4KAXA

Crystal structure of the grp1 ph domain in complex with arf6-gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
163
structure length
163
Chain Sequence
GSMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/signaling protein
molecule keywords ADP-ribosylation factor 6
publication title Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2013-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kaxA00
3CF2A 4Q9LA 1E1QA 2ZE7A 4Q1AA 2GF9A 3KKOA 1E2GA 2OUKA 1VECA 1G8YA 5EZ6B 2R44A 3R7WA 2TMKA 2EVWX 3RC3A 3WMEA 4MKGA 1CU1A 3BB3A 3SFZA 2OAP1 4H1VA 4CT5A 1XP8A 2LCFA 4EDHA 3KUCA 3LVQE 3MD0A 3Q85A 621PA 4A82A 1E6CA 1YKSA 2EQBA 3X1YA 8OHMA 3VNUA 3DMNA 1B0UA 3QKUA 4PX9A 4B48A 5DYIA 1S1CA 1S0UA 2VHQA 3C8UA 5EE0A 5AR1A 1E1RA 1OLOA 2JASA 5B57C 3NVAA 2NQ2C 2BEJA 2AKAB 2QSZA 3FHCB 1Y3AA 5H1YA 5GJBA 1KO5A 3W8RA 1TL7C 1FX0B 1W47A 3B1VA 4OK3A 3RSLA 2J0UA 2B7CA 4V0LA 5IF9A 3QEJA 2HEIA 1G19A 1GITA 4XTCS 1E9RA 2QTFA 2ZYWX 3I5YA 5KO2A 4JL5A 4M22A 5FR2A 3LBNA 4L5BA 3AKDA 1T0JB 4E09A 3AGQA 4HZIA 1D2NA 1YZTA 2DBYA 1JXMA 2ZSBA 1KHTA 3EPLA 1D9XA 4URXR 4UNNA 4DLYA 3P20A 4W9MC 4DLVA 2GJAA 5BN5A 2YWEA 4G5RA 4US0R 3UG6A 4F91B 1EESA 1H8HD 2JJ2A 3ZJYA 2AR7A 1G9XA 3QPVA 4HUTA 3I62A 4LPKA 3BB4A 4AG5A 3AB3A 3K70C 2GHIA 1KI8A 1CJMA 2EFDB 2LWIA 4JL8A 2AWOA 2EWVA 3HJNA 3LY5A 2A30A 4OK6A 3K0FB 5GJVC 4LV8B 4M8NE 3PITA 4QGHA 4RZXA 1D2EA 4D81A 3U6BA 2WSSD 5FOVA 1XJ0A 4RZ3A 2UVQA 1EFRD 3VKHA 3TKLA 2ZETA 2FEMA 4LSGA 5BYKA 1VCNA 2WJVA 2QGZA 3ICQB 2HXSA 1NLYA 4NYMR 5J4LA 1G1MA 2QT1A 1YR9A 2G0NA 4A8JB 3GJ0A 1U98A 2P3SA 3TSZA 4KAXA 1Q12A 3HU1A 4LJ8A 5JFGA 1E0AA 3B85A 1JR3A 1XXHE 2QAGB 4JT2A 1N0UA 1OFUX 3LLUA 1IN5A 2V7QA 2J0QA 1LB1B 3NH6A 5C4MA 2QRNA 1L4UA 4E03A 1OXTA 2PBRA 1XX6A 1S9HA 1VIYA 1NIPA 1WXQA 2REOA 5CB8A 4JSYA 1HEIA 2YOHA 1U8ZA 3LA6A 3MWKA 1XPOA 1RYHA 2WPDA 3U3RA 4NYJR 4POAA 4OQNA 4HEJA 1WDTA 4ACAA 2CHQA 2CL0X 5AJXA 3LX8A 2G9NA 2GEVA 3VTKA 3IILA 3WRYC 1S3GA 2CNWD 4LC0A 3BRWD 3EWAA 4I1OA 4Z51A 1G8PA 1RKBA 3PUZA 3OHMA 1DAGA 1HT1E 1KZGB 4PHTA 3FHOA 3RWOA 4L4UA 3GQBA 5DI9A 2GCPA 1OKKA 1NJFA 3AGPA 2WJGA 3DEFA 4JLNA 4RJLA 3M6AA 1CR2A 4W5JA 2KE5A 4LPSA 2GXQA 5TVKA 2E9SA 1ZM9A 5KSOA 1ZC4A 2XXAA 2IYWA 4DXAA 1KY2A 1R0WA 4B33A 1CXZA 4IXMA 5EQTA 1G8FA 2HDNB 4LK2A 1ELOA 1WE2A 1VCMA 1DG3A 2C96A 3B1YA 1SVMA 4PQFA 1VG1A 5FTNA 2QT0A 4LI0A 3D31A 3AVWA 4B3XA 4M4SA 1AKEA 1U0JA 4ESHA 5L3RA 2JLSA 3U3JA 1KO1A 3O47A 3IQWA 2PX3A 3VR4A 3JVUA 3NXSA 4KVAA 3FB4A 4I1VA 4RFSA 1HYQA 2ZJOA 1OXVA 2ZS9A 1L8QA 2QA5A 4KHZA 1AGRA 1ZVQA 4Q1BA 5CM9C 3KJIA 1W5SA 3GLHE 2BM0A 1IHUA 3DO6A 5FUYA 1BMFD 3C7KA 3EWSA 1XCPA 2EFGA 2QROA 4RY2A 4XJXA 1N0VC 4NCNA 3B9PA 3T34A 4BLQA 3EPHA 4TMVA 3QKRA 2WM9B 2XEXA 2RKOA 2HUPA 1QHXA 2YWGA 5J4YA 4M1MA 3A1TA 1XTRA 1JQJC 4PHHA 1Z0DA 1GILA 1QG4A 4DUGA 2QL6A 1DE0A 3AF4A 4OKSA 3AP2A 5C4GB 4WW0A 2F6RA 3K9NA 1KIMA 4DLSA 4YLGA 821PA 2J0VA 5D3MB 1KSJA 1RE0A 4ZKDA 2HT6A 3RABA 4US2R 2XTZA 4RD0A 1ZC3A 2FV8A 4TLCA 1IXSB 2XZPA 4PSVA 2GILA 4CZ2A 1SZPA 2NO9A 1UFQA 3CRW1 5AJWA 3PFIA 2ZUDA 2OCYC 2O5VA 1KAGA 3K9HA 5TARA 4B6EA 2W58A 2FG5A 2DY1A 3DPUA 1E0KA 1GRNA 4H9GA 1P9RA 2DFLA 4QNMA 3I73A 2WOOA 2OSBA 2VSFA 4QJ5A 4Q5IA 2Q21A 1FL9A 3CLVA 1NVVQ 1E2NA 2FDCA 1NMYA 1VYTA 3ASYA 1UADA 1S4QA 1XJCA 4O2LA 2VSOA 4PC2A 1C1YA 4ZCIA 4Z1MD 3S1AB 2X77A 2JLRA 2PT7A 2VH5R 2FGJA 3K70B 4HAYA 1NVWQ 3ECCA 1E2IA 2BCJQ 1G291 4JVSB 2ZRHA 1G41A 2N42A 1G7SA 3W6OA 2G0TA 4E22A 5DGXA 1P60A 1F5NA 2R6CA 4WZ6A 4QL3A 4BZXA 1WQ1R 2D7CA 4DEYA 1AJEA 2KBFA 1P9NA 5CJ2A 1XU4A 5HKKA 3O8CA 4W5HA 1XPRA 4NKRA 2IYUA 3VAAA 4OQXA 4N0EA 4Q00A 3GFPA 4KYUA 2F55A 2QMEA 4JKYA 5DE3A 5FI0B 1X8JA 2J46A 3BH0A 4MDFA 4C9BA 1KZ7B 2DCUA 1R8SA 4AWXA 1Z3IX 3I8SA 4J0QA 1OXUA 1ZAKA 3GLHB 2ZJ8A 1VYVA 2ZITA 1TEVA 5CYPA 1NG9A 4V03A 4M9XA 2G1KA 1OFIA 1IN4A 3QXHA 4B71A 4PZZA 2B7BA 4QHTA 4BRUA 3CH5A 1MO5A 2QP3A 3U7EB 1IN6A 1GDDA 1XDBA 4TLDA 4EIWA 2WJHA 4LX0A 4Q48A 5JJLA 1VTKA 1P61B 3FMPB 1G3IA 3LD9A 3PEWA 1T5LA 3Q9LA 3NKVA 1D5CA 3FVQA 1M1YE 4PSKA 5HR5A 2J5XA 4R9UC 4Q4AA 3CPJB 4KFSA 4TMTA 1S96A 2GCNA 3RS4A 3TW8B 2K5UA 2XSZA 1L4YA 1Z0KA 4HLDA 1G64A 1GM5A 1KK1A 3MRSA 2CEAA 4IDQA 4N0DA 1Z47A 5KU1A 1IN8A 1W2GA 2LKCA 3OIVA 4F7WA 2FPKA 4TL9A 1D8TA 221PA 2V1UA 4I1SA 3I3SR 4QJ3A 3R9XA 3G5UA 2WAYA 1GRRA 3DMDA 5FOXA 3KTAA 2OXRA 1U0LA 1LTQA 1OH8A 4G5QA 4MKIA 2OLKA 2OAQ1 3IHLA 4BFVA 3PIRA 3B82A 3BFVA 1GAJA 1MABA 2FSFA 3AQ4A 1R5NA 3BFXA 1YRBA 1CR1A 4IEIA 2VLIA 5FOTA 4DCNA 2PMKA 1IONA 2WICA 4JLBA 4P31A 1GL7A 3KQHA 2WMOB 3X1DA 2EFCB 4GT1A 3TK1A 3HDTA 5JRJA 3W6PA 3W6NA 5EE1A 3C16C 3WXMA 5JJKA 1P2TA 3MWJA 3C41J 4MKHA 1T3LA 5JI3E 2O0HA 3A8TA 1EX6A 1AA9A 3CW2A 3B8HA 3DVLA 4PO9A 2IUSA 3RAPR 1T9HA 4ACBA 4NYIR 3IIMA 2ANCA 3SDZA 1Q57A 3L8ZA 3K70D 2BMEA 2BHRA 2RMKA 5F9FA 2G3YA 2V4ZA 2OFOA 3L0IB 1E2JA 3E2IA 4PPFA 4UKDA 4ZCMA 2JLWA 4JLDA 4OI1A 1CIPA 1W44A 2NPFA 5AUNB 4PXAA 1NSTA 1CF4A 4D2IA 2Q3FA 5KNDA 3WYFA 2I1VB 5FL7D 2OLJA 5G53C 3GFTA 1Z07A 3LBIA 3B13B 4UXIA 1OH7A 3SJAA 1BH2A 2OM2A 4B2IA 2A5GA 2KI5A 1ZIPA 2FEOA 2ZUBA 3NIBA 4DDWA 1G4UR 2A9KA 1OT3A 1QVRA 3GD7A 3MSXA 2ZE6A 4XWOA 1Q3HA 2ZI9A 1UJ2A 1NP6A 4YXWA 4KJZA 4HLUA 5EUMA 1KTVA 1Q3TA 1SKQA 2VHCA 4UNPA 2ZRNA 4EKDA 3EC2A 1EFUA 1P3JA 1HQCA 5TB5A 3RYTC 4ASUD 2V6JA 721PA 5JBQA 2ZI4A 5H68A 2VP2A 2BKUA 4OHZA 3BH6A 1JJVA 2VTKA 2A5YB 1TADA 5GADl 4M9QA 3CZPA 1ZUIA 2QQEA 4B73A 3CF6R 3MJHA 1CP2A 1SVIA 1E9AA 1CBUA 2CVFA 1QZXA 4D80A 5L3VA 1HUQA 1OYWA 2ODBA 5LB2A 3PG5A 5L3SB 5IHPA 3ONWA 1DAEA 4YQFA 1NMXA 2H7VA 4K46A 4KODA 2QI9C 1E2DA 4OHVA 1FMJA 4HAUA 2WVJA 1U94A 1XBTA 2VO1A 4M1KA 4Q47A 2XJ4A 4TSFA 4ZKEA 1CRPA 2O8EA 1CR0A 3TUJC 1Z2CA 4A2QA 3UK6A 3Q8XB 1U9IA 3VR3A 1FZQA 5P21A 5CDFE 2F7SA 3PUYA 2FWRA 3UKDA 3K0EA 4LV6A 1Q1QA 4AKEA 4DSOA 2QNRA 4XH9B 3Q5DA 3LNCA 1F2UB 2ONKA 2ZSEA 4MA4A 1UDWA 2PMDA 3PQCA 4DLUA 1JECA 5EXSA 4TZ6A 4GMDA 1JEEA 4IVQA 1GFIA 4Q1DA 4WXPA 4QNRA 1SHZA 4PANA 4HDCA 3GJ6A 1OHHA 4NMMA 4X8LA 3IGFA 1JAHA 3BBPA 1C4OA 3O8RA 2CE7A 3ZYCA 4GOKA 1GOTA 2C98A 3U4QB 4RSGA 2GXUA 1XEXA 5JMTA 4CT4B 4AI6A 1GVNB 3RS3A 2NO6A 5JSZB 3AVTA 1P2SA 1B23P 4JS0A 2G6BA 3GLFA 5DI3A 3EASA 1Z0JA 3QXSA 2BBSA 5J4HA 3FFBA 3BFKA 4Q4HA 1S3SA 1K6MA 2FF7A 2OXCA 2ZRLA 4EPYA 4HAZA 3U44B 1QHYA 4JBWA 5LD2C 5HPYB 1ZU4A 5C1BA 1RZ3A 3O8DA 4ABYA 4C3ZA 1LF0A 4V0MA 1PJRA 4JJKA 3RRZA 5BN4A 3QOFA 2JLZA 2AL7A 1FNNA 1XRJA 4A1FA 2BKEA 4JT4A 1N6RA 1XTIA 3EW9A 2GK6A 1SVLA 2HXYA 2AD1A 2ZYUX 3C4JA 3EA0A 1U8AA 2HV8A 4WA7A 1OFTA 3FOZA 4JL6A 4P32A 4B74A 4QGFA 2P65A 1J8YF 4Q21A 3X1XA 1NY6A 4C7OB 1Q21A 4HYYA 1HA3A 1BKDR 1CJKC 1KNXA 1GL9B 3U61B 1X86B 4LC1A 1NKSA 2OT3B 4TTPA 2JCSA 2IEZA 2QUZA 1T8TA 5DYGA 1JPJA 2PCLA 3QF4A 4EUNA 3MWLA 5CK5A 1KDTA 4GOXA 3ZQ6A 1GIAA 1GTVA 3HU2A 2RGGA 2OHFA 4ZI3A 2VEDA 1XEWY 3MAAC 3X1WA 3ZIAD 2ORVA 4CEIB 1F3OA 2W6IA 5JRZA 1AS3A 1Z29A 3KQKA 4URYR 4TQ9A 4ZPXA 5DSZA 2WTUA 1QDEA 2FU5C 1W0JA 3K1JA 4L15A 2FNAA 2B8TA 2ANBA 4C0BA 3RS2A 2ZE5A 3TSWA 3WNBA 3WY9A 4HATA 2BEKA 3VKGA 2WOJA 3THWB 3QKSB 1XWIA 2WJJA 4Q4JA 1M74A 4B35A 4DLWA 3BOSA 1HE1C 4P33A 1OB2A 2GWHA 1J99A 3C5HA 1NBMA 3CNOA 3M0EA 4MRNA 4KYIB 1KI2A 1FUUA 1MOZA 1OB5A 2P67A 1UKZA 1DEKA 3A1SA 3DOEA 2IS4A 1DS6A 3FYHA 1PLKA 4Q1EA 2ZUCA 4IJMA 1QHHB 3WNDA 3TBKA 4ERNA 4PPNA 1UKEA 2WMNB 4JVNA 2GESA 2ODWA 1I2MA 4LRWA 5AUPB 1GKYA 2WJYA 3WNCA 1VCIA 3NTUA 5K8IA 5KSZA 1ZW6A 3FE2A 3SFVA 4LUCA 4BFXA 4TZ0A 1E79D 4EPXA 3I61A 1COWA 2AK3A 2C03A 2IXFA 2GVZC 2O8CA 3BE4A 3SQWA 2J7PA 4QHSA 4OHYA 1T0HB 3U7HB 1E96A 1E2QA 1XCGB 3CRQA 3RS7A 3TIFA 1AS2A 1HV8A 1FTSA 1EXMA 2CCGA 4EPWA 3CR8A 2DPXA 3H86A 2ECKA 4JKIA 3ZH9B 3NBFA 4JLVA 1KO8A 2CLSA 3K0SA 2QRZA 1KGDA 3NHAA 2HF8A 1W49A 4TLEA 3ZVNA 2A3RA 3BIFA 1AKYA 4PC1A 1V5WA 1J70A 4MDEA 3CRRA 4EFNA 2W2XA 3I92A 3LLMA 4NP6A 2B8WA 2GTPA 4I81A 2ZM5A 1PV4A 2WKQA 1ZINA 4KFTA 1EWRA 4BPBA 1W4BA 2PH1A 3H0KA 4TMWA 5SZIA 1JALA 2GBLA 4XVRA 4IOKA 3QVVA 3A1WA 2PLRA 2C78A 4Q03A 1OYYA 1N6LA 2VP0A 3QXJA 1VPLA 3B1WA 3PV0A 4EQ6B 1Z2AA 1P2VA 2H92A 4AIIA 1M7HA 4U00A 1WB9A 1EWQA 3THXA 3CNNA 2HT1A 4LHWA 1E2EA 3THYB 3WHLA 2QE7A 1PLJA 1Z0FA 1VKJA 2YYZA 3ZD7A 2YKGA 5LD2B 5B30A 2N1BA 2R65A 4BFWA 2JDIA 1II8A 2FPLA 3MFYA 3VX3A 2YINC 3M4YA 4Q9IA 2VIIA 2J45A 4JVLA 2KWIA 4L9SA 1E9CA 2H5EA 2EW1A 2QENA 3GLIE 2JATA 4HLUC 4IOLA 5FUWA 1F48A 1KJWA 3B60A 3LO5A 4D26A 3B1ZA 5H70A 2JJ1A 2R6GA 4Q9JA 1XMSA 4QGAA 4TT3D 5F3WB 2YVUA 1Z28A 1DAFA 3ND8A 1N6NA 1GL6A 3BERA 3LRPA 1XTJA 3AKYA 4B44A 1KK3A 2CK3A 4GOJA 4C0LA 4DKXA 1Z6XA 2Q0HA 2QMHA 1OW3B 1RFLA 5EP2A 4FI3C 1R10A 3GFOA 4Q18A 2C2HA 3Q72A 3GLGA 2KSQA 2J9RA 1MRSA 3JZMA 3N5CA 2DB3A 2OBMA 3LW8A 5TY0A 2L0XA 1OFHA 2Z4RA 3VR1A 1XD8A 1U9IC 3EZ9A 5EZ5A 3OE7D 4US1R 2PX0A 3W90A 1Q1ZA 2V6IA 3U2QA 3UPUA 2AK2A 4XD7A 4K81B 4W5WA 2ZRDA 1SXJA 3OFND 1TAGA 3QF7A 4IDHA 3VR6A 1VHTA 1KJYA 2OCBA 1MO6A 4JBYA 3CUEF 2I3BA 3CB4A 2JLUA 4DHEA 3DZDA 4CEJB 3ZGXA 4YMWA 4M1TA 4KO8A 1G3MA 2J0SA 1KSGA 1LW7A 1M2OB 1ZUHA 2MMCA 2G77B 2Q3HA 4P4SA 1T3SA 3GJ8A 4M9ZA 1GP2A 3QG5A 1AQYA 1SGWA 2BC9A 3NH9A 5E95A 1VDZA 4B3FX 4DT1A 3Q7QA 2VPPA 2PCJA 4LJ6A 3OEEA 2VP4A 5A5GA 3PEUA 3C15C 1WP9A 4OI2A 2FSIA 3PENA 2O0KA 2H57A 3IEUA 4C0QC 3BH7A 3IO3A 2FE4A 3OIYA 5HCNA 4OQFA 4GDFA 3GJXC 1Z63A 1IJEA 1N5LA 4LV5B 1DVRA 1YHNA 2FFBA 2EYUA 3P1JA 2A7QA 2OBNA 4WVFA 1LVGA 2W6JD 3GLIB 3WP1B 3EARA 3K0AA 2BJVA 4MUAA 3KTAB 4MUBA 1MV5A 1F2TA 4II7A 2ZRFA 4JJZA 2P6NA 3GMTA 2WAXA 3EPKA 1KK2A 1KMHA 4XOIA 1O87A 2XOKD 1G7RA 3C14C 4MRVA 1GNPA 1DELA 2QPOA 4HAXA 5EXPA 4QOSA 1G5TA 2HCJB 2QEQA 1IXRC 2PZGA 4NYIQ 1G6HA 1XD2A 4G0NA 4ZIRA 2JLQA 4AURA 2XX3A 3R8FA 2ERYA 4YMUA 2GCOA 1TX4B 1UKVY 1GUAA 5IK2D 4HUQA 4D82A 4NE2A 4DJTA 3MG9A 4MGKR 3X2SA 4B76A 4YONB 2WWXA 4PAMA 4URZR 1Z0IA 3SYKA 2UZ3A 1JAIA 4EJSA 4GBMA 4JYBA 1H8HA 5FBVB 1KKMA 4RD4A 3KXIA 1C9KA 4BUJA 1TF2A 3CF0A 1OIWA 4YMVA 5HKKD 1H65A 4O25A 2WBLC 4KBGA 4CEHB 3AUYA 1SHKA 4ARZA 1F6BA 5KDLA 4CRWB 1G7TA 3KJGA 2F1RA 1VYUA 2WSSA 3AVPA 3SNHA 2PJRA 2JIZD 3D3QA 3VU9A 3LFUA 1RJ9B 1R6BX 2FFQA 3B7GA 3L8YA 5JS8A 2W2VA 1E9BA 2V54A 3IUYA 1TQ4A 3BORA 2YJTD 1VHLA 1G17A 2WV9A 4EPTA 2Z5FA 1FFHA 4M53A 4B6FA 4DSTA 3KQUA 4LWZA 5DLQC 4GP7A 1E9FA 4B34A 4AYWA 1OSNA 4TYYA 2ZRMA 1N6OA 1R0YA 2XJ9A 3AVVA 3W3ZB 2OCAA 3EZ6A 2WWFA 3A1VA 1DG1G 4ZV4A 1XFAA 5FPKA 2QBYB 1A4RA 1Q1BA 4LYAA 2XNDD 1ZD1A 2JLXA 3F3YA 2OV2A 1P73A 1US8A 2HJVA 1U2RA 2ZSAA 4C4PA 5GVSA 2F43A 5C2JB 4TYNA 1LFDB 5B2ZA 4DLTA 1TUIA 3SI7A 2WIBA 1PZNA 4EAQA 2CNWA 3ZDQA 5L3QA 3CH4B 2ATVA 3VR5A 4QFMA 3O8BA 5KUTA 1W4CA 1EFCA 1JI0A 1XEWX 2KB0A 3CX8A 2GDJA 5JEEA 4YMSA 4BLOA 5SZHB 1YE8A 5E7JA 2BBOA 2BIFA 5DNYB 4NH0A 4TLBA 1MRNA 3HYTA 2VRWA 3TMKA 5KHOC 1E99A 3D6TB 1JR6A 3CIOA 2PEZA 3AP3A 1YR6A 3GEHA 4Q4LA 1Z6AA 2HF9A 3RRYA 3SHWA 3BK7A 4B3CA 1DO2A 3T1VA 3ZVLA 2G88A 2O8DB 3A1UA 5DN6D 3EZFA 3RHFA 1OH5A 4FD2A 4A15A 1XNJA 1KK0A 2IW3A 5DISB 5BN3A 2GZAA 1G7CA 4IW3B 1U99A 1CJTC 3GCGA 4AKIA 3IBGA 1QG2A 2F1IA 3LX5A 4G5OA 1PUIA 1A2KC 3PUWA 4LBZA 2GBLC 3IEVA 1FX0A 2F9LA 2Q9AA 3UG7A 4D4MA 4QM7A 5JWHA 1LV7A 3DM9B 3ZVMA 1ZNXA 5AK0A 2KJQA 5HZHA 4PFSA 1MKYA 2RGDA 4NL4H 4TQUS 3RLFA 3LDAA 1I4LD 2C04A 4G3XA 4GP6A 1BMFA 5KDDA 2R6FA 5G40A 3AP1A 4LJ5A 5FI1B 2ZE8A 4F4CA 1E4YA 1XZQA 2R6DA 3FMFA 4BFTA 3A4NA 2P6UA 2QU8A 2H8KA 5FUXA 4YMTA 5IRCD 2C8VA 1TEXA 3L2OB 4FMDF 3SJCA 2RAPA 2YC2C 4PQYA 3QNUA 4CW7A 3NEYA 4D0LB 2IT1A 1G5RA 3DHWC 3KFXA 4OHXA 1IY0A 1UF9A 3QG1A 3TE6A 4TWZA 3N70A 5TV2A 3RWMB 3K0FA 4V0KA 2QY9A 4V0NA 1HT2E 2C9CA 4GZMA 3W34A 1OV4A 2O8FB 3VQTA 4A6XA 1W36C 1GNQA 5AJYA 2F9MA 2AN9A 4E07A 4PAOA 4PPGA 4DLRA 1RVDA 3VFDA 3NBZC 2D2FA 4A8JA 2VBCA 4HZUB 4Z8XA 2O8BB 5EXTA 1NG1A 4IDNA 3T06B 2QAGA 3SE0A 5DIFA 3ICEA 4URWR 2QGNA 4LOAA 3ZZUA 1N25A 1XJQA 1KO7A 4AYXA 5JCPA 3HPRA 4M1YA 1T91A 3OAAD 1E4VA 3ND9A 1NSFA 5GVRA 1HH4A 2RGAA 2IYXA 4Z1MA 3B9QA 5JHHB 1OH6A 3TQCA 1E2LA 1IJFA 1I2DA 1AM4D 1PUJA 2XITA 2NG1A 3CONA 2CCKA 3KL4A 1CLUA 2RGCA 3K9LA 3B2EA 4B3BA 3PUXA 3H4MA 2ZJYA 3QXXA 3W3AA 4Q7MB 5M04A 5TMPA 1SXJC 2RHMA 4HSEA 2A78A 4LY6A 4KSBA 1E2MA 4OI0A 2Q3MA 2IS2A 1G6OA 3QSYA 3H84A 5E3HA 3HR8A 121PA 1NVXQ 1NN3A 2FFHA 4AY2A 1XPUA 3KKPA 3WBKA 1BOFA 1MH1A 3NBXX 3SJZA 3J81k 1XMVA 2ZR0A 5CLLA 4BFSA 3MGCA 4FW9A 3OEHD 4DSNA 4HB3A 5AWFC 3TGPA 1VCOA 3I1FA 2ZANA 4M1OA 4XTRA 1OHHD 2ZI6A 2Z0MA 1KI6B 4LDJA 2J87A 3PXGA 1W2HA 4FWIB 4Q19A 3RVBA 3LW7A 1E32A 1MR3F 1XMIA 3KJEA 1OIVA 2DWOA 5E7MA 2H1LA 3K9GA 4ZDIA 3AVXA 2FZ4A 3RS0A 2NZ8A 3QQ5A 4U5XA 1ESNA 1XZPA 1W46A 3KDSE 1ZM4A 4BEBA 2AX4A 3ZZTA 4QJ4A 3NHBA 4TL8A 4IOMA 1BIFA 4BE7B 1NN1A 2SHKA 2GJKA 1R5OA 3EIHA 5J47A 2B21A 2IYSA 2R8RA 3TRFA 4MGZR 4TTRA 2NZJA 2BJWA 4A0HA 4PHGA 4B47A 1ZYUA 4PTLA 2CLCX 2DFKB 1DAHA 4TYPA 1E9SA 1K8RA 4XSHA 2VP9A 5KDOA 5CM8B 1JB1A 4AK9A 2OG2A 1GNRA 2G1JA 3I8XA 5E7IA 1XXHA 4HLQB 1A1VA 1W48A 2PJZA 1W0KD 2VHUA 2PLFA 4G1UC 2ZAMA 3EG5A 3TLXA 3CX7A 2NMVA 1NIJA 1L7VC 2CJWB 1TQ2A 3R9IA 6Q21A 4GL2A 3U3MA 3OF5A 1U0HC 2I4IA 5EP1A 5DO9A 1UDXA 1JR3E 4CIDA 1XMJA 3WMGA 4EJSC 4DDVA 4DZZA 3Q7PA 3B78A 3A4MA 421PA 4JMPA 5EP3A 4QBHA 5KYKA 4NTZA 4TYWA 2H16A 3CM0A 4JLOA 4Q7JB 1KI4A 4Y0AA 3LWNA 2IUUA 3R7WB 5JLJA 1JQLB 2YWFA 1TU3A 3CNLA 2IWRA 2NO0A 3S1AA 3T1QA 4YDSA 1TUEA 1RRPA 3OESA 4EFMA 1SVKA 2IYLD 4R98A 5ELXA 1K5DA 2RGNA 3IHWA 5EE5B 4MRSA 1NN0A 5FFMA 4A92A 1W0JD 2ZPTX 3A58B 1G4AE 3HR7A 521PA 1ZCAA 1D6JA 1RW4A 1UBFA 4IVRA 2PZFA 4MITA 1JNYA 5FL7A 1H8ED 3FFAA 2OEPA 4JYCA 3BAFA 4LYFA 4PC6A 3UIEA 3QXCA 3SQXA 2ZI3A 2EU8A 1RRFA 1R4AA 1NJGA 1E9EA 3GJ5A 1II9A 3MWYW 4MGIR 3CWQA 4IHQA 4A0GA 1ZUNB 3AKCA 2DR3A 3EZ2A 4B43A 2J0UB 4MGYR 4B3GA 2CHGA 3DZ8A 4PZYA 5A0FA 2A5DA 1OIXA 2D74A 4HAVA 1HQYE 1AN0A 3CX6A 5J4KA 2C77A 3GLHA 4D4JA 1UBEA 1XB2A 1UM8A 2IC5A 3LVRE 2Q9CA 5K8TA 1R0ZA 3FGNA 1ODFA 2ZRBA 4FMCB 3FKQA 1YZGA 4P4TA 5FBLB 5FOSA 2A5FA 4FMCF 4C0KA 4H1UA 4QXAA 4NCIA 4UJ3A 4DVGA 3TSOA 2ZREA 2Z6VA 2CL7X 3B1XA 4N3NA 3TAHA 4F38A 3SYLA 3NG1A 5K8UA 2RGBA 1QBKC 5HE8A 4TLAA 1YQTA 3KB2A 3QIAA 1X3SA 2BBWA 1UEJA 1VIAA 1UEIA 1TU4A 4RKEA 2IYTA 1ZM2A 1NNEA 1CRQA 1ZM3A 5EP4A 1UAAA 1Z08A 1M6NA 4FMBB 1XD9A 4TQAA 4ZDKA 3E5HA 3F0TA 4MYHA 4BFYA 2BMFA 2Z4SA 3G82C 5KSYA 1ETUA 2AKYA 4AYTA 1J90A 4Q9HA 2NIPA 4BQSA 4WOPA 5SZJA 4Y0VA 5DH9A 5DHAA 3MJRA 1E2FA 4NZYA 3ADDA 2IXEA 2VQSA 2JA1A 2JGNA 5GJWC 5HZKA 4QKQA 1Q20A 2R9VA 1U8YA 5BXQC 3K53A 4DCVA 1E98A 1CEEA 2Z43A 3QKTA 1DAMA 2WSMA 3UMFA 4LGMA 4DBLC 2X1VA 1E1QD 1Q22A 4XVQA 4B2LA 2CBZA 5KOYA 5B64A 1A5TA 2OE2A 5AJZA 2QE7D 3K09A 2NTYC 3WYAA 2ZS7A 4KU4A 4PHFA 2QM8A 2GXAA 2ZJZA 1A82A 1N5IA 5BW8A 2JDID 3AF0A 1WF3A 4HB0A 4OBEA 2XXAB 1XF9A 5HTKA 4C0SA 1YZQA 1ESMA 1P5ZB 4HLCA 4LJAA 4BECA 4L16A 1L2TA 1A7JA 4FCVA 4LBVA 4A8JC 1II0A 2D2EA 3LQQA 2ORIA 4MQBA 2REXB 2BM1A 2XNSA 2XZOA 4S35A 1E1RD 2GETA 4UXJA 4LYHA 1Q44A 5F98A 4GI7A 4V02A 3UWKA 4RFSB 1A2BA 1TF7A 5BWMA 3AV0B 1UKYA 2D7DA 3KQLA 4XWAA 2R62A 3CPHA 1IXZA 1RC8A 3T5DA 1KI9A 4NDZA 5CK4A 2QMOA 3T5GA 1P62B 2ZQ5A 4KV9A 2JLYA 1KMQA 3PR1A 1NN5A 1VG8A 3QKRB 4JIMA 1P72A 4M0LA 2DHRA 3WHKA 2JJ2D 2JEOA 3QBVA 4BFUA 3PEVA 5JEDA 2JLVA 2Z83A 1EG7A 1DBSA 3PJRA 2J3EA 4DRZA 4CVNA 2EYQA 2IUTA 5C46F 4DC9A 3EIQA 5AJVB 2GK7A 3FPAA 4IKEA 3TJZA 3TW4A 2BMJA 4F4IA 2C9OA 2HLDA 3NDPA 4P0TA 3BWDD 1W4RA 1G16A 3ZIAA 2W0MA 4NONA 3MLEA 1X6VA 2FSHA 4KSCA 1BO6A 4WZBE 4RZ2A 4X8OA 1XTQA 4AC9A 5L3SA 1QHGA 1R0XA 5EJEA 2FJUA 5CITA 4HI0E 4F93B 3SN6A 2FMXA 1DOAA 4QBFA 2GNOA 3QVUA 3E70C 3QJYA 3M1IA 1JR3D 4ITRC 4KFRA 2V7QD 4Q02A 3H2YA 5CIQA 3TAUA 3V4FA 4BZQA 2E87A 3N2EA 3R8CA 4UJ5A 2FZLA 5KSPA 1ZJ6A 2QTVB 2Q9BA 4TMXA 1F2UA 1GKIA 3A36A 4DWJA 3KX2A 2WPDD 4UQOA 1EFHA 4TN1A 2BDTA 1ONBA 3RRNA 2VYFA 3U3KA 1KYIA 4BRWA 1FQKA 2X2EA 3H1TA 1O3YA 1Z6YA 2DYKA 4G5SA 1ZNWA 2E1RA 4L9WA 3UATA 2ZVQX 4A9AA 3FKSA 3BGWA 3P4XA 2D62A 2VP5A 2OILA 1E2HA 3CWZA 1OKKD 3VR2A 3U4QA 1N0WA 1R2QA 1E79A 4AG6A 3I72A 2ZVPX 3TUZC 3TVTA 1WRBA 1Z6TA 3L43A 5JSZA 5JZVA 3SC3A 3RRMA 3T1TA 2GVDC 1KI1A 4UNQA 3TH5A 2GZDA 1KJZA 2YWHA 3IQXA 1S1MA 2P6RA 1X1SA 1DADA 4ZDWA 1WBDA 1N6HA 1QVAA 3KKMA 3U44A 4NCJA 4PZLA 3W5JA 3ZS9A 4MRPA 1TF5A 3AEZA 1SVOA 1VMAA 5FTKA 5ANRB 4AD8A 1HTWA 4DLZA 1KI3A 3AF1A 4MYUA 4EPVA 1CKEA 1UBGA 1SVSA 4DEXA 1HE8B 3LAWA 4Q7LA 4RKFA 3SEAA 2YV5A 4X8MA 1G3QA 2LKDA 2RGEA 1KI7A 1W4AA 4JBXA 3EC1A 4KCGA 5FTMA 3SHFA 1NMZA 2XB2A 2QP4A 4LHXA 4LBYA 2EFHB 2FFAA 2QORA 2RB4A 4C7OA 3HYRA 4HB4A 2GEUA 2RGNC 2UKDA 3ADKA 4O3MA 3HWSA 4Q4AB 2ZU6A 3FTQA 3QI2A 1U81A 3HPQA 5FPTA 5L8VA 1IN7A 4ESVA 4HDOB 1DPFA 1TQDA 3QBTA 1BS1A 3MCAA 1G3RA 4DUGD 2QPTA 1FTNA 2IEYA 2QAJA 3KKNA 5TXGA 4M21A 3I5XA 1QF9A 1VG0B 4JLMA 2X8AA 1M7BA 5KPJA 4TL7A 4B2PA 1JBKA 3KKQA 4RD6A 2DFNA 2A5JA 3GJ7A 5FPSA 4CGZA 1P2UA 3SJBA 1U90A 2BBTA 5CDFA 2FA9A 4CEIA 2FGKA 1G21E 4PSAA 1NKTA 3DKVA 1RRCA 2WWYA 1AQUA 1KNQA 2Y8EA 4Q1CA 4GMXA 3ZQJA 4D25A 4FCWA 3UXMA 2V9PA 4JLJA 5KNCA 2ZXUA 4IDOA 1GZSA 5J5CA 4IXNA 4F4JA 4OQMA 2GAOA 1GG2A 3SYNA 1MABB 3VHXA 3SU8A 5FBRB 1E3MA 5AUOB 4U7DA 4D4LA 4NPHA 3SBDA 4TT3A 1JJ7A 3CRMA 2VSXA 1T6NA 5FL3A 4JLPA 3THWA 3QKSA 5H8WA 3GJ3A 3T1OA 1Z0AA 3F8TA 4B32A 1KDPA 4TL6A 3UWOA 1S2MA 1S8FA 2IK8A 2AHOA 2BV3A 3W9YA 4O2RA 2GKSA 2ZRJA 3EAQA 3L0OA 4WAUA 4BLTA 2AFIE 5FBWB 1SKYE 1N3BA 1QHHA 4AKGA 4RCYA 2WKRA 5FTLA 2QTHA 2RH5A 2YOGA 2ZAOA 3LV8A 1AK2A 1AZSC 4MKFA 5FPHA 1R5BA 2ZJ5A 1NF3A 4QHYA 4NCKA 4V0OA 4R71A 3U5ZB 3OE7A 1W1WA 3TNFA 1PVOA 1BYUA 1GRQA 3KUDA 1X8LA 3PEYA 3WYGA 5EE9A 3K8YA 3GLFE 3RC8A 1KKLA 1Q1EA 2D06A 4BZPA 3WBJA 5K8LA 3OFNA 3CO5A 3TVDA 2XAUA 1G5PA 1D2MA 3K0CA 4LBWA 1EFRA 5UKDA 1P7CA 4B3DA 5CJPA 3AM1A 4A6PA 2WJIA 4V0ME 2ZEJA 4KVGA 1FPMA 1FQJA 1EFTA 4TMKA 4G5GA 1Z5ZA 3K09C 4C0AC 4KLZA 4FIDA 1MO4A 5GJCA 1ZD8A 5JJIA 1I4DD 4NBSA 2H17A 4ZDJA 2D3WA 2GJSA 4ZI2A 2ZTSA 3TQFA 4R2HA 1X8KA 1FP7A 3LXRA 4L8GA 4KBFA 3IIKA 3ZZ0A 5D3QA 4C2UA 3TR5A 3BD9A 4ILEA 3VMFA 1XEFA 2ZR9A 1XXHB 3B6EA 3CR7A 2ZSFA 3THOA 4IDPA 2QN6A 3IIJA 1SULA 2WWHA 2W6JA 2XSZD 4EQ6A 3RNLA 3NBYC 3G0HA 4RD3A 3THYA 2O8EB 2AXNA 2ASEA 1E2PA 3CZQA 1AGPA 4DB2A 2OZEA 4DCTA 3QE0A 2XOKA 3A37A 1AIPA 2BVNA 4MH0R 2FN4A 2EWWA 4EPRA 1DAIA 4MRRA 4BWYA 2QZ4A 1IOZA 2W83A 2WWGA 2YZ2A 1SVWA 4GRAA 2ZJBA 4PR0A 3AVYA 1V43A 4DCUA 4EFLA 3TR0A 2ZI5A 2ZRIA 3AF2A 2OCPA 1TTTA 4O0MA 4DB4A 2FX3A 2V1XA 1NVUQ 1SKYB 2J59A 5IK2A 2ZSDA 1N2CE 2AWNA 1NL3A 5LB4A 1LY1A 2QMUA 1NBME 3QENA 3HU3A 2CLDX 2C99A 4RZUA 3ZLJA 1CJUC 1J2JA 1XEXB 3LXXA 4JLKA 5DHFA 3IPYA 1ANKA 1KOFA 4NU0A 3FMIA 2GA8A 2AFHE 2WHXA 1NY5A 2GZHA 4Q01A 1J7KA 1E0SA 3Q3JB 5J40A 3GLFB 1YVDA 5DI3B 1Y63A 2ZYTX 4C30A 4Q4HB 4QG7A 3W5IA 2PZEA 4QRHA 3KFVA 2NOAA 4FMDB 5CLQA 2CCJA 4RVCA 2VL7A 3T35A 2JIZA 4UNRA 4G01B 4BGDA 1OPXA 5JWOA 4OHWA 4P4UA 2DWQA 1QHSA 4LZZA 4BFZA 5B58C 4NHOA 2D4HA 2NGRA 5KPDA 2PEYA 5F9HA 5FTJA 1T4GA 3AVUA 1T8UA 1XTSA 2J41A 2ZJAA 3NC0C 5FR1A 2IBMA 3OIUA 4OYHA 5JS7A 1M7GA 2OFXA 3KZ1E 4C0HA 1N6PA 2I1QA 2QG6A 4YXWD 4CEJA 2XTNA 2V8OA 1MO3A 1ZRHA 3OZXA 1OXSC 1NLFA 4DSUA 4FCTA 3DL0A 4URUR 2XNDA 4QBIA 3UANA 4LCBA 3X1ZA 1MT0A 2KBEA 2WWWA 1X1RA 4KLNA 5SZKB 1IY2A 1KSHA 2GXSA 1ZNZA 3GEEA 4ON9A 5TDHA 3DOFA 4YDHB 3QF4B 2DFTA 1ZCBA 2J7KA 3FMOB 4WZAE 3R20A 4Q9KA 3NDBB 3N2IA 2P2LA 1F60A 3PUVA 1JPNA 4LJ7A 3U7FB 1YZLA 2IS1A 3JZAA 4I99A 1WA5A 3AF3A 3LBHA 4WIAA 3SR0A 3V00A 1OE0A 2IHBA 1IQPA 4I1UA 3I4LA 4ZCLA 3SOPA 2H18A 2F3RA 4E5UA 3E1SA 1T3HA 2IL1A 5JI2E 3UMSA 1RIFA 3DM5A 3GLIA 2VF7A 3NEJA 1Q0UA 3P27A 1WMSA 2ODEA 4TSFD 1NRJB 1YR7A 4OJKA 5CIWA 2ZYVX 1LNZA 5KTYA 5DN6A 3QPUA 3IDQA 2IHYA 1P4SA 1Z06A 1YZNA 1P75A 4Q4JB 4A0RA 1KSFX 4DDTA 1M8PA 4LJ9A 1G8GA 3P26A 2P5SA 1N6KA 4C0JA 2ZJ2A 5F2EA 3ADCA 5LBIA 1KDOA 4MYCA 4D0NA 2C95A 4DLXA 2BOVA 1Z83A 4IFEA 4PC7A 1AS0A 4GNKA 3BJIC 1GSIA 1QRAA 2OO7A 2V55B 4IOJA 5LPNA 5EUQB 4HDQB 2GF0A 3WP0A 4BASA 1XCMA 2DWPA 3IO5A 1TQ6A 2W00A 3U6KA 4M9SA 1R7RA 4U02A 5HCIA 3T12A 2A2ZA 3DDCA 1FNMA 4BLPA 2O8CB 2F3TA 4MYTA 3FWYA 4M1WA 2OBLA 4F92B 2ZS8A 3QY0A 4N1AA 4KXFB 1OF1A 2C9YA 4FN5A 3A4LA 4YC7A 3CKLA 3SZRA 4CEHA 3GLGE 2CVHA 5G3YA 1GKUB 2O52A 2P5TB 2JAQA 1D9ZA 4X8HA 1KO4A 4URVR 1Z6GA 1FUKA 1DARA 1RJ9A 2AXPA 4LHZA 2ZRGA 1QHIA 1TPZA 2C5LA 4Z54A 4CYMA 3P32A 5C18A 3AVOA 5D3MA 4ZO4A 2ZROA 1ZMXA 1SXJE 2WKPA 3B5JA 4GSYA 2VHTA 1N5JA 4S2EA 2ZRAA 3D8BA 2CMKA 2RGXA 5CB6A 4K8OA 3AVQA 1J8MF 2J1LA 2IYRA 1E94E 2WZQA 1E0JA 3OAAA 3QUSA 2QBYA 1LS1A 2ZRKA 3REGA 3PVSA 4Q1FA 3VX4A 2P0EA 1ZP6A 5FPYA 4UXHA 2MSDB 3THXB 4HAWA 3KB1A 3REFA 3IBYA 4DDUA 1FOEB 2RCNA 2UZIR 4W7SA 4CDGA 3GEIA 1XTKA 1Z22A 3BC1A 4IEEA 1WBBA 2BWJA 3QPWA 4FINA 4JVMA 4M1SA 4PAQA 4HB2A 1II8B 2FSGA 2FOLA 1NVVR 2QM7A 2JJ8A 3K0CC 2W6ID 2ZU0C 4RD1A 5G41A 3WMFA 2W0SA 2AD5A 3BB1A 2ZRPA 3MUFA 2HYIC 3W8NA 3R9WA 1PLLA 3HP1A 1DO0A 5A4JA 1OJLA 4XWKA 2F1HA 2O8DA 4R2IA 1W36B 2IS6A 5G3ZA 4JSTA 3OEHA 2CHVA 5JCZA 4QM6A 4OK5A 2VA8A 2B92A 3ZS8A 3EIEA 1ZBDA 5FOUA 1NBMD 3ETLA 3BS4A 1FMLA 3AH8A 3VNVA 3LH5A 3V4RA 2ZR7A 5BYJA 1CS4C 2WIAA 4WXRA 1N6IA 1UPTA 2O0JA 3RS5A 1SQ5A 3EZ7A 2ERXA 3ASZA 1CULC 3ZD6A 2EFEB 2XTMA 3VHLB 5FBQB 4DIEA 5E4FA 4ASUA 4BLSA 3WRXC 3GLGB 2NO1A 4I4LA 1K5GA 4Q66C 4TMZA 2V3CC 1EK0A 1NLZA 3QEOA 3IKJA 3NC1C 4C2TA 2OFWA 2XGJA 1COWD 1IM2A 4FXPA 2IYYA 2J7PD 2PT5A 1R8QA 4GZLA 3EA5A 3PCRB 4PQRA 3SS8A 1ZIOA 3Q5EA 1E69A 2IF0A 2N46A 1CTQA 2GEDA 2FH5B 4JLAA 1SXJB 4A36A 3CBQA 1IAQA 2HYDA 2IYVA 3EXAA 5JWRA 1ZD9A 4BEJA 5FH9A 1TNDA 2B6HA 4XIGS 3EX7C 2OESA 1W0KA 2MSCB 1G8HA 2HJGA 1ZNYA 1ZM7A 2YC4C 3JVVA 2O8FA 2R6AA 4P4SB 3SBEA 5CYOA 4D0GA 2ZRCA 5HE9A 4LYJA 3UMRA 1UBCA 2IWHA 4DCSA 1KAOA 4DT1B 3P4YA 1LS6A 2CL6X 1CJVC 1S9DA 4HZUA 3L82B 4TTQA 2O8BA 1FW6A 1W7AA 1RRGA 4NYMQ 5EE3A 3DKPA 1LF5A 2HCBA 3L0PA 1JXOA 1YZKA 2VF8A 1YRAA 1RPZA 4XVUA 1WCV1 3FHTA 3CRVA 2RHDA 2ORWA 1P9WA 3RANA 2HLDD 4KITB 2IYQA 3T61A 4A0FA 2CDNA 4AKHA 3KXKA 2GAAA 3I32A 1EGAA 4R7ZA 3K0AB 3VKWA 4QC2A 2BMDA 2QPAA 4LHYA 4RCZA 1F2TB 5IDVA 4NYJQ 1TMKA 4OJQA 2BCGY 2GRJA 2IF2A 3GPLA 2YHSA 4RFVA 1G18A 1KMHB 3TUIC 1AZTA 4QGGA 4JZKA 3ZVRA 1NI3A 1YU9A 1H8EA 2MSEB 2CXXA 1E9DA 3KXLA 4OL0A 4XSGA 3F5FA 2XZLA 2WWIA 3U3OA 4PO8A 4D6PA 3U60B 5FUVA 1N5KA 5LDDC 1RYFA 1XD2B 3RSOA 4ZIRB 3GP8A 5BQ5A 4A4DA 4IVPA 1QHNA 2GCOB 2JJ1D 3D7MA 4IFBA 3FDIA 1W36D 1E2KA 2QAGC 5J4VA 2IX3A 4HUQB 4NCHA 2QSYA 3AKEA 5JECA 3KQNA 3RDPA 3KJHA 3NWJA 4IRUB 3V9PA 2R2AA 2ODNA 1ZU5A 1KI6A 2ATXA 3MMPA 3ADBA 1IBRA 2NO7A 2ZI7A 4EJSB 3U7GA 2CK3D 3FKSD 4KI0A 4UNSA 1OXXK 2QQ0A 4BLRA 3GJ4A 4GFDA 1HY3A 1M34E 5FOWA 4CF7A 2W2TA 4Z8YA 3OIWA 2VHJA 4PO1A 4WBSA 4KFUA 2IXGA 3EPJA 4ARZB 1KY3A 3LQRA 1DTSA 1EX7A 1I4TD 2NPIA 4LJYA 5JHGB 3IPXA 2G83A 4QBGB 4A2PA 1T5IA 1CR4A 3VU9B 1KDRA 4GPTA 5AUQA 3BXZA 2GJ8A 3CPEA 4D4KA 3A6PC 1IY1A 2GJ9A 4B75A 1HURA 1FP6A 2PL3A 4XD7D 1P6XA 2REBA 1SXJD 4PPQA 2XB4A 4LHVA 5IT5A 2FPMA 4M2LA 1G20E 4PC3A 2MMGA 1YJ5A 2X2FA 4RD2A 2YOFA 1W5TA 3AUXA 2ZIAA 1DAKA 2F1JA 2QP9X 1VG9B 3C5CA 4OI4A 1Z8FA 2CE2X 2VP6A 4OQLA 2ONJA 5KNBA 2IYZA 2CJWA 4P3YA 4FWTA 1BYIA 1YZUA 2YNMA 1US8B 4Q7KA 3L0SA 4LJ4A 1JEDA 4A2WA 2IA5A 2F43B 5EXXA 1G3UA 3T15A 3OEED 4DIDA 2Q6TA 1YR8A 2X19A 1GWNA 4TYQA 5L3QB
chains in the Genus database with same CATH superfamily
3V1MA 1EK6A 4LZWA 4DC0A 1G59A 5I9TA 4YYEA 4Q1AA 2GF9A 1NR7A 2AUTA 3ED1A 1E2GA 1GADO 1JGTA 3LUJA 2ZXFA 4QOEA 2P9ZA 2VK4A 4XPIB 2RIPA 3KEFA 3WO1A 3I8OA 5EZ6B 4DJ5X 1XMQB 2QMYA 3LL7A 1EHIA 4MKGA 1CU1A 3BMQB 3BB3A 1ID8A 2ZKLA 1UDAA 2YHIA 3R5HA 2Q50A 1T5OA 3TZKA 2PKRA 1PHPA 3MD0A 2OOSA 4A82A 1YONA 1SD5A 1E6CA 1USKA 5C7YA 4LDQA 4PYIA 1T9AA 2NVBA 2QAIA 3HCFA 3UOWA 2YTZA 4E12A 2AXQA 4NULA 8OHMA 3DMNA 1YQUA 2ZT7A 1GAQA 1PJAA 1QYDA 2DTXA 3KZKA 3ZWMA 4CXMA 2XMRA 3IS3A 2OGSA 3JWIA 5BRNA 2VJLA 4B48A 1MJGM 3GHYA 1V16A 3CSDA 3I04M 1T6YA 1NF2A 3ZU5A 1E1RA 1OLOA 1WHSB 2JASA 3BZWA 3CG4A 3NVAA 5B57C 1O54A 2BEJA 3IPAA 4NEQA 5IXYA 3M2TA 1BQEA 1SIOA 5AQEA 3PJFA 1ZPDA 3K70C 1W47A 5CX1A 4EDFA 1BDIA 3RSLA 4II2A 4YREA 4V0LA 2M6LA 3U7IA 2HEIA 1G19A 3HLYA 4Z49A 1E9RA 4WV3A 3M4JA 5IEBA 4AJLA 5CGZA 4M22A 4OHMA 3DEJA 1P1CA 1T0JB 2EW8A 1GTRA 2KS6A 3NEAA 3LC7O 4IS3A 4LSMA 3IT3A 2AJ8A 2PH7A 4NS1A 1V3TA 1KHTA 3GJZA 4LECA 1BGVA 3DBOB 3JQ9C 4DZTA 3PBKA 3AM3A 2XT9A 2SKDA 4DLYA 5BN5A 1X7GA 2GJAA 4Z3DA 4US0R 4F91B 2H5JA 1EESA 4FYHA 2W9XA 2DP4E 2JJ2A 3R7DA 4ARAA 2EZ9A 3DHVA 1H6DA 3V8MA 4NZMA 3I62A 2HRDA 3ZGVA 1EFKA 5EJAA 1KAEA 1C9YA 2GHIA 3U17A 4OIFA 1KI8A 1ONOA 1CJMA 4B87A 3RVPA 4PR3A 2OBFA 4KNYA 1RAIA 5KVSA 2HHHB 1XZDA 3I1IA 3PITA 1TFRA 3ETHA 2ZYIA 1HXHA 2UVQA 3ANYB 3I52A 5L4NA 1L4KA 1VCNA 2G72A 2WJVA 2QGZA 1XQVA 1B4DA 1W4LA 1NLYA 2WLTA 3O8NA 5J4LA 4R9NA 3HUUA 1YR9A 4MUJA 2G0NA 1LJLA 1WU7A 4A8JB 4EHJA 1AE1A 4RM2A 5U4QA 4Q15A 2P3SA 4QDUA 3TSZA 3AY6A 4A8TA 4F2DA 5JFGA 3HU1A 3VAYA 3VRHA 3WWEA 5LMNB 2A86A 5BPFA 1ZHOA 1CEYA 1E0AA 1JR3A 2MOKA 1N0UA 1MXHA 1WPGA 2V7QA 1KR2A 2E7ZA 2J0QA 1R6TA 1Y3IA 4HQNA 4CIYA 2QRNA 1OXTA 3V7UA 1EGMB 2ZZMA 1W34A 3ROTA 5HJEA 1RQ2A 2QLBA 1T9CA 2REOA 4GKJB 2ZZNA 1JHDA 2YOHA 3COWA 3WWZA 4DOMA 4RZIA 3LA6A 1SEVA 2OHIA 5D3KA 1XPOA 1RYHA 2WPDA 3A1CA 1XVVA 2IGTA 3P0JA 2DCMA 4P83A 4EITA 2J30A 5KX5F 1HNXB 2GEVA 3A6KA 4NJMB 4KDCA 4ND8A 1S3GA 4L0MA 2CNWD 5DXFA 3VTKA 3ZW8A 4ARCA 4BAGA 4NARA 4Z51A 3JQRA 4EHDA 1C9EA 4YI3A 2B0JA 2WYUA 1EM8B 1KZGB 4JNKA 1ORTA 5TQ0B 3RC1A 2WTNA 3RRZA 3JW8A 3UJHA 3DFIA 3RWOA 2IZ0A 4Q3CA 1GLGA 1DXQA 3AGPA 2FWIA 1K3FA 3UXEA 3SDBA 3HV0A 3ZZNA 4C5CA 5AW5A 4B3MB 3WNZA 1QRDA 2W6OA 5DNCA 3G49A 2M2IA 4LPSA 4QEKA 5TVKA 1K68A 4IMIB 3ILXA 4UCXA 1SU7A 3L8EA 2NSHA 4FB5A 1JEQB 2C9DA 4RVSA 1L5GB 1QH9A 4B33A 4IXMA 5EQTA 1LI7A 1ZIDA 2HDNB 2PTGA 1WE2A 1V2GA 3DKKA 3B1YA 3CLSD 2QG4A 2ZT6A 2HPHA 2E4YA 1A2OA 2VDNB 2VWHA 2XEDA 3D31A 4IG9A 4LI0A 4MVXA 3ZWPA 2RSLA 2XUPA 4M4SA 1VI6A 1C8BA 4XGRA 4PLPA 5AKEA 1CQJB 3L4BA 1ENZA 3L93A 1FQWA 3IQWA 3O47A 3PJGA 2J5BA 4RMNA 3TLKA 1GAEO 4Y6OA 3QLJA 1JSXA 3V2HA 4I1VA 1DHTA 1C3JA 1T34A 2INGX 1NW8A 4KHZA 1AGRA 4Q1BA 4PYMA 4YJDA 3HJGA 2G7MC 3DCJA 3KJIA 2GPTA 3LI2A 2YZKA 3UCEA 5JOQA 1BMFD 1Z4MA 3OQIA 3EWSA 2AF4C 4KEAA 1Q95A 4LZJA 4ZP1A 3V8QA 4UM5A 1P5HA 5HS6A 1GSOA 3SS7X 3NTLA 5KOJB 4XJXA 1N0VC 3NBKA 4BLQA 1RZRA 3MWFA 4QSHA 2DETA 3EPHA 3BKWA 2R6R1 2NAPA 4PYJA 2HQSA 1H1LA 3PU6A 1GUYA 2WM9B 1OBFO 2HUPA 1QHXA 2RKOA 3Q40A 1MB0A 4KQHA 5THXA 3VAZA 1L1EA 3A1TA 3EIXA 5J4YA 2L82A 4PHHA 1J2TA 1R9MA 5HFNA 2X58A 3UJNA 4B7XA 4F04A 2FR1A 5CB4B 1OWNA 2UZ1B 1I01A 4OKSA 3AP2A 4W5RA 1KIMA 2IEGA 1YCDA 1QC5B 1DBWA 1TIPA 2FXVA 4JD5A 5ALUA 3RVQA 1PWXA 9GPBA 4EHNA 5AVWA 1GZ6A 2ACKA 5JDCC 1IBSA 4C14A 4ALLA 1KH3A 4IGKA 4PBSA 2X0IA 3OZUA 1U5AA 3A7EA 3ER6A 4B5LA 4PSVA 1Y48E 4R1OA 4AF8A 1K5HA 1FVXA 1NW6A 5AJWA 5H16A 2UXDB 4HNSA 2AMLA 1JG3A 2QN7A 1YR3A 2X6QA 3EGOA 3HNRA 4U7HA 3WO0A 3OWXA 1KAGA 3K9HA 5TARA 2X9LA 2DY1A 1GRNA 1F5SA 1BA3A 2BM9A 1P9RA 2YYAA 4URHA 1RT9A 4RZQA 3I73A 3F5QA 2WOOA 2OSBA 1YB1A 1PJ4A 1U3CA 3OZGA 4QJ5A 1HT3A 1QAQA 3HADA 2G40A 4Q5IA 2BGWA 2XXBA 2FDCA 4JYAB 3OFJA 2NYRA 3PXBA 1HE4A 1KY5A 3PVZA 5DRTA 4BEWA 4ZCIA 4Z1MD 1UBSB 2ZZKA 2I2XB 2Z2ZA 2JLRA 3NNSA 4MJ7A 4GM0A 2RHTA 4UVIA 3BL8A 4HHEA 4YAIA 2YWBA 1MIOB 5IP5A 4E1VA 4HAYA 4EL5A 1NVWQ 2WE7A 3ECCA 3KAKA 2BW0A 1F06A 3Q8LA 1G291 4JVSB 3RVDA 2ZRHA 5BNZA 1G41A 2N42A 2DQSA 4XW2A 2PGNA 1R4NA 3CEAA 3PD0A 4CQMD 2FW1A 2JGRA 5DGXA 2ZIXA 2NZUG 4EWLA 4WZ6A 4BZXA 1RBQA 1WQ1R 3JAWA 4J91A 2G4CA 2X0DA 1TLLA 3C7AA 4ZGWA 1ZISA 1PQYA 1XU4A 1ZN9A 1EK2A 2YHBA 3AR4A 1XPRA 1MB4A 4DR3B 2MSWA 2RI0A 2AJLI 1JDTA 4KN9S 5IJ9B 5L40A 2C07A 3DOUA 2AMYA 3FOCA 2D1TA 1IQ0A 3GFPA 5A9SA 2F55A 3P19A 5CXQA 1FFCA 1X8JA 2J46A 4OF4A 3N59A 3BA6A 1O1YA 2CLKB 1R8SA 3WLNA 4AWXA 4C6RA 3VO2A 1T4CB 1T9KA 2B25A 2ZBGA 3LUKA 3QV1A 5CYPA 4BGUA 1I80A 4V03A 1YB4A 1V5EA 2Z04A 2F9FA 4M9XA 4TV9F 2V65A 4YBZA 4TSKA 3OPYI 1USWA 4UU1A 4OSOA 4PG6A 2ZSJA 3EISA 2XQFA 3C3XA 3DUFB 5HX7A 4ZYUA 1C14A 1KERA 1PFWA 5LQJA 4WCFB 2QP3A 4QQKA 5E9QA 4H77A 4OGFA 1L5HB 1IN6A 1NT4A 2VUSA 2IPMA 1KBQA 5CT4A 1PE0A 4BDTA 5AW1A 2PWPA 2K2QB 4DG5A 1G3IA 4E70A 2ZW9A 4X1OA 2Q0XA 4GC5A 2A9QA 3MJVA 3NCTA 2CDCA 3WWPA 3WRWA 4BY9E 1K7YA 3D6JA 3K92A 2FUNB 2HSWA 3FVQA 3CA8A 2YRFA 4PSKA 4GR5A 4J2OA 2BHLA 2P0YA 2RCYA 5E8JA 2R6JA 4JJ4A 4M8KA 4KFSA 3AM5A 3L7BA 3OUTA 3BILA 4LAFA 3GVPA 2LVBA 1L4YA 1Z0KA 2HHLA 4ZEWA 4RWEA 1G64A 2DFDA 1GTG1 4BBAA 4FU0A 1RJFA 1SD1A 2CEAA 2Y0CA 1ECPA 9LDBA 2HJRA 5KU1A 2D0PB 2UXCB 1C4KA 1X92A 2RH9B 4F7WA 1QP0A 4ZMSA 3I9V6 4TL9A 1D8TA 3ULKA 1ULHA 3I3SR 4E5SA 1ZEJA 3S44A 3R9XA 3G5UA 2WAYA 5H83A 1TO6A 4DM4A 5FOXA 4F3CA 3KTAA 1U0LA 5T6BA 1LTQA 1OH8A 1QTRA 1LLDA 1Z34A 2J4FA 1OXBB 1R4MA 2GD1O 3G88A 3KP1A 5ELMA 3OQMA 1U7HA 3P71T 3B82A 4C21A 2AJDA 1KFKB 2B1IA 1MABA 3Q0IA 4RKWA 3ZE0B 4F46A 3RFCA 4YRFA 5IDWA 3AR3A 1YRBA 5IC5A 4DIFA 1AXRA 2Z1NA 2O54A 1BXZA 4I4TF 5FOTA 4DCNA 2PMKA 5FD8A 3GDWA 3RF7A 4P31A 2X14A 2WHQA 1UBHS 3NVMB 1X15A 3X1DA 1ZJZA 2OKCA 3MJEA 3DONA 2N47A 2W98A 2CXHA 3W6NA 3LQ2A 3C16C 2JFNA 2YYYA 3PC2A 1T3LA 5FNZA 5JI3E 1FTWA 5HIKA 2D5IA 1EQ2A 3BD8A 1C41A 3KYDA 2ANCA 3SDZA 1E1MA 2VAVA 2V4ZA 4PPFA 1E2JA 3DTVA 5DM70 1MOSA 2JLWA 3VMMA 1LD3A 1MAUA 1CIPA 3GRZA 3G5TA 1VZ3A 1TA0A 2NPFA 3VTAA 3ABOB 5LBTA 2VQFB 1NSTA 3K0KA 5KQGA 3R5FA 2Q3FA 2OB2A 5KNDA 5ERXA 5EIEA 3MOSA 3ZV3A 4DS3A 3DG9A 5DGTA 1ZIYA 4P2GA 2YZMA 4HDSA 3LBIA 3B13B 4YP7A 5JY1A 2BEWA 1CQIB 5FWXB 3RIYA 3KKZA 3EFHA 2ZUBA 3BL6A 4B2YA 5HOQA 3F6BX 1OT3A 4XWOA 3HZZA 2ZE6A 3V8EA 1JIJA 1Q3HA 4IG4A 5EWJB 1NSYA 2XA1A 4D97A 1NP6A 3N2KB 2XBUA 5EUMA 1KDYA 4ZCRA 1TZJA 4UNPA 2B4YA 2C00A 2ZSKA 2W4MA 3RQIA 3HL0A 3P2EA 5TB5A 3TYXA 2XVZA 4ID9A 2XTAA 5AW7A 1JW9B 1FMTA 2RHWA 4TX1A 3IMGA 3AF6A 3CNBA 1BMDA 2GQ0A 1Z13A 4QUDA 4ECEA 2QQEA 2H51A 1R9NA 3AL0C 1GPLA 4NSNA 1K98A 3CF6R 3CUVA 3IUPA 4H0CA 4Y0NA 2GI4A 2GERA 4HFRA 4EF5A 3BREA 1FE8A 4D80A 4I1PA 3CJTA 5BSUA 4C5AA 3SDSA 2COUA 2X1LA 2ODBA 2NACA 3K1TA 3PG5A 4DR5B 2BCEA 1MVLA 4BNTA 1YRQA 2I6XA 1I51A 2B5WA 3RIEA 5L3SB 1R3DA 2DQKA 4IIYA 3DA8A 4XQGA 4ZO7A 3HB5X 3ET4A 4HAUA 3AUSA 1U94A 2NZXA 3DZHA 4F3TA 4TSFA 3EJ6A 1RQ7A 3E4DA 4CLHA 5KCZA 1GCGA 3GVCA 4TZTA 2EXXA 5SYAA 3SAJA 1FZQA 5P21A 2PPLA 3U7RA 4A7PA 2CV0A 4UEOA 4LF9B 1Q0ZA 3OX4A 1GTJ1 5CDFE 3PUYA 2FP4A 3K0EA 1J2UA 4AKEA 1NNLA 1NXSA 2AF3C 5DT9A 1VLZA 4XH9B 4TKVA 5DDIP 4CPDA 5CIYA 3Q5DA 2ZSEA 1UDWA 2Z2IA 3B38A 3PQCA 2B4TO 4WMLA 2V59A 3NWPA 3OJLA 2QVCA 5EXSA 4GMDA 2QYTA 4F60A 3E3OA 5EMLA 1TKRA 3AY7A 5KYXB 3QVLA 3VZRA 1Q7RA 1SHZA 2H2DA 2LW7A 3GJ6A 2XIQA 5JS2A 2K4MA 2QR5A 3RK0A 3H4TA 3IGFA 1JAHA 3D8NA 2O2HA 4L72A 2O4UX 3KSDO 3BBPA 5B53A 1S2IA 6ABPA 4GDMA 1FNDA 1A2QA 1I9GA 2JIDA 2WUDA 2BGKA 2C98A 4HQ6A 3SC2B 1ZR2A 1UPAA 2BFPA 5IM4F 3RS3A 3N2GA 3U7QA 1QQ7A 5JSZB 5DM60 3E27A 1I10A 2VH2A 1B23P 5K4HA 2OGUA 2BDUA 3E9QA 3AJ8A 4JS0A 3TDMA 3GLFA 1Q0RA 2AG5A 4DZRA 3EASA 2VDVE 4QTUB 4AMGA 1CDEA 2HQ1A 3DXXA 3HABA 3FFBA 3MYRA 4Q4HA 1QQ6A 5ALKA 2XRFA 1JIVA 2ZRLA 2Q3LA 4L3OA 4EPYA 5LD2C 2BHNA 4I2VA 1THMA 4Y6QA 5C1BA 4D3FA 3E5MA 3HFSA 3K5IA 5A3VA 1RZ3A 3GT0A 1N75A 1NGSA 3COZA 3WYEA 1LF0A 3UHOA 4ABYA 4Z4FA 4U6SA 4HF7A 4I50B 4XQEA 1KYYA 4ZYWA 1DIBA 3ASUA 4MIOA 4ZHQB 1FNNA 2BKEA 3HCAA 5AICA 3B5EA 4Y2YA 1XTIA 3EW9A 5DLQC 1Z5GA 2HXYA 2YY5A 5T64A 3TQIA 5JRDS 2HV8A 1YVEI 2XYQA 5J43A 5KQMA 4JL6A 1MXFA 4PO3X 2IY8A 3K30A 3GC6A 4KQGA 1NY6A 4X54A 5KYYA 3TCNA 4Y1RB 5YASA 1OGJA 3JRNA 3VC2A 3VPHA 3MWEA 3U61B 1S7CA 4PSDA 1X86B 2A58A 3QPCA 4BCCA 3HQ4O 3NI2A 4LC1A 1JTEA 1R9GA 1PZMA 3C6YA 3QOWA 3B48A 4TTPA 2X9VA 2JCSA 1VMDA 3TS1A 3L40A 1H3FA 2IEZA 3K32A 5B37A 1MAVA 1RRMA 1T8TA 5IUKC 4AS2A 4LJRA 2PGJA 1OASA 3W4IA 2AT1A 1G6Q1 3JAKB 3I45A 4ZI3A 2VEDA 2ZWMA 3MJFA 4DQDA 5DULA 3EBOA 3DLAA 2I54A 3TQOA 3T3OA 3M70A 2I4LA 4L9AA 2W6IA 1DXOA 4K6HA 1JPVA 3LZCA 2P2ZA 3R1IA 5DSZA 5FEMA 1ZXLA 3K1JA 1Z8HA 3H9BA 2FNAA 2BUBA 4KQWA 1ZD2P 1A5ZA 2QL9A 4Q4DA 3RS2A 3TSWA 5TPZA 3VZCA 1WEHA 3VISA 4N9QA 2MDTA 4MVJD 2WOJA 3N8DA 1Q3KA 4BNUA 3QKSB 1XWIA 2X5OA 3R9KA 1A5BB 2DHCA 2O50A 1M74A 3SKXA 3W4JA 3IJRA 3NWBA 5JAMA 1VHWA 4YMIA 3ZWDA 5AIAA 4I0WB 4OJYA 3AUUA 4MQUA 5E8RA 1FUUA 1YRWA 3OTGA 4K7JA 4CM7A 1OB5A 1YL6A 1D5WA 3SOZA 2CT8A 1N2HA 1K6IA 4RPJA 1XKTA 3WYNA 2IV2X 2XI4A 3EG9B 3WNDA 4RHYA 4PZ9A 2WMNB 1QGYA 3UTCA 4EW2A 5F78A 4DNOA 4FBGA 5KYUA 1I2MA 1GKYA 5K8IA 5EC8A 3UC5A 4TKLA 3VR2D 2XGMA 3HR4A 4R1SA 4DA6A 3LUGA 2JI9A 2VR1A 1COWA 2IXFA 2GVZC 4PXSA 1E96A 1E2QA 3R44A 4L57A 3RS7A 1AMNA 2PBFA 2X13A 3I2GA 1HV8A 4PZCA 1EXMA 1AKNA 2R00C 4FWBA 3I6YA 4IPTA 4R4JA 3CR8A 5AK4A 1P5RA 1KDZA 4A03A 4MP8A 4CG2A 1UMCB 5K3SA 3FPFA 4XLTA 2ECKA 4GE3A 3OCCA 2HMSA 1DJMA 3ZTYA 1KO8A 4C3VA 1KGDA 7ADHA 4EOGA 4TLEA 3HBFA 1RHMA 4I36A 4IX9A 5IT0A 5MDHA 2WF7A 3LS2A 4YT5A 5ILOA 2JJMA 4I1RA 1JDUA 1UQRA 2WLSA 4G0XA 3FVTA 2O19A 3CRRA 4YEDA 1VC2A 5CDUA 4GUAA 2B2XA 3I92A 3LLMA 3OTHA 1JHAA 1KOLA 4UVHA 1EUCA 5A7FA 2P7IA 2QGFA 1LBQA 1JALA 2GBLA 4XVRA 1CP3A 3JATB 4AQYB 5EAIA 1K08A 4Y1GA 2C78A 6AT1A 3TG8A 5HG0A 3IX7A 5A2QA 2OZVA 3HFJA 1U1IA 1Z2AA 2H92A 4NNOA 5EPEA 3B89A 1Z7YA 4NMXB 1T2UA 3CNNA 1Q83A 5CT9A 3THYB 3ANSA 1J39A 3SF8B 1GZ5A 4TTJA 2C5EA 3MT9A 3SCZA 3ZD7A 1SXPA 2QVXX 1PW7A 1T2VA 1PR1A 1V3VA 3BN3A 4EGFA 4KPEC 1MNQA 2B1QA 4OXXA 2IW1A 2N1BA 4E5YA 1X0XA 4D8WA 5B30A 4BFWA 4EG7A 4CGZA 1II8A 4EEKA 3D81A 4IYRA 3I2JA 4P7JA 4I3FA 4Q9IA 2IH5A 4JVLA 2KWIA 3D8RA 3PDIA 4L9SA 1PJLA 5C53B 1QCCA 3LL4A 4QQRA 5LP6C 5A6SB 3O95A 2YW2A 4HLUC 1QTIA 2YY6A 4N40A 1KJWA 3ROGA 4WESA 1A8UA 4LOLA 2Y05A 2PGLA 1RNLA 2I8AA 2Q1UA 5F3WB 2JHCA 3OFSA 3W9SA 2XECA 1N6NA 2PS0A 1H0SA 3BERA 3KEMA 4X7PA 5DBEX 1XC7A 4QLBA 2WNIA 3DDOA 5FEUA 1IVYA 3FNGA 1KK3A 1LJ8A 2X42A 2XUAA 5IZCC 2Q2WA 2CK3A 1PWYE 4GOJA 4DKXA 2ZIUB 1DZIA 2P4UA 4CV1A 1OW3B 5J23A 4O4JF 1T1EA 2JIPA 1O9HA 1ZOLA 1RFLA 4N3CA 1WXXA 1XDGA 5EP2A 1J0EA 4KUEA 5I5EA 4MI1A 4JJEA 2Y99A 1R10A 2OY0A 1J5EB 1AGXA 2P9EA 4IM7A 4E2ZA 1N3YA 2JZOA 3V46A 5FKJA 3C8ZA 2J9RA 3AI7A 3DR5A 2DB3A 1Z36A 1A7AA 2L0XA 2FMKA 3VR1A 1XD8A 1U9IC 1UMDB 3EZ9A 3VVLA 5M3BA 8AT1A 4US1R 1SOAA 2G5CA 2FPPA 2PX0A 3FYDA 5IHXA 1OLXB 4FZ3A 1SPBS 4E94A 4WECA 2N0SA 1ORVA 1WCIA 3DLPX 1FDOA 4BBPA 1HORA 1ZICA 3CUUA 4W5WA 4Z0PA 4YR9A 2IOHA 3OFND 4TRJA 4EBBA 5CDTA 5D7BA 2C42A 3TZBA 4HVCA 1VHTA 4ZT7A 3E8MA 2WIDA 4CV0A 2OCBA 1MO6A 1TMGE 3KO8A 1LVHA 3CB4A 4DHEA 5EYPA 3NHSA 4CEJB 3EJWA 3OIFA 2XWSA 4L22A 2BELA 1LW7A 2HJHA 2MMCA 1T1IA 1Z88A 1TTPB 2Q3HA 1T3SA 1VI2A 4RIIA 4TTAA 5JJCA 2NV0A 3ZHOA 5IARA 1MZVA 1AHIA 5E6UB 4B3FX 2EZ8A 5ENDA 2QL5A 3EXIA 3BT7A 2VP4A 2XNHA 3VDMA 1P7ZA 4V2UA 1WJGA 4EY3A 4OI2A 1NXPA 3CT6A 3PENA 4OHRA 2H57A 2W2NA 3NIDB 3O4JA 4AUNA 1VE3A 1JHPA 4ZQBA 1TA4A 4RV4A 2QNBA 1T9GR 3JQPA 1N36B 4ID3A 2WFAA 2ZAIA 1IJEA 2BEVB 8ADHA 4LV5B 1DVRA 4XFDA 2FFBA 3I01A 2EYUA 3P1JA 2A7QA 2OBNA 3PGLA 4WVFA 5F5XA 4D1YA 1EVIA 2ID8A 3JX9A 5KCMA 1H2FA 1T36B 4NOMA 4C6TB 4B6PA 4N7MA 3EQZA 4MUBA 2BJVA 3TRDA 1HO3A 1NT2A 1MV5A 1KPIA 4H31A 5KJ6A 3JQAB 2HOQA 4HWKA 3GLUA 3FLMA 3LRXA 3ZEAA 1F2TA 4JJZA 3PHLA 2IH4A 2ACVA 1YBMA 3GMTA 3CVOA 2LPMA 3FF4A 1QLHA 4J16A 1YR2A 4Q3BA 4HWRA 4DTCA 1G7RA 3C14C 5LQUA 4NCBA 4YRNA 5CFZA 3BD6A 4MRVA 1I7PA 1DELA 5DBFA 5EXPA 1G5TA 1USGA 3OPQA 1L5VA 3LBAA 3UJ8A 4JITA 2PZGA 4RA6B 1QX3A 2L18A 2P9GA 4NYIQ 3VVMA 2R1VB 4I46A 4BX0A 3R8FA 3QUAA 4GI1A 4YMUA 4O1MA 2GCOA 1RJDA 1T0PA 1ZCFA 3PYXA 5K3FB 3AO0B 3RVMA 2FI1A 3SVZA 3V32A 5T4BA 3AZOA 3UAXA 3GCXA 1GCUA 5T8KC 2O4CA 1CZHA 2ILTA 2ZUUA 4YONB 4URZR 1QV9A 1Z0IA 1ZSYA 2C3OA 1YZVA 1NOIA 3A28A 4KO2S 5ALVA 5H9WA 1B0PA 1JAIA 1NRIA 1Z5PA 1QCYA 3UCXA 4JYBA 1Z68A 4R1UA 3TL3A 4DLPA 1U02A 1N5DA 3KXIA 4BUJA 4CM8B 1TF2A 3CF0A 1SQ6A 3PFCA 1O2DA 2H0QA 5ES3A 3KZMA 4EBFA 4ENVA 3RNOA 4QICA 1H65A 4GM4A 5D5PA 1B8VA 2GN0A 5IFKA 4KBGA 2VHZA 2VZLA 4CEHB 1WXFA 1IHPA 5E2BA 1YCHA 3L6DA 5H02A 2XBMA 2FPOA 3PFWO 2FPGA 4K9LA 3WIBA 3ZU3A 3HCRA 3ZI0A 4JBIA 1WIWA 2YIVX 3OWOA 1XG5A 3KJGA 1YJXA 5JMWA 2ZUFA 2PJRA 1HKHA 4UM7A 3AR9A 4KO3S 3M4ZA 4BVEA 1RJ9B 3IUEA 4BP9A 4CLDA 1Q1GA 4U2CA 1RCTE 2J5RA 1QB7A 1TQ4A 3BORA 4PBRA 1T6BY 1XK6A 2YJTD 3ST7A 1G17A 3VU0A 4EPTA 2KMLA 1JIIA 2Z5FA 2DHEA 2GPSA 3KAPA 3KQUA 1NVBA 1B74A 1E9FA 2ES4A 5DGHA 4B34A 4ENPA 4JEHA 5AI9A 1R0YA 3AVVA 1JHQA 2R4TA 3W3ZB 2DBRA 4F8EA 1FJXA 4ES6A 2QBYB 1XFAA 1ILWA 4LYAA 1ZD1A 3WR5A 1TKCA 2NXCA 4P3NA 3P0HA 4D6YA 3F3YA 5KC9A 5JVDB 4WXMA 1YDFA 5GVSA 2IITA 3DMRA 2F8SA 1W6UA 3GJRA 3A9TA 1AMUA 1TUIA 3UBMA 5JW6A 5U9CA 1OC4A 3VU3A 4C07A 3LPAA 1PZNA 3AL3A 1PWEA 2X0EA 2H9IA 3DD5A 3GGJA 4NR0A 3D6FA 3NU1A 4ITUA 3UK1A 5KUTA 2I1WA 3DZIA 4GX1A 3RGWS 1XEWX 2KB0A 3H5OA 3GPBA 1XMXA 1MW9X 3T4EA 4YMSA 3HNPA 3JU3A 1Q77A 4BLOA 3WL3A 1KFEB 5E7JA 2QLTA 3WAKA 3SSMA 3H9GA 1QQTA 4TLBA 5CCDA 4WBNA 1HDGO 2I2FA 1GQRA 3D6TB 1SK8A 2HK6A 3EDMA 3R3UA 3LMKA 5G1NA 2VA9A 1BGXT 1VBMA 1WXGA 1Z6AA 2HF9A 1PJBA 3HP7A 3EVZA 3QLVA 4YJ2F 3BK7A 3RRYA 1VHJA 1ZJ4A 1MX9A 1WZ2A 1QYIA 1VJ1A 1MT3A 2G88A 2GBIA 2LXNA 3FDFA 5LLSA 1IH8A 3U19A 1ST3A 3EGDA 4FD2A 4YUAA 1OH5A 3CUKA 2AI2A 5BN3A 2ZCJA 1A96A 1RZUA 3V2GA 4IW3B 3GCGA 5D7NA 4I5EA 1I14A 1EGVB 3NPMA 3DCYA 5C7IO 2FSPA 1EFVB 2VNHA 4PVDA 4QAJA 5CT6A 2Q3BA 4G5OA 4N3AA 5AIBA 3DEZA 3KSBC 4YPVA 4LBZA 4YJGB 4PV7A 2GPNA 2AQIA 4PZEA 3C3PA 1EJ6A 1FX0A 2F9LA 3M6IA 4HH1A 4DC1A 1M34A 5JWHA 2A0UA 2FPUA 3ZVMA 4IYJA 2KJQA 1X0VA 1QVZA 4PFSA 1DT3A 4RY0A 2CBXA 2FWBA 4NL4H 3RLFA 2BZSA 1I4LD 1NBOA 3NFRA 2Z57A 4CF3A 2VOEA 5G0VA 4Y9SA 1Q19A 3AP1A 4LJ5A 5FI1B 3CNEA 1E4YA 4OMUA 3DTVD 4CFYA 4F5DA 2R6DA 2I9KA 4BFTA 4BDSA 2QU8A 3CN7A 4O4LA 2G07A 5E0OA 3H97A 3X0DA 3MCTA 2H8KA 3PQ4A 3UTDA 1S8OA 3E58A 1TEXA 4K9SA 1MB3A 1V0JA 2VAMA 3C98A 2YC2C 3L2OB 4PCLA 2XNCA 1LLUA 3T3NA 1JQDA 1A97A 1M0EA 3NUQA 3KFXA 4OHXA 5CPBA 4JHLA 1OLSB 3M8KA 2BGLA 2JW5A 2XMQA 1JIXA 2ORED 2L42A 2BL4A 3DEHA 4H7KA 5FI5A 4BKPA 3P0EA 1VSQA 3K0FA 3ELDA 4F6RB 1CRLA 2QY9A 4IEFB 4RIEA 4V0NA 2SKCA 1DQNA 3AZQA 4FONA 2WILA 4QRDA 4Y2HA 2FR8C 3W34A 4DY6A 5B55A 3BGOS 2XD9A 3O74A 2HBQA 1F1BA 1TIKA 4M83A 4MQFB 3UUEA 1YL7A 4YP9A 4EQ6A 2YFQA 4TLMB 3FJYA 2MYPA 2Y1KA 4DCMA 4JB2A 4R6XA 5A0VA 2GO7A 3E1GA 3R5TA 4Z8XA 1XO1A 1BD4A 4IDNA 4Q1VA 3T06B 1SXHA 2HB6A 5DIFA 4GYYA 3UT6A 2JLAA 3ICEA 3LP5A 2QGNA 2YVQA 4P6VF 3ZZUA 1N25A 2FVXA 4PGGA 4G9BA 3OAAD 3KIPA 4PLVA 3W2TA 3B1KA 4CF4A 1E4VA 1M1UA 1FFSA 1Z7WA 4H08A 4ZXFA 2XKAA 3EGWA 1ZN7A 1TM7E 3S40A 2RGAA 1L8XA 4HOYA 3EH1A 3BWCA 4ZQHA 1K7CA 4QE3A 2C9ZA 1MAWA 1VIDA 1IJFA 1I2DA 1AM4D 2LE0A 2WSIA 1U63A 3DEIA 1Y6QA 3BE6A 3DV2A 1IXKA 2CCKA 1P2DA 1E7SA 3A0UA 5CFQA 4HDMA 1WVIA 3BGSA 2WINI 3PUXA 3H4MA 2ZJYA 3QXXA 3ZU4A 4Q7MB 4W5OA 3COVA 5E3IA 3CLKA 3OH8A 4HSEA 1RQNA 2A78A 4LY6A 2AQKA 4RFVA 1D7OA 3A9WA 1NXQA 4JJFA 2IX9A 3OEYA 3L7IA 1ONPA 1YJAA 2HWWA 2X1HA 5E1MA 1RS0A 1G6OA 5B5SA 3H84A 4ZQFA 1DFIA 2WAAA 1SR8A 2DT5A 2FFHA 4AY2A 3AHIA 2I7VA 3KKPA 5EZYB 1JEYB 1NI4A 4KGZA 3PP8A 4AUMA 1SOWA 1V26A 2ISSD 2V58A 4BFSA 4YRKA 2C61A 4BUZA 4PE5B 4HB3A 4DSNA 4DQLA 5HQJA 3THRA 3EN0A 3TFQA 4L0CA 5JNUA 4XTRA 1JSCA 4A3SA 2PUFA 2JEYA 5LUBA 3FCEA 5SY6A 1W2HA 3QX7A 4FWIB 4FR0A 3LW7A 4C0XA 3BE5A 4JIGA 1XCLA 3KJEA 1V8DA 5E7MA 1RI4A 3DE1X 3K9GA 2BE7A 3LCUA 4U5XA 3LT5A 5DP2A 2O2ZA 1ZM4A 4QXQA 1WBJB 1FBTA 3I6MA 2VT2A 1C9NA 2XBLA 3NHBA 3R5JA 3C87A 2WB2A 1XE3A 3IULA 2SHKA 2GJKA 4CCAA 2B34A 4DV1B 2GN9A 5IN5A 1P74A 2B21A 1M2GA 3RRJA 1RWQA 1T1GA 3QXGA 3U4HA 2NZJA 1BVRA 2BJWA 4B47A 1X7XA 2QUJA 3FETA 2CLCX 3LT1A 2JIRA 4OQYA 3E8SA 3LCVB 1D1TA 1I3CA 2JGAA 4EATA 2PKWA 3KTFA 1ZSNA 1K8RA 2GD2A 1C30B 1FLNA 2I2AA 2J6BA 4KPUA 1QRUA 1GGJA 4DCCA 4ZAVA 4AJPA 3PC6A 3ON5A 4H7PA 4KZKA 1N3IA 4WFIA 5AXAA 5FNVB 2VDRB 5E7IA 5DHTA 1FW8A 1A1VA 1P7YA 1TC2A 5BQPA 1W0KD 2VHUA 3JWPA 3ML1A 1TZ2A 2PLFA 3D3EA 3L4EA 4UFOA 2ZAMA 1QIMA 3EG5A 5BVGB 1JX6A 4GPD1 1NIJA 4G97A 3B36A 3TZCA 5C1OA 3W79A 1CUUA 4WBXC 4OHBA 2P5UA 4WT7A 2QLNA 3KBBA 4C03A 1E66A 1RPAA 3OF5A 2UUOA 1EZ1A 1U0HC 1VBKA 2V03A 2IYPA 4DQXA 2I4IA 1DKQA 1E3WB 2YZNA 3RIHA 3TCKA 1JDNA 1P3Y1 3WMGA 1PFYA 3FTFA 5ELLA 3CTPA 1QNFA 2WYHA 5LSAA 4DV4B 1XZJA 2I67A 1DKRA 1JDSA 1V6SA 1YHZA 3JYOA 3RVJA 3ODGA 3ITKA 2O7NA 2P2SA 2CW5A 3CM0A 4HVAA 1D1QA 2P6OA 3PQEA 4DIBA 2HW8A 3D2AA 3SEFA 5JLJA 3X2FA 1EUYA 2GYVA 1SU4A 3NHLA 1YD7A 1Y1TA 2J09A 4OJMX 4Y7DA 3THSA 1M6VA 1Z2OX 5ESRA 4B5KA 4AO8A 4WNCA 5F77A 1OFGA 1QK5A 2EV9A 1OX4B 1F7VA 2BFDA 2CUKA 5DNVA 1VB3A 5BSKA 1R16A 3IHWA 3RUPA 3GEMA 4X66B 4MVJI 5EE5B 4MRSA 1YZYA 2PZBA 4JXJA 4P82A 3HA7A 3HY6A 4CLXA 2HSEA 3PPVA 4MTLA 2CNDA 3IERA 1JVBA 4HVLA 4TGLA 1ZZEA 2FRVA 3HR7A 4FW8A 4PEVA 1RW4A 4IVRA 4MITA 5FL7A 5IBRA 1H8ED 3FFAA 1H2ZA 2OEPA 3H5AA 4IIUA 4EHKA 3VA7A 1FJGB 3MCZA 2PV7A 2WD7B 3SQXA 2O7VA 3OU7A 1RRFA 2F1OA 1Q7EA 1R4AA 1SFRA 4WQMA 4JEMA 1II9A 4P38A 5JNLA 2H2IA 4A0GA 1N2EA 1Q14A 1ZUNB 4F5ZA 5K0SA 1CUBA 4B3GA 2W6MA 5DBOA 1ZESA 3TGLA 1Z74A 1OIXA 2A5DA 2D5LA 2JBHA 4FGSA 1QFJA 4KXVA 1HQYE 1UJ5A 4E6PA 4EGAA 5I4KA 1VPEA 5K3AA 2GAFA 2P9QA 4D4JA 1FMCA 1H9CA 1EVKA 1BC5A 1GTZA 2FCAA 4NU8X 3A32A 3PA6A 3MGBA 4MS3A 2Q9CA 2HHJA 2O48X 3VNBA 5KTSA 3L7CA 3BTSA 1YZGA 2FWMX 4P4TA 3OLYA 1P9OA 3TQTA 1ETHA 2ONYA 4H1UA 3SS9X 1GUZA 3GARA 4H6VA 4AFNA 1CY8A 1J07A 1NV8A 5A4DA 3CUTA 2V5VA 4DVGA 3TSOA 5HQ3B 2ZREA 1SH7A 3KV1A 3B1XA 4NU6A 5K8UA 3NG1A 1NLUA 2A1UB 4ZT5A 3UHPA 3DFUA 1PCXA 4TLAA 1LRKA 3BXOA 4K0KB 1OX5A 4GI3A 3BQ9A 4I9GA 4OG2A 4UAVA 1C7IA 2BBWA 1ODJA 1UEIA