVA 2JK1A 2CVQA 2IYUA 2X9VA 2R8RA 1YZHA 2QTBA 3M4XA 3PE6A 5LA6B 3UMJA 3FKJA 2IZ1A 4OHPA 3K6SA 2JGRA 3D9QX 2Y1KA 1DBIA 1W35A 2EGUA 1P0CA 3CCBA 1ZOOA 1TIPA 2RAVA 3FNGA 2IW1A 1J0EA 3BD7A 3OU2A 2WLTA 2ZM6B 1Q77A 1U1DA 3IKLA 4TV9B 4CDGA 4DM3A 4I4CA 1P0FA 3LUPA 4L4YA 1G3MA 1JTEA 1KH2A 1U2QA 2II6A 4KR2A 3CWZA 4RY0A 2E82A 2OCXA 3LH5A 3G1UA 4ZP1A 1EVLA 5BYKA 2IGTA 2VA9A 3AK4A 5JY6A 1FA9A 1JXOA 3SN6A 1JR3A 2PMWB 1WSAA 2Z0MA 5KSPA 4QYMA 1DWOA 3HJUA 3OZGA 4G4GA 2YXLA 3DA8A 2NPIA 3H7IA 2HRDA 2UVDA 2IKQA 1VG8A 3QLJA 4G8JA 4MJ3A 5B3LA 4CL0A 4N3NA 3O83A 4K0KB 1H9CA 3CZ9A 1AUVA 4OY3A 3TZEA 5A9RA 3C16C 4BTLA 1VA5A 3CUSA 3EGXB 3MS2A 4L9WA 4I19A 1ETHA 2MSEB 3BUSA 4INPA 1FP7A 3QK7A 2G70A 3VNVA 4GZ6A 1ELOA 1RJEA 4IXDA 3RGGA 3VYSB 4L6CA 2QGZA 4E5MA 5LBUA 3I0ZA 4LC9A 4TWJA 5KMGA 1RCTE 1MH9A 4R8KA 4H3HB 4KSYA 1TJ3A 3U4AA 4BX8A 3UMGA 4BLRA 2AFIB 3C8DA 3FWNA 2G4LA 4WEQA 1FX1A 5I8WA 1DOHA 1GUAA 1IUKA 1R6VA 2VUIB 1KAGA 2ZAYA 4QG7A 4YDHB 3WGIA 3H13A 4S1NA 1ES9A 3DNFA 2OBLA 5AM0A 2G9VA 3DVQX 3A06A 3BJRA 5DULA 1C4WA 1HKHA 5IC4A 4F3RA 1YXMA 2J3DA 2ZRIA 5CHEA 1PGJA 2Q9UA 3PIIA 5EKTA 1E2KA 3DR5A 2G72A 4K3VA 1DQPA 3BB3A 4JYZA 3NOXA 1IPHA 6LDHA 3DF7A 3G9XA 4REMA 1FPQA 2Q41A 3G9ZA 2P11A 4N6GA 4P33A 3KO8A 1W47A 2XUGA 3O82A 2GSDA 4J0EA 3E70C 3ZK8A 1P77A 3D6NB 4HQFA 4UTXA 3U17A 1L7EA 1MEJA 1KQ3A 1R0SA 3K30A 3PXEA 4GSKA 2ZRGA 4FYIA 5EXTA 4BMZA 1SHLA 3AWIA 5HTKA 3CRMA 4XWWA 3A31A 1AM4D 3GRRA 1B1CA 3WBBA 2HU5A 4B8ZA 2RBGA 1SH7A 5EIHA 4ZYLA 5JI3E 1ODTC 2REQB 3RFTA 3LY9A 3DH0A 1ONBA 2ZE7A 1E2NA 4OGLA 1WLSA 3CISA 2JBAA 4NDZA 1QG4A 1E2MA 1OPRA 1GAQA 3O8DA 4DLPA 3I04M 3OHMA 2JD1A 5DHUA 5IDYA 2XI4A 1W4CA 4LMRA 4X7PA 1QAMA 2LP4Y 4II7A 3AOGA 3MWEA 5CVDA 5EUQB 3W06A 4AS2A 4D8UA 5C5DA 2FWAA 4RL6A 4G97A 4CIVA 1JPVA 4MZDA 2CLFB 2FOXA 3ZXSA 2O8BA 2LW7A 3ROMA 1Q1GA 4GICA 5BN4B 2R6DA 1GNPA 2ZOSA 4B7UA 2PUAA 5TMDA 4IXTA 3HRIA 1UINA 1T8TA 3FDZA 3IQDB 3JYOA 1WW2A 4O2LA 1JILA 3P5SA 4DIUA 4DLYA 1F9EA 3SU8A 1I0LA 3TJRA 1CQXA 4PNZA 4AJKA 1Y6FA 1BRTA 1G55A 2DPLA 3N0WA 3KZOA 4G8CA 4DY4A 1D1PA 4EGJA 4DKJA 4MDFA 1SQFA 4URWR 4Z1MA 4IJ5A 1ESEA 1NMYA 1ADFA 2PT6A 4G63A 3AKEA 3WFIA 2FSFA 3Q3HA 3EB9A 5C80A 1GG2A 1MU0A 3BHMA 5JMWA 4R2MA 1RWBA 1T9GR 2QQ0A 2JANA 3TI7A 5JYDA 3A4LA 3SAJA 3GUUA 3QF7A 5EIBD 1Q20A 2DVMA 3GLFA 1U4NA 2G63A 3L8MA 5JSHA 1HEIA 5CVTA 4EHIA 3HBFA 3HNOA 5FXMA 4GIBA 4PO1A 4QPZA 4RMJA 1SC3A 2FSGA 5CPFA 3AL3A 4FDMA 2J9FA 2UYQA 3RK0A 1BS1A 3ZW9A 1RYHA 4BMNA 5CFNA 1FLVA 2VLBA 1IB6A 4BO4A 2CN1A 1E3LA 4ZD6A 4C43A 3IAAA 2VJLA 5LYJF 1U0HC 1JWBB 3JYQA 1GU0A 1U3GA 5ENDA 1WQ1R 4OQQA 1N33B 1Y33E 3QLUC 4PAOA 3H5NA 4LHYA 1XXLA 4HDNA 2IXDA 3CRQA 1X38A 4GDFA 4HB3A 2EKBA 3DW3X 4BVFA 4JYMA 3LPLA 2GFHA 1UJBA 4OOEA 4K6CA 4ISCA 4Q9JA 4PXAA 3T9AA 4DMMA 3TVDA 2AT1A 4U6QA 4L22A 1Z4KA 3BXEA 2ZYHA 2W6ZA 3TN7A 4QJ4A 2FX2A 3W2EA 1R0KA 4DSNA 1H66A 2H18A 5CBKA 2WB4A 2PSSA 3LXMA 3R5XA 5KYYB 1NMQA 1WB5A 4MRAA 2EEZA 2V59A 3C85A 4DJDC 2Q3DA 1TYCA 2Y1EA 2XT6A 3VR5A 1AC5A 3B52X 3EISA 4WOPA 1VB3A 3BTUA 2XOEA 5BSUA 4RJLA 4QBHA 3HDQA 2W2VA 1WU8A 5AT1A 5FYQA 5A2QA 1OYYA 1V1JA 2E49A 3M2PA 3QFFA 1Z4QA 3VU1A 4EQ6A 1UMDB 5JCOC 3DOFA 4JR0A 3WGGA 4BS9A 3IE2A 4OHYA 4B48A 2R7KA 3EMVA 3GJTA 3JQBC 6REQB 2XB8A 1Z8FA 4Y9DA 5EPEA 3V2GA 2IX9A 2KBFA 4M9UA 3Q72A 1X1DA 4X54A 1MHPA 3AG6A 5MDHA 4K28A 3ZY2A 2B1IA 2QP3A 3FVVA 3IV6A 1LQUA 3KBBA 2BOVA 4BZPA 2HLDD 3V4ZA 1RP7A 3EYWA 3LYLA 3N8DA 1Z37A 1H23A 3IDSA 3V8NA 3ZHSA 4CLRA 1BO6A 3Q7SA 5TMBA 2W4IA 1KJ8A 4NCAA 2B5WA 1M1YA 2WYVA 3BB4A 4WXRA 2I4OA 5AM1A 5ILQA 3ZLBA 4ALLA 3NAQA 4D57A 3F97A 1MAHA 2QN1A 2B30A 3USES 4Y1RB 4TUYB 3FZYA 4V0SA 4MV5A 3COYA 2ZPUA 4QBGB 2Z3ZA 4R5MA 1Z6YA 1W85A 3E18A 1Z8NA 3GCWA 1IBLB 2NTVA 3UPUA 2P6PA 4R41A 1K8YB 3OY2A 3JAKB 2FUG6 3N2LA 3ZOKA 5IC5A 1HYQA 4PG6A 3N7TA 1SB8A 3K0AB 4OU5A 1CB0A 4XW2A 4QUDA 2VEOA 2DY0A 3SHFA 3T3IA 5KJCA 2VT7A 3PQ4A 5ELXA 1IIBA 1IN5A 4R2WA 2A9FA 3L77A 4ZARA 3BWCA 2W2OA 3GJRA 4BU0A 3QPAA 3ZWOA 2X5OA 4FR2A 3WLMA 1J1IA 5CNJA 2VDRB 2IP4A 3V8QA 1C9EA 3LYUA 1LDBA 1ZVVA 4U8GA 4KWEA 4W63A 1SAYA 1TEVA 3V2HA 1ENZA 3OG9A 2FW9A 4KOAA 4FNGA 4D9FA 4H08A 4DB4A 1EG2A 1G3UA 2NAFA 1O8BA 4MW1A 4D9KA 1NPDA 4ZJYA 4M8SA 1R88A 2OBXA 3OO1A 2C61A 4YRCA 1C14A 1G3QA 1U8AA 3IIKA 3CLRC 1P7ZA 1VIAA 1LW6E 1BMFD 3GT4A 4XPIA 3KVOA 1JL3A 2ODQA 2HA7A 1TYZA 2H3HA 1AIPA 1LSJA 1VYUA 3KALA 1Y5RA 4TMTA 4L73A 3W5CA 3B8EA 2J3QA 5KI6A 3TRDA 4F5DA 1BEEA 2AXNA 3H84A 4DBZA 4DMKA 4HADA 3MT8A 1RYNA 2XWJI 3QMWA 3FSRA 3HC7A 4JR2A 5CYFA 2KS6A 2Q7OE 4E5UA 1L7DA 2QRNA 1QCZA 4GAEA 4GF5A 3QEAZ 3B6KA 3NBQA 1SQ0A 2NAPA 2I7CA 2AG8A 4R31A 4IVPA 2XECA 4C89A 1EWQA 1P81A 1KOJA 5EIEA 5TX7A 3GGJA 3NRBA 3D7NA 4RKQA 1NVVR 4FTWA 4M21A 4Y18A 4YDRA 1V2HE 3V7WA 1YB6A 2HXYA 1PW5A 1D8TA 1KWKA 4I8IA 4UDOA 1QANA 1VMAA 3SF0A 2BFCA 3MK31 3VV2A 3BORA 3QRWA 4UEWA 5HA5A 2IYWA 2WSSA 4GGPA 1SIUA 3N2EA 4KPFC 5A03A 2WTBA 4K03A 4LZNA 4EO4A 3VYUB 2DUUA 2XE6A 4E6EA 1ADBA 3PQEA 1O58A 3TRHA 3MM4A 4MVWA 1NSTA 4FYPA 4RGQA 4XFDA 5JV5A 4ARBA 1OGIA 1MO5A 1IPEA 2X4LA 3W8EA 2YJ4A 1N3LA 2AA3A 3K9QO 1T3GA 1IG0A 2X15A 2BZ0A 4FDVA 4G85A 4QU9A 1Q3KA 2E4WA 3WDLA 3GNTA 3KSBC 1F2DA 3GLIA 4FFRA 2OFPA 3D2LA 4JC4A 4MIYA 4WLOA 3RYHA 4A23A 4X61A 1T2DA 1TYBE 1A2OA 3VR2A 5KQLA 3L8CA 1QE0A 1HORA 2ADOA 2AZMA 4AN1A 2BR4A 1KKLA 2FPUA 1L4NA 3X1WA 1NKVA 2JEYA 3OTGA 4TPKA 4CMIB 1HV8A 1OLSB 5FBKA 5FLYA 3COZA 5K7SA 2JJ1A 2Z5GA 2KE5A 1NAHA 1ZGJA 5I5EA 1O87A 2XZPA 4GRAA 5K51A 2ZT6A 1P0MA 3EPJA 1ZGAA 3W9YA 4LYYA 3PDUA 4Y0VA 5LXTA 1GTRA 2FDCA 2ZITA 5DIFA 4ZI5A 5FHRA 2C5FA 2Z5FA 2YQZA 2IY8A 4WJKB 4X8OA 1C7IA 4D9IA 2ETVA 4X90A 4MV0A 4K9KA 4TTJA 3T1NA 2FEAA 1Z5GA 4ZRMA 5JH7B 2YTZA 4S3MA 1KMQA 2YRWA 1OI7A 2ZVQX 4FSDA 4PIVA 4DR4B 1X9GA 3R3SA 1OT5A 4AUMA 1XXHA 4OGWA 3QVWA 1T0HB 2ZW9A 2HQ1A 3ESCA 1I3CA 1SKYE 2FFQA 3IURA 3OLWA 3IP5A 4B81A 4UTRA 5CAEA 2PIDA 4XYGA 5C1PA 4KVZA 2ZB2A 4Z0NA 1NX9A 4LY3A 5ALPA 5ITWA 3BIOA 1K27A 4UVDA 3GT0A 1T6YA 1V6SA 4Q7MB 2GILA 4QFDA 3OP4A 4G1CA 5HCIA 2WF8A 1OXVA 4MV4A 3K15A 5DI9A 2I3BA 4JEHA 4KEAA 2IBTA 4NENB 2XKKA 1XZLA 2OD7A 2R7AA 4ZN6A 1SWWA 1UK7A 3IIIA 4YRPA 5EWJA 3EF3A 1T1GA 4QUAA 3O84A 4Q82A 1ISJA 1XTZA 3VZCA 1MD9A 1JU9A 4H9GA 2G9UA 1DV2A 1JUDA 3QVVA 1APBA 3ZGNA 5JRZA 1G64A 1NT4A 4OAOA 3HYNA 5HK8A 2AMLA 1SOUA 3OUUA 5THXA 2QRKA 2JCXA 3KZCA 3VR4D 1ND6A 2V5AA 4CWAA 3ZHZA 1I0ZA 4G84A 1GGFA 5FRDA 4EA6A 2JATA 4JJ6A 4EPTA 5CNMA 1GQQA 5CBPA 4E30A 5KTKA 3W6UA 4WASA 2M6LA 3S28A 1JN0A 2QVXX 2Z9CA 1E98A 4NWIA 2O7SA 1RQXA 2DBZA 1RE0A 4TLMB 5EQJB 5B1HA 1R6UA 1FQKA 2ZBFA 1SZJG 3H2HA 4HJXA 5KVAA 2X76A 1NR5A 3TS1A 1A9TA 4C6TA 4OF4A 2PQ0A 1ZH4A 2D4AA 4MPRA 4HZUA 3WGNA 1T4GA 3WLRA 5HYVA 3DOHA 1XAJA 2E4AA 1L4FA 3IAS6 4GMHA 4JSTA 4EITA 4FZJA 5IHPA 1N77A 3ZKWA 3CEAA 2B98A 1RQ2A 2XV1A 5JBNA 8MHTA 2Z8YA 1PN3A 5F7OA 1ESDA 5J63A 2D4HA 1DLJA 2QUZA 4PR3A 4R1TA 1QYCA 3NIWA 5I7EA 1IEWA 1OVGA 5LBIA 4DL9A 1GZ4A 1TM7E 1ZJJA 3A9UA 1JR6A 1K92A 2XIJA 1WHTA 3HFRA 4WZAE 1NWCA 2JF0A 4I9UA 5IDQA 3UTDA 2G9RA 2R0QC 1O6BA 1F1BA 4LSMA 3HPRA 5E7QA 1DRVA 2SNIE 2NUAB 1G21B 5A5EA 1U1IA 2ZR8A 5DXJA 2YZNA 4L57A 2VBCA 3BMNB 4XRRA 3GLFE 1VCOA 2R2AA 3ETEA 3AJ8A 3LD9A 1MPXA 3EIWA 4LBVA 2OZVA 4OJKA 3ZGYA 3VU0A 4DARA 1W4BA 4A03A 3UJ9A 2I9KA 2EJBA 1NXOA 1GU7A 4ZQEA 5DTQA 1L1EA 2B2CA 3LVQE 4N65A 1V71A 4B3BA 1SXIA 4LHSA 2OUIA 3UWPA 1I5OA 4O8CA 1EP1B 4BC0A 3GD5A 3V8BA 3ZYZA 3MWJA 1O6GA 4B1FA 1K5PA 4QGFA 3IOYA 4BEVA 3KKNA 4W9MC 5FI1B 5BV8A 2P2GA 4GP6A 2DLCX 3BXOA 4RBNA 3WNVA 4YHBA 4YPOA 5EE5B 3WA7A 1KPGA 3R6TA 2FETA 1B14A 4ZOLB 2Q2NA 1UBGA 1EI9A 2IEDA 2XUZA 2J3HA 3TNYA 1N7GA 2UUOA 4CHTA 2H59A 4HB2A 1TW2A 2H0QA 1TO6A 4P7KA 4F4JA 4K05A 5IVDA 3SYMA 1SURA 3SFVA 1JV2B 4HLQB 2WP8J 1CUZA 2I8AA 3W8NA 2XE8A 3HY4A 3K94A 4O2RA 4RPKA 4R1MA 4UBKA 4AWBA 3M6MD 4RETA 2NUPB 4Q1FA 1MB4A 3LFHA 3UJ6A 4BZQA 2XTZA 4UJ3A 3V1TC 2H51A 3OJFA 4RJTA 5KYXA 1GCAA 4BNDA 4AMVA 1JR2A 4BO6A 1ZX1A 4MUKA 3FPFA 4A6DA 2R5WA 1D3AA 1ZWLA 2AYXA 3E58A 4N39A 1FYEA 5ENVA 5IAJA 5LQJA 2JAUA 2XLCA 3REFA 5TV2A 1VHTA 1A95A 4X20B 5BW8A 3U1TA 5MN5A 1SHKA 1U04A 2FMHA 4XB2A 1O5OA 3EC7A 5E9WA 5CA0B 5IUNC 5F35A 1B74A 3RUIA 1D7AA 2LZ0A 3TFOA 1J09A 5AW1A 4BZXA 2ATEA 2GASA 3L7KA 3W0LB 4B43A 2ZYWX 1FJHA 2ZG6A 1P0PA 2A57A 2YJ6A 1RBQA 2Y05A 5TNXA 3S2SA 4CM9A 1VBMA 3TTUA 2X6TA 3N8HA 1DBWA 3GVPA 4NBWA 3ND9A 4EA8A 3PC4A 2XUIA 3LP6A 1JEEA 2JIZA 1PI3A 2WFMA 1IY0A 5EJGA 1RRMA 4HFJA 1DRUA 4IDBA 4E88A 2GAOA 3QVGA 3H8VA 5L40A 3AM1A 4ZCIA 3EH2A 2AMYA 2C04A 2D00A 4KB5A 1I4OA 2KPOA 4K6FA 3GZ4A 1THMA 2AK2A 3EGEA 1TM2A 2ZJ8A 4LNUB 3RTGA 1KI8A 2IPLA 2MJLA 1KHHA 2MYUA 3ZH9B 4GD3Q 1BDHA 3GMIA 4KVAA 3QG5A 5FI3A 4ESVA 2BSQA 2CE2X 1N8TA 1Y1QA 1I3MA 2WWYA 4UU1A 3I2JA 4A6XA 1W1WA 3GJ3A 3I4CA 3OETA 5HBRA 3E3LA 4NIMA 4H4DA 2WUGA 3SSNA 2Z6QA 1JNYA 4AWAA 1Q0PA 5IM4F 1FFXB 2E6KA 2XXJA 2FR0A 1O97D 4QWWA 4Y2RA 4BO8A 1USWA 1UAYA 1T6XA 4OXRA 1NQTA 4C0WA 1TUIA 2BKLA 3LXXA 4LV8B 2JLYA 4H2DA 3HJFA 1BQ3A 1QM5A 3SSOA 1L5YA 2OZLA 3ECCA 1E1YA 2XAAA 1JG2A 3KETA 3BICA 1SWVA 3MJEA 2HJHA 1ULSA 5FV7A 3S2FA 5JECA 3EEOA 2JFBA 1YB7A 2A3NA 3RQSA 4WY8A 5LQDA 1BQEA 4LDRA 1UKEA 1THZA 1VYVA 1WXFA 2FJ0A 2GCIA 3CURA 1DEAA 1GRCA 3C41J 4PC3A 3UGKA 4F6RB 4DBLE 2AE1A 2W0SA 2V65A 1U11A 5CT9A 3DC7A 2ZJZA 3GO4A 4WFIA 4RAOA 1ZITA 5HF9A 4HXEB 2RGBA 3TEMA 5CB4B 3RG8A 1M10A 3NZEA 3E48A 4WKNA 1OU0A 4E5PA 5KYWA 4HQ6A 5F7XA 4QXQA 4J0CA 1S2IA 3N7UA 1NKTA 1O4WA 3GW8A 4LE1A 4WEOA 4Y9SA 2C7BA 3H2JA 3LQRA 4ZQFA 2QRPA 4MI9A 3VHXB 5K3OA 4DV1B 4J7UA 2HSJA 1WD5A 1ZD1A 5L3SB 2V8OA 5AUOB 4LFBB 2NPFA 3GUCA 1XMQB 3RS0A 5JQGF 3QVKA 3CH6A 5TQ0A 4A9AA 4Q4DA 4B4DA 2DPXA 3C24A 1AA9A 5D86A 2OGUA 3LCCA 3LL7A 4J4HA 5CNIA 5AVOA 1KGDA 1QV7A 1ZOPA 2PGNA 3Q8MA 5KWEA 3QPUA 2F3PA 2COEA 4BVAA 2BIFA 4DA0A 3GFQA 1C0EA 3CZMA 4PAWA 4MZXA 1GPNA 2G8NA 5LYJA 3EIXA 2DWUA 5FPYA 3QLTA 2I62A 4D5GA 5CDFE 1PZXA 4IY1A 3KLBA 5F1OA 4BFWA 4IIXA 3ZHYA 4CKYA 5HM8A 1WCYA 1QCCA 2WSBA 4YP1A 3OZVA 4OM7A 2IUUA 3IAUA 1B15A 1IN4A 1TAQA 4RTSA 4IOJA 2QRZA 3GLIE 2E37A 2EW8A 4J7AA 4XM1A 3JARA 3KTFA 1Z35A 1RQRA 4PM4A 3UNXA 2ZLBA 4ZU3A 4C7OA 3E2IA 3FNQA 1KF0A 1G63A 4RVUA 3JAMA 1EDDA 5E6SA 2N1MA 2YVAA 2AKAB 1DXQA 3IKVA 4D02A 1LDEA 1OXXK 2Q27A 3FAZA 3GYGA 3B5JA 2VDWB 4H7JA 3DP7A 2ZGVA 3R5FA 4MIOA 2ZXUA 2XOXA 3GP8A 3K2EA 2JJ2D 2H07A 1PJ2A 3C1UA 4NF2A 1QYXA 2JFZA 2PCJA 2ZUBA 4PG8A 1EDOA 3D2CA 3Q6NA 2YWEA 3V1UA 1PIWA 4Q34A 1KQOA 1T1IA 1HDCA 2PX8A 4KPUB 2BE9A 3GRYA 2RD2A 1RFLA 1ZCAA 1S02A 4RIHA 4FBMA 3ZY6A 2P6UA 2W42A 1ZICA 4PLGA 3NOOA 3GAZA 1II9A 1YI0A 1LBEA 1SOAA 4XR4A 1F48A 2D5CA 3FNIA 1LPPA 1TC1A 1WCIB 5AXDA 2NTJA 2PKRA 3I2IA 3FJOA 4UW9A 2YJZA 2ZTVA 1HDOA 2FAXA 3TIGA 3DL2A 3ZQ4A 4PNEA 3HB9A 3CS3A 1KMIY 1DADA 1N6PA 3IRUA 1AKQA 1AZTA 4GP7A 4BO9A 5IH3A 2W2MA 1UJNA 5BV1A 1O5TA 4ZT7A 4R71A 5E1BA 3VGPA 3L1KA 3LUCA 3PLRA 2ERXA 3LOUA 5EHGA 7YASA 3ELYA 2Q3MA 3SI7A 4JI2B 3BHIA 5IJXA 2BTQB 2AF3C 3QUTA 2VTVA 1P9OA 4WV3A 4PX5A 3U7HB 1XK6A 4G4SP 1OXMA 2M6KA 4DTIA 2HT6A 4YT5A 3EIQA 3RJZA 4NCBA 4BQIA 2H11A 4R05A 1RW4A 5DGCA 2PS3A 4CDRA 4HJRA 2XNSA 2OK7A 4YAOA 3EXEA 3EA4A 3DE5X 3JPWA 4JLMA 4QAJA 3UWSA 1IBSA 1RSZA 5JCZA 5LN1A 2X4GA 4AJ4A 2QMZA 3AJRA 4GM4A 5U1PA 3B6MA 3MW8A 3NXSA 3A3NA 1HA3A 3FDIA 4NFHA 1IZ0A 4ZJZA 3LNTA 4GBED 3UK7A 1K3TA 4ZCRA 1KDYA 2MDTA 2PBFA 4EMTA 5AHXA 3MLAA 4UTVA 2C9CA 1EXWA 2ZB8A 2XGMA 5HRAA 5IAOA 2B0CA 3JD4A 3STTA 2QMUA 1V7CA 2FQWA 2B5OA 5JS1A 5A9TA 3VH1A 3N5CA 3CB4A 3IILA 5JARA 4RMIA 3CF4A 2ZAMA 2JK0A 2P75A 1DXOA 2BMJA 1LPNA 5CJJA 5EIAA 1PYDA 4L50A 4EY4A 4XJXA 3MWYW 2QMQA 2VJCA 2CLCX 2QVZX 1K6JA 4Y9RA 1XEWY 3JXEA 4NNPA 2ZQ5A 2P9ZA 1A3CA 1ABFA 1GGVA 1NQXA 1TRHA 1Z8DA 2EKZA 1BXRB 3GJXC 1QVRA 4PG5A 1ZKMA 2GKGA 4AYTA 3AT1A 2D1QA 4ASUD 1YHYA 4XGKA 5MGBA 3L92A 1Y8RB 4UZSA 5EXPA 1KIAA 1Z6TA 2VXBA 1C3OB 4UNPA 3GQBA 1QC5A 3VC2A 3T0FA 2UVQA 1DU4A 4K8OA 2XYGA 4CQLA 2A7QA 4IFIA 1BC5A 1VC2A 1Z4IA 2JI9A 3BD9A 2W71A 2F1JA 2H5LA 2VP3A 4JBNA 4MVJF 1LBSA 2WJPA 4UUOA 4QQKA 1AXGA 1OE0A 2ATCA 2CUTA 3BCSA 3MMSA 4AROA 4C87A 2XGOA 2ZAOA 1QGYA 4EG1A 2A0KA 2H2FA 13PKA 2FN4A 2D1SA 4Z7NB 1R5NA 2B5VA 4FOOA 4RPHA 3TMYA 3IKTA 3OFVA 3NHMA 2DFTA 2HIMA 1RXVA 2PZKA 3LFTA 4TTSA 2ZR7A 2H4FA 3L6EA 3LUBA 5T4HA 3Q87B 4PG7A 5KNBA 4GOMD 4DV2B 4KK3A 1FRNA 2VNIA 1AN9A 1XTKA 5HQ3B 3BB1A 3R7DA 4NZNA 1XL1A 3JVVA 4LRTB 4AY4A 3GPLA 1Z6AA 3A6FA 3KSRA 5JO9A 1JYEA 4X1OA 3ABZA 1UP6A 2P68A 5JD3A 1AKRA 1NMZA 1F60A 1LC0A 3EQ2A 3VR4H 5L53A 3WVNA 3E22B 1JMYA 4UCXA 4EPWA 5DGHA 3FPCA 1KKMA 3HXPA 3I64A 5DWQA 2Q6KA 2Y27A 4PICA 3STUA 1Z2OX 3TAUA 4CTJA 1PJAA 4MRVA 1K2WA 4Q05A 4EJSC 2UZ0A 3NO4A 3BE5A 2JRLA 2ZRMA 3CNLA 3FCYA 2D2XA 1I94B 3VZDA 1LTQA 1EVZA 3FLBA 1IMJA 3E4CA 3HLYA 3R76A 5KOHB 5FB3A 1FDWA 3ZDAA 1U63A 2I6SA 4H4CA 1NN0A 1RC8A 1VB5A 4A2CA 3LDAA 4EEZA 4URHA 5F76A 3VC1A 3DAOA 4PHHA 3IIEA 2QYOA 3K8QA 4PX3A 2DYKA 4X6LA 4M89A 3WLPA 4CMJA 4D45A 3DVSX 5EKUA 5J2TB 3KQUA 3BTVA 1BN7A 1R0BA 4C7XA 4E6PA 2UVPB 2PUTA 3HB7A 2AS0A 2QVLA 2VF4X 3NX4A 4KE8A 4UTPA 4RVDA 1OLOA 2GK6A 2NO1A 1KA9H 1UM8A 4CF5A 2MSCB 2A6PA 3PEEA 4CDMA 2PLWA 1INLA 1DINA 1PK7A 4OMUA 2X7HA 1Q6ZA 4PF1A 5TQ2A 2OYRA 3B60A 3EGDB 5EYPA 5JT1A 1P1KA 4DQUA 3T0GA 1OIXA 2IYYA 3V4LA 1ENOA 4EENA 3OM0A 4MWSA 2REBA 1QMGA 1Z2CA 2QG4A 4IUBS 5EUCA 3RU3A 4CKWA 1YASA 4JT9A 2YNMD 4YRZA 2NVOA 4R16A 1Z47A 4L5IA 4OHVA 2EBHX 3HHPA 3KR9A 3NANA 3ZDYB 5BMVF 3GAFA 4MA5A 3ZK7A 1ZQ1A 3WLEA 1UEJA 3S7TA 4P0PB 2GCPA 3Q0TA 3L6OO 1FQJA 5J2TF 3NUGA 1H22A 3L7CA 3ROPA 2GWRA 3NG1A 4KV7A 2VJQA 3T0IA 1QRUA 1H42A 3QVMA 5LVAA 3C14C 1J0AA 2PSJA 2WYOA 3DGEC 4XGQA 3OC0A 1E2JA 5IARA 4LSGA 4IINA 2YJGA 1A8UA 3GZJA 5JWHA 3RSLA 3M81A 2YUTA 3U09A 4P8RA 3CXUA 3FGOA 1MB3A 4M1KA 3PG5A 3R75A 4F86A 5JZBA 2VNJA 5AKLA 4BE9A 2F8LA 1V8DA 2LWIA 2P3SA 3TZCA 5K0LA 1KMMA 1M2OB 1ND5A 1ULTA 4XIIA 2WUFA 5K1ZA 3N70A 3A4MA 2RB4A 1KDPA 1EFPA 3R9XA 1L7NA 1Y1RA 2X1LA 2X40A 3TMAA 2FSPA 2J3IA 4IICA 5ANRB 4ENUA 3HZHA 1FYVA 5KYGA 3PFGA 3AY0A 3COPA 4NG5A 5B1SA 1U9IA 4GPZA 2H8KA 3B1KA 4JAVC 5CGQB 4V0QA 1VZ2A 4BRWA 4PY2A 4WE3A 3H75A 5AW0A 5J4KA 1U2GA 2FSIA 1VP3A 5EJ7A 1C1XB 2UZ1B 5TR9A 3PHLA 4L51A 3HI6A 1RXCA 3RT7A 1W0KD 5AICA 3W5SA 1TNDA 1A27A 4WK2B 3K96A 4G5YA 5FQNA 4IJWA 3UJBA 4JX9A 4MS1B 2X0EA 3R77A 3OEHD 1ZM4A 4OM8A 2PKCA 3BOSA 4JVOA 2XB4A 1A5BB 3B3AA 4QGBA 2VDNB 4WWHA 4MO2A 3LBHA 4O63O 3C8HA 1N2OA 1IONA 1YJXA 5SZJA 4E5YA 2C1ZA 2DUNA 3C3DA 2B7BA 3F3SA 3QH4A 2XITA 4I3HA 4U3JB 5CDTA 5IBCA 2IEAA 2W2TA 3BAZA 4G0WA 3RW9A 1MX5A 4JZKA 3EWIA 5FLXA 3C7CB 1CFJA 4WZ6A 1RJWA 3YASA 2CFTA 4JVLA 1BCRB 3QMPA 2I65A 3UHOA 3W4JA 1T4CA 1YSCA 3OM1A 4MVJD 1ZIYA 2O06A 4R8RA 1LLFA 2JHGA 3C3KA 3C6QA 5AVQA 1IBKB 3FPHA 1CJMA 2BGLA 4TL9A 4XKJA 1AG9A 2GD1O 2TS1A 1JSZA 1MJ5A 2G25A 2LIVA 3DYVA 4HN9A 4YAGA 1Q95A 2GPNA 1RLUA 3IP8A 3C1TA 3KUDA 2AOTA 2W6CX 3PUJA 4G5XA 2YZKA 4OB6A 5D5QA 1TA4A 1YFJA 1FXUA 1C2YA 3O4GA 1R5OA 3EF1A 3SZOA 3UGQA 2EP5A 2B1QA 2VJYA 3D43A 3ESZA 2PWPA 1WZ2A 2AHRA 2R8XA 1X80B 1CQWA 1Q7RA 1PQYA 1XA4A 2J48A 3P2YA 4YCBA 3W1WA 4BMPB 2VQEB 5EWLB 1GFWA 3R24A 1TF5A 2DTEA 1NONA 3OAAD 5FFNA 1P6XA 5AXBA 1QV6A 3P2MA 2XUKA 1T43A 1UMKA 2H16A 2D0DA 4N9WA 3U9LA 1L5LA 2R00C 5DI3B 2ISQA 3SMVA 1X13A 3VQTA 3ZWKA 3A25A 1J9GA 1RMQA 3ANLA 4WZBA 4Y30A 1WMSA 1EU1A 5BW6B 4Z0TA 4LFAB 1FJGB 4HRAA 2QU8A 2OQ2A 4DY6A 1T6NA 3DJYA 4NH0A 2JJ2A 1AUXA 2PXXA 3G2PA 1S2OA 3Q3IA 1MG0A 1SC9A 3QU2A 1J8FA 1A5TA 4R9UC 2OHOA 2Y4NA 4HAWA 1IL0A 3PVSA 4RMGA 3NHFA 4HLUC 4GPEA 1P9LA 5B2FA 2I7XA 3MTAA 3SR0A 3FKSD 5DT2A 5FCDA 4D8XA 1HFEL 1OV4A 3GRZA 5BVHA 2P3QA 5EZ5A 1UDXA 3DW1X 1L7OA 1TLTA 4B34A 3USZA 1YKSA 1A9RA 2GS9A 1YZKA 3CIOA 4GPAA 2X6RA 4YROA 4XUGB 4YCLA 2F3UA 2W4QA 3EVAA 1O08A 3N05A 4MLZA 3HUFA 3WLAA 1TC2A 5LP6B 4GQIA 3ORQA 4IXWA 4R0NA 4RM2A 3DT9A 1G5HA 3A14A 3NHBA 1NHWA 3R7FA 1E1MA 2ONKA 2HBZA 4FMDB 2BDTA 2YYAA 3BERA 5H4HA 2GKOA 4F91B 1RI2A 1A1SA 3BRWA 3REQA 2QSZA 2G08A 1ICEA 2OFWA 4WD3A 3FXAA 3GJZA 3TOXA 3V7UA 4J4BA 4JUDX 4LVUA 4Y8VA 1JHMA 4EKGA 2WKSA 1X2BA 4ND2A 2JLAA 3ROKA 3TTWA 4KSBA 5FWNA 2ZS8A 4MW5A 5CLHA 2ZBUA 1BG6A 3I12A 4IWNA 1XMPA 4A8JB 2QPLA 2I8CA 2AFHE 4Y1EA 2GBLC 2O8DA 3K32A 3L4SO 4ND6A 4RDCA 4YRJA 3RFFA 1BOFA 1LB1B 2RHCA 4CHGA 2OLKA 3BMOA 2IHBA 1DJQA 4PU0A 3HO6A 4ER6A 1PW7A 3M6LA 4ZVMA 2HMUA 2OY0A 3AV0B 2IHYA 4U7TB 5B12A 1MHTA 1S5PA 1LV7A 1VMEA 2QVYX 2P9YA 3JWIA 4C0HA 5LP6F 1DJMA 4HWPA 3EGCA 5AYVA 1E0AA 2H1FA 1SG6A 1TZMA 1L5NA 4B9EA 5IM4A 2EJWA 4JUFA 2F00A 1ID8A 2PSHA 3HMKA 2PE5A 2OWDA 3VR6H 4PN7A 1TD1A 3C3XA 4EB3A 1KPHA 5T8KC 4FM9A 4RPLA 1JLRA 3C5HA 4QYIB 3KD3A 3UWMA 3QG1A 1WZUA 4DLVA 4JNCA 3ZWWA 2FN7A 1MGOA 3AV3A 3C3WA 3GUVA 3OSUA 3PEUA 4G37A 4BZZA 2WR8A 2H85A 1B16A 2FI1A 3ORYA 4WCVA 4BVGA 2KX7A 1PGNA 3D31A 3G7SA 4YMVA 3DPSA 2HCBA 5D85A 1M5RA 2HKIA 3MS4A 3DLHA 4GLFA 4CN8A 4P54A 2DFPA 2EFDB 4M98A 3UAGA 1E1CB 1IZYA 4ASUA 4KYTA 4Y9TA 5DNYB 1O95A 1PL7A 3PGA1 1SG0A 2OA0A 5CLFA 4S24A 4JI0B 2JH8A 4FFSA 4NH4A 1PLJA 3KFVA 3OURA 3QSGA 4DFDA 4GW3A 5K6AA 3T34A 3DEKA 5DOVA 5HK9A 3K2IA 5FNZA 3RSQA 1YOVA 1V8FA 2FPSA 3FCEA 4KX3A 3TNDA 1KFJB 4DT1A 1ZISA 3RSHA 3EXIA 4M0MA 2DJIA 1IRXA 3G2IA 4DPMA 1WXXA 2BZ1A 1ZSNA 4CM4B 4B5KA 5CD9A 4MR8A 4GYKA 1UP7A 4KJXA 1H0SA 1QHHB 3OLXA 3T3MB 3FHCB 3KL4A 5AIBA 1PL6A 2WB2A 5IW8A 2JFVA 2FUCA 1GCGA 1KSHA 2PUJA 4XQ9A 5JQGA 5C7IO 5D3MB 1FE8A 4QUKA 2ZEJA 1ZI8A 3DAHA 1TYEB 3LK6A 2X0DA 9LDBA 2JHPA 2YR0A 2X7XA 4ZI2A 1OOEA 5FBRB 4BNYA 8AT1A 2C0CA 2CHQA 4LBZA 3RIYA 3WGUA 4G4IA 1F6DA 4A0SA 2JI8A 1TAUA 1BU5A 1QO7A 4XR9A 1N6KA 1U0JA 3CONA 3GZNB 1VHQA 1ZXXA 3L8ZA 2K4MA 3FUTA 2G5TA 3FZNA 2DAPA 1F0PA 1RNLA 5EZQA 2P2CA 3I92A 4OGFA 3MS7A 3RCBA 4FNOA 4BWFB 1NRIA 2OCIA 1ZU4A 2C7PA 1MVNA 1LF5A 2QLNA 2PRSA 5M29A 2FPIA 3G23A 4BNZA 2ZJ7A 4F60A 1ULHA 3TW4A 3Q3GE 3QEKA 3AEKB 3ZBQA 4EBBA 4MS3A 1TVKB 4LPKA 3BSYA 4NFYA 3VC7A 4L3OA 5FPHA 4PFKA 4XVCA 1BHJA 4ZICA 3QOXA 5SV2A 3F7MA 4JUCA 5CFQA 3R3WA 5ER9A 4GS5A 4D6PA 4P81A 4MKXA 5JZOA 3HR7A 5E3HA 2BGGA 3HKEB 4JQZA 2NU6A 5JFGA 4FJ2A 3OF3A 4YAFA 1GTVA 2EKQA 2JKVA 1DIHA 3H5IA 2YC4C 1UQRA 3IJRA 1XLUA 4QNMA 5A71A 3TZHA 1EK5A 1QHIA 1KFEB 1FMLA 4UHJA 3P9XA 1YB5A 4RADA 3UV7A 4EL0A 1U5CA 5JG7A 4PXSA 4P4NA 3KR1A 5JYEA 1N2BA 2BTEA 3KXDA 4OK3A 2GPTA 4ZI7F 5KYTA 3FUVA 2BT4A 2H9YA 1CUGA 1PUIA 3G0GA 1OASA 3PQ6A 5DCWA 1Z7GA 2C3UA 3SC2A 2PS0A 5KQGA 3ANTA 5FUVA 2AOXA 1NBOA 1T2FA 1U7WA 3DMGA 3UT5A 1L0BA 2B3TA 4FK8A 4BFZA 1C2TA 2B3DA 721PA 1CUAA 3UMCA 3A6JA 4CKBA 2A1TS 3U7FB 1TZBA 3U3XA 4NE2A 1SEPA 1U3VA 1JAHA 3M6IA 5JZ9A 4N48A 4DJ5X 3T7CA 3LQFA 3GEDA 4G3XA 1EE1A 1JXAA 1N5IA 5ITVA 2CEKA 4JIMA 1J8MF 2BEUB 4QDTA 2VP0A 1Q0SA 3O3MB 2JLXA 5HVNA 4ZMSA 2A1IA 3U7QA 4BOYA 4RTLA 2LRHA 4DR5B 4OHOA 1KDZA 4B3JA 3TRJA 1AKVA 1B8PA 1R5JA 2ERCA 2OCYC 1D6JA 4W5WA 1Q7EA 4UUAA 1UWLA 5LMNB 2IUFA 1E8DA 1IUOA 2ORED 3G5TA 1JR4A 2RIRA 1VDMA 4EG4A 4RKYA 1ZY2A 1JHYA 1YJQA 4QQFA 2NZUG 2YVKA 3TECE 2AI2A 1M74A 1WSWA 1I30A 2ADMA 1BA3A 3C1OA 3LPDA 4HLCA 5TC4A 4Y6PA 3M3PA 5DTEA 3ZY3A 3ASVA 4CEHA 4TS9A 1HLGA 3SVZA 3OZSA 1SA0A 3IR7A 1DKMA 3R23A 2V7GA 3HBLA 3S29A 2C83A 2CUNA 2GPAA 4PLCA 3SM9A 5C2JB 1E4EB 3GRUA 4M6WB 3AHJA 2AXPA 3ORFA 3U62A 2F62A 3AFIA 1UDAA 2WM3A 5F9FA 3K6KA 2VATA 3FBGA 4IJMA 4UPDA 1L4MA 1GV0A 3JQRA 4KFUA 5LC1A 4M3NA 1E9AA 1HY3A 1TO2E 3FW1A 4URVR 2FEOA 3DEHA 3KU1A 2K2QB 1GFSA 2V0CA 2JGDB 2Q62A 3AR9A 1B00A 4NCHA 1GG9A 4AN4A 1XZAA 1C80A 1LJUA 2BAGA 3EAFA 2JI6A 3D1JA 1E4OA 3MTIA 3OIYA 1LRLA 1FYWA 3CBQA 4HDMA 4C2BA 4HT3B 4ZGWA 2D1YA 3E1GA 4EA7A 4JQOA 1T6BY 2QAIA 5LQSA 4U2CA 5JCJA 2I1LA 3DE0X 1PL8A 4D41A 1J5PA 2XLBA 5C1IA 3RVQA 2G77B 2Y77A 2Y0CA 2L19A 2WF9A 3HI4A 5EQDA 3CX7A 1EFVB 4FLFA 3SJBA 4EO7A 3A1CA 2BMVA 3KL2A 3BZBA 3GFTA 1ZD8A 1X7YB 1TKAA 1SXJE 3P97A 4AJLA 3A9SA 1GAJA 2JGFA 1E8MA 4ZEMA 4PSCA 1K3UB 3SC6A 4E7OA 4ZJUA 3ZCSA 4M9XA 2RDMA 1FNCA 4RK5A 3RQIA 4RA9B 4AO7A 4AN0A 1OHHA 4DLZA 1BE0A 2RGCA 3T7IA 5REQA 4AMBA 5A06A 4JJEA 5JRDS 1GPLA 4PSKA 4AY6A 3RBZA 3KFXA 2AI3A 1NBAA 1RKBA 1KP3A 1YCGA 2BFEB 3KE9A 2CE7A 4Z0PA 1KE1A 3PHCA 2PAAA 4KLRA 4PYRA 2H5EA 2CB9A 1HRKA 5CXXA 5ELLA 4WZBE 3HV2A 3TLKA 5ISMA 1AUPA 1OLUB 3EW9A 3MGCA 2PSEA 4G0QA 5DTRA 4BO7A 1UIRA 2HCFA 3RKUA 3VNAA 4DRYA 2GF2A 2XZTA 3QWIA 5K0NA 3UV6A 4F7DA 3FKSA 4P35A 1G6HA 4P7GA 1SXJC 4DGQA 3U60B 1MV5A 3U3DA 5DYNA 4NV1A 3H4IA 1L5FA 3JVDA 1XWWA 3KM0A 1NZJA 4EABA 2QE7D 2AFVA 1GT6A 1UBNA 1R9GA 1IHDA 2FPGA 1IY8A 2ZKIA 3CR7A 3LY8A 4L4RA 4WLUA 4Z4HA 2VYND 2WU1A 4Y2PA 3KQMA 1D0SA 1W8IA 1QTIA 2CDBA 2G04A 3PQFA 3Q9NA 4RTMA 2HMTA 2PX5A 2XB2A 1CE8A 4HZGA 1NUPA 4A92A 2F8MA 3EWAA 4FFPA 4GC5A 3TSWA 3WWYA 5KDOA 2A92A 3G9UA 1R6BX 3ANSA 1YVRA 3ABOB 1LC3A 1CVRA 3SQDA 1WXQA 3UA3A 3G8BA 1E0KA 3KVVA 3N53A 2C2KA 5EE9A 1WUKS 4QNRA 3Q41A 1GL6A 3VJKA 1IK6A 3CLTC 2H2IA 5BMVA 1AGRA 1Z7BA 4PPGA 2CHEA 3RS7A 1WW3A 5HEKA 3RVNA 1XMIA 1E5VA 4C4TA 4DQLA 1M6EX 3KUKA 3D02A 4KSCA 1ZOIA 2AEEA 4UBIA 3DMNA 1QYRA 3H5OA 3MBIA 4K8RB 4U6NA 3E53A 4IMPA 4CV0A 5AESA 3MCUA 1U8FO 2SECE 1XLVA 3VZSA 4BNTA 1H2AS 1GSOA 1QNLA 2FWRA 1HDYA 5BW5A 2ODAA 3HUUA 3WKDA 2IXTA 1LK7A 2P2ZA 1Q0TA 1GR0A 4WERA 2VT6A 3SFZA 2CXUA 4CCAA 5AVUA 2O54A 3BF7A 4B6OA 1B42A 2G7ZA 3ABIA 5LJIA 4DEXA 3IJ5A 4PQEA 3S1LA 4EYQA 1U1CA 2F43B 1RIFA 2I1VB 4EW6A 2HNAA 4HSEA 3B6IA 2QM7A 1CCWA 1EB9A 4DYDA 3DTVB 2C42A 2XQVA 4W5HA 5G40A 3DBRA 3SXJA 2F55A 5I8PA 1TU0A 2PHZA 5DGXA 1G3IA 2P35A 2ZTLA 3U3OA 1IH8A 3CF4G 3RVJA 2ORVA 3BGDA 4C7JA 3CSDA 3IO5A 1FDVA 4IGFA 2ZRCA 3FCAA 1XR3A 1CPYA 4ONEA 1JHVA 3V48A 1QU3A 1Y98A 1E0DA 5HHTA 1EVJA 1XP5A 1QYIA 5H7XA 4ARVA 1VHJA 5C34B 2WQZA 3BL5A 1ZUD1 3M6WA 4GMFA 1Z8HA 2A14A 2Q9BA 2BEVA 2WILA 2K5UA 1S1MA 3BIWA 3DBHA 4LEIA 2PGXA 4RYDA 4MVJM 1ZCZA 1W36C 1U28C 3QJYA 4CTOA 3PNQA 1QCDA 5G4LA 3TLGA 1JHUA 1R8SA 3ILXA 3R1IA 3ONWA 4B6JA 1QHFA 2CXPA 4KXNA 3FAKA 2OLJA 3JTEA 2WTUA 2PK3A 3FH0A 3CF6R 4Z86A 5BUQA 3U4HA 5JTTA 2NV2B 4JV5B 4XEUA 4RXUA 1UXOA 1EDEA 1LNZA 1SUPA 2JFXA 2VCYA 3D3QA 5LB4A 3SYTA 1EGQA 2AD5A 2V96A 3URKA 1K7FB 2OHIA 1DTSA 4Y2JA 1XTBA 3PC2A 1SBIA 2XUQA 1TCVA 1JKIA 2YFYA 5FI0B 3WO1A 4J07A 1S2LA 1SJ9A 4NNOA 2XNKA 4P9NA 5KS2A 1W94A 1MAVA 4KPYA 3R7WA 2B8JA 3DYIA 4DNXA 2CHGA 5ENZA 4F84A 1DSSG 1UPUA 4QLOA 4X6YA 5EKSA 1DMRA 3ANYB 5FWYA 1B0ZA 1QH8A 1RHMA 3IT2A 4DLTA 2QZ4A 2Z43A 1BH2A 1YHZA 4G9GA 4ANFA 3C97A 2IH4A 3NORA 4GM1A 3PC7A 2QAGC 5FYDA 1D6MA 1PHRA 2Y1XA 1EUDA 2YBEA 5AJZA 1M1NB 1DP4A 2O5RA 3O1LA 5TIIA 1N78A 2BW0A 3K0FB 1KEUA 2QQFA 2EP8A 2IT1A 1EX7A 1NR7A 2XHEA 3JQ8A 1BX1A 2Y1DA 2D5LA 1U6IA 4A8HA 4CMGA 1W73A 4TN1A 1UOQA 3Q8WA 4XUEA 2MSDB 1TEXA 2IZ7A 2VKTA 4WFKA 4XOUA 2EFEB 2Q7XA 4BXOA 3TOVA 1JKJA 4M9RA 2G1KA 1Z2EA 1T91A 4G09A 1ENYA 2H7CA 4ARSA 2YHUA 1GNQA 4JI4B 1ESCA 3NUQA 3Q7EA 2QR5A 4M9SA 1DIBA 1S96A 2AUTA 3GGPA 5EXXA 1GQ2A 1NLMA 1PAUA 2FFBA 1JIUA 3RYIA 5KJFA 5EJ5A 4RDXA 1QNFA 2X0RA 3NP7A 1ZHHA 3PPXA 2FG6C 1Z18A 1M2GA 4PPYA 2FF5A 2C2BA 2I4RA 1CUBA 3T7AA 1C9DB 1T3SA 2AUMA 4HBGA 4ACAA 3QP9A 4K9SA 3V80A 1UQTA 2GCOA 3GI1A 4PZ9A 1DBQA 3W8FA 3TG2A 1JI3A 2OXRA 2R5FA 3D7RA 3BN3A 3A8TA 3UH0A 2BV3A 3RTEA 1N2CB 1SCIA 1MC8A 3CRW1 4PAMA 5GONB 3MMZA 1PNVA 2N9UA 2YRFA 3OCJA 4KBFA 5TGZA 4CR6A 3QOWA 4EVIA 5K3EA 1JB1A 2ID4A 4PBRA 3GPBA 4MNTA 3VSDA 4JLKA 3R9IA 5B4TA 3T1YB 3M9WA 4R1QA 4KWTA 4H3SA 1QFMA 2DSTA 2WU0A 3ZU4A 4AVYA 4QLAA 5JJIA 4MAAA 1K63A 2BISA 3O26A 1R0LA 1DB3A 3PWKA 4XGIA 3U81A 2OV8A 3JQ7A 2A35A 3MCVA 4ZOAA 5KWSA 5D3QA 3THOA 2AG5A 4F3TA 2PS9A 3VNBA 3UJ7A 3OZ7A 1A71A 5C5EA 4ESHA 4OHUA 5FTWA 1COZA 4JU8A 1ULAA 3R6GA 1TDJA 4RZIA 5TMEA 2VNKA 4MQ4A 4N5NA 2XF8A 1SVUA 4JLNA 1JKXA 3INNA 3KYDA 5K2OA 1UBUS 3OPYA 4Z7QB 5EA2A 3CVVA 4KACA 5HQJA 5TS3A 1O1YA 4DHWA 1Z0FA 2WJAA 4HYQA 1GA4A 3U48A 3SF8A 4PYMA 4B6GA 9ABPA 1LPMA 3EK2A 3BJZA 3VPCA 3L02A 3H4MA 3RLIA 4D8YA 2PUBA 4J75A 1KI6A 3AR8A 3SOPA 3AM5A 1UBMS 5M34A 4HI0E 1SCUB 5AJHA 3KUXA 4HGOA 4IX1A 2DU8A 3FBWA 4HNQA 4QEKA 3TTYA 3S7ZA 1KY4A 2XJ9A 5LU8A 2ACWA 4KU4A 4I66A 3KU4A 1UDWA 2BE7A 2KLBA 2JD2A 3BEDA 2A9VA 4YUAA 3NDBB 2N75A 2XUFA 3R3XA 4CETA 1QIEA 3UJPA 2X1HA 3EXFA 2OCAA 4FQ5A 3HUTA 4FHZA 4NR0A 1G60A 2EJCA 1RI3A 1YD7A 1E3WA 4KLAA 1U8XX 3SEFA 4MGHA 1PZEA 2ZJ2A 1UBEA 4GR5A 3RYCB 4P4UA 3GC6A 5TARA 5JY1A 2O50A 2VPWA 3AUKA 2X8WA 5FEMA 4AZ3B 3ZVNA 3ZNOA 3JALB 5IJ9A 1H1TA 2G1JA 3Q85A 1Q1AA 5ADHA 1DQYA 4ZU1X 5TGTA 5CM8B 1ECPA 1Y4SA 4YRDA 1SD5A 5DO9A 3HCRA 5EC8A 5F7JA 2DBVO 2RH8A 5DCLA 1U0SY 4UXHA 4WMLA 2RJNA 5TPWB 1E2FA 3KTAA 1T8SA 3ZI4A 3FVRA 4U7PB 1O0SA 1QIFA 2I80A 3O21A 4IZIA 2Z98A 4FMPA 4MV1A 3RC3A 3M34A 1ABBA 2Z5VA 2CMGA 2C4MA 2XQIA 3CW8X 3AI2A 3JV7A 4KGDA 3PDIB 1ZCFA 1Z0IA 2MYNA 2PVSA 5FBWB 2VPXA 2FSVA 4GI3A 1UFRA 1V47A 4DUGD 1QGUB 3Q5DA 2XYVA 3EGVA 2P0YA 2HSZA 4FR5A 4UM5A 4V1CI 1ISGA 2P1ZA 3CX6A 3U3JA 5FEUA 4UMFA 1SD2A 3X1JA 4RVGA 1F06A 2EHJA 4A2WA 2C3OA 3UMMA 5B37A 3FVTA 4MPJA 3NCTA 4MWDA 4BC1A 3ILHA 4DLKA 1ZHOA 2AI1A 3HKCB 4N5HX 4BO0A 2R1TA 1ZMOA 4ND5A 2FRVA 3DC2A 5BOSA 2FQXA 2NXCA 1P2DA 4GBMA 5HMMA 1S1CA 4NYIQ 1DAFA 4BJ6A 3WSTA 3CZRA 3WK8A 4ZCQA 1UC5B 4K9QA 3ETDA 1XPUA 2XCSB 3KQWA 1GTJ1 1AK9A 1P9RA 1SBHA 3EARA 1QZUA 9LDTA 4XDZA 3VPHA 1WMFA 3SNHA 4U4AA 2GZDA 2Q29A 1EZ1A 4FW9A 5ECDA 4E5SA 5CEFA 4B3GA 1I14A 1Z73A 4URZR 3KJXA 3RJ9A 4JP1A 1EXVA 1F20A 1LF0A 1MFZA 1Z15A 1FS5A 2Y1WA 3P9IA 4N0MA 4I5IA 4MTCA 4NPHA 4UFPA 4Q03A 4RMNA 2EWVA 2O2CA 2CUKA 1MOSA 3EEBA 4XQEA 5DP2A 4Q4JB 5DRYA 1K7XB 1NBMD 4GEKA 5TXGA 1T8WA 2ZI4A 4RK1A 1ODIA 3VVBA 1ZRSA 5G0UA 3AJEA 5ADWA 2ECKA 2Q28A 3VKWA 1F2VA 1KP2A 1GUZA 1KH3A 2QXTA 2RGNC 3MLBA 1YE3A 4L76A 3HXOA 1H2ZA 4FCVA 4QDJA 5FPKA 3C48A 2EERA 5KNCD 3PEWA 3H3JA 3LUDA 4B74A 4BP8A 1YKFA 4Z4EA 1PNQA 4KIWA 2Q5HA 4NEHB 4YJ2F 5TPZA 2YX1A 4ZI7A 1JDUA 4RTOA 1WVIA 2E18A 2GD0A 2Z4RA 4LXQA 4LY0A 4R0VA 2PYZA 4C1NA 4R7GA 1DWQA 1GQYA 3FA2A 3JRWA 3TZ6A 2EJVA 3CBGA 5THKA 2X4IA 1JLKA 2Y76A 1CS0B 3TLXA 2OYSA 1HX7A 4D9CA 1KEVA 2JS7A 3BXGA 4XSVA 1YGPA 2G40A 4X6XA 3PKIA 1A7AA 1S9DA 4BCCA 2WJ3A 3GLHB 3WB1A 2J6BA 5DHSA 3T52A 1TKRA 5EMJA 2QJOA 1L3BA 3DLPX 4DDTA 1GRQA 3JW8A 1JEOA 2ALJA 2HV8A 3OPVA 3W3AD 2HO4A 1AF4A 1QJ4A 3TZBA 1LI7A 1N0HA 3TKAA 1KZYC 4EOGA 4RY9A 3QQ5A 3THSA 3NYWA 4YREA 5I3CA 1MNAA 2V0NA 4WRRA 1H1DA 1TVCA 4C4ZA 4DLSA 1RXUA 5AI8A 5A5VA 2RHHA 2YFQA 3AKYA 1YQUA 1QGED 3KJHA 4HNSA 5C31A 2JFHA 3WL3A 3ZHOA 3QVJA 3FROA 1RPAA 1E7SA 2RFLA 2QRJA 3WGZA 4IL5A 2VEDA 4WL0A 4Z1OA 3IERA 3PE4A 2FWBA 2J4DA 3QFTA 4BFUA 3H1TA 3K0CA 1CDEA 1J49A 1Q91A 1W6UA 2WIJA 2WJZB 1WKCA 2Y1LA 4PAQA 4CPDA 4COOA 4OBXA 3PT9A 4NV3A 4UFOA 2RBKA 3OZXA 1U99A 1GQOA 2PU7A 4PHCA 4FYJA 4D97A 4KITB 1FBTA 5IH7A 1C4OA 1XU7A 1YIOA 5KIAA 5JAUA 5KWIA 1Z7WA 3OKFA 4I5DA 3PHBE 3S0JA 3C6ZA 3FSJX 2BFBB 4YO7A 1GUFA 5FNVB 3VPSA 1N2IA 1WJGA 4PLTA 3EG9A 4TVBA 4Q1AA 2HNKA 2C78A 4BLWA 5H83A 2W5UA 3F6YA 4YI3A 3ZWAA 4EZEA 1EE9A 2AGVA 3PUWA 2DPGA 3BZWA 5JMOA 3R4VA 5EP3A 1JVSA 3ZI0A 4BUZA 2JARA 2NO5A 2QK4A 1D4ZA 2YXDA 3GF4A 1C8VB 5FOWA 4UHCA 4JL6A 4WACA 3HKBB 5E6RA 5JE8A 1YTUA 2J5KA 3TSZA 3IBGA 4D26A 3WBKA 3VYRB 2CFRA 3NXKA 5G0SA 2XKJE 3OX1A 4EFNA 4L7VA 2QB5A 2OHFA 3W3ZB 3GDGA 5GP1A 4R2LA 3DPUA 4U5XA 4Y67A 1KFCB 3DMTA 2ORIA 3HVIA 4QQRA 1FDIA 2Z8XA 5TEVA 2AEMA 2ZUDA 3UHPA 3OJ0A 4WLNA 2YVLA 4FZ5A 1ZH0A 1R16A 2ZU0C 1G5PA 3FIJA 4R68A 3VDMA 2YW2A 4AJPA 4OX9B 1L5ZA 2RB5A 2WPDD 2ZI7A 1YB2A 1KZ1A 2XD4A 4FX2A 4PCUA 1JEQB 1YE5A 3P32A 4FKMA 1RI1A 2OQVA 1J2EA 1KEWA 1KHTA 3LDUA 3M6XA 4EF6A 2C31A 3OBBA 4A4DA 2V54A 4QVGA 5BV7A 4WY2A 2D2FA 3STVA 4DQXA 1SU7A 4HUTA 2F3QA 2JAXA 2EQBA 3PDWA 3T94A 3ZCVA 4D9JA 1XMJA 2IVZA 3OT5A 4I1OA 4ID9A 3MCZA 1YBMA 2C9ZA 2OK8A 3OJWA 5EJAA 2IHZA 1ML4A 2P67A 2W2LD 3EQ8A 4MV3A 3KQNA 3MQ4A 2A9QA 5G41A 3HN7A 3DG9A 2XUHA 3KK0A 2OBBA 3HZZA 5EP1A 1EBFA 1M2JA 1EFTA 1PDVA 4NYMQ 5HOQA 3I53A 4PRKA 1C3VA 4NP6A 2NNLD 4QPJC 1AV6A 4V38A 1CDDA 3Q11A 2EX1A 2IFTA 3GEGA 3ZXYA 1FFSA 3IH5A 4BYMA 3PNSA 1TCBA 3OX3A 2DHRA 1C3EA 3ZJUA 2PZBA 4DR1B 5GJBA 4JVSB 5EQTA 3GROA 1L7AA 4JP8A 4P3PA 1BX3A 2V6BA 4MHSA 4QXMA 4F4UA 4I55B 4QELA 3F6EX 3ZD8A 4L8GA 2I3AA 4UEQA 4BUCA 4JJIA 2FJUA 1W1IA 4HN2A 5CX4A 3KZXA 3GT7A 3QYJA 4F92B 1KJ9A 2XZDA 3WLFA 3RTDA 4C06A 1EHCA 1UOOA 1NTOA 4OKNA 4RVHA 2FV8A 1WABA 1Y3CE 2E2WA 4COKA 3DMDA 3LXRA 1E9CA 1GJRA 1P5RA 3TLCA 2CDCA 3E9QA 3I9LA 2IELA 4X8HA 2IWRA 3GBVA 3K7EA 1CJVC 1JTVA 3EAGA 4PBSA 1KOGA 4H3VA 4JENA 2QY9A 2HPVA 3FWZA 3OCZA 3OICA 3PXCX 1Q15A 4PFQA 3DMYA 5EHQA 3QGMA 5I48A 4Y2TA 3KRTA 3G17A 3M6UA 4PHGA 4MQEB 5IKOA 4BGVA 5F9HA 2J6IA 4RSMA 4KC0A 3FPGA 1P1FA 4GU5A 1BZYA 3DQQA 4IP0A 4RF5A 1H3NA 4B3HA 4DR2B 1U31A 3I2FA 2ZP1A 5GMOA 4UUNA 5DMHA 1KO1A 4JXXA 3AIOA 1UK6A 4UHFA 3HL4A 3L7MA 2YZ7A 4NG4A 1MX3A 4CLHA 1F7VA 1TI7A 2QV0A 1E69A 4IG4A 2WVGA 1DQZA 1HSZA 1V11A 3ZD9A 1NV8A 2FZVA 4PRYA 4FFBB 3LL4A 2GAJA 4MYDA 4XLTA 5CFOA 1D4AA 1NXWA 3GLVA 1JDSA 3CUTA 1V95A 2A5LA 4Q3LA 5DWVA 3WWOA 4I3GA 3B3QA 4QGAA 3HXKA 3R40A 1FNBA 3TZKA 1OBFO 4UOEA 2H17A 1PZMA 3A11A 5M3BA 3AP3A 1WBDA 5C81A 4OQPA 1RAAA 5CVUA 2W48A 1IAVA 4H1VA 4LZLA 3NPMA 1CWUA 4TM7A 1YL6A 3VC3A 1NURA 3GLGA 4YMTA 5EZSA 3BILA 3F4BA 3MILA 4FW8A 1ITZA 1PJ8A 2FZKA 2NZJA 5DTJA 4IIUA 3WLTA 1K6XA 1P4RA 2HJVA 2ODPA 1GZ6A 2YMQA 3A2MA 4EHHA 5BQFA 1QGAA 4NOLA 1G2OA 4KJZA 2NZXA 4J6FA 4MVJG 1THTA 4I5GA 5ALFA 3LO5A 3OWHA 4US0R 5IJWA 4F9FA 5B1YA 1DDIA 1ZK0A 3QUQA 1PYOA 4C14A 5B4UA 5IKEA 4B40A 3R6LA 5A7GA 3D6MA 1BJTA 1O0BA 2C4TA 5AHRA 5DTMA 5K03A 2C96A 3OZTA 4JXKA 3MCTA 4MDHA 2Q3EA 4RD1A 3ITEA 1YJ8A 5ESWA 5IAEA 5BUSA 1V1RA 3TXXA 1KP9A 1S7GA 3FMPB 2VZ0A 4ZQBA 2OO5A 3H11A 2DY1A 1FPMA 2DWPA 1UM9A 3OQIB 4H6PA 3H4TA 5ERXA 4AIIA 2YWBA 3F2VA 2FE1A 3MQ2A 3ZCPA 5C8YB 4C08A 1Q3HA 4L72A 3WIOA 3LQ1A 3EXAA 2FKAA 2FG7C 4QU0A 4UD2A 1D04A 3PX2A 1MEOA 1PR6A 5FPTA 1QORA 3KDAA 4J9VA 3P52A 2CLSA 3CJQA 4N47A 1KR2A 5TEWA 3O38A 4O4LF 5FOQA 1EXDA 1UQUA 1SCDA 1F2TA 1JLLB 2WU8A 4G5SA 5KB3A 1B76A 4P86A 5F5NA 1EDBA 3AETA 5JIBA 4DA9A 4BQFA 3IO3A 1V9LA 2GN8A 5IXJA 5AOVA 1KO4A 2A5FA 2PL9A 4M0UA 5HZGA 3O1IC 1VTKA 3PKJA 5LU9A 5AJVB 3HN6A 1XK7A 3ZY4A 1MJGA 3H17A 4N01A 1YR8A 1WHSB 5LSAA 2WWTA 3KWFA 1E9VA 5BO5A 2PANA 2IJGX 4JJKA 5AKIA 5KYUB 4BAGA 1TO1E 1YK0A 1AD2A 4G5QA 2R4TA 1BMTA 3UA4A 3TZLA 4RZUA 3VHLB 2B6NA 1UBTS 3SZ3A 3TSYA 4O4IF 4B0OA 5K3CA 1Y7LA 3ZDRA 2V7XA 2Y1CA 3BE6A 4JLAA 1HE1C 1TLLA 2P0EA 3IDZA 3QBEA 3UKJA 5FLKA 5C8VA 1GM5A 3FWPA 1A8IA 1DEKA 1PZHA 2Q5CA 2YW9A 1L4YA 1U90A 1GGMA 3FY4A 4YJGA 5P8WA 3QFCA 3T7EA 3UB2A 1FVFA 4G0ZA 1OTHA 1RYBA 4MJXA 5EGSA 3FFAA 4N82A 4IAOA 4QGSA 2DUMA 4TVOA 821PA 3KQHA 2C7OA 2VUSA 2WG2A 4RCZA 4B3RB 1FUIA 4EJSB 1W9MA 2XTMA 1QIDA 4I9GA 5G4KB 2IX3A 2BGWA 2GA9A 4J49A 5E0OA 4ZALA 3P9ZA 3BXZA 2FKNA 4TSFD 2AZDA 1PT9A 2RMKA 4EFLA 2FOLA 2YJ5A 5EOVA 4OHZA 3QUCA 4QFMA 4CM1A 1E1RA 4PBTA 4EATA 2D0IA 2VJMA 1S2GA 4LJ9A 4E1VA 1KVQA 2QN6A 3ME5A 2JEOA 2PSFA 3NT2A 3KKMA 5JNUA 1J0CA 1XLTC 2Q2OA 3MYRA 4CFYA 1CR4A 1UJ5A 3HDVA