4KAXA

Crystal structure of the grp1 ph domain in complex with arf6-gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
163
structure length
163
Chain Sequence
GSMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 6
publication title Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 56
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2013-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kaxA00
2ZRCA 4LJ7A 5HKKA 1TU3A 3ECCA 1P2TA 4N0DA 4M21A 2ONJA 4B48A 4PX9A 1MKYA 1JR3E 1N0UA 1FMLA 1LB1B 2PMDA 3FVQA 3H4MA 5JSZB 1XTKA 4KLZA 5IDVA 1BS1A 1YR8A 3QI2A 3TSOA 5HZHA 1NMXA 3ADCA 3ADDA 1GUAA 5CDFA 3CNOA 4ZDWA 2JA1A 4ITRC 1W36D 4IFBA 4AKHA 4OQFA 1OSNA 2P0EA 2B92A 2CVFA 3TKLA 2OE2A 4LJ9A 3TR5A 4LPKA 4EPRA 2A5DA 2PT7A 2QN6A 1HURA 4KODA 4B34A 4G01B 3K0SA 2Q6TA 3BAFA 2OLKA 4Q4AA 4TQ9A 5J5CA 1IY2A 4A0GA 5JWRA 1KDPA 1KMQA 3UIEA 2ASEA 3IO3A 3M6AA 3K09A 2G0NA 1N25A 2BBSA 3CW2A 2QTFA 4Q1CA 5FTNA 1AA9A 2WIAA 4WZBE 3U44A 1WRBA 2B7CA 4Z1MD 4P0TA 4DZZA 3PITA 2XNSA 2IXFA 4URWR 1ZUHA 2VO1A 3AP2A 4V0OA 3RS7A 3GQBA 4MYTA 2ZS9A 3QBVA 4JKIA 2QAGA 2Q3MA 1QHIA 4PHGA 2JLUA 4OL0A 1DAHA 2IYUA 2ZQ5A 3T12A 2V1XA 1WXQA 2W00A 4RZ3A 4L15A 2QA5A 4URZR 3ZD7A 2Q0HA 4OHWA 4XTCS 4D81A 1G9XA 2C99A 2ZS7A 3QQ5A 3MWYW 3TVTA 4DIDA 3C5HA 4WIAA 1G291 4YMSA 4AD8A 3OESA 4TMXA 2BBOA 2J3EA 3K0CA 3K9HA 1G8HA 1D2NA 2I1VB 2HXYA 2BCJQ 4FCVA 3MWKA 1OW3B 3ZIAA 1KO4A 3T35A 4TL7A 3BB1A 5CLLA 1ZVQA 5DSZA 4GMXA 1G7TA 4LOAA 1NJGA 4L4UA 1GRRA 4DDTA 2NPIA 5DI3A 4DUGD 4HUTA 2AKYA 1M1YE 2OO7A 3LDAA 3N2EA 4QRHA 4TSFD 1CJKC 1X8KA 3AF3A 2XTZA 3AP1A 2NZ8A 2Z5FA 3L2OB 2WMOB 5K8TA 2W6JA 4YMUA 4G5OA 1R5NA 3SFZA 3AB3A 2IYZA 1KO1A 2C78A 4URUR 4B3DA 1UEJA 4OJKA 3EARA 4HB4A 2BMFA 3TUIC 1F3OA 4C0BA 1GKIA 2C96A 2J59A 3O8DA 3LAWA 1GIAA 5DE3A 4D80A 2HT1A 4RD6A 4HAYA 1BMFA 1XWIA 2OXCA 4KO8A 4LK2A 3CB4A 2XTNA 3OEHA 1D2MA 4TL9A 1IY0A 2GXSA 1CRPA 3DHWC 4KFUA 1Z0JA 3SBDA 5KU1A 5JJIA 2Q9AA 1VCIA 2R6GA 2EFDB 5JJKA 1NBMD 2PLRA 3B1WA 1GL9B 3M4YA 3VX4A 4O25A 5K8LA 1RPZA 1SKYB 3OIWA 3AVYA 2ZRHA 5FR1A 1OKKD 3E70C 1FUKA 2PZEA 1TPZA 3CIOA 4E22A 2VF8A 1W4AA 2EU8A 2DWPA 3R9XA 2OEPA 3Q5EA 1YKSA 3ICQB 4GP6A 3OZXA 1ANKA 1GAJA 2ZYWX 4TYQA 4C0SA 4QL3A 5DHAA 1VTKA 2O5VA 1E9AA 2AHOA 1FMJA 1GZSA 1NIPA 2AK3A 2BCGY 2QEQA 2YNMA 3PVSA 1JXOA 1RZ3A 1W4CA 4PSKA 2F43B 4KFSA 5DO9A 2WSSD 2EQBA 4GBMA 1CF4A 4C2TA 1G16A 2F1IA 5FOVA 821PA 1R10A 1L7VC 1TQ6A 4JSYA 1OYWA 3VR2A 5JEDA 3DKVA 3AM1A 3KTAA 3EZ6A 1SZPA 4EJSB 3BS4A 4HUQB 2ATVA 2F1HA 2QU8A 5AUNB 4NDZA 4OI4A 2XX3A 2F6RA 1BIFA 4LBVA 5FTJA 2DBYA 3QEJA 1U99A 3THOA 1KI3A 4O2LA 4N1AA 2VLIA 1SXJC 2JJ8A 4NYIR 1FFHA 2J0UB 2ZSEA 3ZGXA 4TMZA 3W5IA 1N5JA 1RW4A 2F9LA 1F2TB 2JLXA 2GA8A 2EFEB 4F91B 1DAMA 3VU9B 3Q3JB 1M7GA 2HYDA 721PA 3EASA 3UK6A 1X3SA 1D9ZA 1E9EA 1JJVA 1SXJB 3D7MA 4IOLA 4LYFA 3HP1A 4PHTA 4V0MA 4LYHA 2QG6A 4BQSA 3GLGE 1MR3F 1XB2A 2CHGA 2PMKA 4HLCA 1JB1A 2UZIR 2J46A 2KB0A 2XZOA 5LD2B 3SQWA 3H84A 1MO6A 1XD2B 2BJVA 3K70D 5EZ6B 1Z63A 1R5BA 2VHQA 1WF3A 2C2HA 3MUFA 2TMKA 2PZGA 4Q21A 3U3OA 5KSOA 3ZQJA 3ZVLA 4DLSA 1E79D 2O8DB 2NTYC 2E87A 3BRWD 2R65A 1VHLA 3ZZTA 4HDOB 2MSDB 3A37A 2DFTA 1GNPA 5KSPA 3SYKA 3F8TA 3ZVNA 2IT1A 4LV6A 3RDPA 4Z8XA 2YKGA 4O3MA 1KTVA 5FPHA 1E4YA 4D4KA 2H57A 3T1QA 1KI2A 1W2HA 4TTQA 2G3YA 3BORA 4HZUA 1CP2A 3AH8A 1E0SA 2FSIA 1QHXA 1U0JA 4PZLA 4YMTA 3IBYA 4TT3D 1LNZA 1T8TA 1E2IA 4TTPA 1DAGA 3RS0A 4KITB 2VBCA 2WKRA 4BFUA 1Z83A 1FW6A 4MGZR 4UJ5A 2ZSFA 1EWQA 1NL3A 4LWZA 3GLIE 1CR2A 2PL3A 4BFTA 3ZLJA 1SVKA 3GJXC 1CS4C 5CB6A 2IS6A 2W6ID 4NYIQ 4JLMA 3OAAA 4PZYA 1E9BA 5DH9A 1N6PA 1FTNA 1II0A 4IDHA 1UDXA 2X77A 3B9PA 4G5RA 3MWLA 3DOFA 2A5JA 5IK2D 3I3SR 5CM8B 3VHLB 3WNDA 1CR4A 5FFMA 4RD2A 4NE2A 4TZ0A 1PLKA 2FGJA 4ZV4A 4V0NA 3GLHB 2B7BA 3BK7A 5EXTA 2WV9A 1CXZA 2ZVPX 5KHOC 4NMMA 1KGDA 5JFGA 4XD7A 2QQ0A 1QVAA 2GXAA 1XTSA 3ZQ6A 5GVSA 4ZO4A 4CZ2A 4ACBA 3K9LA 5HE9A 2YC2C 4A4DA 3KKOA 2ZRLA 1TUEA 4HLDA 5FR2A 4AK9A 1XD8A 1Q20A 1Q1QA 4LZZA 2YZ2A 1XZPA 3TW4A 4AG6A 5FUVA 2O0JA 5L3VA 4DDUA 3CR8A 1N6LA 3H1TA 4NZYA 3KXIA 1I4LD 3LVRE 4IVPA 4B3FX 5F9HA 2FZ4A 2WWFA 3B1ZA 1CJVC 3P20A 2N1BA 4BPBA 3CF6R 1VYTA 2L0XA 1OE0A 4FWTA 2OCAA 1VG8A 2XXAB 3SC3A 3AVWA 1XF9A 1XEWX 1CR0A 1T0HB 3OFNA 5AJVB 3QBTA 1KI7A 4JZKA 4QJ4A 2XZPA 2GILA 4P4UA 4BFWA 4F93B 4JLKA 2IUTA 4PO9A 4TYPA 2V8OA 2XTMA 2JLWA 3QSYA 3ADKA 2VA8A 2JGNA 4OI2A 4MH0R 5DN6A 5JECA 3ZJYA 5K8IA 2OILA 1CJMA 4JLAA 5GJCA 3T1VA 2QM7A 3QVUA 4DBLC 2IYWA 4EIWA 2VPPA 3GMTA 1NSFA 1QRAA 2D7CA 4IJMA 4IDPA 1CTQA 2QP4A 1L8QA 1W44A 4JLBA 3SJAA 1IN5A 3SDZA 4Q4JB 3I32A 2IYYA 3EIEA 4NCKA 2QP9X 4PAMA 2FSFA 3IIMA 5DNYB 4RY2A 2ZRNA 3QXCA 4GOJA 1QHNA 4AURA 2IX3A 4G5QA 1Q1ZA 5G41A 5C46F 3TUZC 1E1RD 1UBGA 2CLSA 2NG1A 3SS8A 4QBIA 1RJ9B 3MFYA 2NMVA 5J4VA 2GJSA 5FOTA 4MDFA 4B44A 1XPRA 1VYVA 1PUIA 1XTJA 2F43A 2QE7A 5KDOA 4M9ZA 4Q9LA 1U2RA 3EC2A 3WNCA 3HR7A 4AKGA 3RS5A 4LBWA 2XNDD 4A36A 1A1VA 3CZQA 1JAHA 2JLQA 5CYOA 3Q8XB 4EJSA 4HUQA 1FUUA 4ACAA 2GF0A 5CIQA 1ZM9A 3UWKA 4FCWA 3W3AA 4LJ5A 5EJEA 2WAXA 1G7SA 2VP5A 1E96A 3L0OA 1Z07A 4P4TA 5FOUA 2VRWA 4Q18A 3IPXA 3AVUA 2WKQA 3DMDA 2HF9A 3MGCA 3MRSA 3UKDA 1RRPA 3A1WA 3BFKA 2HLDA 2J0UA 3NVAA 1JBKA 4BFVA 1E9FA 5FPSA 4OQXA 2CNWD 3VU9A 4I1UA 3X1DA 2OESA 3SHWA 3AEZA 2VF7A 3GFOA 1A5TA 2DCUA 1JJ7A 3WRXC 2ZRDA 1P2UA 4C0AC 1P2VA 1NI3A 4LV5B 3MWJA 1Z3IX 5LBIA 1I2MA 5JMTA 3FGNA 5J4LA 2BEKA 2YYZA 1OB2A 3VHXA 4QHTA 4XVUA 2VP0A 5C18A 1XD2A 5KOYA 4DXAA 3I62A 1I2DA 4KJZA 4P32A 1G19A 1II8B 4MKFA 1TQ2A 2O8DA 1R0YA 1SVWA 1X1RA 4IXNA 1W4RA 3FYHA 1JR3D 1NN3A 5KNBA 2FH5B 3BD9A 1G1MA 1D8TA 1JPNA 3NHBA 4A0HA 5JCZA 1II9A 1TF2A 5FI1B 4DB2A 4FW9A 4CEIA 4GL2A 1S3GA 5KPJA 1XU4A 4V0KA 4GI7A 2ZM5A 1XEFA 4DB4A 2C9OA 5AJWA 1T5LA 4E07A 2GXUA 2X2FA 3M0EA 3HU2A 1E94E 5JHGB 3I8XA 3FMFA 2A3RA 2ODBA 1DG1G 2JJ1D 4Q1FA 3GJ4A 5AUPB 3B7GA 3A1TA 3KX2A 1IONA 2DFKB 2PT5A 3CRQA 2VL7A 3QXJA 2NO6A 5KTYA 2RHMA 2OCPA 3UMFA 5FI0B 3FFBA 1R0XA 4LUCA 2V6IA 2NO7A 4Q7MB 2F1RA 1NKTA 2GTPA 4RSGA 4LPSA 1ZBDA 1W36C 1GKUB 1QG2A 1GL6A 1RRFA 4HLQB 3U3RA 2Q9BA 2IWRA 1WB9A 3GLHA 2ANCA 3AV0B 3K09C 1M8PA 3AVOA 2IYTA 2QQEA 4M9QA 3PENA 3U61B 5E95A 1W36B 4IHQA 2IC5A 3QKUA 4MGIR 2IEZA 1KKMA 2P67A 3F5FA 3QIAA 5FL3A 4I1VA 1ZD8A 3D8BA 4D4LA 1G8GA 1AS0A 1KJYA 1FOEB 2AWOA 4JLDA 4B3CA 1N6IA 1KZGB 2QAGC 2WJJA 2ZJ8A 2J7KA 1W0JD 4NL4H 4TN1A 4JLNA 4R98A 4TLDA 2C03A 1ZCBA 2V55B 1KDTA 1OFHA 5CLQA 4LJAA 2QAGB 1UKVY 5JS7A 2XXAA 4BRUA 1W5SA 2Z4SA 2ZRBA 3PIRA 3GLFE 1YR7A 3K0CC 2RGEA 4PC3A 5EQTA 3U6KA 4KI0A 1XPUA 4BE7B 2VYFA 3E5HA 1AS3A 4KBGA 2DR3A 1R4AA 3KDSE 4E03A 2GAAA 1DG3A 2ORIA 5IHPA 3JZAA 2P6UA 3TIFA 2IF2A 4OHXA 1ZRHA 2J41A 2LCFA 1Z28A 2ZJ2A 4Q1AA 5BN4A 4TQUS 1DAKA 3LLUA 4X8MA 3HWSA 1QVRA 3AVTA 3B6EA 4CT5A 5DYIA 3PXGA 3P27A 4PHFA 1T3LA 5M04A 4Q4JA 5DI3B 2QRNA 4IFEA 3CZPA 2J7PA 3L0PA 4PO8A 2ZI6A 5EXXA 1KOFA 3GFTA 3CNNA 1T4GA 5AK0A 2FJUA 4AIIA 3TK1A 1KJZA 1G8FA 2NQ2C 4ASUA 5B58C 5B30A 2GF9A 4KFTA 4CGZA 4AC9A 3BB3A 3P1JA 4NKRA 4P31A 5HE8A 4YDHB 4JYBA 3L0IB 2J0VA 2QBYA 5B64A 1IN6A 4OK5A 3A4NA 1SVMA 5EXPA 2Q3FA 4U7DA 4A82A 3HPQA 2V4ZA 2VH5R 4X8OA 2IA5A 4IKEA 4JT2A 2ZYTX 2J5XA 3EWSA 1AZSC 1G41A 3HYRA 1RC8A 1HT1E 3EZ2A 1G8YA 1VIYA 3G5UA 5BW8A 4RFSA 2IYRA 5AJZA 1MOZA 4YXWA 4KBFA 3KUDA 1A82A 2ZJAA 4PANA 1VCMA 3THXB 2NO1A 3RABA 4UNQA 5FTMA 3L8ZA 3AKYA 4BEJA 5GVRA 2MSEB 1QBKC 1NP6A 2UVQA 4KVAA 1VIAA 4NYMR 4DVGA 3UMSA 3C41J 1R6BX 3GD7A 4LGMA 3V9PA 1KJWA 1UF9A 2G1KA 3KL4A 3TSWA 3K8YA 4URVR 3CPEA 4D4JA 3I1FA 3GJ0A 2BIFA 4DSUA 1W48A 4R2IA 4Q4HB 4AKIA 1E4VA 4TMVA 3B85A 4V0LA 5AUQA 2GZHA 1FP6A 2V7QA 5LB4A 2BC9A 3U5ZB 3BGWA 4QGAA 3KKQA 3RS2A 1HYQA 2A2ZA 1IN4A 3A1SA 2ZEJA 3R20A 4K8OA 4POAA 4A15A 2XSZD 1II8A 4MUAA 3CR7A 5TARA 5AWFC 4TLAA 4DLYA 4DLVA 3NTUA 5KSZA 4CEJA 4ZIRB 4YMVA 3CO5A 3SE0A 4TTRA 3GLGA 1KK3A 1UPTA 4Q4LA 1FL9A 2CLCX 3OE7A 1MABA 4U00A 2YV5A 3QE0A 2QMEA 2GCPA 2ZSAA 3QG1A 3KFVA 1QHHB 1J99A 3B78A 1DAFA 3W6NA 1G20E 1NLZA 2JEOA 4TQAA 4C30A 3TR0A 5A0FA 3IEUA 1UADA 3RRNA 1N0WA 4PSAA 3GPLA 4IEIA 4P3YA 1GNQA 5HTKA 3THYB 1H8HA 4HYYA 3VR4A 4NCNA 2JLSA 3PV0A 3NBXX 5SZJA 3NBFA 4FI3C 5FH9A 1LVGA 3Q7PA 4NYMQ 2BHRA 3DZ8A 3B1YA 2FN4A 3THWB 5CB8A 3TJZA 5JWOA 2RGAA 4HEJA 4QGGA 1G64A 4D26A 3K70B 1KKLA 1DELA 1N5IA 1ZCAA 4ZPXA 5B2ZA 2WPDD 1N3BA 4BFYA 2XGJA 1MRSA 4U5XA 5HCIA 4HZUB 3O47A 1HT2E 4PSVA 1QHYA 4JLOA 1AK2A 5JEEA 4A92A 3EPLA 1AN0A 4EPXA 4GRAA 4HAWA 2FFBA 4GZMA 3CH5A 4NH0A 2GXQA 4TLEA 4LHZA 1ESMA 2FE4A 2WJVA 5DI9A 1YRAA 6Q21A 3WY9A 5KUTA 2E9SA 3PUXA 5AJYA 1KK2A 3EAQA 4AYXA 2QGZA 1ETUA 1ZNWA 4LHYA 2YINC 3NDPA 4G3XA 2H1LA 2AFIE 4LJ8A 5AJXA 2AD5A 2Z83A 1ZM4A 3LX8A 4HB3A 4Z1MA 3VR3A 1EFTA 2KJQA 1NLFA 2OAQ1 4HDQB 1CRQA 3RS3A 2ZETA 3F0TA 4BGDA 1G6OA 4KYUA 1ZP6A 1XMSA 1IY1A 2FWRA 4CF7A 1NVVR 4JVLA 1VCNA 3QPUA 1GITA 4I1SA 1UKZA 3FTQA 4XTRA 2XOKD 1WQ1R 1ZMXA 2ZPTX 4LJYA 1WP9A 3SJBA 3SEAA 2RGNC 2ANBA 1T9HA 1M2OB 1CJUC 2RHDA 4QJ3A 1M7BA 3A58B 1E2LA 2F9MA 4Y0VA 3REFA 1T3SA 3QVVA 2JCSA 3I8SA 1KY3A 3QJYA 1HQYE 2KWIA 1O87A 1PUJA 2C98A 4QNRA 2HYIC 3U3JA 1E9RA 3VMFA 4ZDKA 2JLYA 4GNKA 1R8QA 2J1LA 3I5XA 1KK0A 3I92A 1AIPA 3KXKA 3EA5A 3D31A 4MA4A 4DCSA 3TVDA 3S1AA 2W0SA 3WYGA 4JBXA 1G3QA 4U02A 4Q9HA 1E32A 4WXPA 1AGPA 2FSGA 4DUGA 3KJEA 1IXRC 3GJ6A 4MUBA 1GRQA 1EWRA 1XRJA 2AFHE 4TSFA 4ZDJA 3HU1A 4BLSA 2BM1A 1G3IA 2VP9A 4LC1A 2YC4C 4PXAA 2BBTA 2CL6X 4UJ3A 2IWHA 2KBFA 1E2DA 3LY5A 1SVOA 1LS1A 2ODEA 1ZM7A 4PQRA 3N70A 3N5CA 4M1YA 3BERA 3THXA 1R8SA 4G0NA 2R6DA 3TUJC 2QPOA 1R7RA 1KZ7B 2CCGA 3BE4A 1VMAA 1Q1BA 4OQNA 2DPXA 3AUXA 1GTVA 4KCGA 2IS2A 1KI9A 1P73A 1UDWA 2W58A 1E2KA 1EFHA 1ELOA 2FFAA 1L2TA 4MGYR 5AUOB 1XFAA 1FZQA 4LBZA 2ZJZA 3AP3A 2IYLD 4NBSA 4RCYA 3OIUA 4FXPA 3QENA 4YONB 3RVBA 1DE0A 4M1OA 4BLQA 4WVFA 3PEWA 3PJRA 1NVVQ 5C4MA 3LLMA 2GEUA 4AWXA 3IBGA 1HQCA 5EUQB 1NBMA 4Q4HA 1FPMA 2WICA 4M8NE 4EJSC 2DY1A 2NO0A 1P72A 3C5CA 2EWVA 2QGNA 3IHLA 1OKKA 1HTWA 2ZANA 2ZYVX 4E09A 2FX3A 3RAPR 3LBHA 1E2QA 4C3ZA 1UEIA 1P9NA 3SBEA 4L9SA 2GCOB 2H18A 2ZTSA 3CH4B 1Z8FA 4US1R 4PQFA 4ZCIA 1H65A 3FMIA 5HZKA 2O8BA 1ZD1A 1E2FA 4WBSA 4LYAA 1GWNA 2C8VA 4ZIRA 4R9UC 3WP1B 3PEUA 2WSSA 3LNCA 4QKQA 3NH9A 2BMDA 2YHSA 3REGA 5FUXA 4AYTA 5KO2A 2ZUDA 1BKDR 2H92A 4IVQA 2N42A 4MRRA 5FOSA 2DFNA 1VCOA 1A2KC 3RC3A 4HSEA 1ZU4A 4DCUA 1NLYA 2LKCA 3EA0A 1QHHA 1OXTA 3H2YA 2FEOA 5LD2C 1TL7C 1TF5A 4IOKA 3WRYC 1OIVA 3X1WA 3KZ1E 3U7EB 1M74A 4B2LA 1NF3A 1G3RA 1E98A 1ZNZA 2PJZA 2K5UA 3THYA 1ZC4A 4HLUA 2JLRA 3K0EA 1CBUA 2Z0MA 3T1OA 2ZRMA 1KDOA 2A5YB 1DO2A 2CE7A 3HPRA 5JI3E 4C0HA 2EFCB 2RGDA 3ASYA 2GZAA 3PUWA 2GJ8A 2ODWA 4A0FA 2WJHA 3GEHA 5SZIA 4HDCA 3ONWA 2H16A 1U0HC 1YR6A 3THWA 1OFTA 3MMPA 4CEIB 4OI1A 4UNSA 5JJLA 5L8VA 1T0JB 1PV4A 2D62A 4IW3B 4UXHA 3FHTA 1YR9A 2ZJOA 1E79A 4B76A 4XIGS 1N6RA 2WJIA 4OQMA 1EFRD 3QOFA 1I4TD 3C14C 1YVDA 3WMGA 4F38A 2ORVA 1NN5A 3O8BA 4LY6A 2XAUA 3BBPA 1Z29A 3PUYA 5KDLA 4IVRA 4TZ6A 1ZUIA 1NRJB 4HI0E 2GJAA 3VQTA 1KDRA 3LV8A 4A9AA 4TT3A 4BLRA 3IEVA 2IBMA 4OJQA 5LB2A 4F7WA 2IF0A 1JR6A 1XMJA 3FE2A 1ZINA 4G5SA 4JJZA 3GCGA 4Q9JA 2OHFA 1F48A 5A5GA 1E99A 1Z0AA 4I99A 2OXRA 3RRZA 2RAPA 5E3HA 2W6IA 2EYUA 1IXZA 1Y3AA 3QF7A 4MITA 4ARZB 5P21A 2R44A 4DEXA 2CL0X 4OI0A 2JATA 2D4HA 1E6CA 2HDNB 4LDJA 2XB4A 4MYUA 2AN9A 1LY1A 2G88A 3G82C 2PEZA 2W83A 5FPYA 5IK2A 1PZNA 1B0UA 4TL6A 3PFIA 3I72A 3AQ4A 1G5TA 3AKEA 5BQ5A 3RNLA 3GLFA 4ZCLA 3WMFA 5HPYB 3W5JA 5TXGA 2ZR9A 1OF1A 4LX0A 3CBQA 2RGNA 1R5OA 5EXSA 5J40A 3SU8A 2O8CB 3GFPA 4HB2A 3J81k 1EESA 1ONBA 2ZE5A 5HCNA 4MQBA 4KSBA 2AKAB 3BC1A 2Y8EA 3AF1A 3EIHA 1Z6XA 2FDCA 1JQLB 3W8NA 2HT6A 3NEJA 1GVNB 4QGFA 1SHKA 1VG0B 3JVUA 2VHTA 4XH9B 4B2IA 2ZRPA 4LI0A 5JRJA 3PR1A 4MRVA 2DYKA 1C1YA 5E7IA 4BRWA 1OH5A 1R0WA 3PEYA 4LV8B 2VEDA 3ZD6A 1Z6YA 3PCRB 4N0EA 4CRWB 4OK6A 2I3BA 3DM9B 3A1VA 4B74A 1OHHD 1X1SA 4EPVA 4YQFA 1LF0A 1K5DA 4DLUA 1W4BA 3SHFA 3AKDA 2V54A 4ESHA 1Z2AA 2PH1A 2RH5A 3KKMA 4DLZA 1AQYA 1YQTA 3C4JA 3L0SA 3KQLA 3VNVA 3FMPB 4DCTA 3T34A 3CM0A 5K8UA 2QMOA 4B73A 5EE3A 3TQCA 2IXEA 4US2R 1N5KA 1VG9B 2D2FA 4BFSA 1E2PA 2VHCA 1G21E 3BB4A 3TLXA 3NBYC 3U3MA 2V3CC 4IEEA 2FPMA 2G1JA 4HAUA 4IOJA 5H68A 4JIMA 4D82A 3FKQA 2O0KA 2GNOA 2QBYB 1CEEA 5LPNA 2A78A 3ZS8A 4ZKDA 3D6TB 1W5TA 5TB5A 1XMVA 2GK7A 3ADBA 1LFDB 1EXMA 1Z06A 4DT1B 1E1RA 1OT3A 1W0KD 2DWOA 3DZDA 3QPWA 2OSBA 3FKSD 4H1UA 1P7CA 3EW9A 4RFSB 2GCOA 4LSGA 1Z5ZA 1XXHE 1OPXA 3QY0A 3VR1A 1RKBA 2C95A 2ZU6A 3GEEA 2O0HA 5UKDA 2ZJ5A 3MJRA 4ZDIA 4NYJR 1VECA 3L82B 2G77B 2ODNA 2HF8A 2CHVA 5J4YA 2XB2A 1NIJA 2XNDA 3KKNA 1U94A 4DWJA 1TUIA 2EYQA 2BKEA 2G6BA 2JDID 3LW7A 2WKPA 4CT4B 4P33A 3GJ8A 1P6XA 5EP3A 3OF5A 3SNHA 5IF9A 2CVHA 3U7HB 2GK6A 3IILA 4AYWA 2QP3A 2YWFA 3HR8A 3JZMA 3LWNA 3V4RA 4FIDA 1ZNYA 2PBRA 3CWQA 1Q21A 4M1TA 2J87A 3AGPA 2HCBA 4QC2A 2IXGA 2ZR7A 1SXJD 3BH7A 4US0R 3RRMA 2CNWA 3W9YA 2RGGA 4GT1A 2BMEA 2OT3B 4BLPA 2KSQA 4EPYA 5FBVB 3EPKA 2WWXA 1KO8A 1NVXQ 1W2GA 4RCZA 3OEED 4B47A 121PA 1KSHA 3A4LA 5FL7D 4CEJB 4DLTA 4L5BA 3LH5A 3NXSA 1YZLA 2B8WA 3GLGB 1N6HA 2PCJA 1DEKA 1ZUNB 3FHCB 1VG1A 1HA3A 4B32A 1MABB 1JEEA 1Q3TA 3QG5A 3IIKA 1JR3A 4FMBB 4Z8YA 4A8JA 4ZI3A 1P2SA 4O2RA 5EP1A 2CBZA 1WCV1 4LJ6A 4Q1BA 4NU0A 4Q02A 4KFRA 5DIFA 1CLUA 1KIMA 5EUMA 1MO5A 2C5LA 4DRZA 2NO9A 3TAHA 4EKDA 1J2JA 4KU4A 2MSCB 4W9MC 2QAJA 4QM7A 4NYJQ 4M1MA 1HH4A 5GJBA 2R6CA 2JAQA 4B3XA 1IHUA 1KAOA 5DYGA 1SKQA 1VHTA 5DISB 1JNYA 4D0LB 1OV4A 5HR5A 5IRCD 1TX4B 2JJ1A 4MRNA 1UKEA 3W8RA 4C9BA 2AL7A 3FMOB 3LX5A 2GJ9A 1E0AA 4UQOA 2P5SA 1WMSA 4QNMA 4D0GA 2LWIA 3KKPA 5TMPA 1D5CA 3T61A 2GBLC 2FFHA 2ZRKA 1VYUA 3RS4A 5FPKA 1DAEA 3V00A 4ARZA 3GLIB 4MRSA 2PZFA 3EZFA 5J4KA 2CK3D 2OFOA 3KFXA 1AGRA 4QHSA 1WA5A 1ZIPA 4MDEA 1XEXA 1UBEA 3MSXA 1DTSA 1DAIA 1S8FA 2QTHA 3QXSA 4B3BA 4B71A 3I61A 1ESNA 2DB3A 1U9IA 1OYYA 2DWQA 4F4IA 3P4YA 1N6NA 3SZRA 4DLWA 5JHHB 1XJCA 4CIDA 3OIVA 2O8CA 1U8AA 4B35A 4BZPA 2Q21A 2RGBA 2ERYA 1KI8A 3AUYA 4Z54A 1X8LA 4DCNA 5FTLA 3IDQA 2CJWA 1KMHB 4GFDA 2GETA 3P26A 4B2PA 1J7KA 1UBFA 2WAYA 3E2IA 3IKJA 3PQCA 1RFLA 3SN6A 3X1YA 3P4XA 1NG1A 1DOAA 1W0JA 2NOAA 3T5GA 4Z51A 3C15C 2ECKA 4GSYA 4IOMA 3PG5A 3UWOA 5KNDA 4NCHA 5TY0A 2O8EA 1DS6A 1E3MA 4DLXA 4ILEA 4W5WA 5ANRB 2HV8A 5A4JA 2JIZD 3BWDD 1VKJA 2RGCA 1Q12A 5J4HA 1G18A 4FD2A 2VP4A 1Q57A 1GDDA 1NY6A 3B82A 2I1QA 1RRGA 1P3JA 3X1XA 3SQXA 4LHWA 2LKDA 3MCAA 5IT5A 3KXLA 3KQHA 2GHIA 2ZYUX 1AQUA 1E2GA 3CWZA 1GILA 5JBQA 3CX6A 2OBLA 3HU3A 3RRYA 1D2EA 5JS8A 4PPNA 2XITA 5KSYA 2PJRA 1NJFA 4IDOA 1KSJA 1YZTA 4Q9KA 4XWKA 3CX8A 3LXRA 1P75A 4DKXA 1IM2A 3S1AB 1EX7A 3GJ3A 1L4UA 3R9WA 4B43A 3B9QA 1N5LA 2OFWA 2H5EA 2AK2A 1COWD 4M9SA 4V03A 1YRBA 2AX4A 1ZJ6A 3LFUA 4DT1A 1XNJA 3NDBB 5GJVC 3LD9A 4CVNA 2REBA 1Z08A 3B1VA 1OFIA 1XTRA 4IRUB 4KHZA 4QHYA 1OH8A 3QF4A 2R9VA 3N2IA 4QBGB 3U4QB 2JLVA 1ZAKA 1V43A 3P32A 3F3YA 1K6MA 1E1QD 2WVJA 4C0JA 2OFXA 4PAOA 1A2BA 3FOZA 2WIBA 1SKYE 5CITA 1J8MF 2EW1A 2ZRGA 1XCMA 3WXMA 1EFUA 3CKLA 4J0QA 3RYTC 3RWOA 1S1MA 1XXHB 1XJ0A 4M1KA 3KQKA 2N46A 3QUSA 1CIPA 5JLJA 3QPVA 4GMDA 3HDTA 3QEOA 4ERNA 4M1WA 4M0LA 2HJGA 4BFZA 5GJWC 4C0LA 1XEWY 4CDGA 1KK1A 8OHMA 4KAXA 4YLGA 2REXB 4PPQA 3LBIA 1CU1A 3PUZA 3NC0C 5G3YA 5FBQB 4Q00A 2O8BB 2OAP1 1OLOA 4DJTA 5J47A 4A2QA 2J9RA 4ZI2A 2WJYA 3NIBA 3B2EA 2ZSDA 3RC8A 2GKSA 2I4IA 3K1JA 4W5JA 1GG2A 2UKDA 1YHNA 4JL5A 4NONA 4KSCA 4AG5A 3DM5A 3IHWA 2R8RA 2JJ2D 2JLZA 1UAAA 4HB0A 2XSZA 1FTSA 2G9NA 4QOSA 1NKSA 2YWEA 421PA 4L9WA 4HLUC 1V5WA 1JAIA 4FMDB 3UG6A 1RVDA 1SXJE 4RZUA 1CKEA 3VFDA 2DHRA 3ZDQA 3ICEA 2QM8A 3UG7A 5FOWA 4A0RA 1E2JA 4QBFA 3VKWA 1SVIA 4C0QC 3AVXA 1XJQA 4TYNA 3IQXA 1R0ZA 2FPLA 2F55A 1KNQA 5FUYA 3ND8A 2ZI7A 4UNRA 5HKKD 4QJ5A 2WMNB 1Z0FA 2GVZC 4JJKA 3K70C 4H9GA 1UFQA 2ERXA 3EC1A 1M34E 4JVNA 1OXVA 2CL7X 3VX3A 1IN7A 2UZ3A 4Q01A 4JS0A 1EX6A 4NCIA 2ZU0C 3SJCA 2IUSA 3EZ7A 2P6NA 2FZLA 1LF5A 2ZI5A 3BXZA 5JZVA 3GLIA 1OFUX 1NY5A 2VHUA 1WDTA 1YU9A 4RZXA 1GFIA 3WHKA 1SVSA 4PTLA 1DVRA 1NN0A 4K81B 5F3WB 1HE8B 1M6NA 2WZQA 2GBLA 3DEFA 2GJKA 4FMCB 1XCPA 1G7RA 3NBZC 4V02A 1JECA 3BIFA 4F4CA 4PHHA 2WPDA 3RSLA 2RB4A 4M1SA 2FOLA 2OUKA 3DMNA 3IIJA 4PO1A 2IS4A 2FEMA 2YJTD 2OBNA 2DFLA 3QXXA 4B33A 2WM9B 1KHTA 1ZD9A 1AJEA 3MLEA 3KJIA 1GOTA 2CCKA 4HZIA 2XEXA 4UNPA 4WOPA 3WMEA 5JCPA 1KSFX 1N6OA 2FGKA 3CRW1 1KMHA 4RKEA 4C7OB 2ZAMA 3LQQA 3MJHA 3K53A 5EP2A 2PEYA 1SVLA 2VSXA 4M22A 4A6XA 2D7DA 1IN8A 1FNMA 4IXMA 1NMYA 3R8CA 3U6BA 2QROA 1KSGA 3GJ5A 4TMKA 3M1IA 2F1JA 1S9DA 3SJZA 4JMPA 4L8GA 2CLDX 2QORA 3CRVA 2VSOA 1E0JA 2D74A 1E9CA 1FX0B 1VPLA 2C9CA 3GLHE 3Q72A 4GOXA 5D3MB 1WBBA 4LRWA 4JVSB 1N2CE 1P62B 2RKOA 3FWYA 4JLVA 2P2LA 4FWIB 2A9KA 3BOSA 3JVVA 4R7ZA 4ZKEA 3KJHA 4NPHA 4FINA 1T6NA 3EPHA 1UJ2A 4LC0A 4DCVA 3GLFB 2EVWX 4D25A 1KYIA 1NSTA 3ZIAD 3LQRA 2EWWA 1FP7A 2CCJA 4YMWA 3RLFA 4R71A 3SI7A 5FUWA 2J45A 2PX3A 4PPGA 2XOKA 4EPWA 1G4AE 4E5UA 1GM5A 1DBSA 2WJGA 1ZU5A 4JKYA 2BBWA 2PCLA 2WTUA 1N0VC 4EPTA 1Q1EA 1ZM3A 3ZVMA 3IO5A 2V1UA 5CK5A 2V6JA 4GZLA 3IQWA 2EFGA 5L3QB 2IHYA 4TMWA 1CR1A 2W6JD 3SR0A 5EE0A 2CDNA 3R7WB 4W5HA 1G3UA 2A5GA 1NVWQ 1LV7A 2CE2X 4R2HA 1IJFA 1QZXA 1SGWA 4EQ6A 1KI1A 3AVPA 3EIQA 3ZZ0A 3UPUA 4BECA 3IPYA 4PC2A 1OXUA 2CMKA 4M9XA 4MKIA 5CYPA 1WBDA 4O0MA 1BMFD 3NWJA 5BN5A 3U4QA 2HUPA 3CRMA 3OEHD 2W2XA 4HAXA 1Z0DA 2ORWA 5EE9A 3VKGA 3NEYA 1YZQA 3LO5A 2QMHA 4WZAE 2RGXA 1F6BA 2YOFA 3D3QA 4FN5A 1F2UA 1QF9A 5G40A 4W7SA 3U2QA 3RHFA 1J8YF 3Q85A 2FNAA 4KLNA 4JBYA 2WSMA 3UATA 3VR6A 2QRZA 1XZQA 2YOHA 3H0KA 2IHBA 1XXHA 2HEIA 1B23P 4TL8A 3VAAA 3ZS9A 4I4LA 1LW7A 3LA6A 1XPOA 2A30A 1TQDA 2ZRIA 1NVUQ 3FDIA 4G5GA 5FPTA 1XD9A 2ZRJA 3SYLA 2ZJYA 1XDBA 2BMJA 4Q9IA 1U98A 3VNUA 4XSGA 3LVQE 2H17A 4NHOA 1HY3A 4LHVA 4MYHA 3WBJA 5BYKA 3V4FA 2FV8A 2KBEA 4OHVA 4NTZA 5BN3A 1YE8A 1EGAA 5L3SA 5E4FA 2OBMA 1U90A 1ZC3A 3CF0A 2O8FB 2QL6A 1UBCA 1GL7A 4TWZA 1T8UA 5B57C 2IYXA 1C9KA 1NMZA 3KUCA 5CIWA 2NPFA 1HE1C 1ODFA 3UMRA 2VP6A 1S96A 1JALA 3ASZA 3CNLA 1FNNA 1KI4A 4WW0A 3CPJB 3DL0A 1M7HA 2WWHA 4GPTA 2CEAA 3TNFA 4AY2A 2AWNA 5E7MA 1US8B 2P65A 4QFMA 3TH5A 5C1BA 4ON9A 1GRNA 1LTQA 1S9HA 4DEYA 2C04A 3CUEF 3TW8B 5TVKA 1A4RA 2ZS8A 3RSOA 2IK8A 3CF2A 4L16A 2BKUA 2PX0A 3A1UA 2AXNA 5EP4A 4B6FA 2IS1A 2QTVB 2IW3A 3VTKA 4PFSA 3K9NA 3AKCA 4CEHB 1X6VA 1W49A 1MO3A 2Z4RA 1VDZA 3EG5A 4JBWA 3CPHA 2QY9A 1G5PA 3K0AB 2MMCA 1EK0A 5DLQC 1G4UR 4DLRA 4QGHA 1MO4A 3KQNA 4K46A 5KDDA 4QM6A 3FPAA 3R9IA 3BH0A 3NHAA 1OXSC 3PEVA 2ZE8A 1RYFA 4M4SA 3RANA 1U8ZA 3FB4A 4UKDA 2KE5A 4D6PA 3ZZUA 5FBRB 3ZYCA 4BWYA 1XTQA 2ZJBA 2WOOA 4A8JC 2YVUA 1G5RA 1IJEA 5H1YA 2W2TA 221PA 4OKSA 3DPUA 1CJTC 5FBLB 1TEXA 2VSFA 2AD1A 4OQLA 2VQSA 4N3NA 4A8JB 3KB2A 3Q5DA 5JSZA 3WYAA 2Z6VA 1IOZA 2V9PA 2XJ9A 5G53C 1S4QA 3UXMA 4ESVA 4FMDF 2ZI4A 1HV8A 4C0KA 1C4OA 3EZ9A 1A7JA 2WHXA 2MMGA 3MAAC 3SOPA 1LS6A 4WA7A 1EFRA 3EPJA 2FU5C 5BWMA 3O8RA 4JL6A 2ZSBA 4DHEA 4C7OA 1Q3HA 3GP8A 3L43A 4RD0A 2VIIA 5CDFE 4YC7A 5F2EA 3OAAD 4DDVA 2IYQA 1G6HA 2BVNA 3K9GA 1PVOA 2YOGA 2NGRA 4P4SB 3DVLA 1RE0A 2BWJA 1YZUA 4QXAA 5SZKB 2JASA 3DKPA 5BXQC 4OHYA 1MT0A 1FX0A 5D3MA 5H8WA 1CULC 4XJXA 1U9IC 2QT0A 4BLOA 3MD0A 5CJPA 4XVRA 1TAGA 4D0NA 1XEXB 3TE6A 2Q9CA 2ZREA 4MGKR 1Y63A 3FFAA 1Z6AA 3EWAA 2OV2A 5DHFA 3FHOA 4XD7D 4JT4A 4FMCF 1P5ZB 1SULA 2FMXA 1JXMA 3KB1A 3T1TA 2IUUA 3I5YA 1QHGA 2KI5A 4EUNA 1P9RA 2CJWB 3PUVA 1P9WA 3TGPA 4MRPA 2QI9C 4I1OA 2FF7A 1P61B 5C2JB 3W6PA 5KYKA 3QXHA 5EZ5A 4RD1A 1XBTA 3H86A 3LW8A 2ONKA 5L3QA 2PLFA 4B75A 3NH6A 2J0SA 1O3YA 2W0MA 4KVGA 3R7WA 1Q22A 3OFND 1OXXK 1UKYA 4BZQA 3G0HA 2O8EB 1JQJC 1L4YA 2P3SA 4Q1EA 1AS2A 3TRFA 1GNRA 4NCJA 1R2QA 1W1WA 1G7CA 2Q3HA 5DN6D 4S2EA 2OCBA 3C7KA 1S1CA 1ZNXA 1OJLA 3DO6A 1DO0A 4LBYA 4XOIA 2WOJA 1E69A 2FSHA 3E1SA 2R6AA 1Z47A 5EE1A 2NZJA 2AXPA 2RMKA 1OHHA 4RD4A 3GEIA 4X8LA 3C8UA 1U0LA 4HAVA 4AI6A 1KNXA 3BH6A 2H7VA 1E2HA 4JLPA 1J90A 4DSTA 2YWHA 2G83A 3ZH9B 4MKGA 1Z22A 3AVQA 4CYMA 2FFQA 2QSZA 5FOXA 2OG2A 1EG7A 1OIXA 3IUYA 5GADl 1TTTA 3B5JA 1T3HA 2QE7D 2ZIAA 2IEYA 2QT1A 4KXFB 1KO7A 4EFMA 4WXRA 1E9DA 2O8FA 4Q66C 1TU4A 3A6PC 3QF4B 5LDDC 4Q7JB 5F9FA 2E1RA 1XMIA 1W0KA 4M53A 1XX6A 1D6JA 1OH6A 1G17A 1TF7A 3FKSA 2ZXUA 1AKYA 1E0KA 4Q5IA 1NNEA 2BOVA 2HXSA 1E2MA 2WBLC 1IAQA 2OLJA 1US8A 3L8YA 2HLDD 2QSYA 2ZAOA 3B1XA 5JRZA 4B3GA 2WWIA 2ZRFA 3CLVA 3CRRA 4RJLA 2VHJA 5F98A 4BZXA 2HJVA 2D06A 2NIPA 1BOFA 4LJ4A 5E7JA 3I73A 1NBME 2GEDA 2JDIA 1F60A 1P4SA 521PA 1U81A 4CEHA 1BYIA 2C9YA 2Z43A 5JI2E 2ZI3A 4JL8A 2QENA 1F2TA 2WWGA 3K0AA 2FPKA 2ZUBA 1Q0UA 4Y0AA 1IXSB 3TBKA 1KI6B 1SXJA 2QZ4A 4DSNA 3OIYA 4JVMA 4UNNA 3QKSB 3DDCA 2GCNA 2X19A 2G0TA 2H8KA 1Z6GA 3EX7C 2ZE6A 3K0FB 1X8JA 2OZEA 3QKRB 4TLCA 4JSTA 5C4GB 2ZROA 3WP0A 1TMKA 1YZGA 2AR7A 5CJ2A 1TNDA 5KNCA 3KQUA 4Q7LA 3OEEA 4KYIB 1ZYUA 5G3ZA 3A4MA 4A1FA 1KO5A 1G3MA 2ZITA 5FL7A 4V0ME 3DOEA 3A36A 1XCGB 1XTIA 2ZUCA 4Q19A 5AR1A 4JYCA 3U60B 5EE5B 3TMKA 5JWHA 2QPTA 3A8TA 1JEDA 1HUQA 3AF4A 1J70A 2OCYC 2VTKA 2F3TA 2IYVA 4BUJA 1W46A 1KAGA 4LHXA 2C77A 3W90A 3W3ZB 4QG7A 3ETLA 2XZLA 4I81A 4EDHA 1G8PA 4EFLA 2IL1A 4PC7A 3HJNA 1P60A 4A6PA 1PJRA 5ELXA 2X8AA 3C16C 4Q03A 1Z0IA 4Q48A 4P4SA 2ATXA 2X2EA 1QDEA 1PLLA 2GDJA 1GSIA 3B8HA 4FCTA 4IDQA 5CK4A 4RD3A 5FTKA 4QBHA 4Q7KA 4DIEA 1SHZA 2B8TA 1UM8A 2RCNA 3AF0A 4MKHA 4PC6A 1ZW6A 2QMUA 3W6OA 1D9XA 1ZIOA 1TEVA 4H1VA 4MYCA 4XVQA 3VR5A 2GAOA 2CXXA 1YZKA 3HYTA 3T5DA 2EFHB 3NKVA 4GP7A 4BFXA 1RRCA 1FQKA 3ND9A 2CK3A 3MG9A 2ZVQX 4RKFA 3TSZA 3UANA 4GOKA 2ZR0A 4Q4AB 2P5TB 2ZE7A 3AF2A 2A7QA 4D4MA 2BM0A 1YJ5A 1S0UA 621PA 2R2AA 4PQYA 3WNBA 4RFVA 2A5FA 1RYHA 4AKEA 3U44B 4C4PA 4ABYA 4DDWA 1NG9A 2QUZA 2O52A 1TQ4A 1K8RA 1K5GA 2WWYA 1HEIA 1IQPA 1AZTA 1OH7A 1Z6TA 4B6EA 5TDHA 1WE2A 1OB5A 1MV5A 2CHQA 1MRNA 1E2EA 4PZZA 3Q7QA 1NN1A 2BDTA 3U3KA 3CX7A 2JIZA 3I4LA 2F3RA 1AM4D 2BEJA 2GRJA 2J7PD 3QKTA 1E9SA 3AGQA 1U8YA 2QNRA 4KV9A 4DSOA 2R62A 4BEBA 4ASUD 1N6KA 1SQ5A 4F92B 4XWAA 2BJWA 4NP6A 2FA9A 3OHMA 4PPFA 4TLBA 4WAUA 1X86B 4RVCA 1JI0A 5FBWB 5TV2A 4HATA 4PAQA 4OHZA 4PR0A 1I4DD 4EQ6B 5DGXA 1YZNA 4UXIA 1T5IA 4BLTA 1F5NA 4II7A 2BV3A 2D2EA 1XP8A 3TAUA 2ZRAA 1DADA 4TMTA 4GDFA 4Q47A 1COWA 3SYNA 1Z0KA 1RJ9A 2XJ4A 4YXWD 4WZ6A 1TADA 4TYWA 2D3WA 3WBKA 4OK3A 1F2UB 3U7FB 2SHKA 2REOA 2X1VA 1H8ED 4XSHA 3IGFA 3B60A 3BJIC 1OIWA 2GVDC 2W2VA 4CW7A 1W47A 1BO6A 4EFNA 3W34A 2FG5A 3BFVA 5SZHB 3T15A 4S35A 1BH2A 1GKYA 1S3SA 3WYFA 1E2NA 2P6RA 4D2IA 4HAZA 2GWHA 1E1QA 5L3RA 2GESA 3LBNA 2YWGA 3AVVA 3B13B 4A2WA 4XWOA 3LRPA 1T91A 4UXJA 1H8EA 4YDSA 5D3QA 4A2PA 1AKEA 4URYR 1Q44A 3T06B 4RZ2A 4EAQA 2OM2A 2V7QD 1QHSA 4LYJA 4URXR 3U7GA 1IBRA 3NC1C 3Q9LA 5L3SB 3KJGA 1KI6A 1KY2A 3CONA 3O8CA 3ZVRA 4M2LA 3QKSA 3GJ7A 3X2SA 4Q1DA 4IDNA 4ZCMA 2ZI9A 1MH1A 4G1UC 3K0FA 5KPDA 3QKRA 3VKHA 1PLJA 4DC9A 3EXAA 5CM9C 1S2MA 3TQFA 3SFVA 2GEVA 2HCJB 2QPAA 3KTAB 5BYJA 4BASA 4OYHA 3NG1A 3OE7D 4PC1A 1W7AA 2B21A 2VP2A 1BYUA 3BFXA 4C2UA 4F4JA 3R8FA 2B6HA 3X1ZA 2JJ2A 1DPFA 2J0QA 2GZDA 1FQJA 1GP2A 1RIFA 1JPJA 1H8HD 1QG4A 5H70A 2F7SA 4TYYA 1EFCA 3RWMB 3QNUA 4X8HA 2WWWA 2IYSA 3WHLA 4JLJA 1Z2CA 1DARA 1ZM2A 4OBEA 4LCBA 3LXXA 2R6FA
chains in the Genus database with same CATH superfamily
4EUKA 1WZEA 1CUCA 4ZVPA 4EUFA 5F21A 1X0VA 2SICE 1OT5A 3ESCA 4N0DA 3C24A 1QR2A 3FPCA 1MKYA 1GCGA 1JR3E 1N0UA 5AIAA 2QM3A 3KDAA 3R0ZA 3UJ7A 4F6RB 2QQGA 3W2GA 4TPKA 4CIBA 1QHEA 1MAUA 3ADCA 2Q50A 4QWWA 4EGAA 1GUAA 4AWAA 1YCHA 4HOYA 1XQ9A 4ITRC 4ZCPA 1W36D 1JPUA 3W4IA 4AKHA 1OOEA 1OSNA 2P0EA 2VWGA 3EEFA 4LXTA 2HQSA 4EGSA 5I6DA 5JJCA 5EL0A 1CZUA 4LPKA 3V8QA 4EY5A 3KEOA 3UZUA 2QN6A 3FCUB 2AG1A 4B81A 1KBZA 4NY1A 4U7PB 1RAFA 4G01B 3TFOA 1HEYA 3BAFA 2OLKA 3NLLA 4L9RA 1SXQA 3CZ9A 5H81A 2XMCA 1T3GA 3IQFA 5FNZA 1KDPA 4AJNA 2ASEA 3CEAA 3M6AA 1ML3A 1VHWA 1WXDA 1RM5A 1XU7A 2G0NA 1OR8A 3M8KA 2QTFA 4FKZA 3SGLA 1AA9A 4ZAYA 4EP1A 2COUA 1U28C 3C6KA 4P0TA 1B00A 1R0CA 2XNSA 4HDKA 4C0XA 4K1LA 2SCUB 2WB2A 4M0UA 1MXHA 1FVXA 1NMEA 4KR2A 2E37A 2YV3A 1UBKS 4V0OA 2JFNA 3E7DA 4KWTA 2IPAB 3RS7A 5CT4A 2ZS9A 2ONCA 3AUJB 4ZICA 1L4GA 1NDUA 2R8PA 1QHIA 4PHGA 1FVOA 4A6DA 4G1MB 3PGXA 1DAHA 2IYUA 3EQ8A 4QOJA 2M6SA 3T12A 3BJMA 3GDOA 4MULA 4ZCSA 1FSFA 3UJ3X 4OHWA 4D81A 2SKDA 1G9XA 4QTXA 4ZVVA 2YX1A 2W42A 1ZX1A 2MDTA 3LYUA 4QLAA 2VQEB 1QRTA 1DBVO 3USZA 1G291 5BNTA 3HVRA 4PLPA 3K0CA 1DAOA 3HCFA 5LL6P 4P4NA 1G8HA 1HFEL 1YQUA 3U3DA 1UQTA 2I1VB 2BCJQ 3HKBB 5K7SA 3AEKB 3MWKA 2WJWA 3Q15C 3A32A 3IIIA 4LF8B 3BB1A 3L8GA 4GYKA 4K26A 4EA8A 1ZVQA 5DSZA 1VI6A 2X4DA 2IY8A 1GRRA 3H18A 1K9VF 3E4CA 4YRTA 1B0AA 5T8KA 3Q3GE 3GGOA 1L5WA 2DHQA 4DN6A 3CLRD 5CHYA 2XIQA 4DJEC 1G2PA 1TZKA 2QTWB 3LDAA 3BRQA 2ID8A 1RT9A 1X8KA 4ND1A 5DV9A 2D3TA 3LDHA 2AZDA 2Z5FA 2IHKA 3ENQA 1L5YA 2WMOB 3JTEA 3L2OB 2J3MA 1VIVA 4Z3DA 2V7WA 4G5OA 1D1TA 3SFZA 4AS3A 5DOVA 3FNEA 1KO1A 1E18A 1SIBE 1U3DA 4MPDA 4URUR 1UEJA 3D8NA 4BVLA 1KYYA 2NXEA 4ZEXA 2C57A 1B73A 4Q7QA 3ZHBA 5G02A 5IVIA 4LNUA 4JQOA 5JNTA 1WTCA 3WIVA 5JNVA 5JLAA 3NONA 2HT1A 4RD6A 1P2GA 1EUCB 1POWA 2ETVA 2YH2A 2B2NA 4QTYA 5G1PA 3PYLA 4NESA 4TL9A 3A6GA 3KLNA 2GXSA 4P93A 4FGWA 2RFLA 1XZBA 3A14A 3DHWC 3ACDA 3V33A 3CVVA 3N87A 3WISA 3AUKA 5FAXA 4YREA 3CS3A 5DK6A 1TT5B 5J2UA 2AMLA 5ALMA 3ZI0A 5JS1A 3DAFA 2J4CA 3DVAB 3M4YA 3VX4A 2YIDA 3OIWA 4BTEA 5FR1A 2OP0A 2FCRA 3E70C 4X54A 5CXXA 1TPZA 1F06A 2VDOB 1BDBA 2VF8A 3WGZA 4F5ZA 5F4BA 3FOFC 2ECFA 3O0TA 5DM1A 5HJEA 1H5QA 3Q5EA 3WLEA 3ZCPA 1N1MA 3D0KA 4GP6A 4QYIB 4LOLA 4F3YA 4YFVA 4XKJA 5DHAA 1BW9B 1I36A 4QQFA 1L4EA 1FMJA 1GZSA 1NIPA 2BCGY 1Q7GA 4G0YA 4JGGA 4LMPA 4REQA 2D1SA 2QHXA 1H9AA 1W4CA 3TE7A 1XP5A 3D3WA 3ZUGA 1YDHA 5C1IA 2WSSD 4GBJA 1TFRA 1VL2A 4PGGA 5K4HA 5HG0A 4G5XA 3WZLA 6REQA 2P5UA 1TQ6A 3IUEA 1T43A 5KBYA 4O4JB 1K8YB 3P0HA 3KTAA 3KZNA 3P9XA 3GAMA 4WZZA 3V8EA 4CPDA 2ATVA 2CFIA 5THQA 3D6FA 1WAMA 2QU8A 4NDZA 3SYMA 5EEHA 5I4KA 1TZMA 1BIFA 3NOVA 1LLCA 1XOIA 4LBVA 4QPJC 2DBYA 5EIAA 4LJRA 3VPFA 4EZIA 2VLIA 2RARA 1N9ZA 1G8JA 1OASA 1NW9B 1PK8A 1LDGA 4MXDA 3MYRA 2VCHA 2BSXA 2R1ZA 2JLXA 3HXMA 1F2TB 1Q14A 1Z7BA 4KQ1A 2GERA 2AJCA 2VBGA 721PA 3EASA 3LKZA 2UZ4A 5A3VA 5C5DA 4LYFA 1JJVA 1I7PA 4GMKA 3ENKA 3MMSA 3MJFA 4UBNA 3TMAA 2XUQA 2R11A 2E89A 5IG2A 3GLGE 3FPSA 2CHGA 3AFGA 3S40A 3ESAA 1JB1A 3F7NA 2UZIR 4NH4A 2XMSA 3TQHA 1V1RB 3ME5A 3MMXA 2VZLA 1QSGA 1B42A 2CKMA 4JYZA 4HXGA 3SVTA 3WAGA 1NPTO 1U2DA 1O6BA 1Y1RA 1RPTA 3G88A 5EZ6B 3IVRA 3LFHA 2PTGA 1Z63A 2ISSD 2Y71A 4Q21A 4QSMA 5H3HA 3HN2A 4P1ZA 2O05A 4M86A 5FRDA 1F8YA 4V0QA 3DDSA 5KYYA 5LMNB 2V45A 4HDOB 3KR1A 1NYRA 1N0IA 3RJ5A 2CFCA 1EJBA 2FDRA 3OM8A 3RC7A 3KZOA 2ETXA 5I9TA 4U2CA 1YGPA 3U9TA 3F8TA 3KR2A 4Z8XA 1DRUA 2WD7B 1KTVA 1E4YA 1RXEA 3JASB 3PGVA 4D4KA 3QPBA 2GEJA 1S02A 3QJ5A 4NMHA 3T1QA 4HMQA 4HZUA 5EKSA 4DJJA 3H6GA 1GCUA 2VWPA 2IKQA 4YMTA 2WT8A 4OGGA 3TZBA 5DNVA 3RS0A 3JY6A 4OP3A 4W82A 2R1UA 2AZTA 2ENWA 4H18A 4PX5A 4ZMSA 2V7UA 1T4CB 3N59A 4E7OA 2D0PB 2I54A 1EHYA 1QS0A 1Y6JA 1KAHA 1GFSA 3DEYX 4X7MA 1IPFA 3WL7A 4RVNA 3I9MA 1D1SA 3GLIE 2K7FA 1CR2A 2PL3A 3BZBA 1M8GA 1SVKA 2DKFA 1R74A 2PN1A 4JOSA 3K8OE 4MV6A 2W6ID 2GWRA 3FWKA 2IS6A 4HDMA 1NOJA 2GS9A 3PTLA 1D2AA 4XOUA 2Y1OA 4DV6B 4PZYA 4EB0A 3SJUA 2FP4B 1YA4A 5DH9A 1N6PA 4BQRA 3P9SA 2ADMA 2GAFA 2V98A 3G23A 4X41A 5IK2D 1CIVA 3I3SR 4GXNA 4LY0A 4K05A 2I87A 3WNDA 2H4XA 1CR4A 2A88A 1KZ9A 3L8MA 5LDGA 3GYGA 1HDXA 1O8BA 1X14A 1PLKA 2JIOA 1KMIY 1BTOA 2VOEA 3FDJA 5I7RA 1MEOA 4V0NA 2A94A 1PCXA 3GLHB 3JZFA 3H97A 4JDUA 1VKRA 3OG9A 2X3UA 5KHOC 3OU2A 3PJEA 3D5TA 1RHMA 4Q3DA 4K2HA 1JTVA 5AKHA 5JFGA 5MHTA 1HTTA 1QFMA 3DE6X 3OLXA 3SC4A 2QQ0A 3VPXA 2Z6QA 4XUDA 2GXAA 5M34A 1XTSA 5EFZA 4G5HA 3ZK8A 1K6EA 1QH9A 3URKA 4FB5A 3AHJA 2D0DA 1I3LA 4KNVA 4KRGA 2J9ZB 3SR4A 4A3SA 1XD8A 3O9VA 3U0BA 5IZ4A 2YZ2A 5KAPA 4ZARA 2X0FA 3K9CA 4AG6A 2O0JA 1TKCA 3RVDA 5L3VA 2CZCA 4XJVA 3ZGNA 3CR8A 5FYQA 2O3TA 3PQDA 1O6GA 2P27A 2HHAA 3LSYA 4IVPA 4IGKA 2FZ4A 3B1ZA 1CJVC 4RIHA 1ZHFA 5DYTA 1C41A 3FHTA 1RHUA 1CR0A 3AJAA 3OJOA 5C8YB 1U1FA 3ENVA 1ENYA 4X95A 3ZI4A 5K6RA 3E9NA 2H51A 4QJ4A 2GILA 4CIXA 1X92A 3C48A 4XM2A 5U1PA 3AHGA 3PDHA 2V8OA 2MSWA 1PYDA 3EN0A 3QSYA 1BD4A 2VA8A 3NUGA 5DTMA 2EKDA 3KJXA 4MW4A 4QTZA 3ZJYA 5LMCA 1MAVA 2W7TA 3ZZNA 5ITVA 1ZH6A 2FQ1A 2JI4A 5K2MA 3RYFA 3PFFA 4EIWA 5K0GA 2J9YB 1OAKA 1N78A 1ILWA 2VPPA 2PNJA 2H54A 2PRSA 4AXBA 5M5BA 1DTWB 1XYGA 1SOMA 2D7CA 4IJMA 5D5HA 2FRVA 3FYUA 1L8QA 3P5SA 3QBEA 1MG5A 3OJXA 3R6WA 4JWTA 5EIHA 1IN5A 2HNBA 4RF4A 4N5IX 4D8WA 4W7IA 3I32A 1XCBA 4UBKA 2NW6A 3F8WA 4WZAB 2IYYA 4A16A 4BVFA 3EIEA 1JSZA 4PAMA 3DWGA 5L45A 1H22A 2KHZA 2Q2QA 4GU5A 1CYDA 2CSUA 3CLUC 4I4IA 3QXCA 4OSPA 2C5AA 3IR6A 5FNVA 5TRTA 3VZDA 1Q1ZA 3LU1A 4AURA 3TUZC 4Q0MA 2LNDA 3TR6A 2MJLA 1UK7A 1OJ7A 4I8IA 2UYYA 3ZE1B 3MFYA 5FEUA 2NMVA 4XQGA 1EZZA 1JLRA 2UYOA 5FOTA 4MDFA 1AXEA 4DIFA 1VYVA 4O4IB 5INTA 4BJ5A 2QE7A 2NYUA 1CPYA 2Y66A 5H02A 3AHDA 1QGUA 2G67A 3A6LA 1U2RA 1KXJA 1JNXX 1SCNE 3O3NB 4G25A 4M9ZA 3V6LA 4ZJYA 4AKGA 3RS5A 4YX9A 2V7BA 3K1AB 4DY4A 4DTIA 2FWPA 4A36A 2NXCA 3C8HA 5CYOA 5G4KA 3Q8XB 3U62A 1TCUA 3EK2A 3MILA 4EJSA 5CAEA 4HUQA 1FSPA 1FUUA 5EWMA 4H1TA 3UJAA 2F8MA 3PPYA 4ACAA 2QN3A 1J25A 2WI8A 4FCWA 3RF6A 3E05A 4PBSA 2VDNB 1TUBB 3L0OA 3Q3IA 1Z07A 4P4TA 5FOUA 2IUYA 1AQIA 1M2HA 3AVUA 2I33A 2WKQA 3MGCA 2HF9A 4O1MA 5F1PA 1JWLA 3A1WA 2ZRQA 3BFKA 3C3BA 2IZ6A 1U3UA 4G23A 4V1CI 4AY5A 3C3JA 4OQXA 1QIJA 3T9DA 1L0BA 5AI9A 1NJ2A 1VC2A 4XVHA 3QLTA 1PWXA 2BJHA 2IVFA 2QN7A 3GFOA 5DMXA 5K2OA 3KR0A 2VDKB 1JJ7A 3RVKA 3GEBA 1A97A 3RQSA 3L4EA 2ZRDA 5FV7A 4LV5B 3LC1O 4RK7A 3MWJA 4CIYA 1GU0A 3K9QO 2FN3A 4NENB 2D5BA 2YYZA 3IP1A 3UT5A 3IDAA 3BRCA 3OJFA 3FFXA 5DP2A 3PHIA 4J16A 3TD2A 5KX5F 2J33A 1JJFA 5C18A 4AU1A 4CG3A 2WU3A 5AW7A 2BLNA 4U63A 3DXXA 5K20A 1G19A 1II8B 3MTIA 4AY4A 1Q0ZA 1DZIA 1TQ2A 4TS9A 3LFTA 1JN0A 4IXNA 3FYHA 3LTEA 5FPQA 2ZOSA 1K0FA 1TM5E 1G1MA 2VSQA 3BD9A 3F90A 2WTNA 1QYXA 3OT4A 4A0HA 4ZOCA 2HO4A 3B3FA 2UXBB 3TPFA 1Y42X 2P91A 1N1DA 4DB2A 2V7XA 2OB2A 5IH7A 4YRLA 1HT3A 2YVKA 3MF4A 5BV7A 4NEHB 4Y1RA 1QQ7A 1J8VA 1XU4A 1T6ZA 2QOEA 1PR3A 1Q19A 3HLKA 1XLVA 1MZPA 3CEJA 4KREA 1MC4A 4CDMA 1YT5A 3LL7A 1BS2A 2X2FA 4E07A 4UVHA 3GNQA 3U7QA 2ZDQA 2YXBA 3P97A 1SK9A 1E94E 2W6OA 3I8XA 3GZTB 3M5WA 2QW0X 2PTHA 4BDSA 1DG1G 4L5JA 5AUPB 3G7SA 3B7GA 2L42A 1U0RA 2PT5A 1GHTA 1SCUA 4EJFA 1SB8A 2J9XB 3LPCA 4KWCA 5KTYA 3WYBA 1JSCA 4CBVA 1IATA 1D2HA 3G6WA 4RVHA 2BSQA 1WZNA 5E9JA 4DANA 5HUJA 2AFRA 2JBWA 3K5HA 2DEUA 1T2UA 1EDEA 4LUCA 1S2LA 1ZPDA 1JB9A 4WX2B 2H8GA 1MDBA 2GH1A 3KHTA 3UMVA 1VMKA 1IZ7A 3A11A 1WEHA 1TRKA 2XE7A 2CXQA 2F1RA 3N76A 4U6QA 4JROA 1EDOA 1AKVA 2GHQA 3KSZO 3N8IA 3OZSA 1ZBDA 1GKUB 3IOCA 1QG2A 2VK1A 1GL6A 4JI6B 3RYHB 3PE4A 1AUVA 3AIMA 3HABA 2R97A 1V41E 1B0PA 3L9WA 4FX2A 4MS1B 5DGCA 5C37A 2JVJA 3GUUA 4IIXA 5G2OA 4M9QA 2XRMA 1IXYA 3QH4A 5E95A 4RTRA 4IHQA 4DMFA 2V6BA 3QKUA 3RS9A 1GR0A 1PYOA 2E18A 1WUHS 3RFVA 1ZRSA 2H11A 2O1WA 2LDBA 3QIAA 4I2VA 5CH3A 3FOBA 4RE6A 4KR6A 3E15A 2JCXA 1AHIA 3D8BA 3K72B 2AWOA 4JJ8A 3ZV4A 5FLXA 2C4UA 2FPXA 4B6QA 1JLKA 1XQ6A 5TT1A 2ZJ8A 4HDKB 3ZV7A 2XD9A 1VZ3A 3QW2A 1XMOB 3DCIA 3RT9A 1E3LA 5TMBA 4JHLA 2VRNA 4HH1A 1T1JA 5B58T 2MCFA 4TLDA 4CCWA 1UOEA 5KNDD 2RGRA 4YCBA 1JPVA 2C94A 3LM8A 4KUEA 4LVOA 4LJAA 4BV8A 2HK7A 4J2OA 4BRUA 1A04A 3EMVA 5H9WA 3IDFA 4QO8A 1YR7A 2A3NA 2AEFA 3K0CC 3KLPX 4PC3A 1Q7EA 4UD2A 1ATZA 4XQCA 5EQTA 2RONA 3TNDA 4UQPA 3TNLA 3AX6A 1VFNA 4PZUA 3M4ZA 5LQDA 2X0KA 2QTGA 1CEEA 3E5HA 1JSRA 4GHWA 3TLBA 3SC2B 2NTJA 2QJWA 1ILEA 3KDSE 4E03A 2QLBA 1DSSG 1AGXA 4PS1A 5IHPA 1Z5OA 4MHTA 5T8KC 4M7PA 1E3IA 2ZJ2A 2LCFA 2XADA 1GGKA 4TQUS 1N5DA 2FFJA 1QVRA 2RI0A 3GO4A 3AVTA 2J0EA 1ORWA 3HGTA 4EJ0A 3PT9A 4D8XA 4TZTA 1O5IA 4X63A 3AWIA 3C3CA 1XQYA 4DTCA 4RH1A 2UU9B 2D1FA 4IFEA 3IOMA 4L3OA 2PBZA 2QN2A 2J7PA 3SKYA 1C7EA 1U9ZA 1Z6ZA 1FFSA 4BP8A 3GFTA 1VB3A 1BDMA 3CNNA 3L04A 1Z25A 2FJUA 3TK1A 3WB0A 2NQ2C 4ASUA 5DM60 5BRJA 1BHQ1 2E48A 3ZIUA 2QZ9A 3X1KA 2GF9A 3IOEA 4KFTA 4IXDA 1J0BA 3ZGZA 3BB3A 4XARA 3VC7A 1PS8A 4RJIA 3EGIA 4YDHB 1E3TA 2J0VA 3K16A 2HA0A 1NFQA 1P19A 4NBRA 3EY9A 3UGTA 5CDSA 3A4NA 3BPSA 4MAMA 3NMUF 4HVLA 5EXPA 4NBKA 3RB8A 4A82A 1DXHA 4MI3A 2HK8A 2FDXA 5DLDA 1ZGBA 4PINA 3EXEB 3W05A 4DJ5X 3WAJA 4JT2A 2ZYTX 3HYRA 1G41A 2H5IA 4CKBA 1IZYA 4D9CA 3EZ2A 5IS2A 4KI7A 2OMKA 4V1CB 1JQ3A 4Z9AA 3FD8A 4KBFA 4PANA 1DWPA 3G9ZA 1VCMA 4MLPA 5K5EA 4TROA 1ISGA 4ZAXA 4PSCA 3NT5A 4ZZ2A 1WVGA 2DTDA 1A96A 2YCLA 3X2EA 2YMPA 1QBKC 3QRWA 1VIAA 3G0OA 3PFKA 2PRKA 1CK4A 3C41J 3GD7A 3K5WA 4OOFA 4Y2JA 3V9PA 3FPFA 4UHDA 5A4DA 2HX1A 1ZMBA 2E4AA 3PX2A 3T5MA 4ARCA 3Q7SA 1VM6A 1FSSA 2HZ7A 2G9ZA 1ZLYA 3FNIA 2R87A 4ME6A 4URVR 3CPEA 4DXHA 1RXVA 4GQIA 3HYNA 5PGMA 2WF9A 2VSNA 4A7PA 3E03A 3V3KA 4IQ8A 4YCLA 4AKIA 4J03A 2OO5A 3FOAA 5EKUA 3AJ8A 3WWYA 3ZTTA 5DCUA 4UMVA 2HAEA 3JR3A 3RS2A 4JOBA 1IN4A 4AP9A 2W71A 3K9WA 2DOKA 3FVTA 4ZZ1A 2AOWA 2XSZD 5TARA 3VOAA 1Z8HA 4C6TB 4EB6A 5HMLA 2DGDA 1SCQA 3C6ZA 4FFVA 5F3DA 3CO5A 1C7ZA 4TTRA 3S6JA 4F5EA 4ZIRB 4HNTA 3GLGA 1NRWA 3D59A 4U7HA 4F86A 4JSRA 4IIJA 4LAFA 3VUEA 2JAHA 2NACA 3AU8A 4JD5A 4PYLA 4IM7A 4Z9BA 4FZRA 2IQ5A 1MABA 4OQPA 2YV5A 3OT5A 1PVDA 2GCPA 2ZSAA 3QE0A 3AK4A 1U0BB 4HQKA 4AL4A 3BWYA 4G24A 3GELA 3B78A 1J2EA 4KXLA 3TR0A 5A0FA 1UADA 4AULA 1DBRA 3M4JA 2IVZA 4FGJA 3CE6A 1GNQA 2VDJA 4GMFA 1V7PC 4QPPA 3STXA 3THYB 2XEDA 5KJ1A 1VP3A 3GIWA 4JI0B 1RBZA 1YS6A 1IBKB 3TQRA 1GGMA 5LOVA 1CUVA 1WDKA 3CB2A 4YBRA 5SZJA 4KR3A 1NMQA 3KK0A 2C2KA 2BMWA 4OAQA 5DGTA 2OD2A 4AY6A 1TGVA 5LYJA 4YASA 4D9FA 1ZJ4A 1OAOA 3KZKA 2HY7A 4JYMA 4Y7DA 2IXBA 4TXMA 1KEKA 2FN4A 4AECA 4TYYA 4FYXA 3CINA 4GYJA 4O0LA 2AUMA 3TJZA 4AAYA 4FR2A 5JWOA 1DV1A 4DDMA 1KKLA 5B36A 4GLOA 4MB0A 1ZCAA 2GAJA 4MCAA 1UZUA 2EGUA 2XGJA 1C14A 2YJ3A 3F9CA 3MAJA 3RYIB 3PC8A 5EKXA 3HRIA 4HZUB 3O47A 2Q8PA 2XYGA 1CD5A 1QHYA 3NGXA 2DERA 3Q0IA 4Z4QA 3A6JA 3GUCA 1XHEA 2J5KA 3FIUA 4U0KA 1OQAA 2Q46A 5JDIA 4XYMA 3PFBA 3M70A 5HW0A 4GZMA 2IEBA 3CH5A 2GXQA 5K3BA 3LX4A 3HQ4O 3DZFA 5DI9A 6Q21A 2FN8A 4GC5A 2ZPAA 5H83A 1JQKA 5I51A 1J06A 4CLXA 4AYXA 2O2ZA 1IUNA 2IPNA 3GVHA 5DDIP 2QW8A 3CLKA 4PM4A 3AF5A 1FB5A 1PR0A 3HCPA 4LHYA 1VPEA 5I8PA 3NDPA 4G3XA 3TLJA 2QMQA 2H1LA 2JEYA 3F5MA 4BDTA 2D7JA 16PKA 2AFIE 4N18A 4OGWA 3RTDA 1Q6YA 3L9XA 1SZJG 3QMMA 2KJQA 1NLFA 1A9QA 4IV8A 2X3FA 3BMOA 3RS3A 4A8TA 3HMKA 1KEVA 3QU4A 3F0TA 1XDZA 1ESZA 1Z5VA 5JPDA 2CFTA 4CF7A 5CLJA 2XCSB 3GUVA 1GSHA 5D01A 4OHPA 5JW6A 5BR8B 3TJMA 1D4AA 3LOQA 2VNKA 5IDYA 4FUTA 2QTLA 1RLOA 1MU0A 1UKZA 2HU7A 2DF8A 2I67A 3A7EA 3D7RA 1ZMXA 2PUHA 3KYCB 2CW5A 3OU6A 3R4CA 2QLJA 5FPPA 5LCXA 3UN1A 2WT4A 1T9HA 1BDJA 5KHAA 4BNZA 3KVYA 1MHPA 4C6HA 3NHLA 3PNOA 1T3SA 3REFA 4KWEA 3RJMA 4ZVKA 4HYQA 4DIUA 2P2CA 3I8SA 1NV8A 2AHRA 1HQYE 2KWIA 5I7VA 4D3DA 1JG4A 1BC5A 1TTQB 3QYJA 3N07A 3WWOA 3VMFA 3ST7A 1KETA 3BWEA 2VR1A 5TEVA 5BN1A 1FE8A 3KQTA 4LRUA 2O8VA 3I5XA 4IJ6A 5ES4B 1UPFA 1AIPA 3KXKA 2J08A 4BV3A 4A26A 1Z7WA 1HXHA 1YS4A 2NNWB 3HCNA 3WYGA 1VKOA 1G3QA 2QTZA 4JBXA 4U02A 3K6SB 1E32A 1MJGM 3O92A 4MUYA 4WXPA 4WNAA 3JARB 4OXIA 3A0UA 2A7XA 2YXPX 2J3DA 3KJEA 1IXRC 3TB4A 3NC4A 3GT7A 3A9VA 3NT2A 4LSZA 4MICA 5AW4A 4DGQA 5B4TA 5C8VA 5K4GA 1G3IA 4KJXA 1MT3A 2CC2A 5JDCA 3KPWA 3ZWPA 5DW3A 3PQ3A 1V11A 3FYUC 3AUSA 4LZLA 3RYFB 3LI2A 4PYOA 1JDJA 2KBFA 4HN2A 2CFOA 2CVZA 1VPVA 1I7NA 3B1KA 3EGCA 5KQMA 5EJ5A 2ODEA 1JTFA 4MVJG 3N70A 1NJ1A 3BERA 3ORYA 1CZNA 4G0NA 2BUAA 1STOA 2X3YA 1U7HA 2JIDA 2OAGA 2X1MA 4QNNA 4XDHA 1ZCZA 1VMAA 3DQPA 2FWMX 5AK6A 4B7AA 4UTRA 3CKKA 2WQ7A 4GUAA 2DPXA 4OQNA 5J59A 4YMHA 5F7OA 5JT1A 2P3QA 3CWCA 1GTVA 1KI9A 1P73A 1OC4A 5HILA 2O2CA 1J33A 1NTRA 2HO5A 1FZQA 3HDGA 2XWQA 4HK4A 4M1ZA 4NBSA 4RCYA 1N3YA 3OIUA 4FXPA 5IABA 3S2IA 5E6RA 4AJJA 3D6MA 3ITEA 1Q0LA 1NVVQ 1SPBS 2FR1A 2VPTA 2P9GA 4PLGA 4YJ2F 3FWNA 1CUIA 1PRYA 1XC7A 1UOPA 2GEUA 2Z2IA 4CG2A 1UPXA 4PYKA 4OHCA 3V7WA 2E7ZA 3M6LA 4EJSC 1NASA 2DY1A 4Z6KA 2Z30A 1FPQA 1E3DA 1UC8A 2QGNA 1QGUB 3C5CA 2IZ0A 2BE9A 1OV6A 3QHPA 2PRIA 1J8DA 2ZWVA 1L3BA 1EU1A 2ZSIA 4C3ZA 3FAZA 1IUOA 4ZU3A 5CDGA 1GZ7A 4F1WA 5LP1A 3QTBA 4WLNA 5CAEB 2GCOB 3VO9A 1GT91 4QFDA 4CJXA 3C5EA 1VZ2A 4AZWA 4UHFA 4YCSA 4JLWA 4LYDA 2EEPA 4TN5A 4WBSA 3OFSA 4E1BA 2C8VA 3BICA 2W8BB 4FFPA 4R9UC 1I2ZA 3WP1B 2O9JA 2WSSA 2ISQA 3REGA 4BQOA 4XYLA 3H2JA 4H4CA 5FUXA 5KO2A 1UEXC 2ZUDA 4NZNA 2QRVB 2B69A 1BMTA 4Q15A 1VE9A 2SBTA 5J63A 5IVHA 3RUCA 3G02A 3RC3A 2ZB2A 2NXNA 3DNPA 3OP1A 1X7XB 3S8EA 4U9IS 4YAFA 3KKEA 2ZW9A 1IJBA 4RDCA 4Z4EA 3I53A 4FHGA 4H59A 3OH8A 4WACA 4J16C 1OIVA 3UAGA 1HK7A 4GRIA 5IM5A 3GL9A 3RSZA 1E98A 1VKNA 3NKFA 4F85A 4BV9A 3UMMA 1ZC4A 2HCRA 1ODJA 4FYYA 3QEMA 4HLUA 4KR0A 4ETIA 5B1YA 3K0EA 5ARCA 1FXWF 4KXXA 3UT5B 2C88A 2R8XA 4EENA 3F96A 3ZBUA 1JXAA 1XZJA 4CWAA 5H7XA 1KDOA 2A5YB 2AG0A 4JGBA 2CE7A 4DREA 3H05A 2JGKA 3PWZA 4CLEA 4JKOA 2RGDA 4J0KA 4B0OA 4JCCA 3S5JA 4EHNA 3NTQA 3FNHA 5EVCA 2ADOA 3JAKA 2ODWA 3HKDB 1E1MA 1FA9A 4BNVA 4CKYA 5C5IA 4FSDA 3IBCA 3A1CA 1IQRA 4LK3A 4NBLA 3TTYA 1WCYA 4LGCA 1K8QA 1I80A 3GCWA 2W6CX 3MMPA 5GAJA 2CT8A 4HNVA 1QZ3A 5FWXA 1M54A 4L5CA 4ZA2A 1ODKA 4C14A 1CIJA 4Y1RB 3HI4A 4UXHA 2I9KA 4FBLA 5HMMA 1GJRA 4TS3A 1JLLB 2F3UA 3IJ5A 1QFZA 3DF7A 4RBNA 4XDGA 4E51A 2CNOA 5ITWA 1I4TD 1RWWA 4PY2A 4X90A 4DYHA 1TDJA 3WMGA 3RVSA 2ORVA 1JWBB 3AFMA 1TGYA 4A27A 3H4TA 3HO6A 4RPLA 4EYKA 5BURA 3O8BA 3WA7A 3AL0C 3EXIA 4F9FA 3HHEA 5BT8A 2AJBA 1AHHA 3ECSA 5KDLA 4ZCRA 2CB9A 3EF0A 4TZ6A 1DJNA 2B78A 3DMPA 4TM8A 3VO2A 1AX9A 2H2WA 4FE4A 2QW1A 1GTG1 3E22B 2IBMA 2CDBA 3E5MA 4OJQA 1U7UA 3IEVA 2IF0A 1JR6A 1P1BA 3QVGA 3E9RA 1IG3A 3P19A 3DLAA 5CUQA 3TEFA 4JJZA 3GCGA 4I5EA 4YEDA 4XVCA 1YB5A 1DDGA 4CMAA 1Z13A 1Z0AA 2A1IA 2ZTVA 2JLBA 5A5GA 4B3MB 2H1OA 3EDYA 2RAPA 3GEDA 2IE8A 1GFWA 2ARKA 2W6IA 3BWBA 4GPIB 5E3HA 4DEXA 3R3VA 3LKVA 4L8LA 4LDJA 4PG7A 3HS3A 3SC2A 2XB4A 3K71B 2BFEA 5IJZA 2G88A 3MWDA 4PE5B 4JQZA 1K7EB 5IK2A 4GPAA 5ALRA 4D1YA 1PZNA 4O4HB 4GYYA 1B0UA 4TL6A 1L5QA 2WP8J 5DWDA 5C52B 1Y4AE 2FPPA 3M83A 3AKEA 1M72A 4ZCLA 4DABA 3A7DA 3PHGA 5DXAA 3WMWA 4KRFA 2ZR9A 4MR7B 3BMQB 4HFRA 4LX0A 1G8AA 1UP6A 1R5OA 5A0VA 2PQMA 3BA6A 3GDHA 3O8LA 1QO7A 3GFPA 5CHEA 5CT6A 3FB1A 5CFQA 2ZE5A 5IWCA 3MM4A 4QPNA 5HCNA 4MV3A 1H0HA 3LPAA 2ECPA 4GKJB 4IIHA 2WNSA 2FDCA 1U0SY 4FZ3A 3PGMA 4TTIA 5JSHA 1LLFA 1W85A 4CUZA 1SHKA 2J30A 3JVUA 4LI0A 3KZMA 4MRVA 3INYA 1PZFA 4HWRA 1C1YA 1QGOA 3HCDA 3NS7A 1O97D 4TWIA 2BELA 1MLDA 2FUKA 3MRVA 4DZTA 3PEYA 4RMIA 1FCJA 1QK5A 1Z6YA 3ZD6A 4CRWB 2XBUA 2I3BA 4OK6A 4U2DA 3DM9B 1WZ2A 3BRSA 1SRQA 3I64A 1OLSA 1LF0A 1RP1A 5IN5A 4EPVA 3I9FA 3QPCA 4ESHA 2F67A 3VUFA 4DLZA 5HIMA 1CUSA 4R9VA 3L4BC 4E70A 2QG4A 3C4JA 3AL3A 4WKOA 4ER3A 3BD8A 2Q0XA 4Q12A 3T34A 4LZWA 4A6EA 1NJ8A 5BT9A 1CYEA 1RCFA 3ELUA 1WL8A 3Q6MA 1B6RA 3AKZA 2Y0CA 5K05A 1JSLA 2OQVA 5J23A 2X7XA 1UR5A 1G21E 2VHCA 3BB4A 3LZDA 3NBYC 4IJQA 1T2FA 4J29A 4J9UE 5EIWA 4AZVA 4E5VA 1C7IA 4RMJA 3H7AA 4IAOA 4JIMA 1XNGA 3FKQA 1Q1NA 3N0WA 2A9FA 2ID9A 4AMYA 4EG0A 2FRXA 1O5OA 3STUA 5FA8A 1D5WA 1EDZA 2GK7A 3KT8A 3ADBA 2EKQA 5DWVA 4FZ5A 1BXKA 1J6UA 1GO2A 1KMNA 1T3TA 3L8EA 3V8VA 3W3AH 5CNMA 4DT1B 3AJDA 2BP7A 2OSBA 3FM9A 4BJ6A 1P7CA 4CKWB 5EJFA 4JFRA 4LSGA 1XXHE 1OPXA 3QY0A 3VR1A 4B3TB 4DA0A 4Y6SA 2RHTA 1HO3A 1XGKA 2JA2A 3HV0A 3K0HA 3OCYA 1G0OA 2RJ3A 5HS4A 5JOQA 1ND6A 5LXTB 3JYNA 1S89A 3HXTA 3L93A 5CXSA 2HF8A 4DQDA 2PU7A 5J4YA 4ER5A 4P08A 5A06A 4QU0A 1DHRA 2EZ9A 1TUIA 3KDPA 4ND5A 3OWHA 2WKPA 2O7SA 5IF9A 1K3TA 1P6XA 3H5NA 2AUTA 2CVHA 5HKAA 1S7CA 3U7HB 2VF5X 3NWOA 4YUYA 1U0TA 2OO5C 2Z09A 3TOZA 3PNSA 1WLSA 4KE9A 1HLFA 1XQWA 2GBPA 3C98A 2XUHA 3MWGA 3JZMA 4G84A 4YJFA 3LWNA 2OFFA 3TW8A 3V4RA 1XKXA 1Q21A 3BGIA 2J87A 3AGPA 2YW2A 3FSRA 5KWSA 1E6UA 3KELA 4MV0A 5JRDS 4TV9F 3VVMA 2M1XA 3EGDB 3HKEB 3GEGA 2EGHA 4X9XA 1Z4IA 3D8UA 1BSVA 5KNBH 4GT1A 2Y99A 2HGSA 2R7KA 3OX1A 2JF0A 5JNSA 2I3GA 3ITKA 3WGUA 2WFAA 2WWXA 4CU5A 3WGLA 2AGVA 4QDUA 3DE2X 4K9DA 3HK2A 4BNMA 3A70A 2QVBA 1Z38A 3H5IA 3MT0A 5FL7D 2GZMA 2XUGA 3KYJB 2R68A 4DLTA 4CEJB 4EABA 4E6PA 3HO1A 3GLGB 2B8WA 3KQOA 5EJIA 3DL4A 1YV9A 5ADUS 2BFFA 4Y6OA 3T6KA 4R8KA 4YP9A 5JCOA 2PUVA 3WIUA 1DBWA 1YQWA 3KR9A 4NAVA 5ILOA 5KTMA 1MABB 1JP7A 1TM2A 5EHXA 3DOJA 3E3LA 2HPHA 3ZKWA 2GAIA 4NK5A 2B98A 4FMBB 4BKQA 4Z8YA 1D09A 2FLVA 2IGBA 1RHQA 1LD3A 4F5DA 4YAUA 4FC6A 4YQYA 2X0EA 1KAQA 3RBVA 1Z2OX 1L1FA 4BP3A 1CLUA 1MO5A 1JILA 1OAOC 3T7EA 5GOTA 4IDFA 4XA8A 4KU4A 3VYTB 5HZMA 5JQGF 1T26A 2BONA 1VLJA 1HH4A 3PC4A 1L9XA 2Q5QA 5HP4A 4O2AB 5GJBA 3GBSA 3FLMA 1HKHA 5LYJB 1KAOA 5IJ9B 5LR6A 3VO8A 3JSXA 1VHTA 2Z04A 5DISB 1JNYA 1ZJJA 4FQ7A 4GE3A 4OBBA 4YJ3F 3VJRA 1OV4A 5HR5A 3EHEA 4ZANA 1KH2A 2FF5A 3DMHA 3WWEA 4BATA 1FJGB 1XZFA 3HJBA 3PC8C 3EODA 1TRHA 1NONA 3PXEA 2PUDA 4N3AA 2P5SA 2CWDA 5TMPA 5IM4F 1D5CA 1A9YA 3T61A 3LXUX 2FFHA 1LQUA 4A5OA 3Q1LA 5J2TA 4U5QA 2VXBA 5IBCA 3G0DA 3GLIB 4MRSA 1ACJA 1ITZA 5K0TA 1GQYA 3EZFA 3LUKA 5ARDA 3JVDA 2CK3D 2V5UA 1XWWA 3W7VA 2E82A 2WAMA 4GRDA 2H65A 2E4VA 4YV1A 9ATCA 4P54A 1QJCA 3FCCA 3ZDRA 4BX0A 3MSXA 1DTSA 3PR3A 3QXSA 4P35A 2AFIA 5TGZA 4B71A 3IB3A 3DW3X 4OREX 4BIMA 1UJ4A 3PYXA 5BV2P 2DWQA 5H4HA 4DLWA 1D2GA 2DUUA 3ZCXA 5JHHB 1XJCA 2JIMA 1E1NA 4QDXA 2QSJA 3MQFA 3OIVA 3QU7A 3TZEA 2HWWA 4D0RA 4R84A 4BZPA 2Q21A 3PNVA 4MW7A 3AUYA 1KI8A 1SHJA 3N6XA 3IDQA 5AXAA 3U4GA 3DVQX 2GETA 3P26A <