4KAXA

Crystal structure of the grp1 ph domain in complex with arf6-gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
163
structure length
163
Chain Sequence
b'GSMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 6
publication title Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 56
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2013-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kaxA00
1KTVA 3Q7PA 4B3DA 3X2SA 1ZJ6A 1NJGA 4OQMA 1YRBA 2A2ZA 4TMWA 2AKYA 4WOPA 1XCGB 1GRRA 2XZPA 3A36A 4IXNA 1DAGA 4RSGA 1W44A 2Q3MA 3U7HB 2QE7D 1QVAA 5FL7A 1WBDA 2GDJA 2IK8A 3MJRA 2WPDA 2YWHA 2DYKA 1U0HC 1NVWQ 5FFMA 5ELXA 5IK2D 3I62A 3R9XA 4ACBA 2WSSA 3KKPA 4MA4A 3I92A 1SXJD 1SKYE 2A9KA 2C9OA 4C2TA 1XXHA 3ZGXA 3ZVMA 5KPJA 1RW4A 5AUOB 3FMFA 1F2UA 2GZHA 4RY2A 1VG8A 1G8HA 1EFRA 2CVHA 1U99A 2RGAA 4ZKEA 2G9NA 2JIZA 2R6CA 3B1WA 5TMPA 2YKGA 2ODEA 1RYHA 3B13B 5FTJA 4D0LB 2RHMA 2WOJA 2ZE8A 1MRSA 1ZINA 1R8SA 1OYYA 4HB3A 1NLZA 3EPKA 4DEYA 1OE0A 2PCJA 4KFSA 1N5LA 4NDZA 1SULA 5AUQA 4KVAA 5HE8A 1R8QA 4KU4A 4NTZA 4KLZA 1UDWA 2KJQA 3LWNA 1DBSA 5TVKA 4LSGA 4LI0A 3SYKA 2QBYA 4HLCA 4NHOA 1E2HA 3DM9B 3CR7A 4BEBA 3AKCA 3SQXA 1KHTA 2JCSA 4BWYA 1G8FA 4HUQA 1XZPA 1Z6AA 2VP0A 1IQPA 3LH5A 4Z1MA 4BRWA 1MV5A 3M4YA 5LB4A 2XAUA 5FOXA 2GZDA 3B1VA 1AZSC 2JLRA 2RGEA 4L9SA 1E0JA 1O3YA 4ASUA 2RGNC 1YZGA 1XD9A 3ZZTA 1IJEA 5BYKA 4AWXA 2YNMA 3H86A 4ITRC 3MJHA 1PUIA 1NG9A 3ZS9A 3CNNA 1QHSA 4P4SA 5K8LA 4GFDA 2QQ0A 4YMTA 3CF2A 3HR7A 1MRNA 4JLOA 4V0NA 4YMWA 3LNCA 2AKAB 4R98A 3CPHA 4TLDA 1NP6A 2XX3A 3LFUA 5CK5A 3SYNA 3AM1A 1FTSA 4WZAE 4ARZB 2V55B 1P3JA 2FA9A 2LKDA 3GLGE 1J90A 4UQOA 4G01B 4PQFA 5KHOC 2JLSA 3TGPA 1G5RA 4P3YA 2CL0X 1NMZA 1W0KD 5J5CA 2JASA 3L8YA 2DFKB 3AVUA 2ZSBA 3NTUA 1NBME 2PMDA 5L3SA 1WDTA 1HTWA 2YC4C 2B8TA 2QRNA 5ANRB 4AYXA 1T8TA 2CHGA 1XTKA 4RD2A 2E1RA 1ZP6A 5TY0A 1G9XA 1GG2A 2GVDC 1DG3A 1A1VA 1VPLA 2QT1A 1EWRA 2F9LA 1L2TA 4EKDA 3GEIA 1A7JA 4UNNA 4CEIB 1S4QA 2QP3A 4M9SA 2RAPA 2FFHA 2GK7A 2ZUBA 2ZPTX 3OZXA 4OQLA 1OXTA 3CUEF 4DT1A 521PA 5G3YA 1JXOA 2H17A 1ZM4A 4MYHA 5EUQB 2ZSFA 2RGBA 3DOEA 1AQYA 1JALA 4MRPA 2RHDA 1E79A 2CNWD 4O25A 3PG5A 4A0GA 4LK2A 2V7QD 4KFUA 5EP4A 3OEEA 3T61A 1DVRA 3NDBB 4LHWA 3L2OB 4PSKA 4HDQB 1HA3A 1N6LA 1Q12A 4TZ6A 1F2TB 1RJ9A 4LHYA 1YQTA 4KCGA 4O2LA 1WE2A 2QY9A 4NBSA 4GDFA 4CZ2A 3WYFA 3A8TA 1ZD9A 5GJVC 2JGNA 3PUXA 4JLDA 2FSGA 2QE7A 2GXSA 4KO8A 5EXSA 1NLYA 4F92B 1PJRA 1DELA 1E2DA 2B21A 4TTRA 1E9RA 1MH1A 3K53A 5IK2A 4B71A 3IDQA 2BJVA 2IYYA 2OE2A 2IWHA 1SXJA 3JVUA 5KYKA 2F1JA 1Q1BA 2IYVA 2AXNA 4K8OA 2N42A 2ZI6A 1GZSA 4PC2A 4KSBA 3R8CA 1Z0IA 4M53A 3BS4A 2WWIA 3AF3A 5BYJA 3GLHA 4B73A 2J46A 1GNQA 3A6PC 5GJBA 4DUGD 4M9XA 3E5HA 4PC6A 1W2GA 2OAQ1 4B3CA 3AEZA 2FE4A 5FOWA 3T34A 2ZI4A 3D31A 4B33A 5TXGA 4Z8YA 5BQ5A 2HT6A 1FL9A 2H92A 2EVWX 1ZM3A 4NCNA 1F6BA 2MSCB 4NYIQ 4D0NA 3BRWD 5JBQA 2AK2A 3QENA 1D8TA 4H9GA 5FPKA 4LY6A 4CEJA 1KSHA 1VHTA 5EE5B 5FPYA 1J70A 2RCNA 4RD1A 4URYR 1WBBA 1HY3A 1X1SA 4U00A 3EA0A 5FPHA 1UFQA 4OJQA 4X8OA 1L4YA 4XOIA 1J99A 1ONBA 1CJKC 4C7OA 3MAAC 4G5OA 3L0OA 1WXQA 4ZDIA 2DWPA 5FTKA 4A8JA 2AK3A 2ZSEA 4EPTA 4R7ZA 5JLJA 3JZMA 4B32A 3GLIA 4TYWA 2ZR9A 2HJGA 4G1UC 1XBTA 2ONJA 5G40A 4A9AA 1A4RA 2UVQA 4MKHA 3FFAA 2PJZA 2NPFA 4PZLA 1QHHB 1SVIA 1OXXK 1S9DA 4A0RA 3EA5A 3GJ3A 3B1ZA 4JLNA 5TV2A 1S1MA 4RKEA 3MWJA 2PCLA 3QKRB 1KO7A 4HZUA 4EFLA 1EFHA 3QPWA 2Z83A 3U3KA 1LW7A 2WWFA 1W0KA 2O8DB 1TU4A 5J4LA 621PA 1HEIA 1P5ZB 3GFOA 1GUAA 1UBEA 4P4TA 1R6BX 1Z83A 2QMHA 1AKYA 3IHLA 4NH0A 4Q66C 4A1FA 3RHFA 2A78A 4JJKA 3AB3A 4Q1DA 1XMVA 1SKYB 3KZ1E 2FEMA 3CF0A 4B75A 3ONWA 3VQTA 1GOTA 1K8RA 2FPKA 4UNRA 3N2IA 4DKXA 3KUDA 1OPXA 4A2PA 4E07A 3WRYC 3AF0A 3LO5A 4DBLC 4I1UA 2VP4A 4KITB 1R0WA 1GIAA 4DLRA 2F43A 2GCNA 2VHUA 2CNWA 3U44B 4TTQA 3EZ2A 5HCIA 3QG1A 2C9CA 2QI9C 5L3QB 3KXIA 2FU5C 3K1JA 3BK7A 2V7QA 2GEUA 3I72A 4Y0VA 1G4AE 3DOFA 4DB4A 2KBFA 2O8FA 3GFTA 3U5ZB 2IYZA 3BE4A 2Q21A 3LV8A 3K0CC 4ZIRA 4ZDJA 5FBVB 3W5JA 3HYRA 2IT1A 2F3RA 4HATA 3ZQ6A 3WP1B 5JSZA 1R5NA 4PQYA 2EW1A 4PSAA 1W4RA 1F60A 1N5KA 4HI0E 3F8TA 5GJCA 1E2KA 8OHMA 4PPQA 3GJ7A 4BZXA 1Q1EA 4OHXA 4C0AC 2G0TA 1P60A 2GEVA 1IY0A 3B1XA 1XNJA 3BB3A 2CCGA 4C9BA 1G17A 4JBYA 1GNPA 4MDEA 1VIYA 4TLBA 2JLQA 2D7CA 3RWOA 1Z2CA 3FPAA 2FFQA 5DYGA 2YOFA 2GBLC 3EW9A 3WBJA 2JJ1D 3QBTA 5EE3A 4QHSA 4DLVA 1EGAA 2G77B 4DUGA 3KQUA 1VKJA 1CR0A 2X2EA 2I3BA 2ONKA 4Q47A 2JLXA 1U0JA 3ND8A 3X1XA 2QAJA 3VX3A 1T5LA 4HLUA 4C0JA 3HJNA 5JEDA 1EESA 5C2JB 1M7GA 4MGKR 4LV5B 1N0VC 1SVWA 1OB2A 1UBFA 1YZUA 4ESVA 1JAHA 3O47A 5JEEA 1XCPA 4LYAA 4C30A 4OI0A 2ZJ5A 5F3WB 2REXB 3M0EA 3Q85A 4D2IA 3I8XA 1K5GA 1ODFA 2CCKA 5HZKA 2ZRLA 5FOVA 4AG5A 4CEHB 4AYWA 4E09A 4TMKA 1RRPA 3TUJC 1NMXA 3MFYA 4XWKA 2WJYA 2QTVB 4Q1FA 1HE1C 1M6NA 2WMNB 3HR8A 1KAGA 4MUBA 1XPRA 5KUTA 3TQFA 3CZPA 4E5UA 3U7GA 4IDOA 2HJVA 4TSFD 3W3ZB 1LF0A 1BOFA 4TLEA 4XSHA 1KZGB 1N5IA 3R9WA 2W0MA 3NEJA 5BN4A 3L43A 4MKFA 4NP6A 4A0FA 2ZRIA 1T3HA 2R65A 1KAOA 3TSOA 3VR2A 3K0FA 3PR1A 221PA 3WXMA 3CM0A 1Z6TA 3KKNA 4LWZA 3BB4A 3THXB 1G41A 1XEXB 3CRVA 4QJ4A 2OZEA 3KQLA 2GJKA 4G5QA 1M74A 2J3EA 3OFND 1FZQA 1LY1A 2VHQA 1ZCAA 3TBKA 1XCMA 2FG5A 4RFSB 3UK6A 4XD7D 3AVOA 2F55A 2Y8EA 1E4YA 1XMSA 1HE8B 3CPEA 4S2EA 4JLMA 1OLOA 5BN3A 2PZEA 2EYUA 2QRZA 4NYJR 4GP6A 1YJ5A 5K8UA 1Z6GA 2ZRFA 5FBQB 1ZD8A 2P6NA 3ZH9B 1HQCA 4MH0R 5FR2A 4PR0A 5AUNB 1V43A 3Q7QA 1X8KA 1DADA 1JQJC 1LNZA 4IVQA 5H68A 2QAGA 1N25A 2ZQ5A 1XMIA 4Q5IA 5FUYA 2ZJAA 2J0QA 3KJGA 4G5RA 1G7SA 2HEIA 3KFVA 1TTTA 2C99A 4IDNA 1GKIA 2C5LA 2IL1A 2QTFA 1FUUA 2JLUA 3AUYA 1G4UR 3PITA 4JT2A 4N0EA 3CIOA 3Q72A 3AGPA 3WNCA 3FHOA 4UNQA 1W5TA 2ZS7A 2BM0A 3W6OA 421PA 5HKKD 3QF4B 4I1OA 2IXFA 4Q9HA 2QPAA 5HPYB 1IXZA 1NN1A 2OUKA 3QIAA 2HLDD 3B1YA 3DEFA 1XWIA 2G6BA 1YU9A 3B6EA 2NO1A 5DSZA 4Q02A 4V0LA 1U2RA 2VHJA 1E0AA 5KTYA 4CGZA 1KGDA 1R5BA 1KSFX 3HU3A 1AGPA 1LS1A 1NKSA 1OXVA 3TVTA 1X3SA 4LBVA 3I8SA 1YR8A 1SQ5A 4ZO4A 5KSPA 1PZNA 2ZEJA 4DC9A 4WAUA 1KO1A 3IQWA 3KKMA 1S1CA 1BMFD 4JSYA 2DR3A 2LCFA 3MWLA 2EWWA 2B6HA 3QKTA 3THOA 2R6AA 4Q4JA 3C8UA 2JJ1A 2ZVPX 3T5GA 3WYAA 3B8HA 1E2QA 3FHTA 1TADA 1Q3TA 3OEHD 1P9NA 2J1LA 4JIMA 1OF1A 1YZNA 3A1VA 4BFVA 1VMAA 2IBMA 3RDPA 4QKQA 3CBQA 3BD9A 5E7IA 2OCBA 4KJZA 3KL4A 2W2VA 3HP1A 2O8EB 4KAXA 3TQCA 1ZUNB 4FMDF 4QNRA 4US1R 1Q1ZA 4NYMR 3LXXA 5CJ2A 3WRXC 3LAWA 4ABYA 2C04A 5JRJA 4R9UC 5BW8A 1W47A 1ESMA 2GJSA 1UKZA 2TMKA 4F4IA 5LDDC 3NEYA 5CLLA 1C4OA 2NG1A 1G21E 3I4LA 4HAVA 5KO2A 3UG7A 1MABB 4HAYA 4D0GA 1QVRA 4LHZA 2VQSA 4I1VA 3OAAD 4TT3D 5CYPA 3NH9A 5FI1B 4TSFA 4G3XA 1Z0KA 2IHYA 2FH5B 2C2HA 2XZOA 3QEOA 1KK0A 4HLDA 3TJZA 2GXQA 4Q03A 3BC1A 4ZCIA 3CX8A 4II7A 1J2JA 3BOSA 4I1SA 1Z29A 4WIAA 3KUCA 1KIMA 1WQ1R 3A1UA 3NC1C 4JL6A 4HLQB 3I61A 4TMTA 1FX0A 3T06B 2ZVQX 5AJVB 2RGCA 2ZS9A 1QDEA 2QNRA 1U90A 4US0R 3WBKA 1HQYE 4ZDKA 3U6BA 1W1WA 3AGQA 3OFNA 4EPWA 1VCMA 4V02A 3KX2A 5FI0B 2WZQA 1T0HB 4IW3B 1BIFA 4XD7A 4PO8A 3H84A 2ODNA 4BZPA 4D6PA 2P3SA 5CIQA 4LC0A 5JFGA 3U7FB 4GOJA 1E9BA 4OQFA 1CJUC 4PC1A 4AKEA 3JZAA 1XD2A 4FMDB 5CK4A 3A37A 4RZ3A 4NPHA 1YVDA 2YJTD 3GJXC 2GEDA 4Q01A 1OIVA 4K81B 4BLQA 1NJFA 2A7QA 4B76A 2VP2A 4HZIA 3NVAA 2WTUA 3D8BA 2WAYA 2VL7A 5GVRA 4YMVA 1KNQA 2ZSDA 4JT4A 4OHWA 3RS0A 4WA7A 3WHKA 4EPXA 4URXR 3VFDA 4PHGA 3EARA 1G5PA 3WYGA 3GEHA 4AURA 1IXRC 2ZJ2A 3B5JA 4C4PA 1OFHA 3U4QB 4C2UA 4U02A 2P6UA 4DRZA 2GK6A 4WXPA 1ZIOA 2RB4A 3RWMB 4XVUA 1ZW6A 1MO3A 1UEJA 2ZE6A 1XD8A 3F3YA 4DLUA 3MWKA 4WZBE 3TKLA 5HKKA 2F9MA 3Q3JB 4PPNA 4IRUB 4UXHA 4E22A 3HPQA 2HLDA 5FTNA 1AKEA 4UXJA 4DJTA 2N1BA 3VHXA 4DEXA 2IWRA 2VIIA 4D80A 3U61B 3LDAA 3HWSA 2A3RA 1GITA 2B8WA 2W6IA 1XTIA 2IS4A 2F1RA 4K46A 2CLSA 1KMHA 3OIWA 3EZ6A 5J47A 2YWEA 4MYCA 2DFLA 5CDFA 2JEOA 2HYIC 2E87A 2ANBA 2GF9A 2VF8A 3NHBA 2CJWB 4B6EA 4O0MA 2PX3A 3KB2A 4QFMA 4F93B 3OESA 1E9SA 1XEFA 2A5GA 3MCAA 3SNHA 3GEEA 2FWRA 3OEHA 1TF2A 3K9HA 3SJBA 1IONA 1AZTA 2PT5A 3A4LA 1TQDA 2ASEA 4EPRA 4KFRA 3CONA 4ZCMA 2NO0A 3H4MA 4KI0A 4YDSA 3NIBA 4F91B 1F48A 1ZYUA 2FGJA 3TH5A 2WICA 2FEOA 4D4MA 4LDJA 2OLJA 5H8WA 2H16A 4IOLA 4LJYA 1IBRA 1OKKA 1G7TA 1P72A 2BJWA 2O8CB 2GZAA 3L0SA 2CLDX 4TYYA 2V1UA 4AKIA 3TLXA 5FBLB 1T6NA 4QGAA 1XTQA 4ERNA 2ERXA 5EE1A 3BB1A 4M2LA 3E2IA 2F1IA 2FDCA 2ORWA 3W34A 4GPTA 3OAAA 2B7CA 1Z6YA 3KFXA 4UNSA 4TT3A 4C0LA 4MYUA 4ZKDA 2QQEA 2FSFA 2R6GA 1KKLA 1VDZA 3FTQA 1SKQA 3DL0A 3K09A 4URZR 2HDNB 1IAQA 3O8BA 4J0QA 2VYFA 4W5JA 4EFNA 5FUVA 3VHLB 3RABA 2W00A 3LD9A 4OHVA 3VKGA 1U9IC 1QRAA 2C95A 1N6OA 4GSYA 5C4GB 3GLFB 1E9AA 3IO5A 4PFSA 1Z0FA 4PHHA 5CYOA 1PLLA 2HXYA 3T5DA 4C3ZA 1G8YA 2F7SA 4CT4B 1NVVQ 3I32A 4FMCB 1MT0A 3U6KA 1ZCBA 3FWYA 4LHVA 2WM9B 4LGMA 5P21A 2JLYA 2CK3D 2R2AA 3P27A 5L3VA 1G1MA 1X1RA 2H5EA 5J4YA 1H8HD 1YRAA 1DAKA 2L0XA 5JHHB 1XZQA 2BKUA 2BDTA 1SZPA 3NC0C 3RLFA 4V03A 3RSOA 3BFVA 1DAHA 3LX8A 3HPRA 1R5OA 2H1LA 2ANCA 2CLCX 4OQNA 4PPFA 2PL3A 5KNCA 1E2GA 1KNXA 2ZI9A 3PVSA 2WWYA 1KI6B 4PAQA 1WRBA 3QJYA 3IKJA 2ZRPA 2DY1A 3GQBA 5FUXA 1JEEA 2C8VA 3QNUA 4W5WA 3KQHA 1WP9A 2GKSA 1W46A 4W9MC 5JWOA 2BMJA 2C03A 1JR3D 4ZV4A 3KXLA 4AK9A 721PA 4FCWA 2IYQA 3SU8A 4P32A 1U8AA 5E3HA 4C0HA 1NSFA 3KKQA 3ZVRA 1QHNA 1YR6A 3GFPA 1CXZA 1HT2E 3PUZA 2QMUA 4DLYA 3W3AA 1MR3F 2NTYC 1V5WA 4AYTA 3MMPA 5D3QA 4NU0A 3GJ8A 1DAMA 2GWHA 5UKDA 2VPPA 1TF7A 3SFVA 3B85A 5EE0A 4TTPA 1D9ZA 2YOHA 2W0SA 1E2MA 2ORVA 1E6CA 1I2DA 3DZ8A 1II8B 5IT5A 1E94E 3KTAB 1AJEA 4TQUS 3KXKA 4TL8A 4RD6A 4GBMA 3B78A 1YZTA 3TUIC 2QP4A 3W6PA 4ARZA 4DCUA 2C96A 2OCAA 2QU8A 3B82A 5G53C 1XU4A 4RD0A 3UKDA 5EP1A 1XPOA 4PHFA 4TWZA 1U98A 3TUZC 2MSEB 3QF7A 4HEJA 4ZI3A 4CYMA 1NL3A 2PT7A 1NKTA 5CB6A 2H57A 2I1QA 2CMKA 1K6MA 2ZR0A 5DIFA 2FFBA 1AM4D 2P65A 1GM5A 2ZR7A 3PCRB 1BKDR 2P5SA 1ZM2A 2C77A 3NBYC 1KK1A 2FPLA 2KSQA 3RS5A 3AVYA 1UM8A 5FBWB 2OESA 3BGWA 2RGXA 2NO9A 4P33A 1TX4B 4CEIA 1DG1G 4LPSA 2ERYA 4EQ6B 2R6FA 2ZJYA 4KBGA 3L0IB 3R20A 1E99A 3TIFA 2YV5A 2GJ8A 3CNOA 1RIFA 2WKPA 5KNDA 3K0AB 3KQKA 1Y3AA 1W2HA 3SE0A 1KI9A 1NY6A 5LBIA 1YKSA 2A5FA 1AK2A 2IA5A 2C9YA 5F98A 2Q9CA 1CF4A 2F3TA 2KE5A 1UF9A 3QXJA 2P2LA 3QVUA 5C18A 1E9CA 2AD5A 4GT1A 5H70A 1FQJA 5FL3A 3RNLA 1F2TA 2K5UA 2I1VB 2DPXA 3RSLA 1XJCA 5EE9A 2XXAB 1JEDA 1RE0A 2UZIR 1Q44A 3R7WB 2ZITA 1GFIA 1VYTA 2UZ3A 4EJSB 1ZMXA 2MMCA 4M1WA 3RS2A 1FP7A 4AC9A 2Z4RA 3KJIA 4GL2A 2HF9A 1KY2A 2ZYVX 2CHVA 2CK3A 5KSYA 4OI1A 3RVBA 3X1ZA 1H8HA 4UJ3A 2Q0HA 5FBRB 1E2NA 1OIXA 3HDTA 4R71A 4QNMA 1D2EA 5B30A 3GPLA 4UJ5A 4XSGA 2IYXA 2N46A 2WKRA 3IHWA 5JCPA 3REGA 1XMJA 3WMGA 4DWJA 1W36C 4M8NE 1GDDA 2RGNA 1KYIA 1G7RA 1QZXA 2QZ4A 1Z0AA 1KJZA 3UPUA 2R44A 3R9IA 3PV0A 2ZROA 2IC5A 3VU9B 1N6HA 4LV6A 2A5DA 2F6RA 3H0KA 2IX3A 3AP3A 1JR3A 1HH4A 4JL5A 4NZYA 1NBMD 5DN6D 2QEQA 1IN6A 2CL6X 4V0ME 3A1WA 2BMDA 3FGNA 3EWAA 1UKYA 1TF5A 2AFIE 3MUFA 4M1OA 1U94A 2J9RA 3VR1A 1B0UA 1KMQA 1Q20A 1H8ED 2ECKA 1Q21A 2PBRA 1VCOA 4HAXA 3PUVA 2XSZD 1PLKA 2FNAA 3QI2A 4D4JA 1MKYA 5EXTA 4KBFA 3SDZA 5JCZA 1CULC 2IYWA 3EG5A 3UWOA 1I2MA 1E2FA 1WMSA 2AWNA 5C4MA 5DNYB 5EZ5A 1KDPA 4OI2A 1PLJA 4Q00A 3CH5A 4FN5A 3QBVA 1QHHA 1VTKA 3DHWC 1KI1A 1YHNA 3AUXA 4O2RA 5EP2A 2NZJA 4BFYA 4TYPA 2P5TB 1RC8A 4M1KA 3B9QA 2XOKD 3QKRA 1E9DA 3ZVLA 4LJ6A 2OLKA 3UATA 3IIKA 2WVJA 2A5YB 5DI3B 2O8DA 1S8FA 2V9PA 1M7HA 4QBGB 4B3XA 4BRUA 3FYHA 2RKOA 3C4JA 4WBSA 1J8YF 2R8RA 3W8RA 3QSYA 3RRNA 1ETUA 4TYQA 2QG6A 3EC2A 1SGWA 4TQAA 4DZZA 3T12A 2IYRA 4AI6A 2QSZA 2DCUA 2IYSA 4C0SA 5M04A 4FWIB 2YWGA 1Z47A 4UNPA 2OFXA 5BN5A 4V0OA 3B60A 4JVMA 4NYIR 2DBYA 3TNFA 1C9KA 2AN9A 3AP2A 3LX5A 2FPMA 1Z3IX 1DO0A 2ZAOA 3TAUA 2ZU6A 2GCOB 2FX3A 1E4VA 4LHXA 2HT1A 2VSXA 1VCNA 2BVNA 2D2FA 2FOLA 4OK3A 2PLFA 3U44A 1RPZA 4LJ8A 4GOKA 2HF8A 1R2QA 2IEZA 4Q1EA 4YLGA 5L3QA 2O8BB 1FW6A 1M1YE 3GLGB 1KO4A 3GJ6A 5DH9A 3PXGA 1KK3A 2ZE7A 4FCVA 4I4LA 2BKEA 5C1BA 3I5YA 2J0UB 5CM8B 4LBYA 1VG0B 3T35A 3CX7A 1KI8A 2OCPA 2D2EA 3THYB 2PH1A 5CDFE 5SZKB 1MO5A 1UPTA 2X8AA 1W36B 2BBWA 2BEKA 1MO6A 4LJ9A 5GVSA 3A4NA 4D81A 1DARA 2ZREA 4QGGA 1GWNA 3WNBA 1F5NA 4HSEA 2W2TA 4IDQA 2LKCA 2WJHA 3IEUA 1G8GA 5DI9A 2G1JA 2NO6A 4DCSA 3V4RA 1AS3A 1TEXA 4KODA 3DDCA 4D4KA 5DYIA 4OQXA 3IQXA 5HTKA 2D62A 4QG7A 1DAEA 4M9ZA 4R2IA 1XXHE 2NOAA 2VA8A 2QN6A 3BH7A 4N3NA 1NI3A 1O87A 4PC7A 1FFHA 5JWRA 1VYVA 3AV0B 1D5CA 1G6HA 5IRCD 1NBMA 2HUPA 4IJMA 5DN6A 3AVQA 2ZRKA 5EXPA 4EPYA 3TW4A 4EAQA 3EIHA 1JXMA 1XF9A 1EFTA 2YINC 3IUYA 4FIDA 3BH0A 4LJAA 2ZU0C 1N2CE 3LQRA 4TMXA 5A5GA 4CEHA 1US8B 2WWWA 2OM2A 3UXMA 2XGJA 1BYIA 1H8EA 5AR1A 3FFBA 4M9QA 1N6NA 4U7DA 2XSZA 1OH7A 1VG9B 1D6JA 1RYFA 1IN7A 2H8KA 1S3GA 1Z5ZA 5B2ZA 5DHFA 4N0DA 1NN5A 2GJAA 2NIPA 1YZQA 5HZHA 1E1RD 2W6JD 3BAFA 2V8OA 3SHWA 2HXSA 4BASA 3N5CA 1EFCA 3TR5A 2PEZA 3C14C 3PFIA 4DCTA 3IBYA 4CT5A 1E2PA 2RH5A 4OK6A 4Z54A 3CW2A 2MMGA 4DLWA 1CJVC 2IF2A 2VRWA 2WHXA 1S3SA 3IILA 4JKYA 4UKDA 3HU1A 1L8QA 2XOKA 3D6TB 3M1IA 5CIWA 4URVR 5B58C 4QRHA 5FR1A 4BLOA 3K9GA 3U2QA 3AP1A 5E7JA 2AFHE 2IUUA 3QQ5A 4MGIR 1CEEA 3THXA 2O0KA 1XEXA 4IEIA 4B34A 1U0LA 2LWIA 2WV9A 3LW7A 2OEPA 4X8HA 4Q21A 4NONA 1A5TA 3THWB 3LY5A 4QJ3A 3CR8A 3DKVA 3RRMA 5B57C 3F5FA 4RFSA 3QKUA 3K0EA 3QXSA 2WMOB 4PO9A 3FB4A 2QL6A 4H1UA 4JBXA 1TMKA 3RS4A 1UKVY 1FUKA 2RGGA 5SZIA 1YZLA 1ESNA 1G64A 1W49A 1R0ZA 3K0CA 2EYQA 5JJIA 4TL7A 2DFNA 2PEYA 2OBMA 4OBEA 3CH4B 2GNOA 3DPUA 4A2QA 1VECA 5FOTA 1EFUA 5D3MB 1OH8A 5KDOA 2QM7A 3ASYA 2DWQA 3AF1A 1W5SA 2QSYA 5IDVA 1FMLA 3BXZA 2KBEA 4B47A 1E0KA 2WAXA 2J7PD 2ZRGA 1OJLA 2CCJA 3FVQA 4IHQA 4LUCA 4PANA 5J40A 4MRSA 3REFA 3CRQA 3QKSB 1HURA 3ZLJA 2J7KA 4O3MA 4BFWA 2Q6TA 3B7GA 4Q4AB 2Z6VA 3T1VA 4YXWD 3SZRA 4PZZA 3AVWA 4RCYA 4RCZA 3QF4A 4NCKA 1OFIA 4BPBA 2ZE5A 3AQ4A 2GBLA 4IOKA 1TUEA 1Z08A 1CKEA 1KY3A 2J0VA 3ICEA 3RRYA 3VKHA 1CJTC 2ZJ8A 1PUJA 4FW9A 3QE0A 2NPIA 1E9FA 4JLBA 2XB4A 2BCGY 2ZANA 3KDSE 2V6JA 1YR9A 1NVXQ 1G5TA 3AKYA 4A92A 2ZJZA 5KDDA 1R4AA 1VHLA 1RRGA 3L0PA 2ZRDA 1N6IA 5GJWC 3ZVNA 1TQ4A 2O0HA 4TMZA 1NN3A 4URWR 1CU1A 4WXRA 5FH9A 2XTNA 3TSZA 4RD3A 2QT0A 3LW8A 5FPSA 1SXJE 2BMEA 4JS0A 4OK5A 5CJPA 4Z8XA 4JYCA 3BORA 3QY0A 1E9EA 2FGKA 2QGNA 4WZ6A 3UMFA 3VR3A 1CJMA 3K70C 3NHAA 1B23P 4TMVA 3KJEA 2J0SA 4G5SA 2XTZA 3RS3A 1OB5A 2O8EA 4FCTA 3U7EB 5F2EA 3LRPA 3GLHE 4RZXA 3W6NA 2W2XA 3DMDA 3SOPA 4HDCA 1UBGA 4BE7B 4JJZA 4D4LA 1KO5A 2YZ2A 5SZJA 4Q4HB 1GVNB 1MABA 1EWQA 2QMEA 2KWIA 1BH2A 2X19A 2ZI7A 2VSFA 4PSVA 1VG1A 4G5GA 5JHGB 2IYLD 3ADKA 4TL9A 5DO9A 4LYFA 3VKWA 1T9HA 1E1RA 2IW3A 2BBOA 2W6JA 3ZIAD 2D06A 4C0KA 4I81A 3IIMA 3B9PA 1ZRHA 5AWFC 1SHKA 4IFEA 2J5XA 3S1AB 1FP6A 1NIJA 2X77A 2PZGA 2V6IA 4DCVA 4Q1CA 1GAJA 1DEKA 1S96A 3ZZ0A 3AH8A 3GLIE 1JBKA 1EX7A 1G3MA 4B35A 4MKGA 3MGCA 3LBHA 2VP6A 1E2IA 3H2YA 5BXQC 2GF0A 2NZ8A 1NLFA 1FPMA 3PUYA 3W9YA 3TW8B 4IFBA 1E32A 3O8CA 4MGYR 2Q3FA 4ESHA 1G3UA 4LPKA 4MGZR 2CE2X 4A36A 4FI3C 1C1YA 1K5DA 2H18A 1E96A 4B2LA 1P7CA 1T8UA 1NIPA 2ZS8A 3TRFA 4QBFA 1OFUX 3CNLA 3QVVA 4E03A 1BMFA 1NMYA 3CWQA 2QGZA 3UWKA 1GL9B 4GI7A 3TE6A 2Q9AA 4DVGA 1X6VA 1W4CA 1R0XA 2IUTA 4JMPA 2G83A 4FMCF 5KPDA 3UANA 2HV8A 2J7PA 2VF7A 1JQLB 3U4QA 1XXHB 1RRCA 1DPFA 2REBA 5EXXA 2CEAA 4S35A 1G16A 1F2UB 5EJEA 2Q9BA 4KSCA 1XJQA 5SZHB 2EQBA 4KV9A 4B3BA 2NGRA 4YXWA 2CL7X 4B6FA 4C0QC 4EPVA 2QUZA 5AJWA 1M7BA 2EWVA 1LS6A 3QXCA 1KSGA 5A4JA 1U8YA 1YE8A 1JR6A 3IIJA 3SR0A 1KI7A 2YVUA 3IPYA 4JLVA 2QPTA 1CS4C 3PIRA 1SXJC 3QPUA 4EIWA 1N5JA 3F0TA 1N0WA 3PEVA 1N6RA 4I99A 5LPNA 3LVRE 3K70B 3VX4A 3EPHA 2QBYB 4U5XA 4BLPA 4BFUA 3GCGA 4ACAA 3QXHA 3WMEA 4HUQB 4TYNA 1KDRA 3UIEA 1PV4A 4AD8A 1XEWX 1FOEB 1T91A 2FMXA 3GMTA 1N3BA 3RRZA 5JS8A 1WCV1 2CJWA 2WIBA 4BECA 2BM1A 3NBFA 1P73A 1XRJA 2XJ9A 1OYWA 4RZUA 1ZAKA 4XJXA 2VHCA 4YQFA 3OIVA 3AVXA 3G82C 3TSWA 3DM5A 3RAPR 2GA8A 4P4SB 1OH6A 3EASA 2WOOA 2H7VA 5KOYA 2HCJB 3UMRA 2ATXA 2VBCA 1W48A 1GL6A 3DVLA 1UEIA 3I1FA 4Z51A 1M34E 4OJKA 2AX4A 2ORIA 5JI2E 4X8MA 3LBNA 3N2EA 2CE7A 4DIEA 5FPTA 2IYTA 4HDOB 4JZKA 3NWJA 1UDXA 2ZTSA 1YZKA 3NBZC 2B92A 2VEDA 4F4CA 2O8CA 4A8JC 2OFWA 1ANKA 3AKDA 4L9WA 1KK2A 3RANA 4F4JA 4Q9IA 1GRQA 3C5HA 4OI4A 4BEJA 1P61B 3U3OA 2WKQA 1OH5A 5L3SB 2MSDB 1QG2A 1IN8A 4RD4A 2ZUDA 4EJSC 2D7DA 2YYZA 2XJ4A 2VP5A 3IBGA 3ZIAA 4D25A 1E2JA 1W4BA 2V54A 4B43A 3FMIA 2V3CC 1RRFA 3NH6A 1QHYA 5EZ6B 4QHYA 3ZYCA 1Z06A 3FOZA 1AGRA 1XB2A 4PZYA 2EU8A 4YDHB 3QG5A 2ZRJA 2XTMA 4CIDA 2EFCB 1Z28A 2SHKA 3T1OA 1CR1A 1NN0A 2OV2A 3ETLA 2WWXA 4NKRA 3NXSA 2ODBA 1TUIA 3DMNA 1T5IA 3GLFA 1D2MA 4DT1B 1JECA 1KSJA 3AF2A 3N70A 4ON9A 3SEAA 3KJHA 4OHZA 2WJGA 1N6KA 5J4KA 1IY2A 1P6XA 1RKBA 4JKIA 4Q9JA 4IDHA 4LYHA 1HUQA 3P1JA 1LB1B 5DE3A 1IJFA 2XEXA 1AQUA 5F9HA 2RGDA 2WWGA 2CVFA 4NCHA 3AVPA 1COWD 3FMOB 4QGFA 3BERA 4LC1A 3MSXA 4NMMA 4F38A 5DISB 1QHGA 3SBEA 2X2FA 1EXMA 1RJ9B 1SVMA 1DS6A 2ZRAA 5IF9A 2WIAA 2D74A 4PC3A 2VHTA 3PEWA 5JI3E 3Q8XB 3LXRA 1GNRA 1NF3A 3O8RA 4L15A 5FOSA 1OHHD 3V4FA 1KI6A 1MOZA 4LCBA 2BHRA 1NG1A 2OXRA 4GP7A 2UKDA 5KU1A 1ZU4A 1XTSA 4IDPA 2AD1A 1DOAA 1SXJB 1W4AA 2QROA 3SN6A 3TAHA 4D82A 2ZETA 1A2BA 1T3SA 3Q5DA 3QXXA 1A2KC 1G3IA 3P4XA 2ZI5A 2ZI3A 2BMFA 3ICQB 1CTQA 2ZUCA 1A82A 2JAQA 1VIAA 4KYUA 3EXAA 3C41J 4IVRA 3PENA 4P0TA 3WNDA 3KQNA 2FZLA 3ND9A 3CRRA 1Q3HA 3NDPA 2WJVA 3OF5A 2OXCA 4LOAA 3GLHB 3IGFA 5JJLA 3FKQA 4BUJA 3FKSD 4JLKA 4P31A 1G3RA 1F3OA 3DO6A 2GILA 4UXIA 1ELOA 4LJ7A 5AK0A 2JLZA 5FUWA 1EG7A 2KB0A 2VP9A 4OKSA 4DLSA 4DLXA 4L8GA 4Q48A 4PPGA 4HAWA 4JL8A 3ZJYA 4R2HA 3SJAA 2HCBA 4TLAA 4CVNA 4QM6A 3MD0A 2FFAA 2CXXA 4JVLA 4TZ0A 1GL7A 1KDTA 4CEJB 1NVVR 4C0BA 1II8A 3DKPA 3KTAA 3M6AA 4GNKA 5H1YA 1JAIA 1OXSC 3ZQJA 3TK1A 2R62A 5HE9A 1OFTA 1HT1E 3EZ7A 4HYYA 4C7OB 5AJXA 2GTPA 1GP2A 1TQ6A 3B2EA 4B2IA 4DHEA 2V1XA 3UMSA 3W90A 1U8ZA 4HLUC 4A8JB 1ZM9A 5B64A 3ASZA 3GLIB 4RFVA 2E9SA 1II9A 1P9WA 2J45A 3TVDA 1Z8FA 2W83A 4LJ5A 1GILA 1H65A 4XWAA 3X1YA 4DSUA 5EUMA 5JWHA 3SHFA 2ZJOA 3X1DA 5JMTA 4AKHA 2JJ8A 3QOFA 1Y63A 4Q7MB 1XX6A 2XNDD 5TARA 2OBNA 2BBSA 2WWHA 4HZUB 4JLAA 1ZNXA 4EQ6A 5IHPA 2WJIA 2ZRBA 1XJ0A 4W5HA 5A0FA 3ADBA 3VNVA 1Z07A 3U3JA 1U9IA 1TNDA 1W0JD 3V9PA 3C5CA 3K0AA 3NKVA 1P4SA 4A15A 3SFZA 1OV4A 1P75A 1XTJA 4HUTA 5AJZA 4PXAA 2Z4SA 3JVVA 2G3YA 3GD7A 2JDID 4QM7A 4V0KA 1ZM7A 1D9XA 3RYTC 1JNYA 4BLRA 1NNEA 3EIQA 3SBDA 1WA5A 3Q5EA 3VAAA 4XIGS 1NSTA 1QHXA 2BOVA 2GJ9A 4FD2A 5F9FA 5G41A 4ZI2A 4BGDA 2XXAA 4AIIA 2YWFA 1T4GA 3VR4A 4JVSB 4KXFB 3R7WA 3WHLA 1CRPA 2CDNA 3LLMA 1W36D 1IY1A 4EJSA 1G19A 2G1KA 2JLVA 3VNUA 2F43B 1FNMA 4LRWA 4RJLA 5LD2C 3PEUA 1OT3A 5C46F 2GAOA 4XWOA 2DFTA 2C78A 4Q7LA 3K0SA 1COWA 1EX6A 4TQ9A 4YC7A 3LQQA 4CF7A 2GESA 4M1SA 4NCIA 2O8FB 4QOSA 3U3RA 4YMUA 4F7WA 5J4HA 2ZYTX 2GAAA 2WSMA 5DGXA 4XH9B 4ZIRB 2GXAA 1G291 1E1QD 5TDHA 1OSNA 2QP9X 2WBLC 2QAGC 3SI7A 1OHHA 1Q0UA 5JSZB 1XTRA 3ZS8A 4KHZA 1LV7A 1R7RA 3CZQA 1TL7C 3VU9A 1W7AA 1I4TD 4IOMA 3VR5A 4Q9KA 3VMFA 1Q1QA 2HYDA 4IVPA 1P2UA 4GMXA 4LBWA 1GSIA 4QL3A 4JYBA 4GOXA 1GTVA 2GCPA 1FTNA 2QORA 4LYJA 2YOGA 3SJZA 1SVLA 4DSNA 2REOA 4ZDWA 1LF5A 1CBUA 4WW0A 3FKSA 4M1TA 1E98A 2XITA 3DZDA 4EDHA 1PVOA 2J59A 2Z5FA 1ZNZA 3BH6A 5DHAA 1XPUA 4XVQA 1L7VC 4QJ5A 4NYJQ 5FTLA 2VTKA 3RS7A 1XFAA 4JSTA 4A2WA 1D2NA 5EQTA 1QG4A 2NQ2C 2BIFA 4QHTA 4RKFA 1WB9A 3LVQE 3TMKA 4W7SA 4POAA 3CKLA 4OL0A 1G7CA 5JS7A 1OW3B 4KLNA 3QPVA 2A30A 5CLQA 2OCYC 1SVKA 2I4IA 5K8IA 3IEVA 3MG9A 3CO5A 4IXMA 5DI3A 3WMFA 2D3WA 4BFZA 4MRRA 2FSHA 2J87A 1EK0A 2ZXUA 3QEJA 3A4MA 5JJKA 2B7BA 5TB5A 4RVCA 3AF4A 1G18A 1U81A 1X8LA 4MRVA 4YMSA 3NBXX 1Q22A 2BEJA 4KFTA 4FMBB 1IN4A 4FXPA 1T0JB 2XNDA 1II0A 2IYUA 3LLUA 1R0YA 1ZC3A 2VH5R 1ZNYA 3OE7D 4HB2A 3K0FB 4IOJA 5HR5A 4NCJA 3HYTA 4JLJA 1RFLA 3BFKA 4HAZA 4ZCLA 4KYIB 1W0JA 2GCOA 4BFSA 1DAFA 1RZ3A 2XB2A 1AIPA 5FOUA 4BFTA 2PJRA 2FF7A 2O8BA 2JLWA 1JPNA 2AR7A 5E4FA 3FE2A 4L16A 1R10A 2ATVA 3P20A 1BO6A 2JDIA 2OHFA 5LD2B 3CRMA 1ZC4A 1E0SA 2OT3B 3P26A 3BBPA 3GLGA 1NY5A 4GRAA 2J0UA 4LJ4A 4DLTA 2AL7A 4TL6A 1IOZA 4GZMA 4Q7KA 1QHIA 4P4UA 4RZ2A 3THYA 4L5BA 2O52A 1BYUA 1IHUA 2ZRCA 2QAGB 1IM2A 4NYMQ 4DDTA 4TLCA 2ZAMA 3IO3A 3MWYW 3AVVA 1FMJA 4M1MA 4DIDA 1NRJB 3PUWA 2BBTA 1Z6XA 3GJ5A 4PX9A 4MUAA 2JJ2D 1P2SA 4KVGA 121PA 1ZUIA 2JATA 1ZVQA 2EFGA 2V4ZA 4MITA 5EP3A 2XZLA 2Z43A 4JLPA 3U60B 3L8ZA 3E70C 2OSBA 1DE0A 2R9VA 2P6RA 3I5XA 1FQKA 2IF0A 1E1QA 1RVDA 4WVFA 3CWZA 3I3SR 4GZLA 4FWTA 4DSOA 4B3FX 2J41A 1FNNA 2NMVA 1AN0A 2GRJA 4LZZA 3D7MA 3EC1A 1GRNA 3P4YA 3BIFA 3CPJB 1J8MF 4B48A 1P9RA 1X8JA 1UADA 4IKEA 3SJCA 4HAUA 1G3QA 1N6PA 2EFDB 4LV8B 1S0UA 3T15A 4B2PA 4H1VA 2FZ4A 2PX0A 1CIPA 1CRQA 3LBIA 4PAOA 3ECCA 1OIWA 4A6PA 1IXSB 1US8A 2ZYUX 4LX0A 5CB8A 4Q4JB 4DDVA 2DWOA 2DHRA 2OO7A 3ZD6A 2QPOA 2IXGA 4DDWA 1LFDB 3CB4A 6Q21A 2QENA 3CRW1 5LB2A 1TEVA 3GLFE 4EFMA 3I73A 2DB3A 5DLQC 5KNBA 1XDBA 1TU3A 3SQWA 4AKGA 5BWMA 1Z63A 4PHTA 3SYLA 4BLSA 3ADCA 2GXUA 4M1YA 1M8PA 3OIYA 1CR4A 2NO7A 1E2LA 5E7MA 4B74A 1M2OB 5KSZA 4CDGA 4XTCS 3W8NA 2A5JA 1CLUA 1SHZA 3V00A 1JJVA 2W6ID 5L3RA 2QA5A 1G8PA 2VSOA 1SVSA 3VR6A 3AKEA 4BFXA 3L82B 2ZRNA 3PJRA 4MDFA 2EFEB 2GVZC 4JVNA 3RC8A 4Q18A 2WJJA 1YR7A 3VTKA 4CRWB 2BC9A 3THWA 3G0HA 2Z0MA 3GJ0A 2P0EA 4QGHA 2R6DA 3EX7C 4DSTA 2G0NA 1BS1A 1KOFA 4Q9LA 4ZPXA 3QUSA 2G88A 1ZU5A 4Q4LA 3C16C 821PA 2AWOA 2KI5A 4YONB 1G20E 3MRSA 3OE7A 5L8VA 1SVOA 2IXEA 2GHIA 4A6XA 4MKIA 4BQSA 2ZIAA 1ZD1A 5FL7D 3R8FA 2WPDD 1FX0B 3AVTA 2O0JA 5D3MA 1KO8A 3RC3A 3ZD7A 3E1SA 1TAGA 4A4DA 1CP2A 3K9LA 4MYTA 1IN5A 4X8LA 2WSSD 4A82A 1JPJA 4PTLA 4B44A 3NG1A 1Q57A 4IEEA 1OKKD 3OIUA 4PAMA 4M22A 5AJYA 5GADl 1UAAA 2BV3A 2BCJQ 2YC2C 2QM8A 3K09C 1JB1A 3MLEA 2GETA 5G3ZA 3ZDQA 3QKSA 3ADDA 2YHSA 1E69A 1S2MA 4MQBA 2ZM5A 2PZFA 2IS2A 3BWDD 3LA6A 4Q4AA 2AHOA 3D3QA 5KDLA 1EFRD 1XP8A 2PMKA 2OBLA 4DDUA 5J4VA 5JECA 5K8TA 1P2TA 1S9HA 3A1SA 4DXAA 1QF9A 3EZ9A 4G0NA 1XD2B 1KJWA 2JIZD 2OAP1 3EAQA 4V0MA 4FINA 1AS0A 4M21A 4M0LA 1ZNWA 4QXAA 1G6OA 1AS2A 1DTSA 3C15C 2IS6A 1E3MA 3KKOA 1Z22A 1UBCA 1QBKC 1MO4A 4EUNA 1UJ2A 4N1AA 1TQ2A 3K70D 3GP8A 4OHYA 3O8DA 4Q7JB 2QTHA 2OILA 2JJ2A 1ZUHA 4A0HA 5JZVA 2ODWA 1UKEA 2CBZA 2ZJBA 4Z1MD 2ZYWX 1KI4A 2IUSA 2FN4A 1KJYA 1LTQA 4DB2A 3EPJA 3OHMA 4LBZA 1Z0DA 4ASUD 2VO1A 5E95A 3EZFA 1TPZA 1E2EA 4GMDA 2ZRHA 3Q9LA 5AUPB 3GJ4A 3KB1A 3SC3A 2OFOA 1HYQA 2BWJA 2FV8A 3CLVA 3TR0A 2W58A 5CITA 5HCNA 3U3MA 3W5IA 3PQCA 1Z0JA 2ZSAA 2O5VA 4DLZA 3FDIA 5JRZA 5FTMA 4D26A 1VCIA 3X1WA 4NL4H 1J7KA 2XNSA 1NVUQ 1GKUB 2EFHB 4URUR 1GKYA 1KKMA 4L4UA 2QMOA 2C98A 1P2VA 1XEWY 2F1HA 1VYUA 3T1QA 1KI2A 1KMHB 4XVRA 3K9NA 3G5UA 2IS1A 1N0UA 1JJ7A 1DAIA 3K8YA 3EIEA 4DCNA 1KZ7B 4Q4HA 2FSIA 4Q19A 2X1VA 3WY9A 4XTRA 3UG6A 1I4LD 1X86B 3ZZUA 1JR3E 3A1TA 5KSOA 4US2R 4B3GA 4BLTA 2IEYA 3A58B 3C7KA 4HB4A 4QBHA 2ZRMA 1OXUA 3EPLA 1P62B 4CW7A 4Q1AA 1KDOA 1L4UA 3BFXA 1AA9A 3H1TA 4AY2A 4QBIA 2P67A 3HU2A 4Q1BA 2VLIA 3WP0A 3PEYA 3S1AA 3T1TA 3J81k 3CF6R 1KI3A 4NE2A 5CM9C 2OG2A 4ILEA 3EWSA 2AXPA 3BJIC 4BZQA 1DO2A 1Z2AA 4AG6A 3P32A 1HV8A 2CHQA 2D4HA 4JBWA 4PO1A 2FJUA 2IHBA 1I4DD 3IPXA 3CX6A 2JA1A 1ZBDA 4HB0A 2Q3HA 1E79D 4PQRA 2PLRA 4QC2A 1CR2A 4OYHA 1WF3A 3FMPB 4MRNA 1JI0A 1T3LA 3FHCB 3SS8A 4TN1A 4M4SA 4Y0AA 1LVGA 2RMKA 3OEED 1ZIPA
chains in the Genus database with same CATH superfamily
3RYFA 1R9GA 2A0XA 3Q7PA 4UTVA 1GLVA 5K01A 1XMOB 2A2ZA 1VKOA 1SZJG 4D4IA 1XCGB 1GRRA 2XZPA 1FXWA 3K2QA 1DAGA 2I3AA 1W44A 2Q3MA 3KCNA 5AI0A 5HWSA 1T15A 3R7DA 1JDUA 5EJGA 3R6DA 5IM5A 4YRDA 3G85A 1NFQA 1NBEA 5IHXA 1U0HC 1NVWQ 3JPYA 4YEDA 2A9OA 2MDTA 5IK2D 1QMGA 5ARDA 3OLXA 2EQAA 1LA2A 4MA4A 2PFKA 3A1FA 4JA0A 3I92A 1SXJD 1XQ9A 3DW1X 2IYOA 3P9CA 2C9OA 2CKDA 4FFPA 3RVRA 2ZT6A 2AFVA 2JI8A 4C2TA 5ALGA 2XH8A 2MIIA 4LRXA 4O29A 1XSEA 2DHQA 1T4DA 1OZ0A 3I01M 3JALB 4CIXA 5A3JA 4P84A 2UYOA 1F2UA 3OJLA 4EKGA 2D5BA 1G8HA 1J6UA 2HW8A 3J7AC 4LOLA 3M81A 1JSLA 1U99A 5SYNA 1NRWA 2B82A 2BEUA 2GGSA 2WQ6A 1XZGA 1BXGA 2JIZA 4HCJA 2PIDA 2Q8QA 2WVGA 2OP0A 4EYKA 2YKGA 1SIUA 3R5TA 4RHFA 2C4WA 1NVFA 2NAFA 1MRSA 1ORDA 1A71A 1H66A 1RAAA 2P5UA 2QM3A 1NA5A 1OE0A 2SNIE 1N5LA 3CHYA 3JZIA 4E1AA 4R2KA 5HE8A 3GQBB 3ZY4A 4M0DA 4DC1A 1LPAB 4BATA 2AC7A 1LU9A 2V5UA 3LWNA 2J5RA 3GVCA 4LYYA 5HF9A 3AEXA 2PKQP 4HLCA 4NHOA 3Q6IA 3BQMB 4BEBA 4IHJF 3BTSA 1V8OA 3D6FA 4NBWA 3SQXA 1Q1GA 1XHLA 2YASA 3V1NA 1QIGA 4HUQA 2BGWA 2VP0A 1NNUA 3LH5A 4HDRA 1KRHA 1YBVA 3BF8A 3M4YA 1PL8A 2CNLA 4OB7A 3KOXA 3U49A 1W4ZA 3T7IA 2XKBA 1YZGA 2H5JA 2OGUA 3BWYA 1KZ4A 4IR7A 5K3SA 4J9UE 2FMKA 3PGLA 1QPBA 2I2XB 2ZKLA 3MJHA 2AEMA 4LYGA 2L18A 3MELA 4RE6A 4OAOA 3ZS9A 1E77A 3PQ2A 4JBLA 3RK0A 3M89A 1B6RA 2QQ0A 4DQVA 2VZ8A 3EF3A 4YMTA 1SUSA 4KGXA 1X7ZB 1YE3A 3COPA 4J1NA 4EHAA 3HR7A 5ERXA 4JLOA 4V0NA 2Q6LA 2H2WA 2YN4A 1GXSA 5ETJA 4R98A 3GI1A 3SS9X 5AVZA 4NULA 1PQYA 4TLDA 5ILOA 1EUYA 4CF5A 3UJDA 3EH1A 1DIAA 1ZKMA 4X63A 5LQDA 4AY3A 1BWRA 4ARUA 4E94A 1P3JA 2FA9A 2GPJA 4GLOA 4IL5A 1UWLA 5CW2A 5EJFA 3OECA 4YV2A 4G01B 3GLGE 4IQFA 5KHOC 2P9EA 1WO8A 2FVYA 4P3YA 3DV0B 4GVXA 5DGDA 4L2IB 4Q7EA 5B36A 3ORFA 2DFKB 4QOEA 4Q3DA 2HR1A 3L1KA 3ER6A 3IXLA 3NTUA 3PR2B 4M0EA 4IWYA 1Z5NA 1WDTA 1R00A 4HF7A 2NU8A 1HTWA 3FFXA 3QELA 2YC4C 2Q1YA 4OYRA 2QRNA 4ZVSA 3NGXA 3RS9A 2CHGA 2P2ZA 1XTKA 5TY0A 4AYXA 2JLAA 3F9RA 5C1IA 1GG2A 3H19A 5CLIA 2Z58A 2IBTA 2QT1A 4MI3A 3KAJA 3Q7RA 2F9LA 4NFYA 5IP5A 2IPMA 4OMCA 2V7EA 2WHRA 3S7ZA 3UTCA 4CKWB 4ZA2A 3D59A 4RTRA 4M9SA 2AI3A 1ECBA 2ZPTX 3AF5A 4OQLA 1EDEA 1OXTA 3GHHA 4U0JA 4DT1A 1CY6A 1R0CA 2H17A 3E27A 4FX5A 2WHPB 3FZNA 4MYHA 1ZRNA 3WL5A 2FLWA 1JALA 3PA6A 1S2OA 3PNVA 2R1VA 4OATA 4ZK2A 2W6OA 4CCYB 2HIGA 4BNIA 2NZVG 1O95C 2FF5A 4FHZA 3LHSA 2JFGA 2SICE 4N9QA 5A6SA 1C0PA 5EP4A 1DVRA 1F0NA 4BHTA 2XYHA 4M60A 4YK7A 3NVMB 1DC8A 5TEWA 2QY9A 5KQMA 5KYYB 4X3OA 2RHRA 4CZ2A 1T3TA 1OBFO 3CNQS 4MWBA 2Z2ZA 4I9UA 1R6TA 5HJ5A 1T8SA 2QE7A 1XQWA 4E1VA 5EXSA 5CLJA 3O91A 4NZNA 1DELA 2C5AA 3OCVA 3LRTA 7GPBA 2B21A 4ZEWA 3C6XA 3K53A 4BNJA 4QODA 3IVRA 3M4ZA 2DEUA 4D9HA 3FIJA 2OE2A 3L1UA 2O23A 4WXYB 4CM5A 5AW7A 1ZCJA 4LJRA 1CG6A 3C5WP 3JVUA 2G06A 3FCUB 2F1JA 1U3WA 1Q1BA 1YD7A 1EHIA 2AXNA 3F5MA 3GP3A 3TDNA 3PUIA 4XOUA 2ZI6A 4LF6B 3GVPA 3I37X 1X9GA 3R8CA 2Y1OA 4ENUA 4M53A 5JAUA 2ID8A 1JEAA 1NXQA 3C3KA 2IPNA 4UCWA 2BONA 2B1IA 3GLHA 4WT7A 2EJVA 1NUHA 1PGJA 1JFFA 2J46A 3EXEA 3PCXA 4IILA 4D5EA 5GJBA 5HFNA 3VJRA 2BI7A 2YHUA 2HJRA 5DBHX 3BK2A 3P0RA 1TUGA 4OP2A 3F7MA 2FZ5A 3JY6A 1OZAA 2Q1TA 1SD1A 5TRTA 5TXGA 1WCIA 5AH0A 4Z0TA 1DMSA 1NBOA 5F2KA 1KOLA 3I04M 4MIKA 2MSCB 1XAGA 3CR3C 3WRWA 1LNSA 3BRWD 4I6GA 2D2VA 5JBQA 4XGQA 2H1HA 2ZJ1A 2YZKA 5DLDA 1B74A 1KSHA 1VHTA 4QQNA 5T5QA 1YQEA 3A9SA 3B70A 5FPYA 5A1JA 2P68A 2RCNA 3EQ8A 4WQMA 2G4LA 4RD1A 4ZI7F 1X1SA 3GGCA 1O5TA 4L5IA 1J0EA 2PLWA 1UFQA 4OJQA 4XOIA 3OTWA 1ONBA 1CJKC 5CDGA 3A9TA 4MEBA 4G0QA 4C03A 1CZLA 3SMVA 3MUNA 3JZMA 4B32A 2C3PA 4C2AA 3ZYZA 4HG2A 3DTNA 4TZKA 3V7YA 2HJGA 4FR2A 4G1UC 4R7GA 1LPNA 1E1LA 4Q0MA 4TSRA 5G40A 5HEKA 4MR8B 4XJVA 2GDZA 5LMNB 4KR7A 1BCSB 1ULZA 3IDAA 3QWFA 5GY7A 4B83A 3O4IA 3OJCA 1E6UA 3DF9A 4QNNA 3GJ3A 1S1MA 4DUPA 2BGKA 3UN1A 2W2PA 4DYVA 5BN1A 3O1HB 2J9XB 3QKRB 4N49A 3G2MA 1HXHA 3FDJA 1U5AA 3NKLA 1LDEA 1CK4A 2A6PA 3W1EA 3FTEA 2Y1DA 3V8EA 4TS4A 1LW7A 1YB1A 1K3UB 5HF8A 4BB0A 2E4XA 2WWFA 1JXAA 1R9NA 1TU4A 1X87A 2XVAA 1TYBE 1KPIA 3C5EA 1N2ZA 3A27A 4IDDA 2IDMA 4CGYA 4ETMA 1YFKA 3F7OA 4WUTA 1KHHA 1MVNA 2R60A 3NQ41 4ZO7A 3IURA 4PSUA 2B1RA 4NU8X 3U48A 4A7PA 2W4MA 4NH0A 4BKRA 2H4WA 2PVCA 5L4LA 3H17A 3AB3A 4Q1DA 4FR5A 3ILXA 1O08A 3IRUA 3RG8A 4EJFA 2CNDA 4Z1OA 5JSQA 2ZIWB 2PPLA 1BFKA 5TQ0A 3OUTA 3ONWA 3VQTA 2FPKA 4DJDC 4Q6BA 3N2IA 5BN5B 4DKXA 3KUDA 1OPXA 1E66A 4CN8A 4A2PA 5U4XA 5JC1A 4QO7A 1RQ7A 3MTBA 5DYNA 4ZI7B 4I1UA 3TL6A 2C2YA 5G4KB 5C32A 5KBYA 1SKUA 1IBKB 1G2OA 4MVJA 2HFKA 1LI5A 4IO1A 4LZLA 5D3KA 3SQLA 2CNWA 1GKLA 3EZ2A 2GRAA 3H7AA 2QGFA 4QUHA 3EQ6A 1N5OX 3QG1A 4W8GA 1QHFA 4J7XA 5FULA 4BNUA 2IQIA 1W85B 2EKDA 2YMPA 2JFNA 5JZMA 4QVIA 1L7QA 3UGTA 2DAPA 3WGYA 2V7QA 4EB8A 1NNI1 2GFQA 3TNLA 3WIVA 2JVKA 3R3UA 5FEMA 4FFLA 4CQLA 4ETWA 3WLSA 1UH5A 2C94A 3DOJA 4A03A 4UD2A 1B41A 1JAZA 1NHGA 1YR2A 2JFPA 2C3MA 1MX3A 2QTZA 3LDUA 4X1YA 3RGWS 3VC2A 1UEXC 3I5UA 4HX5A 1P19A 3NETA 4Y2RA 3W5JA 3I6MA 3LX6A 1Y80A 4ND2A 1EVIA 1GO2A 1M2NA 1PWXA 1PT6A 1QOZA 1PYDA 2FKNA 3NKFA 2JC3A 3OY2A 1DHTA 3DMRA 3KP1A 4PQYA 3AG6A 1Z0ZA 4J94A 2IV2X 1ILEA 1UINA 3E3OA 4B9EA 1F60A 1N5KA 1PV1A 4HI0E 3F8TA 3KU4A 2PWZA 2Q5LA 4IQGA 1NDHA 4WKCA 4BZXA 3RF7A 2CL5A 4N3BA 4C0AC 5EGSA 3PL1A 2GEVA 4GM1A 1IY0A 1CRWG 1XRNA 1XNJA 2PUHA 3BB3A 4EHDA 4BTLA 2PTGA 5BOVA 4C9BA 3AL2A 1RT9A 3I1YA 3IT2A 1VIYA 1Y1LA 3GFGA 1YAJA 2GBLC 2YOFA 1M10A 3GAMA 3I9LA 3RSHA 2H06A 3WADA 1CC1S 3CF4A 1ESEA 3QBTA 5EE3A 5HK8A 4B84A 2G77B 4FZJA 1KFJB 2Q6OA 3P9ZA 5DTQA 5FYDA 4DLVA 2X2EA 2WZBA 3KQWA 4P81A 3ND8A 2RONA 2BUAA 2QAJA 2QSJA 3KYCB 4ZCSA 5LDHA 1GAEO 3KVYA 2H8GA 3NNDA 4WKGA 1DKOA 1ZJ5A 2KYRA 3DMPA 4ZOLB 5CBKA 1MG0A 2J9GA 3RTGA 3RO7A 3T3HA 3EUFA 1RKVA 1XCPA 3K6RA 4TVOA 2DPYA 4LXXA 2O5RA 3QPCA 4HTAA 2IXBA 2REXB 3H4VA 3M0EA 4Q3CA 4D2IA 4IQ4A 1WVMA 2Z8YM 1W4LA 3IPAA 1ODFA 5HZKA 4AG5A 1NU8A 2ZZKA 3K2IA 3CW9A 3KQYA 4YP1A 3CNHA 4TMKA 1BJTA 4F6RB 2VXOA 1ECGA 4MS4A 1W52X 1TZ2A 1L5ZA 5T4EA 4UHJA 4XWKA 3WKCA 2WJYA 2X2PA 4TV8F 4Q1FA 1HE1C 2ERCA 1T6BY 4TYMA 3O8OA 2BSAA 3MBOA 4YAEA 2OXTA 3ZE7A 3CZPA 3R41A 5JV5A 3W3ZB 1EZ4A 1U7ZA 2HJVA 2MYUA 3D6NB 5K99A 1PAUA 4RS3A 3EEOA 1X77A 1U7XA 4O2AF 2W0MA 5BN4A 3C1OA 4WV3A 1A8QA 3AY0A 1ZVVA 4ZVVA 4H1WA 5G1OA 5DTRA 1BWQA 1KAOA 4Y2QA 2QJOA 1KEZA 5LP6C 3TSOA 3OLYA 3INTA 3FSGD 4UZFA 3R0JA 3B48A 1MAAA 2X8JA 2CUTA 3AUAA 3CM0A 5JISA 1Z6TA 3K6JA 5LC1A 1KMMA 1AF7A 4AWBA 1E58A 1BCRB 1V1RB 1JGTA 2AJLI 3SGLA 3CZRA 4X20A 1SXHA 1IBMB 1OX6A 1LC3A 2OZEA 1M5TA 4TXHA 1NI5A 4W7HA 4HMPA 4Z0HO 3PTAA 2I4OA 1QNFA 1E3WA 3RSCA 4A73A 5IBPA 2J3EA 5TMDA 2WYVA 4EAAA 4L78A 3OFND 2ZVDA 1LY1A 8GPBA 3D54D 4XDGA 5EJ8A 2HSGA 2VHQA 5B3JA 4ZYXA 4B40A 1M1NA 1X80A 1XCMA 2FG5A 2R8ZA 5FEUA 3I6ZA 4QLAA 3U62A 2WF5A 2O07A 4S0XA 1JA1A 2JGDB 4GP6A 4WSOA 3ZGYA 3ZV6A 1MO2A 1Z6GA 2ZRFA 2RH4A 1EVZA 2B1QA 5CT8A 2P6NA 5FBQB 4YCCA 2H1SA 1HQCA 5AUNB 1X8KA 4LY3A 4OO3A 1KTIA 1U04A 3ROKA 1FVOA 1N25A 4WLVA 5FUYA 1THGA 3ADOA 5CNMA 1Q0SA 3R7AA 1XWWA 3ITDA 8AT1A 1VB3A 2C99A 3CNEA 3NZEA 3IX7A 3Q1LA 4ZICA 5IW8A 4A0SA 4YAIA 1FUUA 4F1WA 2JLUA 2J9FA 3PITA 4GX2A 1HL7A 4UEJA 4FMPA 4YIKA 4Z7NB 1J2TA 5ITSA 4ZAGA 4DJ5X 5DCUA 3WNCA 3FHOA 3PNKA 1ZXLA 2Q2QA 1BX3A 2BM0A 4GXRA 4RK5A 4IVNA 4GRDA 3K4PA 4EBBA 3EDQA 4RW0A 4YRNA 3NT2A 4Q9HA 4HBGA 1EJ0A 1OCEA 3A0RB 4G5XA 1GTJ1 1NN1A 2OUKA 1YFZA 2YXDA 3LI2A 3B1YA 3QIVA 1XNHA 1B2RA 4KQXA 4P6VF 3RM3A 3SX2A 3U4HA 4B82A 2WD8A 1MAHA 3B6EA 2NO1A 1DRUA 2ZDGA 3WIBA 4XUEA 1L7OA 3OY7A 2NVUB 3HXLA 1R5BA 1N33B 3R5FA 1LS1A 1NKSA 3LT2A 3ZKWA 3NRJA 4ZO4A 5KSPA 3TCNA 3TLKA 4N8EA 1UZLA 3R6GA 4DC9A 4WAUA 5AW9A 3KKMA 1N3LA 1YI8A 3U7IA 3O73A 1UMKA 2LCFA 4YROA 1K6XA 3KZOA 3L8DA 3QKTA 1GGEA 3RIGA 1NRIA 5CX4A 3T4UA 5FFFA 3ESCA 3VPSA 4HFRA 4I19A 2AC4A 1PJZA 5KYTA 3FHTA 4HNHA 1PR6A 2Y93A 2VH1A 4IF4A 4PR3A 4Q93A 4M55A 2QAIA 4NVRA 5LM3A 4N41A 2IBMA 5JS1A 1A9XB 4I3FA 3G9ZA 3PHLA 2ZT8A 2ATCA 1WXDA 2OCBA 3RUHA 4TQGA 4DMCA 4KJZA 1F9AA 1XCBA 3VU3A 3HP1A 5F1OA 2O8EB 3TQCA 4M87A 2NUPB 1BHJA 1MX9A 3HBAA 4QNRA 4G2TA 3O75A 1SXGA 1MA0A 1TIPA 1N75A 4R9UC 1S89A 1UKZA 3LY9A 4F4IA 4D8XA 1ZRMA 5CLLA 1C4OA 1PZXA 5JANA 5LIRA 4HKTA 1B3RA 1WEHA 3SBXA 1VLQA 2OSVA 2ZYAA 3HFGA 5LP6B 5CRIA 1QVRA 4RGYA 1FMFA 1CJBA 4MA5A 5JQWA 4D41A 2VNIA 4Z49A 5TQVA 4F9TA 2EXXA 4J76A 4DIOA 3HVIA 3BM5A 2FDRA 4RK4A 4TT3D 1ECJA 3EIWA 3G2NA 4LDNA 3QW2A 3RS8A 3QEBZ 4KQKA 4P82A 2X9QA 3DFMA 5FI1B 1Z0KA 1HZZC 2YHIB 1JVBA 3EG9B 1XPJA 2Y2VA 4RSRA 3U1TA 3KT8A 3I2IA 2XZOA 1WDMA 3R24A 5FUMA 1SBIA 3A6GA 2E48A 3CC8A 4P53A 2C07A 3CKMA 1KK0A 3EZYA 4E5KA 1BE1A 5AP9A 3WP1B 2J5QA 1OGIA 2VT2A 2PRYA 3BOSA 2A86A 4PS1A 1RAGA 4ROTA 4ZU1X 3KUCA 3NP7A 4M7PA 4MUJA 1WQ1R 3A1UA 4WCVA 1E5LA 2W7TA 4JL6A 4HLQB 1SC4A 5CT5A 1EZZA 1NMSA 4YREA 1JLLB 2RIPA 4CIBA 2BEWA 3T06B 6GPBA 2ZVQX 4IIHA 3IBFA 1KE1A 5DP2A 1KE2A 3ZWDA 4C4ZA 4ZDKA 3U6BA 3HXKA 4I9HA 2P2GA 4AAYA 3ILYA 4CV3A 1ODKA 4B7AA 4EPWA 3P2IA 3QVSA 4TTVA 1QUFA 4NU5A 3W9SA 1RLOA 4RTMA 2HMAA 2G63A 1Q16A 4PO8A 2OHGA 4XD7A 5CIQA 3U7FB 1NUPA 2P2CA 4LC0A 4EVIA 5LNK6 2ALJA 1YRHA 2WA1A 3WGIA 1Y8QB 1E9BA 1QFYA 1XZJA 2YY6A 3BSSA 4PC1A 1XD2A 1XKXA 4PCLA 3A37A 5CK4A 2V7VA 3WBBA 1L9XA 1JEQB 2PUTA 3A4TA 2YJTD 4EW1A 1JILA 1G5HA 1LK5A 3BEOA 3HY6A 3A9UA 3NAQA 4Q01A 4ZRDA 5TPZA 3PE6A 3L6DA 2C9MA 5JYBA 4J16A 3DR5A 2VP2A 4HZIA 2BGLA 4WK0B 2PS3A 3PQEA 2WAYA 4MP6A 3NHUA 4ZT7A 4J0HA 1KNQA 2ZSDA 4L6AA 1M1ZA 2Z4TA 3FDXA 2AQHA 4OHWA 5K4AA 1MFPA 5HZMA 2H7YA 4JQSA 2IU3A 1P7ZA 4XLLA 3B5JA 2ZJ2A 5J1SB 1OFHA 3GT0A 3QLUC 4YHBA 2B3DA 3DMGA 4U02A 5L95A 2OA0A 2NYRA 1FFXA 1ZI9A 2GK6A 1OREA 3NYIA 5CFZA 1P1BA 1T0UA 4XVUA 1XZHA 2XMQA 1ACLA 4E15A 5D87A 1UEJA 1V7PC 4BFCA 5KYUB 3F3YA 4WZBE 1JW9B 5IC6A 4CKCA 3LPAA 4HNUA 3E4DA 1PQWA 1TTQB 3NIFB 3TZHA 3ZBPA 1GFWA 1U0EA 1J9ZA 1U3DA 3RGGA 2HLDA 3JV7A 3Q6MA 4J91A 4OLJA 3FFWA 1YH3A 3ZXIA 3JASA 4DJTA 2N1BA 1SPBS 3X1MA 4E32A 1EWTA 3DVAB 1N0HA 3JQAB 3U61B 5LMCA 3LLVA 2A3RA 3I2GA 4C05A 4YJ2A 2B8WA 1Z8HA 4YFVA 3IIEA 3T9DA 2ZYRA 1QK3A 2IS4A 5LUAA 1PFGA 3FRIA 3AXSA 3OHSX 3MT8A 4M1ZA 5DGTA 3R5XA 4BMCA 3MT9A 3WGLA 1WQ4A 2J08A 4XVHA 1E60A 4N7BA 5AW5A 3TXYA 4HQFA 5AMXA 2BFDA 3INGA 4G1BA 1I5RA 3EZLA 1YNSA 4KLAA 1PD0A 2NXNA 2PX3A 3VYRB 1A9QA 4R81A 5JLAA 3V6LA 5HRAA 1J0DA 2HRCA 2XNCA 4QFMA 2I34A 3OESA 4BL5A 3D5TA 1SUDA 2VXBA 3MCAA 3GEEA 4CKYA 3GRKA 1WXIA 2AV6A 3DR3A 3MGAA 1TF2A 3HB9A 3K9HA 4ALIA 1I4WA 1CUYA 4FUTA 1Z2OX 4NOMA 2V7WA 1SHJA 2B2XA 1EVKA 4J2HA 4L0QA 3LKBA 1TQDA 2AUTA 4ZCMA 1UMCB 2HNAA 4TMFA 5GAJA 5LQCA 3OLWA 1ZSVA 2NO0A 4HFJA 1ZS9A 5AW3A 3NIBA 2FGJA 1AU9A 3IR6A 2OLJA 1NXXA 3I9V1 4Z4IA 4MP3A 1QV9A 5IWCA 2EF1A 1OKKA 1P72A 2GTIA 2VNKA 3ZDYB 3SYTA 3KEMA 1RC1A 5E6RB 2BELA 2NVBA 4UOQA 3FPKA 3VC3A 3GA0A 2NXCA 5FBLB 1E6MA 1RJGA 3MB5A 4QGAA 4XRGA 5KNDD 2ERXA 5JSKA 5DN9A 4NJEB 3BB1A 1IBLB 2HPHA 3E2IA 2EBFX 2ORWA 4K03A 1RJEA 4HDKA 4KLRA 3F46A 5FF9A 3CS3A 4NI5A 1BS2A 2QQEA 1PK9A 3I23A 4HADA 4KH1A 4HWRA 1VKHA 1MQ9A 2C88A 2HSJA 1OTXA 4PFQA 4GKBA 4KUEA 3WXBA 2F1OA 5K3BA 3STUA 4S1NA 4E33A 3PXXA 3O95A 2VYFA 2WSLA 4EFNA 3WQBA 2W00A 1B16A 4OHVA 3T7DA 2A59A 3VKGA 4OHFA 4PX5A 1TB4A 2C95A 1NE7A 1QRAA 3OO1A 1F38A 4GSYA 5CTJA 3WWCA 3O8NA 3GLFB 3QPBA 4O4HF 1H3FA 3D0KA 3H83A 3K72B 3WK4A 2GFHA 2QW0X 2Q5IA 3T5DA 2TMGA 2H6EA 1T2VA 1G8YA 4CT4B 1NVTA 3NNSA 1IEVA 2DVMA 3KEQA 4FMCB 3F5DA 3FWYA 5IVPA 1XCLA 4IXWA 5BV1A 1M0WA 4KGZA 3PYXA 4ZODA 2HIAA 5CFOA 1TXGA 1R4NB 2X0JA 1V95A 3JALA 4XIJA 3I5AA 3ESXA 4WK6A 5J5VA 1YRAA 1DAKA 3E9MA 1U9ZA 3VHQA 3VNAA 1OXKB 5HGJA 1QCZA 4U6QA 4DQUA 1EB8A 2P7HA 3G2LA 4XASA 2IU0A 4RJIA 5JADA 3QUBA 2P1DA 4DN6A 3DHYA 2ZRQA 5ALTA 3BXEA 3MQFA 3GJYA 5KNCA 1E2GA 5KTSA 1WNFA 3H5TA 1H2FA 3TM5A 1BDBA 3OHPA 1PWYE 4YFYA 4PAQA 1KL7A 3ACCA 3U4DA 1WRBA 3QJYA 3IKJA 4FW8A 5GM2A 4ZAFA 3GQBA 2N1MA 5FUXA 1F20A 1GVHA 2K4MA 2AGVA 5ALXA 4ZV7A 3KQHA 4ZAWA 3ZTTA 4W9MC 5JWOA 4JXXA 1KY4A 1X9IA 1BFDA 2BMJA 2ODPA 5TS3A 2PUFA 3VV2A 4PLYA 1E3IA 3SM9A 1J0AA 1X38A 1MOSA 1U8AA 5K05A 4JB3A 4M0CA 4AULA 3KKQA 5B7QA 3VR4H 1YR6A 1TA0A 1XOIA 3MWDB 4JX8A 1OAOA 1PSZA 1HT2E 4L6IA 1U7DA 4FYMA 1D04A 1HDYA 1XHFA 2X0KA 4PWYA 2GBFA 1E63A 5ESRA 4ISCA 2GX6A 2PN1A 3LVFO 1A5AB 2NTYC 1V5WA 4F71A 1GAQA 5IC5A 4AYTA 5AICA 3PNPA 1SQSA 5AW1A 3CLRD 4K26A 2Y27A 5JR3A 1B6TA 4O4HB 1J8QA 4FNAA 4JFAA 5FPQA 1X7ZA 1TF7A 3P8ZA 1A04A 4DMLA 2NP7A 5E0OA 1ZIXA 4TTPA 4LDRA 2FWIA 3HJFA 1E2MA 1YE5A 4I2NA 5BYBA 1I2DA 3DZ8A 4J1QA 5IT5A 3GGGA 4TQUS 1RU3A 3E2MA 3AWDA 1TO2E 1N2EA 5JD4A 5DNYB 2XD9A 4Z3OA 2Y1WA 2OL4A 2C96A 1TM3E 3BE8A 1Z6PA 3KQQA 2J6CA 2PIAA 1XVLA 3IKLA 3UKDA 1I80A 5KJFA 3DV0A 3SF0A 4CIYA 4HYTA 4P4GA 4L2IA 3TUZC 5C52B 3WB1A 3VR5H 2FPRA 3QF7A 4HEJA 1K5PA 1T2FA 4QVGA 2OBXA 2EKPA 5DRTA 2CMKA 4PSDA 2ZR0A 5DIFA 1JDVA 4D02A 1AM4D 3V33A 4KK3A 2VFAA 4N6NA 1BKDR 4EHLA 3ORYA 2C77A 4PZUA 1KK1A 2VT7A 2KSQA 1FU8A 3R5JA 3DEHA 3EMVA 4MUYA 1UM8A 4TVKA 2OESA 5FBWB 5ISMA 1HYEA 1R6XA 4R3NA 4CKWA 1T0BA 3IULA 4UMEA 1TX4B 1V9SA 2VTVA 4TTIA 3PPVA 1I0ZA 2GKGA 2QYSA 4EELA 2R6FA 1FDRA 2GUWA 3PWSA 1M2KA 3L0IB 1E99A 4MI6A 4A6EA 1WOYA 1QMPA 2YV5A 2Q3JA 1LV8A 3QHPA 2WHPA 5K3FA 1LDGA 3WGGA 1A4IA 3B6JA 3SE0A 1R9MA 3T9CA 1H4SA 3S27A 1L4BA 1NY6A 2O4CA 1UXKA 1WB6A 1NNLA 2R87A 2G67A 4K9OA 5LBIA 1CZHA 1T5HX 4CCYA 1NNSA 5M7EA 2I33A 3MPUA 3TSYA 1CF4A 3HHEA 1ZMTA 3QVUA 4H35A 3WKEA 1RIIA 2AD5A 4GT1A 1FQJA 3LHKA 3LQ1A 4INOA 4I1RA 5DBFA 1A8UA 3GN2A 5DLYA 2XQGA 3C3WA 4PRYA 4JH0A 4YP5A 1OV6A 5HQ3B 1EUCB 2DPXA 1NXWA 2QQGA 4HGYA 1XJCA 4XIIA 1C80A 2PRSA 1JEDA 1H6AA 2PUWA 4TX1A 3N8IA 2M9MA 2B25A 1VLZA 2E1PA 1GFIA 1RLUA 2R68A 2PWAA 1VYTA 3C8HA 3GZTB 8ABPA 1X42A 2AG0A 4RDHA 4EKEA 1CJSA 2Z4RA 1QAMA 2IP4A 4GL2A 1ZA2A 4PWZA 1HK7A 5DTJA 3SXPA 1KY2A 2CHVA 2W2OA 1W73A 2CK3A 5FB3A 5K0GA 3HJCA 5AVOA 3KO8A 5A06A 3PWTA 4UJ3A 2Q0HA 5FBRB 4R71A 1OIXA 3R3JA 4DMGA 3BX1A 1D2EA 3FWPA 2X8BA 4WMLA 1VLHA 1K9VF 4QQ8A 1SBYA 1UOQA 4TGLA 2NQ8A 3ZV3A 4BO8A 1SBNE 1UFOA 4OGLA 4E11A 3EXFB 3SDSA 3I30X 1TLTA 3ETHA 3GWZA 1JYEA 1OAAA 1RKXA 2FOXA 2R44A 3EHDA 3PV0A 4I5DA 4K1XA 2RB5A 4RLQA 3TRDA 1WNTA 2A5DA 4KBYA 2ETXA 3I6BA 2J6BA 3NVDA 3AP3A 1GU7A 4DTCA 4A26A 1NBMD 5DM70 2V59A 2BFEB 4WK4B 4M54A 1IN6A 2P1RA 4JYAB 3NAMA 4V0ME 3KLMX 1TYDE 2BHNA 2NQTA 4INJA 3EWAA 1TF5A 4D9JA 1G8AA 1FS6A 1H8ED 2ECKA 2MR5A 3FVVA 4L4XA 4CLHA 2XSZD 3Q3EA 3I9FA 2IEIA 1KAQA 3ETDA 4KBFA 4MW1A 3SSOA 4DSZA 4HVTA 1PR5A 2WTXA 3EG5A 4GMGA 4IIXA 1JHMA 4X95A 5DHTA 2C7PA 2DTXA 3DP9A 2AWNA 2GA9A 3NJ4A 3QFCA 1QF7A 1T2AA 2PSEA 3KKZA 2D0DA 4NK5A 3E9RA 3OTQA 4MR8A 2XTAA 1F0YA 1BCSA 3RIMA 1GZ7A 3NWPA 1VTKA 1XR3A 3DFUA 3DHWC 3AZQA 4MWSA 5HG0A 3KEGA 1X1DA 4P92A 2A1TR 2UUAB 2NZJA 1U0SY 3N74A 1UT8A 4M1KA 2RH9B 3QKRA 4CIVA 5FJJA 3MMNA 5E4YA 2TRSB 5IAEA 2W22A 1PNVA 3L6RA 2OLKA 3VPXA 2JIOA 3NJRA 4P4NA 4B87A 2JVIA 4ZZ2A 2IUYA 5CM2Z 2V9PA 1OVMA 1AUOA 1M7HA 3K5IA 4GF5A 3COSA 3RAJA 4F5WA 3FYHA 4QO8A 1YBAA 3FWNA 1X0XA 3LUFA 3GR6A 4O1HA 3STTA 4RIIA 4ALNA 5JFOA 1XNGA 1ICEA 1MQ8B 3F6PA 3S6JA 4H18A 4LECA 3RRNA 1GUZA 3KPVA 4O08A 4AJ2A 4ZPJA 5K4HA 4AJHA 1V5GA 5EUCA 5T6MA 5TVGA 4BZZA 4UCFA 3T12A 4AI6A 1NF9A 2RBEA 1T25A 1L5MA 2NSJA 4F3CA 1XUOA 5IJAA 1BH6A 3VJKA 2OFXA 2V03A 5BN5A 4V0OA 3B60A 4JVMA 5JDIA 3UGJA 2HU5A 2AN9A 3AP2A 4HN9A 2VJMB 4LMBA 5COQA 3RLIA 4ZI7A 1DO0A 1Z3IX 1DEXA 2BGMA 2ZAOA 3QVOA 5G4KA 2GCOB 2FX3A 3BE5A 3HNPA 2R8BA 3DLPX 3PEWA 2FOLA 3LXUX 1YGYA 3Q8MA 4LJ8A 2HF8A 4UEWA 1YK0A 1Z0SA 2IEZA 4Q1EA 1LPBB 1JQBA 1W85A 1C8VB 1DIGA 2GYYA 3DDSA 1PBNA 4R2XA 5AVKA 4C6HA 1XZIA 2ONYA 1SBCA 3RVMA 1TK2A 5DGIA 1UOPA 5DH9A 1ZGGA 1KK3A 1TAHA 1IEXA 2BKEA 4JDUA 2XMCA 2WYHA 2C1EA 3BGIA 1OI4A 2FPWA 2H2IA 5GZ3A 2O1WA 1MFZA 2WU8A 5G0VA 3NLLA 3TD2A 5CYGA 1VJ5A 5KQGA 3UUFA 2NAPA 4OSEA 2VJDA 1FRQA 1MO5A 1SUCA 2H85A 4H7KA 4S2UA 2X8AA 4GW3A 4RBNA 4JT8A 2QRUA 4Q9AA 3VO8A 1W7AA 3INNA 4D81A 4WPGA 4NARA 4WEQA 4HFNA 4BMYA 3HY3A 5FTWA 5G4LA 3AU8A 5LDGA 2WMDA 5ALEA 1F5NA 3SJ7A 4IDQA 4ZFNA 3GEGA 2IYFA 4IMRA 3N2ZB 2WJHA 1EDBA 4K28A 1CETA 4LZJA 3D3JA 5DI9A 3F74A 5LBUA 4D9EA 3AWIA 5JZSA 3V4RA 2RJ3A 3KL2A 5JT1A 1U80A 1TEXA 2QX6A 4NV0A 1NYTA 2W43A 3ANTA 1KFKB 3DDCA 1CVRA 4LF9B 4JEHA 2QTMA 4N39A 4UBNA 2D62A 1Y6JA 4R2IA 3EIXA 1JH8A 3KYCA 2GZ3A 1PDWA 1NI3A 4ZOLA 3D64A 3ET5A 4CLRB 1FFHA 3F98A 4QBTA 5JWRA 1R18A 1RQPA 3AV0B 3KUKA 1G6HA 3KE8A 4Q4CA 4CM9A 1GZHB 2ZJ7A 1J9EA 1R66A 3URMA 2YFKA 2XCSB 5EXPA 2ZYIA 5D8DA 1DT5A 1NF8A 1HLPA 2Y9MB 1FXSA 3EIHA 4KZKA 1MD9A 2YINC 3IUYA 4LJAA 1JWLA 3BH0A 3CJQA 3LQRA 4TMXA 2H3EA 2WJZB 5C8VA 1US8B 1EVJA 2HA2A 2AJCA 2J5BA 2OM2A 2WWWA 4W63A 1BYIA 5AR1A 2PH3A 3DEKA 4F6RA 1KMIY 4U7DA 1V11B 4ND5A 2XF2A 5A3VA 3ZHCA 4E14A 4DR2B 1OH7A 1Y9ZA 5GP1A 5C3MA 1IN7A 3N7TA 1D07A 1BG6A 1QGDA 2FUG6 3DE1X 1CYDA 5BSTA 2GJAA 1SVUA 3BRSA 1YZQA 3WL3A 4BQNA 5HZHA 3I9MA 3BAFA 3E18A 1Y4AE 3N5CA 3TR5A 3TAXA 2POCA 3C14C 4W5NA 3KD2A 4ZT2A 3MBKA 4CT5A 1WBJB 2RH5A 3CUTA 1NSYA 1WTCA 4OK6A 4X5OA 1P0PA 1CJVC 3V34A 1NUSA 1BTOA 2RAUA 2DUWA 3I09A 4MR7B 4ALLA 1UKBA 2I1LA 1UL1X 5DRYA 5B12A 4UE2A 4UKDA 3KPWA 4URVR 2X86A 4RSHA 1B14A 3UJPA 4DR6B 2XIQA 1N8SA 3BXFA 1J21A 1BCRA 1TLFA 1GPKA 1V1RA 4PNHA 3K4QA 3ER9A 1EQAA 1XO1A 2WU1A 3ZDBA 1KZ1A 3KOYA 1RYMA 3CE9A 4EH1A 2LWIA 2YXNA 1X70A 4TXJA 4HOYA 4JHLA 4PGFA 1LWNA 4Q21A 4KNVA 1IB0A 3FUXA 3PP8A 5EAIA 4NONA 3ZWKA 2VDQB 3K31A 3CR8A 3DKVA 2OWEA 3HZHA 5F7JA 3DD5A 3QKUA 2ZSKA 3IR7A 4O3FA 4YP7A 4LFAB 3CSSA 1DKQA 2QL6A 4H1UA 3W7AA 1ZWKA 1UKVY 1EWKA 4R1QA 1I4OA 2JGDA 2JKYA 1FUKA 1M1UA 3NM4A 3EJWA 1ESNA 1G64A 1MJNA 2PT6A 1R0ZA 3DMTC 3KSDO 2DFNA 1JJBA 2PEYA 1IY8A 1W93A 4HGOA 3OJEA 4OGFA 4PEVA 2YWCA 5HRUA 1YGPA 1CIJA 4UDYX 2AMJA 4O8CA 3C7TA 4QU9A 3ERCA 5KDOA 1VMIA 4DXHA 5KEIA 2G72A 1AKVA 3JW8A 1RBQA 5DXFA 1FFYA 1T9KA 2HQSA 2ZIVB 3BXZA 1MF7A 5EZSA 1E0KA 2WAXA 2XT6A 2ZRGA 1OJLA 1AKTA 2CCJA 2CMHA 2HWWA 3FYUC 3C97A 4JP3A 1KORA 1DKPA 1U2SA 3QKSB 4MRSA 4PANA 5J40A 3REFA 3UAGA 3UXEA 1N34B 4LF8B 4BFWA 5KB3A 3WYDA 4UM7A 1GTMA 4TXLA 2XDWA 2AN4A 3O38A 2Z6VA 3T1VA 1WS6A 3WKAA 1QGUB 5KWJA 4JNKA 2QLFA 3AVWA 3MGKA 3QFHA 3S99A 2HQ1A 5JNTA 3EY9A 1OFIA 4JOSA 4O2BF 2GBLA 4IUDS 1DWQA