4KAXA

Crystal structure of the grp1 ph domain in complex with arf6-gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
163
structure length
163
Chain Sequence
GSMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 6
publication title Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 56
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2013-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kaxA00
2D74A 4TMXA 1A2BA 1QBKC 4PO1A 521PA 1G19A 1KO1A 1IAQA 3A1TA 1KI8A 4IEEA 1ZM2A 1R5BA 4B32A 1ZBDA 3FFAA 2B21A 1ODFA 5P21A 4ZCLA 3KKPA 3PIRA 3HPQA 1I4LD 1MKYA 2OLJA 3MWJA 1AA9A 2ZRHA 2YWFA 1FQKA 2AK2A 2QMEA 1RRPA 4M53A 1E69A 3OFND 3SU8A 5FBQB 3GEEA 2WBLC 3IILA 2FDCA 1EFCA 4JT2A 1G21E 4TMTA 2JJ1D 2ZE7A 3BFXA 3THYB 3W6PA 2PX3A 2ZRLA 3C16C 4MDEA 2QI9C 3ADDA 4P4SB 1KSFX 2WWXA 3JZAA 4DSTA 4JLDA 1LVGA 3L43A 2GVZC 1P2UA 3P27A 5L3QB 4M1WA 3SR0A 1JR3E 3BWDD 1QHIA 2WSMA 1R4AA 1CR0A 4M1OA 3I5YA 3KB1A 4Z54A 3QNUA 2ZYWX 2PCLA 4G5SA 1FZQA 3KJIA 3BC1A 5JEEA 1Z0IA 3V9PA 2FJUA 1HYQA 2IEYA 1VIYA 1UKEA 1XFAA 3OAAA 2ERYA 4IFBA 5AJYA 3EAQA 1NBMA 3T61A 2QSZA 5CK5A 2NZJA 2ZJAA 3DM9B 3DO6A 3S1AB 3FHCB 4PPNA 1GOTA 3V00A 1FUKA 2V1XA 4HZUA 5KDOA 2WWGA 2X1VA 1YZTA 3PITA 2WKQA 4MGIR 3GLFA 4C7OB 3KQLA 1IN6A 3L0OA 2RGNA 3U44B 1SVMA 2QG6A 2C9CA 1GAJA 1NF3A 2ZRFA 1FX0A 3DOEA 5JJIA 5FOWA 2FEMA 2DHRA 3T1QA 3OEHA 5B64A 2RGEA 2WHXA 4ESVA 1G8FA 1XXHE 4OK6A 3KL4A 1E2DA 2OE2A 4RZUA 2FSHA 5FOXA 2ZRGA 4Y0AA 1KSJA 4QBFA 1MT0A 4F93B 3B1ZA 2HEIA 2VP6A 2MSCB 4RCZA 3T12A 4QGGA 1W0KD 2C9OA 1JEDA 2WV9A 1XTRA 3M1IA 3NVAA 1KAGA 1FQJA 2GEDA 3UANA 1AZTA 3HP1A 1CP2A 2JGNA 3DKPA 1CKEA 1OT3A 1T6NA 1O3YA 2C03A 1XMVA 4TSFD 5F9HA 1XD2A 4TLBA 4EJSB 2XZLA 3GJ8A 2DY1A 5EQTA 4ESHA 2H17A 3IKJA 4US2R 3JZMA 1W4BA 4W5JA 4TYNA 2WIBA 2VLIA 3CPJB 4URVR 5KSOA 1SXJE 3U4QA 4HLUC 4B74A 1RW4A 3LA6A 4B6EA 1NG9A 4KBGA 3ICQB 2XGJA 2FGKA 2DWQA 1C4OA 2QGZA 1C1YA 4TQUS 4LZZA 4YMVA 4DDVA 4AWXA 3EZ9A 3E2IA 1P73A 1U9IA 1X8KA 2GXQA 1BIFA 1E79D 1T3HA 3U6BA 1DS6A 4BLSA 1KO5A 2OSBA 2DBYA 4JYBA 4TMWA 4LPKA 3EWSA 3T1OA 2IA5A 1K6MA 2IT1A 1U0LA 2ZI9A 4JLMA 4M22A 3U7EB 4NCKA 4I1VA 4PPQA 3OEED 3VR1A 1JPNA 1G5PA 2F1RA 2ZETA 1KI7A 4UNSA 4CRWB 2XTZA 2GBLA 5FBVB 3T15A 4DCVA 3QIAA 5GJCA 2YJTD 3Q3JB 3KKQA 5IF9A 4V0OA 1XJCA 3RS7A 3LW7A 1KI4A 1I4TD 3IHWA 4V0KA 3DL0A 4GDFA 4OHZA 4JJKA 3D31A 1U94A 2NQ2C 5DHAA 3ZS8A 1GVNB 1A5TA 1N0VC 1NNEA 2BC9A 2GAOA 4B35A 1TEVA 3B1WA 2XITA 4TTPA 1E2NA 5B2ZA 4B73A 2OAQ1 1W4CA 1RPZA 2GKSA 2A78A 4BFVA 4PO8A 3SYKA 2HF9A 1ZU4A 2C78A 1XPRA 3ZVNA 2WICA 1BYUA 4X8OA 5AR1A 5M04A 4HLCA 2FG5A 3G5UA 2XSZD 1JALA 3AEZA 5GJVC 4TTRA 3PEWA 3BB4A 4V0ME 3SBEA 2BMDA 3EZ6A 1OIVA 1XF9A 3TR5A 4TL8A 2GESA 5CB8A 1RFLA 2QMUA 4NU0A 3TVTA 1P2VA 2VSXA 2O8DB 1GTVA 2YWHA 1U8AA 3REGA 2D06A 5LB4A 1PLJA 3VU9A 1NVVQ 2XOKD 3BK7A 4PHGA 4AYTA 3KJGA 2GDJA 3WXMA 2FFBA 1DADA 1YR8A 2CDNA 2ZI7A 4WIAA 2GETA 3MSXA 5DO9A 2ZU6A 3LX5A 5E7JA 4JLJA 3X1DA 4EPVA 1UKZA 3NBZC 4TLDA 2WVJA 2XNSA 2ZI5A 2GA8A 1R5OA 3H84A 5J5CA 4C4PA 1E1RA 3AP3A 5CITA 2ZAMA 3NBYC 4Q00A 1MABB 1E0AA 4HLQB 1P72A 2QM8A 4KYIB 1E9BA 2GCOB 4A2PA 2V6JA 5CK4A 2W58A 3GLIB 2BKUA 5CDFE 4D0GA 1BOFA 1WB9A 1T8TA 2JLQA 1XP8A 5CLQA 1Z8FA 1IBRA 1ZUNB 1QHHB 2ZJBA 1H8EA 2ZS9A 1H8HD 1T5LA 1E2PA 3UPUA 2PH1A 3NBXX 1PJRA 4JBXA 2VO1A 4C0SA 2G77B 5CJ2A 1E9RA 4R98A 4UXJA 3AVUA 1R2QA 2HLDA 3LFUA 2WPDA 3I8SA 1F3OA 4LV5B 3SQXA 4QFMA 1G3QA 4AIIA 4CEHA 3EX7C 3ZZ0A 5B58C 2Q21A 1JBKA 5EE1A 3KQKA 1CRPA 5IHPA 4B3DA 3UG7A 1ETUA 1UM8A 4MYTA 1EX6A 4G1UC 5KPJA 3ZVRA 1II9A 1XZQA 2QRNA 1SVKA 1E2GA 1E4YA 1P9NA 1UBCA 2QGNA 4Q21A 4IVRA 2FX3A 1E1QA 1F5NA 3WP0A 3QG1A 2R6FA 1AKYA 2KI5A 3EPJA 3DEFA 4B2PA 3ND8A 1GSIA 5D3MA 621PA 4KFRA 3FKSA 1LS1A 3ECCA 4WOPA 1SVLA 2BBOA 4DVGA 4MH0R 4DXAA 1TL7C 1E96A 2RGCA 4ASUA 6Q21A 3QEJA 4QRHA 4OYHA 1AK2A 3QY0A 1Q22A 3FTQA 4LHZA 1UFQA 4M9ZA 3X1WA 1GP2A 1X8LA 1ZJ6A 4BZPA 1E2LA 4QGFA 1NSFA 1U8ZA 4IOJA 2ZS7A 1HH4A 4PC7A 1XDBA 4HUQA 2QM7A 4G5GA 5G3YA 3TNFA 5JS7A 1TU3A 1BH2A 4LBYA 2VH5R 1GIAA 2W6JA 4C30A 1Z0AA 1G8HA 4PC6A 4CZ2A 1QHGA 1SKYE 1HTWA 2ZRCA 1GFIA 4CDGA 1XTIA 3HYTA 4N0EA 1VG1A 2D2EA 2GHIA 3IPXA 1G6OA 5D3QA 4MKHA 1E2JA 3DVLA 3T1VA 2FN4A 1AGRA 2IYVA 3IIJA 5JWHA 1KDTA 1JJVA 4V02A 4PFSA 2JJ8A 3KDSE 3CZQA 2GVDC 2EFGA 4LJ4A 1Q44A 3ZZTA 1RYFA 3OE7D 4BFYA 2AKYA 4BFTA 5JEDA 1VHLA 3HYRA 4E03A 3IHLA 4LWZA 4NCNA 4BFWA 1CU1A 1G7RA 2JJ2D 2OO7A 1KK2A 1FOEB 2ZRJA 1DAIA 5FBLB 5AWFC 3CWZA 3RVBA 2D3WA 3QF4A 1U90A 4DSOA 2PT7A 3H4MA 2A2ZA 4E07A 1AIPA 2R65A 1BKDR 2BEJA 5CIWA 1KMHA 2O8BA 1SHKA 2OV2A 4QJ3A 3BB1A 3VHXA 5FPYA 1Z0KA 1KI3A 4L15A 4CF7A 2DFKB 2I1QA 3I4LA 4TYQA 4DDUA 3LBIA 3W90A 3GLFB 3KTAA 4RD3A 4HSEA 1KI6B 1O87A 3CBQA 1OKKD 2EFDB 2JAQA 4OKSA 4A6XA 4E5UA 3H1TA 1II8B 4BZQA 1NBME 2FFQA 2WKRA 2EFHB 3HWSA 3AM1A 5FBRB 1VCOA 1JR3A 4N0DA 1XJ0A 2OFWA 4QJ5A 4I1SA 3GEHA 1VKJA 1QHYA 1UBGA 5DN6A 3UATA 2GK7A 1OFTA 5FOUA 2D7CA 5EE9A 1NSTA 2PMDA 4QHYA 5LDDC 3BAFA 2F3RA 1ZVQA 3E5HA 3K0FB 2DPXA 2JDIA 3RWOA 5JCZA 3U3OA 5C4MA 2ZUDA 5KSZA 2G88A 4IOKA 2AK3A 2C98A 4TZ0A 5FTJA 1S3GA 2F43B 1LFDB 3C5HA 3I72A 4Q1DA 2J1LA 1R6BX 2HJVA 3UK6A 1KK0A 3AF3A 2BBSA 3TGPA 1T0JB 1J7KA 2XTMA 3SOPA 1XXHA 1Z6AA 4U02A 1KJZA 2FZ4A 2W2XA 3DMNA 1TEXA 4BLQA 4C0QC 3U4QB 1NN3A 1NVXQ 1W44A 3MLEA 3TKLA 1E2FA 3RC8A 4EFNA 1Z2AA 2JIZA 4TYYA 2IUUA 2X2FA 2ZYTX 4HLDA 3U61B 2YNMA 4DLRA 2IEZA 4DLVA 1TF2A 5DNYB 4AD8A 3TJZA 2J0SA 5FR2A 2R6GA 1OHHA 2I3BA 2ZSAA 3D8BA 1Z22A 1M74A 1XMSA 4W9MC 2WJJA 4Z8YA 4CYMA 1GILA 1W46A 4H1UA 4WZBE 1KNXA 3C7KA 4EKDA 1NP6A 4JYCA 1I2DA 1N6OA 4UJ5A 4A6PA 2GCNA 2W0MA 5F98A 4QG7A 1SVOA 2Q3MA 1XU4A 4HDOB 2GZAA 2Z5FA 3K09A 1JI0A 4NBSA 4JL5A 3BFVA 2BMEA 1UDXA 2Z4SA 2F7SA 4DLTA 2BOVA 1SKQA 2HDNB 4AC9A 2ERXA 5L8VA 3AKYA 2BM1A 1N6KA 2WOOA 1AS3A 3SE0A 1W47A 2XTNA 1YE8A 4MA4A 2GXUA 2N1BA 1QHSA 4Q4LA 1T3SA 1JAHA 2J0QA 1HE8B 1HQCA 2YHSA 1KDOA 1VPLA 3I92A 2NO6A 4ZKDA 4NMMA 1Z5ZA 2ZE8A 2VYFA 4DKXA 2FSIA 1KMQA 1S1CA 1OXSC 2O8FB 3B6EA 2GXAA 1TUEA 2CE7A 2KBEA 5B57C 1Q0UA 3WMFA 1Q21A 1OB2A 5DHFA 3IUYA 1W2GA 2C96A 2ZRBA 1GNQA 3GJ0A 5AJVB 1RRFA 4IXNA 1Q1ZA 4DEXA 3EZ2A 3RC3A 2MSDB 3B82A 3RDPA 3TLXA 3CRVA 4JLVA 3RS5A 4TMKA 2VBCA 3MD0A 1VYUA 4V0NA 5EJEA 4HDQB 4PHFA 4Q02A 3DZDA 4GRAA 2R44A 5GJWC 1W1WA 2QU8A 3TH5A 5C4GB 2F1HA 1UAAA 1Z2CA 2F6RA 2I4IA 2W2TA 1JEEA 2DB3A 4DLWA 4BPBA 4LYHA 2ZREA 2FPKA 2CCKA 2H16A 2W83A 3OHMA 2IUSA 2W2VA 4LJYA 1CJMA 3K70B 5JLJA 2WMNB 4HYYA 2RMKA 2W6IA 3KKOA 5FL7D 4V0LA 3TE6A 4CEIA 3NKVA 3TAHA 3WRXC 2K5UA 1R0XA 2QAGB 3GFPA 4KSCA 3SHWA 2ZJ8A 4OHWA 4JLNA 1JR6A 3GLHA 2UZIR 1QZXA 3EIEA 1AN0A 4C2UA 3AVWA 5JSZA 4KU4A 3BRWD 2G1KA 4D0LB 1TX4B 2P6UA 3L0IB 1LV7A 1ANKA 1YHNA 3OIYA 4PX9A 3K0SA 2IHBA 4KVAA 3RLFA 3SI7A 1EK0A 3K0CA 4EPRA 1G8YA 2QE7D 1OH7A 5BYKA 5CDFA 4MRRA 3WNBA 1T8UA 2OILA 1NN0A 1XNJA 1YR7A 4FI3C 1CJVC 3MFYA 4R2HA 2FNAA 4UJ3A 4DCTA 2IF0A 5H8WA 3FB4A 3B1YA 3CW2A 5D3MB 1KIMA 4JKIA 2JASA 1IN8A 1E0KA 4N1AA 2FU5C 4LK2A 4B3XA 1J8MF 2X19A 3C14C 3LLUA 5CLLA 3K9NA 4RJLA 4LGMA 5HE9A 2NO7A 4M4SA 3O8CA 4I1UA 4QHTA 4WVFA 2QL6A 4OHYA 3VKGA 3KXKA 1XEWX 4P4TA 4UNRA 1ZMXA 3AV0B 2ORIA 4IRUB 3PVSA 5J4VA 1KTVA 1N6HA 2CVFA 3QKRB 2GNOA 1UADA 1WP9A 4CGZA 4R9UC 3VR2A 4YMUA 2VQSA 3LVRE 3VNVA 2IHYA 5DYGA 1BO6A 3K0AB 3FHTA 1R5NA 3KJEA 1LTQA 2YVUA 3NC1C 4LOAA 2R6AA 1CULC 1DAMA 3UXMA 1XZPA 4PZLA 1G9XA 4KO8A 4DCUA 3I73A 4LBWA 3NG1A 3LX8A 3HJNA 4IOMA 4YMTA 4QBHA 1WCV1 4Q03A 4D26A 2GEUA 3CH4B 1U0JA 2EFEB 3EIHA 4UNNA 5KOYA 5E3HA 1ONBA 1MV5A 1Q1EA 2PT5A 2VF8A 2QAGC 3WYAA 5KYKA 4DB4A 4BLPA 3GFTA 2GZDA 5LD2B 4MKFA 3VR6A 2IS1A 4HAZA 1XCGB 2J0UA 2HJGA 2QNRA 1YZGA 1L8QA 1DAFA 3FMFA 4GZLA 3IBGA 3WNDA 4BLTA 3SJAA 1KMHB 3OIVA 4B34A 4QHSA 3Q5EA 2P3SA 5KUTA 2BJWA 1Z6GA 4Q7MB 2IYUA 3CRMA 2HT6A 2O8CA 1G16A 4Q1EA 4DHEA 4DZZA 2PJZA 4LUCA 2IS2A 821PA 2D62A 3Q9LA 1ZP6A 3HPRA 4I81A 1NY5A 2ZRMA 2OLKA 4U5XA 3OAAD 1ZD9A 2A5YB 2H8KA 5TMPA 1XTSA 1G291 5L3RA 2WJYA 2HCJB 5EXPA 3IEUA 5GJBA 2ZI3A 4MRPA 4B76A 1VMAA 1VECA 4B71A 4ZIRB 2CL0X 2ZIAA 4O25A 5EZ5A 3GLGA 3HR7A 4PAOA 1IM2A 4LV8B 4JLKA 2ZRPA 5KO2A 2D4HA 2AKAB 5CJPA 1G3MA 4QKQA 2NOAA 4CT4B 5CYPA 2AHOA 3EZFA 2J7KA 3KUDA 3P26A 4A2QA 2P2LA 2ZSFA 1W2HA 5TB5A 4RD6A 1LB1B 2J7PA 2XNDA 4EQ6A 3CZPA 3R9XA 4MKGA 4K8OA 2Q9CA 2JA1A 3B1XA 5J47A 1Z06A 3R8FA 4S2EA 3CLVA 4OK5A 1MRNA 2IYQA 4HAVA 1KOFA 1Z0FA 3RHFA 3T5DA 3GP8A 4X8HA 3IIKA 3SJZA 1N6NA 5EXXA 1Z6XA 5FPHA 3W6NA 3LBNA 3SN6A 4IFEA 1G17A 3TUZC 3QPVA 1D2NA 1R0WA 2RH5A 5TV2A 1ZYUA 2F1IA 2H5EA 2OBMA 5A4JA 4LC1A 3B85A 1KO8A 1GZSA 2WOJA 1IY2A 3FVQA 2C5LA 1W36B 1L4UA 4Z8XA 4J0QA 4D80A 1OYWA 4XD7A 4IDPA 2V1UA 5LD2C 2VP0A 2NMVA 1E3MA 3W3AA 1DEKA 1T3LA 1CIPA 2V7QA 3VHLB 3WHKA 4WBSA 2HYDA 4A8JA 4A0GA 4DT1A 4D4KA 4MGKR 2X8AA 4HDCA 1KHTA 1C9KA 1NKTA 2IF2A 3B78A 5EE3A 1SQ5A 3L8YA 4DIDA 3THWA 3SS8A 1WRBA 4LJ9A 1HA3A 4DDWA 3TSWA 3RRNA 1H65A 2AFIE 3KJHA 3TQFA 1SXJB 4MRNA 4PO9A 5TXGA 3VX4A 1OW3B 2P5TB 1NIPA 2OBNA 5KPDA 3QSYA 4F7WA 1G6HA 4DDTA 2C99A 2Z6VA 4FD2A 4A4DA 5FTLA 1ZAKA 2Q9AA 1QG4A 1NRJB 2C8VA 5AUOB 4GFDA 4W7SA 1SVSA 1TUIA 1N0UA 1CJTC 2QBYB 1UBEA 4US0R 4PTLA 3PUZA 2G6BA 4GP7A 2OXCA 3JVUA 3ZD6A 1G3RA 1NMXA 3CPEA 4CEJA 5GVSA 2B6HA 2AD5A 2J3EA 2ZSEA 1P9WA 2O8EA 5CYOA 5DI3B 4MYUA 4Z1MA 2QEQA 1CBUA 5HCIA 4C9BA 4TMVA 2PEYA 4X8MA 1YKSA 3AKDA 1QVRA 2LWIA 3A1SA 4PPGA 4P33A 1IN7A 1TPZA 3NH9A 3ZDQA 1M34E 1K5DA 2IYZA 1IXZA 1IY1A 1D8TA 4WA7A 4XSGA 5J4HA 1E4VA 4UNQA 3WMGA 2VHUA 4NP6A 2OEPA 2VHCA 1S1MA 3AVPA 1I4DD 5JZVA 5JJLA 5DISB 1W0KA 1EWRA 4KFTA 1TTTA 3P32A 5BW8A 4AURA 3UMRA 1KO4A 5C18A 2CMKA 5EP2A 1E32A 2CLDX 3LQQA 4DBLC 1P5ZB 1E2IA 1XEFA 1NJGA 1P2SA 5KTYA 4TSFA 5KHOC 4URYR 5DLQC 1N5LA 3AUYA 4RD4A 5EUQB 3WY9A 4DUGD 4QM6A 2CCJA 3FWYA 3KXLA 4KFUA 3U5ZB 2IS6A 2ODEA 2QPTA 4LBVA 3DPUA 1NMYA 3EWAA 2DWOA 4Q9KA 1MR3F 3L82B 1E1RD 2RGGA 1BYIA 5FFMA 4ZDKA 1MO3A 2QT1A 4Q19A 3SFVA 2CHVA 5BQ5A 3U3MA 5FI1B 2QPAA 5FTKA 4OJKA 5G40A 3FOZA 3Q8XB 2OCYC 3SJCA 3MJRA 5BN4A 1N5IA 1GL6A 2G0TA 4CIDA 3BB3A 4M1SA 4EJSC 1B0UA 2A9KA 2HV8A 3K70D 3SQWA 1OFUX 4QNMA 2PZGA 1Y3AA 2ZJOA 3QKSA 3AP1A 1UPTA 1OXXK 2BBWA 4RD0A 3DHWC 3OEEA 3A37A 3FDIA 3IQXA 3MMPA 3NXSA 5LBIA 3GLHE 3ZZUA 2CK3D 2HLDD 4V03A 1SVWA 221PA 2WPDD 1XD8A 3U6KA 2ZJYA 4H1VA 3AKEA 4DLUA 1MO5A 2PZFA 1W49A 5K8LA 1OIXA 5AJZA 4PSKA 3BH6A 3UWOA 3QBTA 3LY5A 4IJMA 3W6OA 1E2KA 5IDVA 1W0JA 3PEVA 2IC5A 1TF5A 4ARZA 3U3KA 1EFTA 2QTHA 3A4MA 4M9QA 5L3SA 4XSHA 3QEOA 2O52A 3AQ4A 1HE1C 2RHDA 4NYMR 3NIBA 1YU9A 3C8UA 4GMDA 4LSGA 4DLZA 1E1QD 5LB2A 4BRUA 1WDTA 1NI3A 4XVUA 2J41A 3N2IA 4GOKA 3QXCA 1G20E 2R2AA 3GMTA 1KK1A 3FKSD 3Q5DA 3QOFA 4YQFA 2A5GA 2VL7A 2RKOA 3N2EA 3N70A 5HKKA 4ASUD 4EPTA 4LHWA 3OF5A 1N5JA 5DGXA 1VYVA 4XTCS 4B48A 4YLGA 1SVIA 1N6LA 2GF9A 4RFSB 4BGDA 1NVWQ 3B1VA 2QZ4A 4AG6A 1G7TA 3R20A 4EUNA 4P0TA 1WMSA 1TADA 5E7MA 3TUJC 4IEIA 2XZOA 2W6JD 1OXTA 1P3JA 3QKUA 4GT1A 4B2LA 3W9YA 2ATXA 3GJ4A 1XEXA 3V4RA 2OBLA 3SC3A 1FP6A 3FMOB 1QDEA 1OYYA 4L9SA 5AUPB 1F2TA 4Q4HB 1G3UA 1E9SA 2J0UB 1US8A 3VFDA 5TDHA 1RJ9A 4RKFA 4KCGA 4TLCA 1KI1A 2VF7A 4ZI2A 2JLYA 1FW6A 1CJKC 2JLVA 4TZ6A 1OXUA 1VDZA 1SKYB 1Z6YA 4M9SA 2JLSA 1MOZA 1KDRA 1MH1A 4A92A 1P60A 5SZKB 3SZRA 2AX4A 4GOJA 5JRZA 2O8CB 5C46F 1OSNA 3C41J 4JLOA 4M8NE 1ZIOA 3TAUA 3ZGXA 2RGAA 4AK9A 3QXHA 2CHGA 2ZR7A 1XMJA 3I3SR 4G01B 2QY9A 4XWAA 2NO0A 3H86A 4WAUA 2C2HA 1BMFA 4JSYA 2FSFA 4TYPA 3KFXA 4KBFA 3LO5A 4BWYA 3Q7QA 3SEAA 4Q01A 1GUAA 1WQ1R 4EPXA 1HY3A 2CLCX 1G64A 3IGFA 2OHFA 4MYCA 3FPAA 1ZUIA 5JRJA 2UVQA 3VR3A 3KKNA 1JR3D 5FPTA 5AUQA 2GF0A 2REXB 3W34A 4A82A 3CH5A 2OM2A 2REBA 4GSYA 2I1VB 4O3MA 1EESA 1F6BA 1NKSA 2AL7A 4EQ6B 5DN6D 3GLGE 1M7BA 4LV6A 4YXWA 1E98A 3TR0A 4JVSB 3RSLA 3GJ5A 1D2MA 2R6DA 1DAGA 3ZLJA 2QP4A 4HZUB 1KSHA 3Q85A 3U2QA 1E94E 5GADl 1CS4C 3AGQA 2JDID 4JVMA 3NHAA 5IK2A 4DIEA 1DBSA 3THOA 2AD1A 4M2LA 4F4CA 1VTKA 3P1JA 5TARA 2XB2A 2ZYVX 3CNOA 1FX0B 1G7SA 4PSVA 4URZR 3IPYA 1HV8A 2VHTA 2PL3A 3AVXA 4OI4A 3SFZA 5KDDA 1N3BA 1VCMA 1FFHA 1NIJA 1U2RA 2Z43A 2A5DA 4G0NA 2Q0HA 1MO4A 4NYJR 1GRRA 2VRWA 1OV4A 4EDHA 4DT1B 1FTNA 4JLBA 5EXSA 3AH8A 3AVTA 1QRAA 1E2EA 4ZCIA 3THWB 1AS0A 3U7HB 2VEDA 4HAYA 1E6CA 3THXA 3KKMA 4ZDIA 1YQTA 3GJXC 2BKEA 1W4RA 2JIZD 4I4LA 1W36D 5FPKA 4RD2A 3OE7A 1OPXA 2Q9BA 4DCNA 3ZIAA 1OXVA 2REOA 4NDZA 1XD2B 4JLAA 1T0HB 3HDTA 4HLUA 1TAGA 1OHHD 2Q6TA 3CF6R 3CKLA 2H18A 4RFVA 2YKGA 3W5IA 4FXPA 5K8UA 3PG5A 4NKRA 2HUPA 1LF5A 4RSGA 4K81B 4TT3D 1E99A 4LJ6A 1SXJD 1TQ6A 1YRBA 4MUAA 2WSSA 4ABYA 2O0JA 4JJZA 3FE2A 4CEJB 3WYGA 2FH5B 1AGPA 1OKKA 2AWNA 4GL2A 4YMSA 2O8EB 4LYJA 1PZNA 1ZW6A 4IW3B 1W5TA 4B44A 5FUVA 1GRNA 1YZKA 1TMKA 2IYYA 4PXAA 4NHOA 2QQEA 3K1JA 3N5CA 2X77A 4Q1CA 4PZZA 4IDNA 1VHTA 4NH0A 3TVDA 1S4QA 1FMJA 1I2MA 4XVQA 1ZCAA 3R7WA 3U44A 2X2EA 1GNPA 2BWJA 3CM0A 3CPHA 4G5OA 2QORA 4O0MA 3VNUA 4NCHA 2WJGA 1DE0A 1NLZA 4NYMQ 3UWKA 4OQNA 1PUIA 1Z3IX 2EWWA 4NTZA 4GI7A 4Q47A 1P6XA 2QPOA 3DMDA 4LX0A 1G1MA 4B3CA 3UMSA 4BE7B 2FMXA 2QAJA 4NONA 4DJTA 5C2JB 2GJAA 1NY6A 3TQCA 4FMDF 2GJSA 3QPWA 4GBMA 2IK8A 4C2TA 1U0HC 3MJHA 1KKMA 4E22A 5JHGB 3TUIC 4OJQA 2XX3A 4OHVA 1S3SA 1HUQA 2GJ9A 1DAEA 2IXGA 1JECA 3QJYA 4Q4JA 1OH8A 3KQHA 2G83A 2FZLA 3EA0A 3M6AA 4C0JA 1SULA 2JATA 5A5GA 3NEYA 4A2WA 2J87A 1IJEA 1N6PA 1YR6A 2ODBA 2ORWA 2RHMA 3K8YA 4FCVA 2ZPTX 4BFXA 3RS4A 1AZSC 5E4FA 4HAXA 3VU9B 3U3RA 1YZUA 4AI6A 2QRZA 1Q12A 1AM4D 3QKSB 4QOSA 3RRMA 1X8JA 1S8FA 2GWHA 2C04A 2P5SA 2W6ID 2YOGA 1ESNA 3WMEA 4M1TA 3CNLA 2F3TA 2VIIA 3I62A 2XXAA 1KI2A 1X1RA 2BCGY 3WP1B 1S2MA 2EQBA 2L0XA 4BZXA 2DCUA 3RRYA 2O0KA 3QBVA 3GFOA 1WF3A 5K8TA 3ICEA 1EFRA 3TK1A 1Z0DA 3O8DA 2VP2A 1U9IC 3AF0A 2CNWA 4KVGA 1D9ZA 2J46A 5DE3A 2KSQA 4BFSA 4ZCMA 1SGWA 4KHZA 4IDOA 4D4JA 3NDPA 4A9AA 2GAAA 2VHJA 4FIDA 4F4JA 4P3YA 3AF2A 4NE2A 4Q5IA 5JHHB 2H92A 1G3IA 2FV8A 4L16A 4P4UA 5FL3A 4DSNA 4EFMA 1FNNA 1OJLA 1P9RA 2OFXA 3TRFA 2AXNA 2GBLC 2P6RA 4L9WA 4RVCA 3TSZA 3CWQA 2V4ZA 121PA 2WWHA 2ZRKA 2CBZA 4M9XA 1RE0A 3LLMA 5KNBA 2CLSA 1XX6A 2FF7A 4CEHB 2C95A 2ZS8A 2EFCB 2W00A 2J5XA 3LVQE 4YONB 3ZD7A 2IYLD 2NPIA 3GQBA 1UKVY 4Q48A 1KAOA 4K46A 4OL0A 2ATVA 5DH9A 1UJ2A 4BASA 5IRCD 2UKDA 4C0HA 2RGXA 4FWIB 1M6NA 1XMIA 2ZJZA 2ZR0A 4MDFA 4A36A 2YYZA 2XJ9A 2BCJQ 4URXR 1CTQA 4P31A 3I1FA 3LDAA 4NYIR 5FUXA 1T5IA 1XEWY 3MAAC 4DCSA 1OE0A 4JBYA 4A15A 2VA8A 1NG1A 2EU8A 1G5TA 1JXOA 3M0EA 1R0ZA 1WA5A 5FOVA 1ZM7A 4LJ8A 2YZ2A 1J90A 2G1JA 4TLEA 4DLSA 1GM5A 1HEIA 1CR1A 4IOLA 2WIAA 3LH5A 1F2TB 4EIWA 1US8B 4Q4AA 5J4KA 4URUR 1XCMA 1RJ9B 4R7ZA 3L2OB 3IDQA 5TVKA 1OH6A 4TMZA 1Z08A 3UG6A 3MCAA 4AKHA 1K5GA 4NYJQ 3NWJA 4Y0VA 5J4YA 1G4UR 3MG9A 3E1SA 1COWA 3AVVA 4BEJA 4XWOA 1W7AA 4HUQB 4QBGB 1GKUB 1CEEA 3X1YA 5BXQC 1YRAA 4QXAA 4NL4H 1RVDA 4BECA 4AG5A 1KO7A 2Z4RA 5DIFA 4Q66C 4XJXA 5SZHB 1QHHA 1ZRHA 2FE4A 1DG1G 1KZ7B 2OZEA 4G5RA 2QE7A 3AF1A 3RS3A 1Z07A 2ZUBA 3BORA 4HATA 3UIEA 4A1FA 3K9GA 4FN5A 3K70C 3B2EA 3HR8A 4JLPA 4EPYA 3IBYA 3MWYW 3OIWA 5EE5B 2AWOA 4BFZA 2YV5A 3NC0C 5IT5A 2QT0A 3VMFA 1U81A 1YR9A 3CUEF 1VG9B 2BEKA 1XJQA 1Q3HA 4B75A 4IXMA 5LPNA 2ORVA 2ZITA 5EUMA 4KITB 4C0BA 2QMOA 3QF4B 2EYQA 1XWIA 2GRJA 4E09A 3QXSA 1HURA 4LY6A 4S35A 1GDDA 1FMLA 5H68A 2FFAA 4Q9HA 4Q9LA 4FMDB 5AUNB 2O8BB 3HU1A 4RCYA 5B30A 5SZJA 3UMFA 5GVRA 3ZS9A 3EASA 3KTAB 4QNRA 1XPOA 2O0HA 4LC0A 4XIGS 3TSOA 2J7PD 2XNDD 4DC9A 2IUTA 3LW8A 3RABA 5EP3A 1NBMD 3B8HA 3IQWA 4F91B 4ZI3A 4KAXA 4MGZR 1N2CE 3NBFA 2BVNA 1GL7A 2ZRNA 3B9QA 2YWEA 4A0RA 3GJ7A 1GKIA 3FYHA 2GTPA 3IO5A 2BV3A 1Z63A 1GWNA 1HQYE 1E0JA 2B92A 1ZUHA 4HEJA 4OQXA 5CIQA 5JBQA 3ZH9B 3PR1A 3VR4A 4YDSA 3THXB 2E9SA 4KLNA 4TL6A 5FUWA 1RRGA 4XOIA 2WWYA 1ZD1A 3OEHD 1WBDA 2OCBA 3IIMA 3X2SA 4XD7D 3EC2A 1W48A 2QN6A 1E9AA 3BBPA 4MYHA 3X1ZA 2V7QD 4GPTA 4ZDJA 4NCJA 1LY1A 1DG3A 3VX3A 1DARA 2IL1A 4D2IA 1QHNA 4ZKEA 2ASEA 2Z0MA 4HB3A 1UEJA 5JI2E 1DAHA 1XXHB 4NCIA 3F3YA 4HB0A 3ADKA 1KY2A 2OFOA 4FINA 4LJAA 1XTJA 2B7BA 2GXSA 3D6TB 4POAA 2YC2C 2P0EA 3CRQA 1FUUA 3EPLA 4RZ2A 1KJYA 1Q1BA 2ZU0C 4LRWA 2R62A 5EZ6B 2EVWX 4GOXA 3WBKA 4B43A 1P75A 1KJWA 2C77A 2J0VA 1GL9B 4N3NA 3OFNA 2FWRA 4Z51A 1UDWA 1BS1A 2QTVB 2J45A 1N5KA 1KSGA 1XCPA 4DB2A 2CXXA 5A0FA 1II0A 4O2LA 5EP4A 2BJVA 1ZD8A 3BXZA 5HTKA 1ZM9A 3PV0A 3FHOA 4FW9A 3SNHA 3WYFA 2B8WA 2JJ1A 4GP6A 1G18A 1JQJC 5EE0A 1M1YE 2GK6A 3R7WB 1KI6A 2QA5A 3TIFA 4JL6A 3EG5A 3PCRB 5JWRA 2IW3A 1II8A 4Z1MD 4WXRA 2ZR9A 1TQ2A 1L4YA 1RZ3A 2BDTA 3P4XA 1NMZA 2YC4C 1N25A 1R10A 4BQSA 4C0AC 1Z47A 4EAQA 3X1XA 1EGAA 3SJBA 2FA9A 1FPMA 2BMFA 2IXEA 3EARA 3SDZA 5JCPA 1RIFA 2PMKA 3AKCA 1R7RA 3K0FA 1K8RA 1J70A 3FKQA 1NN5A 2WJVA 4M0LA 4MGYR 2WWFA 2ZE5A 1QVAA 3PXGA 4C3ZA 2MSEB 4CT5A 3TW4A 3SYNA 1PUJA 3TW8B 4JKYA 2IBMA 2QROA 4TLAA 2F43A 4Q4JB 4FMBB 1OFHA 1MRSA 4NYIQ 3AP2A 3R8CA 1ZNXA 3DKVA 4JVLA 3EW9A 1WXQA 3VAAA 3PFIA 2F55A 1GKYA 3A4NA 3I5XA 2G9NA 2IWHA 4KFSA 3PEUA 2BBTA 2JCSA 2VSFA 4ERNA 2FPLA 1JNYA 3MRSA 3CIOA 2FSGA 1YZLA 1CJUC 4LBZA 4ACBA 3ZJYA 2WTUA 3B13B 2XXAB 5EP1A 4OQLA 5E7IA 4KI0A 2MMCA 4OBEA 3B60A 3QXXA 4PZYA 2VPPA 1DTSA 2VP9A 1A2KC 3RAPR 2A3RA 2E1RA 4D81A 3LWNA 1AKEA 1XD9A 3ND9A 4L8GA 4WZ6A 1W36C 1E0SA 3QKTA 3WHLA 4XTRA 3FFBA 4MRVA 1Z0JA 4D6PA 1UF9A 2HF8A 2CE2X 2V9PA 1AS2A 3NDBB 4JIMA 1QF9A 4Q9JA 1JPJA 3KUCA 3MUFA 4EPWA 8OHMA 1DAKA 4QJ4A 5KSYA 2B8TA 2WM9B 1KY3A 1Q3TA 3EA5A 4KLZA 4PC2A 1IHUA 1F48A 2ZROA 5FR1A 2ZVPX 4B47A 1AJEA 2PZEA 4CEIB 3R9WA 2OUKA 4Q1FA 3A1WA 4XVRA 1V5WA 1W0JD 2DFNA 2EYUA 2QTFA 1S0UA 1SXJC 3GLHB 2NG1A 1JXMA 3C5CA 4PC1A 5JSZB 1CRQA 1E79A 1HT2E 3MWKA 3PUXA 4WXPA 1YJ5A 3D7MA 2R6CA 4PHHA 3K09C 4PR0A 2A30A 1XTKA 5CB6A 1UBFA 4PANA 1H8ED 4QBIA 4EFLA 4ACAA 2HCBA 1WE2A 2DFTA 3CX6A 1EG7A 3K9LA 3CF2A 3GJ6A 3A4LA 1ZNWA 2PBRA 4H9GA 5HZKA 1XPUA 5C1BA 5KNCA 4P32A 2O8FA 1ZM3A 2WKPA 2YOHA 5SZIA 5FTMA 5HKKD 5CM9C 2ZTSA 1SHZA 3CNNA 2ZVQX 1X3SA 4YDHB 1OB5A 1CR2A 4OQMA 4M1YA 2RB4A 1B23P 4Q4AB 3RYTC 4IVQA 4DUGA 4JZKA 2DFLA 2H7VA 2AR7A 1D2EA 1T4GA 2R9VA 1IJFA 3LBHA 3F5FA 3T34A 1M7HA 5JFGA 1DVRA 5F9FA 4Q1BA 2Z83A 4RKEA 5F2EA 1DO0A 2JLZA 2XSZA 2ZAOA 3B5JA 5ANRB 2GJKA 3QE0A 4M21A 2CJWA 1Z29A 2XB4A 2IX3A 1EFHA 2EW1A 4IDQA 4GZMA 4M1MA 4LHYA 3T06B 3W5JA 2XZPA 4UQOA 4ILEA 1TQDA 2PX0A 2W0SA 5JS8A 1E2QA 2XOKA 2IXFA 4AKEA 1IOZA 2PCJA 5J4LA 3U7GA 2FGJA 3LXXA 3K53A 3SBDA 3RS2A 4ZPXA 3KZ1E 3FGNA 3T5GA 2VSOA 3ASZA 3AVOA 2QAGA 4LYAA 2CK3A 3GLIE 2AXPA 3KFVA 1RKBA 1XB2A 4Q18A 3QXJA 4DWJA 4Q9IA 2NGRA 3NTUA 2ONJA 2H57A 1CXZA 2WAYA 2WWIA 1N0WA 3RWMB 3VTKA 1BMFD 2DR3A 2GEVA 3AB3A 4D4LA 3M4YA 4WW0A 5KDLA 2V54A 2IYSA 2ZRDA 1A1VA 2YOFA 2YWGA 3K0CC 2G0NA 1M2OB 3HU2A 1H8HA 3ZVMA 1DPFA 2CEAA 3LV8A 4AKGA 5JWOA 2EWVA 2WJIA 5HCNA 2CVHA 3QVUA 5BN3A 3GD7A 3NEJA 3QG5A 3LRPA 4BUJA 4D25A 1AQUA 2IYRA 2RGBA 5KNDA 3A36A 2JEOA 4YXWD 1E9CA 4B33A 4BFUA 1NLFA 1X1SA 2CHQA 2A7QA 2WMOB 2Q3HA 1GG2A 2TMKA 2NPFA 4W5WA 3BH7A 3BIFA 3WNCA 2NTYC 4LJ7A 3GPLA 5HE8A 3JVVA 1L7VC 2QP3A 2G3YA 3IO3A 1RC8A 3B7GA 4AYWA 3GEIA 5AJWA 3CONA 3GLGB 3LD9A 4C0KA 3ADCA 4I1OA 4DLXA 5IK2D 1W4AA 1Z28A 2XJ4A 3BERA 3GCGA 4RD1A 4XH9B 2CL6X 2VHQA 1EXMA 4MRSA 2ZJ2A 3QKRA 4JL8A 4PAMA 1SZPA 1S96A 3T35A 4HB4A 3J81k 3W3ZB 2VP4A 3ASYA 1D5CA 1F2UA 4IDHA 4Q7LA 1E9DA 1YZQA 2ZJ5A 3K0AA 3O47A 5CM8B 2ZUCA 5G41A 2WWWA 3CB4A 1Z83A 5H70A 3KQNA 5AK0A 2JLXA 1UEIA 2OCPA 3W8RA 1TU4A 3L8ZA 1CLUA 2WJHA 4ZV4A 1HT1E 2PLRA 1E9FA 1G8GA 1ZNYA 3MWLA 4KXFB 4TQAA 4U7DA 3I61A 1J8YF 1CR4A 1OF1A 3G82C 4HUTA 4QGAA 3RRZA 3ADBA 1NVUQ 3I8XA 1X6VA 2ECKA 1IQPA 2GILA 2ZSBA 5KSPA 2ODWA 5JI3E 4LPSA 1GRQA 4TN1A 3SHFA 2ZQ5A 4US1R 1ESMA 3ZIAD 421PA 4II7A 3CR7A 2P6NA 3AGPA 3L0SA 5G53C 1OIWA 2IYTA 1MO6A 4QC2A 5ELXA 4KODA 1LS6A 4TYWA 3EIQA 1R0YA 3F0TA 5UKDA 3R9IA 4W5HA 4A8JB 4A0FA 2HYIC 2CCGA 2FFHA 3L0PA 3CF0A 5K8IA 1KDPA 2BHRA 2V55B 2WSSD 3U3JA 4U00A 1KGDA 4LYFA 2QENA 4TL7A 4F4IA 1E9EA 4M1KA 5BWMA 1G4AE 3RSOA 1DELA 4B3GA 5FTNA 2YINC 3VQTA 2HT1A 4LHXA 1U8YA 3WBJA 3DZ8A 3CR8A 3PENA 4B2IA 1P4SA 4HI0E 4IVPA 1IXRC 3TBKA 2JJ2A 2NIPA 4LDJA 3K0EA 3GLFE 4OI2A 3ONWA 4ZIRA 3P20A 1LNZA 3THYA 1J99A 1IXSB 2LKCA 1J2JA 4P4SA 4PHTA 4B3FX 5EXTA 2F9LA 4I99A 2J59A 2NO9A 3QPUA 5L3QA 1VG0B 4ZDWA 3VKHA 3QF7A 2NO1A 2D7DA 4CVNA 3PJRA 1N6IA 1EFUA 1IN4A 4KYUA 2VP5A 3BFKA 3LQRA 2IYWA 1OFIA 4ITRC 3W8NA 2ODNA 1R8QA 1G7CA 2OG2A 3OZXA 2SHKA 5JMTA 2FEOA 1RRCA 1RYHA 1EWQA 3S1AA 4D0NA 2N46A 3U60B 1A82A 3AUXA 2PEZA 2QQ0A 4FCTA 1XBTA 1OLOA 3NH6A 4O2RA 5FOSA 4OI1A 1NJFA 2C9YA 4QM7A 2MMGA 2QSYA 2ONKA 4C7OA 1G5RA 1V43A 1XRJA 3QVVA 1E2HA 5DSZA 3AVYA 2ZE6A 1KYIA 2OESA 4JSTA 2JLUA 4F38A 1AQYA 4URWR 1U98A 3PUWA 2UZ3A 3CO5A 3EZ7A 4PAQA 4LHVA 1A4RA 4LI0A 3A6PC 4AY2A 2RGNC 2OCAA 3RANA 4FMCF 5HPYB 4RY2A 4TQ9A 3ZYCA 4L4UA 4UXHA 4BLRA 1IY0A 1E2MA 1NLYA 4JT4A 4MUBA 4R71A 1VIAA 1YZNA 2HXYA 2Q3FA 1JAIA 1S9HA 1KK3A 2HXSA 3C4JA 3QI2A 1G41A 1ZIPA 2ZRIA 4A8JC 4FWTA 5FBWB 1OH5A 1U99A 4TT3A 2B7CA 1S9DA 4JS0A 1SXJA 5E95A 3ZQ6A 2LKDA 1PLKA 1DO2A 2P65A 4NPHA 1EFRD 1UKYA 3AVQA 1KNQA 4JBWA 2H1LA 2PJRA 4EJSA 3P4YA 2CNWD 1P7CA 4QL3A 3UKDA 2FPMA 4UKDA 1FP7A 4HAUA 5DI9A 3KQUA 5KU1A 2PLFA 2ZYUX 2BIFA 2KE5A 4GMXA 1XTQA 2J9RA 4X8LA 3GJ3A 4ON9A 1KKLA 3H2YA 2QBYA 3HU3A 4HB2A 4LCBA 3IEVA 1PVOA 2DWPA 4KJZA 1T9HA 3D3QA 4MKIA 2V8OA 1JQLB 1N6RA 1IN5A 3BS4A 5J40A 5L3VA 4DSUA 2BMJA 3PUVA 4G3XA 2JLWA 2ZEJA 2ZSDA 4NZYA 3CX8A 3KX2A 5DI3A 5FH9A 3KB2A 4PC3A 3K9HA 3EC1A 4MITA 2IS4A 2DYKA 3CRRA 3FMIA 3OESA 5H1YA 3OIUA 4D82A 3LXRA 5BYJA 3FMPB 1YVDA 1Z6TA 3B9PA 4KSBA 3CX7A 1ELOA 1T91A 4OK3A 4ARZB 2A5FA 1PV4A 5L3SB 4C0LA 2OT3B 2RGDA 4B3BA 3ZVLA 5F3WB 1D9XA 5FI0B 2OAP1 4Q1AA 4FCWA 3A1UA 1P61B 1TQ4A 4HAWA 1TNDA 2FOLA 4GNKA 2QP9X 2IWRA 3VR5A 3EPHA 4F92B 2A5JA 1ZC3A 4TL9A 2CJWB 5G3ZA 4PQFA 4DEYA 4V0MA 2ZM5A 1VG8A 2AN9A 4DLYA 3SYLA 4G5QA 4UNPA 1W5SA 4CW7A 3RS0A 1F60A 2ZI4A 1FNMA 4BRWA 3BD9A 3DOFA 5JECA 1TF7A 2GCPA 3TMKA 3REFA 1DOAA 4YC7A 3LAWA 5DYIA 3PUYA 1COWD 3NHBA 2RCNA 5FPSA 4QGHA 2QUZA 2Y8EA 3BOSA 2E87A 4UXIA 2WZQA 1ZINA 1XEXB 4WZAE 3AF4A 1Q1QA 4JVNA 4OHXA 3QUSA 3DM5A 1FTSA 1QG2A 3V4FA 3ETLA 2O8DA 4IKEA 4Q7KA 4IHQA 1Q57A 4TWZA 1M8PA 3EPKA 3RNLA 3LNCA 2LCFA 1D6JA 1Y63A 2N42A 4OQFA 4HZIA 1IONA 4OI0A 1ZU5A 2ANCA 2KWIA 3BE4A 2NZ8A 1NL3A 2V3CC 3MGCA 1ZM4A 1NN1A 1VCIA 5FL7A 1MABA 1GNRA 3G0HA 2BM0A 3EXAA 2GCOA 4PPFA 5FUYA 4YMWA 3QENA 1WBBA 3GLIA 1LW7A 4AYXA 4PSAA 2ZRAA 3I32A 5FOTA 3A1VA 2R8RA 4DRZA 1L2TA 5AJXA 3CRW1 2GZHA 721PA 1ZC4A 3WRYC 3U7FB 5JJKA 4MQBA 1CF4A 1QHXA 1X86B 4XWKA 2O5VA 1FL9A 3PQCA 1R8SA 2QMHA 2V6IA 2AFHE 5HR5A 5TY0A 2IYXA 3KXIA 4L5BA 2ZXUA 3F8TA 4JMPA 2XAUA 4BLOA 3C15C 3T1TA 2D2FA 4TTQA 1GITA 4FMCB 2KB0A 1F2UB 2RAPA 2ZANA 3Q72A 4KV9A 4BEBA 1VCNA 3BJIC 2OXRA 3BGWA 1P2TA 3A8TA 4RFSA 2JLRA 1KI9A 1ZNZA 4LJ5A 2F1JA 2KBFA 3Q7PA 1G8PA 4A0HA 1M7GA 4RZ3A 4B6FA 3O8BA 4Q7JB 5HZHA 4PQYA 1EX7A 1JB1A 2KJQA 1A7JA 3E70C 3A58B 3VKWA 2P67A 3ZQJA 3QQ5A 1Q20A 1NVVR 1KZGB 2CL7X 3PEYA 1PLLA 4PQRA 4R2IA 4RZXA 2VTKA 1VYTA 1ZCBA 2ZI6A 1P62B 2XEXA 3DDCA 4Q4HA 2GJ8A 3O8RA 4AKIA 2WAXA 5BN5A 1LF0A 3H0KA 1JJ7A 4D4MA 3BH0A 2ANBA 4ZO4A 2F9MA
chains in the Genus database with same CATH superfamily
1E0DA 3S3TA 1B41A 2EAUA 2G70A 1SB9A 5CLGA 3VR0A 1R8YA 3DW1X 1H2EA 1NMQA 1NYRA 2BHNA 5IJWA 1YQWA 4RTJA 1W52X 3C6YA 2PGOA 3X44A 3FZNA 1Y1QA 4DR3B 4MPTA 5JD4A 5AKEA 4ZCLA 4P3OA 3PIRA 2HHCA 1RTTA 5KAPA 1QAMA 4HDKB 3QTTA 2BI8A 3X2EA 3MWJA 1AA9A 4DTIA 1AHPA 3OQBA 3HN7A 2V7EA 1S8AA 2OECA 3QVTA 3M89A 3H5NA 4GE3A 3UQYS 1HKUA 2H9YA 4MVJP 5FBQB 1AZLA 2OAGA 3OT1A 2PX8A 1YT5A 5KS2A 1HEUA 1TZCA 2R86A 1WXDA 4ADSG 3EZXA 1MFPA 1DQYA 2LIPA 4ZI7A 3DGFC 3BFXA 3ZGOA 5GONF 2YIJA 4L1KA 2HHJA 4IS2A 1QJ4A 5JZSA 3IQIX 3ESQA 4MR7B 1CY0A 2H5IA 2WWXA 4ZREA 2OGZA 4DSTA 2GVZC 3P27A 3CJRA 1UMDB 3PHLA 3SR0A 3I5YA 1LPBB 3UUWA 1Z5VA 3RUIA 3WK6A 4S05A 4ZOLB 3LDHA 4M99A 1KAHA 3ISJA 4P7JA 5EWJA 5CXXA 3VPGA 1KBOA 3O3MB 4L6AA 3IJRA 3WKDA 4EHHA 3V9PA 1YJXA 3AI3A 2IEYA 4IICA 4L4SA 1I9GA 5AJYA 2I87A 1EXNA 4LDZA 1E3JA 3KWJA 4C5AA 5CK5A 4CWAA 4AVYA 1Y5LA 3FHCB 3V00A 4JJIA 1Z8DA 3R6TA 4H18A 5LC1A 2YUTA 2C4TA 3I9JA 1N32B 1ZI8A 2GLXA 1NUPA 1YZTA 4R31A 4F45A 1F4PA 3MINB 1EB8A 3GLFA 1IN6A 4RANA 3ZVKA 3PC3A 1SVMA 1QX4A 3GJTA 2C9CA 3EQ2A 2PPVA 4DUYB 2Y6UA 1K7FB 1NWCA 4KPEC 1QYDA 2YQ4A 1FX0A 1TLLA 1USKA 2HA3A 2ZRFA 4BO6A 4CCAA 2DHRA 5HXAA 5AXBA 1KAQA 1H9BA 2HTFA 3PQFA 4N8DA 3WZMA 4BVKA 4ESVA 1GLGA 5B3JC 4KNYA 4UVDA 4J3NA 4B1FA 1EE1A 5KZMB 5FLYA 1XZMA 2XGOA 4RZUA 5JDCA 2FWBA 3I39X 2H0RA 1RCFA 1HE4A 3JQAD 3DD1A 1LRLA 4LHEA 1Y5NA 2MSCB 4MULA 4QGGA 2Y6VA 3ORHA 2AOUB 1LLUA 2C9OA 2WV9A 4DWOA 3V8EA 1QH9A 1KAGA 3MD9A 4UM8B 2GEDA 3A6DA 2PXAA 3BJZA 3HP1A 3WHIA 5IKEA 4EELA 3NLLA 1L7BA 2A57A 4ITVA 4DUZB 3EHEA 4J7CA 4XX1A 4ENQA 4WK2B 4YAOA 5JPCA 1T6NA 5E4JA 1DC8A 1XMVA 1XRSB 3GP5A 1FFBA 3M6WA 1XD2A 3NM5A 2EP5A 4TLBA 4TSFD 4TV9F 5EQTA 1M0WA 4ESHA 2XZLA 3IKJA 5JARA 1YA4A 1ZA2A 3IE2A 3WLLA 1FNBA 1XSEA 3JZMA 3O8NA 2ZBVA 3GT0A 1WCYA 3M6IA 5IZCC 5KX5F 2E4XA 1QB8A 1A88A 2EJCA 3AEXA 4J0JA 1V6SA 4NULA 5HGJA 1J9GA 1L1FA 3A9WA 3QK7A 4GO1A 5G2OA 1RW4A 3VOAA 5CD1A 2CWDA 4EEXA 5DGCA 5F7XA 1YC5A 3DE1X 2FCRA 1KC1A 4TYMA 4KQHA 3ERCA 1CZNA 1C1YA 2R00C 4TQUS 4DDVA 4AWXA 1KVQA 2GOYA 1P73A 1CFJA 1OR8A 1U9IA 2OD7A 4DBZA 2OHVA 4WRRA 5J1SB 1EVJA 1DKLA 2QRKA 5FP0A 1MAVA 2AI1A 3RF7A 1BDBA 4RPLA 2DBYA 3EYAA 5TPWA 1KZHA 1D4AA 4JYBA 4QVIA 3OPXA 3EWSA 5CEEA 2IA5A 1O6CA 2IT1A 4FWBA 4XIGS 2B94A 4M22A 3G8AA 2LE0A 5C1IA 4NCKA 1DC6A 4X20A 3UYLA 3QVWA 1D1PA 2ZT6A 2KQUA 2NT4A 2F1RA 1G5PA 2IDKA 3OEED 5E1OA 3VR1A 2HJWA 4UNSA 4CRWB 5FBVB 3I6MA 4FOLA 4ARIA 3V34A 3BWYA 1EDOA 2GO7A 3MB5A 3LW7A 3H8VA 3E3LA 3V6MA 4E4YA 4ZV7A 2VDWA 3DL0A 1XFDA 4NXNB 2ZDQA 3STYA 3O3OB 4PBTA 3RLIA 4I6JA 1N0VC 1ISJA 4IR7A 2P8SA 4C21A 1I2AA 1TZBA 2P41A 3OFSA 3T0IA 2GAOA 5IKPA 5L4SA 1B8VA 4B35A 4TTPA 3GFRA 3SIPA 1W4CA 2DTEA 2A78A 3M4XA 3N07A 3FR7A 4BX8A 1XPRA 3AEYA 5MFZA 3NVMB 3ZVNA 4HQFA 2IZ1A 3D8TA 3TTYA 3KBOA 3N8HA 1P0IA 4X8OA 2RHTA 3R7AA 2AOVA 5M04A 3A0RB 1BDJA 4HLCA 1IFXA 4F72A 5D51S 2AGVA 2HMSA 2VPYA 1DJQA 2XSZD 5AI5A 4TTRA 4MEJA 5GJVC 1L8AA 1BS2A 2QN3A 2YFHA 3BB4A 3GRCA 3RW9A 4JU8A 3HXLA 3O91A 1OIVA 1AGXA 2IE8A 2OV3A 1EPUA 3DEJA 4JC0A 4N18A 4BDTA 3FPJA 4NR0A 1RFLA 3TVTA 3PQ4A 1JUDA 3PNVA 3TFWA 2O8DB 2YWHA 3B2NA 3REGA 2D06A 2XOKD 4CR6A 5I7WA 4ZICA 1PBNA 3PYXA 1Z0ZA 3P0JA 4AW9A 2ZI7A 2OGWA 3OJFA 4WIAA 5DO9A 4EY8A 4X7MA 2DKOA 1K3FA 3ZCXA 4RM3A 4GLFA 4X7BA 4QOIA 2XNSA 1DEAA 2O3SA 5CJJA 1R5OA 3K96A 5LQNA 1ZCFA 4B3IA 2NZXA 4FN4A 1OROA 3WKBA 3RAFC 2C61A 3AP3A 3PNQA 2EZUA 1QG0A 2VK8A 1F2DA 2ZAMA 2HWYA 3NBYC 4GYYA 5CITA 4KYIB 4IG9A 2WA1A 1E9BA 2C31A 1QV6A 1Z6PA 3F5DA 2BKUA 4RHEA 5CDFE 1F12A 3ABIA 1RXIA 1X1DA 3HA7A 3NIWA 3TINA 3LLCA 2EP7A 1K97A 1KVRA 3FFTA 4ZO6A 2HXGA 5CLQA 3M2TA 4NE9A 2ZS9A 2FN9A 1T5LA 2OQRA 4X6YA 3RTCA 4UHEA 2FX2A 4F2PA 3QW4B 4UQLA 2VQ6A 4DUPA 3WLFA 5KBYA 3IMGA 4TZTA 3SEQA 5LLDA 5CJ2A 4R98A 4R3NA 4IUCS 4UXJA 1IBSA 2D1TA 1FFXB 5GGYA 4CGYA 2COKA 3AVUA 5EERA 4ZCRA 4NABA 1F3OA 2BZ1A 3SQXA 4IY1A 1G3QA 2CHFA 4FC6A 3CVJA 2NYRA 3E6AA 3STHA 1H3FA 5KNDD 3KOUA 4MAMA 5IKXA 2A3NA 5LU8A 2H54A 4JBLA 1EINA 4QIHA 3Q98A 5LP6A 2RGRA 1TJ3A 1YHZA 2QTAA 2ZBEA 4OQ4A 5IULC 3KQKA 5FHQA 2QVBA 1PDOA 3HH8A 1WD5A 5FORA 1U0TA 3DTVD 5CDUA 2AXEA 5F7JA 1C1HA 1QBGA 3FJ1A 2QRNA 4EKYA 5IJZA 1Z5OA 2WT4A 1E4YA 1P9NA 2BFMA 2WINI 1UBCA 4Q21A 4TKVA 3RSCA 4IVRA 4J7AA 1GA6A 4UVIA 3W5BA 3OCXA 5TEWA 1Y9ZA 8GPBA 1N3LA 1VL2A 4LJSA 1FEZA 2GARA 2WUFA 3MXOA 4D57A 3V7NA 4CDMA 4L2IA 1GTMA 4BQPA 3IEMA 5EJFA 1PJ3A 3F3KA 5AVWA 1QNFA 3ECCA 1OU0A 5D87A 2BBOA 4O0LA 3QXGA 4II3A 2X6QA 4O5AA 3TZEA 4DVGA 2YTZA 4EECA 5I47A 3DOHA 1PJLA 1OYOA 3GRKA 2RGCA 1ODTC 2NUAA 3QEJA 1X1AA 3A3YA 2QN1A 1FFDA 1BEUB 4G4IA 2XUQA 3HCNA 2J9FB 1DDOA 1GP2A 3LK6A 5H9WA 3RSSA 1GSHA 2RAFA 1E2LA 1I0LA 5H02A 4JR0A 4QGFA 3GOHA 5HIMA 1VI6A 1HH4A 4ZVSA 2QM7A 5C80A 1TU3A 2E5FA 1I1NA 3CW8X 2VH5R 4FYIA 4LBYA 3FLMA 4JODA 4OKIA 5HF6A 4CM3A 3SIWA 3H2HA 1G8HA 4B7AA 5AI6A 2DHEA 1N0IA 1YR1A 5D86A 5EZYA 3RUDA 3TLGB 3VPCA 4B45A 5DM70 3VDNB 1ZVMA 3GJZA 3CNQS 2CEKA 1D2RA 3HYTA 1LC3A 2IXAA 3PI7A 4HNGA 1M2HA 4UU7A 1MW9X 4JQYA 1B6GA 2OBFA 4R7TA 3TQHA 1XCLA 4DR5B 1SWVA 4AY6A 4MKHA 3RK0A 1B76A 1S8NA 4C88A 2WC1A 4RACA 4F9GA 1JJVA 3KM0A 3ZHRA 3THSA 2C97A 2JJ8A 3E27A 3QU7A 4Z86A 1Y7IA 1ORIA 1YQXA 2NU9A 1B8OA 2VHXA 3ABSB 4E3WA 4HF7A 2EFJA 3PQDA 2AKYA 4BFTA 1I2CA 4I50A 3N1UA 4GOOD 5B1YA 2PS3A 3BMQA 4CV0A 2I67A 4LWZA 1L7EA 3FRHA 3PHCA 4BFWA 4JBHA 4YAJA 1VP9A 1KK2A 3HDVA 4K1XA 5FBLB 1WM1A 1ZXLA 1UM9A 3PVCA 1U90A 3QF4A 4BV9A 4DSOA 3KEMA 4E07A 2ZUSA 4MVJF 5C5EA 3LRXA 1K5PA 2FDRA 3CQ9A 2O8BA 3BD6A 1JJAA 2TRSB 2VLBA 3O0DA 3GVHA 1CVLA 2NUBA 2R48A 4L15A 5FPYA 3VHXA 5DV9A 4F3KA 2DFKB 4CF7A 4MPRA 3SVZA 1W2WB 3KT0A 3QUQA 3N8GA 2FHPA 2OLEA 3NIFB 4RD3A 2C7RA 1SBZA 3E9CA 1JSZA 2JAQA 4OKSA 4OAPA 4A6XA 1DOZA 1JIVA 5CU7A 4BZQA 2XTJA 5AVKA 3KR0A 4ETIA 5HBGA 5JPDA 5LNK6 3HWSA 1JLHA 2JK1A 4M1EA 5J43A 2M9MA 5ISMA 4CM8A 4UULA 3AM1A 1L4BA 4Y6GB 4F9EA 2RHHA 1EWKA 2PZBA 1W4ZA 4KAAA 4ZRDA 2G8NA 2MT9A 3RADC 3ZE0B 2BEVA 1QHYA 1E3EA 4G4GA 5GY7A 5EKXA 3UATA 3V5NA 1ZR2A 5JBNA 4EA9A 2VNJA 5AIBA 1HGXA 1JIQA 5C8VA 2PMDA 4QTYA 4YRSA 5EHXA 3LP8A 1VI2A 3GWGA 3M1YA 1E8DA 3J80A 4LYYA 2DPXA 4JY7A 1HTBA 4Q4DA 4BZWA 3V7UA 2ZUDA 3TM5A 3EEOA 1JZTA 2G88A 4JLSA 2YV3A 4FYPA 5T64A 2AK3A 4H3SA 5KSZA 3OM0A 2UAGA 5FTJA 3C5HA 4MUMA 4Q3LA 4Q1DA 4JQCA 2EF1A 4IFIA 3MHTA 1IVNA 4E4TA 5MGBA 1KYWA 1L4FA 1UWLA 2GZ2A 1R6BX 2HJVA 3FYSA 5EIBD 4D97A 4YT8A 4YMLA 1KK0A 2BBSA 1FFAA 1MXHA 1J7KA 4TM7A 3UGTA 4JXKA 1PEAA 1XXHA 1Z6AA 1DJMA 1YMVA 1BAPA 2HPAA 2JA2A 3HVIA 4INZA 2XMGA 2ET6A 3MJDA 1NN3A 4I55B 1NVXQ 3BREA 4G65A 4B3SB 1PKXA 1E92A 1JG1A 1DKRA 3RC8A 1C50A 2N75A 2L69A 3DZGA 3JARA 2IUUA 4FHEA 2X2FA 5AVVA 3RNOA 3MB8A 4DLVA 4AD8A 3TJZA 1RXSA 1ESZA 1K27A 2QTVA 1GDHA 1NDUA 5FR2A 1CUUA 2YN0A 2R6GA 1FJ2A 4OO3A 2Z95A 1XO1A 1Z22A 1EDEA 3IP6A 5FNZA 3URKA 2I7CA 3RFUA 3PT9A 4LK3A 3IVGA 1NRIA 4QOJA 1HSZA 4EKDA 1NP6A 2FFRA 1I2DA 3D43A 3PFKA 3Q8WA 4A6PA 2GCNA 2W0MA 3BXHA 1DV1A 3ZY2A 5J9FA 4BMYA 3IT0A 4EG6A 4HDOB 5AD1A 3RYFA 4A7PA 1BCRA 3UT6A 3L77A 2P2ZA 4J43A 5E2IA 4JL5A 4AQYB 2HOQA 2F7SA 1GLNA 2JLBA 4FGUA 2WQ6A 2X7JA 2GHQA 2G71A 2C0QA 2IOYA 3PPIA 1LNSA 1N8SA 5T4EA 1D04A 2PLWA 1AF4A 1Z5GA 2WOOA 5AOVA 4RJ2A 2QD5A 4F6RA 2YHBA 1QF7A 3VZCA 3IH5A 1D6NA 4KXQA 4IIYA 4X1KB 4CMJA 1VPLA 4OM8A 3TW8A 4WFKA 1B0PA 2XUKA 1DIRA 3EMVA 4G0PA 3INNA 1HRKA 1S1CA 2C4KA 1FLDA 1OXSC 2O7SA 4QFCA 4XR4A 2Y9MB 4YTEA 2GXAA 1UPUA 2BF4A 4OHFA 4RM2A 1Q21A 2JGJA 2NTVA 3M2PA 4CMIB 2BFPA 4FFPA 2C96A 1SBHA 1BX0A 2ZCUA 3EY9A 2OPHA 3ZIUA 3D2LA 1MAAA 3GJ0A 4BNMA 5H80A 1RLIA 1LEHA 4IXNA 1RAFA 2P11A 4PXYA 4YFYA 4OXIA 1MN6A 4D3DA 1CE8A 3EZ2A 2O0LA 1ZOIA 1YCHA 1H6AA 2EL7A 5DNDA 3DFMA 2C57A 3OZTA 4IS3A 2VQFB 3WDLA 1XLTA 3JQ7A 3A05A 4V0NA 3PUKA 2NU7A 3F6EX 3ENZA 3H9QA 3NWBA 4XOUA 1Y3CE 5EJEA 4HDQB 5LKAA 3DZDA 4GRAA 5IEJA 5GJWC 1UODA 5EJGA 3NGXA 3TH5A 1E7QA 5C4GB 3WKCA 2F1HA 1YUMA 1UAAA 4LFAB 1H4TA 2F6RA 3N2GB 4FGJA 3Q0EA 2W2TA 1JEEA 1L7QA 1RJFA 3DNFA 2GJ4A 1EG2A 4YRZA 2ZREA 5ILOA 1KAMA 2EG9A 3UJ3X 4I2NA 1XZCA 3RTBA 4YAGA 3OHMA 5K0JA 2ZUWA 3USZA 3K70B 1T2VA 2B35A 3IC5A 3TIIA 5JLJA 1GYRA 5GMOA 1X39A 2PTHA 5L95A 1NOKA 4CEIA 3ELUA 1AUXA 2BMVA 4OBWA 1CNEA 1EB9A 1XQ9A 2H0QA 2X40A 3ANMA 2ZDGA 3SHVA 3PGMA 4KSCA 5EYPB 4BO8A 3P9SA 4OHWA 3NQ41 3PHJA 2E3JA 2P9ZA 3M5DA 3BSSA 1DTEA 4RZQA 1IBLB 5H59A 2JFFA 3L0IB 1LV7A 3K0SA 4KQKA 1UK9A 4QTXA 5GZ1A 3G2NA 4GD3Q 4OL9A 1SCQA 2PTGA 4QO7A 1QOZA 1STOA 5T57A 1QZZA 3HJTA 4BNYA 1ZN8A 2QE7D 1OH7A 1P9OA 2BUCA 5L7WA 3LI2A 1MB2A 1P1FA 2B83A 5J2TF 5BYKA 1UWVA 2QD4A 4NESA 5F7OA 3LYHA 3L7NA 1MTOA 1T8UA 4X24A 4ZPJA 4DYHA 4YUYA 1YR7A 3N2YA 1U3UA 3IXMA 1C8KA 3NPMA 1XK7A 2I9PA 5K2OA 5H8WA 1GTSA 5D3ZA 4Q1VA 5BOSB 1ICEA 1KIMA 1XZAA 1IVYA 1XE3A 2J6IA 1SG0A 3DVSX 3GQVA 3WSTA 2GB4A 3QYAA 4E7OA 4N1AA 4CCYA 4LE1A 4B3XA 1J8MF 5CHEA 3HG7A 2HI0A 2J3LA 2AFHB 3A9UA 2AUTA 2WDZA 4N3CA 5AMXA 1OMOA 2CMHA 5AK6A 4EG8A 4AUEA 3D3EA 4YAKA 1NGSA 4LGMA 2NO7A 3JY6A 1SKUA 1FDTA 4NFHA 3CLTD 1JX6A 1I8TA 3DWIA 3VKGA 1GV0A 2DQKA 1ONNA 2Q6VA 1BKSB 2FN3A 2VN8A 1XEWX 2Q7DA 4UNRA 2J5QA 2AYYA 5F2NA 4XASA 4FOTA 1KS2A 3D6JA 1E59A 1IYZA 3PVSA 3W1EA 2G5PA 1N6HA 3ZHQA 1EBFA 4MV9A 3ABZA 1N9GB 1UADA 1Y8QB 1R9GA 5DZSA 3PE6A 3OLZA 4GX0A 4AJEA 1BO6A 1RXUA 1ZIYA 2VBIA 1EIZA 3KJEA 3HO8A 2BFFA 3KQQA 2FUCA 2YVUA 4KTVE 3KQOA 4GC9A 4LE2A 4LOAA 2R6AA 2JAUA 4RHTA 3REQB 2IGTA 4RORA 5JR3A 5DP1A 3ZY6A 3B53X 3WZLA 4XXHA 4BGEA 3K5WA 3OTWA 1NP7A 1RT9A 4JI3B 1R1DA 3F3SA 3OM9A 1E5TA 1SQFA 2TYSB 5KYUB 4NSNA 4KO8A 1OWPA 1LDMA 1U5CA 3I73A 4LBWA 4KMRA 4KPGA 1M8KA 2F1KA 1PJTA 1I3NA 1TI7A 2HBZA 1T6ZA 4CL0A 4D26A 3DJYA 4MZDA 4WCFA 5E3HA 1DRUA 3FCOA 1ISMA 1Q1EA 1G63A 2VF8A 5KYKA 1AGYA 5AM0A 4E3ZA 4B80A 4JCCA 2GZDA 3Q7RA 5LD2B 2YY6A 3H5VA 4NJMA 2J0UA 3HEAA 3UJAA 1ZH8A 1G9SA 1JFTA 1EP1B 1L4LA 2GNAA 3DMHA 3IBGA 3WNDA 2K2QB 1HG1A 3E9EA 5EVJA 3RUEA 4Q3CA 1KMHB 2PMEA 3OIVA 1GNTA 3ANSA 3SC2B 1M2OA 1XNRB 4OGWA 3D8RA 3HKEA 5K7SA 3EVGA 1Y5RA 2XECA 5F7ZA 2AR0A 2BJWA 2RJ3A 5KUTA 4PG6A 2BM8A 4OYLA 2DCMA 1PKEA 2OMKA 3GMSA 1ADCA 3S8MA 1YJBA 1Y6ZA 1H1LA 4Q1EA 3AEUA 3C74A 5LMUB 2WUDA 3Q9LA 1EGMB 1WKBA 4KDEA 1ZP6A 2E4VA 3HPRA 1NY5A 3EDCA 4EK9A 1G60A 2OLKA 4PFJA 4JR2A 4U5XA 5AT1A 5JAHA 1NFFA 2A5YB 2B30A 3BL5A 3R3SA 1FZTA 1W29A 4YO7A 2XNHA 1G291 3H6GA 1GL3A 2W2NA 2WJYA 1MEEA 1QVVA 3EGXB 2P9QA 3D4IA 4FX5A 3OUZA 3TOCA 2B8EA 2CGEA 1T5OA 1BTOA 2WT8A 3D2BA 3V4OA 3FZQA 4O25A 1QHEA 1AUPA 1P4JA 3TX6A 4FYJA 1H3NA 3G2HA 3HR7A 3U4IA 4JUFA 1IM2A 3W4KA 1RHQA 1MXFA 4LV8B 5F4BA 5KO2A 3BMCA 3SQMA 4TWAA 3T5PA 5JDIA 4OXNA 2YS7A 2W71A 1DKMA 5CJPA 4XVCA 1V1RB 2B34A 1HOXA 4S1OA 4UBNA 4QKQA 2XYPA 5CYPA 1SCJA 3F3MA 4UARA 5C34B 1OZ0A 3MBOA 3P26A 2IP4A 1NQOA 2I7VA 2NSYA 3AY0A 3RUFA 4GEGA 4RD6A 1Y5MA 2J7PA 3A6JA 2GCGA 2XNDA 3CZPA 4M9CA 1T3ZA 4Y2VA 2J5BA 5T8KC 1JAZA 4YECA 2JA1A 3RODA 1GZ5A 5KJEA 4S2EA 3R8FA 4OK5A 5ENZA 1MRNA 4KR6A 1WUIS 1Z0FA 3RHFA 1B8PA 3T5DA 2LXNA 5D7BA 5HOEA 3KKKA 4PZ0A 3NTQA 3ZHXA 3IIKA 3SJZA 1N6NA 4L74A 3ES9A 3NBAA 4GECA 2NT3A 4CR7A 4Z53A 3PQ3A 3LBNA 4AROA 2EZTA 1YJ8A 4XYMA 1G17A 1VM6A 4MMYB 4NBVA 3TQIA 1Z34A 1S2IA 5AI4A 4ALLA 2CXOA 2F1IA 3PSAA 5IAJA 5A4JA 3HXTA 5L4NA 3HTXA 2CZCA 4LC1A 2CXPA 4B8YA 1JG3A 1GYQA 5FNVA 4ZVQA 3LC2O 4MUYA 4Z8XA 1ULHA 3I52A 3M8KA 4D80A 2YCBA 4UM7A 3BN3A 3LQYA 3T0GA 1QIIA 3W3AA 3OQOA 4A8HA 3BJMA 1V3VA 4A8JA 1E3MA 4B6JA 1A8IA 1TKBA 5M34A 1UJMA 2HHAA 2O20A 3DR5A 4I8IA 3DUFA 1QIDA 3DSRA 1RABA 4X44A 1MVOA 3VJKA 3B78A 1SQ5A 2HN9A 2ZWPA 5ICCA 3THWA 4LJ9A 4GOMD 4Z4IA 1K0UA 1R4MB 4DDWA 4OXKA 1JHDA 3KJHA 5ALTA 3OKCA 1QMGA 2CXSA 3K6KA 4ZODA 2JHFA 1D2AA 1XQVA 1CNMA 1MVLA 1IWBB 1WHTA 3DC7A 5IJ9B 2CV1A 2OBNA 4GM1A 1RQ7A 2H7XA 5BP7A 1U04A 1JG4A 4D42A 3Q3CA 2PGIA 2C99A 4EVIA 5FTLA 1V3TA 4A4DA 1ZAKA 4ECEA 2I6TA 1JP7A 1Z8NA 2J31A 2A4MA 3R24A 5JZMA 1YH3A 1T4BA 2OD9A 4AJNA 2E18A 2C8VA 5IVPA 2UUAB 4KGVA 4OQEA 4PF1A 4W7SA 1ZGBA 3DO5A 4FBMA 4D8YA 3E05A 3PUZA 4FXOA 1B6SA 2H0AA 2WHEA 3P52A 4LRXA 4MX8A 4AJOA 3DLIA 5D00A 2NTJA 5HILA 4CT0A 3FTFA 3JSXA 4X6UA 4YN3A 1EUCB 2B6HA 1FRNA 1SC9A 4F21A 4MUEA 2O8EA 2R5WA 1USWA 2QJFA 2ZAIA 2COEA 3O26A 2N0SA 4MI1A 4MP8A 3AI1A 1CBUA 4AL4A 4TMVA 2PEYA 2QV0A 1YNOA 2DFVA 4BKOA 2OM6A 3A1SA 5T3UA 3KSMA 5AW7A 3PUJA 1FXSA 3HVJA 3A3PA 4P33A 3MW8A 3ZDQA 3MGAA 5BV0A 5JADA 1TVKA 1TZMA 4YRNA 5DLEA 4EHIA 2IYZA 2OAEA 3WIUA 3S2GA 2D0OB 1IXZA 4AAYA 5AFSA 1TYEB 5KVAA 4GMKA 1VPTA 4RKWA 2QR5A 1PT9A 4DL9A 2VHCA 1SUCA 1RNLA 4W9NC 1JA0A 2F4NA 1W0KA 5ADHA 3IAS6 5J63A 3FNFA 3OUUA 2CB0A 3IRVA 1E32A 1X2EA 2GMWA 2AN1A 1DWQA 3LQQA 1UDCA 4RLHA 5F98A 4YWJA 2C2GA 3IBCA 4OHMA 1O0SA 1P8JA 1OT5A 1XALA 2WAAA 3DB2A 2XKJE 3HI4A 1FFGA 3BM5A 1FVXA 2ZM6B 4H27A 4HN9A 3HDYA 3K9BA 1A5SB 2Y93A 3QKWA 1XL0A 2LD4A 1M2VB 4RD4A 3RB8A 3WY9A 3X1KA 5JAPA 3U5ZB 2QPTA 4Z9XA 3DPUA 1NULA 1NJ2A 3IDAA 3FMVA 1MH9A 4J9UE 3W4JA 2DQSA 3Q3EA 4ZEWA 3O38A 5G4KA 1UJ5A 1J23A 5FO1A 1RS0A 1NTRA 1CQWA 3FWZA 3L82B 5ERYA 4D9FA 1MO3A 1NX6A 1XNGA 1EZ1A 3KYDA 1UJ6A 3DXFA 3R3WA 4Q19A 5SV2A 3SFVA 2CHVA 1TLFA 5DHRA 3DC2A 5G40A 1PQPA 1LPOA 4OJKA 3ZLVA 3Q8XB 1SCBA 2PH3A 3MJRA 2C1XA 5BN4A 1QGOA 3GNLA 4BO5A 3H11B 1S2GA 1ZZEA 1MBZA 3LCCA 4KQIA 1DRWA 4EJ0A 2XWJI 5KREA 3NOQA 1U2EA 2PU5A 2AEEA 2Z5VA 3Q0IA 2BDUA 4QNMA 4E2WA 1E64A 1Y3AA 4YJGB 5KKCA 2D2VA 3AP1A 3CT4A 1JFRA 1IZYA 2BBWA 2EQAA 4RD0A 2ZUEA 1MAUA 3VJLA 3FDIA 4G4JA 1CR6A 2Q0QA 3ZW8A 2ZYRA 1I51A 1OX5A 3ZZUA 2V9CA 4BPBA 3HV0A 1UDAA 4R83A 2C2WA 1O7JA 4NK5A 5LYJF 3S7ZA 3P96A 4AZ3A 3EGWA 3TVYA 1GD1O 1PT6A 2PZFA 3CUTA 1PWEA 1Z2DA 3H8WA 4G0XA 1MT3A 1LBHA 3V8VA 2JW5A 3PDIB 4EFDA 4ZK2A 1VRWA 1XEAA 3LY5A 4HQLA 4V3CA 4EI8A 1XI2A 1W0JA 2PY6A 2IHVA 3R3ZA 2IC5A 2XUPA 2YYAA 4ARZA 3DEIA 4BOYA 1KFCB 4O4HB 4PGAA 1D7OA 1SIUA 3GK3A 3PNLA 1PZFA 1C1DB 1Z35A 3A4MA 3E7DA 3JZIA 4M9QA 5DRTA 4A6EA 4DMHA 2VYNA 1C8LA 3EWNA 3EVEA 2X58A 1J56A 2DHQA 3NIBA 3WDKA 3C8UA 1V8DA 2CLOB 2TECE 3I2IA 5H16A 3VNAA 1T9BA 3ZCUA 4UQPA 1C7IA 3PZBA 3QE3A 4HJRA 4EUEA 2A88A 5E9QA 1TYBE 1FXWF 1ZJJA 1UPBA 5CDGA 4BAZA 3DE7X 1V3UA 3QW2A 4YBZA 3IEKA 2A5GA 5K3AA 3ZV3A 1I7DA 4E5PA 5CYGA 3B5IA 4KMSA 3TG2A 1IQ0A 4QEKA 3E8XA 4FLMA 2Q3DA 1EI9A 2YY7A 4NBLA 3HL0A 3H75A 2W2MA 2C2OA 1ZK0A 1PFVA 1N6LA 1PGPA 2QG4A 3GARA 3WV4A 1NVWQ 3B1VA 5K0ZA 2CDBA 1VL8A 3TR6A 3U4DA 1ZL0A 2ZIXA 3GV0A 2HBRA 1G7TA 1KYVA 3R20A 2VJYA 4TVBA 4P92A 4ENSA 3VVBA 1I30A 5CVUA 1X38A 3F8WA 3HO6A 3IT2A 3TUJC 1QSGA 5C7IO 2F00A 3I9MA 2IIPA 4B2LA 3OWXA 5JS6A 2ATXA 4DRXB 4DV2B 4WBXC 3VKFA 2V97A 2OBLA 2IOQA 5ARDA 4MUKA 3U81A 3LUFA 5FADA 1FP6A 3HJFA 2AC4A 4EI7A 4FKBA 2G04A 2OHJA 4O4JA 4KK3A 5ILGA 1RE1A 1E61A 1QFZA 3RIHA 8ADHA 1E9SA 3VFDA 3IPLA 1U7WA 3L9WA 1PSDA 1UPCA 2FUG1 1KI1A 2JLYA 1MOQA 1CJKC 2GSWA 4YRGA 2O14A 1H69A 3I2KA 1VDZA 4P22A 1KZ6A 1T5DX 4Y2PA 3E9NA 4DJJA 3IAUA 4X60A 5IKOA 1KDRA 1PZHA 5EJMA 2H4FA 2V3VA 4Y2TA 4CLDA 3O2NA 1WB6A 1PAUA 3QHQA 4LOJA 3NYIA 5AVTA 1AUOA 5JRZA 1WPQA 3LQ2A 4D4GA 5H3HA 1OSNA 3MMSA 2AV6A 4JFRA 1LDEA 5LJLA 3U9TA 2RGAA 4FMPA 1Z7BA 2QD1A 1QQ5A 4GR5A 1L7NA 5F51A 1C0LA 4G01B 1J0CA 2BFWA 4G41A 2NO0A 2ZFUA 3DKRA 3OT1B 3H86A 2X9NA 1HR0B 2FZCA 2C2HA 4QUEA 4BBPA 1C7JA 2A0YA 2GBFA 1U9ZA 4RPCA 4KBFA 5IT4A 4Z3OA 2WF9A 1KL7A 2DSNA 3I0ZA 1NBHA 1IWPB 1Z4OA 2X0FA 2VAWA 4BO3A 3WL4A 1VC2A 2QIOA 1LCIA 3EUEA 4XJSA 1HY3A 2CLCX 1G64A 1H3EA 4MYCA 5JRJA 1TYZA 3FPAA 2JEYA 1NR1A 2A9PA 2PQ0A 4R8VA 1DCKA 2REXB 3UO8B 3UJ9A 5EWJB 1ONSA 3LKVA 4RADA 2REBA 4GSYA 3FX2A 1I3MA 1WO8A 3DBOB 4PYLA 5KEIA 2GGSA 4WGGA 2AL7A 1BCSA 4WESB 2DG2A 3HJGA 2WKSA 3WICA 1E98A 1LPAB 3OCWA 4MWDA 3SSOA 4JXXA 3VDQA 1VP3A 3A2LA 3RSLA 1SJ9A 2R6DA 1ISIA 2PIAA 4G1MB 2BE9A 2OD2A 4RH0A 2QP4A 4AZ0B 1KSHA 4FR5A 3RQSA 2XCTB 3W6ZA 3KQYA 7MDHA 4EO7A 4GLLA 3WLJA 2WU3A 1AXRA 3THOA 2ODAA 1FX0B 1E6UA 1G7SA 3COVA 4KOAA 2YJGA 4F5WA 2XGSA 3A1EA 3D81A 5C8YA 3I23A 3WRWA 2PL3A 1BXZA 3MYYA 3F96A 4HTFB 1N3BA 4OI4A 1B2LA 1WNFA 2DULA 3VOSA 4YJ2A 1OV4A 4J4BA 2NSHA 1FTNA 2BGWA 1VBMA 3HC7A 4JLBA 3GAFA 1Z5UA 1V48A 3RS8A 4HHEA 2Y0PA 1T9GS 1VMDA 1RBQA 5DT2A 1AS0A 1JIUA 1UFKA 2HU5A 1E6CA 2IXDA 3THXA 2FYTA 4MB0A 2V7WA 4I6GA 2RAUA 2Z9BA 4I4LA 3W2GA 2J3MA 5EFZA 2O23A 2Q9BA 4JWKA 1FLVA 4QXPA 2B0CA 2X4LA 3FOWA 2Y0DA 4OHCA 4BKQA 3ZIAA 1OXVA 4LDNA 4C0XA 1CWUA 1CZHA 1XD2B 1RWMA 2PMFA 2CB9A 2VG8A 4NDZA 4ZO8A 3UENA 4FB5A 2VZ9A 5AKHA 2W2KB 2H18A 5HUQA 2P2YA 3OPQA 2BH9A 3G23A 4O2BB 3VU0A 1BE8A 3W5IA 4D8TA 1FVFA 4ERXA 3PG5A 2HBQA 1GZVA 3EFEA 3I04A 4IHAA 1LF5A 5CFLA 1H2BA 4C5BA 5DYYA 4MUAA 4PTZA 3O94A 3D54D 5E9AA 4CEJB 5DULA 1UDBA 5DHUA 3KD3A 5ECYA 5JO9A 3WYGA 1BHSA 1VE9A 4ISBA 4RVUA 5A4MS 1GT91 1RWWA 4YMSA 5BORA 1P0MA 3AJ8A 4U0KA 4EHKA 4LYJA 5T67A 1DDGA 1WDMA 4IW3B 4W4TA 1BQEA 2PM8A 2CYCA 4YR9A 4DR7B 2IYYA 1QWSA 4PXAA 2AYXA 5EGSA 3RBAA 1JAYA 3F2VA 3WLIA 3OTQA 1SIWA 4P2GA 1R6XA 2X77A 2OV1A 2H48A 2VDNB 3DBIA 4Q1CA 1YS1X 4PZZA 1ATIA 4XYGA 3OUTA 4U3JA 1BXGA 2PYDA 4JH0A 4X20B 3KT3A 5AHKA 4ER3A 1S4QA 1GR0A 4O4IA 1FMJA 4RVSA 1PDVA 4ZVUA 3R7WA 4ENPA 2B3TA 2BWJA 3TDKA 1FFSA 4OXXA 2ZJ7A 1GTZA 1THTA 1G66A 1MEJA 3I6IA 4EL5A 2Y1CA 3VNUA 4OAQA 2EX1A 1P1BA 2Q3JA 1NLZA 2GAIA 4FHFA 2VDWB 1PUIA 1Z3IX 2Z9CA 3AOGA 3S4YA 1T8RA 5JLAA 3NZEA 1P6XA 1KBQA 2Q29A 3PJEA 4KQMA 4UUMA 2VUIB 2XMPA 4DMMA 2RE8A 1M33A 3FFXA 4QYIB 2G4VA 3GNSA 2VDVE 2QAJA 1DFIA 2XI4A 4NONA 4ZO7A 5T7BA 2H1WA 1OBFO 1QDLB 3A10A 4UAVA 4KIGA 1NR7A 3O92A 3Q0TA 3QUCA 4FMDF 5HQTA 4A10A 4DLBA 1Q17A 3ROFA 1YTUA 1M2EA 3MJVA 3C85A 1T3TA 3NB0A 3JQ8A 3ZC3A 5IU6A 1YDMA 4FYHA 5DIZA 2A1UA 1L3CA 3V2HA 4BMVA 1P1RA 1IK6A 1KF0A 4GNRA 1GPBA 1S3SA 1JPVA 2GJ9A 2IXGA 4LZJA 3IUNA 4NCXA 1BA2A 2G83A 4EZEA 1I0ZA 2FZLA 1ID1A 4C0JA 1P1IA 4GGPA 3TRJA 3NEYA 4ATNA 5TLSA 4R1MA 2ORWA 2RHMA 1FRZA 1NQVA 3K8YA 2ZPTX 4K0RA 4I8DA 2C94A 5CGQB 5E4FA 4ENVA 2XD9A 1XMOB 1JQ3A 4MQ6A 4B6RA 4AI6A 4KX3A 1RI1A 3AC0A 3RAEC 1X8JA 1ADJA 4E11A 1QONA 1YKGA 2C04A 5G0TA 5CAEA 2BTEA 2KS6A 1ESNA 1B00A 2GRUA 3I62A 2XXAA 2PAFA 1IC6A 1KI2A 1KQPA 3SF0A 3WP1B 2JI7A 4BZXA 1ICIA 3QWBA 4FYWA 4XUDA 1MX1A 2PS9A 2ZTHA 3R0JA 3RRYA 2AJCA 2O0KA 3U1BA 3TD2A 1H9AA 1YAJA 3LL7A 4KACA <