4KAXA

Crystal structure of the grp1 ph domain in complex with arf6-gtp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
163
structure length
163
Chain Sequence
GSMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords ADP-ribosylation factor 6
total genus 56
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2013-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kaxA00
1CS4C 1DEKA 3GJ3A 1Q57A 2QROA 4XOIA 1G4UR 2GF0A 2IYLD 1JAHA 2MMCA 3QXHA 5SZKB 3OESA 1T6NA 1KO7A 1FUUA 3THWA 2RGGA 3Q9LA 4DLTA 2HYDA 3EZ9A 4ASUD 1OXVA 3A8TA 5BW8A 2AK2A 4Q4AA 2BM0A 2F9LA 1WE2A 5E95A 4A6PA 1KMHB 2KBFA 2JLRA 4LHWA 4Q9JA 4CRWB 3PUXA 2P67A 4U02A 4KBFA 1DE0A 2O52A 3LXXA 3PUVA 4BASA 1W7AA 4LRWA 3DOEA 3PEVA 5TVKA 3X2SA 2JCSA 4DCUA 1H65A 1G16A 3MWKA 4MGZR 4TTQA 4HATA 2G6BA 3T5GA 5BYKA 3L0OA 2F7SA 2PCJA 1OT3A 2HCJB 4LC0A 3RS4A 3UMRA 4EFLA 2VLIA 1Q21A 4RZ2A 2HT6A 1CJVC 1S0UA 1KDTA 1V5WA 2FSGA 4B2IA 2AFIE 3OEHD 3T61A 2VEDA 4RY2A 4F7WA 5DSZA 5DI3B 2N42A 4WW0A 421PA 1FX0A 4NYIQ 2QMEA 5KSZA 3CX6A 4DSNA 3EG5A 2DCUA 2ATXA 3Q72A 4Q48A 3GJ8A 2QPOA 3MFYA 4QGAA 2OESA 2VYFA 4W5WA 1CR4A 1K5GA 3AVPA 1JECA 2ZE7A 5JHHB 5EQTA 1GILA 4CEHA 4DSTA 1UEIA 2QI9C 1E4YA 1ZIPA 5JJIA 4LJ9A 1LNZA 721PA 2GF9A 1M7HA 4ZDJA 1XBTA 2YJTD 4WZAE 1GG2A 4PHGA 1KI1A 3O47A 4Q9KA 4NCIA 1P72A 4C0QC 2V6JA 3E70C 2V55B 3QF4A 1ZW6A 2WZQA 1H8HA 2H8KA 4KBGA 1VG0B 1U8YA 3R9IA 4CW7A 2B6HA 1G8PA 3BH7A 1MKYA 2QZ4A 3GQBA 3PQCA 1XEXA 3HYTA 1FTSA 3IDQA 4Q4JA 3E5HA 1GKYA 4TT3A 4IRUB 4CT5A 5P21A 3IILA 1G8YA 1GOTA 5LB4A 1KDRA 3B85A 4XWOA 5DN6D 2E9SA 2VL7A 1E94E 1A2BA 2Q3FA 3A1SA 4G5QA 4NHOA 3SFZA 4C0JA 2B92A 1NSTA 4URYR 2J46A 2C99A 5C18A 5CK5A 2JJ2A 1FMJA 4KFRA 4MYTA 5EP1A 1PUJA 4E09A 2J0UA 2MSCB 1MH1A 4S2EA 3KKNA 4DEXA 1CXZA 2WWWA 4JIMA 5B30A 2ANCA 2GZAA 3HU3A 4G1UC 4TLEA 1W36B 1UADA 1M7GA 3U5ZB 4ABYA 4A9AA 4AC9A 4QNRA 1DG3A 4TLDA 2AX4A 3I61A 2WTUA 1G19A 3VAAA 2QBYB 1IM2A 5JWHA 1ZINA 2V9PA 3L82B 4IOLA 4HB4A 2C04A 2ZIAA 3QXJA 5UKDA 3EWAA 5CM9C 4FWTA 1CRPA 2ZYTX 3TR0A 2IYZA 2WM9B 3R9XA 3LW7A 1AM4D 1W4RA 2QG6A 2A5FA 5J4YA 1AJEA 4KJZA 1F6BA 3CO5A 1Y63A 3VKWA 1N5JA 3FHCB 3NVAA 2WJHA 2YKGA 4PO8A 1P75A 4IVPA 4JS0A 4NTZA 4EQ6B 1FUKA 2XJ4A 4OHXA 4D25A 5KSYA 3K70C 2QTVB 1TADA 1T5IA 1YR9A 5LD2C 2FV8A 3RS5A 3KJHA 4LJ4A 4XJXA 1E9SA 1XD2B 4RVCA 3VFDA 1RE0A 3CR7A 1JAIA 3D31A 4L5BA 3VQTA 1F2UA 4JBYA 4QKQA 2F43B 2GBLA 2OE2A 2WWFA 4GOJA 1VYUA 3SJCA 2E87A 5SZJA 1ZAKA 1TNDA 5L8VA 2CCKA 3THYA 2DB3A 4YLGA 4HDCA 1OJLA 1U90A 2RB4A 3MJRA 4MUBA 2O8CB 1HH4A 2BM1A 3WP1B 2JDIA 4LZZA 2B8WA 4QGFA 1D2NA 3NBYC 2YOHA 5J5CA 2QM8A 4F4CA 1VECA 1JR6A 5FL7D 3U3KA 2JLSA 3M6AA 5EP4A 4NDZA 1GFIA 2ZVPX 3WHKA 3CB4A 3WRYC 3K70D 2ZJOA 3K0EA 5KDDA 4YMWA 3HP1A 4URZR 2H7VA 1YJ5A 5D3MA 2RGNC 4D4LA 4QGGA 3VHXA 1O87A 5K8UA 3PIRA 1M34E 1R0WA 3IEUA 3BIFA 4JL6A 2GDJA 3THOA 4FIDA 1Z0KA 2YOGA 3TIFA 1RYHA 4B33A 4WOPA 1LVGA 1SXJD 5F9FA 4NCNA 2VP5A 4BEJA 1KIMA 1KKLA 1GRNA 1QHNA 3ZYCA 3OIVA 3SYNA 3EC2A 2AL7A 1W49A 4B6FA 2G77B 3TKLA 3T1OA 4PAOA 4WBSA 5C1BA 1MABB 1MRNA 1YR7A 4EKDA 1OH6A 1AA9A 1F48A 2BIFA 2XZLA 3L2OB 3D3QA 2OCPA 3LBHA 2F1HA 5AJWA 2ZYVX 2QQ0A 3Q5EA 1NVVR 4FMDF 4PPFA 4OQLA 5HPYB 3RS3A 3T12A 3EA0A 1UKZA 3F5FA 1M1YE 2ZI4A 1T8TA 2FF7A 3PR1A 3SC3A 2ZM5A 2R2AA 4JVMA 5J4LA 2GCPA 4WAUA 5KYKA 2VTKA 3KTAA 2RGAA 3SI7A 4WA7A 2AD5A 3WNDA 4B3DA 1RYFA 2V3CC 2J7PD 1NVWQ 4RJLA 1Q0UA 4P33A 4Q4LA 1II9A 1TUIA 3WNCA 2IK8A 3CONA 1E96A 1GKUB 1DAKA 3QKUA 2HXSA 4EPVA 1BH2A 1SXJB 1XEFA 4M9ZA 4G3XA 4KXFB 3U44B 4MITA 2ANBA 2BBWA 4OHYA 3SQWA 4UNQA 2J0QA 2W6JD 1SVSA 4HZUA 3EXAA 3LXRA 2CK3D 4NCJA 4OI2A 1EWQA 4Q1FA 2NO0A 4KHZA 1KO5A 4ITRC 1ZM2A 3B82A 4NYMR 3CIOA 1P62B 1KK3A 4I99A 1JR3D 1BOFA 1RPZA 3N5CA 4RD3A 3B8HA 3PEWA 1TF5A 2OCAA 1N6PA 1ZC3A 4RZXA 4GP6A 2C03A 4P4TA 3RSOA 5DI9A 2RGNA 4D82A 2H92A 2QP9X 2ZRNA 3VNVA 1WDTA 2QQEA 2F55A 1NMXA 4LPKA 3AP2A 3QPVA 3DO6A 2QSYA 5DH9A 3K70B 3ADCA 1U2RA 1KZ7B 2PEZA 3AF0A 4IDPA 2G83A 2ZRFA 3U3JA 4XD7A 2ODNA 5C2JB 3BH6A 5EXXA 4MRVA 1A2KC 2D4HA 4IOMA 1Z5ZA 3QBTA 1HT2E 1G3RA 2AWOA 3B1VA 4M1TA 1OLOA 2DFLA 3UMFA 1KK1A 3CR8A 3OAAA 4Z1MD 4FMCB 4B71A 1E0KA 4FMBB 4B76A 4DDUA 2AK3A 2ZRBA 2FX3A 3FKQA 5FTNA 2WJVA 2XNDA 1RIFA 3A1WA 4O25A 3BB3A 1R5OA 1Z29A 1VDZA 4JLJA 1AKEA 2ZI5A 5L3QA 2WKQA 1W48A 3OEED 4Q00A 3K1JA 3PUZA 3U6BA 5CIQA 1L4YA 3T35A 2XEXA 2W2XA 2YC2C 2IUTA 5IDVA 4D4JA 4NL4H 4DIEA 4YMVA 4PSKA 1G6OA 2H18A 2WJJA 2CL0X 3LQQA 1K8RA 2QMHA 5BQ5A 5IRCD 2FPLA 5FR2A 4BEBA 1N6OA 2EFGA 2NZJA 1N0UA 5KNDA 2EW1A 2DWPA 2JLQA 5FUWA 1XZPA 4LCBA 4A92A 5IK2A 3J81k 2UKDA 4HB2A 4YXWA 1D8TA 1Z6XA 2J41A 5KHOC 3I1FA 2CK3A 5LPNA 3TBKA 3SYLA 4DRZA 1TQ2A 2RKOA 5CJ2A 2OFWA 5SZHB 4PTLA 4I1VA 2JLUA 2H1LA 1A82A 3PCRB 3RS2A 2ERXA 3T06B 1JJ7A 1JR3E 4OQXA 1I2MA 4KODA 3SZRA 1F2TA 4NYIR 2NTYC 2W58A 2ORIA 3BFKA 2ZR9A 1IN8A 1G18A 1ONBA 1KO4A 2W6ID 1S2MA 2RCNA 2VBCA 4FW9A 1OKKD 5JS8A 4QM7A 1LS1A 1KO1A 1XPRA 3AVXA 3RC3A 2BBSA 4NYJR 3TQCA 1CRQA 4XTRA 1KI9A 4B3CA 1U0JA 1GNPA 2DHRA 3FKSA 1S8FA 4GOXA 3ND9A 3GJXC 4URXR 5EUQB 5CITA 2F3TA 4D0LB 3NXSA 4Q7LA 3AVVA 4TMVA 3NH9A 3BB4A 5BN4A 2ODBA 2IYTA 3QVUA 4M1YA 1G5PA 2O8FB 1YU9A 3LH5A 2VP9A 5A0FA 121PA 3EPHA 4MGYR 3LFUA 4JVLA 4Q02A 3EIHA 3K0AA 2WOOA 1D5CA 3ZZTA 1UKVY 3UXMA 3W8NA 2A2ZA 3IKJA 3T15A 4AY2A 3VU9B 1R0YA 3HPRA 2J45A 4HB0A 3NDBB 3BE4A 1E2GA 5H8WA 1Q20A 1J99A 3P32A 5CYPA 1T4GA 4QHTA 2IYUA 3TNFA 2HUPA 1HA3A 4PANA 3HR7A 2LKCA 4K81B 4PZYA 4BFZA 5JWRA 1BYIA 3GLGB 3BD9A 2SHKA 4QL3A 2CBZA 3KQLA 2QY9A 1X3SA 5FOUA 1JALA 1Z47A 3C5HA 5JCPA 4XVRA 1KSHA 3EPJA 3M4YA 3KKOA 4OHZA 3FHOA 2JLWA 2VP4A 4CGZA 2UZ3A 4JLVA 4AKHA 4Q7KA 4C7OB 2CHGA 4LHZA 2QAGC 1AS2A 2AN9A 1E69A 4A8JA 4XD7D 3ASZA 3BRWD 1KJZA 4OL0A 4R71A 3IEVA 1XU4A 1BYUA 3LO5A 3GLIB 3OIUA 3THXB 4CEIB 2EU8A 4W7SA 4AKEA 4DCSA 3H0KA 1G20E 2R62A 2REXB 4RZ3A 1GZSA 2WIBA 1E2JA 2IEZA 4QJ3A 1NG1A 2QGNA 2QT0A 4Q9IA 4NP6A 1WRBA 1CJKC 3DPUA 4KU4A 1Q12A 1ZRHA 4Q18A 4Q47A 4LBVA 4DB2A 1KMQA 4DLXA 5IT5A 2DWOA 2FEOA 3K9HA 2FOLA 4B48A 4DT1B 3AKCA 2YWEA 5FH9A 2BCJQ 4LI0A 1FFHA 4URVR 1US8B 1DTSA 2NZ8A 5G3ZA 3W90A 1MO3A 1IXRC 3KB2A 2ZE6A 2ZS8A 3WMEA 4GI7A 2GEUA 4ACBA 4K46A 2CDNA 2DYKA 1RJ9A 2VHQA 1E1QD 1PJRA 1KI4A 1W0KD 4BLTA 2NO7A 1XCPA 4LJYA 4N0EA 4ZCMA 4E07A 3UATA 2FDCA 5KPJA 5JJLA 4AD8A 4TTRA 1XEWX 1W4BA 1H8EA 2JLXA 3SHFA 3LY5A 1UDWA 2OXCA 1G3MA 1NP6A 2W0MA 3L43A 5TY0A 1C4OA 1W0JA 1Q1EA 2BMJA 3NHBA 4TMWA 1CR2A 4LGMA 3KQNA 3C15C 3WHLA 4IXMA 2F6RA 3FKSD 2XB2A 4BFUA 2LCFA 1E2NA 5H1YA 2AWNA 1JEEA 1EX7A 2CHVA 2F1IA 2GCOA 2J9RA 3GLHA 1E32A 3ZQ6A 3GLFB 3R7WB 4A2PA 3I5XA 1KI6B 1W2GA 2WPDD 1W5SA 1P5ZB 5FOWA 4ESVA 3QG1A 2CLCX 2ZR7A 2XSZA 2YWGA 1S9DA 2N1BA 1UBFA 5AUQA 5FTLA 4V0ME 4LV5B 4NCHA 5B2ZA 3AEZA 1CF4A 5CB8A 4GMXA 5DGXA 1E2QA 1TEXA 4NONA 1E3MA 5M04A 3GP8A 4ZIRB 4TQUS 1P2SA 3D8BA 2QRZA 1WXQA 3KFXA 2OBMA 4L9SA 3SYKA 3PV0A 2GVZC 4Q03A 4V0KA 2ZUDA 3BXZA 1UBEA 1VG9B 1G7RA 2MMGA 1N6IA 4E5UA 5KOYA 2QE7A 1AZTA 1KY3A 3OIWA 3ND8A 3TR5A 4NKRA 2WICA 3EX7C 4AYTA 1QVRA 4OI4A 1XF9A 5AR1A 2O0HA 2QGZA 1X6VA 2CL6X 5FBWB 4J0QA 1E9CA 4BZXA 3CH5A 3ONWA 1XX6A 4L15A 1ZUIA 2GK6A 4C0KA 1Q44A 3QE0A 2ZYUX 3UWKA 3DKVA 3ECCA 4MGKR 5KTYA 3EPKA 1KY2A 1XTRA 1XJQA 3B2EA 4EDHA 5IHPA 3T1TA 2CEAA 3CNNA 4CEJA 4X8OA 1SHKA 2AHOA 4DLSA 3FMFA 4IKEA 4URWR 4B34A 1TQ4A 4BFVA 4JL5A 2XNDD 2PLRA 1XD8A 5AWFC 3QKRA 1SVIA 4F38A 5FL7A 3VNUA 1MO5A 2AD1A 4A0RA 5CJPA 5HCIA 1DS6A 1XP8A 1KAOA 1ODFA 5C46F 3CPHA 4UNRA 4ZI2A 2IWHA 4M0LA 3IBGA 3V4RA 1JNYA 3LNCA 2IXEA 4QRHA 4FMCF 4JMPA 5CLQA 5EE5B 3VKHA 4JYBA 1DPFA 1RZ3A 2Q6TA 4IOKA 1IJFA 1S1MA 1TMKA 4PHHA 1M2OB 4Q1EA 4QGHA 4C4PA 2R6DA 4FMDB 4ZO4A 1R8SA 1VIYA 4C0HA 3TMKA 3MAAC 3NC0C 1CEEA 2IYSA 3NDPA 2ZRHA 1OFHA 1ZIOA 3TE6A 5BWMA 1GP2A 1NN5A 4JLAA 2O8DA 3L8YA 5ELXA 3BORA 3AM1A 4HB3A 5DO9A 1HTWA 1LS6A 3TJZA 1F5NA 1SKQA 2VRWA 4TL6A 2FG5A 1W2HA 2IYRA 2IS1A 3VKGA 5LDDC 3FGNA 1VYVA 4OQFA 3SJZA 5FI0B 1E2PA 3AP3A 3EZFA 4OKSA 2ZYWX 2IX3A 5DI3A 2XXAB 5K8IA 4XVUA 1OFIA 1NKSA 2A78A 4HUQA 3FFAA 3SNHA 3MGCA 3QSYA 1CIPA 2IYYA 4UQOA 2QTFA 3FMPB 3VR6A 5AUOB 2VHCA 3EZ6A 3A1TA 1W36C 1SZPA 3ZGXA 1LF5A 1JR3A 3GEIA 2JLVA 4PO9A 2ECKA 3ZVRA 4X8LA 1ETUA 2VP0A 3CNLA 3C5CA 1S1CA 1B0UA 4HDOB 4A15A 1Z0IA 3RWMB 5BN5A 1Z0AA 4I4LA 1XRJA 3NEJA 4CVNA 2J5XA 4JKYA 2QRNA 2ZI6A 5AK0A 1ANKA 4DXAA 5BXQC 1L7VC 5JWOA 1D6JA 5EP3A 3TLXA 4HEJA 2J7PA 4IXNA 1T3HA 3DM5A 1CJTC 3AKYA 4P32A 4C3ZA 3GLHE 2IF0A 5DN6A 4RD1A 3A4NA 3GCGA 2KWIA 3W6OA 1W47A 1KDOA 3AQ4A 1LB1B 1E9EA 1G3IA 5TDHA 1AS3A 2OV2A 4MA4A 4QJ5A 5FOSA 3SBDA 1P3JA 221PA 4M9SA 4AYWA 2HJVA 4JT4A 1J2JA 4HDQB 3KL4A 4P0TA 1N2CE 2D62A 2IYVA 4LWZA 3EASA 3GFPA 3IQXA 3UG7A 1E98A 1NMYA 3QIAA 2ZRJA 2AFHE 4D6PA 4DVGA 5E4FA 1G5RA 1QHXA 1T0JB 1JQJC 3T1QA 4DBLC 2R9VA 2V1UA 1Z6TA 5EE0A 4AURA 2ZAOA 2O8BB 3DHWC 2GVDC 3CRQA 4R2IA 3RANA 2I4IA 5J47A 2JLZA 2WPDA 5K8TA 1KO8A 1P9NA 1HE1C 1FQKA 1P60A 2HT1A 4V0LA 1XWIA 1DO2A 2VQSA 4Z51A 3VMFA 3B13B 1H8ED 1OFTA 1UEJA 1XDBA 3H86A 3QVVA 5F2EA 5CDFA 1I4DD 1R6BX 2B21A 3TK1A 5GJCA 1GL7A 1XMJA 4M2LA 5J4VA 5KSOA 1KI8A 2Q0HA 3TQFA 4TTPA 1E9BA 4W5JA 2J0VA 1Q3TA 3LV8A 1QZXA 1NI3A 4N1AA 3Q7QA 4RFSB 4EIWA 2Q9BA 1YZTA 1TL7C 2W2TA 1KHTA 2RMKA 4EQ6A 3AVUA 2ZJBA 4KFSA 2A5JA 4KITB 4IVRA 5LBIA 2ZRCA 1ZC4A 3KKPA 4AYXA 2DWQA 5JEDA 2FJUA 3L0IB 2BJVA 2REOA 4C9BA 3Q85A 2YINC 1AGRA 5E7JA 3DZ8A 2PH1A 3UWOA 1TQDA 3JZAA 1L4UA 4LBWA 2EFEB 2JDID 3A4LA 3IO3A 1G9XA 2O8EB 2G0NA 3KXIA 5JSZB 1YZQA 1CJUC 1WP9A 4HAXA 4US0R 1IONA 3H4MA 5EP2A 2VH5R 2KSQA 4B43A 2KB0A 3V4FA 4DIDA 1P4SA 3U60B 4FCWA 4DHEA 1A5TA 1COWA 1VTKA 1X8KA 4MQBA 1EGAA 1RW4A 2XJ9A 4H1UA 5KDOA 3THWB 3I62A 2XNSA 4BE7B 4B73A 4MKHA 1G7TA 2GJ9A 3TW8B 1LF0A 1VG1A 3DMDA 4NZYA 5D3MB 5G41A 3AVQA 4V0NA 1E9AA 2GJ8A 1EXMA 4XSHA 4U00A 3GLIE 3CX7A 2ZROA 1Q22A 1U81A 3HU1A 1G5TA 5DE3A 1NKTA 3VHLB 4GMDA 3NIBA 5GJWC 3WYAA 1KYIA 3LD9A 3QOFA 1OYWA 2FSFA 1NVVQ 3KXLA 2CE2X 4PAQA 1II8B 1OXSC 1ZYUA 3ZD6A 1SVMA 4LJAA 1N3BA 3AKDA 1UBGA 4HAZA 5CK4A 4TLAA 4TLCA 2D7CA 4C30A 5TMPA 3EZ2A 3FMOB 5FI1B 2ZREA 4PFSA 2EYUA 2FZLA 3CM0A 4BFYA 2OLKA 3X1DA 2GZHA 5BYJA 1E2EA 4QXAA 2XZPA 1ZVQA 2CLDX 2V7QD 3LA6A 1R2QA 4BUJA 4DDTA 1FX0B 4RD4A 2PLFA 3MMPA 1CP2A 2IYXA 1NL3A 3BFXA 4JJKA 1AZSC 1WF3A 2F1RA 4WZ6A 3TUIC 4DDWA 4GDFA 2X2FA 4JZKA 4F4IA 3CX8A 1YZLA 3HR8A 4AI6A 3QQ5A 5KSPA 1QHSA 4YQFA 1XJCA 5AJXA 1FP6A 4LK2A 4OJQA 3U3MA 2HJGA 4JLMA 4O2RA 1ZMXA 2XOKA 3AH8A 2GJAA 4YDSA 4DUGD 3ZVLA 1B23P 4RFVA 1SXJA 3O8RA 5AJVB 5FOVA 5J4KA 4BFSA 4MKGA 1K5DA 2HF8A 4KSBA 2R44A 2BV3A 3A58B 1X8JA 3G82C 1W0JD 3AP1A 1D9ZA 1KI2A 4YC7A 4GZMA 3P1JA 3QXXA 5L3SA 2BMDA 2GAOA 4QOSA 4B3XA 4ZDKA 4YDHB 2V1XA 2ZJ5A 1P2VA 1P73A 4MRRA 4Q4JB 3K0FB 4G5RA 3MWYW 3NWJA 3K9GA 4QNMA 2CCJA 4BLQA 4H1VA 1TF2A 3WP0A 5TXGA 2WWXA 3M1IA 4NMMA 3GJ5A 4Q1DA 5HKKA 1BO6A 3OEHA 1FTNA 3RVBA 4EJSC 4IVQA 2OBLA 3L8ZA 2IUSA 3GLFE 2ZRKA 4OQMA 1E1QA 2J0UB 1JBKA 1NY6A 4R98A 4UJ3A 3KZ1E 4MYHA 3IPYA 2WIAA 2C9CA 3U2QA 1MO4A 1YR8A 1E4VA 2GAAA 2GWHA 4I1UA 4LDJA 4PHTA 1Z63A 2PT7A 3SU8A 1E2LA 1ZNZA 2IWRA 3QKSB 2KJQA 2BMEA 3OFND 3VTKA 1N5LA 3I8SA 1KSGA 1WA5A 4JLNA 2CJWA 1M6NA 2WKRA 3NH6A 4RSGA 4EUNA 2X77A 5KUTA 3B9QA 2P0EA 1XTKA 4PX9A 4EFNA 1DAGA 4C0AC 1UM8A 3MCAA 1DAMA 1HV8A 1NMZA 2CNWA 1IN5A 2RGBA 4X8HA 5CLLA 4LYFA 1AQYA 2ZI3A 2ASEA 4PQYA 1N6KA 4QBGB 2WSSD 4PO1A 3TW4A 4LYAA 2ZS7A 3VX3A 4TYNA 1GIAA 1AGPA 3LQRA 2QN6A 4BFTA 5EZ6B 1UKYA 2MSEB 4EPWA 4D4MA 1UAAA 2ZSFA 2E1RA 2VHJA 5E7MA 1RRCA 1CU1A 4G0NA 2LWIA 2ZRGA 2F43A 4TMXA 5F3WB 2ZJAA 2C2HA 2W0SA 2BKUA 3LX5A 3TH5A 3HU2A 1DARA 2BJWA 4PC1A 1UF9A 4PQRA 2V54A 4DLVA 3THYB 2G3YA 3RRNA 2ZR0A 1X1RA 1C9KA 3QY0A 4LV8B 5EZ5A 4MH0R 2CCGA 4BGDA 4TMKA 1CTQA 2R65A 3SBEA 1FW6A 1OFUX 3B1YA 4KLNA 4QHSA 5HE9A 5HTKA 1QDEA 2ATVA 4JLBA 2WMOB 4G5SA 4TT3D 1F2TB 1PLJA 2Y8EA 5HKKD 3C7KA 3L0SA 3VR5A 1E2HA 3CH4B 1IY0A 4IEEA 2FFQA 2OXRA 2BHRA 1NBMA 2WBLC 4M8NE 5FBRB 4ZI3A 3KQKA 3QJYA 3EAQA 3SFVA 1EK0A 4M1WA 1VG8A 1HQCA 4JYCA 3SE0A 1XXHB 3TVTA 2X2EA 1GRRA 2RHDA 3DMNA 4AG5A 2H57A 4XIGS 1IN7A 5H68A 3RYTC 2RH5A 3RSLA 2G1JA 2IA5A 2PX0A 4B2PA 3R20A 1Z6GA 2HLDD 4KVAA 3QBVA 1U98A 1JJVA 1GWNA 3GEHA 3NG1A 1I4TD 4LV6A 3U6KA 4Q9LA 3CZPA 4D2IA 5DHAA 1T3SA 2HLDA 3K0AB 4DLYA 1KZGB 4FCVA 4IFEA 5JS7A 1O3YA 4DLRA 4OBEA 1E79A 4JSYA 2EFHB 3IIMA 1GSIA 2OBNA 2ZI7A 5FOXA 5HR5A 2XTMA 4KV9A 5FFMA 2QA5A 4G01B 1NN3A 4OHWA 2C9OA 4WVFA 5FR1A 5TARA 4EAQA 2VA8A 2GBLC 3DVLA 4TWZA 3A1UA 4RD2A 2D7DA 2VHTA 1OB5A 3GLGA 1R5BA 2BKEA 2EFCB 1IAQA 1TU3A 1SVOA 4II7A 1JI0A 2A5YB 1YR6A 4TLBA 1PV4A 2HCBA 3TAHA 2QENA 3GFTA 4V03A 1YZUA 2OO7A 3OEEA 3W6PA 2VF7A 3ZQJA 4PSVA 2FEMA 2ZJ2A 5IK2D 1EFUA 2UVQA 4B2LA 3R8FA 2A3RA 2OILA 3N2EA 1RRPA 3V00A 1TTTA 5JHGB 1KI7A 4PC7A 2GXAA 4QBIA 4RCZA 4KAXA 4ON9A 1AK2A 3QF7A 3SN6A 4FN5A 2HXYA 4BECA 2NQ2C 1WMSA 4Q7MB 2OCYC 4IDHA 1KKMA 3PJRA 4PQFA 3U61B 3SR0A 1Z6AA 5B57C 2XX3A 5FTJA 5FPSA 2JIZD 2DFKB 1SVWA 2QP3A 2P6RA 2AXPA 4MKIA 3OHMA 4OI1A 2FSIA 5GVSA 3IHWA 1UPTA 2YZ2A 4I1OA 4B35A 2Z5FA 2ZE5A 5D3QA 3ZD7A 2XZOA 4FWIB 3LAWA 4A2QA 2CNWD 1P9RA 3QKTA 3OFNA 3TSZA 4M53A 1NVXQ 3W5JA 3RRMA 1YQTA 4M1MA 3BC1A 2AKAB 2QAGB 1N6NA 1IQPA 1MT0A 1E0JA 2WV9A 2QMUA 3A36A 1E6CA 1G1MA 3AVYA 4TYWA 4RKEA 4M21A 4DLUA 2QM7A 1EX6A 1MO6A 5B64A 3I72A 5SZIA 1TAGA 2JASA 2RGDA 4Q1CA 4F93B 2VP6A 2ONKA 2DPXA 4JLKA 4DDVA 1L2TA 2GTPA 3D6TB 5JBQA 4U5XA 2PZGA 1TQ6A 2D74A 4TYPA 2C98A 2O0JA 1DOAA 4NPHA 1W44A 4JLPA 4PSAA 4GNKA 4MRNA 4AKIA 4HLQB 4YONB 1T91A 4CZ2A 4Q4HB 4DUGA 5JJKA 1DBSA 3WBKA 4XH9B 5DIFA 3UG6A 5HZKA 1KI6A 1ZBDA 2OAQ1 4XTCS 4KO8A 2FN4A 3UANA 1OB2A 1RC8A 4A36A 5FPYA 5EJEA 2DY1A 1Q1QA 4O3MA 1SKYB 3RAPR 5KPDA 2ZVQX 2EQBA 4C0SA 1RRGA 2XOKD 4OJKA 1EG7A 2OSBA 3I92A 1ELOA 4HAYA 4OYHA 1E2DA 3OE7D 1GM5A 1OHHD 3T5DA 5FUYA 2ZUBA 3T1VA 1OF1A 2HF9A 1DAEA 4NE2A 4RD0A 4XVQA 3CPJB 3ADBA 3Q8XB 1S3SA 3PUWA 4ARZB 5J4HA 2WJYA 2QSZA 2YWHA 5DISB 1XPUA 5JRJA 4KFTA 2GJSA 3BERA 4R2HA 2XTZA 3FTQA 1HQYE 1ZD9A 3TUJC 4A0GA 4EPXA 1TUEA 4UKDA 1SXJE 1NLYA 1Z0FA 3CPEA 3ASYA 4JKIA 2IW3A 2BBOA 1QRAA 3QEJA 5AJYA 1TF7A 3AF3A 1J90A 2P3SA 3CF0A 1HY3A 2AKYA 3W3ZB 4QBHA 4A1FA 3U7EB 4MGIR 2H5EA 2FPKA 2Z4SA 1YZGA 3OIYA 4RKFA 1C1YA 3ZZUA 4HLUC 1IXSB 1YKSA 3KJEA 3M0EA 2H17A 1OYYA 4U7DA 4E22A 2YNMA 1N0WA 5JZVA 2ZQ5A 2O8FA 1MOZA 3KJGA 2P2LA 4EFMA 1QHHB 2WMNB 5LD2B 4PPGA 1P61B 4DSUA 3QKRB 1E9FA 3B9PA 5LB2A 1S4QA 2EWVA 2GJKA 4ILEA 4JVSB 2OAP1 3PUYA 3X1XA 3VU9A 1BMFA 3PENA 4IDQA 4BRUA 2ZPTX 2EWWA 5L3VA 3N2IA 5FPKA 4D26A 2R6FA 1KK0A 4P4SA 1NY5A 4IEIA 3ZVMA 1M74A 3O8BA 3IHLA 1CLUA 3GJ6A 3LDAA 4Q4AB 4IOJA 1NN0A 2WWGA 3R8CA 2JJ1A 5CIWA 2OFXA 5AJZA 1P6XA 5BN3A 4NBSA 4D81A 1XFAA 5G40A 2JATA 3I8XA 3L0PA 3AGQA 3MD0A 1ZCAA 3MUFA 1A1VA 1QHGA 3WYGA 2P5SA 1OH8A 2ZSDA 1TU4A 2WSSA 4ZCIA 2GXQA 3FVQA 1VYTA 1E2IA 4KFUA 2GEVA 1VCOA 5B58C 3ZS9A 3HWSA 2CXXA 3DZDA 4S35A 3W5IA 821PA 4F91B 2WJGA 4B47A 4DSOA 3GLIA 2XXAA 4GOKA 1MR3F 4HUQB 3O8DA 2BDTA 1E1RA 1IXZA 1XMVA 1ZUNB 3CKLA 5EUMA 3GMTA 3PFIA 5FBQB 3ZJYA 1GDDA 2P5TB 3IPXA 2BEKA 4KYUA 5FOTA 2Q3MA 5KO2A 2IS6A 2IL1A 1P2TA 1FOEB 4GFDA 1SXJC 521PA 1JQLB 3DOFA 2ZU6A 3UK6A 1UJ2A 1EFHA 1HURA 1XZQA 1GL9B 4CF7A 4DT1A 5KU1A 3KB1A 4TZ0A 2Z83A 3VR1A 4TL9A 2D3WA 1WBBA 1R4AA 4WIAA 1US8A 4OK6A 1S3GA 2W83A 4PZZA 1Z83A 4AWXA 1OXTA 3NEYA 3HDTA 5JCZA 4DEYA 1FQJA 5KDLA 1TEVA 1GNQA 1FNNA 4MUAA 3QPUA 4PC3A 1ZNWA 3SOPA 2HEIA 2ZJYA 1YRAA 4LY6A 5DYGA 1E2MA 3QF4B 2ZSAA 1NN1A 3C41J 4ZCLA 1X1SA 1OKKA 3E1SA 3K9NA 4EJSA 4DCVA 5FUVA 3IIJA 5F98A 5AUNB 1OIVA 1NRJB 1PLLA 2Q9AA 1LV7A 4LUCA 1YHNA 1XEXB 1ZU4A 2JGNA 3W9YA 4X8MA 2F3RA 3OE7A 2V8OA 1LFDB 1G8GA 4TQAA 3FB4A 2NO1A 2V7QA 2O8BA 1OV4A 1VMAA 2YV5A 3SDZA 1NJFA 1KJYA 2VIIA 4A0FA 1HYQA 1TPZA 1ZP6A 2GZDA 5KNBA 1HT1E 1AKYA 2G88A 4M1KA 2GCOB 2NGRA 3AF2A 2BWJA 5ANRB 3QI2A 3GLFA 1WB9A 2OT3B 2RAPA 2OG2A 1R5NA 3C4JA 2FSHA 4IFBA 4TSFA 3W8RA 3F8TA 2FGKA 2RHMA 2ZJ8A 1ZNXA 1G7CA 4MKFA 3N70A 4LHVA 3BJIC 1IHUA 1KAGA 4I81A 4V0MA 4K8OA 1X8LA 4A6XA 4YMTA 1W0KA 2TMKA 3KDSE 3AUXA 2QBYA 2VP2A 3P20A 2WWHA 4GBMA 1UDXA 1YE8A 3CW2A 1NG9A 5H70A 4PHFA 2BMFA 4UXIA 3A6PC 3B1WA 4DLWA 2HV8A 1YVDA 1Q1BA 2C8VA 2GCNA 1PUIA 2QTHA 4HUTA 4F92B 4B3FX 4CYMA 2KBEA 2W00A 1QBKC 1OIXA 3CNOA 4DJTA 3K0CA 1N6LA 1RFLA 2CMKA 2ORVA 4R9UC 3H1TA 4D80A 2RGXA 1XD2A 3I73A 3EIQA 3PG5A 2PBRA 4FINA 4JJZA 4TL8A 3I5YA 3U4QA 3IIKA 3LLUA 4C2UA 1Z0DA 2CVHA 2ZRAA 2C78A 3B1ZA 4JBWA 4ZV4A 4CEJB 1P9WA 4IW3B 1LTQA 2X19A 3I3SR 2RGCA 3CWZA 4ASUA 5FBLB 4A82A 4ACAA 3S1AA 1MV5A 1DAIA 2NIPA 4UNSA 2O8CA 2QMOA 2XB4A 4B6EA 2FH5B 3AF1A 4BLSA 3KQUA 2CLSA 4QC2A 3TGPA 1U9IA 2QNRA 3T34A 2R6GA 4LJ8A 5TB5A 4F4JA 5JECA 3BWDD 4MRPA 1R0ZA 1LW7A 1GKIA 3RC8A 4TN1A 4MYUA 1FPMA 4PR0A 1CULC 2IF2A 2QEQA 1KMHA 2WAXA 3LLMA 4LYJA 2HYIC 1W36D 3BGWA 2Q21A 4AG6A 3WRXC 4TQ9A 3AV0B 3U3RA 2W6JA 3WY9A 4Q7JB 1VHTA 3X1YA 3SJBA 4CT4B 2VO1A 3P4XA 3Q7PA 1U0HC 4M9XA 2ZXUA 3UIEA 1M7BA 3EZ7A 2JJ2D 4RD6A 1NBME 3B5JA 3EIEA 4QBFA 3FHTA 1ESMA 3CRRA 4B44A 3FDIA 1IY1A 4TMTA 2B7BA 1XTSA 2KI5A 1MABA 2PCLA 2PX3A 1ZM3A 4PZLA 4Q1BA 4EPYA 4WXPA 5EXPA 4BRWA 1G17A 1KNXA 2YHSA 3PVSA 2PJRA 4Z8YA 3SQXA 2I1QA 5G3YA 1G8HA 3E2IA 2ZEJA 3ADDA 2K5UA 2P65A 2IS2A 5JI3E 4DCNA 3KTAB 1Z8FA 3W6NA 2XSZD 4Z54A 1G21E 3QXSA 1EFTA 3H84A 4LBYA 4CEHB 3LVQE 1NNEA 3MLEA 3CLVA 4A4DA 2EVWX 3BFVA 2BCGY 3AKEA 2FMXA 2C96A 1T0HB 4FD2A 5CM8B 2GXSA 1HEIA 1Q3HA 5L3SB 3WNBA 2IUUA 3LVRE 3ZH9B 2ZANA 2C95A 2ZRMA 1JEDA 3I32A 4LJ5A 3REFA 2CE7A 2W6IA 1ZCBA 3CWQA 3MWLA 2IS4A 3CF6R 2ZSEA 1OPXA 1FZQA 3GJ0A 4OK5A 4EPTA 2H16A 5AUPB 3WYFA 4E03A 1RVDA 1AQUA 4CIDA 4EPRA 5JEEA 1Z06A 4A0HA 3SS8A 4WZBE 1KI3A 2I3BA 3CRW1 3V9PA 2DFTA 1KGDA 2V6IA 3B1XA 1D2MA 3IBYA 3AVWA 1Z0JA 3EA5A 4AK9A 3H2YA 3K0CC 3GEEA 3QKSA 1DADA 1W4AA 2EFDB 4JLOA 2YOFA 2NPIA 4DZZA 1IN6A 1NVUQ 1WCV1 3RS0A 1P7CA 5EXSA 1S9HA 1T3LA 4QFMA 2KE5A 3FPAA 4Z1MA 4AKGA 3FOZA 1UKEA 1SKYE 2Z43A 1HUQA 2XITA 3BOSA 3DL0A 4KLZA 4QHYA 5EXTA 1DVRA 2ERYA 4LHYA 4RFSA 5FPTA 5FUXA 4QG7A 2ZUCA 3VR4A 4BLOA 2ZRDA 1G3UA 2NG1A 1I2DA 1VKJA 4IDOA 3ZS8A 3ZZ0A 2R6CA 3CZQA 2OEPA 5FTMA 5HCNA 1IBRA 4W5HA 3VX4A 2WAYA 4I1SA 3CBQA 5L3QB 5FBVB 3B60A 4WXRA 3RABA 1NLZA 3RNLA 1J7KA 1JPNA 2IT1A 3MG9A 4CDGA 1EESA 3C16C 2O8EA 3LW8A 2OCBA 1IJEA 5C4GB 5JSZA 2Z6VA 5L3RA 1T8UA 2G9NA 3F0TA 3JVVA 2JJ1D 4HAWA 1F2UB 1U8AA 1W4CA 1GAJA 3D7MA 2ZRLA 3P4YA 4ZDIA 3BAFA 2DR3A 3PEYA 4FI3C 3EW9A 3TRFA 2A5GA 2Q3HA 2DFNA 3AGPA 1F3OA 1DELA 1G6HA 1OE0A 3MSXA 4NYJQ 4DLZA 4M22A 4DKXA 2J7KA 2X1VA 3BK7A 1J8MF 3SHWA 1XTJA 4OHVA 1BIFA 1XXHA 1VHLA 1XMSA 2FFAA 2ODEA 2VSFA 4QJ4A 3KJIA 2BOVA 2VHUA 1IN4A 3PITA 1KSJA 3KFVA 2YYZA 4HAVA 2FE4A 1R0XA 3GPLA 3TUZC 1QG4A 1II8A 3O8CA 1KSFX 1BS1A 4RCYA 2G1KA 2GRJA 2WHXA 3DKPA 5CDFE 4TYYA 2R8RA 4UJ5A 1FL9A 4Z8XA 4HSEA 5J40A 4D0GA 2V4ZA 1DO0A 2N46A 4PC2A 2QL6A 4JL8A 3B7GA 2X8AA 4B32A 5A5GA 3QNUA 2QPTA 1Z2CA 1Z22A 3QENA 2ZTSA 4H9GA 4LOAA 3MRSA 1LY1A 2F9MA 2ONJA 4FXPA 4BFWA 3OF5A 4JBXA 3NBFA 4BWYA 1Z07A 2OLJA 5FTKA 3NC1C 4M9QA 4PXAA 3RRYA 3ZIAA 5EE1A 5GJBA 3SEAA 3ZVNA 1NJGA 1YZKA 4GL2A 3HYRA 3BS4A 3I4LA 5TV2A 4M4SA 5C4MA 4GPTA 4Q01A 3U7FB 1WBDA 4XSGA 2FGJA 4L4UA 1OXUA 1ZM4A 3WXMA 4B75A 2ZRIA 2WOJA 3GD7A 2FZ4A 4LX0A 2QUZA 1RRFA 1Z08A 4YMUA 3LBNA 8OHMA 3AVTA 4HI0E 4PPNA 3C8UA 5G53C 1ZUHA 1OH7A 4A8JC 2IHBA 2PMKA 3HPQA 1ZJ6A 3AF4A 4IDNA 5GVRA 2ZSBA 1OH5A 2ORWA 4JSTA 1J8YF 3AB3A 3LRPA 3U44A 2OZEA 2YC4C 2YVUA 3VR2A 1N5KA 1Q1ZA 1VCNA 1R8QA 1N6HA 2ZJZA 1N5IA 1E1RD 3K0FA 1Z3IX 4HZUB 1KTVA 3ZDQA 3K53A 2PEYA 3K9LA 1XCGB 3WMFA 1W5TA 5E3HA 2JAQA 5EE9A 3RDPA 5JMTA 2ZITA 4US2R 3CRMA 3GJ7A 4QM6A 1GTVA 1Y3AA 2GXUA 2C5LA 2Q9CA 3MWJA 2JJ8A 4LJ7A 1ZD1A 3K09C 3VR3A 4OI0A 4B3GA 5GADl 1ESNA 1DG1G 1HE8B 1NLFA 4C2TA 2UZIR 4G5GA 4ESHA 1E9DA 1KOFA 1GITA 1XB2A 1U94A 1XCMA 3OAAD 3Q5DA 4OQNA 1G41A 2QAGA 4O0MA 4PPQA 1QHYA 3FFBA 4HLCA 2PL3A 4C0LA 2JEOA 5DHFA 4KYIB 4DWJA 1XD9A 4YMSA 2CJWB 4GRAA 4UNPA 1CJMA 4ZKDA 2ZRPA 1M8PA 1PVOA 1VCMA 2O0KA 2B8TA 3QPWA 4BZPA 2YWFA 4US1R 2NPFA 4AIIA 1XTIA 1R7RA 4ERNA 1YZNA 4LHXA 2EYQA 4ZDWA 2WJIA 3BB1A 3K8YA 3TAUA 4M1OA 1G4AE 1KK2A 2Z0MA 3IQWA 3JZMA 1EFRA 1IY2A 2OFOA 3RS7A 2LKDA 4LPSA 4BFXA 4B3BA 1AS0A 3NHAA 4C0BA 4JT2A 2L0XA 4JLDA 4GZLA 3RWOA 5IF9A 4D4KA 2GA8A 2BEJA 2IYQA 1ZM9A 1OSNA 4O2LA 5DLQC 2WVJA 1SVLA 5JLJA 2RGEA 2GILA 2P6UA 4W9MC 1KJWA 3B78A 3IO5A 2P6NA 3GLHB 1E79D 1RKBA 1KNQA 4KCGA 1U0LA 3R7WA 1GUAA 2QE7D 4UXJA 2J59A 4DC9A 4PC6A 3G0HA 1SHZA 1A7JA 3AUYA 1VCIA 3AVOA 2XAUA 3P27A 2ZETA 3NKVA 4V02A 4XWKA 1U99A 3ZIAD 4V0OA 2WSMA 3BBPA 3QG5A 2A7QA 2DBYA 2QORA 4IHQA 3A37A 4KI0A 2AR7A 4TSFD 4R7ZA 4ZIRA 1TX4B 4P4UA 1II0A 3NTUA 3WMGA 1CR1A 1OIWA 1G291 2ODWA 4A2WA 3R9WA 1FNMA 1DAHA 1VPLA 1H8HD 2J1LA 3ETLA 2BC9A 2ZI9A 4LBZA 2WWIA 2D2FA 4BLRA 1XMIA 1PZNA 3FMIA 5HZHA 2GKSA 5CYOA 3C14C 1KDPA 4OK3A 5GJVC 3DDCA 3G5UA 2IEYA 3KXKA 4YXWD 4BQSA 2FFHA 4Q5IA 2MSDB 2BVNA 3DM9B 1K6MA 1W1WA 2C9YA 3QEOA 5K8LA 1U9IC 3UPUA 1AN0A 1NBMD 1W46A 5JRZA 5DNYB 2WKPA 2IHYA 5JFGA 2B7CA 3SJAA 1DAFA 1U8ZA 2GNOA 1GL6A 4PAMA 1JPJA 4P4SB 1OXXK 1EWRA 5EE3A 2PT5A 3QUSA 1E99A 1XNJA 3LBIA 4N3NA 1OW3B 4TMZA 4Y0VA 3X1WA 1X86B 3KQHA 1SULA 2REBA 2R6AA 3W34A 3RHFA 1ZD8A 3PEUA 1QG2A 3PXGA 1N25A 2QU8A 2FWRA 4TL7A 2ZU0C 5DYIA 4RZUA 2A9KA 2GETA 3UMSA 2OM2A 1XPOA 2XTNA 2Z4RA 1FP7A 2IC5A 1D2EA 4LYHA 2CVFA 1UFQA 4P31A 2PJZA 1COWD 2JA1A 4HLDA 4URUR 1YRBA 4GP7A 4BLPA 2VPPA 4P3YA 2ZE8A 2O8DB 2O5VA 1R10A 2AXNA 4C7OA 3CRVA 3EARA 1G64A 1Z2AA 2WWYA 1FMLA 3GJ4A 4NH0A 5F9HA 1AIPA 1JB1A 4Q66C 1NIJA 4A8JB 1T5LA 1I4LD 2IYWA 3BH0A 4HAUA 4DB4A 3ICEA 3MJHA 2JIZA 1BMFD 1XJ0A 4NU0A 5FL3A 1NF3A 2GHIA 2BBTA 2QPAA 1XEWY 2QT1A 2I1VB 3OZXA 4L9WA 3ICQB 3THXA 1QHIA 1CKEA 1L8QA 4CEIA 1IOZA 1CR0A 2W2VA 4DCTA 1ZU5A 1E0SA 4LJ6A 1GNRA 4FCTA 3U7HB 2J0SA 4MDEA 3FWYA 3B6EA 2NO6A 2NMVA 5JI2E 2C77A 3A4MA 4D0NA 4M1SA 2VSOA 3KKQA 4Q1AA 4HZIA 1G7SA 4UXHA 2J3EA 3KX2A 1BKDR 2IXFA 1J70A 4GSYA 4BZQA 2G0TA 3F3YA 4IJMA 4KVGA 3EC1A 2CL7X 3RRZA 3EPLA 4LC1A 2GESA 4N0DA 4TYQA 3IUYA 1PLKA 4G5OA 1XXHE 1RJ9B 1T9HA 3Q3JB 5E7IA 4EJSB 4ZKEA 2OUKA 5A4JA 2GK7A 3ZLJA 1GVNB 2VSXA 3KUDA 1JXMA 1G8FA 1MRSA 2FA9A 3FYHA 1SVKA 1QF9A 2NOAA 4B74A 3GLGE 1F60A 3LX8A 4Q4HA 2A5DA 3EWSA 3QXCA 4Q19A 3RLFA 1OHHA 3U3OA 2CHQA 4KSCA 4MYCA 4MRSA 2ZS9A 1Z28A 4Q21A 4XWAA 1E2KA 2F1JA 2OHFA 3TSWA 5CB6A 2IBMA 4JVNA 1XTQA 4BPBA 1S96A 1GRQA 4ZPXA 2A30A 2FPMA 2FU5C 1ZM7A 3K09A 1Z6YA 1ZNYA 1D9XA 4NCKA 1E2FA 4UNNA 1E9RA 1A4RA 4HYYA 3A1VA 2J87A 3ADKA 1SGWA 4ARZA 1NIPA 3W3AA 1VIAA 3NBZC 3K0SA 3UKDA 1WQ1R 1NSFA 4NYMQ 6Q21A 1N0VC 2JLYA 4POAA 2NO9A 2PZFA 3KUCA 2HDNB 4Y0AA 3JVUA 1SQ5A 3KKMA 1N6RA 2GEDA 3LWNA 4Q9HA 2PZEA 2ZAMA 4GT1A 3IGFA 1P2UA 2QAJA 2VF8A 3U7GA 3HJNA 3TSOA 3TVDA 1V43A 3CF2A 1UBCA 3GFOA 3P26A 1CBUA 1EFCA 1QVAA 2PMDA 3REGA 2QP4A 3U4QB 5HE8A 2FFBA 3WBJA 3DEFA 3NBXX 1JXOA 5FPHA 4HLUA 2D06A 1EFRD 2IXGA 621PA 4L16A 5KNCA 4L8GA 3X1ZA 1G3QA 1QHHA 3CUEF 4MDFA 4LSGA 4TZ6A 2D2EA 2FNAA 3FE2A 2XGJA 1E0AA 3S1AB
chains in the Genus database with same CATH superfamily
2HQOA 1WPXA 1YJXA 1ZKDA 1ZVMA 2WF9A 4OB6A 3TD2A 4NCAA 4ZXFA 1SU7A 5SZKB 3F8WA 4E46A 1E62A 1ECGA 1QIJA 1QR6A 1T6NA 2EBFX 2NSDA 3CUSA 2RGGA 1SK8A 2JGFA 3EDMA 3Q9LA 4I55F 3RC9A 4ER7A 5J2UF 1FDUA 5KVSA 2HYDA 3VR0A 3QFRA 2XE8A 4EHFA 2PKEA 1QH9A 2QX9A 4UUNA 2X0FA 5BW5A 1QWSA 4O4IF 5IZ4A 5E95A 4A6PA 1QRUA 4CMEC 3RFFA 2JLRA 2X9GA 2R00A 4YACA 1PZGA 4KUHA 1TUBA 1X87A 4IMJB 4AN4A 1ORRA 3PUXA 2P67A 4CRWB 4R3WA 3ZI4A 1ITZA 3K9FC 4BASA 4TLMB 4GM1A 1L4HA 3LQ2A 4LRWA 3DOEA 4O8CA 1Z2NX 2JCSA 2Y1WA 3M6LA 2GYWA 1MB0A 4KV7A 4ZAZA 4FU0A 2I71A 1KAEA 4LNHA 2Q9UA 5JXJA 5I7RA 2Y6UA 3NTVA 2OPHA 5DN9A 1JQ3A 3VNBA 3CGGA 1OT3A 3UMRA 3FYUA 3FG9A 5J3JA 2VLIA 1ZOLA 3H9JA 2O7QA 2CXRA 4ZQIA 1RLMA 2XOEA 2GNAA 1Q21A 2JFOA 4EW6A 4IBOA 5J2TA 3EUAA 1S0UA 4CIVA 2FSGA 4E4TA 5EHZA 5G0SA 2AFIE 2VCHA 4UBMA 2VJMA 4G97A 4P36A 3KYIB 3Q7RA 4QEDA 2VEDA 5BSTA 4EA8A 3EH1A 1H2YA 4LOIA 3DMTA 4S24A 4AAYA 5CLHA 1GQYA 5DSZA 1DKNA 3UMVA 1K1EA 3MJDA 421PA 3JD4A 3GW8A 4NYIQ 4B84A 4QU0A 4YGXB 1WR8A 2DCUA 2VS1A 2QX7A 3Q72A 4OMCA 3B2QA 4QGAA 3T0GA 3R3VA 4W5WA 4XM0A 1CR4A 1I1OA 2P3LA 1JECA 1FEZA 4MINA 2PHZA 1GILA 1A9XA 1NONA 4TRNA 2XUFA 1QCDA 2VWQA 2XWSA 1JFSA 2WUGA 3A7DA 5JS6A 1EAMA 3DE0X 1E4YA 2P9EA 4GLJA 1ZIPA 4L02A 3MHPA 4Y7CA 4KK3A 2GHQA 4WESA 1CUGA 4JUFA 1M7HA 1BKYA 2BFMA 1QTNA 1UFVA 3E9RA 3T6KA 1NJSA 2YJTD 5LKAA 2H2DA 1IC6A 3C0KA 4Q9KA 4QE3A 1WDWB 4MZDA 4DV0B 1JFVA 1TVKB 3KOZA 2FR8A 3JCZA 1DQYA 1BFUA 3N6VA 2WZQA 2GD0A 3KQMA 4ND8B 3DLIA 2H8KA 2WFZA 2WW8A 1U63A 4RQAA 1VG0B 1U8YA 3GZJA 3SEQA 3CG4A 3ILVA 4GPBA 3HVRA 4D4HA 4K1LA 4C6HA 1JDTA 1MKYA 2QZ4A 4O1HA 4Q4JA 3SC4A 2EDAA 1WMFA 4V0RA 1GKYA 4D1YA 3KYJB 3O8QB 3PTZA 1CVIA 1GOTA 1LI5A 1QVVA 4RPKA 1U65A 3T4XA 4XWOA 2E9SA 2CNOA 4Y6QA 3HYNA 4NEQA 1A2OA 2R7MA 2ZSHA 1I5EA 2Q6OA 3UK0A 2FQYA 3H5IA 3B38A 3MGBA 2C99A 2XUGA 1GLGA 3Q12A 4URYR 3GRPA 3VU3A 3FSRA 4B0OA 2R8OA 4KFRA 1O6ZA 1XTZA 1XL0A 2QT9A 2A57A 4HS9A 4MYTA 4PY2A 1UBMS 5AM4A 2J0UA 5ELLA 3VBEA 4BV9A 4YVFA 3C3AA 4BFLA 5JH7F 3LUHA 2ANCA 5B30A 3HU3A 1TC1A 3PPYA 4EP1A 4QGSA 3MQFA 2JBWA 1HO3A 1KYXA 3II6X 4MPDA 1UADA 4GMHA 3W1EA 4OQMA 1M7GA 4FYVA 4UUMA 4ABYA 1QQ5A 4KAJA 3KAQA 1DG3A 3ZV4A 2JF0A 4CR7A 1K88A 2J33A 3I61A 4HWOA 1U7OA 2AUMA 2O2EA 3KOMA 4TTSA 3RSQA 3VAAA 4C4TA 3DE7X 2BKLA 4UM5A 4IOLA 1QX4A 1U9JA 5KTPA 4HB4A 4O4IA 5UKDA 4LY9A 1GCUA 3JQCA 1J5XA 2VBIA 3BCRA 4GDMA 4G25A 4HH3C 1CRPA 4HQ0A 1KBOA 3LW7A 2QG6A 1KJQA 4KJZA 2QTZA 3VKWA 2EIXA 4FSXA 2WJHA 2QM0A 4UC0A 1IMJA 2C2BA 4WNIA 4CMIB 4IVPA 1SOMA 4G67A 1TLLA 4HXFB 3Q2IA 4JS0A 4EQ6B 2ID4A 2XJ4A 1PJ2A 5LZ7A 5KNCH 3KVVA 1W19A 3K70C 3MYYA 4C0WA 2XW6A 4RHCA 1T5IA 1YR9A 2PKYX 2ZBUA 3PNMA 2FV8A 2XUPA 1SUCA 2AJBA 3ETGA 4B6OA 4C7MA 2WMDA 4WA8A 1PT9A 3CW8X 3VFDA 4Z3OA 3L6UA 4FFNA 5M3BA 3D31A 4ZO7A 5BMVB 4BL5A 4WMLA 1K06A 2E4VA 1Q77A 4F4HA 1A5BB 1BHO1 2I7DA 1F2UA 2RGRA 1BVYF 2OE2A 1Y1TA 3QEMA 5IU6A 4QUBA 4E21A 2E87A 2QTLA 2DB3A 3ZWXA 4JEHA 4BX9A 5KTSA 5FJIA 4OIFA 4OIMA 3RYCA 1O5OA 1L5NA 4NS1A 3LPLA 1FDSA 1BNCA 3MJRA 4REQB 2G9VA 4CE6A 1JG4A 3BCUA 2ZCJA 4BO9A 2P69A 1NBEA 5B1YA 1VBKA 2P5YA 13PKA 3BTUA 3NBYC 3PX3A 5J5CA 4BKMA 3EVEA 2J8ZA 2Q1UA 5CDSA 3U3KA 3W2EA 4N01A 4G4SP 3TE7A 2ZVPX 4WHMA 3WL6A 4F4UA 1T1SA 3R3HA 3Q4GA 3ELWA 3LPNA 4A23A 4O02B 5KDDA 1RRKA 3OLQA 5H4GA 2QLJA 1P7ZA 1RYZA 3LY8A 2JIOA 4KWTA 1O87A 4BEVA 1M34E 3N2ZB 1R0WA 4JL6A 5AQEA 5C1OA 1JIJA 4P80A 2Q46A 4GX2A 4WJLA 1RWVA 1PCXA 1RYHA 4MB6A 3K20A 4A5OA 5F9FA 5G0WA 1YASA 1DXYA 1UP4A 2VP5A 4CG3A 1U11A 1KIMA 1QGED 1YQQA 2MSWA 3FJYA 3KQWA 2I4OA 4EY5A 2PH5A 1GAQA 1YS9A 2WD7B 1IJKA 1LJUA 4B6FA 4AG3A 4G56A 4WBSA 5EPUA 3IQZA 1A77A 4CLHA 1AA9A 1F48A 4H77A 4MV0A 1J0XO 3WDLA 3WC4A 3CCFA 2XZLA 2OB1A 2F1HA 4N3GA 1BXRA 1XMQB 4Y1RA 2ZYVX 3RFUA 2GH1A 3Q5EA 4X7PA 2EQ5A 1PSDA 4PPFA 1YDGA 1JIVA 2JFHA 4IX9A 4LSMA 3T12A 4B5LA 1D6MA 1EH5A 3HP4A 1UKZA 3F5FA 2ZIWB 4R01A 4RLSA 3IDSA 3MILA 2ZI4A 4DMRA 1YJBA 2FF7A 1T5TA 3EGDA 1NQTA 3EIFA 2X5NA 3PR1A 1P74A 1JDZA 4OU5A 5EZYF 1ODKA 4E30A 1L5MA 1RLOA 1B93A 1XZAA 4BO5A 2IW1A 3CN7A 1X8XA 3SI7A 2AD5A 4UNIA 2C1ZA 1YS7A 3T3NA 1KHHA 3QWHA 3T99A 2VQEB 4EJFA 1EZ1A 5F7JA 1FS6A 2HDHA 2JL1A 3AEKB 1ZOOA 3B5IA 2P4SA 3GU3A 1AC5A 1RJDA 1DAKA 1SC6A 2ZW9A 3HZRA 3MPUA 4Y18A 5CX1B 4HV4A 1MV8A 1BH2A 1XEFA 2HDOA 3I58A 3ETCA 4GR4A 4KXFB 2RI0A 4TWRA 1IYZA 1WDMA 2ALJA 2BBWA 3C5EA 3SQWA 1RXVA 2IXDA 2W6JD 3E48A 4TSKA 1PTKA 5BNTA 5F12A 4HZUA 1RSZA 3EXAA 5EIBD 3VPGA 2QUBA 2CK3D 3GNQA 4IUBS 3RLIA 4LF8B 1EWQA 3ESBA 4LXQA 4YRJA 1BXKA 4M0CA 1Y5IA 3KCNA 2NO0A 4KHZA 3T7SA 1EM8B 1GZDA 1GT6A 1WY5A 4ITRC 3B82A 4OQZA 1K7CA 1GJRA 5JSYA 4IJVA 1P62B 3G3EA 3DVQX 1USGA 3PP8A 3B3AA 5EUBA 3ILSA 3U9LA 5LMCA 3B8HA 1JTEA 3PEWA 1ZC3A 4QUHA 3I9MA 5L7TA 5T4HA 2RGNA 1NPDA 4J16A 4JGIA 3QPDA 1NWHA 3G7SA 1UT8A 2HRRA 1RM3A 2ZRNA 3VNVA 3LUFA 4PRKA 1EDZA 1YZ3A 4DSAA 3NHMA 1CUHA 1MVOA 3HNRA 3TB4A 4ZQBA 3H2KA 1PJZA 2DF8A 5DH9A 3KO8A 1KZ7B 1SU4A 2PEZA 3CUTA 3KALA 2CYBA 3U3JA 1MC5A 5IUJC 2OXFA 2Y1CA 3A4IA 3LC0A 3W4IA 3BH6A 1CUXA 3MTGA 3OLVA 3VSDA 4GWKA 4J0IA 1G3RA 2QYOA 3A9CA 3FWHA 5CBPB 3UMFA 3CR8A 3RIMA 4B71A 4ZI7F 1T4CB 4ZMRA 5A02A 4DV1B 4GX5A 2EF1A 2Q3EA 3WNZA 4B6SA 1B41A 2AK3A 5FTNA 3AILA 3JQ8B 3MMXA 3OZBA 3WX0A 3ZD8A 2COUA 4EF5A 2XNDA 3BB3A 1LI4A 1Z29A 1IUPA 1Z4IA 4O4LB 4FOTA 4JLJA 3W9UA 3ZQUA 2Q4OA 3BWEA 3OEED 2ONZA 2VPZA 4YUAA 5A3SA 4PBTA 1FE8A 1BHQ1 4CQMD 5AJUA 4Z9YA 5EINA 5JZ9A 3AW8A 3V1KA 1PT7A 2JJYA 2NUPA 3NJ8A 4NL4H 3FLMA 4DIEA 4YMVA 2PT6A 2WJJA 1T2NA 5FLXA 4XRRA 2CXNA 5FI5A 2FPLA 4FI3F 2G5GX 4BPRA 4F9GA 1Z4MA 2ZWAA 3OETA 2EFGA 3ECSA 1N0UA 2NXEA 1C1HA 2JLQA 4I6GA 4J7AA 5IK2A 1ISGA 2P9HA 2UKDA 4YXWA 3P9PA 5KHOC 3IAS6 2O8NA 5HFAA 3UB4A 1X0VA 3EUEA 1KU0A 4BO7A 5A5VA 4OX9Y 2QTTA 4HGQA 5IAAA 4P3PA 1PFGA 4NENA 1RZRA 1I2AA 4UAVA 3W6UA 1AQNA 1OT5A 1D5WA 1KXZA 2H1LA 3KC2A 1EQ2A 1PZEA 3SQNA 3FDJA 2ERXA 3VC3A 4RETA 1JR3E 1T0UA 1C81A 3JQ7A 1I2MA 1D0IA 1QFYA 1WEHA 3BFKA 1IN8A 2JLBA 1DWQA 3UHAA 3TM5A 1M0WA 2VBCA 3MWEB 2HMUA 4FW9A 5EJMA 4C29A 3UPTA 4W9NC 3LSYA 3OOSA 4C07A 4TTVA 3UJNA 4HGZA 1COZA 1UBTS 3HRKA 4MULA 4B9AA 1UP6A 3DSRA 4UCXA 4XTRA 3X3HA 3FZYA 3SG0A 4JX8A 3TIXB 4XLTA 1S8FA 1L3CA 3GJXC 3R75A 5DV9A 2EV9A 2F3TA 2GUWA 2PWYA 5KVVA 1YMVA 4WUTA 4CKZA 4RV9A 5H7XA 3LUJA 4JY7A 4ZICA 4KGDA 3NH9A 4L8FA 2W71A 1G5PA 1T2VA 3DE5X 3L4SO 3MWFA 3V4OA 3W77A 1IQUA 1JKIA 1D2HA 3LFUA 3MJTA 2ECPA 2IVFA 4Q02A 3K0AA 9LDTA 1D5CA 3LYLA 4DADA 3FVVA 3LKDA 3OZGA 4YLEA 1UC4B 2YJ3A 3W8NA 5TIIA 3QPAA 4HCJA 5T6MA 1NBAA 2BGJA 3ELDA 2NUAA 3VU9B 3BWCA 2V3VA 3EVAA 3TLGB 2EC5A 1NTRA 1QFSA 1APBA 1PUXA 1LWNA 2X4GA 4FHGA 4MIYA 3S5UA 4EG6A 1Q20A 2B4QA 5DEIA 1OI7A 2PGJA 2R8YA 4IXTA 4HVTA 4QHTA 4BXOA 1X7YB 3TNFA 3VJMA 4E51A 2LKCA 4PZYA 2JAOA 4H31A 5E9JA 3U81A 2Y66A 5GZ3A 2XQVA 5IF3A 2R85A 1PNQA 2XWQA 2CBZA 1GYQA 3EXFA 3JQBC 5AFSA 5LXTB 2FJ0A 5FOUA 1L4BA 3AI3A 5JCPA 2FR8C 3FMGA 3G0BA 3SYRA 4DSZA 5LQKA 3GZNB 2A4MA 1RJGA 1OWNA 3FHOA 2VP4A 2I54A 4F3CA 4DV4B 2UZ3A 1IOVA 5AW2A 5BSEA 3T1YB 4KDEA 2E5FA 1N0IA 4WXYB 1EK5A 2GPNA 1E69A 2PA0A 4A8JA 2FVYA 3DMTC 5HJ5A 1P80A 2J31A 2DPYA 3ASZA 5IM4F 2NW6A 3D9QX 4ZVSA 1J8DA 3ZDYB 4C4RA 3TSCA 3IEVA 4BKUA 4Q82A 5K0ZA 4ZALA 3GLIB 1FFBA 2HCTA 2X9NA 4U7FA 1SCQA 3IUSA 1SIOA 3H0KA 5FPPA 1G20E 3EA4A 1OWPA 4RZ3A 2H0QA 2DECA 2CXPA 2WIBA 5AIAA 2IEZA 3K6SA 3ISJA 2DUNA 1RJEA 1K98A 3TPZA 2H2HA 3IQHX 4NP6A 1CUDA 3ZG6A 4HEQA 3B7WA 1WRBA 2GFIA 2C7GA 3DPUA 4QTUB 4KU4A 2Z9CA 4I4IA 2IV2X 2C94A 1I32A 4Q47A 3FCXA 1O97C 5IT5A 2ZBRA 2RGYA 3DWGA 3K9HA 2WYVA 1MF7A 2QW0X 2WHRA 3AERB 3GL9A 2PJDA 2J3QA 1ISPA 4U6SA 2GK3A 4DNQA 4ZGWA 2BCJQ 4PM4A 5AKYA 2AC7A 4HDMB 3GRRA 4NJEA 2LGJA 3D2BA 3HKCB 2FN3A 4MV1A 3KB2A 1EVEA 2ZBPA 2B8EA 2I7TA 3K1AA 1ZL2A 3ORFA 4I5DA 4RGQA 5IKEA 4K46A 2N1MA 1BDJA 1ODLA 5C53B 1E1QD 1VBMA 1A04A 1UQTA 3HBFA 1PJRA 3R0VA 1N9GA 2NO7A 2C97A 1XCPA 3EJ6A 3OOHA 1NQXA 3AHIA 1AURA 2BFCA 4I6JA 1TM5E 2QW8A 4MJ3A 2QR2A 4DMCA 5K2OA 2FDCA 5JJLA 1HOTA 2GLTA 3WNQA 2Q4BA 3DGEC 3LY5A 4CI9A 4G1MB 1UDWA 2OXCA 4Q93A 2D3TA 4QDOA 1DZIA 2W0MA 5L4LA 3WB2A 1FB5A 4HL6A 3KSRA 1Q1EA 2BMJA 3CLKA 2BGTA 2F3QA 1CQPA 2JRLA 1YMQA 1SUSA 3C15C 1FLAA 3F6YA 3NHJA 2P9BA 2XMPA 2OAEA 1KFEB 2I33A 3FKSD 3NWPA 2YN4A 2HPZA 4C04A 5K0NA 5CDUA 1RLTA 1E2NA 1XV5A 1DCMA 2F1IA 1N8NA 2WUWE 3GLHA 3K31A 3RVOA 3ZQ6A 4CM7A 4YMTA 4IG9A 5KC8A 3R3WA 2ADMA 4RIIA 4EHNA 1W5SA 2QF7A 4I8XA 1XRSB 1Z0SA 5D51S 4QULA 1SOAA 3QG1A 3QYPA 5EXEA 2ZR7A 2WHYA 1UBJS 3HJCA 4WASA 4WXEA 3K6KA 3ESRA 1QH8A 5ALLA 1VJDA 5HX7A 3UMJA 5LL6P 1G6KA 1THTA 3ETEA 1F20A 4GMXA 4RVFA 2FPSA 5DGXA 4DNXA 1ONOA 2C4KA 2H65A 3GOHA 1OAAA 3A9SA 3H6GA 2OD2A 1TDJA 1Z2PX 5DYWA 1P2SA 3KYDB 1KR2A 3KFXA 4LECA 3RTAA 4EABA 3SYKA 3LDHA 3LTNC 1E1CA 2NXCA 3R7NA 3T9FA 2PRJA 1TI7A 1IEVA 2QZSA 4YDRA 3KPWA 1Z5PA 3IKTA 1UBEA 2WVHA 1EINA 4D9MA 3QELA 1TT5B 3FKJA 1M1YB 1MTZA 3CTPA 4DMFA 4U7TB 3OIWA 1F38A 5CVCA 4BAZA 2X15A 3EX7C 2WICA 1O7JA 1QVRA 4OI4A 1ZX1A 1B8OA 2CL6X 3O5AA 1RTTA 1U6JA 4J0QA 1E9CA 2FZCA 4BZXA 4I5FA 2ABWA 1DP4A 2GK6A 3NORA 2H2IA 4YJ2A 1Q44A 2YHIA 1N4DA 2F17A 2JKZA 4EGJA 1KH1A 4RHTA 2BGIA 5AHRA 3ECCA 3OCCA 4JA0A 3O4GA 2DHQA 3EPKA 5BPHA 1XJQA 3ZIUA 4CEJA 1BE6A 2JW5A 1ZMRA 2Z30A 1KDVA 4YEDA 1XDWA 4URWR 5DNWA 1THGA 4P0QB 2WKWA 2QL5A 1Z4JA 2O1SA 1IMOA 3N8NA 3QKRA 5TGTA 1E3JA 2AD1A 4MRAA 1SD1A 4KLRA 4BCDA 3HXOA 1DS6A 2LDBA 4HOYA 1U0FA 1F8GA 4CNQA 1DBPA 1X2BA 1Y42X 5EKDA 1U1FA 4E4RA 3P9NA 2PPLA 3SP1A 3UKJA 4GI5A 4M0LA 2IWHA 3V48A 2C5SA 3E03A 1KEPA 1XWFA 1P91A 2IXEA 3IBGA 4YA6A 4RJIA 2I3GA 1AN9A 3QQPA 4JMPA 3ASVA 5CLQA 5EE5B 1UXJA 4R8SA 2PMEA 1EZZA 2WFLA 2ZWMA 4UAUA 2Q6TA 4ZT6A 3LC7O 4J07A 1TMKA 2RI1A 5E9QA 3SM9A 4CU2A 4MDYA 1U4NA 4IUCS 3L8HA 1ZK4A 3LWZA 4EBBA 2Q2NA 4F8JA 3TMKA 4MAMA 2AGVA 3FJ1A 4KE8A 4QOIA 4B7XA 4YCMA 1MJGA 3AM5A 5BN3B 3NVDA 4HNRA 3GX1A 4Z4EA 1OFHA 1RRMA 3A28A 1YK0A 4JP8A 4QATA 4QYIA 3TE6A 3LY9A 1NN5A 4JLAA 4X9XA 2ISQA 5BWMA 5CXUA 4WLNA 5JO0A 1T6ZA 4H6WA 4GU5A 2JAUA 4EYQA 5DO9A 5B4VA 1HTWA 1LS6A 4RJ2A 2WEKA 1F5NA 2FN9A 3L7AA 3RUPA 3TJZA 1W76A 5JZBA 4JB3A 1SKQA 1C1DA 1UQRA 4TL6A 2FG5A 2WFAA 5D3KA 2IYRA 5EL0A 5EYPA 5IC5A 4IH9A 1PWYE 5LDDC 4D9KA 4DLNA 1VYVA 2R66A 4EG4A 4W1RA 2I91A 3AP3A 1ULUA 3HY4A 5DI3A 2XHEA 5HDQA 1XZEA 4DF3A 3N1UA 2BE7A 4QRIA 3MNFA 4HUQA 3MB8A 1QR2A 2XQFA 3QSYA 1CJSA 1VM6A 4RPJA 4Z0PA 1P17A 4MIEA 1Y34E 1XVLA 2W2NA 1KYQA 2GO7A 2WF6A 1N2ZA 5A71A 2R79A 2Q5LA 3IBCA 3L41A 1UBUS 2P6OA 4LVOA 1JHRA 2HLNA 1U9CA 1ECJA 5FFNA 2HRBA 3AWIA 3ZGYA 4H6XA 2IIPA 1W85A 1XQ1A 1G8KA 4HDOB 3H7IA 1W59A 2HU8A 5JASA 1H1LB 1MRZA 3NTXA 1YGPA 5BN5A 3RSSA 1TJNA 5ADVA 3ZI7A 1NNSA 1YVUA 2XDYA 4JKYA 6NULA 2V7PA 1ZN8A 3GN1A 4HX2A 2ZI6A 4J1NA 5BXQC 1G98A 5JWOA 1HFJA 5ALKA 5EP3A 2H52A 3PGA1 5K05A 1BTOA 1T3HA 4IXNA 5ICEA 5KJFA 4WN9A 4C3ZA 2CXOA 2IF0A 2J48A 2EHDA 3FW1A 3G0IA 3IIEA 3PNBA 2IZ0A 4RD1A 5DN6A 4ZVMA 1W47A 1LB1B 5BYBA 2OORA 4H4DA 1YU6A 3GFQA 3HRHA 4YREA 3HN6A 4QJ5A 4Y9RA 1CZLA 3VPFA 4BNZA 1J2JA 4FYKA 2Q6IA 3VHQA 1DIAA 5KJ1A 1P18A 2CMHA 2D62A 3NBKA 4LWZA 2FZGA 2JGKA 2V74B 1RQRA 3EASA 3GFPA 3IFSA 1HC7A 1P5JA 2RI6A 1NMYA 3S40A 3E9ZA 3S55A 3W7VA 3E1KA 4KO1S 2XMCA 1YOVB 16PKA 4C08A 2MJLA 4BO0A 1T0JB 1H5QA 1JQJC 4GH5A 2V1UA 3QRWA 4KLCA 5EE0A 1ZJWA 3ED1A 2NSLA 1U02A 3R7DA 4DC0A 1XQVA 1LV8A 1JEJA 2GVDC 2HL6A 2VOEA 3DHWC 3M4JA 1PJ3A 4R2IA 1HK7A 2I4IA 3UFBA 1MAWA 2WPDA 4DHWA 2JLZA 4LF5B 3ERCA 1HE1C 4XCVA 1FQKA 1P60A 2LDXA 3JV7A 3PKIA 4HP8A 3JYQA 4Z4FA 2HT1A 1XWIA 4KPUB 3R3ZA 4Z51A 4R2KA 3BF7A 2AE2A 2PS1A 1H8ED 1GNLA 1OFTA 1UEJA 1G2IA 3CTMA 4IH4A 4GR9A 4OQ4A 3ROMA 1I4DD 2B21A 3ODGA 4M7PA 3QGMA 1GL7A 1O94A 1XMJA 2PV0A 4R7GA 4L57A 3MMZA 5G1PA 5J4VA 4B7UA 3LDUA 4Z0TA 2H7YA 4F6CA 3N3AC 2O2XA 1BGXT 4OFBA 3TQFA 4YUWA 1SZJG 1E9BA 1QYCA 2IEDA 3ONDA 4QG3A 3ONVA 4EI9A 2O2DA 4NAHA 3D8RA 3LHSA 3CLTC 1X70A 4N1AA 5JC8A 3T4UA 1PG5A 1UBKS 4CCAA 1WO8A 2XYGA 1NUQA 3ORQA 1Z6QA 1MB2A 3AV3A 4JBIA 2E21A 3SQOA 1KHTA 2WSBA 3WB0A 4QVIA 5CH5A 2GM5A 4KFSA 4O4JF 4KITB 1MJ5A 1NUPA 3C70A 3UBTA 1E63A 2ZRCA 1CB0A 3DQPA 1S3IA 3R6LA 4N49A 2DWQA 3EPRA 5JEDA 3C3JA 2ZIFA 3L0IB 4HNGA 1RI1A 3F6EX 2FRXA 2IX9A 2CWDA 4HH4A 1AGRA 3OO0A 3PNQA 3L0CA 4RH1A 5EJGA 3RJ5A 3UWOA 4AQYB 4R1PA 2EFEB 2JDID 2YJ6A 3A6KA 3MJ4A 1R27A 1NW8A 3BGVA 3BL8A 1HWYA 4MUMA 2F8SA 3JPWA 1Z39A 2AFIB 2Z3WA 4QDXA 5I4IA 1XK7A 3HQ4O 3FCAA 1PFWA 1MMFB 4Y2JA 5ERXA 3UCEA 1RZVA 2QKYA 3PC7A 4TV8F 3HGMA 1T15A 1ISIA 3T7KA 4QVGA 2Q7XA 3GZ4A 4F3KA 2ZULA 5AHXA 3ROZA 4DHEA 1FJXA 5A03A 2QVLA 1W8IA 4ARIA 2OWEA 4L08A 1RW4A 1V0JA 3LUCA 1Z33A 3CNBA 4G26A 3MCTA 4W6ZA 5AOBA 5KDOA 3I62A 4MKHA 1S2GA 2CKMA 4INOA 5LDGA 2GJ9A 1Z34A 4KQWA 2E4WA 3TW8B 5LMUB 1LF0A 1VG1A 3H9EO 2JPDA 4KX3A 3IA2A 2F3PA 5G41A 3T3HA 5HGXA 1OCEA 3AVQA 1E0DA 1KYTA 1T8RA 3BJEA 2Z2IA 4AYTA 2HCRA 4POOA 3COWA 4XSHA 3ZY6A 2MCFA 1LX6A 3COPA 4GUAA 5TQ0B 2ZOSA 3MJVA 3LNTA 5K5EA 1VFPA 3E4DA 2NNWB 3KV3O 5HF9A 1NKTA 5JJ5A 2V03A 2B98A 2W6MA 3ND6A 4GMDA 3STWA 4IJ6A 4MW7A 4PCAA 1KYIA 3QFHA 1C1XB 4UEKA 2GZSA 3F9CA 3GFSA 4K2HA 4WLUA 2JK1A 4PAQA 3V2IA 1II8B 3HJFA 2WJPA 5ALGA 1ZYUA 2RJOA 5CAEB 3URKA 4QPJC 4LJAA 3NXKA 3OKPA 2DR2A 3AM4A 1WW8A 2C54A 2R8XA 1MO2A 4FC6A 1Y8CA 3FMOB 1F14A 3R76A 2WYHA 2DUMA 1XLVA 4CM4A 3UUGA 1IUNA 2ASVA 1JZSA 3CM0A 4BFYA 4UPDA 2OLKA 5AKKA 4X60A 2JGDA 1HXHA 2XZPA 3IPRA 3OQHA 4RIEA 4XGRA 4DABA 1R2QA 2PV7A 1Q0SA 2H07A 1PYGA 2WTEA 3CF4A 3NYQA 3CMMA 3RV4A 2WNSA 1K8ZB 2IYNA 4F3RA 2F1RA 3N2LA 1QDUA 2VH1A 4IDAA 2VYND 1OBVA 2PZAA 3PNOA 3WLAA 4BZZA 4OG2A 4UTNA 1JG6A 4F4IA 1SU8A 1BJTA 4MI9A 4AI6A 1QHSA 3TSYA 2AZMA 4BMVA 2WINI 1FP6A 1LW6E 2Z6QA 2Q8PA 1RIIA 1DHTA 3GGSA 1ZMXA 4TWJA 1SCUB 2XOKA 3QU2A 4EW3A 5T4BA 3SJUA 1CRWG 4H3KB 5AJVB 1GL3A 4BFSA 4O08A 1P31A 4O3FA 4I66A 2NYAA 3KZMA 3G82C 3EDQA 1W0JD 1LA2A 4P7KA 2NYRA 1IIBA 3BXPA 3WGGA 1KI2A 2D1QA 1Z4NA 2PO5A 5F5NA 4NBLA 3P1JA 4I4NA 2X6RA 2BMDA 5JC1A 3ZW8A 4ZDKA 1XCJA 4YDHB 1P73A 1CQXA 4UHBA 1YQWA 2YXEA 1X7DA 1WKCA 4K6OA 3NWJA 1RC0A 3L4BA 2BP7B 1AKRA 2ATIA 4H1VA 5C3UA 2C1EA 3FTFA 4NMMA 5COAA 3RD5A 1Z16A 4G0WA 1IEQA 1H2AS 1QM5A 1FSGA 1A8UA 1Z45A 4IVQA 2O20A 2RHHA 4P6VF 3L8ZA 3GLFE 3CXUA 3ZGOA 5LZ9A 4KYTA 1RI5A 3H4VA 4CV1A 3CRZA 4H3VA 3W5VA 3KZ1E 1YR2A 1KEEB 3P9ZA 3VDXA 4MAFA 2IHUA 3VO8A 1OFVA 1YR8A 4XCXA 3ZEAA 2GAAA 3NEAA 4ESOA 5U9CA 3EOBI 3SU8A 4CQMB 4PYNA 4ZJUA 1CQJA 1PL0A 2BMEA 1JQKA 2DBZA 3I8SA 4BV8A 3ZGVA 4HJRA 1P0MA 4UMEA 4NARA 3UJ6A 1VE7A 4JLNA 4AECA 3L7DA 1QU2A 4MQFA 4PZ0A 3B9QA 2DTDA 4TV8B 3WLLA 4X91A 4C0AC 3HHEA 4QXPA 1UM8A 3V33A 1HV8A 3FSGA 3FCYA 4FFLA 2CNWA 4LVCA 1IN5A 1D2CA 2BUBA 5ED4A 3RJ9A 1XXLA 4BMDA 3NOVA 4MQMA 3U31A 1QAMA 3JQDA 5AW1A 1MNAA 1YBFA 2WSSD 4GF5A 4BO3A 4PO1A 1NFFA 3TGWA 3UT0A 2QYSA 3INGA 4G0MA 1BDHA 3M2PA 3U26A 2CLMB 3I2FA 4OUKX 1GIAA 3TEMA 4BC0A 3EEOA 2GPSA 1FDWA 1UC8A 5B37A 4BFTA 5LP6F 1YB4A 2FPXA 2QZZA 4MVWA 3EFBA 1SG9A 1XC7A 2MSEB 3GLSA 4QQRA 4ZT7A 3RYHB 4DLKA 4FBMA 3VTAA 1UAAA 2ZSFA 2E1RA 4QA9A 5CTAA 1AGYA 2X76A 1CU1A 4IX1A 1FUEA 3G0CA 2ZRGA 3HMQA 3MM4A 3U4GA 2PD6A 4TMXA 4HN4B 1OXBB 5LWQA 2W0SA 4KX5A 2H2FA 3LX5A 3SR3A 3TH5A 1JQEA 5B7GA 1UF9A 4PIPA 1CJCA 3AFNA 2GWRA 3JALB 5LIRA 3FF1A 1X1RA 4LV8B 5G1NA 5EZ5A 1ATIA 5BQXA 4BGDA 3U7QB 2V7GA 2EX0A 1H93A 3E8MA 3GQVA 3NAZA 4KLNA 1GSAA 2G4CA 4KTTE 4QHSA 5LYJA 3ZWVA 3KZVA 3V55A 1L5FA 3OOJA 2WMOB 3Q0TA 4RJJA 4P9NA 3BVPA 1F2TB 1PLJA 3L8GA 3M6UA 5HKKD 2UXBB 2G76A 4R2XA 3VR5A 1E2HA 1GQFA 5D3ZA 3VOAA 5KC9A 2OGTA 4IEEA 3L06A 4RF4A 2R68A 4Y9UA 4KQEA 1I24A 3PE3A 3GR6A 1NBMA 2JD0A 2R1VA 2WBLC 3LP5A 4PR3A 4QDJA 1R00A 3QJYA 5LQMA 3J80A 2NZUG 1EK2A 4PNEA 2XMRA 4FD3A 3PRKE 5EY5B 1C14A 3OPYI 4G1EB 1VG8A 1CK4A 4JYCA 1U28A 1XXHB 3GWGA 1YQUA 1KS9A 1OX6A 3BILA 3ADPA 4R3UC 3FUTA 3LRTA 4ENVA 4AG5A 1GA1A 1AHNA 2B94A 4YRIA 4GYKA 1F06A 1MEOA 4JC0A 3BGSA 2IA5A 2PX0A 3AIKA 1WKVA 1Z6GA 3R20A 3GDHA 3I9V6 1VIVA 1TOAA 4RS3A 1P2FA 1JU3A 2I66A 1U98A 1JJVA 1GWNA 2MYTA 4OQQA 2CVPA 1VJGA 1QV9A 2CMGA 4PYMA 4Q9LA 5CT8A 5HF6A 5SYNA 3ZW7A 2WM3A 4ALIA 4Q0MA 1OUMA 4D2IA 4YDQA 4LGYA 3UB2A 3C45A 3OICA 5K20A 1TLFA 4DLYA 3FWPA 3RQSA 3WA6A 1KZGB 1O95D 1YAJA 1S3FA 1UBRS 4RVSA 1PV2A 2A1UA 4WEOA 4ETIA 4RJTA 5JS7A 1NP7A 1N2HA 4DLRA 2C5BA 1WDKA 2O06A 2VG8A 2GUGA 5JDCA 3ICWA 3PL1A 1B8UA 4MR8A 1N0HA 2D1SA 4MVYA 2IDKA 3E4CA 2XTMA 4KV9A 4EA6A 3F6CA 1SOUA 3FWKA 2B5WA 2V6BA 4OHWA 1KPIA 2W8ZA 3PI6A 2E4AA 3PX2A 2VA8A 4KXUA 3DVLA 2H51A 4TWZA 5BO5A 4K9SA 1IE3A 4DARA 2GAJA 2UU9B 1AOXA 1U7TA 4HDNB 2BT4A 3R5JA 3COYA 4KB5A 2D7DA 4ITUA 2VHTA 3A9RA 3O8LA 3QYJA 5ESDA 3FOEC 4UPEA 2BKEA 4XWAA 1A4XA 2AI3A 4N54A 3G6WA 1IAQA 1U4SA 4LHEA 3P9KA 3WAJA 1LK7A 3QK7A 4D45A 1B3RA 1QP7A 2OO7A 4CTJA 1UZMA 2CYAA 4ZYTA 4J6FA 1E6LA 2BDEA 2FEMA 2ICAA 3GT0A 1KQ3A 3HKEA 3ZW9A 4M9UA 5IJ0B 5JPCA 3N2EA 1RRPA 1YVPA 4CF4A 4MS1B 2C4UA 4AJHA 3AUKA 3G2NA 2V97A 3TLYA 4LDNA 1PL8A 4DQUA 3SEFA 3FGPA 4KQ2A 5KJEA 1DX9A 3KEMA 5EJFA 4FN5A 4OMUA 5EMMA 4RTQA 3AY6A 3DLTA 3R5XA 1ZOIA 5F5LA 2XYVA 3H04A 1P7VA 3N74A 1OOEA 4XVCA 3RVKA 2P9GA 4HHEA 5DHUA 3D7NA 2J9XB 2Y0BA 5FTJA 1UOPA 2X0KA 4JI7B 1UXKA 2P6RA 2KW5A 1W35A 4RDCA 4RGVA 2IV7A 1TRKA 5JS2A 1T25A 1JVBA 2QXYA 3OMWA 3OURA 3AOEA 1JEOA 5C8XA 1P0CA 3ZWWA 5G1OA 4OI1A 1I7PA 4JUIA 2X4LA 3WLEA 2X7HA 1HLGA 2C2YA 2Z3VA 3IHWA 4I1OA 3P2EA 1RKXA 2O3UA 3ZD7A 1I1QB 2UV8A 3Q41A 5EJ2A 4KOAA 2CNWD 1AVTA 4DNFA 2HMSA 3K30A 2FX5A 8ATCA 1JHAA 1PGOA 1P2GA 3OD1A 1QS0B 3TSZA 3RRMA 2FEAA 3BREA 3NC4A 1YQTA 5LBUA 3BC1A 1P81A 5IJ9B 2H6EA 2GKOA 1E0JA 3L8CA 3CJRA 4G0ZA 2X0DA 3O8OB 1E6CA 3CZRA 4TYWA 2V7VA 3OOWA 4QQFA 4NWIA 5FPQA 3PDIB 1ZHHA 2QM7A 1JEYB 1EX6A 3H19A 4HFJA 4CF6A 4ZHQA 5IVHA 5SZIA 1DXQA 1TAGA 1ZCFA 2JASA 2RGDA 3FR8A 4XUEA 4F93B 2IPMA 2X9VA 4WZZA 3WOVA 3AZQA 2BELA 5LYJF 1GPBA 3HABA 4JLKA 1L2TA 1QNFA 1YVRA 3BMQB 5A9SB 4U5XA 4HMOA 2PZGA 1TQ6A 2HQSA 3Q0EA 4BLVA 3B2NA 4AL4A 2AMFA 3M3PA 4LKOA 3UUEA 4NPHA 5EWLB 4JLPA 4DQ0A 2PS9A 4AKIA 4HNSA 2RBEA 1TKBA 2CLKB 2WYWA 3IPAA 1W1UA 4PZDA 4BVHA 4DW8A 3C3PA 2IUYA 1DBSA 4GR5A 5ALPA 4XH9B 5DIFA 5FNVF 3S2EA 3UG6A 5KMGB 3JQAA 1QMPA 2V9ZA 1KI6A 1ZBDA