2ADFA

Crystal structure and paratope determination of 82d6a3, an antithrombotic antibody directed against the von willebrand factor a3-domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
189
structure length
189
Chain Sequence
b'DCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Willebrand factor
publication title Paratope determination of the antithrombotic antibody 82D6A3 based on the crystal structure of its complex with the von Willebrand factor A3-domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting/immune system
total genus 68
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2adfA00
1BHO1 5HGJA 5E6UB 3ZE1B 1TYEB 3M6FA 3EH1A 3E2MA 4F1KA 4Z7OB 3BQNB 2B2XA 4IHKA 2NUTA 4HQNA 1FE8A 1XDGA 4BJ3A 1MQ8B 2VDQB 3EH2A 4HQFA 2VDRB 5E6UA 3V4PB 2WW8A 4PN7A 1BHQ1 1FNSA 4F1JA 2XWBF 1PCXA 4HQKA 2NVOA 3PPWA 4NEHB 1IDN1 5KYWB 4WK0B 1AO3A 3TVYA 1DGQA 5KYXB 4XW2A 4MMXB 5E6SB 1CK4A 1RRKA 1ZOOA 4O02B 4FX5A 1MJNA 3ZDXB 1DZIA 5KYNA 5KYWA 3F78A 4MMYB 1N3YA 1JEYA 5KYXA 1U8CB 2ADFA 1YVRA 1XUOA 5E6SA 4G1MB 1QCYA 1RD4A 4DMUB 2VDOB 1PD0A 3QA3E 2VDLB 3ZQKA 1U0NA 1U0OC 4MMZB 2VDPB 1IDOA 4JDUA 2X5NA 3NIDB 1JEQB 1M2VB 2IUEA 3ZE2B 2ODQA 4C2BA 2ODPA 4C2AA 1MQAA 1N9ZA 1L5GB 1CQPA 3N2NA 4UM9B 1MHPA 1T0PA 4WFQA 4CN9A 3VI3B 3TCXB 1JEQA 1V7PC 3IBSA 3EGXB 1M2VA 1Q0PA 2M32A 4C29A 3FCSB 3BN3A 3NIFB 4M76B 2NUPB 2VDNB 2VC2B 3Q3GE 1MQ9A 3IJEB 3T3PB 2XWJI 3VI4B 2VDKB 5E6RB 1M10A 4WK2B 4IXDA 3EGXA 3K72B 1JV2B 2I6SA 5KYYB 1RS0A 2NUPA 1IJBA 3PPYA 1SHTX 4Z7NB 1ZOPA 1MF7A 1AOXA 3BQMB 2I6QA 5E6RA 3TXAA 3HXOA 1YVPA 2WINI 5BV8A 1LFAA 3EFOB 3ZDZB 4WK4B 1NA5A 4HQLA 4HQOA 4UM9D 5KYYA 1SQ0A 1QC5B 1PT6A 3EOAI 3PPXA 1M1UA 3GXBA 1AUQA 4CNBA 3FCUB 1RTKA 4IGIA 3EGDB 5LN1A 1XDDA 1T6BY 3TW0A 1IJKA 3V4VB 3K6SB 4NENB 3T3MB 5ES4B 3HXQA 1JEYB 3EFOA 5HDBB 1ZONA 3EG9B 5KYUB 3F74A 4A0QA 1QC5A 3EOBI 1JLMA 1OAKA 4G1EB 4WJKB 3RAGA 4CN8A 3K71B 1M2OA 2O7NA 3ZE0B 1PD1A 3ZDYB 3EGDA 4Z7QB 3K6SA 3NIGB 2I91A 2XGGA 1SHUX 1UEXC 2ICAA 2NUTB 2QTVA 2VDMB 4NENA 3HI6A 3EG9A 4UM8B 5HJ2A 5KYUA 1M1XB 3PPVA 1ATZA
chains in the Genus database with same CATH superfamily
1J97A 1RPJA 2XF2A 4X6YA 5BNTA 3BGOS 5DT2A 4EF4A 1SXQA 1VHDA 2G06A 1VYHA 1Z45A 4EYSA 2WJAA 3F3KA 3H65A 1Z0IA 3CLKA 3TOXA 3A1VA 3ANLA 4ROTA 5FA5A 4YT2A 3T1YB 2A9JA 4BV9A 3TR6A 3VH3A 4FMDB 3IQEA 2JFXA 5JZMA 3F6YA 2Q9CA 1NJ8A 1VHQA 2HC9A 2X42A 1BX3A 2JF0A 1A04A 1GITA 1T3GA 2BGWA 3TDMA 4XJXA 3RC1A 3LTNC 3ZVMA 2OXEA 1JVNA 1EJ0A 2NVOA 2QDKA 3W8DA 4A9AA 4YRKA 1GSOA 1Z63A 1PT5A 4CEJB 4TL7A 1NHWA 1T3TA 2G7MC 2NZWA 3KT6A 4PLYA 2IV3A 1XD2A 4ZJPA 5KNLA 2ZZMA 1Z0DA 3PBKA 1QHIA 1SXHA 3FNGA 4BLOA 5BQFA 3TOSA 4LJRA 1A7JA 1EAMA 3KLBA 3U4MA 1HDXA 1XXHE 3W5UA 4ES6A 4BUCA 4EVQA 3ODGA 4UFOA 1E6MA 2D1RA 2NO7A 3CONA 3CVWA 4Z3OA 2OD2A 5JNUA 2CLKB 1Y7PA 4CTKA 2BKVA 1Y3FE 4U0KA 1KTVA 3DO5A 3L1KA 4KYUA 4URHA 5JMOA 4XVQA 4JT9A 5KHAA 1HE1C 1H65A 4DIKA 1S4QA 2FFBA 3GYGA 1RWXA 3LUCA 3WYGA 4EY6A 5GQSA 3QYPA 2E87A 4MR8A 4OP2A 4B40A 3T0FA 3D4PA 3ZC3A 5DDIP 1PR4A 3TIIA 4FSHA 5BQXA 4AQYB 1PNVA 2OTCA 1D2AA 1Z16A 2CKDA 4ZDKA 1T9HA 2HOQA 1DNPA 4CT5A 3DQZA 1YB7A 4CQMB 4DDTA 3DMDA 3S5JA 3T06B 5A9SA 4NVRA 4H3SA 1JSRA 1VP3A 2H4XA 1ONNA 3NW9A 3HUUA 5DULA 2QMQA 1SU7A 5EUMA 3TFWA 5UKDA 1WULS 2B4YA 1LTHR 4BECA 1JNXX 2GXSA 3ISVA 1XWFA 5AMXA 1C8BA 4TMXA 4Q02A 5ICFA 3ZWYA 3OCYA 2FSGA 2IOQA 3X44A 5JC1A 1YO6A 4M1SA 2AWNA 2XAUA 1EUCB 2AUNA 4FDAA 4M8KA 3DOOA 1DIHA 2HRDA 3CMCO 2NXJA 2ZS9A 3KL2A 2HY7A 1SZJG 2A4MA 1P74A 4E70A 3E9QA 1M8JA 1QG6A 4N47A 3ZCRA 1ESCA 1M0SA 5KB3A 2PIDA 3T7JA 3GROA 4G4SO 4ETIA 2VXCA 4ZVQA 4D97A 3QXHA 1AUQA 5IKXA 3O5AA 2J0UA 2ZSJA 5HIMA 3JRXA 1W59A 3CWQA 3BMOB 4TXLA 3QFSA 1GGVA 3DBLB 4KWCA 1BX0A 3A14A 4R6XA 2Q6TA 5DEIA 1XI2A 2Z08A 3T1QA 1TZJA 4AG5A 5DSTA 3HNRA 1L9KA 1X3SA 1MA0A 2HRZA 2OWEA 2VN8A 4K6OA 3ZDYB 4BIMA 5JI3E 1OCEA 3UMGA 4TTQA 1U9ZA 3ESYA 3L8FA 1IUNA 5D5PA 3MUFA 1NXSA 4H7FA 3SX4A 2P90A 3TZLA 3AGPA 4XEHA 3VVCA 1UMBB 2AXEA 1DKRA 3WSTA 1TYEB 2C3MA 2GHQA 2QAGB 4S05A 1CJUC 4KXNA 3OEWA 4CG3A 1PL0A 2BFEB 4Z49A 2IHNA 5GP1A 1HG0A 2DECA 5IJXA 1G1AA 2VIIA 3F7TA 3OO1A 2B1GA 4ETNA 2ZRKA 3MMNA 2NLOA 5EWMA 3T4PA 3PX3A 4M1MA 5CLLA 4ARIA 1UDBA 3DAGA 4C4PA 1E77A 4OD0A 1N33B 4QU5A 1ULHA 3WAGA 2ZJOA 8MHTA 4F3TA 2OV1A 2XQGA 2GO1A 4KIGA 2C4TA 5EMLA 1QGUA 5KJFA 3W4IA 3B70A 3T7CA 4KREA 3GFVA 3GZJA 1Z5UA 3TSOA 2HJWA 3U7IA 4HH1A 3MTQA 3PJGA 3UMFA 1LRJA 1CDEA 1LJ8A 1ACLA 1U6JA 3NI2A 4YAFA 3CW9A 5H83A 4QDXA 4DRZA 5HBGA 3W9UA 1KJZA 1XAJA 4IJKA 5KYWB 2YN2A 4LV8B 1WTCA 3H9EO 3ILSA 2C4UA 1EUDA 2C5BA 4XVCA 4FHDA 3INTA 2V4MA 4DZZA 1FU7A 3SC3A 3KKNA 3KQOA 2TMGA 4ZCLA 4CMEA 3IXQA 3B2EA 4TS9A 5LZ5A 2XVMA 2X13A 4G1VA 4JJ4A 5ESDA 4RIIA 3VDRA 1VPDA 4F46A 4UXHA 4N4AA 1ECFA 4QM7A 3K1AB 2XR1A 3LKBA 1D2HA 2O2ZA 1GPH1 2HKIA 2MSWA 2XITA 4ENPA 2ODQA 1JU3A 1NONA 1WCXA 1RAFA 3AKEA 4KSCA 2V4ZA 1Z4NA 3AWIA 3EIHA 3OLXA 4UPDA 5IH7A 2P35A 5F77A 1U0BB 5ES3A 1QU3A 4UDNA 2PVPA 5KDLA 3WS7A 3TLYA 2V4UA 2OYRA 2H59A 3QFTA 3FCSB 1IN1A 1E9EA 4B3RB 5IARA 3Q0EA 2D1QA 1Q84A 1SY7A 1NFFA 2VWPA 3AEYA 1JBEA 1W35A 2DQ4A 3GI1A 4G65A 1CW2B 3DHVA 5JNLA 3SF8B 3PEUA 1U3VA 3EBPA 4KH0A 4WDQA 4YAIA 4BNLA 1VLHA 2SHKA 5CDFA 1WXWA 4BC0A 1RTTA 4IOKA 3D6MA 3HYSA 2B69A 3ZYCA 4OXRA 5ETJA 2J3EA 4PX5A 1MF7A 4P4SA 5AKIA 1IBRA 1PYGA 1E1MA 3EZLA 3DZFA 4PBTA 2HDNB 6CHYA 2BJHA 4LMRA 1WD7A 2Y05A 1F6DA 2W6QA 4TT8A 3BXZA 5DMHA 1QCCA 2QPLA 1E3JA 3P2YA 1OGIA 3EPPA 1CQJB 1JIKA 1BE0A 2HHLA 2UZ3A 1TO1E 1WUIS 3AI7A 1RKQA 4G1FA 4ICIA 1X1SA 3ZY2A 1T2UA 3OZIA 5GM1A 2QZ9A 3GFTA 1EAYA 2Y0DA 1YNSA 1JZQA 5KAPA 1J1ZA 3FZQA 1YHZA 2Q21A 4IHJB 2UYYA 4C1NA 1WLYA 1KI2A 3PVZA 4PZZA 1GZ3A 2ZYDA 3RB8A 2HHHB 4KL8S 1GTZA 2QTMA 1IMOA 1DT5A 1JZTA 4QA9A 3D1JA 4FMCF 3HB5X 1R18A 4IXTA 1T34A 3U7RA 4E33A 4DLPA 2HJGA 2CJWA 5E2AA 1A5ZA 1K6XA 3KE8A 3QFFA 5HILA 4C7JA 1KQFA 2HK8A 2XRMA 1IXKA 4WY2A 3VC7A 3WWZA 4FNAA 1LC3A 2BRUC 4O4HF 3U3OA 4D9GA 1Z74A 3O9MA 1JSZA 4PV7A 4X45A 4YT8A 1TUGA 4PANA 4FIZA 4QJ4A 2A5JA 4K1XA 5FBWB 1QORA 2WUDA 3QTTA 1D2RA 1Q7RA 3M1LA 3A8TA 4ZTBA 5D3MB 4AZSA 4BE9A 1WP4A 2H7VA 1WXQA 1E2JA 2HSDA 3T5GA 3R0JA 2WM2A 4HLCA 4UMDA 3IB6A 4M1QA 2XWBF 1R6DA 4R2WA 5ENDA 1VMKA 4V1CI 2H17A 2DFLA 1CV2A 3NVDA 4HS4A 4M7PA 1SFRA 2RHDA 4RAOA 5LXTF 5FEUA 4OJQA 2B0JA 2M98A 2Q07A 1PQYA 3N0VA 5JCJA 2Q0SA 3JQBC 3AT1A 1BVUA 1FQWA 2DC1A 2FH5B 3WMEA 3TLMA 1YR7A 1OH8A 1XRLA 1JRLA 3D2CA 4AF6A 5SZKB 5EGNA 3RS9A 4L1KA 3UANA 3IP7A 5A5FA 3R2JA 3NKFA 3OKFA 4BEWA 2HCJB 4B9EA 1SCBA 5A3RA 5LLTA 3FPGA 4MGIR 3H18A 2QZZA 4BVLA 4HRXA 3ML1A 1GDTA 5JAIA 3DEZA 1HEIA 1QRDA 1EB9A 1KK0A 1J0DA 2YY7A 1AM4D 3EXFB 3NBUA 4MRAA 4TL6A 1KGSA 3U37A 3U1BA 3GMDA 2YWFA 1I32A 4JB0A 4P4LA 4ZAWA 4BOYA 3PIDA 4R9RA 3ANTA 1PDOA 1PFGA 5K0LA 3M2PA 3H2IA 2IIPA 4L8FA 3ZWWA 4NBKA 4QQ8A 1O9GA 2XKBA 1PP4A 1LPAB 1VRCA 1D07A 4RF4A 3AERA 2VP9A 4MQEA 3SG0A 4M76B 1RHKA 2RBGA 3ELUA 1MX3A 3ZWKA 4I8XA 4RSRA 4X7BA 3GQBA 3WSWA 1A97A 1F06A 1JZSA 2HA5A 2Q28A 1Y5NA 3CNHA 4GKBA 4L08A 4P7BA 4Y9UA 5CP8A 4DLLA 1F12A 2EW2A 3R7WA 3E1SA 3OQHA 2EC5A 3L1HA 4AYWA 2X1VA 2ZYGA 3TX6A 2PUEA 2JAQA 3GP3A 4MEBA 1FLVA 1X14A 3ZEIA 1Y5RA 1KAOA 5GJBA 1C80A 1Z34A 1HDYA 4P3PA 4JV5B 1TKRA 4F92B 1QHXA 4BGVA 3M6LA 4DCPA 4MINA 5ALUA 5TPWA 2GPWA 4IVRA 3UAGA 4JBYA 4HQOA 1IVNA 1EDZA 5BNWA 1UC8A 2WJPA 3G9UA 1F8XA 1NX9A 4ND8A 1ULUA 2HJ9A 3FCUB 2I2FA 1W85B 2RCYA 3FWYA 3I32A 2ZRHA 4TZTA 4ROSA 4AO8A 3BMNB 4BU1A 2BRUA 1VG9B 4WT7A 3AP3A 3TB6A 3JAWB 4HUQA 2AEJA 4BJ5A 4F71A 4W5HA 5ALOA 4G1EB 2W98A 3ITKA 4WJKB 2HEGA 1PEKE 4Q21A 3KOMA 2FJ0A 2RGYA 1SXJE 3U4GA 3IP6A 3ZD9A 3L4SO 5EY5B 2NVUB 1M2NA 3A2MA 2JIRA 1NZFA 2NUTB 3ZJ4A 1O4WA 1ZI8A 3DFKA 4DLXA 4KIWA 3GP5A 2XT0A 4EPXA 4DUYB 2XB2A 4N3BA 1SEPA 1HUQA 1L5RA 2XZDA 1CIJA 4O0LA 1MO3A 3BGSA 3AVYA 3KETA 3JQBA 2DTDA 4RKYA 5AKXA 1OASA 2IIVA 2XMRA 4H31A 4HPWA 4AY5A 3SYKA 2FUG1 4KPEC 4FINA 4EPVA 4R1OA 4K6GA 2A6PA 2I4IA 1AQJA 2I7DA 3OT5A 4TYPA 2NV2B 2VHUA 2PZAA 3O9ZA 4TMWA 3KX2A 1HNZB 2CFRA 4YEDA 2FWIA 3L6BA 3R6LA 2GDJA 2J9RA 1OPRA 1XO1A 4OHOA 2R6GA 1I51A 2X9NA 4DJEC 4PPQA 1A9YA 5H7XA 3U80A 1XDUA 2ZJ6A 4K6KA 2F1HA 3LSTA 3QOWA 1Q6YA 4OFBA 1YV9A 3PFHA 4KN5A 1GG9A 1J2YA 3ZY5A 2RKBA 2VO1A 1KO4A 3D3KA 4UUAA 4OI0A 2FMKA 1E1DA 5PNTA 4EX6A 1ZL2A 3G2OA 1UKVY 1OV6A 2NO9A 1TQ8A 4F1WA 1RE1A 2LIPA 4MRVA 4ZCMA 5JJBA 5KOHA 3PGXA 4BAUA 4DUZB 5LYYA 3NWBA 2IU4A 1OW3B 2E5WA 4PGMA 2G76A 2EIXA 3SOZA 4ZT6A 3I37X 5KCZA 4R54A 3CRQA 2OBLA 3GDGA 4P3YA 3ZI0A 3NHYA 3MWEA 3K9CA 4QHTA 4UTOA 5D84A 4UHJA 2FXVA 1D04A 4YGXB 3VOBA 3WGZA 2B8JA 2X5NA 2NTVA 4UOQA 4WAUA 1THMA 2Q4OA 2DH6A 3CF4G 1LGYA 3SY8A 2BTOA 5IDYA 5JPCA 2ODPA 2JJ1D 4EQZA 1FNNA 1IY2A 1BXKA 4HDKB 5DP2A 1OXMA 3DAPA 121PA 5F9MA 2PS9A 4B45A 4HNUA 2GUWA 4A6DA 1T24A 4B76A 3THYB 4R1SA 1W0JA 2QE7D 2WD7B 5FUYA 5A03A 4MV6A 1L8OA 4I1SA 4LYEA 4KR0A 3C3EA 2PEZA 5EJ6A 2W11A 1LDYA 1YRBA 1NVMB 5TS2A 1BRMA 3MK31 3AG5A 5E6RB 3D0KA 1A76A 5ALZA 4RTPA 1ECPA 4E94A 1LI4A 1GZUA 3TQRA 1JFVA 2YX1A 4WV3A 3KZMA 4CTNA 1QVWA 2P9EA 3N7UA 2CUNA 5ECGC 3UNXA 5A4DA 3ZIAA 1ARZA 4KMOA 4LDAA 1MIHA 2ZIXA 3GPBA 4OUDB 1E98A 5LBIA 1BCRA 2G8LA 4D6XA 2ZCUA 2R00C 4ZCIA 2IEAA 4YREA 2CV1A 3EOAI 3FTPA 1LX6A 3HUDA 5JARA 5THQA 3IAUA 4NQRA 1E60A 3DMNA 1M7HA 2WV7A 3E8MA 4J7AA 4QDTA 4RQTA 2OAQ1 2NO5A 2QJRA 3AJEA 3ZGXA 2GAOA 1TAHA 2QQFA 3I6YA 3C3WA 2JCVA 2IHVA 2ZSKA 1M0WA 3VU3A 3C1AA 4BB9A 3CBQA 4CN8A 1R9MA 2OO3A 2IZ1A 3TVDA 4CLRA 3TAHA 3WWDA 3HCFA 3TM5A 4GEGA 5DM4A 2B4KA 4ESEA 3DVSX 1KY4A 1IOZA 1MIOB 1Y1TA 2FR0A 2PKWA 3P9ZA 4G8CA 4KFRA 3V48A 3EFEA 2ZDHA 4K2AA 2WVGA 3LC0A 3BQNB 3LBIA 3GELA 4HDSB 4BN4A 2GJSA 3NVMB 3O3CA 4AT1A 3SFZA 1RI1A 1QZ3A 1X1DA 2QRZA 1R64A 1Y81A 4X6XA 2OBFA 3HKEA 4QAQA 4DBZA 5MN4A 1ZUNA 5I7VA 2JLQA 3REGA 3SR0A 1X1BA 3MLAA 2AG0A 2BMJA 3KYDB 3O1LA 5KQMA 2DERA 4NCNA 1XKQA 3D8UA 2QS9A 4LYDA 4IQ4A 2QTWB 4O33A 5BSFA 5KWVA 4GX1A 5TMPA 4L57A 1ANKA 1OB5A 3B78A 4L8LA 4N3AA 1PR9A 2VTBB 3WLJA 1ND5A 4CEHB 2JCGA 2EJTA 4ZVVA 1Z3IX 3TRDA 4ABYA 4RK0A 2WYUA 4UFPA 1CP3A 3LT4A 4N8DA 4WGFA 3V4ZA 3C1UA 2EKZA 4V2IA 1N1GA 5LIPA 1E7YA 1Q22A 1RBMA 5I3ZA 1XG5A 3Q6IA 2G0AA 4DR5B 1K2VN 1EFKA 2V8BA 2V6IA 2FSVA 2WICA 4ZREA 1E4YA 3DCYA 4GXTA 4OLHA 4XFDA 4YUVA 2EZ8A 5CRIA 3I2IA 3TKAA 5C9ZA 2C7OA 5KI6A 1E2MA 3OQ6A 4KI0A 1NV9A 1WMAA 3G79A 1FDSA 2BISA 3H42B 2SECE 2TRSB 2TS1A 5DPMA 5ADUS 4KQCA 2H4FA 4RV9A 2C98A 4AN4A 3BORA 1TA9A 2IYVA 1KSFX 5JVDB 3T7EA 2RGBA 3H86A 3MTAA 5DGHA 4RPJA 5G40A 4JI5B 4Y2QA 3TLCA 4XQGA 2HCBA 1C81A 4L6IA 5DWVA 2GRAA 2HN9A 4RF3A 1W0KA 1G3MA 4GWGA 3RIEA 4QECA 3RTEA 3V4OA 1QM5A 5CB0A 4HBZA 3IP1A 4LHYA 1V6AA 2QRNA 2I71A 3DMGA 3G8CA 4ND4A 3BWEA 3M6AA 3S99A 2BGUA 2F3SA 1PK8A 4XYGA 4GYJA 1IBCA 4POOA 3I9FA 5G53C 2GI4A 3UQYS 3AW9A 2R00A 3FLBA 1U2EA 2IZ0A 2OBBA 5E3IA 2ERXA 5IBQA 5IUJC 1NF3A 1NLUA 5KS2A 2A78A 1ZCAA 3IQHX 3AHEA 1KEEA 2GETA 3C5CA 4A8PA 1OBCA 3IJEB 4M0PA 4WBNF 5KVQA 4PAQA 3ORRA 1U9CA 1QYCA 3R7AA 4TRJA 5A4MS 3JARB 3WIEA 4TQGA 1FNBA 2DGDA 1P1BA 4R68A 3DUWA 2FP3A 3DJFA 2VPPA 3NKLA 4U2GA 5LPNA 1SUPA 2R48A 5GV8A 3EA0A 5CBPB 5K03A 5F4BA 3MJVA 4J3JA 4UXJA 5CVVA 5ECWA 3WOHA 4PN3A 1CR4A 2LV8A 2C5FA 5CHYA 5LYJA 4CF5A 1KDOA 3OOJA 1SZPA 4RLHA 4Q7QA 4G8JA 3UT6A 3RJMA 1GUDA 4DWVA 5KYVA 2K7ZA 5NLLA 3E2PA 3OZFA 5H9VA 3I9KA 3WX0A 5CDTA 3QEJA 1ENYA 1RYNA 3L7CA 4GPZA 1CPYA 2QMHA 4ITRC 4MR7A 4PGAA 1TW2A 2BDTA 4A8JB 3O8DA 5DWQA 2IEIA 1KZ9A 2XE8A 3GA7A 3PEVA 4HAOA 4JYPA 1QF9A 4RPCA 4MS4B 3TLZA 1P80A 3QFCA 1KYZA 5K3FA 3K6SA 1U3GA 1CE8A 2C7GA 2IRWA 3JQ8A 1KR5A 2E18A 2EGGA 2ICAA 2JFUA 3IKMB 4AYTA 1OFUX 2AN4A 1RQRA 5F3DA 4YPVA 3ZCSA 1RR6A 2DT5A 4NMWA 4QPDA 3UT0A 1WPQA 3V46A 4D56A 3IURA 5CB8A 2QLJA 3NTXA 1SBCA 3L4BC 2Y1KA 4D9IA 2PQ0A 3SDZA 1UJCA 5K0FA 4FYWA 4NYMR 2XMPA 3LX8A 1UBFA 1UKYA 2ZRLA 1MEJA 1Y89A 1X0VA 2NTJA 4BQIA 2Y68A 4OQFA 1Z8NA 1Q14A 3OZUA 2Q7DA 3KZCA 4A2WA 2D3TA 1ZZGA 3FTFA 4CDRA 1NU8A 1AB5A 1V4BA 4PSAA 2XCLA 1OQAA 1CZRA 2EJWA 4FNGA 1F2TB 4E1VA 1CQIB 3WK9A 4YA6A 4D02A 5JYEA 1AKEA 8LDHA 4XXHA 4E6PA 2V3WA 1NJSA 3PKZA 2W2OA 3R5XA 1WAMA 1Q5PA 4GX2A 4H4CA 2ZIFA 1ILEA 4QUIA 3PXDA 3OZDA 1A8QA 4LTNA 4M0EA 5D51S 4LYYA 3SLRA 4MRSA 5AXCA 1FS6A 1A5SB 1WSAA 3GPDG 3M6VA 4BO0A 3THRA 2LTAA 1JF8A 3TCNA 4QYMA 3W8RA 3RNLA 3KYBA 3MJRA 1PG0A 4XIJA 4KN8A 2ZUTA 4DXHA 1W88B 1EKXA 1L7OA 4HGYA 2M6SA 1GNTA 4RACA 4OXYA 4A6PA 1QYRA 1Y9JA 4C0BA 2X3UA 4R71A 3C8MA 2ZM5A 4UD2A 4DA4A 3OECA 4MDYA 1XPUA 5HCUA 3Q7PA 2TMDA 2MCFA 4ER7A 2ZJFA 1NW8A 1PX2A 3FLEA 3KPYA 4ZRDA 3KKZA 4RFVA 3UGQA 4M9RA 3A4NA 2BFMA 2WZDA 2X7HA 1I7DA 1FU4A 3KE9A 4WW0A 4BNTA 3BN3A 3D54D 1UEJA 3E7PA 5IULC 2HFJA 1U90A 3IQGX 4FE4A 4PPNA 1ZVMA 4RA6A 3WTBA 5AVTA 2FUCA 4GMHA 1BJKA 1NQ5A 1JHYA 3E9NA 4KO1S 4JI1B 1HQYE 3GJSA 3MTBA 3OLWA 4Y1FA 2AMVA 3SIRA 2W0SA 3G1UA 1BX1A 2P5UA 3PUHA 1ADGA 1S9HA 2JFOA 2QHXA 1E5VA 2A35A 2J5QA 2ZWPA 4FQ5A 4I1UA 3NH9A 5BQOA 3URKA 3GR6A 4AQDA 1I7PA 3QM1A 3AM4A 3SIXA 5CU7A 4URVR 2V58A 1Z6PA 4YCCA 3DLPX 2P1ZA 2WTBA 3O74A 4LDPA 4P4GA 4BLUA 2GN2A 2O3JA 2EOAA 3B8EA 1KI9A 2AKAB 5FBVB 1KQGA 3AI1A 1T5DX 2Z58A 2WIGA 3NJ4A 3H2BA 4KRXA 5J4YA 1A1VA 4R69A 3L79A 2INGX 1U63A 4R7GA 5FFNA 4QFMA 4LWOA 2IIQA 2P68A 3LW8A 4EJ6A 2XUJA 3FGZA 1RWBA 5ESXA 1C4OA 2ACEA 2DF8A 1UF9A 1ITZA 5H16A 1CERA 1X0XA 1AKMA 1GLVA 1K0UA 4JUDX 1VOTA 1H8HD 2GNAA 2Y71A 3R3VA 4BVJA 4C3OB 3JR3A 5AVYA 1GQYA 1FMJA 4UJ5A 3E61A 4M1TA 3X1JA 3GGOA 1T8PA 5HF9A 3ZNOA 5AVUA 5IUNC 1F4LA 3LECA 1SKAA 4LVNA 1JE0A 1HYGA 1PDVA 4JXKA 3OX4A 4ANFA 1QH1A 1WV1A 1OF1A 1XEXB 3MW8A 1Y8QA 3FBGA 2YRWA 4U6QA 4G0VA 2ID7A 3JYQA 3PXUA 1T2CA 2DFNA 2RKOA 2J0SA 5H3CA 3AM1A 4GP7A 2FZLA 4JU9A 4L02A 5PGMA 1G5TA 1FLAA 3OPYA 1OFVA 1NI4A 2XMDA 5LXTA 2VRCD 4QO7A 4C3ZA 2Q5EA 3D8TA 1CUWA 4QUGA 2H06A 3QLEA 5K3BA 4LF6B 4DSUA 1FMLA 1AK2A 4IIXA 1Z5NA 4NV0A 5CM8B 3UJBA 1SWWA 1OFGA 2PSHA 4I55B 3BHMA 4JJ8A 3GJYA 1S8OA 1FFGA 2WAOA 1MX9A 3JQ7B 4ZT4A 3RK4A 4JKYA 4LGMA 1OD6A 2JFBA 2CD9A 5FLKA 5AW5A 3B7WA 3V2IA 4DABA 5EWJA 2XCRB 2R85A 5T41A 3O8OB 1TAGA 3VPHA 1M5TA 3FN4A 3F6PA 2QXTA 1W75A 3L77A 1YDGA 1Z82A 1CB0A 2ZKLA 2ZYRA 4V3CA 4MMYB 3EX7C 3ABZA 3DCIA 1A0OA 1QXSA 3HKDA 4FN5A 4G41A 1SG6A 4XFJA 1W4BA 1SC3A 2MYUA 2YYSA 4OQQA 4D0RA 1R88A 2ZROA 1OA1A 4RH0A 2HB6A 5BW5A 1Q3TA 3HEMA 1WCWA 5D6NA 1CJBA 2PZEA 1DIGA 2IKQA 3JQCA 3PQDA 4FD3A 2P62A 3R8XA 4D46A 1N5MA 1Y82A 1XBTA 3KZVA 3G2MA 4XM0A 3R9XA 4TUYF 5L3QA 4R1TA 4KYIB 5EVCA 1FMFA 3KSDO 5JASA 1G3QA 5JALA 2W2NA 3RUAA 1N9ZA 3FRIA 3HBFA 1YQWA 4H1HA 3CX4A 4GPTA 3VR5D 4KOEC 3FXAA 1Z47A 4B44A 1W36D 2AX4A 3K0BA 2PT6A 3BL8A 4KO4S 1TPYA 3KSRA 2VS1A 3BRCA 3OEYA 3QLUC 4G07A 1E7MA 2HI0A 3OTWA 5LA6F 3IA2A 2ZB2A 2AYYA 1H0SA 1JJAA 2GPTA 4LPKA 1QVRA 2VHXA 3Q3GE 1Q3KA 2O2EA 4HFRA 1V16A 1ZC4A 2FKNA 1BGWA 4K28A 2BUCA 4GECA 3UV6A 2WJGA 4AW9A 3TUZC 3LGXA 4MHTA 1Z07A 3D0OA 1VXRA 3H1PA 2EKLA 1V8OA 3IJ5A 3E22B 3LOPA 1H0RA 4G5QA 4R2LA 1ZH4A 4RGQA 2CEKA 4XZ3A 1QB8A 4DRXB 5HMMA 1KJ8A 4F96A 1ZP6A 2XAAA 3IDQA 1KR2A 1QE5A 5CX1B 4R2JA 1R5BA 1TF7A 4X85A 4H18A 1M0TA 2Y4OA 1PWXA 4B35A 1PJQA 4CMAA 1N6RA 3Q2OA 1MOQA 3N2IA 5J2UF 4WXMA 2HR1A 1J7KA 2RGGA 5H3HA 3EEOA 2RHWA 3H9QA 4FT2A 4M0MA 1TIBA 5AXDA 2HSJA 5YASA 3SMQA 3HBMA 2GHIA 2XD4A 3BEDA 5REQB 3DT6A 3BVPA 3AVWA 4MKXA 3I52A 1KDZA 4TTSA 3HY3A 4KR6A 2G4LA 2ODAA 5AP9A 5C3MA 2LNDA 1NDUA 1QONA 2ZUSA 1BCSB 4UPVA 2G28A 1F8YA 2WJIA 3BWDD 3KVNA 2XVXA 2WM8A 2OSBA 3TTTA 5BT9A 2QR3A 1RJFA 3FHOA 2C4WA 4OK5A 4HDRB 2V03A 1DFGA 5GIOE 1B42A 3ABIA 2ODWA 3L0BA 1Q92A 1T2AA 1Z83A 2AF4C 4OSPA 1M7GA 4ML3A 2C57A 3TZKA 1OH7A 2Q49A 2LE0A 2Z5VA 4LK3A 2W58A 5K09A 3WAJA 1QZXA 3IPLA 3MZ0A 1P75A 4BCDA 1SBYA 4EHFA 2AH5A 2VHVA 2IXGA 5HFAA 4IDOA 5KQLA 1SUIA 2DUWA 5I3CA 4B3FX 4LJYA 2ONYA 4ETWA 1BWSA 1Z37A 2PRIA 4I3HA 4E4TA 2IU3A 3LY8A 2GD2A 4ZK6A 1EBFA 4DCUA 1PT7A 4MVJG 4UMFA 4PX9A 1N7IA 3H83A 4ZQBA 3DYBA 2C61A 1G20B 1YCDA 3WWCA 3QVOA 1UXGA 3PQ2A 4OMFG 4OHCA 2FOIA 5TT0A 5EJ5A 4RULA 1FFCA 4B6JA 1NXVA 3J81k 3KQYA 1KJYA 2O3SA 2VJNA 1OLXB 2GZ3A 2XUAA 3AIMA 4D8YA 4P86A 3H1TA 1RQ7A 2JZNA 1KL7A 3JATA 3OMWA 3RYIA 1C9NA 2UVPB 1PJCA 4IO1A 1FFDA 1N8KA 2JC3A 1JDUA 2O7VA 3H6KA 2O7QA 4RVUA 1YDFA 2I9PA 1Y1KE 4YGYA 1YL6A 2XOEA 1XRSB 2Y2VA 5LU8A 3D1VA 4I9HA 2JAPA 1VA4A 2Q8NA 4GBGA 9ABPA 1T1SA 1VKOA 2TECE 1DXHA 5ECDA 2VSQA 4UUMA 3MYYA 5L3QB 5A1JA 3KELA 2F43A 3GLSA 4ZICA 2C59A 4ZVSA 3F5FA 4BFYA 1EVLA 1M2VB 1NW6A 3U3KA 5JATA 3OCJA 4V3BA 3L40A 2C8KA 3KQLA 5LNK6 3KTFA 3A1UA 3MT7A 4ENWA 3INNA 3MPOA 1EFLA 3Q9SA 5KAMA 3E3LA 3UUGA 2PUTA 1BKSB 1KJWA 2DPGA 4KC0A 1TI7A 4P93A 4Q3LA 1RI5A 1Z18A 1QO9A 1E5TA 1NMEA 2R3SA 2FUEA 4OVKA 4PXYA 4AU1A 1W48A 5E9JA 1WVMA 2DM6A 1OBHA 4D81A 2WFAA 1KS2A 2H2HA 3EQ8A 4GMKA 2NAPA 3KCQA 2W6CX 2ZIGA 4LRQA 3BTSA 3OM9A 3QUBA 1LPSA 3WWOA 3V7FA 1QE0A 1WXDA 3FSGA 3AJRA 4M8IA 4REMA 2CYCA 4WLEA 4MXDA 4QYWA 5ALLA 5A4FS 3JZDA 3RARA 1RYYA 4UQLA 2Y6VA 3O3MB 4LV6A 4O5AA 3JWPA 1YVPA 3IAFA 1JHZA 2IVZA 4LHZA 2I7CA 2QQEA 3PYLA 3ZDZB 3P2IA 2VQ3A 3SMVA 1EUZA 4MV8A 4XIYA 2DYKA 2VZ8A 3ICPA 1M2OB 3LK6A 2JVIA 1Z2DA 2DE0X 2WKPA 3K16A 1V26A 2C58A 3CO5A 4IH4A 5LBTA 2GK6A 4HADA 1E3QA 1N0IA 1R0KA 2BDEA 1AKRA 4KFSA 4N12A 4E21A 3D6JA 3E7DA 5IM4F 2D7DA 3ORFA 3QVKA 2GAAA 2PHZA 2ZEJA 2I3GA 1ZH2A 3QSGA 5KYGA 2YWDA 2QMZA 1US8B 2OUIA 2FVYA 3CR3C 3HWSA 4RVFA 2QWXA 4X1YB 3OICA 2D4HA 3IV9A 4PTLA 1MX1A 1SPBS 1QK4A 3LVFO 4KXXA 3LRXA 3NOXA 3I5MA 2JD1A 2PT5A 4ISCA 4LJ5A 4E7PA 5JD5A 1WZ2A 4G37A 1BH6A 5IS2A 1EE1A 4RH3A 3PRYA 4I5DA 1DV1A 5C32A 4RJJA 2Q5LA 3V6MA 1BVYF 1YMQA 4H59A 4RADA 1Z6GA 2X2FA 5TQVA 5ULLA 5H4GA 3MS4A 2I03A 4YASA 4X84A 2EFDB 3BIFA 2VWHA 3GEDA 2CHUA 5FTLA 2DB3A 2JG3A 3UPTA 3DZIA 2DSNA 3RYTC 1DKMA 4DTCA 5LSAA 2JGRA 3RVBA 2IDMA 4O6VA 3PIIA 3ZZMA 1VSVA 1GV1A 1DBIA 4CM6A 4RELA 1FYFA 2Q6LA 1IM5A 2V7GA 3H5TA 3R0ZA 3RLIA 2JGDA 4LYFA 4BJ6A 3NWEA 1XEAA 1Y4UA 2AOTA 4QASA 2IQIA 5J1TB 1K5DA 2GEUA 5CFNA 3R1IA 3UJCA 2YVUA 1G21A 1Y1RA 1RRVA 2PZGA 2WKRA 4K87A 4WFIA 1E3LA 2JH9A 4LOLA 4E09A 2I6GA 1UBJS 3RHFA 3G68A 3UWOA 4BFLA 2IC5A 4U2BA 1EFVA 5AQEA 2ALJA 4QXRA 5CEFA 3NHRA 4RZQA 3KDPA 1SKUA 5AM1A 3X2FA 4IDQA 2Y1WA 1WDTA 1YZHA 1OT5A 4TZ6A 2YHIA 2BKLA 1NVGA 3MBOA 3PX7A 4K26A 3TNJA 3WGJA 4OHZA 4XIFA 1G2OA 3GJTA 1KQ3A 3QWIA 3LYHA 4ZHQB 2JL1A 2IUTA 4IIBA 1IBKB 3D7NA 4J2OA 2DUJA 5TS3A 4D4IA 4DNXA 3QVSA 4V0KA 5AVZA 4BMCA 2I99A 6REQA 3PHLA 1FRFS 3KJEA 4L5AA 5JRZA 1E99A 1P2SA 1O8BA 5IVKA 2VK8A 3V7NA 3ONWA 4KXLA 3S29A 5EQFA 1OY1A 2BMWA 1LF0A 2V9ZA 5HK8A 4C9BA 1L4FA 3EXIA 1FFXA 2XSZA 3V3KA 1BG6A 1UBNA 1L6RA 1E58A 3AEKA 3KDSE 1JAIA 3FCCA 1XX6A 4HXGA 4UW9A 5DYTA 3AF6A 1T3ZA 1Y3BE 2PIAA 1QQ5A 2O0MA 1PQPA 1RCFA 5JQGB 4F85A 4L9WA 1IN5A 4BO1A 3LXUX 4EG3A 1N2EA 4Y6LA 1VKNA 4BVHA 1OFUA 3WLOA 2ZTVA 2CHFA 1Y34E 2XMBA 5A02A 4K8OA 1YB1A 2H08A 2XJ9A 3EMDA 1I4TD 4CG2A 1GM5A 3PZBA 4BBZA 1XVVA 2QVYX 2YDYA 4LQDA 2XKKA 1I3OA 1BWQA 3A9CA 4I50F 3N8DA 1UKCA 1OTHA 1Q1QA 3S70A 3MTJA 2I9KA 4H2DA 4BU0A 4ENQA 4TVKA 3COSA 3MCWA 3LE8A 4JB3A 2YZ7A 4KU4A 4US1R 2BLNA 2P1DA 4HYQA 2HO4A 4NOJA 3RIXA 2ILTA 3E8SA 1B6RA 3OFND 4GOXA 5ILGA 1H9BA 1U7PA 8ATCA 2CB9A 2XNDD 4O2RA 4WERA 4BYMA 2B36A 1GSAA 4XIIA 4R9SA 4A4DA 3GHHA 1E9SA 4MKIA 4MRRA 4PFJA 1U6IA 4NBVA 2GRJA 1AKTA 2VH1A 3RSHA 2QAIA 3JYHA 3FYHA 1TRHA 2YYZA 4U8GA 2G1KA 4UBLA 1Z22A 2XHEA 3V3TA 4PXSA 5ICSA 4GLJA 2AE2A 3HA5A 4OYLA 3Q88A 2OAGA 1J4AA 2AXPA 2VJOA 3CJRA 2MHCA 4CU2A 2ZYIA 4FYJA 4E07A 5CDYA 1JILA 3CIFA 5KTOA 2IY7A 5AVKA 1XVIA 3IE1A 3ZTTA 3FX2A 1KOLA 4B8ZA 2PJUA 4Z4FA 1WBDA 2QSZA 1CC1S 2RGXA 1KI6A 2ZAOA 3QLVA 4HYEA 2FPLA 4C7OB 3BH7A 3WYFA 3Q7TA 2PRJA 4CDGA 1GV0A 5ALYA 4EMUA 2PYIA 2ZSAA 4MAAA 3GFGA 4KLZA 4PNPA 1M1YA 5HKKD 4KWHA 5IJWA 2C03A 3BXXA 4JIGA 4EATA 2XOKA 1FDIA 4KVFA 1JEEA 2OCDA 5EJ4A 5K0ZA 2RJNA 3WFZA 2Q5HA 3FFAA 4BNDB 4X3OA 1S8FA 2FZWA 1HDZA 1D6NA 1YA8A 2IXAA 2GWRA 4DC9A 3D5EA 2HWKA 4GM1A 5DXJA 1I4WA 2MINA 5FTWA 2VP2A 1OREA 5AI6A 2AA3A 4PS0A 3G82C 1PW5A 3AUTA 4W9RA 3COPA 3A1NA 1VP9A 4B8WA 5LQDA 2DPMA 3IUBA 2CT8A 4GI5A 4DKJA 4GOLD 1U2ZA 3ZHTA 5JZOA 3RS2A 5CEJA 2IYYA 3DBRA 4L75A 1R0ZA 4MLPA 4OJKA 4WKGA 4NBLA 3ER9A 1KH1A 2IYTA 5I9SA 3PA8A 3WJAA 1IWOA 4WRRA 4JIMA 4UDYX 3MAJA 4GIBA 2WE8A 2HSGA 3QLJA 3PDHA 3KQPA 1MQ9A 1L4YA 3TZ6A 1NY6A 1XA0A 4GBMA 4HQRA 3LX5A 2VYCA 1SC9A 3BHJA 3D8SA 3ECSA 4L2IB 4XGKA 1JR3D 4I4NA 1C30A 2IQ5A 4QULA 2JPDA 3EHDA 5A3SA 3ZNPA 3O31A 1T4DA 3INGA 5E8JA 2C2GA 5EJ2A 1G8FA 1VSTA 1NJ5A 4M37A 2WKQA 1IQUA 4F84A 3HBJA 2AE1A 4H6XA 3MRXA 4R40A 3AETA 5HE9A 3A3NA 4GOMD 3ZQ4A 2I6QA 4HWOA 2A9OA 3UFXB 5LMUB 2X2EA 5JH7B 1QRTA 3DE3X 2J3MA 3K15A 1P18A 2A88A 3K53A 3K9QO 1SA0A 2YR0A 3CEPB 3Q3EA 3WLHA 2OCPA 3KU4A 5J47A 4IHJF 5FEMA 3H0EA 3IKVA 4J4HA 2FN8A 5T7BA 3RAFC 1G5IA 1ZESA 1EFUA 3KG2A 4D8VA 4FHGA 3CPHA 3F74A 4RVHA 421PA 3Q7RA 4YY3B 2W93A 3BILA 3DWGA 1OILA 2ZUCA 3I2JA 4IQ0A 2IBTA 4QPJC 3CNOA 1J1IA 5DGXA 2HQBA 2XVZA 2FCAA 4IFBA 4QOJA 4C3VA 4CLDA 3VR3A 2R1ZA 3GUZA 3PWTA 1TYCA 3FHTA 1LBEA 4CCWA 2ZRJA 3EXHB 4YJHA 4ZVOA 4G0XA 4WKPA 1DJNA 2HJRA 1U94A 2EU8A 2AI2A 4S1WA 3AFMA 3IBCA 3VR4A 4LDZA 1NVFA 1YJBA 2EBWA 3CISA 3TSAA 3ZZNA 2YWCA 1LNSA 2NO4A 5DCYA 2Y27A 3B5JA 2VT3A 2ZE5A 5AK6A 1GRQA 5EZ5A 3SC2A 3UICA 4X65B 4JAVC 5LZ8A 1V8ZA 2BFAA 4HFJA 2D0OB 4A16A 2ZSEA 1E5XA 4L74A 1Q3HA 2WC1A 1ZMTA 1NPYA 2PZMA 1CJMA 3OJLA 4EG5A 3W5DA 3AV0B 2YZMA 1YXMA 3K2EA 1N3LA 5IXYA 1OWLA 4BX8A 1ODFA 4FYPA 3ENKA 3NTRA 4H6VA 4MRMA 2I4LA 4YMIA 1R9GA 4R1MA 3TZHA 2VYQA 5B6JA 2WSBA 3OBBA 5EXDA 4W1SA 1YASA 1OZHA 1NDQA 3NWPA 3BXEA 4LQCA 2BN4A 1J23A 1X7HA 4QYIA 4Y7DA 5G3ZA 4IFEA 1M6VA 1W5BA 1K5HA 1I2AA 2D1YA 4YRTA 4CEHA 1TU0A 2OV6A 3DOHA 1S2NA 3QEMB 3G8DA 5BN3B 1ZGHA 3LBYA 3JQFA 3CEAA 3JU3A 5DK6A 3FD8A 1N3YA 2A1TS 4G5OA 5AHXA 1IE3A 1WB5A 1IAQA 4QHYA 2DFKB 5LQSA 4I4TF 4TUYA 1VDMA 2DJIA 3IEPA 3WLSA 4MWEA 1E1QA 3OZVA 1MX5A 4RD3A 3RAPR 2ZVJA 1YDWA 2WB4A 1JEQB 2BMEA 3R5HA 4J0HA 3FCAA 1SPXA 3CKLA 1RAHA 3O4HA 4N54A 5TDHA 2PQMA 1NKVA 4BNWA 4KBGA 1QX3A 1F0YA 1W1WA 4IIJB 3MTIA 2O1XA 2CY0A 5DASA 3RVRA 1O94C 3WYAA 1PBTA 3T1TA 3WLQA 4WCDA 2HIMA 16PKA 2UUPA 1GYQA 4LX0A 4GRIA 4BJ1A 2RHMA 1UBTS 1HFEL 2ODBA 4F0JA 2PO7A 3J80A 1EM6A 2ZBGA 1Z08A 2PX5A 1UODA 1X94A 3IOMA 3VI4B 3O2NA 2UYHA 3DDWA 3KALA 4DR3B 1GAXA 1M54A 1MJGM 2XKAA 3C3AA 1YA6A 3FKSD 2MYNA 3UC5A 4ZT5A 3O2JA 3IULA 4YJ2B 5FYQA 5AVWA 5J2UA 4KDFA 3QVUA 4L85A 1VHJA 4AUKA 3PTLA 5J2TA 1CG6A 2ILVA 2ZREA 5F64A 1RCUA 2Q5FA 3C6BA 4P3XA 1DO8A 3HC7A 1DWOA 3D4LA 4U7TB 3LDUA 3ZUGA 5LLDA 3NX4A 3UPUA 1K7YA 4UHEA 4YROA 4RK5A 4OK6A 3HV0A 3WQRA 5BSWA 4JWTA 4RTSA 1H9CA 4B85A 2HXGA 2ACKA 13PKA 5KPJA 1TM3E 1NATA 2PX4A 3STHA 4W5RA 3NZEA 1NBHA 5JDCA 3FMOB 3G13A 3CEHA 1EBBA 1RYHA 4A0GA 5DI9A 3EC2A 2M6KA 4JQCA 4KXYA 1GU1A 2JHFA 4H7EA 1R10A 3ASYA 1SCKA 2F4VB 1DSSG 1H69A 2NZ2A 1AUPA 1W5SA 4Y6RA 3EISA 1EA5A 2I91A 4ZKEA 4P0TA 2C2XA 3IFSA 4Q6WA 4DZRA 3RFCA 4OJTA 4HF7A 1HDOA 2IPOA 2W48A 4F6LA 4HGPA 5JPIA 4M86A 3MF4A 2ZDGA 1ML4A 2P3OA 1O4VA 1KVRA 1QR6A 2LXNA 2QTLA 2XYGA 2X9GA 4LY3A 5FUWA 3JSXA 3OBIA 5AM5A 3O94A 3V34A 3WK8A 2W00A 5KNBA 4LK2A 3EZNA 2VHYA 3HWX1 1LBSA 1XALA 3IEUA 4M98A 1A69A 2O20A 3Q87B 2FEOA 2NGRA 3EZ2A 5HMLA 3QLTA 3WY9A 4CPDA 1YE8A 2EX1A 5LQAA 1GXSA 1DX4A 3H9CA 4RY2A 4DPLA 2H2WA 1C7ZA 4CM7A 2SCUB 3S27A 2C8LA 1YQTA 4L3VA 1CUUA 5FOVA 3VZPA 4QVKA 4ZOAA 2IYSA 3BE6A 4BX2A 4EHLA 1Q20A 1W25A 2R5WA 4JT2A 3CLUD 1NW3A 5BN5B 5BUZA 2GZ2A 3OEHD 1YK0A 2GR9A 3FZNA 2DTEA 4UJ3A 4Y1RB 4Z3DA 4Z1MD 2I87A 2HH9A 1VPTA 4HGZA 3KB1A 2BSXA 5AOAA 5B7PA 2KWIA 4G2TA 1WDLA 1Y5IA 1YZGA 5T3UA 1V5GA 5TB5A 3NNDA 3PZRA 4F11A 2MSEB 3DHEA 2QV0A 4WZAE 3KBBA 4B4KA 1L3CA 3EAFA 3HXPA 4GWKA 4I99A 4X24A 4GKVA 1T0JB 2HRRA 3OT1B 2ZK7A 3BJRA 1F2VA 5ALQA 3UATA 4G1MB 1ZJ6A 4O63O 3PNPA 4P31A 4FLMA 4TGLA 5CH5A 3OU2A 4V0ME 3TAXA 3RC8A 4DB4A 4KGZA 5AW9A 4CM9A 5JXWA 3KQVA 3PA6A 1HORA 7YASA 4R9VA 5B4UA 4NABA 3VZCA 4QTUB 2VT6A 1TC1A 5DGDA 2AW3A 5EOVA 5LDGA 1Z62A 5DHQA 3C7CB 4EX7A 4D3ZA 1K7CA 4OHWA 2PNFA 3DP7A 1Z6AA 1W52X 4MWZA 2VLBA 4YX9A 4CM4A 2HBYA 1OX4A 2GBFA 3GPIA 4XARA 1UBEA 2F3UA 3BEOA 3CE9A 3VAAA 2F8MA 3FDZB 2JIMA 3PLAE 1NE2A 2KB0A 3ED1A 1W76A 2HTEA 1Q1NA 1Q7GA 4GICA 4ZKDA 3U44A 1NBME 3EF0A 2IEZA 4ZVRA 5B1EA 3PC8A 1MO6A 3D6TB 2XCUA 2A7QA 2BY4A 3C4JA 1MRSA 3ZCPA 1A77A 1HDEA 3SEAA 4V1CB 5EHQA 2Q6VA 3GRUA 1OI7A 1C1DB 1T5SA 3K0EA 4TTVA 2BTQB 3KV3O 3L6RA 5FBHA 2BKAA 3ZXXA 5U4XA 1D0VA 3VSDA 3OKCA 1SULA 4LG1A 1HFWA 1TEXA 2DUMA 3G9ZA 4RCVA 2HF9A 1FTSA 3ESAA 5FL3A 1QIEA 1KJJA 3TJMA 3IP3A 4IIDA 3VTKA 4EG7A 3TUIC 3VM6A 1VIDA 2BUAA 5K3AA 2XCIA 3T94A 3W3ZB 1VSQA 5J4KA 2OORC 3NGXA 3ZGZA 1V47A 1YOVB 4DV2B 2FMFA 1BIFA 3L8MA 3TPFA 5G1PA 4S35A 4JEMA 5HQ3B 1GR1A 3K5PA 4WKCA 1BVHA 1GSIA 2FW6A 2OCKA 5ES4B 3CUKA 5F5LA 1V71A 1XMSA 1LQTA 5KYUB 1ZD9A 1LY1A 4NYJQ 3HB1A 1E1RA 4EBBA 1G6HA 4IIYA 5GJCA 2I4MA 1VLQA 1QP0A 3EPJA 1HT1E 5EKSA 2QYSA 4YTEA 3U61B 2J41A 2FFQA 3VH4A 2QTVA 3N0WA 1K2WA 2BGNA 2D2XA 1MQSA 2JIQA 4K9MA 4KW7A 4QEDA 1GTSA 3WNCA 3VR4H 1DDIA 1YMVA 3NHKA 4ZQGA 4DA9A 4PM4A 2HRCA 1Y8RA 2I7VA 4X41A 3H1FA 3JTMA 4HG2A 4ZGGA 2XYHA 4URXR 3A4TA 3IVMA 5ECYA 5KYTA 2FDRA 3DVLA 1YL5A 2AI1A 2HUNA 4MNTA 3R8CA 3L1IA 3TTXA 3ZHRA 4IYRA 5K3CA 2J1LA 4EAAA 3U7FB 2BFPA 4JQYA 3T3HA 3RASA 3NB0A 5JCXA 1IEQA 5EKUA 1VLJA 1QHHA 1XSEA 2RHCA 5KWIA 2ODEA 4R9UC 1YTLA 4HSEA 4M0DA 2CKMA 1VKJA 4XWOA 3IPCA 2QF7A 1ONSA 4R0MA 1IIBA 2HD4A 3H5AA 1IIRA 3TBHA 1KOGA 3FH0A 1ZRHA 3NPAA 1MP0A 1PN3A 4LHVA 4E88A 5IBRA 2D74A 2WF6A 3B9RA 3BD8A 1YR6A 2D2FA 1E1CB 4HGNA 1SD1A 3IIKA 3QUQA 1Z4LA 5EIBD 5FBQB 4AJKA 2DQYA 1QOQB 1RU3A 1CVLA 1H5NA 1S2IA 4MVCA 4C04A 2H51A 1CY0A 2W22A 3ONNA 2OK8A 2XODA 5TC4A 4EO9A 3O8RA 3GEIA 2RG1A 5JWOA 4HNAA 4F8YA 3E4DA 4U7PB 3WBKA 5KSPA 1NUAA 1NWHA 3QXGA 2PUWA 3GWZA 5AK3A 2FMHA 1JJFA 1NW9B 3KAPA 3NCHA 5G41A 2ZRNA 3UFBA 1Z6YA 4J4BA 4YV1A 5AUNB 5BOSA 3KQKA 3GFOA 4MCIA 5TPZD 4NCJA 3I5YA 4M6WA 4LFCB 2K87A 3OZAA 3VNUA 4OXKA 4YRAA 4JUFA 5MGNA 3H11A 1CLUA 1JQ3A 1DTEA 3NBXX 3LUAA 2D5IA 2O8EA 2EHJA 4EK9A 2R1VB 2QW0X 3Q0TA 4ALNA 1SHLA 4RNCA 2N75A 3R7NA 1Y0BA 4YAWA 3IIEA 1SO8A 3CX8A 1R7RA 4C5CA 3QMPA 1NT4A 2ZWVA 2YCBA 2E2WA 1NG9A 1NJ1A 3IXMA 3D5TA 1TZKA 1NF8A 2KE5A 3GFSA 4QBHA 1WF6A 5HM6A 1GZVA 1IK4A 2WI8A 4NCBA 5F35A 3I2HA 1T8RA 3PWZA 1SC4A 2VHEA 1NDHA 3IAAA 4FDVA 4NOLA 1GGNA 4P54A 4RMNA 1D1SA 4ZYZA 1MAVA 1XMOB 1GT6A 2O8DB 4OFXA 1NBAA 5GONB 3HDTA 4O5OA 4UZSA 1KDTA 3KJZA 2ZE7A 2AJ8A 2H00A 1N2HA 3MC1A 4E22A 2OHJA 5A04A 1GA4A 1XRNA 2GF9A 3UCXA 5ITZB 1JQBA 1SG0A 1YZFA 2VNIA 4IUDS 1DQSA 3T7IA 3VKUA 5DX8A 3NYQA 4XM2A 3ABQB 3ZWAA 2J45A 4RORA 1T5TA 5J40A 3O8CA 5EPEA 3P0IA 1DKQA 1WU8A 1SU6A 4M8NE 3IOCA 1NA5A 5A4JA 4UM7A 4C2TA 5JZBA 3ND6A 4BMVA 4I50A 4L76A 4FHFA 2ZUWA 1QFJA 4TMFA 4B0OA 1TEVA 3T1NA 4ZZ3A 5H82A 1RKUA 2OLEA 1P7ZA 3P2OA 2HJVA 2EW8A 2H0AA 2I78A 3PDUA 2B21A 5BYBA 3LZCA 2ZBQA 4HDCA 5D5HA 1EFPB 2VAXA 3P0JA 4JC0A 3F5QA 5LQJA 3GPCA 2EGHA 4YWJA 4URFA 1R0SA 4KQFA 4LWQA 3BK2A 1JLLB 4DM3A 2QENA 3WMRA 4R41A 1I3CA 3VRHA 2A30A 2CJYA 4IPTA 4X54A 4OFWA 4Z7QB 1FOEB 2X5KO 1XF9A 2I4OA 2Q3BA 2JIZD 1KAGA 2Z9BA 3OY7A 5AW1A 3MJ4A 3M4YA 2OMEA 5I7UA 4OX9B 1KDPA 5AHWA 4IF4A 1VYVA 2CK3A 4HN4B 1HKHA 3ER6A 1Z88A 2DTXA 2DUUA 3HXMA 5FWYA 2A9QA 4K1LA 3NRBA 1S0UA 2RAFA 2QN8A 2R96A 4HEA1 1G6OA 1MZVA 1Q95A 3H5LA 3I04A 3NAMA 4K3VA 4TQAA 3S6JA 2R1UA 4RQBA 3FMIA 2CSUA 3C98A 4FWIB 3ZWDA 4CVNA 1YE3A 4C76A 3CH7A 1FNSA 3L8YA 5L6MB 1JWAB 2FKAA 3WP0A 3C5VA 2KBFA 4EPTA 5FTJA 5BQPA 1TB4A 4QJIA 1JKIA 3DKIA 3OUUA 4QLBA 5ARBA 1WDKA 5JCOC 3DOIA 4EPWA 3PNQA 1F2DA 4H7DA 3THOA 4CKZA 3KPWA 4YAEA 1DJQA 2Z3VA 2H1FA 1EP9A 1POXA 2WHEA 4OHPA 1W47A 1JMYA 3WMGA 3G2IA 3A25A 3LIPA 5TEVA 2I34A 1KXJA 1WCIA 1D2EA 1WSDA 1P2DA 1L4LA 4P80A 1T8YA 2HJSA 4B4DA 4BVKA 3BJIC 2W4QA 1ZOOA 1OA0A 5EJGA 4BKMA 3H8SA 3KPJA 3FNFA 2WWRA 2PFKA 1I5EA 3AUSA 4AJ1A 4W1RA 3K2BA 2YIVX 3TTVA 1V35A 4DDKA 4DSOA 5JT1A 3C3DA 2ZI3A 3FUVA 3DL7A 1QGDA 4K81B 5ALFA 2H1CA 1DG3A 2NN3C 5BSVA 1N9KA 3GIWA 1IZ9A 2FRDC 3C5EA 4CCYA 1ACMA 2EZUA 2J4CA 3W8FA 2P77A 1I0IA 1E32A 1FXWA 2O6LA 3A32A 1V8FA 2B2CA 1YKSA 2VAPA 4GD3Q 5EP1A 1VB5A 1ZMBA 3MJSA 3BXOA 1KU0A 3VR6D 1ZUWA 4C7BA 2QX6A 3HK2A 1KVSA 3F8WA 3R6GA 4WNAA 4BQRA 4YXWD 4EGFA 1RP7A 4FLEA 4RFSB 5IKMA 5AW2A 5FH9A 3F1KA 4WCFB 2IHZA 4BO7A 3WLFA 3H5NA 2BM9A 2B9VA 3EPHA 1KEVA 1ZINA 3TLEA 1WMFA 4N7JA 2W42A 3GA0A 1LBQA 1PI3A 3EZXA 3GEMA 4HQ0A 4L0MA 5IKPA 3TL2A 1JDBB 4IXDA 4AQ7A 4EF6A 3EUWA 1DQNA 1ECCA 5BUSA 3IUNA 5BWMA 4RZXA 3EBOA 3EVDA 3D6NB 4FGSA 1YF3A 4ZP1A 3WB9A 4GFDA 3H1GA 2OPHA 3SX2A 1SMKA 1WDWB 2HX1A 1NMSA 5HUQA 3IO5A 1YJAA 4KTVE 4CDNA 5BMVB 3QKIA 5K8CA 1RZRA 4X95A 4C21A 3VJRA 2PXAA 4IGIA 4RABA 4DSAA 2PFSA 2QRVB 4MEAA 4BKPA 4YLYA 1XLTC 2QVGA 2ZRQA 1GNQA 5CAEA 3AR7A 1ADBA 1O6CA 2PT7A 1XROA 1JAXA 5DNWA 3UWDA 10MHA 4G1BA 2Y1OA 3G23A 3TPZA 5L8VA 5A6SB 4RD4A 2AR0A 2E89A 2I8AA 3A1SA 3K0SA 2FFHA 4QC2A 4HUTA 4YJ3F 3ZE0B 3MHTA 1U28C 1Z0FA 2F59A 2DY0A 2O8FB 4U3JA 5EGSA 1CRZA 5JCOA 3RVOA 4YMHA 2J32A 3HRHA 1XCJA 4U2EA 4PNEA 1U1GA 2J85A 4DWWA 4B6PA 2CXOA 4OGFA 3PVSA 3PTAA 1A1SA 2JIPA 3DPSA 3KP1A 3O93A 5FBKA 4AS3A 3DBHA 3LLVA 4YJFB 1TA4A 3MPUA 4XAQA 3QBTA 1RKBA 5B2ZA 5EZSA 4WOKA 1RMTA 4YONB 1JTFA 4A8HA 1KY3A 1QAQA 2D2VA 2F1RA 4I55F 4Y2UA 3ZV7A 2XNCA 1VL5A 1BOFA 3RANA 3X1ZA 1OYOA 4KZPA 4DV5B 5CPBA 1CUSA 3QPBA 3HJHA 3SJBA 3UGTA 1KP3A 3BDAA 3NAGA 4JOCA 5EIFA 2FRDA 1YUMA 4JK3A 4LXYA 2DXIA 2XB8A 1YK1A 5BSMA 5CA0F 4JVLA 4DJFC 4I6EA 1LF5A 1A7UA 3FFXA 1ZISA 1U7ZA 4GL4A 2C3PA 4O4LA 2WG1A 5E2IA 4EF5A 1ULAA 5F3RA 5TV2A 4GQIA 3KQTA 4CTJA 3GBSA 2IV2X 1BU5A 4I4TA 5FOSA 4BZPA 1VL6A 4BZZA 4CIYA 1OOEA 1WCV1 2ZIZA 1NW4A 2GCOA 3LNTA 4I81A 5CJJA 3WYDA 4DS3A 4MV1A 4INJA 5CIWA 4H0FA 4JP2A 2DG2A 3MTGA 4TRNA 3M70A 2X14A 2FFJA 3R4VA 4I9NA 4DPMA 1WL8A 1V3UA 1GYRA 3I72A 3SXUA 2BCJQ 2RHHA 3KR9A 3ZG6A 1VYTA 1LZKA 2ZJAA 4KRFA 1WHTB 3PFIA 4PYQA 3OTHA 1O8CA 3C8HA 2FR8A 4N5NA 5ESWA 1I80A 2EG9A 3GB9A 3PUZA 1JDNA 3K5WA 3Q5GA 4N76A 1GNSA 4H7KA 1ESMA 1EIZA 1WQ3A 3JZMA 3LC1O 2N42A 4MWDA 4NG5A 4Q7LA 1PFQA 1XQWA 1XP5A 1DEOA 2C2OA 3JD0A 2QP3A 4YLEA 1QTNA 4DYVA 2PWBA 5IXSA 2BSQA 5I7EA 1SGWA 1NRJB 4B6QA 1FTGA 2GPNA 4NNOA 1SBZA 2MWMA 2CV2A 2QRLA 4EG0A 5A3VA 4FE3A 4HWTA 1D2CA 1Q77A 2ATIA 3CYFA 3UJDA 1NUUA 4YRQA 3M1YA 4BVFA 4B6FA 5E3HA 5E1OA 5FTKA 1AGYA 1E2QA 1P2UA 1XLTA 5HIIA 3OD5A 1RPTA 4KQ6A 3GT3A 1KAHA 4G5SA 4W7SA 3REFA 2XXAA 3H5IA 5IZCC 3CWCA 1UMDB 2NSLA 3DQPA 2Y67A 3FPBA 3ORHA 4J2TA 2ZE8A 3OIYA 4LNHA 1Q7TA 3OQNA 1NASA 9MHTA 1MV5A 3VO1A 2WDZA 3L8DA 1LSUA 5IYZF 2KM1A 1NTRA 5FBRB 3OTQA 3KU1A 4MQ6A 4RJLA 1Q2XA 1TJ4A 4BE7B 2BFDB 5FPHA 1JHRA 2E49A 3CB4A 3F4KA 3D43A 4B46A 1TCBA 4E2YA 1NG1A 3BB3A 3ROFA 1YZTA 5DISB 5KMGA 5JPDA 1TUIA 3U7EB 1OAKA 4YRFA 4NCHA 4AJ9A 4F97A 2LCFA 1NUQA 1T4GA 1YTUA 4NWIA 3ZGLA 3DULA 3OZXA 1C9KA 4LJSA 3NDJA 2H54A 1CY4A 2J7PA 1GZ5A 1LU9A 2CZGA 4INPA 4UAJA 3GX1A 5TJHA 3IGFA 4ARSA 1I4OA 1NYLA 3VNRA 1G1MA 4YCAA 1Y9EA 4GPD1 4JLJA 5K6RA 5DU2A 4L78A 4X1IA 2HA7A 1HLDA 2QMYA 1LV7A 3EVBA 2WIBA 3L8HA 3T9AA 1VJRA 4B75A 5DKFA 1JX6A 2E82A 1QV9A 1KO5A 1JHAA 1QVVA 4FEEA 4YUZA 1T10A 5JY6A 3CX3A 4P84A 5AW3A 3EDOA 1VPEA 3C3JA 4RC9A 2E5LB 1Z4JA 3FTCA 2ORYA 4FZVA 3UMRA 7GPBA 5ICGA 2XUIA 3LD9A 4IDFA 4OXQA 1AMUA 3GWGA 1Z4IA 3FTEA 1XD2B 4F2PA 1HFJA 2C2BA 3DG9A 4JP5A 1C5KA 4IDNA 4KUGA 3VPCA 1PQUA 1A5BB 4D98A 5C18A 3TZCA 1Q2UA 1MA3A 2HU7A 1QFZA 3VYWA 3WTCA 2Q4BA 3MELA 3A2NA 2ORVA 1GHTA 3L0IB 2BOVA 3IQWA 4ZI3A 2XWQA 3SSMA 1VJ1A 5DSZA 4BQSA 3TQTA 3MXTA 4ZMSA 5HQJA 1RRFA 3UJNA 5MFPA 1YRAA 1RZVA 1QLHA 2BDUA 2Z2JA 3K1JA 3OZRA 4WNYA 3ZBPA 3KEFA 5DGCA 3A10A 2FDCA 3TL3A 4MR8B 1E0AA 2JJMA 1NNUA 4W6ZA 3BSFA 4LE1A 4YP7A 1WW3A 1CY8A 1Z2AA 1XLVA 4FDTA 2ZWOA 4BFZA 5EZYF 4ER6A 1ILWA 2NSDA 3MGAA 1T2DA 3B3JA 1B26A 1FRVA 1M33A 1L7VC 2UZAA 1IOWA 3AEQA 3MJFA 1K7XB 2ON6A 3WO0A 5JW6A 5HUHA 3M5DA 4C1BA 2DKFA 3N7TA 5A9SB 1PZHA 3H13A 1NSTA 5HXAA 1VL8A 3BF7A 3M1IA 2R8ZA 3AXSA 3PGLA 2QBYA 2Q4EA 3P9NA 1GY8A 3ILVA 3NCTA 3OUZA 4MAMA 2VCYA 4C0AC 3HUTA 3IC5A 1FYWA 3WL7A 5IT0A 3N8GA 2FWMX 2GBLC 4RHYA 3ST7A 3LI2A 4FFMA 3AFHA 3V55A 2IBSA 1K06A 1XEWY 2WBLC 1QPGA 1ORDA 3MUNA 4G0ZA 2QUHA 2YC4C 4HDNA 4HN2A 4HXEB 4ZQIA 2FZKA 3V7WA 4BMDA 1OX6A 3PPYA 2FPOA 2V0NA 2J0UB 4MW4A 5JXHA 2YNMD 2YWXA 3C8ZA 2OGUA 1IXZA 1PUXA 3EXG1 3IVCA 1G3UA 2OB1A 1ESNA 1KEKA 3OPXA 1B93A 4EKGA 5HR5A 4QODA 3OC0A 2Z5GA 4XQCA 1UOQA 3DZCA 3H99A 1DU4A 1WIWA 1WUHS 1C9EA 3F4LA 4EUFA 1DELA 1G8PA 1I30A 1IEWA 4OTZA 3L92A 5L7YA 4CLEA 3GG2A 3LRPA 3W7AA 1N1DA 3BG5A 5LVAA 3IO3A 3IH5A 2A3RA 4XSHA 3TQSA 4ZXPA 4K9SA 1II9A 2JEYA 1CF2O 4HJRA 1NVTA 1IG3A 3ZLUA 4D80A 4JQSA 3DHYA 4HX2A 2BMVA 2WF7A 3AMVA 4B6OA 5M29A 2A9VA 3U5ZB 4M1YA 1GPDG 2ANBA 3LVBA 4Q4JA 4W4TA 3LLMA 3H3JA 1NY5A 4FFBA 4JI0B 3EWIA 5EWMB 1Z28A 4JBLA 2FN9A 1LPMA 4Z51A 1A71A 3RW9A 3PK0A 3MWGA 1JE1A 3DE6X 5E95A 2B9EA 4BCCA 2B4TO 4Z7OB 2XGSA 2J3JA 1T9AA 3WRXC 5JV5A 3UAYA 1CF4A 2I0FA 4B48A 3KTAA 3EEBA 1LH0A 3B3QA 1QGUB 3KZ1E 4YRRA 3A9VA 2N1BA 3L8EA 3DH0A 3O4IA 1TT5A 2QTHA 3KCNA 3NIWA 4L95C 4ZYVA 4ZA2A 4DJDC 4I2NA 4L07A 4Q9JA 3OOWA 4IDPA 1VA5A 1BN6A 2AQHA 2E9SA 1D03A 1FFWA 3ETNA 3FYUC 4K8RB 4U5QA 5BRNA 2QMEA 3C43A 5DTEA 3VMFA 3QNWA 5M5BA 3GRKA 1K6MA 3QJGA 1A72A 2NU6A 5SZHB 1J1UA 3H17A 3N05A 4PLCA 1EUDB 4Q1AA 3LWBA 2H1SA 4UBOA 7ABPA 1T13A 2GM5A 4COKA 4BTLA 4TTTS 5I7WA 1L7PA 1XA3A 3U49A 2PUBA 2XUDA 2ZR8A 4GOND 3BERA 3DFMA 3I01M 2R8YA 4IDGA 3GUVA 4IBOA 1F3LA 2ONJA 2Y93A 1KP9A 2CLSA 1YVRA 3PGVA 1ZIXA 2XA2A 3LFUA 3MT0A 2IP1A 2XUGA 4IJVA 4J76A 1Q0LA 1QYVA 2GBLA 1N7JA 2Q46A 2WJZB 4R8KA 3R9KA 3TAUA 1P19A 3EVAA 1CUIA 1GPBA 2W6NA 4UNPA 2UXCB 4AYXA 4GEKA 3WRVA 4ZHQF 4F3YA 2VP5A 4LKOA 4ILEA 4WZBA 3ASUA 5WRFA 1QYXA 2AB0A 2YFQA 4QX6A 5JYDA 2CNWA 4RZSA 3SBXA 1QO7A 4C6TA 5B3JA 1SBQA 3GZ4A 2D8MA 3Q8WA 2NP6A 5EUCA 1H93A 1ZCZA 4OGWA 3FWPA 1E8MA 4HPJB 2H9AA 3CWZA 1PT9A 4BPRA 4XUDA 5GJVC 2MSNA 4PR3A 1SN7A 1TZMA 2JRLA 2JJ1A 3LY5A 4QOFA 5IXJA 6ADHA 3QX3A 1RQLA 1TQ2A 3WC4A 4BO2A 3I5XA 3T3PB 2BEVA 5KTKA 2QI9F 1Q91A 4P4SB 1HE8B 4B4WA 2WAAA 1QQ6A 1SXPA 3P96A 1LDGA 1NBWB 2JZCA 1O2DA 4ZCSA 3ITNA 1T6YA 3RNOA 5C2JB 5JQGF 3QHQA 5HWSA 2IF0A 1U7UA 1KEUA 1VL0A 4M9ZA 2YWBA 4B2IA 3NOVA 2ZRPA 4IDBA 2BGRA 3OLYA 4TTPA 5EE1A 4D9MA 5EXXA 5D2CA 3UWKA 5HKAA 4LIPD 3ZDQA 4UASA 2HK6A 4QOEA 4PSCA 4U1RA 3ZTWA 1J5EB 1MB4A 3T4XA 5T64A 1LQ2A 1TPZA 3LC2O 3ZE9A 3T7KA 4MV0A 4AZ3A 3VHXA 2W2XA 2P4SA 4XQEA 1E4OA 3CNLA 4RTRA 1M2HA 4RTMA 3WRXA 2ZOSA 4JEIA 1WB9A 4CL8A 1H85A 2VUSA 3HEBA 2H5LA 4PO8A 1E62A 4QQRA 2CJWB 4W7IA 3FE2A 1ZK2A 4Z86A 1GZDA 3DP9A 4CZ2A 3FETA 1W4RA 3EPRA 4MVJE 5J4HA 2I2BA 2PQ2A 3NGMA 3NIGB 3NNNA 4IVPA 5BMOA 1I2ZA 4EFLA 1UOEA 4RKEA 3B1ZA 2CFIA 4AK9A 1TM1E 1FDVA 1R16A 2I4TA 3AYXB 4NATA 5FFFA 1JL3A 4ZAZA 2RHJA 5D00A 3NHWA 4J9UE 3EFBA 4MJ7A 2V7VA 2GYWA 1LBHA 1QGED 2Q5OA 5CT5A 1ZHOA 1N92A 1QK5A 3FVRA 3JQ6A 4HH0A 1YIAA 3EH2A 4R8VA 2CDAA 3Q12A 3CH4B 4MZDA 5J3JA 3QIAA 1GT91 1KRHA 1SCJA 5EXEA 5TMEA 4S2UA 1DADA 5LL6P 2FSPA 3G9XA 5JZ9A 4DVGA 4MUKA 1K8YB 4MKFA 5AW6A 3C6YA 4MP8A 4I46A 1AO0A 4OQEA 5I7SA 2C3YA 3ANSA 4F2HA 4MEJA 2H8GA 4AWBA 1T8SA 2FHSA 3ZXYA 5H5JA 5FOUA 5HM8A 2C1XA 3PE3A 1NYRA 3V8RA 2HMWA 4WY8A 2ZCJA 5GAJA 3PJRA 2YHUA 1TQDA 2VNHA 2YASA 2WSSA 4UBIA 5DH9A 3WXBA 1FTWA 3B3GA 2BKUA 3B2QA 3UA3A 1LPOA 1RLUA 3FF4A 1Z17A 4HWRA 3DC2A 4DIEA 3BH0A 2HM7A 1KK3A 4BV2A 3L06A 3QA3E 1NUSA 2HTFA 3DE4X 3L0ZA 1MLDA 1T9ZA 1YSCA 5DXFA 5DHSA 4BPBA 1NJGA 3RS4A 1E9DA 2C29D 3H97A 3JTEA 4QEZA 1U3UA 2CE7A 2V6JA 3AERB 1RVV1 1SK8A 4MQEB 2REXB 5FO0A 4YMGA 4P7FA 3E7FA 3UHPA 3V9PA 1M66A 4B71A 4EYQA 5K4HA 5CIYA 1G59A 3GQBB 1TK3A 2ZU0C 2JCXA 2IX9A 4Q4HA 5ILQA 3QI7A 4WSOA 3VO8A 1UM8A 1WSBA 3H8WA 3R7WB 4HNHA 1AK9A 1XMXA 1PZGA 2XI4A 4G5GA 1SHZA 1YBFA 2RHGB 2WVAA 4G0OA 4C29A 4PAOA 2P4UA 1FRQA 3BUSA 1EVZA 4PSVA 4XYBA 4CL2A 3KUCA 1IONA 1I10A 1I0LA 3SAJA 3JWEA 4RE5A 5TPWB 2GT1A 3BH6A 1GFWA 3HJBA 4MV3A 2H52A 4XGNA 5KWJA 1OU4A 3JZIA 1J0CA 3NHLA 4M0CA 5LKAA 1O6GA 1E7QA 4G5FA 3P9PA 4YQYA 3WWPA 1QP7A 1NI5A 1WLSA 1SOVA 3LQ4A 1CDOA 3G6WA 4X8MA 2W6MA 4O3FA 2P2SA 5KTYA 2C88A 1MUUA 2QUIA 3L7JA 2OCIA 2VPXA 3JQEA 4HUQB 4DV6B 4A27A 4CKXA 3K9GA 2IBMA 1YE5A 3UK0A 2AGVA 5JEEA 2AIRA 1W581 4HFMA 2QRMA 4YJ3A 5B7QA 2PWZA 1GUBA 5FIUA 3C14C 3E84A 2OHGA 4XJSA 3D9QX 1B8UA 1AA6A 4GM4A 1RXWA 2H57A 2XHZA 1QO0A 1RYZA 3KB2A 4JYMA 1FVHA 4YACA 1BGVA 3DDHA 4OP1A 4LUCA 3SIPA 3JWIA 1BS1A 2YUTA 3PNVA 3GEGA 4IIGA 4M4SA 1NUTA 1MENA 4A92A 2FWNA 3GDHA 1JALA 2VAVA 3LZDA 4MI1A 1E3SA 1HX7A 4PPFA 4BEBA 1Q0UA 1EWKA 5C81A 1W5AA 1P7WA 1H94A 2MU1A 2YQ4A 4K7JA 5LC1A 3UA4A 3HCOA 5FNVA 2EXXA 2EFEB 4KFTA 2N1MA 1JB1A 1M34E 2WW8A 3R3XA 4MPJA 4EB3A 4CV3A 3SX0A 1I4LD 5CA0A 3OLQA 3E0QA 2YFYA 1LTQA 3VYSB 3ZHUA 4M8SA 4QWWA 5L3SA 5AD1A 2ZJ3A 4KZKA 2X9VA 3MVEA 2FPIA 1Z6QA 4YRJA 5KOHB 3OAAD 4ZC1A 3WGYA 1RJEA 1HL3A 1KC1A 4RKQA 5CDUA 4F9FA 3TZEA 1ADYA 2NM0A 4YV2A 1BQEA 1UJ5A 5LNK1 1IHYA 3G7NA 3MWEB 1LUAA 2A9FA 2ZIEA 4QJ5A 1H2BA 1G5PA 2CLOB 3ONFA 1BAPA 4TSRA 5CLQA 3RSGA 3ZS9A 1GCOA 3SLGA 5K3EA 2ZSDA 3E0XA 2WZCA 1L1RA 4PHFA 1WOMA 2VF2A 2Z98A 2KHZA 3IL2A 3PF9A 1U0NA 2H4JA 2X0RA 3O1HB 3B20A 3K1YA 3ANNA 1TAUA 1ZI9A 3S4YA 1NQXA 3D3JA 3BFKA 3WJ7A 3A9UA 1K3TA 1NQOA 4JOSA 3PR3A 1D3AA 1KFKB 1D09A 5CYOA 3TMKA 4A36A 3FGOA 1N2SA 5BYAA 1GCUA 2Q27A 4FXPA 4W6QA 4S0XA 1DKOA 5LP6C 1KH3A 2X1MA 2L0XA 3HKBA 2CSXA 4CL0A 1U0TA 2QPOA 1YDMA 1RT9A 3NP7A 4RU1A 2V7PA 5TF4A 4OXNA 4JJGA 3HM2A 3MOSA 5KQPA 3N6VA 2VDNB 1N2XA 3EY9A 4YJ2F 3DR5A 3IDFA 1V0JA 3BGVA 2WFLA 2ZIXB 4WESA 4C89A 1BCRB 1BD3A 1WXIA 1VIMA 1PAUA 2A5GA 2Q3CA 3OEED 3E70C 1QAOA 1ZVQA 4Q3NA 5F4ZA 3VYTB 4QPZA 3BD7A 2VG8A 4ZV9A 1SH7A 1L5SA 3KKMA 3QEAZ 3MWFA 4Z5XA 2P9QA 4MYDA 4CV2A 1HEYA 2YJ6A 2GWHA 1NBEA 3HCDA 2YIDA 1GNVA 3EUFA 5EEHA 3A1CA 4TV9A 1IPFA 3GEPA 2V1UA 1J06A 1MBZA 5HPYB 4N41A 2OKGA 4F3NA 4MJLA 4Q7JB 1JBQA 2M2IA 1JIJA 1BXZA 3HYNA 1M1UA 4I1IA 1O57A 2XPCA 4JR0A 3WNQA 4DLVA 5HUJA 1WUJS 3R3UA 1E4EA 1SCAA 1W36C 4CLRB 1PR6A 3EGEA 1T6BY 4A1OA 3JW8A 3C0KA 3P19A 3VTZA 5CEEA 3TLGA 1QP4A 3F0TA 4JHLA 1UC4B 2O50A 4IOLA 4LDRA 5EJ7A 4JEHA 3N74A 1L5ZA 4AIRA 1WABA 1LDNA 2E4XA 3LL4A 1B2RA 3DEJA 2HRBA 2ZT7A 1HETA 3HDJA 1X13A 3EXEA 2FGJA 2VRBA 4KITB 3MWDA 5CXSA 3ZW8A 1EFRD 2VDMB 5F1KA 1QH9A 4AWAA 2J0QA 3ETEA 5DW3A 3V1MA 1C1XA 1SK9A 2QKYA 3O73A 3QA9A 3W5VA 4OJNA 5DLPA 3BK1A 4L7QA 3HKEB 4MYHA 1F17A 3TD2A 1ZUNB 2FUG6 3E9MA 2Z5FA 1P5FA 4HX5A 4Q3DA 4D6YA 1B00A 2IHJA 4BNYA 2YW2A 2Z2ZA 4XWKA 5IYZA 1M6EX 4JBNA 4YRSA 1CEXA 1JBKA 1GPYA 1SBNE 1T1IA 2NU9A 2YHBA 4NU8X 2AUMA 4QJ3A 4UBNA 3ZDEA 4G0MA 3RYCA 1GILA 4LOIA 1V41E 1FDOA 1AQYA 2OGWA 3F6SA 3IUEA 3KT0A 2B5WA 5F78A 4AKSA 5COAA 4UHHA 2IOHA 4EI2A 4EKNB 2UVPA 4KSYA 1C1HA 1JDZA 1MC4A 3HA7A 3RRBA 1CR2A 2YXLA 3GAZA 1U0GA 3P9XA 1LCIA 1XFAA 3OKAA 1MG5A 2VRCA 3WV5A 1L5LA 4R3UC 1IQRA 1JNYA 4PS1A 3IV7A 3JCZA 1IXSB 3R5TA 3B6IA 3GD5A 4HVTA 1TQHA 3B1JA 4PO1A 3ZI4A 1BKYA 3L1VA 3FZEA 2NO1A 5LP6A 3M9WA 4YQEA 1JDTA 3HN2A 4XYEA 4AZWA 3GH3A 5EZYA 4IIEA 4NJMA 2Z9DA 1H8EA 2GYVA 2P91A 2WJYA 2FEWB 3ZCTA 3OWOA 1LDEA 4F12A 1RAGA 4DDMA 3T6KA 3BA1A 1XEWX 5B2FA 4R2HA 2C82A 5ELLA 4R7ZA 1E6EA 1DOAA 3N2YA 1LFDB 3P0HA 3C8DA 4FX2A 1B1CA 1SVMA 4ZEOA 4GX0A 3ZEAA 2ONCA 4AP6A 4LF4B 1VG0B 1DEHA 3T95A 3ODPA 2HCFA 3WLPA 4D4KA 3UYLA 1Z06A 1VHLA 2TMKA 3OJFA 4ASUD 4W5OA 3NHFA 1PT8A 3OE1A 4M0LA 2VSYA 1KEEB 2IXBA 3MEQA 1X1EA 3TJRA 2V5AA 2QNBA 3SZGA 5D3QA 5IF9A 1HRKA 4XVUA 3PSHA 1ACJA 1CULC 1XLUA 3UK2A 2QUJA 2PUDA 4MGHA 1A8PA 2XUOA 3ZWMA 2QL5A 4MKZA 4PCVA 4X8HA 4U9UA 4M38A 1Y98A 3OM0A 3L9WA 4CQJA 3LHIA 2XWJI 1KKLA 4MV4A 4CE6A 3LYUA 4HJXA 2WB2A 2JZOA 4DARA 2CL0X 5LYJB 4R6WA 1E2EA 1B73A 2BFFA 5F5NA 4LBWA 1AF4A 1NT2A 4Y9DA 3WZLA 3KQHA 3R6WA 4IKEA 3PRJA 4FGLA 5I9LA 1R4NA 5HQTA 2QLMA 1V43A 1LVGA 3EZ9A 4UZFA 2V45A 5GADl 2FRVA 2YJ4A 3EVGA 2GVDC 4DEVA 3A1FA 3CJQA 2LCQA 3SQMA 3KEOA 4X6UA 4V0RA 5DE3A 1ZMRA 3BCSA 3GP8A 3M1AA 1JDSA 1IBMB 3T5DA 1XRPA 2G1JA 3BQ9A 5J58A 4KR2A 3VC2A 5K3FB 4FDUA 4PYMA 3TW0A 1C0LA 1CE8B 3JQ8B 4AB1A 3K6SB 3S0JA 5B30A 1U7XA 1UH5A 5C7LO 3BTOA 4MDEA 2Y1CA 3ZW7A 4W9MC 4RSMA 4N0QA 5LWQA 1E2IA 1Y48E 2W6ID 4NX2A 5CPFA 5IK2A 2VEDA 5SZJA 2HYDA 4J7CA 1FFEA 5DI3A 3W6OA 3WFIA 1JR2A 1YS7A 5KHLB 4IMRA 1NXXA 1GZHB 4DW8A 1J22A 1ZJ4A 2Q1WA 1OZGA 3GDOA 1E92A 1Y33E 4WNIA 2ZIWB 3LUBA 4D3YA 4DXAA 3IDOA 4N5HX 1AIPA 5EHIA 4E14A 3PUVA 4B87A 2WSLA 1UXHA 2B7CA 2W0MA 5FPSA 1XMPA 1TC2A 4TLBA 3BRWA 5TEWA 5HKBA 4UU8A 1F6WA 1Y1SA 4G24A 3OCXA 2O14A 3ACBA 1SUBA 3T99A 2NXNA 2C20A 4J1SA 2X19A 4R5HA 3U81A 1Y9ZA 4EUEA 2FPWA 2P69A 4OHXA 2GSWA 2YICA 1U2TA 4Y2SA 3DUFA 4JLUA 1JG2A 3ROZA 5H8WA 3A3OA 1CS0A 5H68A 4C4SA 4B3TB 4JLWA 5FPYA 3FPJA 4GU5A 3RS7A 3TOCA 1UPTA 3I92A 1OWPA 3E15A 5C4IA 1N1EA 1E3EA 4ZMBA 2OCBA 5KWSA 1VKRA 1SBIA 1I1NA 1OC4A 1CFZA 1TFRA 1U4OA 4ZVTA 4RWZA 1MOSA 1C0EA 2BELA 3CW8X 4KE6A 4HVAA 4YDSA 4M54A 4E32A 1V1MA 2EWVA 1PGJA 4Q7EA 1XNRB 3GCDA 2VZEA 3W5JA 4YMLA 2YBEA 4BEJA 3UBMA 3FWKA 3Q11A 2WILA 1MJNA 1ZOLA 2J3IA 1RHMA 2ZT6A 4INZA 3H7IA 4JEUA 5JDIC 4DIMA 1N1MA 4XFKA 1N5OX 2FMIA 3BJMA 1CFJA 3ZLVA 1PSZA 1CU1A 2ZBPA 4MA4A 2ZJ5A 3HUFA 2ZBFA 4D4LA 3NJ8A 3M4JA 3P32A 5SYAA 1T0BA 1V1RB 3U39A 1RD4A 2ZWMA 1OHHD 1XKLA 5CCDA 2BEWA 4CUKA 4EA8A 2CZQA 2F17A 3CZQA 4ZAXA 1RYBA 2CDNA 3C1TA 5I9IA 4QO8A 4TKVA 2H9IA 3GJZA 2ZQZA 1N25A 3U7GA 1DPFA 1E69A 2Y6UA 4JC5A 3NHMA 1BS2A 2OUKA