1TK9A

Crystal structure of phosphoheptose isomerase 1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
188
structure length
188
Chain Sequence
MSLINLVEKEWQEHQKIVQASEILKGQIAKVGELLCECLKKGGKILICGNGGSAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFVFSRQVEALGNEKDVLIGISTSGKSPNVLEALKKAKELNMLCLGLSGKGGGMMNKLCDHNLVVPSDDTARIQEMHILIIHTLCQIIDESF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoheptose isomerase 1
publication title Crystal structures of two putative phosphoheptose isomerases.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Isomerase
total genus 76
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1tk9A00
1VI5A 3FKJA 1X94A 1KOJA 4B3SB 3CVJA 4JI0B 2VF4X 4DUZB 1U0EA 2UUBB 2UUAB 1HNWB 1B0ZA 4LF5B 1N8TA 2CB0A 1TK9A 2AMLA 3C3JA 4X66B 2PUVA 3UJHA 3HBAA 1DQRA 3OTOB 4DR4B 4S12A 2VQFB 2XBLA 1G98A 3TRJA 4JI3B 4AMVA 4DV6B 4DR7B 2DECA 4LFAB 2X3YA 3BCHA 3FXAA 3BJZA 4LFCB 3TBFA 1GZDA 4U6NA 1HNXB 4TOIA 1X9HA 5LMUB 1TZCA 3QKIA 5LMNB 2CXUA 2I2WA 4LFBB 3HJBA 4DV2B 2CXSA 5I01A 1M3SA 4JI6B 4B3MB 4KHPB 1NRIA 2PGIA 2ZJ4A 2E5LB 4DV0B 4X64B 3SHOA 4DV7B 3FJ1A 1X92A 1VI6A 4YY3B 3JAMA 4DV4B 1XNRB 2HHHB 2CXNA 3KNZA 1FJGB 1IBMB 4DV3B 4OX9B 1XTBA 2PUTA 2YVAA 4JYAB 3J7AC 1GZVA 4JI7B 1IRIA 1VIMA 4X62B 1JLHA 2CXPA 1IBLB 4JI4B 2CXRA 1HM5A 4DUYB 1XMQB 4DV5B 1N36B 1IATA 2CXTA 2I22A 3G68A 4DR3B 4LF4B 4LF7B 1N34B 1C7QA 4IVNA 2UXBB 1N32B 2CXOA 5FLXA 4LF6B 5BY2A 4DR5B 3J80A 2J6HA 3I0ZA 4LF9B 4JI1B 3J81A 4JI8B 4EM6A 4LF8B 4GKJB 1J5EB 1JXAA 1U0GA 2XHZA 5LL6P 3IFSA 2CXQA 2DF8A 2UUCB 3FF1A 3JX9A 1ZZGA 2E5FA 3LJKA 4GKKB 4M0DA 4B3TB 1JIQA 2PUWA 3OOJA 4S1WA 4DR6B 2UXCB 2VF5X 2A3NA 4B3RB 3NBUA 1MOSA 1MOQA 1HOXA 2F4VB 2UU9B 2ZJ3A 1MORA 1WIWA 2O2DA 4DV1B 1Q50A 2V4MA 4YHHB 1U0FA 4DR2B 1I94B 5A2QA 2O2CA 3EUAA 4X65B 2VQEB 2WU8A 2ZM6B 3T1YB 4AQYB 4JV5B 1XMOB 3PR3A 5IT9A 4DR1B 1XNQB 1HR0B 4NXMB 1NUHA 2Q8NA 1X9IA 2CVPA 4LZJA 3Q7IA 2UXDB 5IWAB 4JI5B 1TZBA 2POCA 4JI2B 3T1HB 3Q88A 1T10A 3ODPA 5BR8B 1HNZB 3ETNA 1C7RA 1N33B 4NXNB 1JEOA 3M5PA 1J5XA 1IBKB 4K0KB 1VIVA
chains in the Genus database with same CATH superfamily
3M1AA 1JIJA 2H18A 1NU8A 2BHLA 1D6JA 2QPTA 2R66A 3ASVA 1ULZA 2QD2A 3LPMA 5K3FB 3T7EA 5ICMA 4FHZA 1K7CA 4G0VA 3R6LA 2DBQA 1POWA 2PBRA 4M0PA 3RRMA 5KVAA 4OYRA 2C9MA 2WHPB 1F2VA 4MS1A 2ZB4A 3PFKA 1GKUB 2JFOA 4Y2JA 5JYCA 2Q1XA 1TPZA 4G0NA 3KB8A 1AQIA 3M8KA 4C4TA 3QEJA 2I7TA 4NNJA 4S0ZA 3BG5A 1A95A 1I3MA 3AR8A 3PKZA 3QV2A 5ER9A 3PUJA 1VBKA 3CNQS 4G2TA 3E4DA 3NVDA 2C5FA 2JAWA 1XQ6A 2YWEA 1ZJYA 1VE5A 3W3ZB 1M75A 1GO2A 3U3JA 3S44A 2WB2A 5JVDB 1NRIA 2ZYWX 5CJ2A 2H52A 3QXSA 1AF4A 2HDHA 1ENZA 2WV9A 3LQFA 4A2PA 5KYTA 3AVYA 1I7NA 5TGTA 1XN4A 5LQSA 2VHEA 4JQSA 4JT8A 1G21E 2A78A 1R6TA 2PR2A 2W83A 3OP4A 1G16A 3TCKA 4OX9B 1YBMA 2EKBA 4TGLA 1USKA 1VGQA 3MD9A 3W2FA 2IHUA 2OZKA 2YY6A 1SXJB 2AJDA 3BEOA 2JK0A 4K9DA 5TVKA 1BO6A 3CRVA 4A8TA 3TF5A 3OFNA 4NMXB 4ARZB 3PQEA 3M82A 4OHFA 3LZ6A 1A82A 5KTTA 1Y80A 1N3IA 1BE6A 5EWMB 1J2YA 2XI4A 4PX5A 1ZOIA 2H2IA 4H7DA 4QTTB 5EJFA 3K8QA 5AW9A 1QUEA 1GRVA 1XCJA 4OO3A 3TZBA 3V1NA 4YV0A 4J0JA 4DB2A 3DCNA 3GCZA 2ZJZA 1HEUA 4IIGA 4M9QA 2JA2A 3E23A 3HY4A 4M1SA 4UARA 1J33A 4UBOA 1SFRA 4MV9A 3EARA 4YMUA 1UANA 1WZEA 2QQGA 1JHPA 2QZ4A 4LJ5A 1MEJA 3G1TA 4KHZA 1QVZA 3BHMA 3PU6A 4M9UA 1XAHA 5FWXA 1LX7A 4JR1A 1Z0AA 1VKHA 2PUWA 1DC7A 4QYSA 4UZEA 3CH6A 3RUFA 1ZI8A 2BGJA 3ANSA 1I7PA 4I55F 1LF5A 3AJEA 3VO1A 4IOKA 5J2TA 3B82A 1M1NB 4UUMA 1GZ3A 1KJ9A 2O8FB 1NNI1 2H3HA 4FB4A 1XYGA 3EOZA 4HUJA 3DDWA 4MI3A 3VH2A 2X58A 3QYJA 4WTOA 4E2XA 4I4LA 4ZGWA 1OD6A 5AVZA 1XRJA 3MMNA 1I4DD 1PVOA 1BAPA 5EIFA 4CKYA 3JPWA 1HE2A 4XRRA 3PQ8A 2ZIXA 3LBNA 2GTHA 3ADBA 3EUAA 1M2GA 3G5UA 4RZHA 3VJRA 1Q92A 4C0AC 2OHHA 4Q12A 3FDXA 4A3SA 5H70A 2HTEA 4Y6LA 2NPIA 2Z6VA 2VBIA 3LUHA 3FH0A 4JLNA 5KS2A 1DFGA 4X91A 3RC8A 1GP2A 1UC9A 4PO9A 2XE4A 4DSNA 2VUTA 1G20A 1TO6A 1UBGA 4PRZA 2BMVA 3AHCA 2PU7A 1PJZA 4FYIA 1JQLB 2F00A 1JEDA 3DF9A 4TYNA 2WPDA 5FO0A 3W8EA 3QPBA 1JHOA 3FLMA 2I6XA 5AIAA 4J0CA 4LC1A 3JQBA 4PAWA 1BDIA 3U4GA 4Q4LA 3PF9A 2KJQA 3IX7A 4U02A 2OY0A 3H4TA 4OI1A 1YQQA 3ZV4A 4F9GA 4FCTA 1PYDA 4D26A 1PEKE 3GOHA 3I9FA 4LVCA 2V9PA 3NJRA 1IZ7A 2JJYA 3QEMB 4GM0A 4CM7A 4GX0A 2Y0DA 4IGFA 4ZJUA 3UICA 4L85A 2WABA 4QSHA 2VJOA 2JJQA 3SX4A 4HH1A 1U4SA 4PV7A 3WV4A 5JZOA 5LQNA 1MABA 1W85A 4RTRA 4NXNB 2V8OA 2ZTLA 1S8AA 1Q12A 3QW2A 4GS5A 3H87A 1BDMA 4W5OA 2P41A 1I7LA 1XI2A 1Z73A 2IQIA 3KR1A 1NVVR 4HLNA 2W6IA 2I3BA 1AGYA 4MEAA 3BWDD 4X1KA 1GN8A 1Y9ZA 2P4SA 4MV1A 3I58A 5JIBA 5KJ1A 5KYWB 4B82A 2YNMA 5JE8A 1UJ6A 4BRZA 3JAMA 4K6GA 1CBUA 2C9ZA 3INRA 2XIQA 1PJ2A 1X7WA 4G63A 3GFOA 3U09A 2H0RA 2NYUA 3ZJTA 2FWMX 1A4XA 1OPRA 2QRVA 3DEKA 3EODA 4IWNA 1I6LA 1RW4A 1W0CA 2PA3A 4QBTA 4RS4A 3DFMA 3GJ7A 3NUQA 1U90A 3S27A 2H4HA 4AJ9A 5MN4A 5KTMA 5GJBA 2OO7A 1V6SA 3SNHA 4A16A 4HNQA 1E2IA 2RGAA 2HIGA 1NBEA 3TR5A 1X77A 4N3NA 4GP7A 1EXVA 5IC6A 1OU4A 4C5CA 2CNDA 1RPJA 2JFFA 2VP5A 4AJIA 2UXBB 4PLYA 4FYYA 3I9V6 3Q3HA 3SD7A 3UJ9A 4CKWA 3GLIB 4X1IB 2RGDA 5KVCA 2Q99A 2GLTA 3AJRA 1FU4A 4JI8B 3LSTA 1AF7A 3EC1A 1XIVA 3HM2A 4CL2A 1YAHA 5KTRA 5JYDA 3IQGX 3RRJA 1QIHA 3HO8A 3TKAA 1UODA 1Z08A 1CJTC 1JDSA 4CUKA 4PIPA 4AN4A 5LFAA 2H5IA 3KVRA 3SHQA 1SB8A 3HHPA 1QHIA 4CLHA 1NQ5A 1VP9A 2CMGA 1WTCA 3ZN2A 2O9JA 3EGEA 2DWOA 1IOVA 3SHTA 1QFJA 3TLJA 3DLIA 1T6NA 4TPKA 4RV9A 2P27A 4DIMA 2VH1A 1A7KA 2NU8A 3SJBA 3KTFA 4A0GA 3EG5A 4JP1A 3DMNA 1TAGA 3ZXSA 5FT9A 1Z15A 3FCUB 1VLHA 2JGAA 3ZGXA 1FSSA 4EG0A 2VQ3A 2O2HA 4W5RA 1RE1A 3O94A 5E6SA 1V47A 3GDGA 5A6SB 3TLKA 2ZR0A 3R3YA 4CF3A 5JNUA 4MLZA 2PBZA 5CGQB 1TM2A 2V6JA 2Q8NA 3FKSA 2OXTA 3CXRA 5CFZA 2VDNB 4MVJM 1ISMA 2HA0A 5DW0A 1OT3A 4BLPA 1SBZA 4BQEA 3D4IA 3E48A 4DSTA 2AC4A 4G9BA 4L6IA 4YUZA 2C92A 3M33A 1DG1G 3MHPA 1KS9A 1ZK4A 3WG9A 3L6UA 4NJEB 3TMKA 3SIWA 4X92A 3VNQA 1GGMA 4FNOA 3JATA 2IS4A 1PEDA 1KOJA 1TCVA 4Q6BA 2JJ1A 3OEYA 3ZDRA 3GJRA 1G18A 3HRKA 1J9ZA 3JRXA 5FTNA 5JLJA 4K87A 5GIPE 1C7EA 3K0FA 2OG1A 2FF7A 2RKWA 1SBNE 3RYHB 3HTXA 3V1UA 3D3KA 2PLFA 2Z5FA 4OB6A 3W79A 4DMUB 3J81k 1FU8A 3ZD8A 4NEGA 5DSXA 4RYDA 3LUKA 5BOSA 4EHJA 2IHTA 3MJTA 2ZRFA 4PYKA 3DMPA 1ZOPA 2HCRA 2JAHA 1PCXA 4R5MA 4BBAA 4QRDA 2C4UA 2WQ6A 1EBUA 2Q4DA 3E2PA 1A71A 2DGDA 1BHO1 4YEDA 1YTUA 5HBRA 2C96A 2ZCJA 5HFJA 4HUQA 2R65A 1JA9A 1ZEMA 2Y0EA 1Q2UA 1T0UA 2ZE8A 3TUIC 5T41A 3A8TA 1SU4A 1LLFA 3WKBA 2IXBA 2QM3A 1QIMA 2GN9A 2OPBA 4MKZA 4IS3A 1XD2A 3HUEA 2WD7B 3A37A 1VSTA 1RBZA 3SF0A 5DN6D 2E3JA 2I2XB 5EJGA 1RPZA 3IIMA 3ETLA 1C9JA 3BXOA 3HGMA 1TOAA 3WIOA 4NOMA 1I1OA 5JS8A 2VP4A 2BFOA 1ZVKA 3GP8A 1ETUA 3C8MA 1T3GA 3EQ9A 3E5MA 5HE9A 3TH5A 3D3JA 4EJ6A 3I30X 3P52A 4GQBA 1XAJA 4DUYB 1SRQA 1CP3A 5I5EA 2RGUA 2QWXA 2V6MA 3RTDA 4EHNA 4ZC8A 3C48A 4CL0A 2AMVA 1ZZEA 2R5NA 3N28A 1R8QA 2GXQA 3K1YA 3P96A 1XROA 3OUUA 2NZXA 1Y3CE 4B5KA 2IP4A 1ESMA 5CXSA 5BYJA 3M6AA 3ROGA 1JFSA 1BX3A 1QMGA 3HKBB 1N7JA 1XEAA 2H3EA 4WCFA 2C8VA 2Q5JA 4TV9F 3VJKA 3AL0C 5HF8A 3LV8A 2VJYA 4J75A 4NI5A 4GVLA 4UAVA 4C0XA 3ZGLA 6LDHA 5AW1A 3NOXA 2VHTA 4QTYA 4YRKA 2VZEA 3PNYA 4KPYA 5DBHX 1FMJA 2ACWA 3EXHB 3RVQA 1K4YA 3K70C 1DX9A 3QX8A 5CNKA 4QDUA 3QXCA 1QHGA 4XDYA 3T3GA 4FI3F 4N12A 4EKDA 3NETA 3QE3A 2QMQA 5TV2A 3W4KA 5GP1A 3P1JA 2AZMA 2PSEA 4BAZA 1P1KA 1O97D 1PHRA 1FSFA 2FR8A 3QA9A 1LSOA 3KCNA 3RG8A 4LOAA 2RGNA 1BEZA 2Q3HA 4K6MA 4M1KA 2QV0A 2P6PA 4GPZA 3RYFA 3UA4A 5A2QA 3RNOA 2XB8A 1CSEE 4RZ3A 5JOQA 2NTJA 1DJMA 5F3RA 2C54A 1FUIA 1WMFA 1VQ1A 2VVTA 4YFYA 4P98A 1QF6A 4DUPA 1XUOA 3EEQA 4QG7A 2PXHA 4QOJA 3I2JA 1FBNA 1XZFA 1YRAA 4RO0A 3ZDQA 3AM1A 1QO0A 5I7AA 3SZUA 2YWGA 3GVCA 1RZUA 2CYAA 1TO2E 4CN9A 1VG8A 2VOJA 4WKBA 4P86A 3V4OA 4AG6A 3MXOA 5IDYA 4BKQA 2AWNA 4X7MA 1U1EA 3FSRA 3PA6A 3G82C 1GG9A 4KO3S 5IM5A 3ST7A 1Q7GA 2G77B 4EHKA 4LSWA 4QDZA 5L6MB 2WF5A 1NT4A 4L8WB 4XFDA 5FWXB 2QKYA 1H9BA 2REOA 3PEFA 1U8XX 3WAGA 5K7SA 1ZL0A 4NBSA 3P20A 2GERA 1SIWA 4UQOA 3A4LA 1JIIA 5J2TB 5F12A 2VAWA 4AJJA 3VSBA 3NT4A 1J7JA 1JXQA 3CEPB 1F2UA 5C4IA 1Q1BA 3DP7A 4BIIA 2I7VA 3AHHA 2WKSA 4H17A 4HDSA 4RKQA 3JTMA 3UGQA 3WWDA 2ZIXB 1YDGA 3KD3A 3UFXB 5A62A 3IEVA 5BN1A 1RIIA 1V3UA 1KO8A 1WBJB 3HB4X 3FYDA 3Q3CA 4KTTE 4RMHA 5AKHA 4CKXA 3KR9A 2FQ1A 4YUYA 2R4QA 3ENNA 2VUIB 1AN9A 3E7DA 4FHGA 5JEEA 1NAIA 2D4AA 3M6VA 2XCTB 2ZAYA 5AKIA 3RRBA 1JX6A 3UWPA 4IM7A 4LBZA 1ZM3A 4LNUA 1FFXA 4V1CA 1EAYA 2R68A 4YJGA 2I3DA 2C2MA 3QWHA 2AB0A 2JBWA 1PWYE 2V1XA 2ZRAA 3AW9A 3HCCA 3QKRA 4M9RA 5ED4A 1S1CA 3OZRA 1J07A 1UXJA 3OA2A 4H1UA 1Q77A 3UHOA 4IMIB 3ANTA 3KXLA 3TJMA 2OGZA 3RQIA 2P3SA 4PRYA 1GY8A 4W6QA 3V1TC 2GZMA 2IL1A 3ROKA 1SVLA 1P8AA 2EQAA 4GQIA 4ILEA 4XSGA 4ZQEA 4Z4GA 2OO3A 3JWPA 1IM5A 4QJ4A 1U7XA 2QL5A 4PYJA 1ZRHA 3I6BA 2ZETA 3L6OO 3TAXA 1XFDA 4DC0A 1Z5VA 4GL4A 3CU5A 1G8MA 1WXIA 1DKOA 1UINA 3GRVA 5DSZA 4RHCA 4BFZA 3ZV7A 3VR3D 2I4TA 3I6YA 4WGFA 3E22B 1RYBA 4B83A 1R3DA 1MABB 1V11A 3G2IA 1W85B 3DZ8A 3KWMA 4GR5A 1VLQA 4KN8A 2C4VA 3VDRA 4BVFA 1MA0A 1WCIB 2QX7A 3J80A 3VOAA 2P67A 3D2LA 2QG9A 1Z5ZA 1Q0QA 2BFWA 4I1OA 4OI2A 1KETA 1UBNA 2ODWA 4GMDA 4JC4A 5HTKA 1GG8A 1A27A 2ROQA 3TOVA 5BV0A 3JQ7A 2H6EA 3QLVA 2JCVA 3INGA 4X1KB 1CB0A 2DZDA 3ISJA 5JANA 3BHIA 4R05A 1I4OA 2D2VA 2XT6A 4UE2A 3H13A 2DM6A 4DQDA 1M1YB 1MIOA 1T6ZA 2FWAA 2GDZA 2E6UX 3N7UA 4M1TA 1M2FA 4M38A 5J4YA 1X7WB 3KZXA 1CYDA 4JEUA 2TS1A 3STYA 5ITVA 5CVDA 4HNTA 2NQTA 2EBWA 3PX2A 4XVQA 5DT9A 3NM4A 3IP9A 1G0NA 3PB3A 5EQTA 5LD2C 2RI1A 1N6NA 2XQVA 3OOEA 4K9QA 2D5CA 4FGKA 1L5SA 4OHXA 4PG4A 5CDFE 1JLRA 1DINA 2MSWA 4K9PA 1M6VB 3FTQA 1T9DA 1UBKS 4D9HA 1Y82A 4JA0A 5ECYA 1FX0A 1EWTA 1GARA 2RONA 4EZBA 4UMVA 4MUFA 2XWQA 1CQIB 3N74A 4Q7KA 1OPXA 5ER6A 2NO4A 4JZYA 3Q4GA 5E3JA 1MN6A 4MWZA 1NN3A 1U0OC 4XW2A 5KHAA 3BA6A 3LCVB 2ODAA 2TRSB 3SLGA 1UBRS 3KRTA 3AF2A 4JAVC 3CEAA 1BWQA 4YAWA 1O9BA 2F1IA 1TZ2A 2YDYA 1GGVA 4ZARA 2ZB7A 4DA4A 2GF2A 5EA2A 2JCGA 4XJXA 4QUJA 3U13A 2I3GA 2WWRA 1GNPA 2ZS9A 3RASA 2X7JA 4BKRA 4E11A 4EY3A 1MDBA 1IG3A 2C2KA 4HYQA 2ERCA 3IDQA 1XBTA 2QRLA 3ZOKA 4OHCA 3TFOA 5BSHA 5JO9A 4J43A 4KQ2A 3SZOA 5J23A 2B4AA 2B5OA 2QLMA 1KYIA 1GCGA 3IHTA 3BDAA 4IFIA 3T9BA 3WYCA 5A4AA 5FJJA 4YX9A 4D3FA 4DJTA 5JBQA 3EUEA 1AQLA 1UMDA 3E7PA 4JB2A 1MNQA 3PGMA 5EPUA 1G98A 4AZWA 2MJLA 1Q7RA 5H82A 5KBYA 4R1MA 4YCLA 5DTQA 2PRIA 3NIFB 2O19A 3I9V1 3SC2A 2DPGA 1P7WA 3NH6A 2EYQA 1MU0A 3FPLA 2SHKA 4KLRA 4LPSA 1Z07A 4DNPA 4ZYWA 4P6VF 4MTCA 1WOYA 1F9EA 3UANA 3VO2A 3AKDA 4B3MB 2BGGA 1E2HA 1KQNA 3R09A 1HDCA 2D1QA 5FOSA 3AO0B 3ITKA 1OU0A 4LYYA 4GBJA 4JOCA 1UFQA 5ICEA 4DMFA 1RKXA 5KYYA 3HV0A 3FUVA 4DUGA 3T38A 3WRWA 1QGED 3W8FA 2AK3A 1Z4QA 2YC4C 1NVFA 1Z8DA 2H57A 3LCCA 2EZ4A 1Z22A 1WMAA 3JATB 3AK4A 1QBGA 3N53A 4Q1BA 1R64A 2A14A 4RK4A 4X62B 1CZHA 2FCRA 1E62A 2OB2A 3OE7A 4N54A 3EMDA 2JRLA 2ALJA 3FPEA 3FTCA 4ZAVA 3STTA 3VR2A 1DSSG 1GLNA 3THOA 3HA3A 4FYHA 3GRCA 3K0FB 1Z7EA 3A0UA 1AHHA 1SXIA 4BMVA 1D7OA 3EB9A 4G1MB 3VMMA 4TSFA 3WDKA 4GUDA 2OQIA 5EKSA 3UV6A 1A9OA 5BOSB 2QRKA 4JX9A 5ALFA 1U0HC 4N03A 3BHNA 4XEHA 5LU8A 4YDHB 5IM4F 1CQPA 1JR3A 5A4JA 3NNDA 3CRW1 1RIFA 3P9XA 4B5LA 4QQFA 3CW9A 5CYPA 3ZXYA 1SBIA 1NY5A 3RRNA 1K6JA 1IXSB 1A5SB 3KM0A 5EFZA 1CRPA 1E8NA 5ALOA 3P94A 1O94C 1AB6A 2CBGA 3BXPA 3H5AA 3SS7X 1O96A 5JRZA 3FFAA 4H6PA 2HYDA 4PFJA 4CTNA 3KEMA 4DSAA 2QQ5A 3UC5A 4E6EA 1R3UA 4H77A 3QBJA 4G4IA 1SHZA 4QFBA 1BNCA 9ATCA 3SC4A 2PXCA 4KUGA 2PCLA 5F52A 3A06A 4I55A 1GEEA 3PHGA 3DSRA 3UMJA 3SHFA 4EJ0A 5C5EA 2Y66A 1OE0A 1FUYB 1RXVA 1W4RA 1Y1LA 2G36A 2ZSJA 5FUQA 1Y6RA 3M70A 1UDBA 2GNAA 4HDOB 1JQEA 2G7MC 3AR9A 3NAMA 4RC9A 2HSDA 3WSVA 4DSOA 3IAFA 3N8HA 2BRUC 3QEKA 4H7IA 4JV5B 2ZDHA 3OLVA 4QQNA 1KHTA 4IQFA 1K75A 4BX9A 4G0UA 4EGAA 2P5YA 3UPDA 4DJJA 4Q7JB 4NXMB 1KDVA 4BNGA 2GK7A 5BVHA 4CKZA 4ALKA 4CIVA 5HZHA 3DDHA 3U4CA 2G1PA 1FL9A 3T4XA 3H1TA 2ZW9A 1F1JA 1PF7E 2CEKA 4N9WA 2WWHA 4FC6A 4PC2A 3N86A 1TFRA 1O5OA 4AJ2A 1KVSA 3IVGA 4Y3UA 5BRJA 5C37A 3FUTA 1IN1A 1NV8A 2J3QA 4ZOLF 3FWYA 3PUHA 1QFSA 4U9UA 4WXEA 3KXPA 1Q0HA 2Q0XA 2J0VA 2WT8A 1Z2DA 2C4MA 2QN2A 3EH2A 4RA9B 1IXYA 1P60A 2X14A 3EXIA 5IAEA 4Z1MA 5AW4A 4OK5A 5LDDC 3RS2A 2BUBA 2Z8XA 3WJ2A 3RYCA 1KTIA 4PX9A 3ZQUA 1OSNA 1R50A 3OQ6A 3X1MA 2E4ZA 2BELA 3GLHB 4NCIA 4EEKA 3FPCA 5AJYA 4NWIA 5GGYA 2VHCA 4OEHA 3K94A 1YFZA 3UO8B 1DEXA 3RYFB 1T3SA 1NKTA 2PRSA 3FZGA 2A1IA 5EEHA 1P1JA 4RCYA 2PX3A 2NUAB 3T52A 4ZDKA 4EY8A 3I61A 3HVUA 3EAQA 2GD0A 1X8KA 2DUNA 1HG0A 2A9RA 3CLSD 4MUEA 1EP3B 2FOIA 2E21A 3IP3A 2NO6A 1NW3A 2ZRQA 1M6EX 4IP0A 4KO4S 1A4RA 4YJ3A 2FX5A 3PFIA 2Q21A 1C3VA 1XMPA 4Y2VA 1ORDA 5B30A 1GEGA 1KL7A 3S4YA 1Q91A 1ZP6A 2C5LA 3IB6A 1VIYA 3AR7A 4MDHA 3OM9A 2IXFA 1DUIA 2DY1A 5L3SA 4MJLA 2OP0A 2BFDB 4DIEA 5B4VA 2C99A 3CLSC 3JYNA 4PQRA 4CT4B 1DX4A 2XKJE 5JXHA 5K3EA 1SJ9A 2ZSEA 2GK6A 2VDUE 5CUQA 5DDIP 3KBOA 3DAPA 3GHHA 5EI5A 4YRGA 2WTNA 5KNLA 1F2UB 4WLOA 5KYXA 1RM0A 3K5IA 1NYTA 2QMYA 4O4JF 4C3ZA 1ATIA 1PRYA 1BS2A 2HSJA 2ZI7A 4FQ5A 1M73E 5DBFA 2YWDA 4ECEA 4RTJA 3VUEA 2A9QA 1RFLA 5D5QA 5A4MS 3P2YA 2CFTA 1RCTE 3L5KA 1CQJA 4JVSB 1P81A 1CUFA 4PWZA 1OZGA 3WLTA 4JASB 1DBSA 2JIPA 2ZRPA 4N4AA 4RPIA 3TAHA 3SP1A 3TSCA 3WOHA 3LA8A 4LNUB 5DZSA 2F3RA 1FFXB 4XR9A 3NASA 1FFGA 2J4DA 5GV8A 1W581 3ZZ1A 3ZYZA 3COJA 3EXG1 4YFVA 2CV1A 4KXUA 4NE9A 3QKRB 4JP3A 1LF0A 4DRXA 1AO0A 1VJ0A 1QANA 1OGYA 4KGXA 1W19A 1MEOA 2X5XA 1Y5MA 3FI9A 2WR8A 4YAOA 1G8AA 1GHTA 1CQWA 3AEUA 3BPSA 1S01A 2NSDA 3FMVA 5DM1A 2I7DA 2RG1A 3LP8A 2V4ZA 5CDFA 3UKDA 4A2QA 3CUYA 3GNTA 5LNK6 2FDCA 5AK3A 2OGUA 1TTTA 2RGRA 1WQ3A 2PGOA 1JKJB 1MX3A 3ASYA 3OQVA 1RYZA 4Y1RA 2X7XA 5JW6A 3WTCA 4DNFA 3PC8C 1ZSNA 4MQEB 4ID3A 3RS5A 4FEYA 4J0FA 4EGQA 3I2KA 1VIAA 3O4RA 3N8NA 2YN4A 3MS2A 2O57A 1FDIA 1AE1A 1Z2EA 2DULA 2FUNB 3D1JA 2WIKA 3HDTA 4J0QA 4ENUA 3M6FA 5B7GA 3DEZA 3UMYA 4U6QA 4Y2UA 4JLMA 3JQPA 3DKIA 3D4BA 1J5XA 1E4YA 1ECBA 3OAAD 3P45A 4GI7A 1E77A 5DISB 1AKEA 4OH7A 5G1PA 1JYFA 4ZDIA 3JQ7B 2BZ1A 2RKBA 3O4GA 4GRIA 1ONOA 4A6XA 4PR0A 3DZIA 4RHUA 1KI8A 2ES4A 2PVSA 4AYXA 3ZHUA 5A5VA 2N1BA 4BTLA 5ALXA 1SCBA 2PX4A 3KG2A 3SQNA 3QTBA 1DBRA 1YZTA 2WHEA 4Q3NA 4QHTA 1U7ZA 4HX9A 3H1AA 4Q6WA 4KPEC 3FWPA 4DW8A 4LJYA 4EOGA 5TR9A 3FROA 4NCBA 3BTVA 1XWIA 3OG9A 4MQBA 2OYSA 2DH5A 3K2EA 3ZHVA 3HHEA 2ZYUX 4A0HA 3Q40A 1E0AA 3NOQA 1YC5A 1UK6A 3UAWA 5L9AA 4P31A 3HVHA 3C8HA 3GFSA 1U8ZA 4PPYA 1X1EA 4HMPA 1FX0B 5AK5A 2NV6A 4RMGA 1E79A 2CXSA 3LRPA 5TPZA 3T5GA 4BMZA 4F06A 5I01A 3ZZ0A 2E0IA 3H9JA 4M49A 4YMGA 2FZ4A 3K1ZA 2OM6A 1ANKA 1H22A 1II0A 4ZU6X 1Y8RA 5KYUA 3SHOA 3L7DA 2GEKA 2CLOB 5IJXA 2O2XA 3K2BA 4CPDA 3L18A 4BTEA 3IO5A 4YP9A 5HG0A 1CEXA 5A7HA 4AZ3A 3L46A 4JA2A 2XLCA 4BQOA 2F2TA 2HD4A 5BT9A 3D1VA 1Z68A 4HRXA 3QVTA 4B87A 2JGNA 4BNUA 3VKWA 4DA7A 4RELA 2P5TB 3B6KA 4WZBA 3UWSA 1BRMA 2FMHA 5D7NA 5AHWA 4H6WA 2XWPA 3JZAA 2HCTA 4BV2A 4XIFA 1KYQA 3BYZA 2HWYA 3CW8X 5COAA 4BVLA 1Y7HA 2X22A 5C81A 3PXGA 4URXR 2XNHA 1MC5A 1SCUA 1LK0A 3A3KA 1UMDB 1T34A 3VRHA 3AFHA 2PU5A 4KVGA 1NLMA 3NJ8A 4D98A 2HZ7A 3GGGA 4GBED 4Z86A 1WP9A 1ID8A 1J4AA 2KBFA 4UQPA 3SC2B 2V6FA 2CLHB 4MUAA 2WP8J 1EEXB 3KTAA 4ZT6A 4ZCLA 3A6KA 3MCWA 4LYHA 1UAAA 4I0WB 2ZWAA 3U4QA 3OT1B 1D1TA 4TV9A 4OPMA 2QM0A 1JPVA 3ASZA 4BP3A 3I8SA 4NF2A 1YHNA 2QLJA 1I5OA 2QMHA 2J3EA 2WHXA 3JY6A 4H60A 4M1QA 5KYYB 3HVRA 1W36D 3WK8A 5K8JB 1KQ3A 4EFMA 2BW0A 4FP9A 4I4NA 2ZM5A 1TYAE 5BQOA 1C7JA 4C2BA 4N3GA 3NC4A 3NP9A 4DLBA 3E1KA 3FRHA 5T8KC 2HT6A 1P9NA 4TKLA 3SM3A 4O4LF 1QTRA 1OI7A 2DUMA 2NXEA 4C4XA 2OT3B 3EQ6A 4HI0E 5T6BA 3RSHA 3GEDA 1VJTA 1ZRMA 2AE1A 4QGGA 3TVDA 5A7FA 5IK2A 1XNQB 2QLNA 2G1AA 3M89A 2CHQA 3QPCA 5DEIA 4HQ0A 4A2WA 4Y9UA 1EB9A 1BFDA 3CVXA 1CZOA 1JZTA 4TVBA 2X6RA 3EX7C 4C2UA 4JKOA 1PSWA 5CT5A 3CLVA 1UBCA 3ZCVA 4F3YA 4IF6A 4QBHA 2V55B 2FB9A 1RAEA 4B0OA 2XVXA 4Q16A 1EPUA 3DO5A 3O95A 1T2VA 1Q7CA 3ZCPA 1JHVA 2ID8A 2JGDA 2ZI3A 3LP5A 2F1KA 1R4AA 2OAGA 4QE3A 4A6EA 5CRIA 1O96B 4EYQA 4OQQA 1V41E 1JTFA 1E59A 3TLGA 3O8CA 1MTOA 3G8BA 2DETA 1SUBA 2AOTA 1LEHA 1SHJA 4MHTA 1GPWB 2XB6A 3DBHB 1PGJA 3QX9A 4G5OA 3HBLA 1DQZA 1Y98A 1WB5A 2CZQA 4I55B 5EXSA 4JXXA 1TTPB 1I2DA 1SN7A 2EEZA 4OM8A 5F7ZA 3GJ8A 1VL8A 3TIGA 3UWDA 3INTA 3TI9A 2NACA 1E6EA 1YIDA 1KDYA 1AQ6A 1BDHA 2YW2A 1P31A 1VMAA 3FR8A 3GNQA 4PNHA 2V1UA 5EIEA 3EEFA 3N05A 5EXDA 4D3YA 1JG4A 1LW6E 3P0JA 2CVZA 2KMLA 5HIIA 2XMDA 4CLOB 1H6CA 3V4FA 2QVGA 4LX0A 4DV2B 2PX0A 4JI6B 4ZVRA 4FZRA 1BE8A 1ZX1A 2V97A 4TTJA 5GOZA 4P08A 4C4AA 5BVHB 4AO7A 2H4JA 1C1XA 2FY8A 3N5CA 2AG1A 1W34A 2B8WA 4LJ6A 1EUZA 3SIPA 2XF2A 3EGWA 1I0IA 4RF4A 4YI3A 1EUYA 3GC6A 4LZAA 1KI1A 4Q4JA 4BDSA 3J7AC 4HADA 1EQ2A 1BW9B 3KUKA 3U19A 4EPWA 3FOEC 4XDGA 1DEHA 1YQWA 4UEWA 5I5GA 3AI1A 2ZWPA 3NAGA 1XKQA 3EXIB 4P7FA 1SD1A 4Q9KA 4Z9YA 1AQUA 3SSMA 3COSA 4U7GA 2SKEA 2ZCUA 5T3YA 3M81A 3SS8A 3WNCA 3RYCB 4RTNA 3ND8A 1XR3A 3DJFA 3DXZA 2O8EA 4PYQA 2PXAA 3P7MA 4I14A 3EIHA 4A4DA 3U0BA 1MO5A 2JNWA 3CGGA 3B3GA 3D6TB 5AKGA 3WGJA 4ZRMA 2RAFA 2NWQA 1P77A 4KWTA 2WQ7A 2NUPB 4C4YA 3OOYA 3QVSA 3K6RA 5FLKA 5LZ5A 1QG2A 1WCYA 4QJ5A 3A9SA 1UMKA 2FPIB 2OGWA 1T1IA 2WHRA 3DFKA 3HJCA 4HXYA 5EIHA 2RBKA 3G49A 3ZBTA 4C0SA 3VI3B 3R5TA 2L69A 3MJDA 3MPOA 5FLYA 3DTVD 2IYXA 3PT5A 1PSZA 3UMMA 4IKEA 4CIAA 1GFIA 1JPNA 5IULC 2WP0A 3OLCX 4KG7A 4OKNA 4DEYA 4WV3A 1QTNA 1YI0A 4B7UA 3AUYA 5LA6F 2VR1A 3SQOA 3W04A 5IFKA 4L75A 1NW4A 1D6NA 3G88A 2XDQA 2HOQA 5JCZA 1W30A 4HQ6A 5EGSA 2ZLBA 4C4SA 2GN6A 1HFEL 3LUJA 2CT8A 1EGVB 1L1FA 4AC9A 4PNEA 4AIRA 1JFLA 5IAKA 2VQEB 3PD1A 2MDTA 1LDNA 3FBWA 3MRVA 4BMOB 4QU0A 1Q0UA 3IAEA 1ZKMA 1DVRA 4J94A 2H7CA 3I01A 4EEXA 3QQ5A 2HXYA 4E0BA 5KYXB 1SUWA 3N70A 5IVHA 3A2NA 3KKLA 1SBCA 1IDOA 3E81A 2C4HA 3DL7A 3HCBA 4O29A 1TC2A 3ZS9A 4JI5B 4ZVLA 3ZVNA 1Z0SA 2WFZA 4D57A 1CQJB 3PUKA 3LPLA 4O8CA 2OCYC 4QREA 3LOUA 1UFKA 4HH0A 5H80A 1E3EA 2I8AA 1IEQA 3LK7A 3QEOA 2BFFA 1CY0A 4FYPA 4R68A 3X44A 2YMQA 1HNNA 1KZ7B 1Z2AA 3T15A 4RHTA 1L8OA 3JQEA 2RG7A 2DYKA 5NLLA 1HBJA 4DIBA 3DZKA 2XSZD 2RAVA 4E12A 4B3IA 1Z4NA 2PGAA 4WZAE 1GIAA 1UH5A 3ZDFA 1PG0A 2ZRGA 2DJ5A 2WUVA 3K09C 5LBUA 5SZKB 4Z0NA 1KIFA 3EVZA 4X66B 3ZWVA 1XE3A 3FBGA 3E2IA 4MICA 5KVQA 3M3HA 5JLAA 3ORQA 1OHHA 1E1KA 2CLFB 3GDWA 4S12A 3AEUB 4RZXA 3I9NA 5CT9A 4D4LA 4ZV4A 5C53B 5ALPA 4OI4A 3LT0A 4AJNA 3I04A 1SCKA 4OJTA 4O02B 1IN4A 1P6UA 1ULSA 5T4EA 1GPYA 4Y1RB 1TZCA 1YVDA 3U17A 4Z0TA 2E4YA 4GQAA 1LBQA 1M7GA 4A03A 3KJZA 3HXOA 4FHCA 1TLLA 4QD3A 1CS0B 1M9NA 1YVEI 2XJ9A 2CNLA 3ZWPA 3X1ZA 2C59A 4LWOA 4LRQA 3KK0A 5EHZA 3C3AA 4YRTA 3EMKA 3V8VA 1TUIA 4F5EA 3EPKA 1I5EA 3OM8A 4JVNA 2WA1A 4OVKA 1JJBA 1GCIA 4CEIA 1T9GS 1KQGA 1AVTA 1RQXA 3BGVA 3NH9A 4RZIA 4TTVA 4CI0B 4EIWA 4BY9E 2PUTA 4KQGA 1TB4A 4YPFA 1S96A 5DI3A 1L2TA 1IL0A 1L7RA 1SIOA 2Q5OA 3UH1A 5CEEA 1WP4A 3SPXA 3G2PA 1WKBA 3N2GA 4TSKA 3T06B 3U4IA 4LISA 3X1DA 5LNK1 5LP6F 2GZSA 1FVFA 5JCXA 5L51A 2C7GA 4N6GA 1LLDA 2E49A 4H3VA 4TLEA 1NHWA 1PR4A 2NW6A 1PDOA 4HB3A 1TVEA 4HAVA 3U7FB 3DOEA 1UJBA 4R2JA 3QOWA 5U4QA 3T5DA 3P5SA 3F3SA 4YP1A 5GPBA 2PH5A 4EG8A 4IQGA 1V6CA 1Y34E 1UPTA 4U2EA 1XJQA 1N9GB 5HILA 3SYRA 2D7JA 4GMHA 2WZQA 2J3HA 5C8YF 1ZUWA 2DVMA 2WZDA 3L0PA 3FAZA 1B6GA 4GGMX 5SY6A 3ZDEA 4B34A 2CCGA 3AY6A 4CCAA 5IM4A 1NY6A 1G38A 1BG6A 1E9FA 3I92A 4JOSA 1A1VA 2JAOA 3B9QA 3IFSA 3JASB 3A6PC 3C3MA 3TBKA 3DG9A 4ER5A 3LBFA 3K9NA 2A84A 1YZGA 1KGSA 2J3DA 2PJUA 3G1UA 4REOA 3A4MA 3RU3A 3WNDA 5KYUB 2RK3A 3PICA 4CLEA 1YK1A 2VRNA 1X13A 3OD5A 2C20A 3A6LA 3B1JA 3LC0A 5J2UA 2DR0A 4AZ3B 2XUAA 3Q9NA 3UGKA 2PKQP 1TQ4A 4FK8A 2MHCA 1LPNA 1V9LA 4UEQA 3SGLA 4BBPA 4XPIA 3F6CA 4WZBB 4I50F 4Y6RA 5K0CA 1A9QA 3LE8A 5SYMA 1Z0ZA 1ONPA 3CBQA 5K0LA 3MRSA 4M1OA 1A4IA 3D54D 1BRTA 4O59O 1KYVA 2H2WA 1ULAA 1JMVA 2C2GA 4XYBA 4US2R 2ZJFA 1U8YA 2B3TA 4UZFA 2RB4A 1SCUB 3IAXA 4XWGA 1QPBA 1UWLA 1TLFA 3C3WA 1ILWA 4UMDA 3FX2A 2JZNA 1QCYA 1N2HA 4U6SA 5I9LA 2J6CA 4TXNA 1NMQA 4M1YA 4IEIA 2XRYA 1KYXA 1EDZA 3KTAB 3ZCUA 3OCZA 4ZVVA 4EUHA 4OHBA 4K0KB 1EQUA 3U4QB 4TV9B 4DVGA 4Q4AA 5AK4A 1RHUA 4LE1A 2Z1NA 4YJ2F 1BJTA 1UP7A 1E69A 1NONA 3A9VA 3ONFA 2AN5A 3PA8A 1L7MA 4ZOLA 1WBDA 4HV4A 1BU8A 2P4EA 5ECGC 2CMFA 4M7OA 4ZT3A 4B3BA 3ASUA 3O2QB 3R6GA 3PNLA 1OKKA 1Y81A 1T0JB 3VSAA 3EGIA 3TZEA 3VPXA 1E0KA 3UN1A 3CB4A 2AR7A 1UBOS 2JLBA 2QI9C 3R3XA 1PT8A 4Q7QA 3LKVA 2I6TA 4Z2YA 4HDMA 5L45A 4Z8YA 2XCLA 3NBMA 4HEQA 1Y3DE 2C1XA 3F9CA 3VU3A 5T3UA 1QP0A 4CVNA 4NFYA 1QVAA 2H4WA 4M8NE 3SY8A 3TDNA 1NFQA 2XQIA 1J0BA 3EF1A 4NONA 3RTAA 2BR4A 1XELA 1EFLA 4MKIA 3UUWA 4J2OA 4F9EA 1TQHA 2OHXA 1CUZA 5CA0F 1Z0JA 1YDFA 1QM5A 2PTHA 3N0RA 1R4NB 1DC4A 2QX4A 3NANA 3A7DA 2MWMA 1D2EA 1W8IA 5D1NA 3G0BA 5YASA 3OWXA 1Z83A 1HFJA 2X19A 1BHQ1 2ZTUA 5BR4A 1ZNZA 2YUIA 4LJRA 4A1OA 4AY3A 1KZ4A 2XE6A 3P9RA 4UE3S 3DZJA 2FUKA 1JNXX 2Q1SA 3NKFA 4TS1A 5LC1A 2JGDB 3IDZA 3LY5A 4WXMA 1D7AA 1XRQA 4N3CA 3H5OA 3TFWA 1JLHA 1GSHA 1LSSA 1QGUB 2D3TA 3PSHA 1Z3IX 1R5NA 2ZS8A 2DSTA 1GZ7A 5AKXA 2IBTA 2AOTB 3A1FA 3UJAA 1FNDA 1ND5A 2OR3A 3D8RA 4WECA 3TLEA 5A04A 4NLLA 5E2IA 2QN9A 3LU1A 1T8SA 4YASA 3PE6A 4XPZA 3GT7A 3OSUA 5C34B 4JWKA 1MPTA 3FMIA 4CEHA 2ZUEA 4E5YA 1YASA 3TSZA 3CNHA 4NYIR 1SUSA 3TI7A 5H68A 4W1SA 2JLZA 1UIMA 3FYTA 3TLXA 4INOA 5G0TA 3STWA 1V0JA 1HSOA 3MGBA 1WNFA 1WXQA 1RJ9A 3QPWA 4PTYA 3VYUB 2X5OA 5AH0A 5DCUA 3UAXA 1P19A 1VLJA 3FYUC 4GX2A 3MFQA 1C1XB 2HPVA 1TIPA 5ALHA 4RJJA 3O8DA 3MYRA 4JCCA 3PFBA 3LT5A 1W5FA 2J07A 1C9NA 1C29B 1DADA 1BU5A 1ZDMA 4Q4JB 1OXMA 3RQSA 2IW3A 3ENZA 3GPIA 2AW3A 2UVQA 1LBTA 4WZZA 5DBOA 1WZNA 4ZWNA 2P9TA 1MPXA 3BX1A 3WGIA 4G8DA 2CL5A 2OHIA 2VWQA 1H85A 5M3BA 1W5SA 4ZYXA 5A4DA 4BZQA 3PRHA 2PANA 2Y2UA 2OAQ1 1M1UA 3GGCA 3AINA 2RIRA 3RC2A 1RR6A 3AGQA 1QE3A 4CU5A 4DYDA 2O8EB 2GEBA 1R0LA 4AKEA 4JJGA 2LDBA 1LQTA 2IE8A 2PZEA 2YDXA 3F2IA 3QJYA 2POCA 3L0YA 3IIIA 4DZZA 4LI0A 4PG8A 2HXGA 2Y76A 1URPA 4R9NA 4ZTBA 3S7TA 4ZI2A 1VJDA 3BJRA 3DWGA 1N6LA 4MR9A 2PMDA 3CC8A 1IBKB 4N65A 4NV3A 1H4QA 1SC1A 3HLYA 4GD3Q 1BWPA 2RGBA 4NEQA 2JCYA 2ZRKA 1IHYA 4GWLA 1XLUA 2ECKA 4D79A 4JB3A 1OLUA 3TS1A 3PR1A 3WA6A 1E1LA 3HB9A 1VCOA 4JEIA 1DU4A 1ZW6A 3H97A 2WJHA 3CO0S 4KGDA 4W8OA 1IHOA 1E4VA 1P62B 4ALMA 4I5DA 3BTUA 1PVVA 1DP4A 5BSGA 4XUDA 1NURA 4ZCRA 4M7RA 3B5EA 1WRBA 4GLBA 5BSUA 3ZK7A 4QBKA 4RD4A 2R8PA 3ZZTA 2IEIA 2PSJA 3BS4A 2D5LA 2ATCA 3VH4A 3MA0A 1DAIA 2B8NA 1QYVA 4ER0A 4UTOA 3IT2A 4F5ZA 1OW3B 4A1FA 5HZMA 3C7AA 3M83A 3O3OB 3NWJA 2CHVA 4KXLA 5ALIA 3HCPA 5REQA 2WW8A 3G0IA 2P9GA 1NI4B 2Q3JA 4NE2A 5TVGA 4ML3A 4D0SA 2VYVD 5KX5F 3R7FA 1NZJA 4JT2A 2EFHB 5JDIC 1VSUA 1FFYA 4NYJQ 4YY3B 1EM8A 4RM2A 1Z6PA 2C84A 1W73A 1SY7A 4PICA 1ID1A 2BFFB 4J1TC 4RZUA 5EESA 4PCAA 1Y4DE 3ELYA 1T2EA 5DCLA 1KWKA 3MW8A 4RIFA 2QX8A 4TZ6A 1MC4A 2OG2A 4BMYA 1RWNA 3EIWA 4GSKA 4TT3A 5H1YA 2AUMA 4OXRA 3RC3A 1NLUA 4ND6A 2AMFA 2BEVB 3OX3A 2EG5A 1XLTA 4BNYA 4BQQA 4LXGA 2UZ0A 3HBFA 4R2WA 1ZGBA 1WDKA 1P33A 1KAHA 4X8LA 1HETA 2EIHA 1E6LA 2CUTA 3QXHA 4IO1A 3TOSA 2OKCA 3R40A 3CRZA 1KJIA 3AZPA 5DGXA 1LLQA 3C14C 3HP4A 4HAUA 3HLKA 5JZVA 5KWIA 3EFHA 3L6BA 3BK2A 1N2XA 5I7RA 1WB9A 3S2FA 3WNZA 2JHPA 2PRJA 3GB9A 4BASA 4LKRA 3IR5A 1V8BA 1W5AA 2HZBA 3BWCA 5KYGA 1POXA 3EK2A 2PWAA 3N0VA 4XAQA 2YQZA 1K8ZB 1R0ZA 4AY6A 3UENA 4BATA 5KVVA 1XEFA 1EWQA 3MTIA 1VRWA 2BKAA 1HTBA 3ITEA 2EXXA 2HA4A 4URVR 2AUTA 4RFSA 1XVAA 2FXVA 2Q3DA 3IEKA 3EDMA 121PA 2VK2A 1K8RA 5BMOA 5F73A 3F3YA 3WA7A 1UKYA 4CEIB 2N47A 2ZYVX 3Q7PA 4DF3A 1JDBB 3EZGA 1OJ7A 1TEHA 5A9RA 1EWKA 4LVOA 3NRBA 4DRZA 4AVYA 5CXXA 3ICVA 3ICWA 3LW7A 2H5EA 4YR9A 1P2DA 4NAHA 1NVWQ 1OF1A 2XF8A 3BSYA 3L01A 3LI2A 2PZFA 4E22A 1UM9B 1GUYA 4NMMA 2FRXA 2JD0A 1S2MA 5JNLA 2OV6A 4ZYYA 1T9KA 1T24A 1BA3A 1L4NA 3K8OE 1MX9A 2QRPA 3OETA 2X8WA 4KPUA 4LAFA 1M2WA 3I34X 2E7ZA 5IKMA 4RIEA 2GR9A 4F85A 2XYHA 1VHWA 4PPGA 4XWYA 4PLPA 2FKAA 2P9EA 2IEGA 2WF7A 2AZ4A 3THWA 1PAUA 3ICEA 3EFBA 3AHJA 4S1OA 3GH1A 4IGAA 3NHFA 2A5YB 2PLAA 4RVOA 3BQNB 3BDVA 1K98A 3RHSA 3K9QO 1PYOA 4MK4A 2QGFA 2JFPA 4HAYA 2CLMB 3RANA 4IDBA 1KDTA 3CPSA 1CJSA 1S2DA 3FRJA 1U28C 4HB0A 1WWKA 2PL3A 5CH3A 5B58C 2ZTHA 1IDN1 3M6MD 2J7KA 4LJKA 1QX3A 2QTZA 2G40A 3MS4A 3OMLA 3PNKA 1R0BA 4WOPA 3LVFO 4JBIA 5LIRA 5CYOA 4XPIB 4WA7A 2G9NA 1KEUA 1L7NA 3QFRA 3WOVA 4C0JA 4F21A 1Q6YA 3E6AA 4FD2A 1EWRA 5IW8A 3U7JA 4FGSA 4WT7A 3JR3A 5TF4A 3LC7O 4HNAA 3GN2A 4IDOA 2A1TR 1ZIYA 4U8HA 3HNPA 4NCXA 3SX2A 1MKYA 3WL5A 2P2SA 4X00A 3D2AA 5BN5A 4UDNA 3UT0A 4BZXA 2X0IA 2A8YA 2G82A 1L5GB 3Q72A 4GKBA 4CM9D 4ZN6A 1IZ0A 4MZXA 3RADC 2XGJA 4DIOA 4W7HA 4RTKA 2R1VA 3FCAA 3OJCA 3QE4A 4ICIA 5E6UA 3AG6A 2R1ZA 3CT6A 4XB2A 5FI3A 1P6XA 2P5UA 3L40A 3WNBA 4B9AA 4GDFA 4Q4AB 5DF1A 1QDEA 2I4MA 4KMSA 4QT4A 4S04A 5JXJA 1QR6A 4U0KA 3FETA 2VCHA 4ZOLB 2DKNA 3QIVA 2GHIA 1QCZA 1VL0A 4EG3A 2YXNA 4FE3A 1ADCA 2GAIA 2JC3A 4Y9TA 1GZUA 2J3JA 3OU6A 1EIZA 3V4ZA 4A91A 5IVPA 1P0PA 5JU6A 4LF4B 2FQYA 3R3ZA 3KEFA 4YRQA 4HLDA 5DN6A 8LDHA 3KLOA 3GI1A 1WLSA 5HX7A 2IYTA 5A2GA 2RAPA 5I4BA 1TKRA 2R7NA 4TXLA 4CFSA 2XGMA 1M6NA 4DN6A 1FSGA 5L3QA 3C45A 4DLTA 1HORA 2OZVA 5F2OA 1DMRA 1XVTA 5F64A 2XMBA 2F9FA 4G25A 2CCKA 3ABQB 1IOWA 1H3NA 4RPJA 3RLIA 3TJRA 5IPFA 4DR6B 2AOUB 4ARSA 2B4TO 1IHXA 4ZI7F 2PLRA 1LBSA 2FEMA 1UKAA 2J0UA 1SA0B 1SQ0A 2HUNA 3L7IA 4G56A 5LOVF 1DKLA 2VP2A 5G4KA 3O8QA 4O3FA 4B76A 1KMCA 1OGIA 3ZKWA 2OFOA 1LNZA 5JH7F 1UBTS 4FFLA 1YU9A 3NJ4A 4IL5A 4XFJA 1MAWA 3BVPA 2HRBA 1JSXA 2VSQA 1RP1A 2B2NA 3O92A 3MGKA 3QLTA 1V8ZA 1DXYA 4WQMA 5C3UA 4F2WA 1YONA 3ZHQA 5TX7A 1MGPA 3HSKA 1TF2A 2YINC 3RBAA 3RVJA 1YE3A 1GDHA 1RCFA 4QSMA 1Z4IA 3LL7A 1YZQA 3H9QA 1XP5A 5HJ7A 5JZ9A 5FI1B 2IUYA 5TJ9A 4KYUA 2KW5A 2WJIA 4IV8A 3SSNA 1S6YA 2YRXA 4O4JB 2ZUSA 2CVHA 3IR6A 4XQEA 1C7RA 4P4GA 1EWVA 2P1ZA 3A04A 3HRIA 4OQPA 1V9SA 3IV9A 3U1TA 4E09A 2JAUA 2YVQA 3TB4A 4AXBA 1RXIA 1XZNA 1VI5A 3M5WA 1IBCA 1N6HA 1W48A 1JR4A 1OGJA 1T2NA 1OILA 1P73A 1RJ9B 2C42A 3O90A 4N5DA 5FA6A 4DOMA 5DLDA 1YNSA 3JVEA 3TRDA 4DCVA 5L7TA 2D2XA 2CHFA 4WA8A 3JVDA 4JMLA 1B0ZA 2Q4EA 4TYPA 2OUKA 3V55A 4EKGA 1QYXA 4QFCA 3VYTB 4UVEA 1BKSB 3BMCB 1C3EA 4FR2A 3UTCA 1ILEA 2CF5A 1RWKA 4O5AA 3TQCA 4TQUS 4I8IA 2A5LA 2IHZA 1JE0A 1JG6A 2HEGA 3ECAA 4H16A 1H2BA 1N2GA 1R8YA 1KOLA 4RQAA 1BVRA 4HT3B 2HF2A 1DIBA 3HMQA 2ZIUB 2X3YA 3HMKA 3LIPA 2OQVA 1R5OA 2NZVG 1EFPB 2AN1A 3LAWA 4M1WA 1Y1PA 3BCUA 3TW8A 4QM6A 2ANBA 2O8BA 1KGDA 5ALDA 3V8BA 5K0EA 3T54A 3OZFA 3QRWA 5L3ZA 1CUGA 1TD1A 2VUHB 2ZDQA 2BSAA 4Q4HB 2YBDA 3HA7A 2R2AA 3DE5X 1O89A 1JA0A 1VGVA 4MSUA 4R84A 5BT8A 4JJKA 5AR1A 3K3PA 3TZHA 3G0HA 1Q0TA 1PJBA 3AF3A 3SZGA 3EIQA 3M6LA 4WESA 5CH5A 4DV4B 1QAQA 3C15C 4MR9B 3NGXA 4XOUA 3TQRA 4CMEC 3ESDA 3AL2A 2XT9A 5K0BA 4Q82A 1NASA 2PH7A 3CKMA 3GA5A 3LLSA 3HYCA 4Q37A 3Q7EA 4QPJC 4B46A 2YICA 1BVUA 3MFYA 1F4LA 3AVQA 4NG5A 1Z7BA 4BFSA 3WDLA 3IKVA 1ULHA 2UUPA 3KV3O 4I1RA 2OYCA 5CW2A 3I01M 3E3NA 3STXA 1Z06A 1HDGO 2RGGA 1XMQB 3KZKA 1CUYA 4DSUA 3HB7A 2PL1A 4MW5A 3WQQA 1X7HA 2ETVA 2GH1A 4HRYA 2QQ0A 1RFGE 4AMBA 5B12A 5LP6A 4KTVE 1U11A 2WIAA 3RHZA 1X1CA 2WAXA 2Z3ZA 5KCMA 1N32B 3H86A 2C4TA 2FWNA 2CDCA 3I9MA 1JLLA 4N8EA 3TTTA 1SEPA 4UVDA 5KTYA 1ZG3A 3L7AA 3KSZO 3ZXIA 1Z5UA 2IVZA 1G1AA 3OJLA 5C8YA 4LYJA 5DYIA 1CLUA 3CE9A 5CNIA 2PQMA 1ZIDA 2PZBA 3A2MA 4LQLA 2AMJA 1HMPA 3KXDA 3VR3A 3AP2A 5DTIA 4P33A 2FAXA 2OHJA 1PL7A 1EM8B 1RHQA 3LQRA 4LCJA 4C7KA 1D1SA 1AB5A 2ZRIA 1Q3KA 4CIXA 2F8TA 1JDPA 2OXEA 1M67A 2PY6A 4OHRA 3I04M 4OY3A 2O2DA 4PQYA 3H99A 2ZTVA 1V35A 5FXMA 3VPAA 4YHHB 2NO1A 1MH1A 2O2ZA 3ENKA 2G7ZA 4H4DA 2QK4A 4IKPA 1VG1A 2VZ9A 2DFTA 4IIHA 4OMDA 2HJHA 2XZTA 1HYGA 1GQQA 2R87A 3RIYA 4DARA 2ZVJA 3ESBA 2RBEA 4U8GA 2XGGA 2C2HA 2FZLA 3FNEA 1QHXA 1KEVA 1FTQA 4ZC1A 3Q8LA 2XV1A 1P9RA 3ZUGA 3LECA 3RUEA 2GSDA 2YHSA 3P4UA 3WO0A 3V1LA 4RD2A 2ECQA 4PPFA 4LGMA 1F9AA 3II6X 3PLRA 4MS3B 3DAOA 3R7NA 3KCQA 2H1RA 2PIAA 4ZQHA 3CVVA 3SIRA 1MUUA 1NBME 2JATA 2KS6A 1QVRA 4KCGA 2ODEA 2Q5EA 4XUGB 3S5UA 4F6RA 3DQQA 1G6HA 1VJ1A 1G0OA 2DH6A 3AVOA 4RFSB 4J6FA 1VMDA 3G3EA 1XZQA 2JDID 4RVNA 5FHQA 1A50B 2WIJA 3ABSB 4PONA 5JBNA 3W5UA 3WQSB 1GPJA 3P71T 4IDCA 4CWAA 1G8YA 3U4DA 4CDNA 4YA6A 4GT1A 5KQLA 4QEDA 3AONB 4GR4A 4FJ0A 5FJIA 4HTAA 1OFHA 4DGSA 3PEUA 2GETA 2QOEA 5K20A 3ID6C 1GZDA 1X1DA 3RWOA 3VO8A 3H9EO 2VPQA 2JI8A 4R6XA 4E03A 4BX3A 5BNZA 4O4LB 4LFBB 2QRJA 2GQ0A 1K2WA 2VTDA 1WMSA 1KR5A 1H1DA 4IDGA 1EKXA 4MW7A 1LQ2A 4RD3A 1T3HA 1E58A 4N5HX 3IGFA 4OFXA 2PGIA 2WYUA 1MQAA 1GT91 1L7AA 4C2TA 1UBHS 2Y8EA 4WI1A 3EZ9A 1XDDA 1W2WB 1RMTA 1JFFB 1RACA 3ZI7A 4DZRA 2ZBUA 2P35A 5JAPA 4B7AA 3LHKA 3A0RB 3OPYI 1JTEA 1ZVJA 4B2IA 3O7WA 1E9EA 1CY7A 1XB2A 5E7JA 3MEQA 1F8XA 3R5JA 2X6TA 2AFIE 2EQBA 4PLHA 4BVEA 1RWPA 3GZNA 3OCJA 5BSWA 1X7ZA 2V6BA 5I47A 4DDTA 1IATA 1Y37A 3SF8A 2QF7A 1EU1A 5CDTA 2EW8A 5CPBA 5I8PA 5CEFA 1LBHA 2D0DA 3H2KA 4Q02A 3V1YA 3CJQA 1F12A 1GNVA 1W0KD 4NCNA 1DOAA 5I7WA 2PVCA 3DE1X 1SUCA 5F5LA 2VI5A 1L5WA 3FJOA 5DYGA 2A0YA 3HXLA 4FGLA 4W5HA 4KQKA 3MB8A 4KU4A 3WGMA 3CKKA 2I4RA 5AW8A 1I14A 4HNAB 1YBAA 1NP7A 2J0QA 1GNSA 1NV9A 2FZCA 2V3CC 1SKUA 4JP8A 3AKYA 1HKHA 3TTSA 4QBGB 4QU8A 1Y1KE 4FXPA 4JC8A 4V03A 3PEWA 1QGZA 2F1HA 3PFCA 3L9XA 1JG3A 1A2KC 2R1VB 4X97A 4AZVA 1EMDA 3TGPA 1U31A 1YCHA 5E6UB 2BBSA 5BSVA 2UZ4A 3ZC3A 4D9KA 4NPAA 2VPIA 4RIIA 4CBVA 4DV1B 4V3CA 3FB4A 1ODFA 1TQ2A 2TECE 2FWIA 2ZSFA 2WU0A 3VMFA 2AV6A 4F97A 4FLMA 5T6MA 4P3PA 1SK9A 1ZJJA 5HMMA 1VLVA 5IAJA 2HY7A 2ZBQA 3OZAA 1QU2A 3GLSA 2QRUA 1IHDA 1W46A 4HMQA 1FUKA 4MYCA 3RSSA 3WAKA 4W5TA 2Y0PA 1ZRNA 5J63A 4DJ5X 1MV5A 4L5CA 4Q24A 1YMVA 5FPYA 4YYEA 3FHTA 4KXNA 1Z18A 1JHRA 3ZG6A 1JDUA 5DX0A 1SVIA 3WLQA 1Q3HA 2PMKA 2N1MA 1GJRA 1KY3A 4LTMA 1CUBA 1AGNA 2C0QA 2JI9A 2Q0QA 2V7TA 3N8GA 4RQTA 8GPBA 4A82A 1A7AA 3IKLA 4Q9NA 3G2JA 1RD4A 3VR5D 3H18A 1J8VA 4KAXA 4GDMA 1CTQA 1R27A 4DA0A 2J0UB 2ODBA 1XXLA 1N4AA 2Q62A 1MF7A 5L3VA 2JFWA 1YDMA 4HS4A 2GBIA 4MR8A 1I2BA 5G4KB 3O8QB 1DFHA 1QFZA 4U5XA 2VJQA 1P2UA 1QLJA 3DPSA 1LSUA 2XDWA 1KI3A 1WDLA 2WSSD 4ENPA 1UMCA 4I46A 5LA6B 4PYNA 2HPHA 2Q5CA 4KQCA 5DHFA 4FHDA 3DZDA 4B09A 1TD9A 2W8BA 4QRHA 4Y2PA 2WWVD 4M86A 3I9JA 3LQKA 3OE1A 3LNTA 4G6ZA 3RHFA 3T0IA 1JILA 3LVQE 2OCAA 2CLCX 4GYYA 2QS9A 5D3ZA 2Z9BA 1M3SA 5AHOA 2IYQA 2IXGA 4HL6A 1J7KA 3LPNA 4NSNA 4WN3A 3B1WA 2Y1DA 2BFBB 4M60A 4YPVA 5EKDA 2HMTA 3S68A 4DAEA 4R9UC 1PGQA 2ZBGA 4FUTA 1R15A 4QLAA 2HBYA 1KE2A 4G1FA 3LLUA 1OY1A 4FFVA 5AM4A 2ONJA 3TWOA 4KI7A 4ZFNA 2WG1A 1NC3A 3DFIA 5AJTA 5D3KA 3DLHA 1H8ED 1PR0A 1GL6A 2LP4Y 3NNSA 4R1QA 4W6ZA 5IYZB 3QYFA 5J59A 1WPQA 1XRLA 1ZOOA 4FLFA 3R77A 4JIGA 4CL3A 2QYHA 4E6PA 3AR6A 4RD0A 3AJAA 1ZKDA 3NTRA 2CJPA 3V34A 5KWVA 2YN0A 1BFKA 4I1PA 5JJBA 2XY4A 1C7QA 2QG4A 1ZGJA 2EGUA 2TMYA 3PJFA 2ERYA 4O2AA 2G4LA 2XAUA 4UAUA 1WW2A 3H5VA 3NEJA 1XZCA 1G60A 1QSGA 2VT7A 2VXOA 5KHOC 2V03A 1YZVA 4M89A 4XQGA 4D0GA 1M2VB 3RF6A 2J9YB 3TW8B 4GKAA 4L08A 1HDRA 1IWOA 1DIHA 1FNNA 2YYYA 3FLEA 4HQFA 4YQFA 3IL2A 5J47A 3DDUA 2WYVA 1X14A 4RLFA 1UPUA 3AW8A 1CUJA 4GXQA 5D6OA 5TT1A 3OZTA 3RBVA 2RGYA 2Y9MB 3DZHA 1Z5GA 1U4OA 4B7CA 3ZS8A 4CN8A 3HWSA 4Q03A 4TWZA 1ULBA 1U99A 4WESB 1CC1S 4I99A 3FN4A 3NHKA 1YZFA 4FD3A 3TIVA 3SJ7A 3Q3IA 5DWVA 3SC3A 1GU0A 4O4HF 1EM6A 2IZ0A 1ECPA 2JJ2D 5AVKA 3ZQKA 3LD9A 3SBEA 3DLCA 3F4LA 4QXAA 3WBJA 2ZPTX 1D4ZA 5IKXA 2GCIA 1QLHA 3JD3A 4MVJI 4MA4A 1HE1C 2FCAA 2P9QA 1PHPA 2W4IA 3NVKI 3KOZA 4F2DA 3AVWA 1N3BA 1NL3A 2J33A 3DOHA 1V7CA 1XPJA 3GUZA 1THZA 2OCKA 1EX6A 1I6KA 3EDRA 3PC8A 3IUNA 6NULA 5IFLA 2PV7A 3W7AA 5BYBA 1DCKA 5LP6B 1RWWA 3JQCA 1W44A 3IDOA 4N49A 5F7OA 4E13A 1K8YB 1MCZA 4IZHA 2HYIC 1T1GA 1UBJS 2P0YA 3Q88A 1YQTA 4G86A 3OIFA 1NUPA 5FBWB 5AKYA 1LC3A 1XQWA 3CW2A 5EJ8A 4BZZA 2SKCA 4J4HA 4O25A 1M1XB 4PC3A 1EJ2A 5GZ3A 5L4LA 1ST3A 4L16A 4NVRA 1L7VC 3EZXA 4XLTA 5C8YB 3QPDA 4B81A 4JZKA 5D84A 2G6BA 1J1IA 1TTQB 2FFRA 2CV0A 1YT5A 2G80A 3L93A 4DDUA 4R3UC 3CWZA 3VTKA 3A28A 4B3SB 4NU5A 4B44A 1S1MA 5AICA 4MITA 4E30A 5MF6A 4H7EA 1SC6A 2IFTA 3P9KA 1ZY2A 3IULA 3JZDA 1MD9A 3L1VA 4ABTA 5CYGA 1K6IA 6GPBA 4G1VA 4AJOA 3HCAA 2OV8A 2VHUA 5AJVB 3R24A 4U3JA 3OAAA 1R0SA 3V00A 4B7XA 4XWKA 3GO4A 2VS1A 1OC2A 1AUXA 3O31A 3CO5A 4LYGA 1IONA 1XVUA 1X87A 2VQ6A 1ZGHA 2WUDA 3FXAA 4KACA 1RM4A 3AVPA 5LB2A 3TNDA 4M9XA 3TMAA 4BQNA 1PFGA 3W5SA 4IXDA 2W0MA 4I50B 1B1CA 2WIDA 4ALNA 3BF7A 4BJHB 1EDEA 4E70A 4KNYA 1QK4A 5G0UA 4OJKA 3RB8A 4NDNE 4BYGA 5CB8A 2A67A 2ZB3A 3T61A 4D44A 1NLYA 4Q1VA 2XUPA 2YHUA 5IMSA 5IKOA 3A7EA 2IYFA 3TLZA 1AKUA 2FHSA 2C98A 2OUIA 3LM8A 4GOXA 1CVRA 2P9HA 2LBPA 3VU9A 4YMHA 4AKHA 2OBYA 3DHNA 4C03A 1Z6XA 5IF3A 3AOEA 4L22A 4CUZA 4FNMA 1QR2A 1R10A 2A9KA 3DOOA 4L8VA 4YAUA 4F6RB 2ZZMA 2DR3A 1Z74A 2AVNA 3G0DA 1T4BA 2Q7OE 2AZTA 1RAFA 2CKDA 3I2FA 4PIVA 3L8MA 2R6FA 1DAGA 1GUDA 5U4XA 3R7WB 6REQA 2P9JA 3ND6A 3ETDA 4YJ2B 1AMUA 1V3QE 2QRHA 4LTNA 3HGQA 3HE3A 1UJCA 4DDKA 2R751 1PLJA 1XQXA 4QA9A 5ENZA 4IY1A 3NLLA 3ZBPA 1E2UA 3ZWMA 2ATVA 1TEZA 1BC5A 3ZLUA 4EI9A 4HNSA 1BMQA 2V7GA 2FMXA 3U80A 4MW0A 2AGVA 4OH1A 1OH6A 1ODLA 1T25A 2J3MA 4D0LB 2VHQA 4COKA 1SXJD 3DDOA 1SGWA 4R98A 3O9ZA 3TL6A 1X74A 4LRWA 3TCNA 2DFDA 2HQBA 1G63A 2P78A 2VZ0A 3LT4A 4WKCA 2PWPA 3N7AA 4UTNA 1BJKA 1K06A 4Z53A 3TDKA 1O57A 5CA1A 5IUJC 3GYBA 4WEQA 5E9AA 1D6SA 5CA0B 2NN3C 3JVUA 2Z2KA 3MGCA 4KBGA 1ZGZA 4JJAA 5CLFA 1EIWA 3FW1A 1L4HA 3OZ7A 4JKIA 4ZI7A 2ZIWB 1SXJC 4LHSA 5LOVA 3RJ9A 3Q3VA 3TLCA 3K6SA 4YK7A 4Z54A 3GZNB 2G07A 1X7ZB 3FMOB 3HN2A 1P3JA 5ESRA 1XL0A 1YJBA 3BZBA 5T8KA 4B3CA 2B1RA 3SF8B 4MQUA 3R23A 2QTGA 2WVHA 2BL4A 1NYLA 2BBTA 1KMMA 1T5OA 4Z5XA 2JEOA 4QULA 2WUGA 3JWHA 2G5PA 3THSA 2DT8A 1U7HA 1C9DB 3K2IA 1E1CB 2O1WA 3C0KA 4JLWA 1NU6A 1C3OA 3O83A 2FI1A 1RRKA 2GPNA 3D0QA 3LMKA 2W4QA 1FSZA 3LDFA 3ZY6A 3QTLA 5KJCA 4YDQA 4M0FA 2NUBA 5BV1A 1R0CA 3TCXB 2C9BA 1KXZA 5EIBD 3KUCA 2C8LA 9LDBA 5DGDA 4O63O 1E1MA 4ODIA 5I4CA 2C5GA 3KHUA 4RKRA 5AI4A 4C9BA 1PJ3A 2ZFUA 4NNOA 2QTAA 5E9WA 3REGA 4ZEMA 5BN3A 5C80A 2C7OA 1RVV1 3L92A 5IH7A 4M1MA 2P2DA 4DM4A 1NQTA 4MVXA 3WXBA 3ICPA 4CNQA 3KEGA 4QGFA 1ODSA 4Q9LA 4D9BA 3KPWA 3GLFE 1VMEA 3WAJA 5SYAA 3VNRA 3SVTA 5E6RA 5EIBC 3CZQA 3EXAA 1UC5B 1CIVA 3B3FA 4PO3X 5KQPA 3BRQA 1SBQA 4H1HA 3USZA 3CQ9A 2BMDA 3UK0A 2ZPAA 2ORED 1NQOA 1SVKA 3H5TA 4TKZA 1QS0B 2PVPA 2FMKA 1U80A 2EG9A 1Y5IA 2XRFA 4H7FA 4KQ9A 4XM0A 5AVRA 2YIJA 3KVOA 4JUBA 4O33A 2V4UA 4JJ6A 4FSDA 1QQ7A 1UKZA 3QE0A 1PZEA 2GRJA 2NNWB 4KFUA 4L5JA 2Y1CA 4PPNA 2ZXFA 4QAQA 1X6VA 3QLUA 4TM8A 4L02A 4M46A 2QPLA 3KNZA 3B3QA 2GBLC 3BXXA 3JWGA 4GWKA 1JL3A 4KFTA 4ACBA 3EVAA 4DTIA 1JHZA 1K89A 1BH2A 1E5XA 1NXTA 3IP1A 1N25A 1TNDA 1VDMA 1MFPA 3IV6A 4RF2A 2W70A 3U9SA 1Y1TA 2IS2A 5TT0A 3H3JA 4H4EA 4EPVA 4LGCA 2OK8A 2OFFA 4ISCA 1V1MB 5IT0A 1PZMA 5K6RA 1NVAA 1XLVA 3JWIA 1L3BA 1VXOA 1PR6A 3PIIA 1ONNA 2XKKA 421PA 1T6YA 4MR8B 1VSQA 3M49A 1DIGA 1X38A 4AWBA 2WILA 2Y27A 2Y6VA 3W5DA 4XM2A 1LA2A 1UMCB 1XZGA 4Z3DA 1S3SA 5K8IA 5EMKA 1XTKA 4A27A 1WEKA 2YFQA 3UTDA 1KSGA 5DYTA 5KO2A 2CWWA 3MWFA 4U00A 3D6NB 1TRHA 4GXRA 1CT9A 4ZVMA 1SO8A 3KS9A 4C78A 4OU5A 4C88A 4BMSA 2TMKA 4UEOA 2WKPA 4HPXB 1DOZA 2PX8A 1ZZGA 4DMKA 5DU2A 3D7RA 3MQFA 2RK4A 3N2ZB 4E88A 2ZKIA 3OWOA 4P3NA 3U49A 3EQ7A 3C8ZA 2QL6A 4RYLA 3VBCA 1M2HA 2LV8A 1C9MA 1WY7A 5JJKA 1Y9DA 5KX5B 2BFNA 3AR5A 4J3JA 4WFQA 5CDGA 2UU9B 2E87A 2XUGA 3A9UA 4OL0A 4BC0A 2IS1A 3ZWNA 5E0OA 2Y1WA 4R71A 4ARBA 1N0WA 3NV9A 2M98A 2H11A 2Z4RA 3PUVA 2C2YA 2O8NA 3AF5A 3BH0A 4P82A 3BE5A 2C7BA 3RFFA 3MUFA 4AQYB 3DTVA 4AS1A 3T7AA 1E4OA 1UOOA 1M76A 4RK7A 4WOCA 4UNIA 2O4UX 5LQUA 3GQBB 1Z7YA 1SHUX 1NUHA 4XOIA 4JUIA 3EXFA 3UPUA 4POAA 2G9RA 3E53A 3I6MA 1VJ5A 3AETA 1ZM2A 1IJFA 3KFVA 3WHIA 3KYBA 1U3TA 5EJMA 2MR6A 4GX1A 1HQDA 1TT7A 2EATA 5DTJA 2HDNB 4W1QA 4QNNA 4YAJA 3RHTA 3O74A 3WYNA 2W6NA 5EYPA 2GLXA 3HKCB 1TEXA 2GUWA 1M2EA 2NZUG 2PPVA 4J4BA 4K8OA 3K71B 1CUHA 1E6UA 3LPCA 8MHTA 2UUBB 2XVAA 1MVNA 4ZICA 4D3SA 2I99A 3CXUA 3K09A 5EY5B 1KFEB 3OBBA 4AZSA 2GFIA 2OLKA 4KXQA 2GNPA 2EF0A 2MR5A 4MVJG 2PN1A 2QYOA 3F7NA 4P3YA 5DX8A 3T3PB 5LQKA 3GJXC 2VTEA 3VKUA 4F6LA 4DV6B 2B82A 4CNBA 4B6EA 1PR9A 4IQ4A 2QB5A 1N78A 3ISTA 5CM8B 1EFAA 4AYWA 2MTBA 3F5QA 4C76A 4RTLA 2XD4A 5EIAA 1L7DA 3A1DA 3PX3A 4ND3A 1QHHA 3M1LA 1ZLYA 4HWOA 2PS3A 1MX1A 4YMWA 4CFYA 3A1TA 2ZANA 5AHRA 1JG1A 1S89A 1V2HE 2QP4A 2RHHA 1QC5A 1QQBA 3ZXXA 1ZH6A 1ZR2A 1M8PA 2F1OA 3F7OA 4AB1A 2HV9A 3C41J 3SDZA 4DJEC 3SEQA 2IYNA 4DL9A 2VHWA 5BWNA 4RVHA 3IQXA 3AF0A 4H1WA 3H5WA 5JAMA 4ZZ3A 1NA5A 3LUFA 3LRTA 3ZPXA 3BM5A 4D25A 1WJGA 2C07A 2CXPA 3E1SA 2RJNA 3N5KA 1XF1A 3IUEA 2C2ZA 2OA0A 1JI0A 1YH3A 2CNBA 3DAYA 4FR5A 4BO8A 1XEWY 2CNNA 3L5OA 2JAPA 1OUMA 2ZSHA 4YJDA 4EB0A 5C52B 1JS1X 2DP4E 1WY5A 5ILQA 5CFNA 5KIAA 3AVTA 1XKTA 3AJ8A 3KPJA 1WDMA 1SM4A 3IE0A 2Z04A 1Q1EA 4YWHA 5BW6B 5K8TA 2DE0X 1HG1A 3NZEA 5INTA 2HXSA 5HM6A 1Z0DA 2Y67A 5MN6A 1EP9A 1K7FB 2V59A 1GNRA 3KYIB 5JFGA 3V48A 5I3CA 1Q7BA 1JSCA 1U2DA 1FYDA 2C2WA 1L8AA 3RIMA 1T1JA 4U7WA 1F6DA 3JWEA 1T5DX 3EQ2A 2PGLA 2JEZA 4XJSA 3RS3A 3KB2A 4GZ5A 2I78A 4B3RB 1EGQA 4HAIA 4EG7A 1CFZA 3P32A 4Y0NA 5AXDA 5K03A 3ED1A 4L9WA 4PLZA 4NU0A 3RABA 3T7IA 3OQMA 4D96A 1ONSA 2GOYA 1Z47A 1CY8A 2VK4A 3QA3E 5G0VA 1M2OA 3G9QA 1E7RA 2MSLA 4AO6A 2B9VA 4TTSA 3UGJA 1Z56C 6REQB 3DBOB 4OA5A 1T15A 1II8B 1UK7A 1SOUA 1UAGA 2DT5A 2QU8A 2FMTA 4QQRA 1FYVA 3VPGA 3VGPA 2XTMA 2XUDA 4I5EA 2YWBA 4KFSA 3SK0A 1RJDA 1PI3A 4MW9A 1T6XA 4WLVA 1NN1A 3ZZUA 4EPYA 5ITSA 2M6SA 1MAUA 2OZPA 4PGGA 1LPBB 1KZYC 1Z4KA 1KAOA 4D9JA 1JU3A 1PFYA 3JV7A 4JWTA 4B71A 5AW2A 1VECA 2HK8A 2B34A 3GOQA 1AXGA 1KBQA 1OREA 2WK1A 4PG7A 4Z9XA 5EL0A 1DZIA 2DTDA 3GFQA 5IDXA 5KAMA 4KBFA 2H7YA 3SFTA 3FOFC 1JB1A 3EXHC 4RH0A 1TX4B 3C85A 2ZRMA 1E3SA 5JATA 4KR2A 3I32A 1VCNA 3BQMB 2ASEA 5MFZA 1ORIA 5KQSA 3FOZA 1TK2A 3B5IA 1S0UA 2DMRA 2ZK7A 3KWFA 3K73O 1SC3A 5C35A 1YHZA 4MQMA 4YC7A 3S2IA 3SE0A 3WKAA 2J9GA 4IO0A 5ENVA 2GA9A 4ZI7B 2R44A 1IZYA 2YZKA 4OXXA 5WRFA 5LOVB 3KSDO 4EHHA 4YCMA 5DOVA 2OGTA 4CZ2A 3GLGE 4AKGA 3ZE8A 4IIFA 3O21A 1FFSA 2FSFA 1T9BA 3FZNA 3A6JA 3L1UA 5JMPA 4CV1A 5JH7B 3LBIA 4KX3A 1HNXB 3DV0B 2AN4A 1I7SB 2EFJA 1BTOA 2PBFA 3CR3C 4I4TF 2Y77A 2VT3A 4EFNA 5LMUB 1XXHE 4LBVA 5AVVA 2CBXA 1CS4C 1QIEA 2G63A 2NMVA 3IYLW 1W36B 1A97A 1IBRA 2EGGA 4M0LA 1RDFA 3DL2A 3UW1A 4R69A 4AFNA 1C3OB 3NATA 3W2TA 1QIGA 4IJUA 3VNAA 1SCAA 1T13A 2CHEA 4J90A 5HGXA 1G42A 1PG5A 3ZJUA 4DC9A 1QVWA 4JDUA 1V1JA 3T7CA 2VOEA 1LTQA 1BX0A 1KY5A 2FN9A 1F6BA 1X1TA 2JGJA 1RABA 3LDHA 3DEJA 3W4IA 4ARAA 1M54A 4X94A 1O6ZA 3VVLA 4ZI5A 3IKJA 1Q57A 4MB0A 2WIFA 4BN5A 821PA 5BN3B 3X43A 1L4MA 2AW5A 2OO5C 4JVOA 4LOKA 5ALSA 1H2YA 4DJAA 4MP6A 4F4DA 1M0EA 5LBIA 2X1LA 3LYUA 3V4LA 4DJDC 4DR3B 4O6VA 4E94A 2ZVQX 1AKNA 4QPZA 5DWQA 3WV5A 4D56A 3ENVA 4LBWA 4TLCA 1KO1A 3JD1A 2DPYA 4ND4A 2QR5A 5KNBD 1V16A 2EFYA 1D9XA 2FG7C 2H16A 1M6WA 4FE4A 4V0RA 4J7XA 2DB3A 4ZQBA 3WLKX 2NYAA 4MUJA 3EN0A 2A88A 3ITNA 3IBGA 1JQBA 2E18A 4ZTZB 2WV7A 1YZHA 1FJ2A 1S2GA 4PN3A 3O73A 2GN1A 5ALLA 3ZCSA 4ZGBA 6Q21A 2E2WA 3WMFA 2RFLA 3SJZA 1PFUA 3L8DA 4MH0R 5BUQA 2AH5A 2I4IA 3ORFA 3SYTA 5CXQA 1AXRA 2H7VA 4HKTA 2G9UA 4YGYA 5D1HA 1R9MA 3OF5A 1MP0A 2RE8A 4JR0A 3OE5A 5LKRA 1ZD5A 2NG1A 3PD7A 4EVRA 4QELA 2NVWA 4HDCA 2IX9A 2XUJA 3CGWA 3QPUA 4O4HA 1P9WA 2JFNA 4JK3A 3K0AA 4TXMA 1AS0A 1ZI6A 2WU1A 4JT9A 1BVYF 3I5UA 3E9EA 3HVIA 4HATA 5B57C 3H5RA 1M8KA 4MRVA 2CD7A 2Q5QA 4D0RA 3V4RA 1KRWA 1I36A 2Z08A 2HRQA 2HA5A 4WEOA 3IKMB 4ND2A 3ZX5A 1A2BA 3GG9A 4COOA 3RJZA 5IWAB 1SD5A 3ZGOA 4F1KA 5TIIA 1BZYA 2D6FA 4DPKA 3ZW9A 1ISIA 4MO9A 3E9YA 2GMWA 3IRUA 1UP4A 3Q2OA 3WHLA 3U31A 5KMGB 1H69A 4I6EA 2JK1A 2WSBA 2VKTA 4WY5A 3E8XA 3L1HA 1G2IA 1UT8A 1BQ3A 2V7QD 4PSDA 4I6JA 3HXQA 2QD4A 5EP1A 3SBDA 3F9IA 3DMTA 3O1IC 2XBMA 3DOUA 1QHYA 2FDRA 2FPOA 1SVUA 5C1DA 5I7SA 3LIIA 2OLJA 1LJUA 2ZYRA 1P7PA 4Q4CA 3MWLA 1TLTA 1WVGA 4ZA2A 5E3HA 4D46A 1TM4E 3TM4A 2YZMA 1TA0A 3RJTA 3AI7A 2W9XA 2ZE6A 3AWIA 4LYFA 4B40A 4WX2B 1RQPA 3GRPA 2X41A 3LX4A 4BO7A 3VZRA 4E7PA 1QYCA 2WM9B 3CB2A 5ICCA 1M2NA 3GR6A 4ZMRA 3DTVB 4FOTA 4L4ZA 3Q7QA 1T5SA 2QY9A 3KYDA 1L5HA 3TYXA 4XB1A 5BNTA 5IBRA 5GZ6A 2BM0A 3EXFB 4GXTA 4HLQB 4BO3A 2CHGA 2YXEA 2BCGY 3E3AA 3AETB 1P2VA 1K7EB 1ZGGA 2ATXA 1NUAA 2XW6A 4JSRA 1NXQA 2D0PB 2PKYX 5HKAA 1Q1GA 1MQ8B 2I6QA 4B3XA 5AFSA 4XDZA 5KOYA 2F7SA 4TMWA 2CXNA 2ZRDA 3L7YA 2PFGA 3USES 1FC0A 1XTBA 4FMPA 1SZDA 2YJ5A 5JS6A 2C7PA 4ARCA 2VA9A 5EYPB 3GQVA 4J3NA 4CMHA 2CBZA 5I9IA 4RV4A 1NXOA 1ZXBA 3KHSA 4KK4A 3VDQA 4E5VA 1KOGA 1QH0A 2A5GA 1PTKA 2IV3A 1Y6GA 4Y6QA 4RFLA 2O8BB 1RLMA 1B0UA 1JT9A 4L4RA 2VYVA 3I3SR 1EI9A 4G89A 1GCAA 2DQYA 3BH6A 3GEBA 4MUYA 5JECA 1P4RA 3PPIA 3P2KA 1QIDA 4GEGA 5ALEA 1H2WA 3DOIA 2IU6A 1KEEA 2OD9A 3K20A 3BRWD 5JSFA 4RXUA 4KI0A 3DOCA 1HA3A 2E4WA 1ZICA 4LDJA 4PW0A 4DBZA 4LF9B 1QH1A 1QUFA 3UUFA 3AI3A 4KAAA 5E4YA 3DE6X 1IN6A 2QNRA 3ITDA 1QORA 2Q9BA 5EE3A 4EATA 1VKRA 4F72A 1TC1A 1C2TA 3FNGA 1U0GA 1C4OA 2EIXA 2VLIA 4XCVA 1ZAYA 3PC3A 4KLAA 4C6RA 1E5DA 1MJNA 2VL7A 2C8JA 5JWOA 4PS1A 2YZNA 3CJRA 1XFAA 2QT9A 2F3SA 1DLIA 3OQ1A 1TVMA 1OB5A 3WICA 3WMRA 2PGNA 4ZJYA 2H92A 2BSXA 2HI0A 3R4VA 2HMUA 3JZMA 5BWCA 2OVBA 2NVBA 1KZ1A 2I9KA 2ZWOA 2I67A 4C01A 2GPYA 4B7ZA 4OQMA 1JXMA 1MLDA 4BO1A 2EBFX 1NF2A 2G0NA 1B93A 1MHPA 3M4XA 3NALA 4K7JA 5JD4A 1P1CA 1HE8B 2CCJA 1JDTA 2VHZA 1JBEA 1JEEA 1F0NA 3B78A 3BSFA 3LOPA 4K03A 4MA5A 4U7JA 1MZPA 4K2AA 3UOGA 1E6KA 2LWIA 4UQLA 1T1SA 4EA8A 1KJZA 1UKCA 1R1DA 4EJSA 1J0XO 2ID9A 3B70A 4GYJA 4WN9A 1RQGA 4DCPA 1M7HA 1TKBA 1C1DA 5GJCA 2W00A 1SU8A 2GD6A 3DEIA 3ZY3A 4ER3A 2ZDGA 3IPXA 1YL7A 1C2YA 1W1IA 4FYVA 2K5UA 4KRXA 3WJ7A 3DYBA 5ADWA 4D6YA 2XRZA 3U3DA 1RKVA 1TEVA