2ADFA

Crystal structure and paratope determination of 82d6a3, an antithrombotic antibody directed against the von willebrand factor a3-domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
189
structure length
189
Chain Sequence
b'DCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Willebrand factor
molecule tags Blood clotting/immune system
source organism Homo sapiens
publication title Paratope determination of the antithrombotic antibody 82D6A3 based on the crystal structure of its complex with the von Willebrand factor A3-domain
pubmed doi rcsb
total genus 68
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2adfA00
3V4PB 3V4VB 3EGDB 3QA3E 5HGJA 4F1KA 1MHPA 3F78A 4MMYB 3K71B 1JEQB 4WJKB 5KYYA 1RD4A 2VDNB 2IUEA 4HQOA 3ZDXB 1AUQA 5KYXA 1JEYB 4Z7NB 1U0NA 1JEQA 1CK4A 4O02B 1MQ9A 4FX5A 1MF7A 4JDUA 5KYUB 3BQNB 5E6UA 1XUOA 1RRKA 1N3YA 1TYEB 2NUPA 4WK0B 3HI6A 3N2NA 3F74A 3PPYA 2VDOB 3T3MB 1IJKA 5KYWB 1XDGA 4IGIA 1QCYA 2X5NA 3EH2A 1LFAA 3FCSB 2O7NA 1M2OA 3PPWA 1IDN1 1V7PC 2I6SA 3K6SB 1L5GB 4Z7QB 1M2VA 4WK4B 5E6UB 3BN3A 4NEHB 5KYXB 3EG9B 4HQNA 3EG9A 3HXQA 1U8CB 3EGXA 3EOAI 2B2XA 5LN1A 1SHTX 5KYYB 3PPVA 4MMXB 5HJ2A 5KYNA 1PCXA 3K6SA 3T3PB 2VDRB 1QC5A 2XGGA 2ODQA 4A0QA 1MQAA 1OAKA 5BV8A 1DZIA 1M1UA 2QTVA 1YVRA 4HQFA 4WFQA 2VDQB 2NUTA 3PPXA 1PT6A 3M6FA 3ZDZB 4NENB 2M32A 3IJEB 3E2MA 4C2AA 4C2BA 4CN9A 4IXDA 1NA5A 2WW8A 2VDKB 4WK2B 3ZQKA 3TCXB 2I91A 3NIDB 1ZONA 1Q0PA 2NUPB 3TW0A 4F1JA 3GXBA 1T6BY 4UM9B 1BHO1 1CQPA 3VI3B 3EOBI 5E6SB 5ES4B 1M2VB 4HQKA 5HDBB 3ZDYB 1FE8A 3VI4B 1ZOOA 4MMZB 1JEYA 3EGXB 1N9ZA 1M10A 1XDDA 1MJNA 3ZE2B 3EH1A 4G1EB 3NIGB 5E6RB 2WINI 4Z7OB 4CNBA 3EGDA 4PN7A 4HQLA 3K72B 1PD1A 2ADFA 1FNSA 4M76B 1M1XB 2VDPB 1SQ0A 4CN8A 3HXOA 1U0OC 4UM9D 5KYWA 4BJ3A 1AO3A 2VC2B 1JLMA 3TVYA 2NVOA 1BHQ1 3BQMB 2ODPA 2XWBF 4IHKA 5E6SA 1MQ8B 2ICAA 1IJBA 2I6QA 5KYUA 1QC5B 3ZE1B 3NIFB 1AOXA 1RTKA 3FCUB 3ZE0B 2VDMB 3Q3GE 1PD0A 4G1MB 3IBSA 1ZOPA 1ATZA 2NUTB 3EFOA 2VDLB 1SHUX 1IDOA 4NENA 1RS0A 3TXAA 3RAGA 1T0PA 4UM8B 2XWJI 1DGQA 4XW2A 4C29A 5E6RA 1YVPA 4DMUB 1JV2B 1UEXC 3EFOB
chains in the Genus database with same CATH superfamily
1QANA 2IYRA 1FVFA 2YBEA 1VPVA 3FHOA 1HY3A 1LBSA 2DJIA 3QVXA 2XNKA 1WHTB 4LZJA 4UBOA 5CIWA 5CVVA 2P4SA 3KUDA 4TWBA 2A4MA 3O84A 1N0IA 4IRUB 2XE4A 1OBCA 3PRJA 4EBFA 4Y2YA 3LUCA 3CUTA 4CCSA 1IY1A 1D0VA 3H5TA 3K9NA 1RKVA 1X9GA 2EW1A 2XMBA 2DFVA 3Q4GA 2NACA 3P9YA 1GPDG 3PFWO 4UEWA 1CF2O 5G53C 1TYEB 3F2VA 2E18A 3TDNA 1G8FA 4HJRA 4KLNA 3S7TA 5DM60 3OPVA 4GG1A 3UOAB 3IX7A 1J8FA 1T8PA 4GGOA 2QK4A 1W0KA 2D2IA 4DWJA 5CH8A 1QG2A 3DT6A 3IAS1 4DIMA 2A9JA 5B3JC 5CM2Z 5CK5A 1GTVA 1HZJA 4WNYA 2WKQA 2WAXA 2DT5A 3JZIA 2OLJA 4YQYA 1EI9A 1SH7A 1F6DA 1OZHA 2NUAA 3PGA1 4NDZA 5IDYA 5GPBA 3ZIAD 2ZDGA 4NEHB 5DHPA 2XB6A 3TEFA 3V3TA 2X13A 4OJQA 4UTVA 1ECFA 2FEOA 4G0OA 4N3BA 1E2MA 1O57A 4D56A 1ORHA 2PH5A 2WA2A 3AW8A 4R1QA 1GDHA 3EQ2A 3P26A 4XFDA 3RVDA 3P32A 1UKYA 2EP7A 1OSNA 4R7GA 1KDTA 1IY8A 1YVRA 4ZOEA 5HJ5A 2D1RA 4ID3A 2IXDA 4UAGA 1AZTA 2CB0A 4OJKA 4P4SB 3RBXA 3TWOA 5IULC 2A5YB 4AJLA 4XIGS 1FDVA 2FEMA 2Q9CA 3CG4A 1G5PA 2FMFA 4BO3A 2AMLA 4YMSA 4H1TA 4M1OA 4EG0A 2WTXA 3I05A 2RGUA 4I5FA 3O4RA 3D6VA 4LVNA 4A2WA 3GG2A 3QFRA 4E46A 4HP8A 2OYSA 4K6MA 4ZGGA 2XXAB 3ZQ6A 3OOHA 2I5PO 4NC9A 4D4KA 2C57A 4HT3B 1D0IA 2WBLC 3QVMA 3GCZA 3I9OA 1ULUA 4QOHA 2PZKA 5IUNC 1SVIA 1IN4A 2D6FA 1N7JA 4JMLA 4WNCA 3UQYS 3DPSA 3EGDA 1S89A 3H4VA 5J2TA 1OTYA 4Z3DA 4B3SB 1XZAA 2WV9A 2HLNA 2RGDA 1TKBA 2P6MA 2D2FA 2NZWA 3NYWA 5ALEA 4CZ2A 4MV1A 4JLPA 3IPXA 2BBTA 3KKKA 2A9KA 3VX4A 2X7HA 3KPUA 3KR0A 1PQUA 1DFHA 5KYUA 1MX9A 2N75A 2PX2A 4Y18A 1NBAA 1VL0A 5EJ4A 1SBZA 3CX6A 2RGNA 1XAIA 2C31A 3M4YA 4RO0A 3QPWA 3VZDA 4NJMA 1ZD1A 2FE1A 4V0RA 4INPA 4ZVMA 1FP4B 1G4UR 4YP1A 4KVZA 1TM4E 1GNVA 2PYIA 2G76A 3QWIA 5TQJA 3ZHUA 2H6EA 2N42A 4JI1B 1GTRA 4WCFA 5D84A 1KZGB 1VMIA 1T36A 3FKSD 5KWEA 3QUTA 2QGNA 1UJMA 2CLSA 2F3RA 1EVZA 1SB9A 3B85A 1TM3E 3NV7A 3PSAA 4Y2TA 1Z0SA 4XYLA 5AW8A 3F73A 4KO8A 1K5HA 4QU0A 3IP8A 3UYLA 3LWZA 3PHJA 4HDKA 3RC1A 2AK3A 4JVMA 3UUEA 2M6RA 4W9NC 5E4TA 4TSKA 1GKLA 3HZRA 3PT5A 3KUCA 3ESBA 2HK8A 4BLTA 3P71T 2IV2X 4N3CA 1IU9A 1JAHA 1ELOA 4MW6A 2ZSAA 5E8JA 4HH3C 4KLRA 4P4GA 3BQNB 3Q7PA 3ZBUA 2CBZA 5IF9A 1XCOA 2YQ4A 1G64A 2ZTSA 3NBXX 8ATCA 1IBRA 2V7WA 5TJ9A 1TO1E 2B5VA 2OM6A 2REXB 4HB0A 3D5QA 1REQA 4TUYB 2C4UA 2QUAA 3NP7A 4O0MA 3NOXA 3SIRA 3T4UA 3UNXA 3TZLA 2CHQA 3H6KA 4ZI7A 2FX3A 3JV7A 1J0EA 3SQOA 4FFOA 3NWJA 1PQYA 2QN6A 3GT3A 5CVJA 2AN5A 1Y98A 1WSWA 1KC1A 3DE3X 4IMPA 3D0KA 2A5DA 1YIDA 1YS7A 5CLGA 4KACA 1X39A 4M7OA 5DFAA 4P3PA 3TQHA 2BGIA 1LLFA 2CYBA 4XYMA 5C0OE 2O2GA 3JQ9A 4PYKA 1ICIA 2XSZA 3H9BA 1QIFA 3RGWS 1OU0A 1E9BA 2J5QA 3R5KA 4EUNA 4AXXA 3F5SA 1Q19A 1E7SA 2EJUA 4GO1A 4EO9A 4KZPA 2Y9PB 5FT9A 1KRWA 4U7FA 4PHGA 5C51B 5EMMA 4HYYA 5CVEA 1XZBA 4FLFA 1NA5A 2YIMA 3IT2A 3DTYA 3CJQA 4H60A 3OZWA 4I1SA 4R3NA 3C3DA 5IBCA 2YXDA 1A1VA 3O0DA 1FRNA 4B76A 1KSGA 1XQ9A 1UT6A 2R3SA 1QWSA 4RGBA 3V2GA 4AKTA 2CHVA 5CT4A 4JP8A 2YYYA 3WBJA 1KZ6A 2FW6A 3RS8A 1SHJA 1BWPA 1WOYA 1PW5A 3H16A 3ISVA 3OP1A 4YYEA 1UADA 2O2HA 2GPWA 3C3BA 3FF1A 3M6UA 4M9SA 4WXPA 3RIHA 3MRVA 4FNMA 4YYZA 5C46F 3NCTA 1HM5A 1GVNB 1IONA 3R3YA 2FP4A 4Q9LA 4D7AA 1K4YA 2BSAA 1CS0A 1P4GA 1QOQB 1TIBA 3LWDA 5DXJA 5LOVB 1JR2A 2IOFK 3I6MA 5JIBA 2ZIFA 2PUAA 3THYB 3R3HA 3GJTA 3WI7A 2FDRA 3T9BA 1C2TA 2PJRA 2RJOA 2AJ8A 2JGDB 2IS6A 2WFMA 2J3JA 3ERCA 3TL3A 2Y1FA 4XD7A 3KSZO 5KREA 4M0EA 3DLBA 3QEOA 1XQ6A 2IZ1A 1Y4ZA 3FIJA 4KQEA 4Q37A 5CH5A 1ZK2A 5AOVA 3WRVA 2QE7A 3LK7A 4FE4A 5GOTA 2G7MC 1PDOA 2YJGA 1F7UA 1K7EB 1JAXA 4BLQA 1ULBA 3WV5A 1NW7A 4E21A 1NL3A 3IAFA 4QJ5A 4CEIB 3IT1A 4ENRA 3M4ZA 4J6FA 4XQEA 3NNNA 3L6CA 3QLUC 3HWSA 4XUCA 3F8WA 1UWCA 3L7YA 5LWQA 1EDZA 4O1IA 4RM2A 2ZDHA 1L5SA 2VTBA 3HZZA 3IULA 2R1UA 2QYHA 4ZZ2A 3AR4A 9MHTA 3G1TA 1UIRA 3ULKA 3MPUA 3S8YA 1ULAA 1QTIA 1JEQB 1ONOA 1YB5A 3ACCA 1O87A 3A8TA 3LT4A 3TX2A 3BD7A 3M4JA 2Y0CA 4DMFA 1JHPA 3WFIA 3HNOA 1NQWA 3I32A 2ZUSA 5FAKA 3JD4A 3IDOA 3UHPA 2HLDA 5M34A 3OE7A 1F5NA 3R24A 5HFAA 4OG2A 1WG8A 4AMZA 2GRUA 2G6TA 2IYZA 4Z1MA 1E9AA 1CUEA 2XEDA 1YSCA 2GAJA 5GOZA 3ZQKA 2A9OA 3ACBA 3C7CB 4WNIA 5C4MA 3L4BA 4RQAA 1LPMA 3C8HA 5ALWA 2PQ6A 1LZKA 2ZB7A 4XWTA 5C8YA 3M5PA 4HNAB 3GZ4A 2TMYA 1LPBB 5LVAA 3JVUA 3PHHA 1NBME 4IDCA 2IV3A 3TTYA 4CMEA 2EKZA 3AIOA 4O2BA 3CZ5A 3GGSA 5HKKA 1I3MA 3HADA 5E6UB 2NGRA 4IVRA 1ZN2A 1BIFA 3HG7A 1F4LA 3AXSA 3S81A 2EJTA 4B73A 3HB1A 4Y6GB 1LDBA 2VYCA 2ZUVA 5G1PA 3HKDA 3N0RA 1B73A 2ORVA 4M9UA 5LKRA 2O20A 3P4UA 2PLNA 4Y2VA 3RYCA 4LG1A 4ZODA 3VJRA 3ZJYA 1N7IA 4RHTA 1WUKS 4IBOA 3PYLA 2W2NA 4LXQA 5KJ1A 1RNLA 1PL8A 2QHXA 3P97A 1YOVB 4U39A 2ZRJA 1ZX1A 1ZXXA 2GK6A 3H5AA 2X58A 4QTZA 2VYND 3RE1A 3LCMA 1KSFX 4B4DA 1NXSA 3RI3A 3AIKA 2JCSA 3X0DA 1FBNA 1V8DA 4ZCQA 4PQYA 3DEFA 1FFYA 1BRMA 1SIOA 3QW2A 1BAPA 1SBYA 2BIFA 2QG4A 2HA2A 1GHTA 3BXHA 5L51A 1J24A 4ZQCB 3E22B 1QVAA 4C7KA 3MD0A 3O5AA 3EGXB 3OZEA 4MRPA 5JWHA 6ABPA 2ODWA 2FA9A 2J6BA 3USZA 3DDNA 2GK3A 4OP2A 4G0PA 5FV4A 4OHKA 3NHBA 5CCBA 4NL4H 2P9BA 1JTFA 4NCJA 5HW0A 1WD7A 1TGVA 4WN3A 4GOOD 3E5MA 4NDAA 3LFUA 4F5EA 4K6OA 1OI7A 3RVSA 3F8TA 1MFZA 1W30A 3KYCB 1GCIA 1MJHA 1UZAA 3TNDA 4WKNA 3WGOA 3O4JA 1T9ZA 4PZLA 2YX1A 3X44A 4EB3A 2YHUA 2JAPA 2IYVA 4BVLA 4EUKA 2C96A 2NP7A 1N6NA 1XL0A 1FPMA 3ZY3A 1KYYA 5HILA 1YDGA 1SURA 2ZWPA 3DKIA 1ZUIA 2FPGB 2PTGA 3DNMA 3TF5A 4U5QA 5DN6A 2A1UB 2OEPA 1WZUA 4AS2A 3MWEB 1U2GA 4O08A 1LTHR 1FXWA 2XUPA 3C3MA 3Q9UA 4H7HA 4R0MA 1ZHOA 1YJQA 2RHHA 4QA9A 2XYPA 4UTNA 4HWPA 2G0TA 4WWHA 5JISA 2WJVA 1OROA 1LF5A 2OQVA 5I7HA 3HVKA 1XCBA 1OFHA 1Q3KA 4K8RB 4YMHA 4TZKA 1IQ0A 1J0BA 1NI3A 2JFGA 4RFSB 4B09A 1GGFA 4O4LF 3K73O 4XM2A 4DYVA 5DLPA 2IH4A 1V4NA 2E4WA 3GEIA 2G7ZA 4HDCA 2OP1A 1UF9A 3KKEA 4UCFA 1B16A 1XYGA 1U0GA 2NZ2A 2VJMA 4HAUA 3C5EA 4ZQGA 3R7DA 2PUEA 4V3CA 1PUIA 5BUQA 1ISSA 4K9OA 1XEAA 3CCFA 2R44A 3GA0A 3PQCA 2O8BA 2A1UA 4OQZA 1IMOA 1TJYA 1JR3A 4PNHA 1NUHA 3NPMA 4Z4HA 2A86A 4PLWA 1RBYA 4M53A 4XQGA 4DA6A 4DQ0A 1XGKA 1KI1A 2OKGA 3OCCA 3OPNA 1X1QA 1DC5A 1YDMA 5I01A 3PEFA 3DQQA 1RKQA 1TM5E 3AF4A 3O8LA 3UK7A 1E2KA 1Z7BA 4DPMA 3LS2A 3RT9A 1W49A 1G8HA 3Q98A 4BQPA 4J43A 1ADGA 3ND7A 4D42A 5JO9A 3SS7X 4MP6A 1GPNA 2QQ0A 1RBMA 4X1KB 2YV1A 3U3XA 5K0CA 3RK1A 3WYGA 1VPTA 3GWZA 3PL1A 4QDXA 1DUVG 1OA0A 4QLAA 3W04A 4AICA 2RIRA 2TRSB 4DQVA 2Z6QA 5LKAA 3NGXA 5AK0A 3ZHYA 4B81A 2QV0A 1EXWA 3H7AA 2RSLA 3THWB 3JD2A 3V8NA 1NSTA 9GPBA 5BPFA 2OV2A 2X40A 2P6OA 4Z6KA 4ZDIA 3UWSA 4P0QB 4CFZA 5HZHA 4TQUS 4MVYA 3TOCA 1KA9H 1UPXA 3OI7A 2YOGA 1M5UA 1WDLA 4O8CA 5CRIA 5DBGA 1C9KA 2ACKA 3OZTA 1SXIA 3RC9A 3L8EA 4GOND 1I4LD 4YUZA 1KQPA 3Q12A 3LA6A 1NFFA 4DV6B 1CQZA 5EC8A 3WLTA 3C6XA 4HQRA 1J2YA 4EJSB 3U1BA 4X65B 4YECA 3EC1A 4MWDA 2FOXA 2RFLA 1DEAA 2X86A 4ZI2A 5DW0A 2PWBA 2QROA 5JYEA 4M8NE 4MYCA 3MYRA 4JAVC 1NONA 2J48A 1U3UA 4H3SA 4KR6A 3I4LA 4S35A 1A1SA 1P3JA 1JEYA 3QVGA 2XNDA 4J76A 2AZDA 2XVYA 3EZGA 3MXOA 5AH0A 3IYLW 4H7JA 1E32A 3QRWA 3ZX5A 1CS4C 4ZK6A 4DV0B 1LWOA 4NJEB 1YH3A 1Q7BA 1VJ1A 2IPOA 2IXGA 1K4KA 4TXMA 4CKEB 3EIXA 4DLXA 1NI4B 3IMKA 4HMOA 3V7YA 1XTJA 3I64A 3PUVA 5DP2A 4AJIA 4KZKA 1E7MA 1MB2A 3C3WA 2GZRA 1BFDA 3LKDA 4MUJA 2OQ2A 5A4DA 5LYJF 4MS3B 4TTRA 4X93A 1QLWA 4KXXA 2DULA 2PWZA 2C5BA 3R77A 4KK3A 4I1UA 3W5SA 4M83A 3SQMA 1QVVA 4PZDA 3VR3A 1GRVA 3A2MA 2PRKA 2PT5A 3OZ7A 4NXMB 2PMFA 5HBGA 3EGOA 3SEZA 2VSNA 3C8ZA 1PZNA 3AY7A 4RX1A 2ID8A 3NDJA 3BULA 3MGBA 4HN9A 5BMVF 1UFRA 3H3JA 4PV7A 4TV9B 4DSOA 3OJXA 2NSJA 4NPCA 1J1ZA 2M6SA 5CTAA 4QVKA 3ZCPA 2CT8A 4FMPA 3ZGZA 3BFJA 3VNAA 4N0QA 2WYOA 3K0CC 4KRFA 3A6HA 3CZAA 4LXIA 5JANA 1KAHA 4YMVA 4NR0A 4RSHA 5FOSA 3TW8B 4AYXA 1BOOA 2VR1A 4EEKA 3UMGA 1RKUA 2WU4A 5HIKA 2PMBA 2X4IA 4GH5A 2GWHA 3ETEA 4IILA 1YE5A 5FORA 1GN9A 1RYDA 4XFKA 5F9MA 621PA 3ABIA 5JDCA 2OECA 3OEYA 3N53A 4YRNA 2VSOA 2PD6A 2V7UA 4GMKA 1UINA 1A8HA 1GPJA 2IYSA 2HEIA 5DGXA 2VRWA 5A03A 3HJHA 2R5NA 4JJZA 5JVDA 5MFZA 2EEPA 3H9UA 2CFTA 1X87A 4JELA 3R3JA 3W5AA 2QMOA 2IP1A 5JARA 1USIA 2UDPA 2LCQA 3VPAA 1WTCA 4MHOA 4DSUA 1JALA 1POWA 3W0LB 2B92A 4JX9A 4IDEA 2O8CB 1VECA 1X6VA 2OZLA 2XQKA 2X0EA 3WS7A 4KX5A 1DLJA 4ZJZA 2VTVA 4UFOA 5CLHA 1F2VA 5THQA 2R8EA 1JAZA 1N0WA 3D3NA 3PSHA 5KCMA 2HPZA 4WBNA 2ZUWA 3GA5A 4K2AA 1R8QA 1Z47A 4L02A 5H3LA 3JTMA 1JSXA 3DDOA 3W2HA 1TUBB 4PGFA 3QA9A 3DC2A 4DJTA 3SKVA 1D8TA 2L69A 1E7QA 1XC7A 2R1VB 1C3XA 3VC1A 1JG6A 3A6EA 3LZ6A 3GN1A 1ZAKA 4EPYA 4FSHA 2UU9B 2PNJA 2W48A 4IJWA 1OH7A 4NK5A 4JLJA 2LCIA 3ASVA 3N8KA 2CSUA 2OHVA 3E3MA 2Y77A 1E3JA 1MAAA 3QY9A 3IVAA 4EP1A 4KBGA 1JKJA 4Y6SA 5EIWA 4I3HA 4DZTA 4B7AA 3CVOA 3HCEA 4WCFC 4KGDA 2H1IA 5LWHA 1CQPA 5ALMA 4KVGA 2XOKA 3H17A 4AZ3A 1DWOA 1WZ2A 1TI7A 1FNMA 1T3LA 3KQPA 4L0MA 4AO8A 4CPDA 1KGDA 1O8CA 3AEQA 3MMPA 4N49A 1BVYF 3CW9A 2WSYB 4B34A 4FILA 4NMLA 1BG6A 1V6SA 1H8EA 2ERYA 1GA6A 2CNWA 3IRUA 4K46A 2MSCB 1JHUA 1Y4AE 2XWPA 2O6HA 3H2KA 2DFPA 1RTTA 2R4UA 2V6IA 4N5IX 5FO0A 3RSCA 5T4FA 3FGNA 3EVAA 3UWDA 3GH3A 4AQYB 3G9TA 1CYDA 3OKFA 1I3NA 4ZEXA 4LI0A 1H9CA 3CZPA 5AI4A 4UHJA 4XWOA 2IE8A 2QW1A 1T1SA 2ZI9A 3P4YA 2VHXA 2IKQA 3QZUA 4WGGA 1XVVA 2ZJ8A 3K9HA 4R8MA 3WVNA 2GYUA 5F73A 1JLLB 5TX7A 2Z5GA 3DFIA 2F1RA 2Z4TA 2I65A 1XMPA 2ZRGA 1KY2A 1DOHA 4MUGA 4V39A 1QHHB 3RROA 3VAAA 5G0TA 5CXUA 4ND6A 3ADDA 2OK8A 2R7MA 2XA1A 3K15A 1LVUA 4WZAE 2I80A 3UW1A 3FTPA 4YMIA 1E20A 2JKZA 3IE1A 2VJOA 4CIVA 1NATA 4GI5A 4JJ4A 4EYKA 1NNSA 1IN8A 1RHKA 3RREA 1E4YA 4MQ6A 4QO8A 5CFLA 2C4TA 2Z8YM 3IBFA 4YN3A 1QDUA 2WTNA 5K45A 5G41A 5HGJA 2IYQA 4CF6A 2DYKA 3UMMA 3QU9A 4CQMB 2R6R1 3FPCA 5KQPA 4K9MA 4F4CA 4YAOA 1EQ2A 1GPMA 4NFSA 4LOKA 3I61A 4YONB 2AJLI 2IDZA 1J9EA 3E8MA 2EG5A 4Z51A 1U0NA 2I1QA 4NDNE 4D45A 1EU1A 2LBPA 3IR6A 3RBZA 1E1QD 5B3KA 3F9RA 4DIFA 3QPUA 1DP4A 3EQ7A 4MCAA 2WJ4A 5TSDA 4EG8A 3H4IA 3DM5A 1FNNA 3ZCSA 1USGA 4UPEA 3N2LA 1U98A 2YFKA 1CY7A 3MTJA 3ML1A 4KJZA 4WXMA 1UJ4A 4C4TA 4WX2B 4CJXA 3KS9A 1PF7E 4L0QA 1L7AA 5G1NA 5DO9A 3ISTA 3HA2A 2DP4E 2ZRIA 4G8CA 3SF8A 3IEVA 1E1YA 4F5WA 4FMCF 3AR9A 1JFFA 2JJQA 3L8GA 1TU4A 3FW1A 2X3FA 1C4XA 3P0EA 4KCGA 1NVAA 3LVRE 4BEWA 4GR5A 1UZNA 2Q5JA 2V0CA 3Q9LA 3SZUA 4PAQA 4CDGA 1Q44A 2PS3A 4LRTB 5JZBA 3ETHA 5D1NA 5TEVA 3AY3A 3F6RA 4XDGA 4I5EA 4F2HA 2J9YB 2VQSA 4GXNA 5AJXA 1WX1A 2G6BA 5HF5A 3SN6A 4PAMA 1EHYA 1XB2A 4R40A 4UHEA 5C8YB 1AIPA 2NT3A 5DU2A 3KKOA 4Y0VA 3Q1KA 1SZDA 2G17A 1T5SA 1DAFA 2YWJA 3CBGA 3F97A 1WLYA 5P21A 1N2BA 1W9MA 1Y6GA 5FA5A 4L74A 3UXEA 2RG1A 3TCXB 3DMPA 2OAQ1 4QFDA 3EUFA 4F1JA 3MWJA 1HG0A 1W85B 1FVHA 5FPQA 1OYVA 2JANA 2ZZKA 2WOJA 4JL6A 2WK1A 1YZTA 3DMYA 2H9AA 5IJAA 3O2JA 3G1UA 5LZ7A 1U0HC 2XMZA 4O29A 4WOCA 1FX0A 1WXIA 4YO7A 2YJZA 3ZXUB 4BBAA 5LQKA 1QX3A 1ZICA 1Y9DA 4UZFA 4XIJA 3PFBA 3H0KA 4W4TA 4PG6A 4BNMA 5E3HA 1Z62A 3URKA 2RK3A 4MI9A 1N2JA 1L5VA 2Z6VA 5LQJA 4K0KB 3OE4A 2O6LA 2KJQA 2OFWA 3GLQA 3PIIA 4RL6A 5AM0A 1QHSA 3K4QA 2PKXA 3EIWA 1AGPA 5E1MA 5I9SA 4DLYA 3O91A 4XX1A 5JQGA 2P2CA 5AMXA 4V24A 4EQ6A 4IS3A 3SEAA 5EQJB 2WJZB 2DPMA 4ZV7A 3HGMA 3UV3A 4H3KB 1CR6A 1XD2B 5K01A 4NH4A 1J56A 1AOXA 1Q7RA 2J87A 5DHTA 1EVQA 2PH1A 1QDLB 2WE8A 3PRHA 5CYPA 3X1DA 5K3OA 4AJOA 3UJDA 2CF6A 1P9RA 2ZVQX 4ZVLA 1Y7HA 4RSRA 5EJFA 2ZRMA 1HZZA 3F2IA 2C2GA 4OQEA 4YP5A 4EKIA 5IZCA 4LDRA 3ZDDA 2L2QA 2P8JA 1JV2B 1ZITA 4Q34A 4F7WA 1RAAA 4C4PA 1XZDA 4KLAA 3R7WA 2O2ZA 3ED1A 1P2GA 1BW9B 3GJZA 3SE0A 1XLTC 4TTAA 4D96A 3FBWA 1ZYUA 1C7RA 1JMVA 2R8OA 4FCTA 2OLKA 2IWRA 1AKRA 1M6NA 2QUKA 2WKPA 5FUQA 1G55A 3FFXA 2IUEA 3K6JA 1H6AA 1VI5A 2H9IA 1G2PA 3ZZUA 3E18A 4P7FA 5CYFA 1A2QA 1T0HB 5ALGA 2NO7A 5G1OA 1RFGE 5F7OA 3BA6A 3QF4A 4CIXA 3I42A 1MAUA 4N7MA 3WGZA 1OLUB 2IHVA 5A4FS 1YASA 5FWYA 5FI0B 1AQIA 4BO9A 1H42A 2RD2A 1WY7A 5EE1A 5FTKA 5KSOA 2W6JD 1MCZA 4FBLA 2I6XA 3VA7A 4XRRA 5T3UA 1DI0A 3EQ9A 4R2HA 1E64A 1JDBC 2GR9A 3EZ9A 3FPBA 1BNCA 2ONJA 3AUKA 2FUEA 1RXYA 2VAVA 1L7NA 2X0RA 2BUBA 3AU8A 3AZPA 3HNRA 4RACA 4YJGA 4J0JA 2CXTA 1FLNA 4GRIA 1ORRA 2V03A 1TMGE 2AC7A 2WVAA 1DEXA 1V3VA 1VBMA 1MVNA 2ZYSA 3DFFA 4LISA 3JALA 3L3BA 6Q21A 2D0IA 4IKEA 1F38A 4ZO7A 1SHTX 2C9ZA 3A36A 4RHXA 1Z36A 2CXOA 4URXR 2PO5A 2VPIA 4KC0A 4K28A 3JASA 2AXNA 2Z1MA 5KQLA 4H15A 4Z0TA 2POCA 1UZLA 1BE1A 1TJPB 4JENA 4UAVA 5K6RA 3SNKA 3HACA 2BFFA 4M9CA 4CQMA 4F4IA 2FWMX 2D3WA 4WA8A 4C7OB 2O5EA 2H1VA 3EWAA 3AJ9A 1PVDA 5LYJA 3DVLA 3QITA 4IOKA 4LJ4A 1CYEA 3JY6A 4UZSA 4IXDA 2F9MA 1MKYA 2I6UA 2NZUG 1J00A 2QI9C 3B60A 3E9NA 5E1BA 1NWHA 1CJVC 3U26A 5CX4A 4YP7A 3RVMA 4LXXA 1AURA 2CHGA 4FN5A 4CLOB 5DOVA 4YFVA 4H7DA 4KQHA 1T0BA 3BICA 1OY1A 2XR1A 3MJFA 1HDIA 4JR1A 2EFHB 4M0UA 3GP3A 4MIEA 3WZ2A 3ZNQA 1PVOA 4QWWA 1TMOA 4GLJA 4KJXA 4MJ7A 3TRDA 3IP6A 2YW9A 3ZGNA 4D26A 3EPJA 3DEAA 2IITA 1RWXA 2JZCA 2FCRA 1ZA1A 4J49A 4BE9A 1KZ4A 4KIGA 5E6RB 1MDBA 1TM2A 4U2GA 3KU1A 1Z63A 5C9ZA 3DE2X 1EUCB 3KX2A 3K72B 1W5TA 3QFFA 4C0SA 2HC9A 3U3RA 3A1FA 3EXG2 3IBGA 3DO5A 4MW0A 5EWJA 4R01A 3NYRA 1PSDA 4P0TA 4YP9A 5BWLA 1H2FA 2H1SA 4GLLA 1ZSVA 3E15A 4MW2A 3RUAA 1VL8A 4GMFA 4DREA 4RVUA 2CC2A 3Q0IA 4KQJA 1CQJA 1XPJA 5HF6A 1LUAA 4W9MC 2XMGA 1SO8A 3ANSA 2I8AA 1NQUA 3CUEF 2PRZA 5FJIA 1PHRA 4MUBA 1T4MA 1TD1A 4YBRA 3P5SA 2NXNA 2FK8A 4KGZA 5AW2A 4KO2S 1BMFD 3JR3A 4LCBA 5DH9A 2JCGA 4RF2A 1CU1A 1R7RA 1E63A 3DDCA 3GLKA 2IHNA 2V65A 5JZSA 4UUAA 3NYQA 3S2FA 1I8TA 4X41A 3WKEA 3N3BC 3FCEA 4OI1A 1NR7A 3G6KA 5IC6A 4Q1BA 2Y66A 3AHGA 5BUCA 4XWWA 4GKJB 1JDTA 1UJCA 1G9TA 3EZYA 4HVCA 1E4OA 1MO2A 3G88A 3H42B 3HXLA 4GMXA 5EUMA 4YRSA 2OCLA 4ILEA 1EVJA 4LK3A 1R0WA 4LRSB 3WA7A 1EEXB 5FWXA 4CM9D 4RJJA 4DAEA 1NOKA 1RQPA 1O6GA 1Z25A 2QW8A 3DFMA 3KVYA 1ZXLA 1U7XA 4K9KA 4W82A 4I1RA 1L1QA 4U2BA 3TI9A 4LSZA 1NRIA 2QRNA 1EFPA 3AL2A 4G36A 2Z4RA 1WSDA 3K96A 2PZ8A 4N82A 3W4KA 3MN1A 4FR5A 4FYYA 2Q8QA 2I55A 2J7KA 1FIUA 3PCTA 3GD5A 2AW5A 2IELA 3I4CA 4N1AA 3IV6A 1G8GA 2LV8A 3CF0A 4NF2A 1NVTA 4FI3F 4JVNA 3H7IA 4LPKA 2VDOB 3VH4A 4Q3NA 4LKRA 2QN8A 1P1FA 2ZG6A 5KQRA 2EZ9A 5L40A 4DR7B 1Y9EA 4R54A 3LPNA 2A0XA 2FW1A 4E5UA 1I10A 4JUIA 1YZGA 1ENPA 2DRIA 3VNRA 2DKNA 3A6PC 4B87A 4IDGA 2R1TA 4BLPA 2VOJA 4H4CA 2AVNA 2ID7A 2P1RA 4ZRMA 1C2YA 3UCXA 3AKYA 1PWXA 2GEJA 5ER6A 4Z53A 4B6QA 3T3PB 2E5WA 4KR9A 1XQVA 4TKUA 4OQLA 1SR8A 2VJMB 2WJPA 1MHTA 1MNAA 5CJ2A 4L5AA 1RLMA 5JXJA 2IXEA 2QNBA 3W8NA 4LE1A 1U0JA 3PXBA 1OR8A 2DWQA 1U7PA 1SJ9A 2OUKA 2XCQA 3H1TA 1JIIA 1YBAA 2EQAA 3LX6A 4KXYA 3T0IA 4F11A 2Q2OA 1KBOA 5C37A 5FV7A 1TTQB 4J3JA 2M32A 4KQIA 3TR6A 2H2IA 5JBIA 2EKBA 4QJIA 3BHIA 3ETDA 1LKZA 5CCXA 4ZP1A 2C92A 4R8KA 4OA8A 3GWGA 5HIJA 4IWNA 2JIDA 4D3ZA 4WE3A 1YQQA 3CURA 4J6EA 1IAQA 5FLKA 1S2OA 1LPOA 2BGNA 2Y68A 4FNGA 2AF4C 5H5JA 4EGAA 4Z3OA 3E7WA 1EHIA 4GC9A 2OV3A 4ZO9A 3QEAZ 1KMNA 3D6JA 2L17A 1T9CA 1NLFA 4MAAA 4HK4A 4HRAA 4NE7A 3ZDYB 3B9RA 4P84A 5DASA 4JLNA 2FRXA 4QOJA 1Q5PA 3LCCA 2VZ0A 1X92A 2ANBA 3N5CA 4KSBA 1JHYA 5JSUA 2QJWA 1R0ZA 2XIJA 3HCPA 4JHXA 1G42A 1A04A 4BFXA 5J3JA 1SQ0A 2C5LA 5H8WA 2HBRA 2NU7B 3HDVA 3KJEA 1MV5A 1R9JA 4LXYA 4P58A 2J7PA 1ZD8A 4G24A 4ZOCA 1M1NB 3O3MB 4QXAA 4DANA 1DC7A 3NBZC 1NF9A 2QTNA 1RJFA 4DC0A 3TR0A 2WU0A 4ZI3A 1F8FA 1MQ8B 5C4GB 1COWA 2HWKA 1WCYA 4EF5A 3TW4A 2WTBA 3THWA 3NQ41 3HKCB 1MGOA 4BB6A 2X2EA 4KBYA 1YS9A 2QU8A 1FNCA 1BFKA 3EA0A 3M34A 3UEOA 4X1YB 4JJFA 3T3GA 2PUFA 2H4WA 5DWQA 4AAYA 3O8QB 2EFGA 1JSLA 2VDLB 3LECA 3SYLA 5JY6A 1TLTA 3AR6A 5EUQB 2AA3A 3GVIA 3KEOA 1OU4A 1B26A 1YL5A 1P2FA 1V5FA 3I5UA 2RKOA 2NU7A 1KIFA 4TVOA 2WT4A 1GAQA 1NF8A 3P0FA 4FEEA 4HCJA 2YY7A 3VVBA 3V4PB 5FLEX 4MI3A 3DEYX 5JZOA 1Z2AA 3QWBA 3R3SA 1KIAA 2C1ZA 3F4BA 2D4AA 3LI2A 3DB2A 1XK6A 2JCBA 2QMUA 3GX1A 3SZRA 2GPJA 2G36A 3GFTA 3Q3IA 4G4SP 4M1ZA 1PT7A 5TMBA 1JT2A 3PQ7A 1BD3A 2WYVA 4EPVA 4YLYA 1LVHA 4XPIA 4JT2A 2EWMA 4GSYA 4XGKA 4HTFB 2PRIA 3NIBA 4YUAA 2PUJA 1AM4D 2YIJA 3PQ3A 3U7RA 1E5LA 2QM7A 4XGNA 1P0PA 2NZYA 3GF4A 1JPVA 2B8NA 2XH8A 1VJ0A 4WHMA 1EUQA 1KO7A 2NO4A 3B6IA 1TJ5A 2ZXUA 3B1XA 3S1SA 1TUEA 1Z2CA 5F35A 3ICEA 4ZIRB 1W2WB 3WIEA 2TSYB 1V95A 2FWRA 5EPOA 1IZ7A 2PD3A 2AOTA 4RULA 4GQBA 3U3KA 1F14A 1M2JA 3O3CA 1VBFA 5K6AC 3DOFA 4X95A 4C21A 1QX4A 4MAFA 3ER9A 2P6NA 4UHHA 2OBYA 3E7DA 3ONVA 1G8SA 2CVQA 2ZZNA 1D2CA 1R4NA 3F0TA 3Q11A 3QMMA 4D1YA 4O1MA 3DDHA 4CIBA 5IS2A 1ZJ5A 4L9AA 2E1PA 1RABA 5EE5B 4HDMA 4QM7A 4D25A 2HDWA 3PRKE 4B6JA 2PGLA 3W5CA 1I1HA 4JC4A 3FFBA 1N2GA 1L1FA 4Q01A 2G1AA 4RD2A 3A26A 2V4MA 4RVSA 3ISJA 1E3MA 4ISCA 2Y1EA 1Q6ZA 2ZIWB 3ZVLA 2FK7A 2H8GA 3QSGA 4JSRA 4UHCA 2NUPB 2IZ7A 4G26A 1XU9A 1KJWA 1PEKE 2EFEB 3AG6A 3QU7A 4C43A 3EBLA 3FI9A 2IYPA 3JWJA 2E37A 2GCPA 4PQEA 3LQYA 1L5RA 3FWYA 1HDOA 1MABB 4MV0A 4RKEA 1YK1A 4X1IB 5GONB 4Y2SA 2NO5A 4EHJA 1GTZA 4GHWA 4AKIA 4LDAA 1FDUA 3O0TA 4CLRA 4OM7A 3ZW8A 2BGJA 1LH0A 1ZINA 4GXQA 3BRQA 4N01A 1EVLA 1UMDB 3G0BA 3LUPA 3V1UA 3TSCA 2X9NA 3EXHC 1PNQA 1V16A 2YASA 1H1LB 2Y99A 4PONA 2QW0X 3A1UA 1JKXA 3EULA 2IYWA 4EY4A 2H2HA 1A5ZA 2VDVE 4REQA 1U3DA 1BDIA 1XF9A 5G4KA 2UXBB 1IJBA 2XYHA 4OQDA 3X1XA 1MABA 1Q84A 2WICA 5GONA 2H31A 3FLMA 3JVVA 2Y76A 5IDWA 4ZV4A 2GHTA 2F43A 5LJLA 4BGEA 2ZJ3A 4HAWA 1L5WA 3U7JA 1GFWA 4RJLA 1VYVA 2FGKA 2XQIA 3ET5A 1W29A 1XDBA 3T38A 3WGGA 1MO4A 5F3DA 3OHSX 3T1YB 5JH7B 1J70A 2ZIEA 3DC7A 4G4JA 4LVCA 4LNHA 3QKTA 1ZR4A 3VU1A 1G7TA 3VNQA 4D5GA 4D9HA 1X3LA 2DECA 2VJYA 4MS4A 4C0JA 1FU7A 1SUIA 2XNSA 1OX4A 3IKLA 1BA2A 5EJEA 1HFJA 3C3JA 3KD2A 3EPLA 3H1GA 4L5JA 1GT6A 2JNWA 3LQ1A 4LNUA 2RBEA 3D8UA 3FNBA 5A5EA 4A1OA 2JIZD 2R2AA 4NE9A 1DKMA 5JADA 1DO2A 2Q5HA 1RMTA 3U7IA 4BVGA 2IU0A 3QEMB 5DIFA 1Y3FE 3JQ6A 3SC6A 3UAYA 1Z2NX 2C1XA 2J5KA 3KUUA 3P9RA 1ILEA 2JD0A 3KL2A 4Y1RB 4CW7A 3HK2A 3U4CA 1U3FA 5J40A 3ZZ1A 4XB2A 2ZETA 3GLRA 2VIIA 4BMNA 2BFDA 1AO0A 1RZVA 4J91A 3RSQA 3FDZA 3KLBA 3OPQA 3L1VA 4OHFA 4HLNA 2XA9A 1TCBA 4UCQA 4ENQA 1U8ZA 3TQRA 4HYQA 5BSTA 4X3CA 1S5PA 2F62A 2V45A 3GVHA 3VKUA 2RHGB 1MU0A 1S3FA 4DCUA 2QRKA 4S1WA 4LBZA 2QPAA 4NQZA 1IBSA 3HV2A 5D00A 3B1VA 5EHQA 4DY4A 3JVEA 4WN9A 3EZFA 3TH5A 1P0CA 5T8KA 3EXIA 1JLLA 5TMDA 2C8LA 1T1IA 2CZQA 1SG0A 3L06A 3TOXA 2XYVA 4YX9A 2KHZA 2PS0A 4R9NA 2M6LA 1ND5A 3DBLA 4J2OA 1BN7A 2QMZA 3OE5A 5FADA 3FPLA 1L9KA 3W7AA 4CE6A 5IANA 4NOJA 5KVQA 5ERGB 4EJ2A 2VPQA 2C9OA 1HDEA 3IAEA 1Q1GA 2XCLA 1P75A 2MU1A 2QZZA 3DD5A 3HUFA 4OBWA 5GJBA 1PGJA 4L2IB 1EFVA 3JQQA 4PHTA 4YCDA 3TQCA 2HDHA 4ZCTA 3WGKA 1I7QB 2W2LD 4N41A 1GUYA 4HFMA 3CM0A 3WDKA 1RWNA 4CQLB 4TLBA 3UMRA 1U9YA 3TLZA 4WOJA 4RKYA 3R5JA 2GKGA 4AYTA 1CSEE 1GPKA 1Y5RA 4X1YA 3NRCA 3IKVA 1SKUA 5COAA 5MGNA 3WLIA 5KWIA 4FZVA 4PZYA 2NYUA 2JZNA 4E2YA 3G8BA 5LP1A 1Q0TA 4E13A 1JQJC 3PE4A 1N9ZA 3TIGA 1T5HX 3FPFA 1YGYA 1PR0A 4U0JA 4UTXA 4F3TA 5L3SA 1PFQA 3KYDB 4G9BA 1FX1A 5JS8A 5IVKA 1ODFA 2HF7A 3BE8A 3T7DA 5CHEA 4ZRNA 4JGGA 1QTNA 2VHVA 3SR4A 5JC1A 2R85A 4CI9A 3F90A 3HCWA 5LPNA 1T1JA 3G13A 3LO5A 3NHSA 4CF4A 2WB2A 5T3YA 4J0GA 3G7SA 2WR8A 1QIHA 2C00A 4ZC1A 4XSGA 1XKXA 4LJRA 5LU9A 2RKBA 1EUYA 1RBQA 1E3WA 2ZYDA 3AR8A 3NBMA 2CHUA 1G8MA 3CF4A 2ES4A 3MS7A 4BASA 2YINC 3L9WA 2A5GA 5EHZA 1EDBA 4G07A 3I8XA 3PD1A 2RKWA 1AHIA 3M6MD 4DR2B 4K86A 2GCIA 2GF9A 2IUSA 1T9BA 4GX0A 4P33A 4E6PA 3AI3A 2VXYA 4QPJC 3JQFA 3BH6A 3ABOB 2YXEA 5JFGA 3W2EA 2QRVA 1UXGA 5F23A 2D8AA 3AV3A 4Q9AA 3C16C 4KIJA 1XXHE 3ZH2A 4EB8A 2PL5A 4ATNA 1G1AA 5IKOA 5KTTA 3A9RA 1UAGA 1R9MA 3DULA 3DWFA 5DMHA 3T34A 2Y05A 4ZPXA 1OBVA 2E89A 2Z5VA 3CIFA 4QRHA 4RF3A 3RRFA 3VDQA 5PGMA 1M34A 3VHRA 1M9NA 1S8OA 4ZHQF 1MT0A 1Y4DE 3BB1A 2VK8A 1YI0A 2X8WA 3FN4A 2I2WA 3BXPA 5G0UA 2WNHA 3NC0C 3L0DA 2EL7A 1IOVA 1W35A 2MSNA 1M34B 1B7GO 3B1KA 4M7RA 1BXKA 4MI1A 4RD3A 1TB4A 3KSUA 2JFOA 3JAKB 1RHMA 3B20A 4KK4A 5DBFA 3TAUA 1PT5A 4IH1A 3G17A 1HLPA 1HYBA 2Q41A 4BTLA 2JLSA 4U7GA 3TKLA 1SCAA 2JGRA 4QBGB 4OJYA 1Z26A 1LFAA 1ZD2P 1WDTA 2EFJA 1AKNA 1HK7A 2I7DA 3P2IA 4WXRA 2H1RA 1N1GA 1QHGA 4MB6A 5CA0B 4R1PA 5B58T 3RNLA 4S1PA 3H9QA 3H8WA 5AVXA 2IBTA 2DHQA 1EAYA 3H9GA 3N7UA 2BMFA 3KOUA 3B82A 1U4NA 2OGUA 4HC4A 2QR3A 2GPBA 4HFRA 2GXAA 3D3EA 1GT91 1JS1X 1ZUD1 3QNUA 4OKNA 1G20A 3CVJA 4LVOA 1WHTA 3OX4A 1A4IA 2IIBA 6CHYA 4OU5A 4YQZA 1OGYA 4TMWA 4HGQA 1X7YB 2YFHA 3JS5A 2BMWA 3R7WB 1HNWB 3GCXA 2MR6A 5JI2E 1NUQA 3R6WA 4IH4A 5HMLA 2NNLD 1IVYA 2ZBPA 1ODKA 3QPAA 4PYQA 3OZSA 3OMXA 3DLAA 5C2JB 1G21E 4PANA 5KVVA 3WL3A 4O2AB 1CUJA 4CL0A 3BIOA 4HSGA 5JD5A 4O63O 4RE6A 4U6QA 5TXGA 1VCNA 4A5SA 1XVTA 2B78A 1ADFA 2DPHA 3N8DA 5BT8A 1IWOA 1F1JA 2PBLA 3QJ5A 3R74A 5GJWC 4RELA 4YHHB 1HYEA 3GEGA 4BZQA 1E6UA 4NV0A 4TTSA 1DC4A 3VPXA 1DKOA 1E0JA 3DAPA 4TQ9A 2VYFA 3TTTA 5EIFA 2WWGA 4C07A 1RI4A 4N3NA 5AVOA 1OXVA 3K20A 2ZKIA 1BROA 4A0RA 4BB0A 4EKGA 1J5EB 1KNQA 2O8BB 1TF2A 2H54A 3KAJA 5LZ5A 2HTFA 2OMEA 4I2VA 2XDQB 1ORWA 2XCRB 4AUEA 2QQEA 4NICA 5JBQA 3TZHA 3ZWYA 4F2GA 5AJZA 1FQWA 4RD6A 4LC1A 1GADO 5F78A 4RAQA 1PJLA 4C0LA 4N5LA 4DCVA 4IO1A 3GUZA 2ZIVB 3PCXA 4HKTA 2B4KA 1DAMA 4E2WA 1JA9A 1KI6B 1YQUA 2NV0A 4MQUA 5IXSA 2E4UA 1E2BA 4TZ6A 3PA6A 4CEHA 4TXNA 3GPLA 2AFIB 1FTNA 4O8ZA 2GN2A 1KQNA 5IF3A 5JROA 1MZPA 3O1JC 4PGGA 4J1NA 4X63A 3VDMA 1KQGA 1XOIA 3FMVA 1JIXA 4WCDA 2BEVA 1A7JA 3M6LA 2XMCA 2PGOA 2WUDA 3L8DA 2DGDA 5ECGC 2IT1A 3OLVA 1N4AA 3P9CA 5AVWA 3AKZA 2VH2A 2POQX 2ZI5A 2ZEJA 2AIRA 2ZUTA 5JJCA 1GY8A 1S2IA 1R9NA 1W1UA 3HY4A 3SBEA 1VJDA 1GEGA 3TKYA 3RAGA 5IAKA 1PEDA 4G56A 1H0KA 3EK2A 3ETNA 3VDXA 1YVPA 3LRTA 1VQ1A 2Y4NA 4NOLA 2FPXA 1E2QA 4KQ2A 1V8PA 3A27A 2H5JA 1OZAA 3M8KA 1UDXA 1OWMA 1VB5A 2IZ6A 3LQ4A 3ZKWB 1P31A 4M0DA 4HNQA 5LCXA 1K6XA 1KXZA 2QRZA 2I2BA 3GLUA 2XD9A 4RLSA 5I9BA 1X0XA 2C94A 1AVTA 2DKFA 2FHSA 4UVIA 3AEXA 3Q2OA 3TAHA 5BQ3A 2OV1A 1PLLA 3DHVA 4DLZA 4TV8A 3W3AD 1QP4A 1M0SA 3KZ1E 4WACA 4COKA 1ATIA 2E3JA 4DB4A 3EWNA 1N1DA 2YFYA 5FOUA 1FSGA 3JATA 1VG8A 5B3AA 2GJSA 2VAWA 5LQRA 1XI2A 1FVXA 1BQEA 2IUTA 3N2GB 4K9DA 4UULA 5C5EA 4PTZA 1U8YA 2CMDA 3D2AA 4XRGA 5LZ8A 1X8LA 2OYCA 2JDIA 3GMIA 2LR0A 4JXJA 1U7UA 5SYNA 1TD9A 1A97A 4HHEA 1AGRA 2JK1A 3THSA 1E2FA 1Z4JA 1C8VB 2G80A 2Q4EA 3L07A 4H59A 5AKYA 1TO6A 1EM6A 5ALPA 2XKKA 5I7VA 5LJIA 3L7NA 1N9GA 1YXMA 4W1RA 1RR6A 1MX3A 1LV8A 1G4AE 1UXOA 2B8JA 2GEFA 4OSPA 2LDXA 4O4HA 2VXOA 4TV8B 1H65A 5AYVA 1RQRA 2OXCA 3L4BC 2H0QA 1UP6A 2HK7A 3VPFA 3JQRA 4C4ZA 2W2TA 4XKJA 1GG2A 3RFCA 4QU8A 5CLQA 4MXDA 4ZZ3A 4G2NA 3TD2A 4DJJA 3JARB 4D3XA 1C7QA 2QD4A 2WPDA 4GPBA 1AA6A 1N34B 4D44A 4NEGA 4PLYA 1NYQA 2A30A 1EVIA 1O5OA 4QGSA 1A4RA 5EYPB 3FYUB 3G9ZA 2AUTA 2CVFA 1FL9A 2GUGA 2PM8A 4G41A 1IOWA 4K9LA 4Z5XA 1BFUA 4B3RB 1C9MA 2H3HA 2H65A 2LUOA 4IHAA 1T4CA 1GJRA 4LJYA 2CL6X 2B2NA 5AVYA 1CUUA 5KNBA 1XNRB 1AT1A 3EXHA 1MEEA 1H4TA 1NMEA 1Y5IA 4EHDA 2J3MA 3JD3A 3VGJA 1V8BA 3L5OA 5HIMA 5KWVA 1S2NA 3A1VA 3OQVA 1GUBA 5I9LA 1P7PA 3TTVA 1B41A 4DARA 2Z5LA 4BN4A 3MWLA 4O3FA 3R9KA 2WMNB 3DGEC 3PKJA 1H1LA 1NN3A 4MDHA 1R0XA 3I72A 4J0KA 5KJEA 5EYPA 5DX1A 3H97A 4NJOA 2Q1TA 3BSFA 4JJ6A 1RWBA 2HRQA 5EUCA 1PT8A 2VDPB 3NM5A 3DL7A 4DUGA 4OFXA 3IDFA 2EW2A 4JASB 5KYVA 3V1KA 4MVJM 5E4FA 2DFNA 4EKDA 4BO8A 5FUMA 4KNWA 2QTVB 4PSVA 4QNNA 2HY7A 5K4HA 1N5OX 2FFRA 3ACDA 4G0WA 3RYIA 4KPYA 2E6UX 2H2GA 4P80A 5IM5A 1R9GA 1ADCA 4Z9FA 4DLTA 4TM8A 3EB9A 4DA4A 2ZR0A 3SXUA 1E1RA 3LXMA 1EA5A 4ZQEA 4ZVKA 1QGZA 1AS0A 1CRPA 2FDCA 2JGMA 2DG2A 1RHUA 1FW6A 2ZOSA 4MW1A 4YCNA 1QPBA 2VJCA 2L18A 4XOIA 1SU7A 4QULA 3AF1A 2Z2ZA 5EMJA 2EEZA 4N4AA 5AESA 5JXWA 4CLDA 3V97A 1T5BA 4Z9YA 5EIOA 1C0KA 4MZXA 4JZYA 3OTWA 2MSEB 3WB9A 2AX3A 3NTLA 4MQBA 4TMZA 4JJKA 1YHNA 3B6KA 1U2GC 4X20A 4KYVA 3R5FA 4RU1A 1ZWLA 2ZSHA 5JZMA 4WUVA 3ZHCA 1EGVB 3RTGA 3WMRA 4MV7A 4PGHA 5JAQA 3TZQA 4DADA 5KYYA 3K9FC 5JVDF 4MZDA 1GYQA 1G19A 2GMWA 2I7VA 4LHSA 4ZT5A 1V2HE 2PANA 1F60A 2GNOA 3STTA 1JVNA 1R50A 5EXXA 5HFNA 1OFVA 1ZVJA 3I9LA 1Y1PA 1NT2A 2IGBA 1Q0ZA 3IAS6 1A2KC 4HN2A 1CUVA 5DHRA 1A3CA 1QZ3A 3L6DA 1O0CA 1BE8A 3K2IA 4I46A 2KLHA 4V0ME 4L8GA 1N2OA 4DDWA 2VHZA 1DCKA 2V5UA 2DVMA 3I04M 1GRQA 4X20B 4J2TA 2EZUA 1UH5A 5BVHA 1UL1X 3NM6B 2X7XA 5ELMA 5M5BA 1BDHA 1PZXA 2PWPA 3JQDA 1W44A 2GEDA 4RA9A 2B9VA 1GNTA 3ZIUA 1J23A 1PWEA 3OLZA 3JQ7B 3F6SA 8OHMA 1M1YE 3TQTA 5JQWA 1V8OA 3FDFA 4YJ3A 3VR6A 4GWGA 5IAAA 2OHHA 3B70A 4MKXA 4W6ZA 2NPOA 2ZYVX 3PPVA 3BE5A 1UMBA 4WJZA 4C78A 2JLBA 5KYNA 3CH6A 1LK7A 4M49A 5CJJA 2ZXEA 5HM8A 1MC5A 1MAWA 1P1IA 1JJ7A 1CKEA 1U8TA 2LKDA 3OA0A 4LOLA 4ECEA 1TCVA 1X7DA 2MWMA 3OZIA 3U6BA 2EYUA 3OTQA 3TS1A 2FLKA 1O03A 1X80B 5DGIA 1G8PA 4D4HA 1R2QA 2CFCA 4L8YA 1SOWA 1TM7E 4JBGA 1BMTA 4OAPA 2JH3A 4DSZA 2OXRA 3UMBA 2G8NA 4DQXA 3IOYA 3IPAA 5IVIA 5KYGA 1NI5A 1ADYA 2MINB 4URUR 5FR2A 3C3CA 4RV5A 2ZT6A 5HDBB 3WXMA 2Q8NA 3RW9A 4ZZ0A 4HDQB 3HVUA 1SXJD 1DU4A 2JATA 3ESRA 5CJPA 4G4SO 1JXAA 2FWJA 1QIEA 4AY2A 3GZNB 2PZFA 3RSSA 1AMNA 1JHMA 5JT1A 4JI0B 2EF0A 4C87A 3TLGA 4YCCA 2HIHA 2X6QA 3N6XA 2QY9A 4OF4A 3ZVMA 1Q3HA 1AXRA 1A8SA 3C6MA 4GMGA 1JJFA 3TG8A 2UZ4A 2XUAA 4CMIB 5A6SA 4TMYA 3A3PA 3PQEA 1E89A 1FMCA 2Q4RA 3WLEA 4BNYA 3EIUA 5DI3A 2FPSA 3DZFA 2WWVD 1O9HA 4YT2A 3D7NA 4CKCB 1VYUA 3HHPA 3UK0A 5F9FA 1R0YA 3GL9A 3AVPA 4XM1A 3GVCA 4FM9A 1FYDA 5EL0A 3VJLA 2AR7A 3E8XA 4J3FA 1ZHHA 4YCSA 5BSGA 2OC4A 2F3PA 5IW8A 4EVIA 3R9XB 1JR4A 4FZ3A 2EFCB 4GI7A 1IVNA 3Q5EA 1S8FA 3R23A 3R5HA 4OXQA 2ECQA 1TK2A 2GCOB 2VZLA 2E5FA 1X7XA 4YJFA 5TVGA 5BQ5A 5E6RA 1H6CA 2VQEB 1TVKB 4IIJA 3WGLA 1SKMA 3AHCA 1KYZA 1C3OB 1KTVA 1QJCA 5FQOA 2OCGA 1EWVA 3FE2A 3MZ0A 1IPFA 3TQOA 1ETHA 3VU9A 3ZWOA 1THGA 2IXFA 2QIPA 1TC2A 3CEJA 2B4AA 3VHLB 4TT8A 2ZRDA 4RLHA 2OG1A 3Q8XB 4OK3A 4RTNA 1TQ4A 4A91A 1W73A 3T3NA 1SELA 4OMFG 5AM4A 4E5VA 1MRZA 3HYTA 2IYOA 1Y82A 4AZ0A 1XCLA 2B69A 3ZCUA 1O5IA 3DHNA 4DLVA 4US1R 3EEIA 3R6LA 5DYGA 5E7JA 2SCUA 2XBUA 1L3IA 1NN5A 3CQ9A 3IMGA 4IMJB 5JNSA 4GYKA 1ZJYA 2IOHA 4IIJB 1YZUA 1ZD5A 3OM1A 4XWAA 3SIWA 1L5MA 4DV4B 1QU3A 2C7VA 1V1MA 3GP8A 4V38A 4Q4LA 5G0VA 1M2OA 1ZIXA 4AMVA 2QKYA 4JYPA 1HLDA 3WLPA 1OBHA 3O3NB 4HO1X 3H84A 7YASA 4V0NA 4L6CA 2CE7A 5CDFE 4NJMB 4YDQA 4WADA 2AOVA 3OE1A 3PDUA 4QREA 1TLLA 3H18A 3W6OA 4GXTA 5LN1A 5CFMA 5K0NA 5L8VA 3EDMA 5WRFA 4BO2A 4F06A 1Z6GA 2VHYA 2P4QA 2XYGA 4QU5A 3PWKA 3C70A 1K7XB 1WXGA 1OAKA 2ISQA 2JLCA 3LLMA 1OA1A 3PWTA 3VR4D 3WTBA 1O9GA 5ALOA 2AGVA 5B2FA 2QNIA 1UJBA 4I6EA 5FPKA 1LPAB 2P9YA 4QXMA 4Q4HA 1UOOA 1KOGA 1NXPA 2XKJE 5F2EA 3H5IA 4Q1AA 1O89A 1DIBA 2YIVX 3O2SB 4O4JB 2NO9A 5GJCA 3SHQA 1GUZA 2DC1A 4YP6A 4L16A 1P1JA 1Z0UA 4KBFA 3NTXA 1HQKA 4J07A 2ENUA 4M22A 5I7AA 3RGGA 3DW1X 3RUCA 3V4OA 721PA 1YOBA 3D6NB 3A58B 1W76A 2Q4TA 2WHYA 1C0EA 4Y30A 1PG2A 4DQUA 1DBRA 3TFOA 1R12A 2ZLBA 4CCAA 3ZWMA 2R65A 2QTCA 1GCGA 3IQFA 1W9HA 1H1DA 2WHXA 2ZXFA 2VS1A 1IRIA 3ESCA 3MW8A 4WECA 3VOAA 5KU1A 3PFFA 1EFCA 4N47A 3T5GA 4QT0A 5DW3A 4MVJD 3EVNA 3ICWA 1VKZA 1SXJB 5FI3A 1YB2A 4ALNA 4CKYA 2A0KA 1QB8A 1TYZA 4MYDA 4BP8A 2EP5A 4NE2A 3OTOB 3QE9Y 4FNOA 2QUIA 4RGVA 2BH9A 3T7JA 1RLUA 4B9AA 1ZP6A 2FSVA 5AKHA 3HA5A 3PV0A 2CSXA 2CJXA 1MORA 3DV0B 4PVDA 2VSXA 4PXSA 1XMJA 1KO5A 5ALXA 4E1AA 2DUUA 3UMCA 3IE2A 4UNRA 2K87A 2I3ZA 3AVXA 3GLFA 1GV0A 4C76A 4NAVA 1QYDA 3BMOB 5B3LA 1Q0HA 4G0NA 2ZYWX 3A1EA 3HKBA 4HH0A 2FWNA 3V6LA 4DIUA 1QH1A 1NJ5A 4M7WA 4YB8A 1ZQ9A 1GGHA 4JWKA 4YRTA 2YBDA 2P2NA 3C3XA 2NUAB 2BGTA 4HAXA 1E1MA 1WBBA 1GGNA 2BN4A 3H6HA 4FGWA 1S6YA 3BHMA 3EF0A 3FJ1A 3A6GA 4GS5A 2B21A 2FLVA 5DT2A 3D6UA 1R66A 1EFLA 4GP7A 2O8FB 3D4LA 1NULA 4O2RA 3DMTA 3O47A 4OGFA 1HDRA 2JI8A 2X5OA 1U02A 2PLAA 5D6NA 2Z4SA 4KXWA 3UAZA 3ZU5A 2Z3ZA 4FHZA 1BGVA 2HOQA 1MC8A 4MVXA 3KEFA 2VNSA 4UMEA 5LA6A 1PR3A 4ETIA 3L4SO 3I2YX 2JJ2A 2CYCA 2VHEA 5D86A 3UAVA 5JJKA 1XDWA 1MQ9A 5IASA 3BIXA 1Z68A 1PQPA 5DK6A 3FYDA 3ROPA 3U9TA 5KYUB 1GU1A 3DXYA 3QW4B 3QBEA 4N40A 3I45A 3UB2A 4FDUA 1MC1A 3C2QA 3GJRA 1Z6TA 3ENZA 5JMOA 5GIOE 3STYA 1ZI6A 4ABTA 4CQNA 4RPJA 1TQ2A 3DNFA 4FFPA 3A3YA 3MT9A 1H23A 2I7CA 1TC1A 2JRLA 3KYDA 1T2NA 3TLBA 4GM1A 2DT8A 1SCDA 3BZBA 3KDAA 3WFJA 5HQTA 3TPCA 2XW6A 2HA7A 2IYAA 2QZJA 1C7JA 4BECA 1S9DA 3B8HA 2ATEA 2HF9A 4RIFA 5F1YA 4D6PA 2PFKA 2VPPA 1TL7C 3MK31 3LV8A 4QJ3A 1JNXX 2CLHB 3ZEIA 5IDQA 3PNKA 3K5HA 1B6TA 1N5MA 5K8IA 1G38A 3T9CA 4Q18A 3MJEA 2AFIE 2I3DA 3BTUA 1JU4A 1AN9A 3E7PA 1R3DA 1TX4B 2WZBA 3LHKA 4CQLA 4EPTA 4QUEA 2X42A 4NIMA 3PVSA 4ZO4A 3U4HA 1T9KA 5LB2A 3PQ2A 3EQZA 4CL3A 3RH0A 3I1JA 5ENZA 4NATA 4MO9A 1U0FA 4OIMA 3VZBA 3SDBA 4OJTA 3IJEB 4C2AA 3QUSA 3RCBA 1CTQA 2HK6A 1QE5A 2EKLA 2A9QA 1W8IA 3K1ZA 3O7WA 1CP3A 4XAQA 1XTSA 1N3LA 2XQFA 2WZDA 1BX0A 1PJSA 4TS4A 3ANNA 4OLJA 3EAQA 3WNBA 1TUGA 4ALLA 5IHXA 5ITSA 2V54A 5T4HA 1XT6A 2ZSIA 3F5FA 2EG9A 4OBEA 4IOMA 3VR5A 2K2QB 1V9LA 2MYPA 2NAFA 3QHPA 5TEWA 1PWHA 5INTA 1EFPB 1QH0A 1QNFA 2EBUA 4O59O 4V0MA 3VPDA 5D5PA 4EA8A 3BIWA 5REQB 2HHLA 1RXUA 4WBXC 3LCJA 2I4NA 1N32B 2OCKA 5KX5B 2J3DA 5AI8A 1CDDA 1L3CA 1B4DA 5FUVA 3TUIC 4CTMA 1UWLA 2FLWA 4UDOA 2V3CC 5LIRA 3O1LA 3ZPXA 1R6UA 2JFBA 3WGMA 2V7XA 1L4BA 1DAOA 5AK5A 3DLCA 3RSFA 1XD8A 1Z73A 2M1ZA 1Y3AA 3HCCA 4L9RA 3FR7A 4ZA2A 3F47A 1M6YA 3PFGA 4G81A 4UMFA 1I3CA 1M6EX 2EX0A 4WBNF 5LFAA 2HH9A 2I6QA 3BB3A 3UJPA 2JAOA 3V4SA 3WLFA 4RY9A 4I9GA 3LW8A 2QTZA 1PR9A 3QF4B 2OXFA 1GQYA 3NIFB 5EINA 1XSEA 3ZE1B 3H75A 3AVYA 4XA8A 3OC0A 3QNWA 1EX6A 1NLYA 1M6HA 3DT9A 5A7HA 3ZVKA 2CXHA 3L9XA 4BBZA 5BW8A 1SD2A 3MS2A 3FWZA 1S2DA 1KVUA 1UJNA 1ULHA 2FWPA 2WJ3A 3EGVA 5JMWA 3T3OA 4C0BA 1KFJB 2IRWA 3B2EA 3DDZX 3FDZB 4TWJA 2JKVA 4P7GA 4C03A 1D4ZA 3L04A 2HFKA 2HJ9A 1M72A 2HWUA 2ISCA 2G67A 2P0AA 3BM5A 2NUTA 3GH1A 3SWWA 4ENPA 5LXTF 1G3QA 2JJ1D 3VTAA 1FOEB 1KAQA 1I2CA 4S0XA 4O2LA 4ZXPA 2VNJA 1I0ZA 1EE2A 1D1SA 4CM5A 1NBMA 2NP6A 4CTNA 5IUKC 1B8NA 3CLTD 4PZ9A 3TTSA 1SU6A 2GM3A 3SXUB 3TSOA 1HZZC 5AD1A 4R1UA 4C01A 2JVKA 3A4IA 3HDQA 1YZHA 5EIAA 4DDHA 4ZDKA 5HXAA 4NCKA 3LUGA 1DBIA 3MIZA 3PC7A 4MUYA 3B1YA 2Q6VA 1C7ZA 4M0PA 4RQUA 2CF5A 1TPZA 3HFRA 4DRYA 1J0DA 4FHDA 3L02A 1E3QA 3FOFC 3U44B 3MERA 3D6FA 1OJLA 3REFA 2ZJ4A 3NVMB 3VYSB 4NYJR 3H3FA 1T3ZA 3RJ9A 4HZUB 1GUDA 3VZSA 1E9RA 1GL6A 2IHJA 1A27A 3HBMA 2ERCA 4XVUA 3SYKA 2EOAA 4LRWA 3O9ZA 1Q77A 1KZHA 2AHOA 1N92A 1TUBA 3C1OA 4ECAA 4BNLA 5BN5B 4HB3A 3MG9A 3OCJA 4FU0A 2XJ9A 3HVHA 4BO5A 3OT5A 2E21A 4NXNB 3WB1A 1FTWA 3WQRA 2XD4A 2RH5A 2ET6A 3PHCA 4OHZA 1NMZA 1JXQA 1OC2A 5TV2A 1GZ3A 4NV1A 1GPYA 1NKTA 3LCRA 3R7NA 1Z2PX 3FZNA 4UPVA 2HNBA 5GJVC 7MHTA 2AB0A 1QFSA 3R40A 5DNWA 3NV9A 4F4DA 2QSUA 1JI3A 2IF0A 4FYIA 1K8QA 1NQXA 1X3SA 1O7JA 1SVNA 1EVEA 2LIPA 1FUKA 1OYYA 2VH5R 2I4MA 1SAYA 1XWFA 2OAGA 2X9QA 3GJ4A 4KWHA 4N5HX 4QATA 4RZUA 3ZR4B 3V32A 4ZGWA 5KTOA 3NJ4A 2AUNA 1LWNA 4WFKA 3EDYA 1O94C 3QJYA 2WV7A 4UM9B 2DLCX 3IBYA 1NPDA 3M5WA 2X0FA 4BRUA 3N86A 3TM5A 3OIDA 3UJ7A 3CT6A 3HE3A 2OCAA 1PLKA 4E5SA 5K8JB 4LZZA 1Y9ZA 1VKOA 1YB7A 2G1UA 1TF7A 1ZZEA 3MMZA 1EVKA 4NU5A 1XDDA 3R75A 4Q7LA 4O6VA 3TQSA 3KEQA 5CHYA 2P2DA 5AHOA 4TYYA 3WMXA 5EJIA 1PX2A 4DLKA 4L7VA 3PDIA 2P3QA 1Y0BA 3KVVA 5T6MA 4FHFA 4NV3A 1C0PA 3CUYA 3HQ4O 5EHIA 2YHIA 2PS9A 5JC8A 1YBVA 4M0LA 3HJCA 2B4RO 4PW0A 5LOVA 2JKYA 1YIAA 2ZREA 3I37X 4KXQA 4MB2A 1VSUA 2Z2KA 4M38A 1CQIB 3MOIA 4ARBA 3DD1A 3LX4A 3TVYA 1ISHA 1JN0A 3LAWA 5K9ZA 5MN6A 4NP6A 3VX3A 5HKAA 1LGYA 1E3WB 3L40A 2W70A 3LNCA 3O82A 2LW7A 1GKUB 4OK6A 1BVHA 3HJBA 1CQIA 4IUYA 5B3JA 1NZFA 1JH8A 3LUFA 4GU5A 4MWZA 4F6RA 2IPAB 3G5MA 4K6HA 4OSOA 1M1YB 5DNVA 5GGYA 3UV6A 4IAOA 2C2HA 1P60A 2JHPA 3QOXA 2WD7B 3HA7A 2O3TA 3K16A 4TGLA 2R00C 1BDJA 1N3IA 1RDFA 2ASVA 2VBGA 2YJ6A 3H1AA 4MQMA 4C29A 3ECCA 4Z9BA 1J42A 1WDKA 1SHZA 4HNAA 4ZQBA 2JAQA 1QH8A 2KPOA 3DBIA 3GJXC 3KVNA 3QA3E 4F1WA 3MWDB 2QUBA 1H4QA 3QBDA 1RU3A 3AVTA 2YQ5A 3KR1A 1KHHA 1PFVA 4CCWA 4XVRA 4Y9UA 4DRZA 3RT1A 4KAJA 3TB4A 1P8AA 2B6HA 4UVHA 4EZBA 2BFNA 3RIYA 6AT1A 4PQRA 2RI1A 3KKMA 5BW5A 4D8XA 4GYWA 3KLMX 3Q2KA 1PK8A 1BS1A 2QE6A 3IEUA 5TPZD 1EXVA 3W06A 4ENSA 3ZXYA 5KVSA 2GT1A 2PWYA 1RQLA 2XMRA 4ZYWA 3T7RA 5MF6A 5EVCA 1R6TA 2BJHA 1T36B 4PX3A 4DCCA 8ADHA 2BMAA 5DX8A 3WJ7A 5KYWB 2ZYIA 1RHQA 1X7ZA 3QQ5A 2BH2A 4HDNB 2XY4A 3UXYA 2DHCA 1TFRA 1VMDA 2BEWA 1T2VA 2Q99A 4KWIA 4B6GA 4CG0A 4OQFA 2ZITA 3W4IA 4EG5A 2CJWB 4B31A 2J5BA 4OFZA 2GOYA 5ALQA 2WF9A 3KWLA 1A8UA 1J9GA 2QU7A 1N7HA 2AS0A 3D8HA 2O1EA 5C7OO 1H8HA 2JLVA 4BO4A 4XM0A 1N5KA 2OVFA 4KIUA 5ALTA 1SY7A 2VDRB 2QZPA 4JBYA 2W6OA 4Y6PA 4XWYA 5FAXA 1DMRA 1F8GA 3SDZA 3NTQA 1MQAA 4LJLA 4MPRA 1K8YB 2M98A 4X64B 2I2XB 1Z13A 2YVQA 1AN0A 5BR8B 3SCZA 3V42A 4C6SA 1XJCA 3F6EX 5FBWB 2YY5A 5AKIA 3GFBA 3RBVA 4DMCA 3VDNB 1EJ0A 3WQSB 4DR3B 3BT7A 1NVVQ 4G2TA 1RLOA 4FMCB 3WDMA 3S3TA 1GTJ1 4EB0A 1XP8A 2LE0A 1N6OA 4UPDA 3ZZMA 4R83A 4B6EA 3DAOA 4X92A 1U5BA 2X5JO 3EA4A 3HLTA 5SICE 1T4BA 4A4DA 4HNSA 2O0MA 4QVIA 3CF4G 4M89A 3ELBA 5JNRA 1FXUA 3CT4A 3MINA 2V6MA 2Q6OA 1ZOOA 3HVJA 4UUMA 1DS6A 2YNMC 4HYTA 2E9SA 4JEUA 4MR9B 1FMFA 5CFRA 5IJWA 2GPTA 2PZGA 3A6JA 4G85A 3MTDA 4CNBA 1QWOA 3KXLA 3DHWC 3PGXA 4P36A 1Y6ZA 4P98A 4R2XA 1TKCA 3LL7A 3KTOA 5CCDA 4F3NA 1V1RB 4D9FA 5DDIP 4L9SA 4B35A 4UDXX 4OLAA 1T9HA 5CFZA 1QHIA 2KM1A 1UP7A 2PCLA 2O06A 5HWSA 4CR7A 4KL8S 2VSQA 2EP8A 2GTHA 1UIMA 4DV3B 3FYCA 3THRA 1ZN8A 2VJLA 4JY7A 4Q7QA 2PGAA 1F8UA 5H4HA 3LY7A 1OI3A 1G8KA 2P9GA 2VAXA 3FY4A 5EQTA 1DO8A 5JW6A 3AJAA 1DAIA 1RAFA 3QX9A 2ZUUA 2R8YA 3MJVA 4ZWNA 3SC2A 4G1MB 3C43A 3MMSA 2ODTX 2YVAA 1WVGA 4X9XA 2P3LA 1JZSA 1ORVA 4IXTA 1Z6YA 1EMDA 2CWWA 2W42A 3ROXA 3NPAA 4AO6A 2ARKA 4OFWA 3MJSA 3ZN2A 3U4QA 1UANA 4B3BA 3UK1A 3KZXA 2AQ8A 5REQA 2WG2A 3CMCO 2OXEA 4JYCA 5F7ZA 4QOIA 2YMPA 1N78A 2C82A 1Z5PA 4L27A 3WFZA 1EVYA 1JDPA 4P53A 4LSGA 3BRWA 4I9UA 1SHLA 2C2ZA 2Q46A 4DQDA 2AHRA 3JQ7A 4MGYR 2NSLA 1QBKC 4CWAA 1JILA 4JZKA 1R4MA 4MB0A 3SPXA 4N5DA 1SUFA 2G9VA 3L0YA 5FTWA 3CNBA 2HMWA 3MLEA 3GZNA 3OD5A 1OMOA 2QLBA 3EXEA 1GZ5A 1BH2A 1CJSA 3L46A 4JB2A 4QUDA 4RVOA 1RFLA 2ZJ1A 4BNHA 4DCTA 4LFBB 3IHTA 3BHJA 3DOCA 3WNVA 4IINA 2BY4A 3A0UA 3N76A 3R9XA 2F48A 2O5CA 4N7RA 2YXNA 1NW8A 1IEQA 4BMOB 4GX1A 1U9IA 2PIAA 3M49A 3RRYA 4B6FA 4EA7A 1TECE 3DE4X 2C2MA 5HIAA 5CGQB 1XHLA 2I9PA 3KTFA 4ZKEA 4BVBA 1E2NA 5TE9A 1FS4A 1XKQA 3NR2A 1ZDMA 2R5FA 2R5WA 4R8SA 5L53A 3O8CA 3GLIA 3AKEA 2EJCA 4RDCA 1P4RA 4B80A 1FDRA 2ZAYA 3BHNA 4EFLA 1CVRA 4QOEA 2Y0BA 5TF0A 4NJEA 3Q7TA 1U0BB 3P2MA 1OPRA 3DBVO 4C2BA 4LMBA 1AUOA 4FZJA 4Z4IA 3T7EA 2FN7A 1YRHA 1JB1A 4M3NA 3DB1A 3QE3A 3MSXA 1E4VA 3T52A 2CK3A 3QLUA 3R0VA 2XADA 4HRVA 5DN9A 1DRUA 1RMQA 1TYCA 1DEOA 4BMXA 4XVCA 4JI4B 3L0CA 4LGCA 2OBBA 5EWLB 1HETA 1W34A 3EYWA 2A7QA 2XQJA 3ROFA 9ABPA 1RSZA 2E82A 4X94A 4QT4A 1M2VB 3H3XA 1WPRA 4HX9A 1KZ1A 2Q3MA 2PFSA 1IHXA 1XAJA 4EJMA 1NHWA 2LGJA 3HN6A 2A9VA 4JJAA 3NVDA 3KYCA 4AJ1A 3WYEA 4NYIQ 1ZH2A 2IVFA 2CVHA 1U9CA 5B7GA 2X1HA 1XJWA 4XIYA 1H0SA 2R1ZA 4NYMQ 3V6MA 1Y80A 3Q87B 1IEWA 2ZE6A 2RARA 1NM5A 4LY6A 5TS3A 1DBSA 2JLQA 5EEHA 4FDAA 5BSUA 4RD4A 4B2IA 1C9JA 2QX6A 2PVSA 4I4IA 3V2HA 1XNJA 4YGYA 3X1YA 1H6BA 4H6XA 4Y67A 1KMMA 1NDUA 1TQDA 1P0IA 4BIIA 2YZMA 4B84A 1H4SA 1PWYE 1WA5A 3ZHQA 2E2WA 4M21A 4YMGA 5CEEA 3OM0A 2VKTA 5FYQA 3WL5A 4FUQA 2GM5A 2XWQA 4TL8A 3CRVA 2H16A 4LA4A 1NXXA 2QLLA 4ZU1X 3P5BA 3TXAA 2XWJI 4LSMA 4GOJA 3HSSA 4HLCA 1KETA 2OBXA 3PR3A 1R0BA 3M1LA 5TQVA 2GZDA 2YV4A 1THZA 3FZQA 2P5TB 1XTZA 3BXXA 4FFSA 4C6TA 5JD6A 5ILOA 3RVQA 3CZ4A 3ZWAA 1JYSA 4M1MA 2D59A 5C1PA 1EJ6A 3JX9A 4LQLA 2NVWA 2JI4A 4WGFA 5DVZA 5L7YA 1IBCA 2Q0HA 2DR0A 4LPSA 3TLJA 3V4FA 5FQNA 3EVTA 3GRZA 3ZQUA 1ZGBA 2AN9A 3G5UA 4RMIA 1PKXA 2FHPA 2ZBRA 3Q41A 4BP3A 3UAOA 4AY5A 4MUXA 4EH1A 4MS4B 4TN1A 2OHOA 2WUVA 1KL7A 1XTIA 1DFGA 3PJEA 4UD6A 4Y0AA 3FGOA 2IZ0A 1FS5A 2PO7A 5AUNB 1RT9A 3DLPX 4CLHA 1Z5UA 1HNZB 1XELA 2FVXA 3K31A 3WAKA 2WMYA 4DNFA 5CDUA 5K8VA 1E79A 2X5NA 1NAIA 3EH2A 1QR2A 1SN7A 2JH9A 5M7EA 3P2OA 4A2QA 5K20A 3E05A 2F1IA 2I91A 4BKUA 1KI4A 1LBEA 1HO3A 3W3AH 5ICCA 1M3SA 3J7TA 1Z4OA 3BN3A 2XHZA 1THTA 4M9RA 4B7CA 1ZRSA 5LM3A 1K3FA 1CUBA 1J49A 4UUBA 3SXPA 3WJ1A 1YCGA 3EVFA 4XVHA 3KE8A 3BGSA 3ZEAA 3F6YA 5JTUA 3L6OO 2OESA 4Q1FA 2A9FA 3RTDA 6REQA 1RC0A 3VKVA 1VHQA 5DHFA 2BV3A 1V1RA 3BGVA 1A69A 4JP3A 4BCBA 3GIDA 5K0EA 3KOZA 4GQAA 2CXPA 1WV1A 3WOHA 4X1KA 2R96A 4XPZA 4DCSA 3IVMA 4DNQA 2VT7A 1C3VA 3AOEA 4NCBA 2IU3A 1IUPA 3K30A 3QGMA 2QRJA 3BD6A 1EWTA 3ELDA 1T5OA 4M99A 4ND5A 1MW8X 5FEMA 3LUAA 1UBMS 1G8YA 4C4XA 3BWMA 5THXA 2PKRA 3O75A 3MQ4A 1JHXA 2J30A 5J5VA 1KDOA 3A3KA 4IGFA 3NALA 1Z12A 2W6ZA 1SQGA 2F6RA 2ZYHA 3ECSA 4YJ3B 5JYCA 3OY7A 2WF8A 3SJZA 2REBA 5A1JA 2ZIXB 4FGUA 2QGZA 3ASZA 3PS9A 4FDMA 4MQ5A 4YPFA 3UFBA 5FOTA 4EB6A 4DLBA 3HEAA 4S24A 3ZE6A 1D8AA 2O14A 5FI1B 1PR4A 1PRYA 3KFXA 1FJHA 4GPEA 4RYLA 3Q3JB 1FNSA 2JFUA 4TVKA 3RWOA 5I7FA 2H5EA 4CN8A 5MGBA 1F2TA 1R6BX 3D1JA 4H0FA 3CUWA 3P8ZA 3PZBA 2I7TA 3N2YA 1YDFA 5EGSA 3SIPA 3T7CA 5EP1A 5DTIA 4WLNA 1BHQ1 2G9ZA 3OU7A 1HQDA 5JYDA 1KWKA 4N8EA 4RAOA 4ZOBA 3IOCA 3IP1A 1IN7A 3VKFA 2REOA 4LWOA 2PUTA 2RCYA 4E7PA 1UAAA 3TCKA 1UC4B 4PSDA 5CU7A 5EHXA 4FYKA 4I7EA 4W7IA 2D74A 4XE5A 2C99A 3IUSA 4LYJA 4BNDA 5F5LA 2EX4A 5FWAA 4INOA 4WOKA 4WZBB 1RACA 3I5XA 1Z22A 2BI4A 1JG2A 4AIIA 3LDUA 1DKPA 2LWIA 3HBLA 1A9XB 1PV1A 1Z37A 5EOVA 3TR5A 2V59A 2X0DA 5JDIA 4G0VA 2QVXX 4KNVA 3HO8A 1JG7A 3SVZA 2FW0A 2Z43A 1FSSA 4XPIB 3UGTA 5G40A 2EWWA 1YQ9A 4QOGA 5FNVA 1E6MA 3MBOA 1IN5A 4XGRA 4C7VA 4OREX 1D0SA 1E2JA 2VHUA 2WIKA 5CITA 1TCAA 3QIAA 3GRVA 5C5DA 3FD8A 5ISMA 4B2YA 1LV7A 1YRBA 1IN1A 3T9FA 4PO3X 1Q57A 2H5IA 1V47A 2NUPA 3QH4A 4JVSB 1SQSA 1IG0A 4OSEA 4U5XA 2RHOA 3N2NA 5FWXB 1II8A 1Z06A 2PAFA 4E0BA 1UKVY 1XVIA 1LY1A 1P39A 2NX2A 2WFLA 1A5BB 2ZB4A 2H4FA 3AERB 3GQBB 5DCUA 4JDPA 5EGNA 5GIPE 3D43A 1V45E 2XXJA 1K2VN 4Q1VA 4HDAA 4QGAA 1VYTA 4US0R 3G2KA 4JQZA 3TPZA 4ENVA 1QE0A 2CNKA 4IMIB 2TYSB 4XASA 1DPFA 4AKEA 1BXZA 2XTJA 3MB5A 3QVTA 2ZK7A 2GF0A 4QG7A 5KSZA 5MHTA 3EG9B 3GEMA 1F6BA 2FPLA 1MLDA 3KSMA 1NOJA 3ZD8A 4HLQB 1UDBA 3PP8A 2W6CX 1A8QA 3HGQA 3RFXA 1BJKA 1HOTA 2NUBA 3TTUA 3ZK9A 2O2YA 2FEWB 4PYOA 1WUHS 2QSJA 1V2GA 1J8VA 1SCUB 2W2OA 3UANA 3PJRA 3AUSA 3MUNA 3BQ9A 2JHFA 4YJ3F 4BFZA 4E88A 3FWKA 5CFOA 2VAMA 3AETB 4I1IA 1U8UA 3V46A 1PYOA 1L5OA 5K7SA 4DHWA 3Q0TA 3SYNA 5K3BA 3ZXSA 2VNIA 2ZYUX 4URYR 3TMKA 5L3VA 1RQNA 3AETA 2X1MA 1DVRA 1I4DD 1UKZA 1TT7A 3OEHD 2ZI4A 4LBYA 1SC4A 1SKYE 3VR1A 4HQ6A 4QAQA 3T9EA 4BX3A 1T8RA 4OATA 2Z30A 4AS1A 1QH9A 4AX4A 2P1DA 5BW4A 2GN1A 2ZE7A 3KALA 4WKGA 1GNQA 1B6SA 4JCCA 3LT2A 2WG1A 2WJHA 4Q7EA 4I4TA 1IPHA 2H1FA 3IR7A 1BX3A 4CG3A 3EISA 1Z88A 1US8A 2Q6TA 1F0PA 3OBBA 5ENVA 3I2KA 1K06A 3RU3A 1YNOA 2AEMA 4HV4A 5HK9A 4J2HA 1KMCA 4Q9JA 3ZLBA 1WJGA 4F45A 1HE8B 3G1WA 2MYUA 1N6HA 3JQAB 4UNSA 3EX7C 2V7QA 1V3UA 4FJ2A 2CCGA 3VO1A 2PAAA 4IV0A 3V00A 2GKSA 2VJAA 2ZATA 4BO6A 4DY6A 1FXWF 2PT6A 3QF7A 3RYHA 4RE5A 1ONSA 5T67A 3DDUA 3SMVA 1GZVA 2FV8A 1JX6A 4NZNA 1L3BA 4HNVA 2IOFA 4KQFA 3K0SA 3GEPA 3GJ5A 1OXTA 2D8MA 4MHSA 3RC8A 1T24A 3PQ4A 5ETJA 3WLOA 2HI0A 2QE7D 3N9IA 4PFJA 4FC7A 5T5QA 5JXGA 5C5CA 1K9VF 2FR1A 3P19A 1PNVA 1RYEA 3R76A 3EEBA 1QP0A 1S3SA 1AGYA 4G4IA 1G5HA 2XVAA 2OENG 3QVVA 4RY2A 3T6KA 1SIBE 4AN1A 1BQ3A 1FFXA 3M83A 3RKUA 3EBOA 2X8JB 2GYWA 2GLUA 1BSVA 3FCCA 2YHAA 3SBOA 4WY5A 1BVUA 2H59A 3TIVA 4EGSA 1X0VA 1XDSA 1E9DA 4MW4A 1UM9A 3R7BA 1IHPA 2VWGA 1OLUA 1PJBA 1QG6A 4D97A 3DBHB 4B4KA 2W90A 3I28A 3CTPA 3LPDA 2F9LA 1FUUA 3FSJX 4ZCLA 2CMGA 1RJGA 3Q7QA 5AKZA 3F49S 4AN4A 4RMGA 4JJ8A 2RH4A 5DBOA 2IVZA 4PAWA 2OO5A 4CTKA 3LP8A 1NP7A 2R6CA 3HSKA 3JTEA 1OFGA 3H04A 1ZK4A 4LYYA 3NEJA 5EMHA 3N0TA 3W5BA 3CISA 4UFPA 1FP6A 1HURA 2JFQA 4IIXA 1QYVA 5FL7D 4E5DA 3IB3A 1AKEA 2HPVA 4DCJA 1C14A 3A3OA 1PNRA 1P2DA 4QEKA 2R87A 3VHXB 1GG5A 1FNBA 1Z38A 3G2QA 3OF5A 1VBNA 1IDN1 3Q3EA 2GRAA