2ADFA

Crystal structure and paratope determination of 82d6a3, an antithrombotic antibody directed against the von willebrand factor a3-domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
189
structure length
189
Chain Sequence
DCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting/immune system
molecule keywords Von Willebrand factor
publication title Paratope determination of the antithrombotic antibody 82D6A3 based on the crystal structure of its complex with the von Willebrand factor A3-domain
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2adfA00
2VDOB 3T3PB 4BJ3A 2NUTB 2ODQA 1DZIA 1MHPA 3HXQA 1RTKA 3PPXA 4G1MB 3EGXA 3ZE1B 3EFOA 3N2NA 5E6UA 3T3MB 3V4VB 4IXDA 3K6SB 1MQAA 4NENB 3ZDXB 2IUEA 4C2AA 4WK2B 2B2XA 4CNBA 5HGJA 4CN8A 5ES4B 4JDUA 1XUOA 1UEXC 5HJ2A 4IHKA 5KYYA 3EG9B 1XDGA 1M2OA 5KYYB 3QA3E 1MF7A 4M76B 1AO3A 2WW8A 1V7PC 2VDMB 3ZQKA 4C29A 3TW0A 5KYXB 1OAKA 1QCYA 3HXOA 4NEHB 5KYUB 1M1XB 1IJKA 4HQLA 1PT6A 1U8CB 1FE8A 1RD4A 3NIFB 2QTVA 4C2BA 1NA5A 2I6QA 3EH2A 1SHUX 3EGXB 3EFOB 1M10A 5E6UB 2O7NA 4IGIA 3M6FA 4MMZB 1Q0PA 3ZDYB 2VDRB 4HQNA 2ICAA 3K71B 3TCXB 4MMYB 1IDOA 1RS0A 2VDNB 4XW2A 1BHO1 3ZE0B 1N3YA 1TYEB 3IBSA 3EGDA 3FCSB 1L5GB 5E6SA 1N9ZA 2XWBF 3F74A 1JEYA 3BN3A 1MJNA 3HI6A 1JEYB 4HQKA 3FCUB 4G1EB 4DMUB 4WFQA 3EH1A 4FX5A 1QC5A 4Z7OB 4O02B 4Z7NB 2VDQB 1QC5B 3NIGB 3PPVA 2NUPA 1M2VA 1XDDA 2VDPB 2NUPB 1RRKA 1AUQA 3Q3GE 4PN7A 1AOXA 3BQNB 1CQPA 1JLMA 1SHTX 4UM9D 5KYWA 4WK0B 4HQOA 1CK4A 1JV2B 1PCXA 2XWJI 4F1JA 1T0PA 1BHQ1 2XGGA 1U0NA 4UM8B 1IDN1 1LFAA 1SQ0A 5HDBB 1PD0A 5KYNA 2VDKB 3EGDB 4UM9B 2I6SA 5E6SB 3PPWA 3IJEB 4HQFA 2NUTA 3K72B 1JEQA 5LN1A 1JEQB 1MQ8B 2ADFA 2NVOA 3EOBI 1ZONA 4MMXB 2WINI 3K6SA 3TXAA 4NENA 1U0OC 3EOAI 4Z7QB 1IJBA 3RAGA 1MQ9A 4CN9A 3V4PB 1M2VB 1M1UA 3BQMB 1ATZA 5E6RA 2X5NA 1ZOOA 3E2MA 3EG9A 4A0QA 3ZE2B 1DGQA 5E6RB 3VI4B 3ZDZB 3TVYA 1FNSA 2M32A 3F78A 5KYWB 5BV8A 5KYXA 2VDLB 3VI3B 1ZOPA 2VC2B 3GXBA 4WJKB 1T6BY 4F1KA 5KYUA 4WK4B 3NIDB 2ODPA 1YVPA 1YVRA 3PPYA 1PD1A 2I91A
chains in the Genus database with same CATH superfamily
2XVZA 1IQPA 3V55A 1DLJA 5HVNA 1P1KA 1SQ6A 2J46A 1RJ9A 1XKTA 3PXCX 1Q0HA 2O07A 3OHMA 1NZJA 5EGSA 1OLUB 2XWPA 3AI7A 1E1QA 4KL8S 2ZUTA 3WRVA 1HE8B 1UPAA 3CPJB 1WHSB 4NYMQ 5F2NA 5HBRA 4I6GA 2DUJA 4FYMA 5IT9A 2VHEA 1NU6A 3EVTA 3I4LA 2YOFA 2Z3ZA 1K0FA 3RHTA 1L6RA 5AWFC 2OO5C 3ZTWA 1PWEA 1QJ4A 4NCXA 2FOLA 2HCRA 2ONCA 2A58A 4WDRA 3LQ4A 4ZQFA 3G8AA 5JXWA 1KJ8A 2QRZA 3AM4A 3ZHZA 3RRZA 4MYCA 1U1IA 3CVVA 1K63A 2C5BA 4FOTA 1QONA 3PQCA 1KDYA 1KJJA 1IJFA 1IJKA 2J3LA 1KKLA 1DHTA 3VPFA 4MIEA 4YQZA 1TUGA 2V7TA 1XEXA 5FA5A 4ZTUB 2YDYA 1E9EA 2Y1OA 4K9SA 1CV2A 4CV3A 4EZEA 6NULA 2ZJ6A 1X7XA 2O7NA 1ZOSA 3HFSA 4A6XA 5GWXA 3JQBC 3O9VA 4JVLA 4K9PA 4KX5A 4UPDA 4DF3A 2OHIA 4V0RA 5DW3A 3IC5A 5ADVA 3EY9A 3KOXA 1L9KA 3Q2IA 3K35A 1JECA 4NZNA 1MG5A 2JGJA 5JEDA 3I9V1 3K0EA 1QTIA 2COEA 3NP9A 3OX1A 3ZH9B 2Y1FA 2IUTA 4UREA 1SOAA 4UATA 1PNTA 1P17A 4QUIA 4KQIA 1XNQB 1YI0A 1S2GA 4KLAA 5EWLA 2QPTA 4XR9A 3FVRA 4MQ6A 2VHUA 4YMHA 2V0GA 2C4KA 3HKBB 4W1QA 4P33A 3K8YA 3FH0A 4C7OB 3VTFA 4YTEA 3QRWA 2HCFA 3I3OA 4G1UC 4NV3A 4OB7A 1Z37A 2Y66A 4Q1EA 4TZKA 3UTDA 2HMWA 2P9BA 1GQYA 1RQNA 4FLEA 4FR5A 1JZTA 4IJUA 4WXYB 4B6OA 1R0LA 4UM9D 3LECA 2UUOA 2JGKA 1NWCA 3JZMA 3ZBTA 5JJ5A 1K8ZB 5EA2A 3GL9A 3L01A 2BH2A 3P9YA 2AEMA 1SPXA 2I3ZA 4CG3A 1C5KA 1YCDA 1NOJA 1Q1EA 2NQ8A 3L05A 2F1OA 1CY4A 2X5OA 4ZEVA 4ZAWA 4BJHB 3O4GA 2AK3A 1UDWA 1ZD3A 2I62A 2CHVA 2XITA 3OOHA 1WVGA 3KAJA 1H6AA 2B4KA 3AHDA 4KUHA 1DKOA 3NASA 4RANA 2V9CA 4AB1A 2UUCB 1YZQA 2GFQA 4KKVA 1QTQA 3AFIA 1WUTA 2PSFA 2VKQA 4M9ZA 4C1BA 3C15C 5AQEA 2AQ8A 1TQDA 4KQJA 5IBPA 4C30A 1HTTA 1V8PA 5FO0A 1DWQA 1HEUA 1HTBA 1XZBA 5CMLA 3SN6A 4MRAA 2XI4A 4TKLA 4C2TA 3QW4B 4US2R 1Z28A 5EC8A 2QAIA 3WJAA 2Q2WA 3FTEA 4JVNA 4FONA 3VI4B 1J2TA 4FKZA 1WDWB 4LHVA 2SECE 4CUKA 5GGYA 1PBNA 1YOVA 3MZ0A 3SC2B 1QV6A 4TMXA 4EG0A 3S1SA 3I37X 1RWBA 3DULA 1PFQA 3QXSA 1GR0A 1WCYA 5BQPA 3GRYA 3S8EA 3GEPA 3HCPA 3GQVA 4FGLA 4LWOA 2FOIA 4RADA 2IHNA 4L02A 4BO1A 4P4NA 3WZ2A 1E7RA 4F4UA 3SF0A 1U2GC 1DRKA 5AFSA 4XE5A 2JGDA 2C77A 4DV5B 3PNMA 1J56A 5FNVB 1ORVA 1TAHA 2ATEA 4M6WB 2PZKA 3DBHB 4RBNA 4A10A 5AD1A 4CKEA 1GUBA 3HY6A 3ZKAA 2G5GX 4YAUA 5KNBH 4G85A 3KETA 2PKCA 3AG5A 4TS9A 1C9YA 2FJPA 4DA9A 2A0WA 5A4KA 3U0BA 3SOPA 3P9NA 1JF8A 1OY1A 1MO3A 2LKDA 3T0IA 4D46A 1F5NA 4QFMA 1NHWA 3O31A 1JVBA 2QM8A 2V98A 4MP3A 3UOWA 1OZ0A 1AZLA 5EWMA 1F8XA 4AJLA 2ODTX 4MWTA 5JCZA 2GKGA 2JBAB 1C1XB 1C3OA 3PEVA 4AZWA 1A2QA 1MCZA 4CQMB 3JYOA 4RA6A 3NLLA 2TMDA 5K2MA 2QLMA 3OT4A 8ATCA 2Q3DA 1CR6A 1U8CB 5KOYA 4MO9A 1H8ED 3AJ9A 4TTTS 3GV0A 2HH9A 1SA0B 4E15A 1MV5A 4BL5A 1FFGA 2OAEA 5LDGA 3FCXA 3DEIA 1K7XB 1S2DA 2GEUA 2J5BA 3NVMB 2WWXA 1W8DA 1M72A 1JFFB 2ZAMA 4GKAA 4TMWA 4AJHA 4MAFA 1FP4B 1OBFO 3K94A 1SM4A 2ICAA 4FMPA 4KMMA 1UBEA 3CU5A 2CLOB 3QSYA 2XKBA 1PWXA 1YUBA 3GHHA 4BPRA 1QPGA 3BILA 3VOAA 1BRMA 1EUYA 3DO6A 1C30B 2AC2A 3PFCA 3LQ1A 4Q3BA 5K3DA 3B6KA 2WHYA 4AW9A 1YDEA 4MPTA 3CEAA 1TIKA 2YXBA 3G02A 3RE1A 4AURA 4B2PA 4GPEA 3CONA 4BV8A 2O2SA 5IZCC 4JI2B 3JQCA 1N5MA 1T43A 1P9OA 2FF5A 4KFSA 1M1YB 2OK8A 2PL1A 5AP9A 2ZDQA 2D1RA 2HIMA 3ETGA 4P7BA 3SE0A 1KZ9A 1FRVA 1O95A 3QUCA 3DZJA 2BFMA 4FZRA 5E9QA 4FEYA 1Q84A 4ANFA 1LY1A 1C1YA 3M7IA 4P6VF 1CCWA 3CZRA 3LU1A 3LUDA 4DQUA 1FMFA 3ONFA 4X97A 3STYA 4FXOA 2XQVA 3JD2A 5DGHA 2B8JA 4D9GA 4LDQA 4Z4CA 3G2NA 4PZDA 2AEJA 3IJEB 2R751 3IP7A 5LQDA 3BL6A 5FFNA 1O8BA 1H0KA 3CRNA 3KZ1E 4F04A 1RC8A 1JB9A 2R7AA 2XQJA 2C2ZA 5E7IA 3G5AA 3KYDA 3Q0TA 1NN3A 4OXQA 5J2UB 1PR0A 4FDAA 3T12A 1KI9A 4Q4HB 4BO3A 5CT6A 4CFZA 4AMBA 5FBRB 3EIFA 4NL4H 1DJOA 1L7RA 2EZ8A 2DBYA 1SK8A 3GJ6A 3VNAA 2CLDX 3ENVA 3C3MA 3NUGA 3AHEA 3KUKA 2V7XA 4TKZA 5A0FA 1TM4E 1J8MF 1N2EA 1FDOA 2YHAA 2QXUA 1WDKA 2QD1A 4KQMA 4MKXA 1UOPA 1DXQA 2A84A 4U7HA 4AY6A 4QBFA 4ROSA 2G8NA 5BMVF 3BD7A 5FKJA 1M8JA 1ZINA 3LFHA 4MUKA 1C9NA 4JHLA 2BELA 4KQ1A 1W4AA 3I6QA 3OPYB 3QW2A 5I4BA 3HNRA 3JWPA 2WFMA 1WTCA 1YK0A 4LX8A 4U2CA 5F1KA 5G4KB 3DE6X 3VR3A 4EMBA 1KBZA 2GYUA 3RVBA 5LL6P 4QT0A 4JLSA 4HUJA 3PHBE 4ZWNA 1M6HA 1E4OA 3U4GA 5B2FA 5CM8B 5BMOA 1AMUA 1JXAA 5JWHA 2BHNA 4PO3X 4NNPA 2DFNA 4WXMA 2H5JA 5G1PA 1AU9A 1ESZA 3ZE7A 4A2CA 2FDRA 2A67A 1JHPA 2WIKA 4UEWA 2RFLA 2CL7X 2CUZA 4AD8A 5GINE 4E51A 1AB5A 5TPWA 5DX8A 1A9ZA 4UHKA 4ZVKA 1WA5A 4GKJB 5CA1A 2EP8A 5H7XA 3RRBA 5JTTA 1FU4A 4OCZA 5JE8A 2FEAA 3WDMA 4MQLA 1LDYA 2AXQA 1CUAA 1Z73A 3GX1A 1UAAA 2ORIA 4HP8A 3AEUB 1JIXA 1OT3A 5JCOA 4AQDA 5FBQB 5B57C 4B2LA 2NT4A 2ZIZA 2ZS8A 3D3WA 4B2IA 5EP2A 1KYQA 3AP1A 3MJRA 1FL9A 2OUKA 2DFVA 2CYCA 3WGMA 2ECKA 1UJBA 4TV9B 4ESOA 4F6RA 2VSYA 1GAEO 3N3AC 4QWMA 1U0LA 3TW8A 4TZ6A 5JD5A 3C0KA 2AOUA 3GMSA 5KTKA 1MX3A 4EM6A 2IHZA 3GCXA 3GPIA 1EX1A 1XWIA 3LT5A 4WN3A 3LGXA 3TQOA 1TO2E 1Z2CA 5CVJA 1P5ZB 2HAEA 3WK7A 1TLTA 4I4LA 4EW3A 5CG2A 3ONWA 2R5FA 1HLDA 2XVXA 3PG5A 4JT8A 3G9ZA 1NPTO 3JZIA 4NV1A 2WQZA 4EHBA 2O8FA 5HKAA 3JARA 4C7VA 4G5SA 4UVIA 3PSAA 3RVMA 3ZWDA 1WEKA 3IODA 4FE4A 3FR8A 4QLAA 4DSZA 3PFHA 3MEQA 4MKRA 4A23A 5D5QA 2PZBA 1IEXA 1QMGA 4J75A 4ZVMA 1O97D 2F1RA 3I04M 3VVBA 2X7HA 5GAJA 1E5XA 4H3HB 4D80A 2OFWA 3LDFA 3GCZA 2PUDA 1IZYA 4EB6A 1QZ3A 1L5ZA 1VHQA 1YC5A 1ZNYA 2G40A 3RFUA 1O6BA 2A88A 3E4CA 3OMLA 4QUAA 4LZAA 2C3OA 5CLLA 1V5GA 4Z8YA 1U0OC 4Y3UA 1CR4A 1M83A 1FYVA 2B83A 5JC1A 4BX0A 5AJTA 3VPXA 5U9CA 2I33A 2O2DA 1KL7A 1NRXA 2ARKA 2XYHA 1R27A 2BMVA 4IUYA 3I9NA 2O9JA 3HKCB 3I61A 4EYGA 4JJ8A 3N2KA 1YZVA 2FZEA 2HK9A 5D1NA 2D4HA 3GFPA 5F5LA 2FRDA 3E58A 4PLPA 4Z4FA 4HTFB 2P3LA 1CUIA 1L3CA 4PC1A 2EC5A 3JAWB 4DCUA 1VI5A 2BZ1A 1VP3A 4BMZA 2O2CA 1EVQA 1E1MA 1R5JA 2AW5A 5FJJA 4JYCA 4I55F 4TL7A 1O6ZA 4V0MA 4E1AA 4JI4B 1YASA 4CEIB 1QCCA 4LCJA 4UJ3A 1UZAA 2BM1A 2ZYWX 4FHEA 4JVMA 5EN4A 4ZT7A 1F0NA 2WSMA 4N8SA 4DT1A 4FCWA 4EHNA 1A71A 2R8EA 2ZWIA 1QKIA 4HZIA 3ESYA 4R8SA 4TS1A 4XOIA 3WB1A 3G5TA 4EO4A 3HMQA 2G8LA 1QIIA 1CHDA 5LCXA 2CLCX 4JGIA 3TRJA 1OLSB 4BNIA 1UMCB 2F3QA 3GFBA 4HWPA 4N0EA 1IN7A 1SOVA 4WERA 3HZOA 4RLQA 4JWTA 2J67A 3J81A 2G83A 1GNQA 3ZCTA 1R1DA 5FTKA 3A14A 3D7NA 3T1QA 3B1ZA 3FSGD 2P0EA 2BLLA 3M4NA 4JFRA 2ZTVA 3GN1A 5FWYB 4C0KA 3IOMA 5KPJA 3FNEA 5BWNA 3MMZA 2P9GA 2X8BA 1GNTA 3K1YA 4U7TB 3CNOA 2NSDA 3UN1A 5EHXA 1VKOA 1GFIA 3ZU3A 4EUSA 1GTJ1 1KH1A 2N75A 3WNVA 2FW7A 4DMMA 1DKUA 3EVDA 3OJLA 1FP1D 3E5RA 1LNSA 1T2NA 2YJNA 3TGWA 1A76A 4B75A 4DMRA 2LDXA 4A8HA 1G9XA 2Q41A 3M34A 2OZKA 1SUAA 1MO4A 3A3NA 4G5HA 3D1VA 3QFRA 3RQIA 2SNIE 1JLRA 3BXOA 3EZLA 1YR9A 2P41A 4MDFA 1ZVKA 5EWJB 3TSWA 3NUQA 4F2PA 1WXFA 2C88A 3A31A 4P2GA 5C9ZA 1YWGO 1P0IA 4BMVA 2QSZA 3TEJA 3FTDA 2OMEA 4W99A 4OI1A 3OG9A 5DT2A 1O1YA 3JD0A 1LW6E 2ZRKA 4V2UA 3V32A 5JY1A 4OHMA 5YASA 1Z34A 3WADA 2OXFA 4IFTA 4ESHA 3FB1A 4K87A 4UMFA 1U9JA 2QZZA 3D0RA 4GOKA 4MTLA 4YA6A 1CUXA 1VL5A 1TD1A 1W9HA 2HZBA 3COYA 3D5EA 4IGFA 2FI1A 2QN1A 1EHYA 4LISA 5FHRA 3AM3A 1UXIA 4WBXC 4RCVA 4D3SA 5ITVA 1G21B 1UXKA 3K0CC 3UTCA 1ONBA 3IIEA 2XE8A 4D5EA 5B58C 1N2XA 3EARA 4C78A 4UPVA 3TIIA 4O2AF 2WQ6A 2UZ0A 1YMVA 2ZU0C 3K8OE 4NG5A 3KZKA 3ZJYA 3TZQA 5IX8A 1YZTA 4X1OA 1LF0A 1GZ4A 1QYVA 5FL7D 3JYHA 4UCWA 1OHHA 4RK5A 5EQTA 2B4TO 3TNYA 3UFXA 4AECA 4BLSA 2FKAA 5I7FA 2QJTA 1SOMA 1U0NA 1Z4JA 2ASVA 5JSKA 4EO9A 4NNJA 1EB9A 3I4FA 2DR2A 2O8BA 1ULBA 3V4FA 3GJ3A 2YWEA 2RCNA 2WC1A 2MCFA 3NWBA 3SJAA 5AW0A 2RHLA 5K4HA 4OHUA 2JFPA 3AB8A 4BYGA 3UWSA 4NAHA 1E63A 1PGNA 4ZZ2A 4KOAA 3ZDRA 1N32B 4NOMA 3HCNA 2XAUA 2JAWA 4KPUB 1HRKA 1AX9A 1XU4A 5IM4A 4KHPB 1FC0A 1Q16A 1VE5A 2PKWA 3SJ7A 2WKWA 1DGQA 4LYYA 2EL9A 1GPJA 3FXAA 2VZ8A 1IWPB 2ZEJA 2AFIB 2ZDGA 2CJYA 5B7GA 1G4HA 3AERA 1I3CA 1PU2A 2X7JA 3BFXA 3Q5GA 4O4JF 4G23A 4DQLA 4RQBA 4TYWA 4DJAA 3OKCA 4PV7A 5EKXA 3CNQS 3KOOA 2AV6A 5J59A 3S2GA 4DSNA 4GDFA 1NJ2A 2QX6A 3WLIA 4FQ7A 5DISB 5FPQA 1W2HA 3RFCA 1HG1A 1MJGM 2BJHA 4H31A 4IHAA 1L5RA 3IO3A 3LE8A 3VXKA 4B4UA 1JSCA 1Z0FA 2DHEA 3HV0A 2WJWA 3LBYA 4J7AA 3MGBA 3KJEA 3TB4A 3CCFA 4RJTA 2PO7A 3BDIA 1AMNA 5CLIA 1WKCA 3CO5A 1SC1A 3EVNA 4BJ5A 2BEWB 4V0OA 1FFWA 4DDUA 5HJ7A 1XZKA 1QX4A 3SGLA 4BZZA 3A6PC 5DDIP 3H1BA 1ZD8A 4AT1A 2WNIA 1JFTA 1AO3A 3F4LA 4D4IA 3D3JA 4M60A 4YJGB 3A05A 3PD7A 2PCJA 4JLKA 1B2LA 5AKEA 3A9CA 1GTRA 3R76A 4QDZA 1PUJA 3NT2A 3OU6A 4R5MA 3RJ9A 5KQMA 3ZCQA 4BFLA 1Q7EA 4D81A 1IQ0A 2FPIB 2WTNA 2C1EA 3AHIA 2AHRA 4XQ9A 2XNCA 4PPYA 2R5WA 5GADl 4XWOA 2P75A 2C5HA 1K6EA 1SC4A 5CXSA 3WFJA 2OPHA 3LNCA 5JC8A 5JXIA 1FZTA 4F1WA 4F3KA 3WGQA 4MMZB 3TOCA 3JAMA 4HB0A 1EWRA 2BCEA 4LDZA 3M2PA 1DC6A 1LPPA 1R6DA 1ZCZA 4EATA 1PK7A 1QZXA 1QRRA 1GIAA 4MYUA 3H11B 2HA2A 2BI7A 3L1KA 3PQ3A 4DM3A 1G2IA 4RZUA 5DULA 2BI8A 1N9ZA 2XWBF 4NZOA 1KY5A 3W8NA 1MAUA 2IYSA 1LNQA 2QG4A 3K4PA 3V4LA 3FMFA 4WKGA 5FPHA 5FLKA 1HV8A 4CG1A 2D5BA 3HKDA 2FPGB 3UT0A 1NQAO 2GD0A 5DV9A 2FPPA 2W6PA 4D82A 2G9VA 2X9NA 3T8YA 5GZ1A 4MNTA 2DLDA 4YMGA 3EPHA 4AAYA 1F14A 3FUXA 2C8KA 3QPBA 1BO6A 3H6KA 3H0KA 3DE3X 2LD4A 1XROA 3Q3GE 1OBCA 1P8JA 2O23A 2V7GA 1UQUA 2H1OA 4W8HA 2LRHA 4GSKA 3THOA 4KPEC 4FWIB 4MIYA 3KX2A 1MZVA 3Q12A 2AG5A 3VMFA 3KCQA 5JJKA 2ZCUA 2VWHA 4JP1A 2F9LA 3V8EA 3F6CA 4MRVA 5B2ZA 4WUVA 1NU8A 1JHOA 5G3YA 4ZCTA 1G20B 4OBBA 2J9XB 3UCEA 1C9EA 2XEXA 4LTDA 4KWIA 4CDRA 2ZSIA 4PZLA 4ZQBA 1WU8A 3JWJA 5AR1A 1EUCB 5TX7A 5D7NA 3VFDA 3IIJA 2XCQA 4RGQA 2LWIA 3G2KA 3F5SA 2A6PA 2IC5A 3G6WA 5HW0A 5ALTA 1RSZA 1TMYA 4A8JB 4KAAA 4LRYA 3OICA 2W2NA 4LRQA 5JNRA 3OCZA 3LO5A 4YRPA 4DTCA 1TYCA 4WD3A 1M6VB 4YMVA 1UBNA 3FFXA 3BF7A 1UXHA 4TRNA 1RLIA 3W2IA 1DDIA 2B21A 1XP8A 2W2TA 4LDRA 4FKMA 4R2HA 1JH9A 3R44A 1UCFA 1L4FA 1P6UA 3NIBA 1U3TA 2R97A 3H8JA 5B55A 1BMDA 3KOZA 2ROQA 4MVXA 2DR0A 3F0TA 1LJLA 3VOTA 1ECPA 3AJ8A 3CR8A 4OM7A 5FI1B 3IQIX 1KARA 3NJRA 3G13A 4K6GA 2MR6A 3RV3A 4QVIA 4U0JA 1NDUA 4EUHA 3BBLA 1OBVA 2PXHA 1ORWA 3UXMA 1I30A 4FNAA 1U3WA 3LT2A 1OR8A 4TPKA 3W4IA 4H17A 2KM1A 4HX2A 3C3WA 1K8RA 4JD5A 3RYTC 3VZRA 3UK6A 1PE0A 4MS1A 2WTMA 3V1TC 2JFVA 3VZPA 4P81A 1MG0A 1U3CA 3L4KA 4MW7A 5AXAA 4KOEC 1RPJA 4B3TB 5JVDA 3VSAA 2QRVB 4EBBA 1LSUA 4K6MA 3WK5A 2Y92A 4AMUA 3Q7TA 1H0SA 1U7TA 4CETA 1A5AB 3PFFA 3DNMA 5B6PA 3IALA 1JJ7A 5ALSA 5GJCA 1RT9A 1KVSA 3QU5A 1GYQA 1U2PA 2O3SA 5B3JA 1YD7A 1IH8A 4IXMA 2PVPA 2ZJAA 3WYCA 2AQKA 3NNNA 1CU1A 2EEZA 5CDUA 3BMCA 2XUKA 3X2EA 1ZMOA 4OQZA 2Z2YA 5ALKA 3G7SA 2JJ2D 1WSBA 1UBHS 3ANYB 4NLLA 1ZIOA 1HO3A 3ZWWA 3HM9A 4FJ2A 1C14A 3A6GA 3ND9A 3RVRA 1J8DA 4NDNE 5TNXA 2AJTA 3CR7A 3GJ5A 1PL0A 3IPLA 5C1DA 5HA5A 5M2QA 1JBEA 1M3SA 4JU8A 5DTMA 2ZXUA 1K89A 2YDXA 3HDJA 1JR3A 2G4CA 3FE2A 4YLYA 5JD4A 5L4NA 1N6HA 4KIFA 2DF8A 3TNFA 2OZVA 2H7CA 4DRYA 5FPKA 5JISA 1KSFX 4R3NA 3I9V6 1XZCA 2BEVA 2CXRA 3BJZA 4QYIB 2XMQA 3UPUA 3VR4A 2WICA 4DABA 5CYPA 4EAQA 3TG8A 5JASA 1ADYA 2JCBA 2XA1A 5L6LB 1V7CA 4HAXA 5IARA 3H13A 3SS7X 2DHCA 3A4MA 1WJGA 2B4AA 2OY0A 2PXAA 1XRQA 4L5BA 3PEUA 4G1EB 3LZCA 2G04A 1ARZA 1B1CA 1G291 1CUHA 3L7JA 4BRSA 1OV6A 5MN4A 3NIGB 4C06A 4DE5A 4R40A 3TTTA 1CQXA 3B6IA 2Q0QA 4I7EA 1DFIA 1DJNA 1WB4A 4RHYA 4RDCA 2W00A 3CO0S 3IERA 3L6OO 1J25A 2NO7A 1Q7BA 3CF6R 4Q9AA 10MHA 1JMKC 4LWQA 4N41A 3U3RA 3QGMA 2FG7C 4CXMA 4OMCA 3S8MA 1EHIA 1QRSA 3VYTB 5KSOA 3U61B 1H2AS 1RWXA 5K8UA 1MC8A 1QFJA 4X7RA 2XPCA 5JROA 2QUKA 4LHZA 3MWFA 4G9EA 2NPFA 4BKRA 3P0FA 2B3TA 4RSMA 1RRPA 3DV2A 5BSUA 1P1RA 4CEJA 4LMBA 2GOYA 2AMJA 2I6SA 3K31A 5HMMA 1SUCA 3Q5EA 2YFKA 2ZI4A 2PYDA 3OJXA 3AUUA 3GGJA 4E1VA 3AI2A 4A26A 1OU4A 3KO8A 4PX5A 4A5OA 1TJPB 4AS3A 1NQUA 2WINI 1OMOA 4RK1A 1NURA 1SXIA 3UOGA 4MLCA 1TPYA 2FPRA 2GWRA 3CGWA 3OVMA 4HMQA 4IDDA 4L73A 2ZUDA 1AQNA 1ZLXA 3LRXA 3A4IA 1QTNA 4JXKA 5HFNA 1NLUA 4KTTE 2JIRA 1SZDA 3ZI7A 2FLWA 4C21A 1N0WA 2R1TA 3LP8A 3PDIB 1GZ7A 4WEQA 2UYOA 3BS4A 5C7OO 4S0XA 1L7EA 4XRRA 1SUDA 3DV0A 4MV3A 2JAXA 3D4LA 3I2KA 4MHSA 2J8ZA 3KKPA 1PL6A 4IO1A 2H7VA 4G65A 3IBCA 4JC8A 2SICE 3O03A 5ALXA 1C50A 1O2DA 1U3GA 1UC5B 5FOXA 5FUBA 1AA9A 1DC3A 2QVYX 3GRKA 2MYTA 1A9QA 5AK6A 4CIAA 1GGHA 4ER3A 1LVUA 4NBLA 1G6Q1 2J32A 3HLYA 4FWBA 1J0XO 4N47A 1EAYA 2FZ4A 2DECA 5BPFA 1RRGA 1XPJA 3W77A 4G89A 1KSHA 2NXJA 2Y6VA 4U63A 3K6SB 4NENB 1RRFA 1J1UA 2HEIA 5JJLA 1EP2B 1MR3F 1IWOA 1DAEA 2JCVA 4G0NA 3NANA 1W48A 5HMLA 3PLRA 2UZ1B 2J0UA 2DFLA 2QE6A 3RODA 2JLUA 2CHUA 5CH8A 1XDBA 2BDEA 3QXGA 3VVCA 2NVWA 4YPVA 2UXBB 3H5NA 3I45A 4HGPA 1SCIA 1YQQA 1T36B 2FUCA 1XDZA 3AESB 3GRVA 3O95A 1JHRA 2PFSA 3MJCA 4RMNA 4EHKA 2CHFA 2FZWA 4J9VA 5JSZA 3B7GA 1XN4A 4G0VA 2R6CA 1DIOB 3KHSA 4C2BA 2GEFA 4OF4A 5KYVA 4EYOA 3OJWA 4RVOA 4WNAA 1VSTA 4B3BA 4F45A 3MAAC 5EE0A 3K8QA 5C5DA 1TTPB 3JAKB 3MTIA 3NB0A 2GBGA 3H5IA 1QGUB 4F38A 3R6GA 3T1YB 3HACA 4DTIA 2PX6A 6LDHA 3FYCA 1ODCA 5M3BA 3Q8KA 4B32A 2Y1GA 3T3NA 2HSZA 3GIWA 1EWTA 1FSPA 1E2FA 3RYIA 2JEZA 1HQYE 4I4CA 4FTWA 4KFTA 3SHVA 4G37A 1CJVC 2BM8A 3VUEA 2HO5A 5C1BA 5DNCA 3QKTA 1F51E 1TO6A 4BNGA 1BOFA 2LBPA 4G0ZA 4AY2A 5K09A 1ZITA 4HQKA 2JFWA 4TYMA 4XUDA 3WKDA 3CLSD 2ZJOA 4QGHA 4BCCA 3KQYA 4DILA 1ZRSA 2CBZA 4JU9A 4EG5A 3M89A 1P81A 3QKRB 1BWQA 4LSWA 1IBCA 3PR1A 4N7MA 3VSEA 2IYFA 2G71A 5A04A 1PQUA 2F3PA 3CNHA 3Q9UA 4RK7A 4X94A 2OB2A 3I76A 3P9RA 4G4IA 1BVHA 3P0IA 5JBNA 1ZI6A 1Z9BA 3CJRA 3ELUA 2FWBA 3F90A 4LI3X 3RRNA 2FGJA 3FOAA 1CYEA 3PWSA 4J3JA 1J7JA 3G68A 1X9IA 1DCMA 4RLHA 5ENVA 5IPFA 1GA1A 4X60A 1C41A 5JQGB 2EJBA 2OLEA 4BJ1A 1LS6A 1DUIA 1KY2A 5ENDA 2VYFA 3FRIA 4PAWA 4RH1A 4BIMA 5EJEA 3Q2OA 5JPCA 4ZYXA 1JA1A 3GLRA 1GG9A 4RULA 4KXLA 5J4HA 2X8JA 4M7RA 4UC0A 4IWYA 1US8A 2CNLA 4E1BA 3EXEA 4C6SA 3L06A 5EOVA 1ATZA 1DCTA 3OD1A 2IGBA 4YLGA 2PS9A 1ZK4A 4INOA 2DBVO 1QRDA 1Z2DA 1DAPA 3HU2A 3OPQA 2IS4A 3IUEA 3C14C 2CDAA 1BN7A 1KDOA 5TVGA 3F78A 4FUTA 3WMEA 2Q5QA 3V34A 4DY4A 4DV2B 2VK4A 2YJTD 4Z9BA 1XMVA 3I5UA 1C7IA 3TQQA 5I8WA 5BORA 2QI9C 4RD6A 4L9AA 2YBEA 3JWEA 3KQPA 4OKIA 4HCJA 2A5LA 4EA9A 1CNFA 1GG5A 1GL9B 2FUG1 4W1SA 1T1SA 1PFKA 5GVRA 2AFVA 1KGDA 2IIQA 3QK7A 3U17A 1EX9A 2OBFA 1E9RA 3RU7A 2A9OA 4QE3A 3FHOA 1NF8A 3P4YA 2YRWA 5GVSA 2W37A 3NM5A 1R9JA 3DZBA 3PJFA 3AH8A 1V39A 1NI4A 3MJ4A 4Q37A 3BH6A 3VYVA 2YKGA 1OI2A 1AHHA 5EQFA 2GNPA 5DF1A 5SV2A 3VDQA 1F2UB 4HDSA 5ES4B 5ECYA 2Y2UA 1EBUA 1EYZA 1OX4A 4PSDA 4DWVA 5AVQA 4B7UA 1QLJA 5I45A 1RPZA 1JWLA 2HPVA 4M89A 1QM5A 1V5WA 3DMGA 4NE2A 4QUDA 1QHGA 1UC9A 2QUAA 1A5SB 2V3WA 3DGEC 3O4FA 3PDHA 3Q72A 4FZJA 3OTQA 4JP3A 4LAFA 4LOHA 5LQNA 4KXNA 2OCXA 4QRHA 3REOA 2FFRA 3FUTA 4LJKA 4MCIA 4PSKA 4PTYA 4URUR 2X19A 3AZPA 5IAAA 3F6PA 2PKEA 5DNDA 1W4BA 2Y9MB 1J1ZA 2OL4A 2H3EA 5IUJC 1AQJA 1UUFA 5KB3A 1L4GA 1RM5A 4WECA 5DGXA 1TZKA 2Q21A 1I14A 2V7VA 4JOBA 3HN2A 2FP3A 1PR4A 4KMOA 5AI8A 5DOZA 3ROQA 1SHUX 3WS7A 5BMVA 4HDOB 3DDUA 4QICA 2WI8A 1AMOA 2ZWOA 1ECCA 2BKXA 3R0JA 2YJ6A 5BSTA 3E7DA 1XKQA 1QDEA 3OPVA 1F0PA 3LI2A 4TTQA 1V26A 1YZUA 5JNTA 3OTGA 3K71B 3ILVA 5DHRA 4JYBA 4Q9LA 3Q8MA 3DR3A 2O57A 4HJXA 1M2OB 4Y8VA 3ZBPA 4EEKA 2HV9A 5IU6A 4O2BA 4ITUA 5LMCA 2C2HA 4G0OA 4EVSA 4MWZA 1KORA 5ADWA 3AM1A 4RNDB 2O54A 1SBIA 5JXGA 2QN6A 1G8MA 4DKJA 2MINA 2PNFA 3DCNA 3WTCA 3UC9A 2ZJFA 1F0KA 3COWA 4IOKA 5F52A 2ZUWA 2REQA 3UATA 4Y6SA 3NQ41 4KGXA 4DR6B 3TQHA 5ILOA 1NLYA 1QGYA 4GG1A 1FFCA 4WZBE 2Z1DA 1CZRA 5JQGF 3TFOA 4G4SO 1W8IA 2PJZA 2ZIXA 3BFVA 5BUSA 1Y37A 4R2LA 5JCXA 3CV3A 3GYGA 3P97A 3DBOB 2E6KA 4GVPA 1EFLA 1CEQA 1EGVB 2P65A 5K0FA 3RSCA 1CX9B 3KQLA 4KYTA 1S0UA 3PICA 4G5RA 1SKYB 1NN0A 2HWKA 4FWTA 1W73A 4J2TA 3ZDBA 1JEQA 4BEVA 1IN6A 4EUEA 5LN1A 2H5EA 4XFJA 3S1AA 4WKOA 3D4IA 3AR4A 1U2TA 1PQYA 3K9FC 4YP0A 4DARA 3V97A 4FS3A 3E9MA 2VH2A 5E9AA 5HK8A 3MLAA 3Q6MA 5TS2A 3RIXA 3V4PB 4ARIA 5LUBA 4J91A 1NPDA 2VWQA 3RC7A 5C8YB 4RZSA 3UENA 2VTBB 4ARUA 1QZZA 3OTIA 5IK2D 2W2VA 2H52A 2WHPB 4PFKA 5BYBA 5B1EA 4UDYX 2HQRA 5IJ9B 2CXPA 821PA 2PZGA 4DAEA 3F3YA 4GW3A 3GLQA 4R0VA 2F67A 2VC2B 3LQQA 2GPNA 2QZPA 4JJGA 3KQMA 5AKGA 4HH0A 3GDWA 2ZQZA 2YMQA 3WXBA 4MHTA 3HNOA 4CKBA 4WNCA 1A7AA 2RAVA 2R85A 3EVAA 3LVQE 5T4EA 3W6NA 4UUNA 4ZP1A 3BSSA 3RS0A 3T4EA 3TRKA 3CCCA 3PTLA 2B34A 3VJMA 3W6PA 1GWNA 1L4MA 4Q19A 4MITA 1C4XA 2I6TA 4OREX 4S35A 2PGIA 4HWTA 4J8PA 3IDZA 2VRBA 1JE1A 4GFDA 4MVJD 5IH7A 3HDHA 3UAOA 3CFYA 2YINC 2G9NA 4BQPA 4CQMD 4EZBA 1OD6A 3G0IA 4OSEA 2XQKA 1VIYA 3WP1B 2WMYA 3M4XA 4B35A 1D9XA 4GWLA 4OA5A 2R7MA 2C29D 3LX4A 2ONKA 1PGOA 4TLDA 1P72A 3HL0A 4MWSA 5IZ4A 4YFYA 3EEQA 4YIHA 5LQCA 2ZJZA 4B3RB 2XLCA 5L7WA 2GCOB 2HQSA 5BW5A 3IVGA 4JB8A 1ZGAA 3PHHA 5J63A 3U60B 1G8YA 3UAZA 2CMKA 4DWOA 2C54A 3DKKA 2PUJA 2AG6A 3DTVA 3IO5A 1ELOA 5ARCA 3UQZA 5JALA 1I1OA 4NYJQ 4TWZA 4W7HA 3R0QA 4QHTA 4CE6A 2VJMB 3IP5A 4AZ0B 1XEFA 2ZJYA 1H0RA 3U9TA 1G60A 4TLCA 4EFMA 1J8FA 4UOZA 3VBEA 4ALNA 2ZUVA 3KOMA 1EFVA 4U2KA 2FNAA 3PNVA 3P32A 5K7SA 1QYRA 1SB8A 2VHVA 4NE9A 4D26A 4YXWA 2PRIA 1UKYA 2O1SA 3S27A 3ZCRA 1IPEA 1ZJYA 2SKCA 3B85A 4TSFD 4KN8A 2ZT6A 4N7RA 2HLDD 2JDIA 3TM5A 3LXMA 3TQCA 2PN1A 2TS1A 4D74A 1AURA 3G8CA 1T2FA 1JR2A 4G2TA 4I4IA 4KR0A 4LWZA 4NK5A 1MKYA 5AHWA 2IBTA 2AI3A 5C1IA 3QE4A 3KPYA 3SYLA 3INNA 3QLEA 3DMPA 3NG1A 3KXLA 4WOBA 3AF1A 4Q21A 3WQSB 1F8UA 3GJ0A 1D2GA 3NS7A 3B6JA 3EGCA 3Q9NA 4F2DA 5I47A 4UNRA 1BXZA 1Y8QA 3KTFA 1O94D 4WHMA 4ZI7F 5JS6A 1DRWA 2JNWA 4URFA 4MKZA 5E8RA 3UJ6A 2V7UA 5HKOA 4M7PA 2QP9X 4PGMA 4UCQA 3SZUA 1Y1PA 2VPTA 2ZKLA 2AN4A 4H7HA 4LQDA 4XVUA 521PA 3F7NA 4I5FA 5LB4A 2FUKA 4QFDA 2X8AA 5ED4A 4ITRC 5KMGA 1RLTA 2V45A 1SRQA 4M36A 3R40A 1ZS9A 1IJEA 4BJ6A 1EA5A 1S3IA 1ZIPA 4IJMA 2P40A 4IJ5A 1FLVA 1RE1A 2PJDA 4BP1A 1JAYA 2RHRA 3BSWA 3C5CA 3U5ZB 1EEHA 5D85A 5KU1A 2RGNA 4XYBA 4O2AA 3K5HA 3N5CA 5EUCA 1Y3IA 3NJ8A 1FA9A 5KYUA 4ETWA 2YMMA 3CBGA 1SWWA 3MJSA 3RQSA 5FWXB 2JH3A 3BXHA 4BLPA 4JL8A 3K73O 4EG6A 2RAUA 1R50A 4R9NA 5ALLA 1RJGA 6AT1A 2CNDA 3MPOA 1F9AA 3THXA 5EJ9A 4NOKA 1TLFA 2HLPA 2J87A 1YRYE 2FX3A 1T15A 1X8KA 2XMRA 4ZDWA 4K8OA 1PN3A 2B2XA 3H04A 1E2QA 2J4FA 3C39A 2H4YA 5FOQA 3OZFA 2DT5A 3DUFA 1BJTA 3L1HA 2SCUA 4R81A 7REQA 3E1KA 3O9ZA 3K9QO 4ZOLF 3SXPA 1I3NA 1Z0KA 1SG0A 2N46A 3NHKA 4QU9A 2FWJA 3CZ4A 1YU6A 2J0VA 1CQZA 4BNJA 2O59A 1DQZA 3DQPA 2R62A 3ZZUA 2RGCA 5JS2A 1ZLYA 5K0LA 1EFRA 1W36B 1V47A 4DRZA 2ZFUA 4QDKA 3M9WA 4YFVA 3GLFA 5F9HA 4IP0A 2Q1TA 2ZRPA 3BDVA 3CX4A 2QTHA 5IW8A 3VR6D 4BFXA 4IIBA 3IHLA 4QNNA 4PX2A 2CLSA 1ZW1A 2CK3D 1M2KA 1RJ9B 3SEQA 3GJSA 4H08A 4DY6A 4CKWA 1IUNA 2CJXA 3E7WA 5TMPA 3LTEA 1V8ZA 2WJHA 2P2SA 1PX0A 2PS1A 3PDUA 4KBFA 5UKDA 4TM7A 1V16B 5H9VA 3LM8A 1Z4NA 2NPIA 2GUGA 3H1FA 1VHDA 1N3YA 4HGZA 1P3Y1 4K9KA 3UEOA 1COWA 1QIGA 2X5JO 1HF3A 3AEXA 4NX2A 1EJ2A 4ZZIA 1P0PA 3FSRA 1UJ4A 3DE1X 4MKGA 4PAMA 1E5TA 3U4DA 2QYHA 1X19A 4PZEA 5CRIA 1F2DA 4ZVLA 1O6CA 1YS7A 3IQHX 4YGXB 1AGRA 1E7MA 2D1SA 1PJ2A 2PKYX 4TOIA 4MB0A 3A4YA 1LNZA 2PX3A 2YTZA 2PNJA 3ZWMA 4AKSA 3R9XA 2G1JA 5KKNB 4CLEA 1AKVA 1UFVA 4WOCA 2QTBA 1VJRA 4H6PA 2R2AA 5CFMA 3T35A 1SQGA 3P45A 3KQUA 1QS0A 3BIJA 4YYEA 3K0BA 2WT9A 3ZKWA 2F55A 3BRCA 1Y7LA 2GYVA 4TKUA 3W4KA 1ZYUA 1G2QA 3WSWA 3HB1A 3HBLA 2OBXA 1X0XA 3H0EA 4NH0A 1B0AA 2YZKA 2QUZA 2FX5A 3MK31 2O06A 4QJBA 3OPNA 5AICA 3I6MA 4CR8A 4Z4EA 4GXQA 2PMCA 3TTSA 5AOVA 4F92B 4YRMA 5K3EA 5SYAA 3UK1A 5JMWA 4MRSA 3EAGA 1XMSA 1SELA 3LX8A 4DDTA 5AVXA 1HEIA 5I7WA 4RZ2A 4KVGA 3W5UA 4L0DA 2R6FA 2A4MA 2IPLA 3R7SA 4DCCA 5LP6F 1I7PA 3C3EA 3EIOA 3R3ZA 2E1RA 4RVSA 1P0FA 2RARA 4B83A 1YIDA 5DBIA 2XB4A 3F9IA 3L0CA 3TXYA 4EB0A 3UMMA 4W1PA 2I2FA 4QYXA 3IP9A 3DS8A 4RLFA 5CHEA 4AMGA 2V7QA 3ETHA 3PQ7A 1D04A 1EEXB 1E2IA 4HYYA 4G36A 1GNLA 1UT5A 2ZKIA 3D1LA 1Z6QA 4MUMA 2G4LA 1QO0D 1WUJS 4D3XA 1R8QA 5JAMA 4ARBA 1YR3A 1RQGA 3ZW7A 3R8CA 4XSGA 5FI0B 5GV7A 5D3KA 3UIEA 1TU0A 3BICA 2BC9A 4WADA 3B82A 3TLGA 1PTJC 3VNBA 1HE4A 5CAEA 3W04A 4AF7A 1SCUA 1FQJA 3MWEA 3DT9A 1EDBA 1SCJA 3OLQA 4P86A 3ANTA 5C3MA 3GLGE 1QR6A 2BGLA 2XKAA 4PZAA 5ERGB 1TKCA 4JV5B 1WB5A 3PQ4A 4DR3B 4XTCS 4AMYA 2VOEA 3TSYA 4UDOA 4FDMA 4PPNA 3C41J 3NW9A 2A30A 5HRCA 1ZA1A 1HDGO 4I14A 1P7ZA 5C51B 2R6JA 1Z4PX 3E84A 2ZYSA 1U2RA 3TTYA 2DQ4A 3VOSA 2XCLA 2HF9A 4EAAA 5A02A 1YR7A 3WSVA 3ROMA 1Z5WA 4ERNA 1YOVB 2I4IA 4V39A 3ETLA 1GQRA 1PW5A 3ID6C 4URVR 2Q45A 3HS3A 3PUWA 4JJKA 2QQ0A 1FDUA 4PTLA 3BWDD 4L85A 1QP4A 2I4RA 2XE4A 1OI7A 3WRXA 2IZ7A 4HFMA 4Q3LA 3NHUA 2NYAA 3I04A 3H4IA 2F3SA 4EA6A 4CF7A 1AN0A 2JZNA 3MOSA 4WI1A 4P36A 4RGBA 3ZZTA 2O8CB 2W48A 3L4SO 5T8KC 2JGMA 1FUKA 4CKEB 1AF4A 2AJBA 2GSWA 3C3XA 2UVQA 1ZJJA 2VNAA 4OHOA 4F0JA 2D5AA 5IN4A 1Z63A 2I3AA 2PUEA 3U9SA 3O0TA 2QMOA 2XOEA 3MS4A 3EGEA 2JA1A 3BKWA 3ETDA 4XWWA 1ICEA 3EDRA 3ZUGA 4TS4A 4J0DA 2PZ8A 2XF2A 1O77A 3PT9A 4Z2YA 3DBRB 1N2JA 3RK1A 1Y63A 5JD3A 4DCVA 1KKMA 1ORRA 1VPVA 1PG0A 3ZHUA 2VNKA 3M5PA 1W0JA 2V58A 3LY9A 1I6MA 1PQ4A 2I8AA 3OZVA 5G4LA 2XHZA 3VR5H 1GKIA 2QTZA 1AQLA 1YI1A 4B3JA 1RRKA 2Y0DA 4D6YA 1CZLA 2QKYA 1FXWF 2R4UA 2PK3A 3SJZA 4B8WA 1V5EA 5C5IA 3HWWA 1Z68A 4F8JA 5ALUA 4WLNA 2UU9B 5LKRA 3EN0A 3OQOA 2DLCX 1BEZA 1EFDN 6REQA 1UT6A 2I6XA 4FR2A 1O97C 1FYWA 1Y9JA 2QROA 2GA8A 5ADHA 1AHIA 1HUQA 4L8YA 2OHHA 1JIUA 2UZ3A 3PEEA 5KHLB 1QFXA 3EFHA 1OXUA 2YX1A 4TM8A 2GCGA 3EXFB 4RC9A 3DJYA 4CMKA 5C31A 3DDSA 4XR4A 1GLGA 1O0SA 2FHSA 2R6HA 3L8MA 4E30A 1C4WA 3R2JA 4QD3A 3HM2A 3LUJA 3KKKA 1HMPA 3GR6A 1OFUA 1I1HA 1W76A 1GKLA 2HKIA 3G2JA 3PC7A 2RH5A 4D56A 4XIJA 8GPBA 4OHKA 3X2SA 2ZAGA 3Q9LA 2HADA 2BN4A 1N4DA 1ZVQA 3RC9A 5A6SA 3ENKA 2WDZA 1ZH8A 1HNZB 2J7PA 2QEQA 3B51X 3D31A 3I8OA 4JVSB 5HKBA 3P9XA 5HKKD 3Q41A 2CNWD 3QLVA 2ZPTX 1QMPA 4EUFA 5EIXA 2NGRA 1NI3A 4C0AC 1CRQA 3LDAA 4BN0A 4RUKA 2OD9A 4RGYA 4C1NA 4D0RA 1I2MA 3OO1A 1G8SA 4N76A 5AK5A 3B3AA 5LZ2A 3IOYA 2W90A 3ZY6A 3BXZA 3EC7A 2W43A 1A9RA 3HVIA 3KYDB 4MVJM 3QE3A 3U3ZA 2YY5A 2C9ZA 4FEGA 5MFPA 3OZSA 4GKVA 3FKQA 1JAZA 2WT8A 3FVQA 4IHKA 1K98A 1A96A 2OYSA 4TUYF 3IYLW 1TQ2A 1KIFA 2VUUA 3I0MA 3HBJA 1AD2A 3VPDA 1IBMB 3DCYA 1DIAA 4ZCPA 4C7KA 1ZOLA 4X85A 3V3TA 1RWWA 4EBFA 4GM4A 1SBNE 3QHQA 2HPZA 1LD3A 1U7WA 1L8QA 4YO8A 1E2GA 4WESB 2AQIA 4WZAA 1T4CA 4Y2XA 1G7RA 4BB0A 3HA7A 3K9GA 1Y1SA 2X0RA 3FPBA 3DLTA 5IVHA 3ESRA 2IPNA 1OASA 1U6KA 1LVGA 1K8YB 3SI7A 2ZR7A 3WL6A 1YO6A 2QBYA 3FWZA 1P5HA 4P84A 4NMXB 2IJGX 2GVDC 1EP9A 2IOYA 3CKMA 3FYDA 4QQKA 3SE7A 1WU7A 2R8RA 1QLHA 1RAIA 3JVIA 4ZJZA 4HWGA 1Y3FE 3THYB 3GROA 4EIWA 3MXTA 3WC4A 2VHYA 3AUKA 2CXXA 1NKTA 2CL0X 4FMDF 4I1RA 2MDTA 5F3RA 5A5EA 2Q5OA 3FOZA 1JEYA 2R25B 5CTAA 1MB9A 5JZBA 1YMUA 2IL1A 5DN9A 2RSLA 4DR1B 1P61B 4OPMA 1R0WA 5HTOA 1QE5A 1M8FA 5TPWB 1B0ZA 4FYHA 5FBVB 3JASA 2D0IA 1H85A 2ZW9A 4C6RA 2FDXA 1ZFNA 3QKWA 4LXUA 5CA1B 2FYTA 2I22A 1URPA 2OQVA 4JELA 2AQHA 5CNKA 5FV7A 1GUYA 2GPJA 1VBMA 1OOEA 1MJGA 1DUVG 1WZCA 3HEMA 4X64B 5EINA 5JYDA 2M6RA 3BULA 1E0AA 2C94A 3U3MA 3K5PA 3OJ0A 4KLZA 4YV2A 4X92A 1IWBB 3R9WA 1L7OA 2IYOA 3QOFA 2FPKA 3D3WB 3VH2A 3LHDA 2P67A 3PD1A 4WVLA 3AL3A 3SVZA 2IDKA 5FTWA 3U3JA 4B47A 4DQVA 9ABPA 5BSKA 2C4MA 2KLHA 1DQYA 2VJLA 3GUYA 3L8YA 3IR7A 4JEMA 2IV2X 3W6OA 4EDFA 1I7LA 4F6RB 3TW8B 1CIVA 1L5FA 3PQEA 4KH0A 2QLLA 4D7AA 2RD2A 1VCNA 2A5FA 4RJ2A 3WKCA 2X76A 3PFGA 1XRSB 2VTEA 3TXAA 1SQSA 3ZD7A 4UNQA 4A0GA 5H0IA 3CH6A 1QB8A 3IUSA 4KQ2A 4GIBA 3WJ2A 4WBNF 5JYCA 2YXEA 3OHSX 3R5XA 2IYUA 5LR6A 2QV0A 3VKVA 3WGHA 4AO8A 5J5CA 4ZJPA 3A1DA 1W6RA 3EG9A 5A1TA 1PL8A 1EXMA 2AX4A 4N3GA 3JS5A 5FR1A 2VAPA 4K7JA 2O8FB 2JGIA 5K6TA 2JIZA 3JARB 1RRMA 4HR7A 2NO6A 3RC8A 1ZWKA 4QNRA 2GASA 3M2TA 1ADBA 4LFCB 2FUG6 3PNKA 4ND1A 4ETIA 4C4RA 4CNQA 1N9GA 1VCMA 2FMXA 2J9GA 1WP4A 3EE6A 3W1VA 3ND8A 4GOJA 4IKEA 2C83A 1F06A 1AGYA 3NHFA 5HJEA 1QOQB 1MABB 1FNBA 1AK2A 3PI7A 5F1YA 5TEVA 1ZUNA 5JDIC 5HF6A 5KTPA 1LLCA 4JJ6A 1L4NA 1BOOA 2ZRCA 3BT7A 3OJEA 4TTSA 2YWRA 2CB0A 2BH9A 3P0RA 2BPOA 4RSGA 3REQA 1ZGCA 4U3JA 4XGNA 2ZRNA 2GHQA 3CWCA 1J0CA 1JIIA 4DJFC 1JRLA 3JQ8B 2RGWA 1PJAA 2K4MA 1Y0BA 2CDCA 3SICE 1NG9A 1PGPA 3K2BA 3OIVA 4E2ZA 2P0AA 3A04A 3U7RA 4HG2A 3IFSA 3P9PA 1GQQA 4F3RA 1ZZGA 3ND6A 3RYFB 4NMHA 1SIUA 4PAQA 1ZGGA 4JJIA 2C5EA 4QELA 3DOFA 4ZPJA 1IN8A 4GR5A 1RD4A 2QTVA 4KXVA 4MR7A 3I28A 2I6QA 1RYNA 2OE2A 2Q4TA 4IFEA 3N8DA 1PV1A 3ND7A 1IUPA 2IWHA 1NUPA 2OAGA 5IFLA 1AV6A 3FI9A 1E62A 2YUIA 3VHXA 1E9CA 2ZRIA 1E89A 1RXIA 2O2EA 2XCIA 3IMGA 1L1EA 3R75A 1XLTC 3TTVA 5KZMB 4IJVA 3OJOA 3WGIA 1P62B 1IDOA 1NDQA 3N9IA 3M83A 5TS3A 3TI7A 1YFZA 2ODBA 4ARSA 2I67A 4NE7A 3IKVA 1PYOA 3O3CA 2QD3A 4S2EA 1QHEA 4WGFA 3HSSA 1M8GA 3W79A 3KC2A 2PQ2A 4R8MA 3ULKA 2J09A 2NTVA 2D8AA 2HQ1A 3BK7A 5FTMA 1DWPA 1DKNA 2IIPA 3GNTA 4NR0A 4QQFA 1JP7A 5DTRA 3QEAZ 1NVBA 5AM2A 1Q5PA 1CTQA 1PTJA 1VIMA 5E8JA 3MS2A 5FORA 3OOWA 4I9FA 3I72A 3TMKA 1UMBB 1P2UA 3C4JA 5CIYA 3P0EA 4ZI5A 2CUKA 4XYLA 3TWOA 1XZNA 3VPSA 4EECA 4E03A 5CW2A 1W0KD 4ZICA 4A4DA 2J3EA 3LW8A 4BCBA 2C8VA 1Q15A 1SQ0A 1BDJA 4F06A 3PUYA 1AGPA 1V1RB 3GW8A 1ES9A 1OVGA 3GDFA 1KI6A 2AN1A 1BFKA 2QVBA 4QOFA 3ZLVA 5K5EA 2QU7A 4D57A 1EH5A 4RJJA 4JA2A 2G70A 5J1SB 2VP3A 3T54A 5JWOA 1KXJA 1YKGA 4I1OA 1YJQA 4B81A 4F4CA 1MHTA 2UUBB 4YMUA 1J90A 3F9CA 1H2EA 1LK0A 1N1GA 1VSUA 2FWNA 3FPJA 2V6BA 2YWFA 1HXHA 4HS4A 3TIFA 4D9MA 2V9ZA 1MIHA 2QPOA 4OJMX 1P8AA 4QDOA 2EFJA 5BSEA 4EARA 4UTXA 5E95A 3L6BA 4JY7A 3GFVA 1UBTS 1XTKA 3ORRA 4UQLA 3HO8A 1Q17A 3LL7A 3BL5A 2KBFA 3UFXB 4H2DA 3OFND 3O73A 4I1SA 3IV6A 3KVRA 2W0SA 1QANA 5CA0A 2G88A 4PVCA 4HGNA 4OUKX 4Z0TA 3UG7A 3VPGA 4DDWA 1SXHA 1VYVA 4V02A 4MPPA 2RK4A 3F96A 2DH6A 1YH3A 3B13B 1U6JA 3DZKA 4XXHA 1KH2A 2UKDA 3KHKA 5CDGA 1XJ5A 1BW9B 1GRNA 3KT0A 3OE5A 5F7JA 3PXDA 2IH2A 3LWDA 4UZSA 2NV0A 1XTJA 1ZD9A 1YJBA 3HUDA 1Q2XA 2O0KA 4J6FA 4KXYA 4X5OA 3RUIA 1IB0A 3ENNA 5KX5B 5REQB 1ZN7A 1OC4A 3PX3A 4RD0A 4P3KA 4KODA 3NHZA 5IYZF 5KCMA 3ESBA 3RPEA 3ZE6A 3AERB 3ENQA 1HE1C 2WD7A 4FOSA 1TZJA 2JAOA 3DHYA 6ABPA 3LVRE 1EWVA 3HFRA 2B99A 4P3XA 4XVCA 3CRMA 2Y93A 1ZJWA 3K2EA 1ZHHA 1T5OA 2MHCA 3CXRA 4MWCA 3STWA 5ALEA 4DMHA 4ZXFA 3ZR4B 5JRZA 2NNLD 1L1FA 3FCCA 5LYJF 2Q29A 3COVA 4CTNA 4MV5A 1M75A 5HQJA 2NX2A 1NW8A 3ANLA 1C0PA 5F12A 1RVV1 3NT5A 3RGWS 1NJ5A 3FW1A 3ESDA 2FPOA 4CV2A 4Z9FA 3MQFA 4O63O 4G4JA 2WHXA 3UKOA 1I13A 2VHQA 2E5WA 1ZP6A 3IAUA 1ONSA 1WS6A 3HCRA 5CDHA 2NNWB 1GHTA 3O4IA 1D1QA 4TL8A 3VUFA 3L8CA 3N7TA 1GZ5A 1XBTA 4IJQA 3TF5A 1SN7A 4AUKA 2CVQA 3EA4A 3NTOA 1KDRA 3OCYA 4JIMA 2Q6KA 4P7KA 3BD8A 2C57A 1B0PA 3TJZA 5BNIA 3RKRA 4G09A 1JPUA 1X1SA 2I2WA 5I9TA 3ICQB 2ZATA 3GGCA 2CMGA 4M0EA 3HE3A 3I1FA 4UUMA 3HKEA 1KGSA 2AF3C 4RS4A 2JJ1D 3QVWA 2NZVG 1IVNA 4H1VA 3ZBQA 5CB8A 5K3FA 4S05A 2FPLA 4ZANA 2OQRA 5NULA 3T41A 2RI1A 2OCAA 2JAPA 2XH8A 4UHBA 4DC1A 1NP6A 4XM2A 1TC2A 2AMFA 3O6VA 1E5QA 3GDGA 3OQHA 5ESRA 1LBHA 4E5NA 1WNFA 2IOHA 3EDOA 1W6UA 3A6ZA 3HPRA 5I3ZA 4NRDA 4IGEA 4MI9A 2KI5A 4O4IF 3PGLA 1JR6A 2VF4X 4D8XA 1II0A 4HC4A 4DG5A 3NBXX 4HAOA 4QUHA 5LP1A 1WXEA 2Q5LA 3HA5A 1P9NA 2JKZA 2O2XA 1RXVA 4U7JA 1A3CA 1SVWA 2O7QA 4W5WA 1CVIA 1FLDA 2GBIA 2FPPB 4LI0A 4P7JA 1D1SA 4IRXA 2RGEA 3SG0A 4DG8A 2W8ZA 1N36B 4HDCA 1QF7A 2JK1A 2HLNA 4NBRA 2AYXA 4BNTA 4R7GA 1KC1A 2ZPAA 4II7A 5I9LA 2B6HA 2IOFK 1XXHA 1RJFA 421PA 1JLLB 3GIDA 1C80A 3AI3A 1WDTA 1YB5A 1U4NA 1OXBB 4EMSA 2ERYA 3QG1A 4M0PA 2WJ6A 2Q5EA 2ZWPA 1VHJA 2AXNA 3HB5X 3HDYA 4RIGA 3WSTA 3CNBA 1Z5VA 3I5AA 3QMVA 2Q28A 3KR0A 2XW6A 4WACA 4ZMRA 2ZUUA 1OYWA 1VLHA 5FXMA 1QH1A 2ST1A 5B3AA 3E3OA 3I5MA 4WWHA 1ABFA 2P1ZA 4FJ1A 2VWPA 2WJYA 2ZIGA 5CM2Z 4W9MC 1E1KA 4FDVA 4ZI7A 4IHJF 1ZOIA 1I32A 4GI3A 5J4YA 4K0KB 1NMXA 2H2AA 4JJ4A 4KQ9A 4DLLA 3G0HA 1UM9B 4BQOA 1RPTA 4MEAA 4EX6A 4F5YA 4OXXA 2ZE7A 1W5TA 3IKJA 1DAKA 2YICA 4KAXA 1KEEA 4BQSA 5JDCA 1NMZA 4AUMA 4ABYA 3QITA 2I3BA 2HDOA 3VH4A 2V4MA 2WOJA 2FXIA 2VJYA 1DPFA 3FDZA 2VXCA 3KK0A 4YRSA 9LDBA 4GOXA 4ZZ3A 2PD3A 4MCAA 5AW9A 3H18A 4CQJA 3DL0A 3QF4A 5C80A 2VEOA 5CK4A 2EBFX 3TOXA 4RV4A 1B8OA 4JX9A 4N01A 5B4TA 4M1OA 2X0DA 1MIOA 1TFRA 1QKJA 2GZ2A 4H15A 4JR1A 3IA7A 1JG3A 5JAIA 1XRNA 4TKVB 3PNLA 3HQ4O 1BFDA 2XQFA 4F5DA 3LOUA 4X65B 4ONEA 3BCSA 3E82A 1TUIA 3MC1A 5F1PA 5TSDA 1RM0A 4LZWA 4RFVA 4RJKA 3EEBA 5HZHA 4GGMX 2RG1A 2WA2A 2C99A 1A2KC 2XODA 2YW2A 4Q3CA 4QYSA 1JW9B 1W2GA 2HX1A 5JO9A 2H4HA 2YNMA 4OFWA 5P8WA 3JQ9A 2Z6VA 4OHYA 4J3FA 2VHJA 1SBZA 4Z1MA 3ZDCA 2ZBFA 1I2AA 1ULTA 2BJWA 3A1NA 1QH9A 3CLSC 3PHIA 4H7JA 1RC0A 2GNOA 4KWHA 4ZOLA 4ZU3A 4DLBA 3NRCA 5B53A 5A9TA 3TNDA 1EUDA 2Y1XA 2F1KA 3V5NA 3BMCB 4UBLA 4Z7NB 2QU8A 4TYQA 3QU9A 5FF9A 1UPUA 1TVCA 1V1MA 1R0CA 2AVDA 2VCEA 2VIIA 3GLUA 4ND8B 1MOQA 4I0WB 4U9HS 1MJ5A 4RORA 1X70A 3N8IA 4QU5A 3HR8A 3I62A 1ZJ4A 2HMUA 1Q77A 1QGAA 2G9RA 4MGKR 3VHLB 4M1MA 5I9BA 1RLJA 1FEZA 3I53A 4A8PA 3G7UA 2ZGVA 1L6IA 1YDHA 2PXCA 3ICCA 4PIPA 1T1RA 3UGTA 2P4HX 4EJ6A 3GZ4A 4GH5A 4DUYB 3OTOB 3DM9B 3L43A 4ABTA 1L3BA 4CR7A 4HDAA 9LDTA 2CXOA 4FYIA 2QMZA 3WYDA 4JR0A 5IBRA 5BT9A 4GWGA 3TX6A 3ER8A 3M0EA 3Q6IA 3GDOA 3OSZA 4EHAA 3MAJA 1PS0A 2CMHA 3ZDAA 1C9KA 2Q5HA 2J9YB 1BQ3A 2I2CA 2Q7DA 1PEYA 1G9SA 4LHEA 3AUSA 2RJNA 3F8TA 3I2HA 4COOA 5HS4A 3U9LA 4MWEA 3P4UA 1F1JA 2UUPA 3ZVLA 1P80A 5I51A 4LE2A 4DOMA 3D0OA 5E6RB 1HDIA 4HVLA 5CVTA 2IZ1A 4L75A 4WJLA 3PYLA 2NSYA 3W3AA 1Z4MA 4RDXA 5IF3A 3NBAA 1Z7BA 2XUDA 4F1KA 2J33A 4AG3A 4YH1A 2Z2IA 1WRBA 4DV1B 2XJ9A 5EJ2A 4JS0A 2B30A 4HD8A 4R51A 3O1HB 4OYHA 5D84A 4LMAA 1R0XA 4OGLA 2QL6A 4EA7A 4G8DA 2BEUA 3II6X 4FQ8A 4D5GA 2C0PA 5L6MB 3AVVA 2PUGA 4YB8A 2Q3EA 3LBIA 5AVWA 2ZJ7A 4ZYUA 1XJWA 2W58A 3SIPA 3EA0A 5HE9A 4BQIA 3OCVA 2CCGA 1YJXA 3UWDA 3V9PA 3VR2A 2EQ5A 3ZCSA 2I2DA 2XMBA 4AY3A 4F9FA 4Y1FA 4RLSA 4GLJA 2F8SA 3CPHA 1DTWB 3ONNA 1W4CA 5H4GA 3GRRA 5E1BA 4P92A 2CVOA 4FIZA 1AG9A 2OZLB 1C2YA 1I6KA 3VTKA 3KJGA 5LKAA 3ADCA 3OKAA 3OZRA 4YREA 1U28A 1JVSA 3ZWBA 5TF0A 1NLZA 2CUTA 2P1RA 2J9FA 3JQAA 3MPUA 5DLPA 1NM5A 3NKFA 1AA6A 2FDCA 3U4QA 2WHRA 2W6MA 3GRUA 4L07A 4S1WA 4YT4A 5L3QA 5JMOA 3SXJA 4OU4A 2RB5A 2Q99A 2WAYA 5EMJA 2E82A 2QL9A 3B6MA 4YJKA 3KQNA 3ZWPA 3I92A 5DIFA 1F6WA 4JXZA 4U1RA 2XUHA 1Y7PA 3QXCA 2O2YA 2A94A 3W2FA 4CQLB 4BECA 3FM9A 4EPVA 1Z0ZA 4RD1A 1D9ZA 1AV7A 2PL5A 2XMSA 4OB8A 1IBKB 3GT7A 3VZQA 2H8GA 2J0UB 1ZH6A 3WNZA 1EJ0A 5DSXA 1E8MA 4D9CA 1ATIA 2NZ2A 1BCRB 3BYZA 4JB3A 2EZUA 2C7PA 3WKBA 1ISJA 5KQPA 1ZK1A 1Z88A 5CBPA 4Z4GA 1YCHA 4FZVA 3CZ9A 4IQ0A 4IXTA 4RPKA 1NJFA 1Y82A 4IM7A 2O0MA 3FPEA 4U39A 5CXUA 4TT8A 1GLNA 1ZESA 3CRQA 3OBBA 3V3KA 5E4JA 3T94A 3Q7QA 4EA8A 1IY2A 3GLHA 4MWOA 1G3RA 2HSWA 1PFGA 5DGIA 4WNAB 2ID4A 2ZJ0A 4ZVNA 2VH1A 5BR4A 5HQ3B 3PLAE 4D9KA 3UXYA 4W8OA 4X45A 1PGJA 1ILEA 4QEZA 3DJFA 1ZK2A 3IKLA 4R3UC 4CL0A 1M2WA 3EVEA 4LBWA 3RS5A 3TLZA 3ZY2A 3L79A 3WLJA 4REMA 4A92A 2QUJA 4N40A 2IYVA 3RC3A 4L95C 4EI8A 4CL8A 4HQFA 5K8IA 3O74A 2X1LA 1L0BA 5GJVC 3FPCA 2HA0A 1N8KA 4YDRA 3OEHD 3DSRA 4YRKA 1ZH4A 3A9TA 1N0IA 3B52X 2AOWA 1IHOA 4AN0A 5IHXA 4TYNA 5CJPA 1IXSB 3ZOKA 1U8XX 3LQYA 3NDPA 4Z6KA 5MF6A 1UBUS 1YR1A 4FBGA 4NECA 4OQPA 4XD7D 5DLYA 3AVWA 4OK3A 3UAWA 4ZO6A 4ZV9A 2GJ9A 3ZV3A 5BNWA 4RM3A 1FXWA 3VI3B 1W2WB 1QVAA 1ZI9A 2ZB8A 4L6AA 2AS0A 4MYDA 1ESNA 1Z0IA 5T64A 2QE7D 2AKAB 2C9DA 4ARVA 3ZHSA 4B71A 3G23A 4MUBA 1RWKA 2IZ0A 2YUTA 4GVLA 1R4MA 4UXHA 2WD9A 2BEKA 1ZISA 4ZRDA 3DAFA 4BBJA 1NQOA 2XRMA 4WINA 2EBWA 4QPCA 4MTCA 1T0HB 3ZD9A 2IXBA 3G1TA 2IEBA 3WBBA 2X8JB 3N2GB 5LFAA 3CKYA 1US8B 2JK0A 4UZFA 2YY6A 3EXEB 1YBMA 5AW1A 3E9NA 2FR8A 4O3FA 3TBFA 1W36D 4R8RA 5E2IA 3LBFA 1M1NB 3VTAA 1G1AA 3BWVA 3ZGXA 1D8TA 1GCUA 1GEGA 2OHJA 2PX0A 4L1KA 1QZUA 3HNPA 4XX0B 5EXSA 3W05A 5BY2A 1U0EA 5KYKA 3AU8A 1IY0A 2CD7A 2O3RA 3AIKA 4W82A 3S2ZA 2DPLA 5JRJA 3G1UA 2RH8A 2OT3B 1C3XA 3MWDA 1TF7A 2JKYA 1K8XB 1KC3A 1I33A 1E1QD 2R7KA 3E9ZA 3AB3A 4L8WB 4OFZA 5DSTA 1V45E 2GSDA 4BMCA 1QIJA 1TEVA 1USWA 2GN9A 3AW8A 3OLCX 4LNUB 2ZREA 2QUIA 4H35A 2WVGA 3SX2A 2Y0CA 3GFFA 2DETA 1DPGA 4GXRA 1OBHA 1BMFA 3AVPA 4AF6A 1AKYA 2C20A 1NI4B 3NH6A 3H42B 2WMNB 4HZGA 5TE9A 1G5FA 3RC1A 1FJHA 1Z8HA 4M1TA 5CVVA 3VU0A 4AZSA 4E46A 4QYTA 3OP4A 3I42A 4ZT2A 1MW8X 1IZZA 1OX4B 1NBEA 2H1SA 5L3VA 3DXXA 1SCQA 3DYBA 2PX2A 3EGDA 4INJA 2XT0A 3M4ZA 1IXRC 4N0MA 3WHIA 2JHGA 5IAEA 1R8JA 2G82A 1P1CA 3RUCA 2ISSD 2OXIA 4TUYA 4BNWA 5JCJD 5JHHB 5M04A 3B9RA 1PWHA 4DB4A 1A69A 1EP3B 2AD1A 2FWAA 3QEMA 2AWOA 2FSUA 2C2YA 4TTJA 2HHCA 2XRZA 5G0TA 4QM6A 3HFJA 3HJTA 2WSIA 2XTAA 2XBMA 1MVOA 4R54A 1LK5A 4JI3B 4LYDA 5CTJA 5B1SA 3CZ5A 2BM0A 4L22A 1L7PA 3L0SA 4OAOA 1IOZA 4PYNA 5EJMA 4HMPA 2PMEA 1LW7A 4BMDA 5BMVB 1FJGB 5EHZA 3A7DA 5K05A 1XTPA 3IP1A 3RB8A 4K9QA 1P4GA 3K8ZA 1UBMS 3OPMA 1ESCA 1WXQA 3VV2A 1O94C 1HOXA 1DHRA 1DV2A 3E9DA 4AZVA 3DWIA 3FPLA 3R74A 2GS9A 2IEAA 2D5LA 1HDXA 3PI6A 4KN9S 4BEJA 2BGWA 3MSCA 4Y1GA 1P1FA 1CLUA 1R3UA 1I6WA 4O2BB 5IKXA 3ZJUA 3H5OA 2XXJA 2QB5A 3QUBA 1BXRA 2R87A 5E3IA 2BGRA 4YP6A 2R6AA 5G1NA 3X44A 1USVA 3U4MA 1JILA 1ISGA 3AM5A 4M9SA 2MINB 1XVLA 1WZNA 4K6HA 1N92A 4CKXA 5BURA 2J9RA 1M1UA 1O6GA 2REQB 4B7CA 4CKCA 1GPNA 3ZV4A 3ZX5A 4A16A 2OP1A 1U2DA 1N5LA 3FMGA 1FYFA 4D0NA 2E48A 3RR2A 1GUFA 1YS6A 2RC5A 1EINA 1GLVA 1QYIA 2H2GA 2ZIXB 3GJYA 3KFVA 2W4IA 5KTMA 4K8RB 3EMBA 5KTRA 2ZRDA 4DUGA 4Z8XA 2DQZA 3EGIA 3S6JA 3NBFA 3BJEA 2MMGA 5EIEA 4LDAA 3NHAA 4OUDB 3DOHA 3H2BA 3VDXA 4ZOQI 5A5GA 5JI3E 2BW0A 2BKLA 2PZJA 3M8KA 2JVIA 3LBAA 3EGXA 4WVFA 1TRHA 1WSDA 3N2NA 4LY0A 3T3MB 3S1AB 4QULA 4MUJA 4AKTA 4EEXA 3E9CA 3G2LA 4LF6B 1UP4A 4CLOB 3PIIA 2IV3A 4N8DA 1YBAA 1R0KA 1Y3HA 3A6DA 3S5UA 2NADA 2VPQA 5CM9C 1B3RA 1WMSA 2GERA 1IQRA 4L0CA 3B2NA 4BBPA 3KB8A 4HLCA 3CLRC 4OXYA 3N70A 2CZQA 5JW6A 2A5DA 4OX9B 3TW0A 4BVKA 1RM3A 4OLBA 4GAEA 4J1QA 1UEIA 3BHMA 2VK2A 4HK4A 1AZWA 2R44A 4LK3A 5HCUA 1M7HA 3V46A 3WYFA 3O8RA 1YRWA 1PG5A 1YB4A 2P4QA 1DEXA 1NBOA 1OE0A 2OXCA 4I1IA 1U7PA 1PZNA 3T9DA 4KRXA 2WDPA 2BMAA 3I2IA 4A5SA 4BVFA 4QPDA 3LLVA 4HXYA 4F6LA 4JBXA 2LXNA 4JWKA 4NQRA 4GXTA 4C04A 3H84A 2HSGA 2MTBA 2V6IA 4J49A 5BV2P 4U8HA 1Y9ZA 1B16A 5BV7A 2DXIA 3TD9A 1PT5A 2ZRLA 2XY4A 4OKSA 1GUZA 2AUNA 2BR4A 2EFCB 3SM3A 2C96A 4NJMA 1BHO1 2SBTA 3DDHA 1JQ5A 1OVMA 4P5DA 1OSNA 4ES6A 3C6KA 3WISA 3KJFA 3A9SA 3A3YA 4ZYYA 2DU8A 2OO3A 4G56A 3SYKA 5K6AC 4M8LA 2EHJA 4P4UA 3V8QA 5IT4A 3GRZA 4X7BA 3FWYA 4CM3A 2HU7A 3Q3HA 3KU4A 1LGYA 3KUCA 5A5VA 3TG2A 2NTYC 4PXYA 2Y1WA 5ECWA 3BSYA 5DHTA 3V48A 4K9MA 1ZJ5A 4DR7B 5CUQA 4NJOA 3MT8A 1Q19A 2NUPB 3A9VA 3FBWA 3SR0A 5IG2A 3UJ8A 2Q0HA 1R9NA 3RU9A 1HURA 3L6RA 3MUOA 2N0SA 3WWOA 4J7CA 1PJSA 1ODFA 3WLKX 3DTVB 2EX0A 2ACWA 1L7VC 1UWKA 1LK7A 4KQEA 4BMXA 5BN5A 1EGAA 4MS4B 5BSGA 1E9SA 1A95A 2F62A 3RRYA 3WGUA 4QGGA 1N3BA 1LBSA 2PBLA 2VR1A 1YB1A 3E22A 4PU0A 2O20A 2XR1A 3B2EA 1P44A 5LMUB 4AO6A 2WIDA 2DPYA 3FUWA 2GZRA 4HTAA 1BFUA 4JUFA 4B7XA 5T3UA 5PNTA 5THQA 3T1VA 3OHPA 1IUKA 1TLLA 1E2UA 1HI9A 2EARA 3P2JA 4RHEA 4URZR 4X8LA 4AN1A 2NLOA 3R77A 5BNZA 5JBIA 3LC2O 3U3DA 3A9WA 2H8KA 1V96A 3ON5A 3WWYA 4FCCA 2HR1A 3CUWA 5KTNA 3WMFA 3E23A 4OMFG 3RVSA 4XQEA 1LBEA 1CVLA 3A2KA 3R3SA 3JQFA 2ZI6A 5EZ6B 4OMDA 2IGTA 4PQGA 3V1UA 3ZY5A 2QG9A 2YWGA 2NVBA 4HEA1 2PPLA 3HL4A 3FUCA 5LPNA 2X0FA 3SXUA 2I4OA 2R84A 4ENUA 4UEOA 1O5OA 1ESDA 5F2EA 2JFBA 1GO2A 2NO9A 3ME5A 2J30A 4MWBA 1NW3A 1YCFA 4RZIA 3PNBA 3DB2A 1Y8QB 4R1SA 4QAQA 4X8HA 5E7QA 4LHXA 4LGMA 5DIZA 1ZGHA 1YI8A 1MHPA 1KOGA 1MJFA 4LQ4A 1XCPA 4QODA 5B6IA 1JAHA 1E98A 2H9AA 3LK6A 1RQXA 3Q3EA 5HM8A 3TQTA 2Q3MA 5F3WB 5KMGB 3TS1A 1RDFA 1TKBA 5TV2A 4LXIA 2QTTA 3D6AA 5A4DA 2WTUA 2CHQA 5D3QA 5HJ5A 5D6NA 4NBSA 2BFWA 1FTGA 3OUUA 2AR0A 1EVKA 3N2ZB 2BHSA 4UBMA 4IXNA 3VX3A 4XGQA 3GC6A 4RDIA 3A27A 2D59A 4MP6A 4UARA 5D00A 4P4GA 4RU1A 4UU1A 5IH3A 1E2EA 5LUAA 2W8BA 1T6YA 1DQPA 4FGUA 1KZHA 3IX7A 5FUMA 2GTHA 5KYUB 5DXJA 1S8OA 2VFAA 4LEIA 4X93A 1DWOA 2MMCA 4MVJE 4YJ3F 1PR5A 3DTNA 4K3UA 2CKMA 4Q12A 3SJBA 3VR3D 3FOWA 2BBSA 5EUMA 4PAOA 4R1TA 4RMHA 1YBFA 3CRZA 3O5AA 3VJKA 5DM4A 3HA2A 2CFOA 3HXLA 3NOOA 3OAAD 1NRIA 3MYRA 3FRHA 3ECAA 2GBPA 4H7FA 3GGDA 2H0AA 4CF5A 2V59A 5CFNA 2VK8A 1P4HA 1E96A 1MRSA 1TEHA 4OTZA 4LDJA 4ZCRA 1VMKA 2H29A 1EXDA 1B23P 1T3LA 3DUFB 1Z18A 5H4HA 4R3WA 1LDEA 5E2AA 5HTKA 3L8GA 3AXTA 3MTBA 3QY0A 4U2BA 5JNSA 3K70C 2DX7A 2O1WA 4U7DA 1FDRA 1ABBA 4XEHA 4N65A 3AL2A 1Q44A 1CDZA 3FCUB 1UXJA 2B4YA 2WVJA 4MS3B 3WKAA 3H5VA 3M9LA 4K05A 5C8DA 4J1TA 1FSZA 1FSSA 1WHTB 1XG5A 1Z16A 2KB0A 2B8WA 4ENSA 1BDHA 4WZBA 3VH1A 2WOOA 3ZDQA 5CYGA 2YCLA 2WWGA 1KE1A 1M1YE 4X6LA 3ADDA 1P0MA 3R0VA 1QXSA 1VKJA 3CEJA 2NMVA 1ZKMA 3AY0A 3FWKA 4GYKA 3VBCA 1LZLA 4CKWB 3GK3A 3CLHA 5DMXA 1ESMA 3I01A 3VPHA 5LYJA 4P82A 5AJVB 4AYTA 5I4IA 1WPRA 2RJ3A 3DXZA 2PWZA 3K09C 1C3LA 3M6MD 1FMTA 3GAZA 4R6XA 4GPTA 2C4WA 1MDBA 1T3TA 3TMAA 4COKA 3MBOA 4FEAA 2Q4DA 1Z47A 3A9RA 4LJSA 4C4XA 5LIRA 5HG0A 3U09A 1U63A 4D8YA 4GI5A 3FF4A 4B84A 4IDGA 4H18A 4JQSA 4Q24A 2APJA 1HFJA 5BYJA 2J5XA 1ENOA 3BMOA 2VDVE 2RDMA 1HEYA 2V7BA 3M82A 3PDCA 4DMLA 3KTAB 5CYFA 3R9XB 1QRUA 4IJKA 1ZOOA 1S02A 1LDNA 3F6SA 4LZOA 4D8VA 4ESVA 2PR7A 3UJAA 2G9UA 4RMGA 4EPTA 3PIDA 3KQTA 1I9GA 1NJ6A 4KZPA 1BE8A 1L4KA 4AI6A 1QV9A 5LZ9A 4LF5B 3SCZA 1ZXBA 3I2JA 5KNDA 4TKUB 3WGYA 1XFDA 3QOYA 4ZEOA 1OAOC 4RVUA 4QG3A 1Y5LA 2BV3A 3R6LA 1CZUA 4JBGA 2QJWA 2IXFA 3A6KA 3NATA 4KIUA 4Q6BA 1P31A 4UBNA 3W6ZA 5ALIA 4LXQA 5I7UA 4Y2YA 1Y6ZA 5A62A 3N6VA 1VG8A 1P18A 4G1MB 2DHRA 2PRKA 1KVUA 3ZE1B 3ECCA 4O4IA 3O8OB 4B3SB 3DC2A 5K20A 3W5AA 3WIBA 4GBMA 3DKVA 1JDTA 4WRRA 5CJ2A 2JHFA 2QSUA 1A8SA 1JDPA 3LT1A 1KK2A 4YAFA 3F7TA 3WAGA 1Q6ZA 5HJ2A 1W93A 3UV6A 1RRCA 2ZYAA 3FCEA 1BEUB 1G7CA 1UAGA 3P96A 1A9OA 3DE0X 1DIGA 5A4JA 4EF6A 4S1NA 5BVGA 5KAPA 8MHTA 3OEED 3HU3A 3ETNA 1XVTA 2O6HA 5DFAA 4C9BA 2HXYA 7ABPA 3LC7O 3DV9A 3TM4A 1KTIA 2PGOA 4YT8A 4E7OA 1I24A 3TLGB 1JT9A 2AIRA 5CAEB 5HXAA 4DL9A 2J3JA 3U62A 6YASA 2Q6OA 1JQAA 1EK5A 1BROA 3F47A 3CZAA 1KDVA 2DUNA 4MVJH 4X6XA 5T3YA 3R8FA 3KV1A 3U4CA 3DOUA 5JANA 3U48A 5L53A 3DAPA 5BSHA 1JDBC 1Q21A 4G07A 4ZAZA 4EB3A 3KEGA 4YRCA 1QO9A 2C04A 3RF6A 3VYRB 4DIDA 4ILKA 1W7AA 2O8EA 1ZVVA 3E0XA 3K0AB 1Z8FA 3O3MB 1XOIA 3WNQA 2NUAA 5B7QA 1NX6A 3HP1A 4O6VA 4P54A 4WL0A 4V0NA 5J2TF 3V42A 3GEIA 3I6ZA 1TX4B 2IH5A 2IYYA 4YRDA 1NPYA 5JJBA 2N42A 3TLJA 1E0KA 4RIEA 5CDTA 4LFBB 5B1YA 4D6PA 1K5GA 5CB6A 2CSXA 5T57A 4KDRA 5C4MA 3I58A 1IHUA 3H8WA 2LV8A 3A6FA 3E5HA 2HA4A 4QUBA 2ZIAA 3RFTA 4DNOA 2ISCA 4DQXA 4E70A 3CVOA 4PN3A 1Z6YA 2X2OA 1E9BA 1ZMXA 3BMNA 4AJJA 1E4VA 2IHVA 1JX6A 1N9KA 2X41A 4HGRA 5G2OA 1YA6A 3SBDA 2F4NA 2C5SA 3ILYA 3P9KA 1R4NA 1ABEA 3E5NA 1IM2A 4FFBB 1TJ3A 4NTZA 2AZ4A 4QOIA 3K1JA 1U5BB 2BTQA 2A92A 1Q0QA 3ZIAD 1EIZA 5AUNB 2OGSA 5EIFA 4JSRA 4C89A 3HPQA 4EELA 4EGSA 1V35A 1XO1A 4XB1A 3ZHBA 2VDJA 3G5LA 4RIHA 5A4AA 3MD0A 4LHWA 4AO7A 4RWEA 2XDQA 1O5TA 2CL5A 2JI6A 2V5VA 4OV6B 4B6RA 4CLRA 1JDZA 2C95A 2FMUA 3CXUA 2WEKA 3NBUA 5CXQA 3EEYA 4K03A 2ZCJA 2HUPA 2KMLA 1WPQA 5DYTA 3PHCA 3ROKA 3M6UA 2Z8XA 4MQEA 4JOCA 1WMDA 2ZT5A 2J3DA 4M88A 2BZSA 4DLWA 4C4SA 4EKYA 3FVVA 4LC9A 1TCBA 3RAGA 1WCWA 2HRCA 4PWZA 3U4HA 3MMPA 3KEMA 4UAUA 1ULZA 4OLHA 2D1YA 2C31A 3KT6A 1YZKA 4ME6A 5ELXA 4HX9A 1LRKA 4IGKA 5TT0A 3HA3A 2GZHA 3PC2A 2VBCA 3FRJA 2FSFA 1ZUWA 3BQ9A 4JAVC 4JCOA 1RYZA 1KWGA 1Q3TA 5LLSA 3U16A 1B74A 4P0QB 6REQB 1J8QA 1DBVO 1EM8A 3L92A 5EJIA 3HADA 3MWYW 3AT1A 2AI2A 4M38A 1CUSA 4F11A 4E12A 1DKPA 5ICSA 5IVKA 3PV0A 1V37A 3D8SA 5CLGA 4QTYA 4ADSG 5IRCD 1P1HA 2HPHA 4B0OA 3DDCA 3R7DA 3WB0A 1PJZA 4BEBA 2HXSA 4BAUA 2JJMA 1W1IA 5T4FA 3CLKA 1JSLA 3AW9A 2VPXA 5EHNA 3LHIA 4MR8A 1JJAA 1FNMA 1KPGA 2OP0A 3H87A 3H86A 3QWIA 4U02A 3ESQA 4YAKA 3U5TA 2Q0XA 3D7MA 4TQ9A 1R0YA 3LRPA 1HE3A 1B15A 1UEXC 4KV7A 5A6SB 1EXVA 1PV4A 2HJRA 4I3FA 3W2GA 4C76A 1OKKA 4QJ3A 1VZ3A 4UU0A 1JI0A 1ECJA 1I0ZA 2IYPA 4HQ6A 3MGCA 1JB1A 4C29A 3JQ7A 1ZKDA 3P2MA 2GRJA 1LLQA 3AR6A 1JJIA 2Z98A