3QVOA

Structure of a rossmann-fold nad(p)-binding family protein from shigella flexneri.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
213
structure length
197
Chain Sequence
HMKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTNSQIIMGDVLNHAALKQAMQGQDIVYANLTGEDLDIQANSVIAAMKACDVKRLIFVLSLGIGEPLKPFRRAADAIEASGLEYTILRPAWLTDEDIIDYELTSRNEPFKGTIVSRKSVAALITDIIDKPEKHIGENIGINQPGTDGDKPFFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NmrA family protein
publication title Structure of a Rossmann-fold NAD(P)-binding family protein from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a
molecule tags Structural genomics, unknown function
total genus 58
structure length 197
sequence length 213
ec nomenclature
pdb deposition date 2011-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvoA00
5JAQA 1XEAA 1NVGA 4IINA 4ILKA 3DDNA 1K6XA 3TPCA 3HDQA 3EVNA 4HXYA 3U5TA 2BFAA 1AHIA 3UH1A 4CM3A 1B0AA 3KLMX 4IBOA 3ON5A 5CPBA 5B37A 3COSA 3OH8A 4DLBA 2PH5A 1B3BA 3FPLA 2NADA 4NIMA 1B16A 1XQ6A 2D4AA 4YT8A 4A7PA 3G79A 4N5NA 1WMAA 1ZKMA 1CJCA 1GZ3A 5EQDA 5L4NA 3FCOA 3OMLA 4FR5A 4I9HA 2VT3A 2B69A 4WECA 1B26A 1IZ0A 2X7HA 2J3HA 2QHXA 1EVZA 2OP1A 3O03A 1RYEA 4KDFA 3CPSA 4E6PA 4GLOA 1BWSA 5JCJA 3RC7A 4YT2A 3H5RA 2DBQA 1GY8A 5KJ6A 1EEHA 4AJ4A 4BS9A 1PJLA 2NVUA 4JP2A 1GQYA 5A04A 1YO6A 5J23A 3LVFO 2W4QA 4BGEA 2BGMA 2C2XA 3MOGA 4HWKA 2IZ1A 2Z5LA 1P31A 4MVJE 3AUUA 2CDAA 2EWMA 3KRTA 4TKLA 4K28A 2O3SA 3H9UA 1P1JA 4GX1A 4R51A 9LDTA 2PA3A 4J1NA 1JWAB 3DZBA 2D5CA 4YEDA 1HDCA 3KHUA 1PX0A 2E49A 3FN4A 1IB6A 5KOIA 3DAPA 4I5GA 1HDXA 3PIDA 3R0IA 3BMOB 4RDHA 4DQUA 3M1AA 5G2OA 4E30A 1OC4A 1IYZA 4YJHB 4A10A 3FR7A 4D44A 1CEQA 3N7UA 2NWQA 2O50A 2NU7A 5CEJA 3BMQB 3RWBA 4FFOA 5K6AC 1KVTA 3F1LA 1MG5A 4PZEA 4J3FA 3GZ4A 4YRDA 1DIBA 1Z82A 3ASUA 3ZNNA 4F46A 2DBVO 3AW9A 3UW3A 3KSDO 1I5RA 1T2DA 4DIBA 2VHXA 2DPHA 3MTJA 3PI7A 4MPDA 3ZWCA 3V2HA 4HKTA 4WE3A 4FDAA 3U49A 3A9WA 4PN3A 1E3WA 4GI2A 3EUWA 4CLHA 1NVTA 3AFNA 4RLSA 4LSWA 4RVFA 1YB4A 3VAZA 1QLJA 1XU7A 4TMFA 3D64A 2HMVA 1ZK1A 2YW9A 1U5CA 2P4HX 5IN5A 4XRRA 2AEMA 4J4TA 4BO4A 1OAAA 4LCJA 3TFQA 2FPPA 3I83A 4FJ2A 4OXYA 4AL4A 1ZZEA 4L4RA 1ZO8A 3IKVA 2PH3A 1WDLA 1ZSNA 1Y8QB 3HDHA 3LLSA 1JLLA 4E2YA 2HRBA 4XB1A 4BMVA 2ILTA 3H4VA 1E6UA 1PJQA 3C24A 4QTZA 2AHRA 4KTTE 1XA0A 4TROA 3M2PA 3BMCA 4O63O 2CVOA 4UVDA 1NTOA 1W0CA 4FFLA 2ZJ1A 1E77A 3L4SO 2OGUA 3HFGA 3KM0A 3RU7A 3WR5A 1Y8RB 1H5QA 2PZLA 3G49A 1B7GO 1GEGA 4ALKA 2JCYA 1ENYA 4X54A 1V8BA 3EMKA 5B4UA 1OOEA 5G0TA 4CV3A 3P2OA 1R6DA 2BELA 3QWIA 3DOJA 1U4SA 3H5NA 3V1TC 4RVGA 4ALIA 4O6VA 2P5UA 1D4FA 4RVUA 3U0BA 5I9NA 2PKRA 3CMMA 1VM6A 4XJTA 2W2LA 3KTDA 2YZ7A 1F06A 3HQ4O 2GZ2A 4WLVA 3D4NA 4Y6SA 1UXGA 2Q1SA 5CPFA 4L0QA 4O0LA 1P33A 1QG6A 5BQFA 5FEUA 4YTEA 2NLOA 4FPXA 4JN6B 2X6TA 1E7YA 1RM5A 3IAHA 4NG5A 4YR9A 7ADHA 4DPMA 1JTVA 1D1TA 1GV1A 4HFJA 2BFPA 2D2IA 3N58A 2BD0A 2QRLA 1XR3A 3I6IA 3JQ9A 1LLDA 3FBTA 3U9LA 1DJQA 3DZJA 4CUJA 3KO8A 1ENOA 4U6SA 3MJSA 3Q3CA 3QWFA 1W8DA 4D41A 4XQ9A 4KZPA 1B8UA 3VDRA 2ZTMA 3C1TA 3MWDB 4G81A 1PU2A 3PHIA 4ROSA 5GZ1A 5TNXA 1QRRA 2X9NA 3NGLA 3TNLA 1M75A 2GYYA 4B4WA 1FF9A 1KY4A 1SB9A 3TWOA 4P4GA 3GNSA 1O0SA 4YAIA 3BTVA 2CY0A 3WB9A 4YT4A 1EUZA 1QMGA 1T2CA 2ZB3A 1HYHA 3BZUA 3GMDA 4CV1A 2HK7A 1LRJA 2WJPA 3GFBA 1ADFA 4BB5A 4PLPA 4YVFA 1LU9A 4CV0A 1B8PA 2PLAA 2RAFA 3ZWMA 2JL1A 4BVAA 4KWHA 2HMUA 1PZFA 2RH4A 2VYVA 2NU8A 1LDGA 2WEKA 5AXDA 1KC3A 2GDZA 2Y68A 3UUWA 4ZJUA 4RPLA 1XLTA 1DIGA 4AJOA 2R2GA 1ONPA 1G1AA 4J9UE 2C0CA 1I3KA 4DXHA 4LRSB 1BXGA 2EJVA 1YDWA 4NQZA 1XDWA 3ZNPA 3SJ7A 1TEHA 1JVSA 1IHYA 4NJOA 3ASVA 4IZHA 4J7XA 1E3IA 4Y6RA 3MJEA 3ENKA 3PGXA 3MEQA 3JTMA 5F1OA 3WS7A 1H94A 1PR9A 3F4LA 2YJZA 4WCFB 5F1PA 3I23A 3LT4A 2HMWA 1NNUA 3DOOA 3I9OA 3QVXA 4MVJH 4GPD1 4N7RA 4BL5A 3GDGA 2E4AA 3JQ7B 1HYEA 5TLSA 1DC5A 4NJMB 5I7EA 3VPHA 1F17A 4YPOA 4ZHSA 4KTVE 2DUUA 3AUAA 4ZQHA 1D1SA 4J1TA 4MIYA 1P1RA 1Y1PA 2Z1MA 3GT0A 4Z9FA 3VVBA 3ONDA 2EEZA 2FWMX 3CMCO 3ZHXA 3D1LA 3ONEA 3TOXA 3L4BC 2YQ5A 4IDAA 5DP2A 4IY1A 4PG8A 1M6HA 4YAKA 2AE2A 2J3IA 4TWRA 3ZU5A 2NSDA 1KEPA 4RQUA 5CDUA 5C3MA 5AVOA 3IUSA 4NBWA 2C5AA 2I3GA 4YWJA 4DPKA 3HHPA 4P8RA 2EIHA 4PG5A 4XQCA 4KUEA 4HFNA 3FHLA 3PYXA 1E5LA 3AY6A 1E7SA 5IXSA 2FN7A 4W9NC 4EW6A 2O3TA 2JCVA 1X7HA 1PTJA 4GLLA 2Y67A 3WFIA 1R4NB 3NJ4A 4DPLA 2WSBA 4YJFA 4R3NA 3QWAA 1FDSA 1I30A 2JFGA 5TT1A 4L8VA 4E5KA 4A0SA 9LDBA 3JYLA 5BSHA 1ZFNA 1NHWA 4E12A 4BKUA 4DYVA 3JV7A 4WLOA 3KXDA 3PWZA 4PLVA 4CM9D 1UP6A 4RORA 4IXTA 4IJKA 2C54A 3GUYA 5H83A 1HE4A 3JD4A 3O4RA 1DRWA 3O9ZA 3ZWYA 1FJHA 4CMGA 4EI2A 1P74A 4J7CA 4NK5A 5JS6A 4UUMA 3OA0A 4YJHA 4CLEA 1FMCA 3L6DA 3LSYA 3MJ4A 1HXHA 1H6BA 3PK0A 4Q3AA 4NFYA 5CEEA 3SEFA 1Y5RA 1MXFA 2VUSA 3ANMA 3SXPA 1HTBA 1A4UA 1QP8A 1EDZA 1H93A 2OL4A 3GVHA 4BMSA 4I08A 2EGHA 3C3XA 3IP3A 3TQHA 3WFJA 2DT5A 3U09A 5JMWA 2X9GA 3OFSA 1P1HA 1P9LA 3HFSA 5T8KC 1PZEA 5DBGA 1ISIA 2HLPA 3UHAA 4IS2A 4J16A 5EINA 4HNGA 1BGVA 5EESA 2YHUA 3HWRA 3GRKA 3RJ9A 1CQIA 2X22A 5DBFA 1NWHA 2R6JA 5ILGA 4II3A 3WICA 3IIEA 4JP3A 3DOCA 3FTNA 4OGWA 4PG7A 5TQVA 2QQ5A 3GHYA 4IM7A 1TT5B 1KC1A 4I1IA 4CM8B 1J6UA 4BV8A 4D0RA 2OUIA 1XYGA 4ZICA 3G17A 4J4BA 5JC8A 1ULSA 2JCXA 2RH8A 3CZRA 3JYOA 2BFOA 2XXJA 3IJRA 3LT1A 3NTQA 1MA0A 3BMNB 3DHEA 4JXKA 2PNFA 1X7DA 3BHJA 3PDUA 2RHCA 1T2AA 3TF5A 3JYPA 1C1XB 3FBGA 4DIOA 5EPOA 1HSZA 2X5OA 3BHMA 2Y0CA 4YJGA 3KVOA 5I8WA 1MFZA 5T5QA 1ZNQO 1L7DA 1VRWA 3D4OA 4CLOA 4WLNA 3AOEC 4Y67A 4EEZA 1Y9EA 3UXYA 4D45A 5GY7A 2DM6A 3E1KA 1YB5A 4S1VA 3WGHA 4A5OA 3AWDA 3GR6A 3JCZA 3KV3O 1EVJA 5HRUA 4AJLA 5C7OO 2E37A 2YV1A 3BTSA 3KETA 2PFGA 1XIVA 1XHLA 3VPFA 1R15A 1Q0LA 3AJRA 5DF1A 4U7WA 1Y8RA 4XEHA 3K5PA 1MP0A 2X0RA 1LXCA 1ARZA 2OO5A 3D0OA 2VUUA 4O59O 2OBNA 3F5SA 1VKOA 4MIEA 1EVYA 1HWYA 4UVEA 3D3WA 4Z0PA 2X8LA 1F0YA 2H6EA 3PYMA 3O38A 1IPFA 1N1EA 3FNEA 4J2OA 4PRLA 4IDBA 4DQXA 4RQTA 1M6WA 3ICCA 2ZKLA 4CL3A 3IDSA 4MJLA 2VT2A 3VTFA 4DTIA 5JCJD 3A06A 4GX2A 4YAJA 4GWKA 2ZTLA 1U5AA 1NQ5A 1PL6A 3GOHA 5EIOA 3ZWNA 3JQBC 3HB5X 4OHUA 5G4KB 3JQ8A 1ZBQA 1NQOA 4INAA 4CPDA 5BSEA 3ZWPA 5ICSA 3I6QA 1PJ2A 3QVWA 1V3UA 2Y66A 3I9JA 4RPGA 4CMEA 3WNQA 3ZZNA 3UCEA 1UXJA 3EAGA 4DQVA 3ONFA 1SO8A 1LLCA 1UXKA 3WSVA 2JFHA 4PCVA 3JQFC 2PD3A 4XIYA 3PLNA 3NT4A 3D5TA 1ADBA 4BNUA 1LRKA 2VZ8A 5KJCA 4B8ZA 1LDNA 1OZAA 2VWGA 3G1TA 3V2UA 3P5SA 4D3FA 1R16A 3H5AA 5JY6A 2HQ1A 1N9GB 3VTZA 1VJ1A 5IF3A 1EBUA 3WG9A 2ZJ0A 5EL0A 1U4OA 5JAMA 1IOLA 3TZHA 2Q4EA 3GNQA 4R3WA 3C7DB 3SC6A 2DLDA 2Q99A 2QX7A 2HDHA 4GSKA 1FK8A 1R12A 4J0EA 4ND4A 3HSKA 5AXBA 4BOYA 2Y1EA 3FTPA 1I3LA 4GWGA 4NMHA 1BRMA 3AU9A 2PZJA 1CRWG 3I5MA 4XGNA 4E2ZA 3GVXA 3GFGA 1TA4A 1AN9A 1VPDA 5A9SB 5H82A 3L9WA 4YT5A 4NR0A 4XYLA 3HJAA 4B4UA 3OQ1A 1MB4A 2FZEA 4RCVA 3M6IA 1K0UA 1MFPA 4TSKA 3VZQA 2O4UX 2ZB4A 2G76A 3PVZA 4NBUA 3ZV4A 1HDRA 4ALMA 2W2KB 2Z1NA 1GL3A 2C5EA 3H9JA 3MWEB 1J4AA 2W90A 4ND2A 3EDMA 2A94A 2GUGA 2C2YA 2NV6A 5U1PA 2FR0A 1ISMA 2D8AA 3GDOA 4U8GA 1GPDG 1O5IA 2IZ0A 3L77A 3S2FA 4E2WA 3JQ7A 2I6TA 1PZGA 3FSRA 3WGYA 1QKIA 3PXXA 4DGSA 4D46A 5JE8A 4B7XA 1FDWA 2BF7A 5JDCC 4NJMA 2OMEA 4S3MA 2JJYA 3KB6A 2GGSA 1UZNA 4AJPA 3KEQA 4GL4A 5A06A 1X14A 4OM8A 4MKRA 3I9LA 4OJNA 1VKNA 3AY7A 3RKUA 4AJ2A 5KTKA 1P3DA 4L76A 1HE3A 4XGIA 2H5LA 2I99A 5TT0A 3DFZA 4MP6A 3WJAA 1EZ4A 4KOAA 3NJ8A 3RU9A 3RD5A 1I2CA 4MO2A 5CHEA 4M8SA 5TRTA 3RC9A 1IHXA 4K9DA 2D3TA 3PJFA 2O7QA 2DTEA 4B3IA 1MG0A 4BNMA 1QYCA 3HN7A 3GAFA 2VNSA 1JWBB 1NX6A 3WX0A 1V9LA 4ND5A 4Z9XA 2B4QA 5AQ1A 4ZVVA 3INGA 2B4TO 1R4NA 2EG9A 3GF4A 2Y93A 1P1KA 2GRAA 1T4DA 2W2LD 3RROA 3AY3A 4RZHA 4KMSA 2JFFA 3QVSA 2ZK7A 4I8XA 5IDYA 1GQ2A 1JVBA 3ZWOA 5CDTA 1H6CA 4B3JA 1P44A 1GYQA 3JD1A 4LCEA 4OKIA 4RF2A 2E6UX 4BO6A 1ISHA 4OOFA 5C7IO 3K9QO 2YFHA 4Z3KA 3ZDFA 1WVGA 4L9RA 3PZBA 4UVIA 4YJDA 1PIWA 1LDBA 3GHHA 4FFNA 3G3EA 4JBIA 3AUTA 3IP1A 1MUUA 1ONNA 3M1LA 5BNIA 1LJ8A 4BNFA 2Y1DA 2WMDA 3E82A 4BIIA 4CLDA 1XELA 3VHRA 1N7GA 5HS6A 5T64A 4CQMB 1O6ZA 2GZ3A 1JKIA 3OEYA 2RCYA 1KIFA 3UCXA 1M76A 3ETEA 1CWUA 1KEVA 2OXIA 1DO8A 1NAHA 2QYSA 4FC6A 3ADOA 4PLHA 4HV4A 2FRDA 3VKUA 1VJ0A 1BDMA 3DFUA 3OIDA 1BVRA 4WK6A 3LQFA 3K96A 5B12A 1YONA 4E5PA 3DR3A 1ZW1A 4FFPA 1L7EA 3MZ0A 1ZCJA 1R4MB 3JYNA 2CFCA 1K3TA 3B1FA 4CM1A 5B1YA 4YXFA 1DOHA 4CUKA 1ORRA 2YY7A 2CMDA 1DIAA 1LLQA 2VYVD 4B4OA 1C0KA 3M2TA 3RUEA 3PPIA 1EE9A 3B1JA 3EZYA 1T24A 2X0IA 4NNJA 5LCXA 3QY9A 4RVDA 1C1XA 4K6CA 2G1UA 5ENVA 4ITUA 4CMJA 1P0FA 2VUTA 2AQHA 3SLKA 4E5NA 5C5IA 5JNLA 2DPGA 3C85A 4J49A 4BV9A 1B2LA 4NFSA 4ZRMA 4TQGA 2AE1A 3IOYA 4N5LA 4WNCA 4D42A 3D7LA 1L1FA 1U28A 1QYDA 3IMFA 4ZA2A 1VLLA 3U4CA 2NQTA 1ISJA 2E82A 3C7CB 3SBOA 4M49A 5DOZA 1EUCA 1O89A 4F6CA 1GUYA 3H7AA 1PWZA 5JO9A 2IXAA 2BGKA 1NBOA 4W6ZA 4MVJF 3OP4A 5DP1A 1JDJA 2D59A 5TJHA 1NHGA 5IZ4A 4PZCA 4MP8A 4PG4A 4WCDA 1NXQA 5JDIA 5KNLA 1GAEO 3DBHB 3FR8A 2WD8A 2AQKA 1YKFA 1QYVA 3RKRA 2R00A 4E21A 4O5OA 4XX0A 1XU9A 3EZLA 4XYGA 3PTZA 4G2NA 4DIFA 1RWBA 2UVDA 1RPNA 2IYOA 3WNVA 3B20A 1V0JA 4RVHA 1D8AA 4B7UA 1F12A 3EGOA 1BTOA 5JO0A 4IS3A 4LN1A 5CAEA 2C07A 2AQ8A 1DRVA 3ZWWA 2CDBA 1H2HA 1B14A 3WWYA 3UFXA 3RFTA 1YE3A 1J0XO 4XZ3A 2ZIZA 3DMTA 3F47A 1LSUA 4QFCA 5DOVA 1CERA 3EYWA 3OA2A 4KQXA 3OICA 3H3FA 3QHAA 1O95A 1VC2A 1YXMA 2OP0A 7MDHA 1PJSA 5COQA 5F3RA 4BKQA 1UDAA 3MCVA 1H2BA 4JROA 2IDZA 1HYGA 5FFFA 5C7LO 1PJ4A 1UDCA 2VHVA 1HDYA 2B35A 1PL7A 2FY8A 3KSZO 2I65A 4BO8A 4II2A 5EERA 1NAIA 1QLHA 1YQDA 1VL8A 5AXAA 4EITA 3RBXA 2DU8A 2OZPA 3NDIA 1LRLA 1GCUA 3DZIA 4ZQBA 3UN1A 3QP9A 3ZWBA 4M54A 4LRTB 3TL3A 1N9GA 1XKQA 1X0VA 3PJGA 4FN4A 4YACA 1E7MA 4UEOA 3GC6A 3IC5A 3OECA 4R01A 3V2GA 3KUXA 3RFVA 1HE2A 5A1TA 1C0PA 3ANLA 4TVBA 4ZN6A 5I7SA 1E7QA 4N5MA 4YA6A 1AUPA 5HWSA 5IZCA 1I36A 4IMRA 4FFRA 1H6AA 4P38A 3FNGA 2Q2VA 3QVTA 4GAEA 3QWBA 1SC6A 2CUKA 4IQ8A 4HP8A 3ZWVA 1A7AA 4D3SA 3RVDA 1LDYA 3HZZA 3PLRA 1EBFA 1Z7EA 3ETGA 2FR1A 1ZEMA 1Z73A 2NVWA 3H9QA 1C0IA 3P7MA 3PHLA 4UUPA 1EVIA 5MGBA 5FI5A 3LLVA 1U2DA 2WYUA 3JQ9C 5THKA 3AUSA 4PLFA 2W2KA 3WYCA 1DHTA 3R6DA 1V3VA 4LISA 1T1SA 1Y9AA 4WKGA 3W4JA 4BNGA 4W4TA 4JX8A 1ZMOA 4A73A 3WQRA 1XSEA 2OBYA 4DYDA 4J2HA 4WLUA 1E5QA 4BNXA 5IDQA 4BO3A 2F00A 2PR2A 4DMLA 3K2BA 1DFIA 5TF4A 2X1HA 1N2SA 4GX0A 5JPIA 4CMIA 2YYYA 4KQWA 4ALNA 1PGPA 3LU1A 3VVCA 3RUIA 4Y9DA 2X0JA 4LSMA 3KYDB 1A71A 5DZSA 4DRYA 1X13A 3AI3A 3ZHYA 4ZGWA 1GR0A 3UF0A 4MDHA 1W6UA 5HA5A 3AFMA 3WLFA 2PGLA 3ROMA 2IZZA 2G0TA 3PQFA 3H3JA 4JBHA 1BW9A 1ZIDA 1WAMA 4LMPA 2BFMA 4JNKA 1HLDA 1R0SA 1YH3A 4R1SA 1ZK0A 5A3VA 3DHNA 4RF4A 1DLIA 2NM0A 2I67A 4ZQFA 3NGXA 1CETA 2Q1UA 3N74A 4R5HA 1PWXA 4YDRA 1WZEA 1LSJA 5F21A 3ST7A 4NI5A 3JQGB 5I8ZA 2GNAA 4M87A 2VN8A 4D79A 1YOVB 1NQTA 3DTTA 3DZKA 3E9MA 2VWHA 3U62A 4BKRA 1HEUA 1JAXA 2ZTUA 5IFLA 5L3ZA 1YJQA 1ENZA 4CLRB 4MVJA 3GK3A 2EKLA 1TB4A 3TJRA 2RHRA 3VZSA 4CR8A 5C37A 3F5QA 3E9QA 3JQAB 2JAHA 3TZ6A 1LSSA 1ONOA 4CMHA 4J43A 4W99A 2WD7B 1BMDA 4CQMA 2Y05A 1PQWA 4L74A 4U5QA 4IMPA 4A26A 3WGTA 2HSDA 1MX3A 4YB8A 4GX5A 3ZGYA 5ADHA 1GD1O 1NQAO 3RBVA 5K9ZA 2V6BA 1PGOA 3AU8A 2CF5A 3KYCB 2RBEA 1A4IA 3BTOA 5CDYA 1FDVA 2FPIA 1E1LA 2XAAA 3VH1A 1R4MA 5L4LA 3QE3A 4BO7A 4AJNA 1GFSA 4B3HA 4FD3A 1J49A 4XWYA 1WDMA 4IDEA 4E33A 1CIVA 3K73O 5BNTA 4WEQA 3PJEA 3HG7A 4FJ1A 4YCAA 4ND1A 1XCBA 1E1MA 3ZV6A 1OFGA 4AJIA 1EK5A 2CDCA 1PJ3A 3X2EA 4NBRA 4A03A 1NP3A 1Z75A 1HRDA 1F14A 3BAZA 4R68A 4UVGA 4EJ6A 1GCOA 1NPYA 4JGBA 3GZNB 1E1NA 3DQPA 3PP8A 4IIVA 1AHHA 3X2FA 1NPDA 4HFMA 1KVSA 1ADGA 5ICMA 2Y0DA 5ITWA 2XPCA 4EUFA 5JSFA 4LW8A 4RPJA 1VL0A 4ND3A 4BUCA 4PLYA 4ZD6A 4D3DA 2HK9A 2O2SA 2Z95A 3HN2A 4AJHA 4B79A 3TZKA 4WPGA 5F1KA 2NACA 3MJVA 3E5MA 2C7VA 2I3AA 1CYDA 5L7WA 4AJKA 3TDKA 1C1DB 2VOJA 4IGFA 4YBZA 2NU6A 1SAYA 1SOVA 4A2CA 8ADHA 3DAFA 3DBHA 1OC2A 1A27A 2CVZA 4RF3A 4XJSA 1GZ6A 1RKXA 1EFLA 3MTGA 3A28A 3SJUA 3KZVA 4J0FA 3BMOA 4QT0A 2HAEA 2J5KA 4I5FA 1Z74A 2P91A 4JLWA 3GN2A 1N8KA 1KETA 1X7GA 5COAA 4U6QA 1LX6A 3ADPA 2WYWA 4L4SA 4DWVA 3DZGA 4RV9A 5CDSA 3PRJA 3BMQA 3E9NA 5I9MA 4AG3A 4NDNE 2XF8A 2GLXA 1H9AA 2A35A 1IL0A 5CEFA 3U4DA 4W7IA 3PWSA 2DTXA 4IUYA 3ZWXA 3IQDB 3WJ7A 1E6EA 3WQQA 1I2ZA 3VH2A 3GGGA 4M89A 2POQX 1A9YA 1CF2O 5DCWA 4XGKA 1P1FA 5K0ZA 1DFHA 4WNIA 5EMHA 4RJTA 2EF1A 3QVOA 3FRJA 2AA3A 3QLJA 5I9LA 1LC0A 3HDJA 3T4EA 1Y6JA 1W73A 5ENDA 2J5RA 4PRKA 1SCUA 4IJWA 4CQLB 2EKQA 3Q6IA 3EY4A 4MIOA 4DBVO 2O3QA 4LMRA 4XDYA 3WGGA 3WGZA 3C8MA 4OXNA 1UDBA 4QSMA 5LC1A 5LDHA 1PL8A 5A05A 4OQYA 3W4KA 4BO5A 1TT7A 5B4TA 1Y8QA 1E6WA 3A1NA 4I5DA 1KS9A 4FGWA 2EP5A 4GGOA 3INTA 3VDQA 4NU5A 1LBEA 4FOSA 2GERA 1H0KA 2DC1A 4L73A 1UP4A 1NASA 3V1YA 3WWZA 1WMBA 2Y1GA 3ZW8A 2C82A 4BNLA 4FS3A 4CMBA 2O3JA 1JKJA 3D4PA 4RDIA 1DLJA 2P4QA 4JJIA 5T6BA 4DMMA 2Y99A 1DIHA 3ETDA 2VZ0A 1E3LA 2G17A 3MJTA 4CMEC 4R5MA 2C59A 5DNAA 3L6EA 2NVUB 2IEBA 4J6FA 4J1SA 3GVPA 3QA9A 1GADO 2ZATA 5KKCA 4CM7A 4BGUA 1PQPA 1PS9A 4D0SA 3ZV5A 2DQ4A 3Q9UA 1XGKA 4RL6A 1ADCA 1QSGA 5AOVA 2O48X 3OSUA 2Y0EA 1H6DA 5FYDA 5BSFA 3Q1LA 5JW6A 3OBBA 4UUOA 5DBIA 1NFQA 1Q7CA 3SLGA 5BNFA 4QECA 1AXEA 1BVUA 5TS3A 3VZRA 2AEJA 1Z7BA 3K2EA 2P5YA 2PD4A 3OETA 2QG4A 4NPCA 1U2GA 1KVRA 3ICPA 3PIIA 1MGOA 1WPQA 4Z6KA 4HFRA 1U3WA 1PGQA 1A72A 2JKVA 2EJWA 1LNQA 1HETA 3K92A 2YHIB 5B4VA 3QSGA 4H7PA 3T4XA 2RIRA 3ORFA 2FR8A 3DTYA 3H9EO 4LK3A 2J5QA 1BG6A 2DVMA 3DXFA 3RUFA 2GN8A 4R69A 3TN7A 1E3WB 4R9RA 3PEFA 1JAYA 4M86A 5DCUA 3VOSA 1P45A 1X1TA 3DHYA 3DWFA 5L45A 2QRKA 3JQGA 5DDIP 1YOVA 2VRCA 1PEDA 3ABIA 3GH3A 2QIOA 4TRNA 5EJ2A 3RBZA 3EVTA 4GKBA 2B0JA 4MVJG 1VSUA 4BNWA 3W8DA 3I52A 1AXGA 1YS4A 4GSLA 1BDBA 2IXBA 4RPHA 1YQXA 1ZUD1 2NTVA 3JQAA 1E7WA 5IDXA 1DAOA 4XB2A 2FP4A 1KVUA 2FZWA 3L07A 2Y1CA 2Q2WA 4YQYA 3DBRB 3GVIA 3A14A 3HUDA 3O26A 2WD7A 2E48A 3DBVO 1KVQA 4DL9A 3RCBA 5JMPA 2GF2A 4Q3NA 1JW9B 3MJCA 3WGOA 3PJDA 4GVLA 1ZXBA 4WCFA 2JD0A 2YV3A 3OJOA 4CL8A 1IZ9A 4WOKA 2PWZA 1TLTA 5F5NA 4QFDA 1ENPA 4Q9NA 2ZYDA 2NTJA 2ZQYA 3UOGA 3E6AA 1CDOA 5A9RA 4NFHA 1UJMA 1M2WA 3QRWA 5GZ6A 5HM8A 1E92A 2ZB7A 4BO2A 2GN9A 3OIGA 4RO0A 4XCVA 2W98A 5HBRA 2VWQA 3OJLA 4AJJA 4DC1A 5T57A 2BMAA 4ZQEA 2CF6A 4PG6A 1WXDA 1DPGA 4IXWA 1P1IA 1Y81A 1UP7A 1YGYA 1S6YA 5TGDA 3HNPA 1EE2A 1DJNA 2A9FA 5BSGA 1Z45A 2DBRA 4R1TA 2F1KA 4AFNA 2FSVA 3JQ6A 4E5YA 2PGJA 3I1JA 3GAZA 3GZNA 2CZCA 1GTMA 1YWGO 1E3EA 1HDZA 2FHSA 2C20A 3E18A 2WYVA 1JKFA 3P19A 1U8FO 3I4CA 4OSPA 4AJ1A 1G0NA 1ZMTA 2OOSA 4A27A 2D1YA 2X58A 2YDXA 4NU6A 3ZI0A 3NX4A 3UGKA 3RUAA 4D7AA 2IEDA 1ISGA 2H1SA 1C1DA 4GGPA 5L7TA 3AOGA 2O4CA 2X9VA 3HB4X 2X5JO 1SMKA 1ULUA 3B70A 2ZCUA 5IN4A 4PLCA 3E5RA 3PWKA 4MVJI 1CQJA 2A92A 2V7PA 2ZYGA 3K8ZA 4JJFA 1O94A 2P68A 1PGJA 1GUZA 2BHLA 2PZMA 3NRCA 4PIVA 3WTCA 3ZU4A 4BNVA 4YYZA 3QWHA 4DBZA 1O8CA 3FI9A 4IJUA 3UVEA 4CM6A 5EQFA 1Y7TA 2GR9A 4XKJA 1GQQA 4DA9A 4R1UA 4OO3A 4O1MA 5TX7A 4WUVA 5DN9A 3HDYA 4GMFA 2EW2A 3WXBA 1V3TA 3BYZA 2VOEA 4XYBA 3JD3A 2PY6A 4CODB 2UAGA 2Q46A 2Q3EA 4Y98A 4QUKA 4HUJA 2VWPA 3OJFA 3LT2A 2JD1A 1TT5A 2HMTA 3WBFA 1E7RA 3F1KA 4CM8A 5JXWA 1NFFA 1T2FA 1ZXLA 2EW8A 2PKQO 1KBZA 4YRAA 1G0OA 1HZZA 4CQLA 3DBLB 1HDOA 3BMNA 3ZNOA 4MVJD 5KVVA 2GN6A 1RM3A 3PQEA 1WW8A 5JDIC 4I5EA 4ID9A 3E48A 2XOXA 2R00C 4UEJA 3RFXA 1K89A 2G82A 3WYBA 1YQGA 3FF4A 4BNJA 4CQMD 2GO1A 3CH6A 6LDHA 2LDXA 3HADA 1K2WA 4FJ0A 3AM3A 4NHEA 4FBGA 3W8FA 3WSWA 4YAGA 4TKMA 1U1IA 3B6ZA 2B4RO 2QYTA 3IL2A 1ZH8A 3G0OA 4KUGA 1YBVA 1A7KA 3QQPA 1GUFA 2TMGA 2DUWA 3DMTC 3ZCXA 1ZJZA 2NUAA 5LDGA 4DREA 3O8QB 4J4HA 3R3SA 4EJMA 5DT9A 3V1UA 1SB8A 1LC3A 4XA8A 3LF2A 4TRJA 5A5FA 4HNHA 3T7CA 4OKNA 2GZ1A 3UAGA 1BSVA 1VE9A 1J5PA 4C7KA 3Q2KA 2GN4A 3L9XA 4C7JA 4YJFB 2VTEA 1ID1A 3ITDA 2QZZA 3JD0A 4FGSA 2ET6A 2OORA 4EGFA 1T26A 3C7AA 4K1LA 3OJ0A 3ULKA 4WLFA 4MVJM 3D3EA 5HTOA 4CMKA 4H15A 2VRBA 2UDPA 4Q3BA 3IJPA 5G4KA 1DFGA 1DRUA 1ZEJA 4ONEA 4UAGA 1QXSA 4PLTA 3ZU2A 3KOUA 4OL9A 3KEOA 2A4KA 3EHEA 4QX6A 4TZKA 4BQPA 1WZIA 4EUHA 3R1IA 3BHIA 5A02A 5KJEA 1HLPA 4CM4B 4W82A 5L53A 1YB1A 4ZQGA 5IZCC 4C4OA 1Q7GA 2TMDA 1UXIA 4JJGA 3NEPX 1NPTO 1KY5A 1RJWA 4GH5A 2HMSA 3A4VA 3OEWA 4H16A 4OAQA 3W6UA 2NVBA 4BQRA 2YHIA 5F5LA 3I9NA 3NT2A 2V6MA 3FWNA 4BNHA 4CV2A 1N5DA 1IY8A 1OI7A 4LGVA 5KKAA 2YDYA 2VYNA 2DKNA 3JQEA 3ZU3A 5FWNA 5H81A 3V5NA 5ITVA 4HX5A 1BXZA 1ZK4A 2Q2QA 2VHWA 3QIVA 5L7YA 5A5EA 3F6YA 3MOIA 2EKPA 4GVXA 4BGIA 4RGBA 1UR5A 4YAEA 4F6LA 3CUKA 4PLWA 5K6AA 1PJBA 4FIZA 3K6JA 3JYQA 1BHSA 1TVEA 4MP3A 1U3VA 4XR4A 3CXRA 1ZVMA 1R0KA 5G4LA 2IODA 4DVJA 4YJGB 1GDHA 5A9SA 3DONA 2EV9A 4YQZA 1SOWA 1YL5A 3JD2A 4WASA 3DBRA 4CLOB 3AM5A 2I66A 4Q39A 4RF5A 4JBGA 3F9IA 1RM4A 3EK2A 3EW7A 3AI2A 4JCOA 1Q2XA 3ENNA 4P4NA 3FPCA 1C0LA 4JIGA 5DCYA 2FPGA 3AM4A 3WBBA 4KDEA 5JAZA 1DC6A 3BA1A 2GASA 4CJXA 4P22A 3PHHA 1JN0A 4WOJA 4ZRNA 3ZNQA 2B5VA 1U8XX 5JC1A 4IDGA 3TOZA 4IQGA 2OFPA 1YVEI 1I24A 1U3UA 1N92A 2J6IA 1P77A 1WNTA 2UYYA 4UVHA 4Q3EA 1IPEA 4IQ0A 5I7VA 4F3YA 1Z6ZA 5A03A 1JA9A 1FDUA 1HZJA 3D3WB 3INRA 1E3JA 2H63A 4XQEA 2NNLD 2WE8A 4L4XA 2WTBA 4OIMA 3S2EA 1YDEA 4AJEA 2FMUA 3RJ5A 1KYQA 8LDHA 3KSUA 5ER9A 5TC4A 3F4BA 3LDHA 2O2YA 3TZQA 2AQIA 3DB2A 1GYRA 3LT0A 1Q1NA 3JQ8B 4R16A 1P0CA 3P2YA 5G0VA 1G6KA 3ZN2A 4W7HA 1I33A 1JQBA 3UCFA 2B83A 1MC4A 4LVCA 1I2BA 4CMCA 3CSDA 4DLLA 1KEWA 2H9IA 1Q0HA 4Q3DA 4B4VA 2HO5A 1NWCA 4M1QA 4MKXA 4IZIA 3NKLA 1SEVA 4IDCA 3PQDA 3PZRA 3GLQA 4BKOA 2O23A 1WLYA 2ZB8A 4WEOA 4E5MA 3JQCA 4E4YA 4QO8A 1E0DA 1ZK3A 2J3KA 2VNAA 3H8VA 3QJ5A 1OMOA 5COBA 1KERA 1I10A 3LC1O 1NYTA 2I9PA 2Q1WA 4FQ8A 1GV0A 3NUGA 2FOIA 3GDFA 3GG9A 3ROPA 3WMWA 1X15A 3TSCA 3PYLA 3W1VA 1QV7A 1LUAA 3RI3A 1HE5A 4M55A 3H6KA 1D3AA 4PZDA 3B1KA 5L9AA 4MVJP 1SNYA 1YRLA 2DAPA 4P4LA 3LC2O 5JBIA 2PTGA 1UH5A 3DO5A 1ML3A 2BH9A 4PVDA 2QRJA 4E32A 1VSVA 2HJSA 3GEMA 4IIUA 4CR7A 4BNKA 1ZK2A 1SZJG 2VRCD 4GMGA 4R54A 3DBLA 4J90A 1GZ4A 3DZFA 1QV6A 1K6JA 1DB3A 2PGDA 1AE1A 3GG2A 1R66A 4H3VA 4J9VA 2PKQP 4R41A 1EQUA 1S7CA 3GA0A 2VHYA 3WDSA 3JQAD 3ZHZA 4NBVA 1SBYA 4ESOA 3ITKA 2SCUA 1C14A 3F46A 2JHFA 3STHA 4R9SA 4G65A 4FCCA 1TI7A 3TFOA 1NR7A 3Q0EA 4R4JA 3BXXA 4HBGA 4QXMA 4DLAA 1B3RA 1I3MA 1V35A 1GPJA 4PLGA 5ES3A 1HT0A 5G0SA 4B7CA 1HDGO 1LSOA 5L51A 3UICA 2GCGA 2AEFA 3NDRA 3I4FA 1GEEA 3RUDA 2OHXA 2YFQA 4R1NA 1RM0A 3O8QA 3H65A 2GD1O 1B15A 2IYPA 5ER6A 4QO7A 4OOEA 1ZSVA 5IG2A 3Q9NA 5JFOA 4Z9YA 4FSHA 4RZIA 4XDZA 2CSUA 5BR7A 3GGPA 4ALJA 4OQZA 2WDZA 2VHZA 3GGOA 3WIDA 1KEUA 1GYPA 4N18A 4B8WA 2DFDA 1UAGA 3L4BA 3D5QA 2VCYA 3R3JA 4J91A 2HJRA 3K31A 1T25A 4IGEA 1JU9A 1ZJYA 1X0XA 1YL7A 4NH4A 4NK4A 1EDOA 2C7GA 4OMUA 4BB6A 2EXXA 3RAJA 3VH3A 2PZKA 4U0KA 1EMDA 4BHTA 2YV2A 3OIFA 3PDJA 4DUPA 4IDFA 4XD2A 4NBTA 1EK6A 1U7HA 4HY3A 2X23A 4W9NA 5IJZA 4CM4A 3FNHA 1Y5MA 4QEDA 3RASA 4OH1A 3DMYA 1Q7BA 3AK4A 4RVSA 4D43A 5T67A 1PR3A 5I7FA 3W6ZA 4YRBA 1SPXA 2B36A 5KWEA 1YBMA 1QYXA 2DBZA 2YQ4A 1IUKA 4FFMA 1YBAA 4CUZA 2O3RA 3DL2A 4JQCA 3IUPA 1N1GA 2HU2A 4BO9A 2D0IA 3RC2A 2B5WA 1PQUA 3ROQA 1I01A 2Q49A 4JK3A 3WTBA 4URFA 3L6OO 3SVTA 1FXSA 3OJEA 4QQRA 2AG5A 3S55A 5KJ1A 1KOLA 3K30A 4BMNA 1M67A 1SEPA 3GN1A 4TRRA 1WWKA 2DFVA 2VQ3A 4XYMA 1F8GA 3NYWA 3W8EA 4BNYA 4EEXA 4CLXA 3AI1A 5L4SA 4Y8VA 2XXBA 4N54A 3FNFA 2G5CA 3NT5A 1NFRA 1YJ8A 1LDMA 4EZBA 4EUEA 2Q50A 2AMFA 2FSSA 5JYDA 4KWIA 5T8KA 5CFZA 3GEDA 5KJFA 2ZCVA 4XR9A 5JCXA 1A9ZA 1VJTA 1MV8A 2Q1TA 2PD6A 4BO0A 1WDKA 3GPIA 1DHRA 4PGFA 3WQSB 2ZTVA 1DBVO 1NVMB 4PFJA 3LK7A 3CE6A 3DC2A 1Q0QA 1K5HA 5JLAA 3S2GA 4CM5A 1MLDA 2QZ9A 3LF1A 4I9NA 4XYEA 1RYDA 2PV7A 2WM3A 3ZWAA 5CG1A 2LDBA 3F3SA 3RSHA 2I5PO 3G1UA 3JSAA 1LLUA 2B37A 4RPKA 4GKVA 3UKOA 2CD9A 5U4QA 4LVUA 3RQSA 4WJZA 1PJCA 3PFFA 3FWZA 4U0JA 3GVCA 3WGQA 5TIIA 3GMSA 3AOEA 4KP7A 3NV9A 1U7TA 3NTOA 3RC1A 3WIEA 1LQTA 4BNNA 3S2IA 3KYDA 3I3OA 3DEYX 3EC7A 4FOOA 4TVOA 1QR6A 2V65A 3BTUA 3C1OA 4IPTA 4E31A 4HADA 5TJ9A 4OYRA 3SX2A 6ADHA 2Q45A 1PS8A 3LC7O 3U4IA 4MKZA 5FI3A 5G0UA 1LQUA 2P9CA 4DC0A 4F45A 4PLZA 5KVCA 3TZCA 4K6FA 4G5HA 3T7EA 5CP8A 3I9KA 4Z0HO 5THQA 1DSSG 1ISFA 5A9TA 4TRMA 4J7UA 4TZTA 3VH4A 3W4IA 3NAQA 2ZQZA 5G0WA 1C3VA 4Y6PA 3WYEA 2NU9A 3TL2A 5DULA 2JD2A 2HRZA 2Y1OA 5GMOA 1EQ2A 5KIAA 1LA2A 4EDFA 1LDEA 4KUHA 3NTRA 2C29D 1IE3A 4PVCA 2Y1FA 4WCFC 3E03A 3OQ6A 5ILOA 4I9UA 1M66A 1DC4A 3QW2A 2IRWA 1HKUA 2GSDA 3LYLA 4CLRA 3CZMA 5GZ3A 2HK8A 2UUOA 1R37A 2X0NA 3V8BA 1I3NA 2EERA 2HCTA 1LI4A 3ROKA 3JQDA 1E3SA 1VI2A 2EGGA 3JQBA 3PHJA 1DXYA 3U4HA 3OHSX 1U3TA 2O3UA 3KLPX 2CVQA 3KBOA 5JAIA 1VL6A 4EYEA 5HS4A 2YUTA 4XRGA 2AW5A 3GRPA 2ZYAA 1BXKA 4UREA 5AYVA 4BKPA 4Z0TA 4BNIA 1LTHR 3VPXA 3L0DA 5AXCA 4OSOA 2Q4BA 3BMCB 3JQFA 3NDJA 3Q2IA 3CTMA 1X1EA 2JHGA 3PFWO 3ZW9A 4CMAA 1I8TA 2VYND 3QV1A 3TRIA 1UUFA 2NTNA 2GPTA 2UUPA 2X5KO 2P9EA 3S8MA 3CINA 1PSDA 3S1LA 3VC7A 3IS3A 4FW8A 3ANNA 3GY0A 3KYCA 3VPSA 3DAGA 3SC4A 2J3JA 4IDDA 2CNBA 1UXHA 1T4BA 4XIJA 3DZHA 1PZHA 1F8FA 1PS0A 2DTDA 1EUDA 1NR1A 1U9JA 3C1AA 1XQ1A 3CIFA 1T2EA 4Q3CA 4CR6A 4E2XA 5L95A 1I32A 1EFKA 2EP7A 3VPGA 1DIRA 3WOHA 5U9CA 2HUNA 2WWRA 3LZ6A 3IKTA 1T1RA 5A3JA 3WMXA 3H2SA 2D5AA 2BGLA 1PGNA 3ZHBA 4BNTA 5L40A 1I0ZA 2V6FA 1UAYA 1O9BA 1H9BA 2JAPA 3CKYA 4CMIB 4CM9A 2J8ZA 3RUHA 1N7HA 1R0LA 3FD8A 4OXKA 1MXHA 1IULA 3RIHA 3ZH2A 1OBFO 3RUCA 1HSOA 1NM5A 1ZSYA 4EJ0A 1V6AA 1WP4A 5CDGA 3WGIA 5EN4A 3OF2A 1HL3A 1MC5A 2I76A 3GEGA 3H2ZA 1D7OA 4UUNA 4FC7A 5KVSA 3H9GA 4RLHA 1A5ZA 1UZMA 5JY1A 4BO1A 3ZV3A 5IAAA 5TSDA 4UEKA 1BW9B 2QW8A 1W4ZA 1XG5A 2BLLA 2WE7A 4GQAA 4K26A 4FB5A 4WGGA 4ZU3A 1YL6A 5JDCA 5KCZA 2V6GA 4E3ZA 4MOWA 5KVQA 5IDWA 1QORA 3U3XA 4AVYA 3HE3A 1DC3A 1DDOA 2HKIA 2BKAA 5CG2A 2PK3A 4XQGA 4MINA 1K6IA 4BNZA 2AXQA 3I9MA 3VKVA 1AGNA 1TXGA 1HF3A 3BIOA 4J1QA 1DAPA 1PJTA 3OM9A 1QYWA 4AICA 4Z3DA 2NQ8A 1XWFA 3GUCA 3GQVA 2X86A 3OQBA 2P9GA 4GBJA 2IE0A 5JYEA 2AG8A 3CEAA 4EBFA 4BGVA 3PGJA 4UULA 5IXYA 4ALLA 3E8XA 5FF9A 1DEHA 1E1KA 3KYBA 1FDTA 1LEHA 2BI8A 1GU7A 4E0BA 2W8ZA 2BRUA 2X4GA 1UZLA 3VZPA 1BXGB 2VTDA 3Q11A 3GNTA 2EHDA 1B8VA 3GPDG 2O7SA 4E13A 4NZ9A 3WLEA 2VZ9A 2BI7A 2UV8A 5BT9A 5A4DA 5MDHA 4IJVA 3PHGA 2P2SA 4WLEA 4L75A
chains in the Genus database with same CATH superfamily
1TYDE 3NWPA 4ZEVA 2NX2A 4EIWA 1XEAA 2HW8A 4OJMX 3JALB 2GI4A 1NVGA 4MVXA 3VZBA 3DDNA 1E2DA 3AESA 3TDMA 1GQSA 9ABPA 5KYUB 1CDEA 4TOIA 4DCVA 5K2OA 3PNSA 3EVNA 2C31A 1IY1A 1TM7E 3U5TA 1AHIA 4DV6B 2CYAA 3UUEA 1RCFA 1FA9A 3SQOA 3KLMX 3LBNA 1CK4A 4ZO4A 1YR8A 3MAGA 4FEEA 4QQFA 2F6RA 5CPBA 3HFRA 1LQ2A 2I8CA 1C8KA 3PTLA 5BN5A 3Q4GA 5HF6A 2W6PA 1B16A 2D4AA 3IVAA 4YT8A 4FDTA 3G79A 3BRSA 4LG1A 1CJCA 1Z08A 1ITZA 3OOWA 4ZCTA 1JR6A 2QAGA 4JB2A 4I9HA 1VJCA 1B26A 1IZ0A 4NV0A 4GOOD 4LJLA 2HRCA 1YC2A 2IX3A 2UZ1B 1ZN9A 3F2VA 4FNMA 4HUQB 3O03A 5CM8B 1DMSA 4RH1A 2QRUA 3TKLA 3GROA 1QE0A 3CPSA 1U8YA 1X92A 2QW1A 3G2KA 4IG9A 1Z16A 1BMFA 5HMMA 2DBQA 1GY8A 3LP5A 1ODTC 5AW2A 1L5GB 2R6AA 1EEHA 4ZCSA 5T7BA 2C04A 3UXMA 2GXSA 1CP3A 3KSBC 3R3UA 3HABA 3SAJA 4RMIA 1JJAA 1UKBA 3VNRA 2GLUA 2BW0A 1Z2DA 1OGJA 4LFAB 2XR1A 4M98A 4ZT2A 5KTSA 3MOGA 2O2JA 3DF9A 2IZ1A 2Z5LA 5ALYA 5KTNA 2G5GX 3AUUA 4G5FA 5LQAA 4TKLA 4AX4A 3L0SA 2B4YA 2P0AA 2ZIVB 3EZ7A 4N03A 5FULA 4GX1A 4R51A 1KE1A 3R77A 4B75A 1EFCA 3IUJA 1MO2A 1L5HB 3KAJA 5JECA 1KIMA 1PFQA 1BKYA 1UKZA 2I78A 3A2MA 4TWIA 4YEDA 4ZQCB 5BRNA 3AINA 3KHUA 4OBWA 4XOIA 4AB1A 4HQLA 2XB4A 4OXQA 3FN4A 3FFBA 5KOIA 4DY6A 3BWDD 5JYCA 1HDXA 3P27A 3PIDA 3IPLA 4RDHA 1LPNA 4MCHA 1RCTE 4DQUA 4OI0A 3W5VA 4YCSA 2HRDA 3LQ2A 1KQNA 3KVNA 1S2OA 5JMOA 1AZTA 4BJ6A 2R1ZA 2ZSUA 3MHPA 4B3GA 3JRNA 1GN9A 2O50A 2XUKA 1E2HA 1DTWA 1UZAA 4LFCB 4W5QA 1WCIB 1U0RA 2J3MA 5K6AC 1KVTA 1PTKA 3GZ4A 1I4LD 5FPKA 1KSFX 3OLZA 4YH1A 5KREA 3VO8A 4C2BA 4IYRA 4ESEA 4Z4QA 3UW3A 4ZIRA 1JMYA 2ZGVA 4P35A 5JPCA 5IS2A 1I5RA 3EBPA 4PX9A 4Z4CA 3G6KA 2XYRA 5JVDA 3NHLA 3V2HA 3IUMA 2I03A 3R5HA 4L7QA 3OTQA 4BMYA 2F8TA 4HYTA 5D7BA 3U40A 4ARAA 1ELOA 1PVDA 1NVTA 1D6JA 1BXRB 2H11A 2QL6A 2W8BB 3CG0A 4LSWA 5KUTA 5IUJC 4Y2GA 2ZRIA 1MRSA 2QJFA 4PBSA 3HJCA 1QLJA 3SZ3A 4TMFA 5CA1A 1H0RA 2ZWMA 1NJSA 4PQRA 3BS4A 1L6RA 1XNRB 5CVTA 2JHCA 4WK0B 4BPRA 5CIQA 4RKFA 2AEMA 3OTOB 2H1FA 4J4TA 4ZOEA 2RBKA 4BO4A 4MWCA 1E18A 2MJLA 4Q47A 3LUKA 2CXSA 5IKEA 3IKVA 2Z30A 2C58A 1YRBA 3CZ5A 3QKSA 4KWTA 2X2OA 1IQ0A 1P72A 2RH9B 3HA2A 3QHQA 1HEIA 2HEIA 4S2UA 2NUBA 3A1CA 4GOJA 5DLQC 2WHPA 1O8BA 2O1WA 4BMVA 3AC0A 1J0AA 2ILTA 1E6UA 5REQA 4IKEA 2BJWA 1XA4A 2QT0A 1BRTA 5B64A 2WZQA 3X1XA 2JLUA 4E1AA 3GPBA 5A4JA 2WWIA 1W0CA 4FFLA 4MV1A 3MBOA 4PSDA 5EMNA 1R8QA 5E6UB 4FGLA 5J4VA 2GO7A 5B55A 2ZJ1A 3ACDA 2OGUA 5BN3B 4AWXA 2VF4X 1KK2A 4LGMA 1EFRA 2HIGA 5E9JA 2O9JA 3CF2A 5ENZA 5DYIA 4Y2UA 1GFIA 2QVBA 1B7GO 4DA4A 3E5HA 2JCYA 4ALKA 1ENYA 4ITRC 4UZFA 3HJNA 4H1UA 1EJ0A 1W5FA 2I9KA 2A7QA 2HK6A 1ACJA 1NX9A 3GLHA 5FWYB 3EF0A 3IAS6 3G7NA 5G0TA 3UIEA 3VR3A 3C5CA 4HAIA 2V6JA 1FFEA 1SKUA 3TZEA 4AZVA 1IHDA 1CS0B 4RVGA 2O5VA 4ALIA 4HB3A 1YB2A 4KR0A 3U0BA 1BEZA 2E4XA 1FP1D 2PKRA 4LWOA 1VM6A 2W2LA 3BXGA 3C41J 3EGXB 3TE7A 2D1QA 2ZYSA 1F06A 1SJ9A 3WGOA 3X43A 1YS2X 1ZH6A 3BFPA 3D4NA 3AB3A 4Y6SA 2DFKB 4HQNA 2AI1A 4MMXB 4A5SA 5KMGA 5LMUB 1NXVA 4QM6A 1SK8A 3H5OA 3UK1A 1XMIA 2IPOA 5FEUA 1VG0B 1YQEA 4YTEA 1TA0A 5SYNA 3HB1A 4GYWA 4INOA 3VBEA 4BDTA 3A9VA 3ETNA 2JGEA 1EFPB 4YR9A 4EYQA 3HXTA 2QP4A 1OWOA 2VJYA 2G70A 3OSZA 4YHBA 3SSMA 5LP6A 1OY1A 2PJDA 3NBXX 4FX5A 1R5OA 3BE8A 3N8DA 3JQ9A 4JJ4A 1XR3A 3I6IA 5ERGB 2ZYRA 4ZCLA 2Z6VA 3RRNA 4II7A 4B83A 2G1PA 2JFXA 1A8QA 3G8DA 4CUJA 4OUKX 1ENOA 1ZC3A 3M34A 3Q3CA 2XDWA 4D41A 4NNPA 2OO7A 4HDRB 4QGAA 5GADl 2CC2A 3MWDB 5EYPA 3PHIA 3Q3VA 2BGTA 2BGNA 4UHJA 3SR3A 5DBHX 2RHBA 2C4KA 3PX3A 3VO9A 3A3OA 3N2ZB 3QKUA 4B4WA 1NONA 1FF9A 4C07A 1C80A 5I7UA 4P4GA 3DKVA 3VJRA 1Z6XA 3H8JA 4Y0VA 3IQEA 4YT4A 2ORED 3WB9A 1EUZA 2HFJA 1T2CA 2IX9A 1BX1A 2F4NA 2NAFA 4LNHA 3WK8A 3WLSA 3GYBA 4IDHA 2QI9C 4GOMD 1CJUC 3WLQA 5CFOA 2D0DA 2CFTA 4NABA 1BMQA 1U8ZA 2PLAA 5T4FA 3ZWMA 4Y7CA 2BZ1A 3EWIA 4HN2A 3GB9A 2HMUA 4KWHA 2F9MA 1XVAA 3J7AC 3V7FA 4YUVA 4DA0A 1RLJA 1ZD4A 5ALJA 2C8JA 3MTIA 4MW0A 1T15A 1KI3A 1VL5A 4JR0A 1F2VA 4ZJUA 4ZGBA 1EWTA 1ODIA 1RKQA 1XLTA 2FPXA 1DIGA 3AHCA 4G0MA 1MVNA 1TM5E 4AJOA 4DXHA 2C0CA 1I3KA 3COPA 5IAJA 2VCHA 4L0MA 1OWMA 4NQZA 4C0AC 4DF3A 3ZBPA 4G0UA 3KX2A 5AK0A 4QYSA 4N12A 4X7BA 3V32A 3SD7A 2VJDA 1W94A 3QEJA 1JEYB 3T3MB 1NUPA 3BMXA 3D3NA 3MJEA 3PC3A 4UFPA 2HN9A 5FFNA 1P6QA 1PR9A 1IY0A 5F1PA 3CJQA 2JH8A 2W00A 2DYKA 2V3WA 4AXXA 3I9OA 4R1OA 2CCGA 5KYUA 3E9EA 3GEBA 3GDGA 3JQ7B 4ZFNA 1P75A 3E7DA 2WLSA 4LOJA 3UJ6A 1DC5A 4Z4FA 1E3DA 2YXDA 3CX3A 3TKYA 3OX1A 1MV5A 4NJMB 5I7EA 3E3OA 5IAKA 4DLPA 2IZOA 3BWCA 2XODA 4I50B 4LK2A 4RE5A 5DMHA 2Z1MA 1VL1A 2YFKA 3NBZC 1YS1X 2FLKA 3CMCO 4XARA 4KL8S 3D1LA 1KI9A 2FQWA 2Y0PA 1GKUB 2QQEA 1WUYA 4GIBA 4IY1A 3VHLB 4CIXA 3H5LA 3A9TA 4YAKA 5LP6B 4LKOA 2J3IA 4JMLA 3ILHA 4TS4A 1MJGA 3NATA 2OECA 3KCNA 2NSDA 3ZC3A 5CDUA 5JLJA 4HUQA 4C7XA 5J59A 3URMA 1W19A 4DZRA 5GOZA 3MA0A 3UT0A 3FLMA 3AHJA 3KJQA 5EOVA 3HHPA 3S40A 1E0AA 3HVJA 4PG5A 4XQCA 1KRXA 3PYXA 5CB0A 1E5LA 1JG1A 2HYDA 3AY6A 4KJXA 4UU1A 5IXSA 4W9NC 3LBHA 4EF6A 4V0SA 1XP5A 4GS5A 5KPJA 4NP6A 3VO1A 5CB4B 3KSMA 2C4UA 3M5WA 1NQXA 1EE1A 1X7ZB 1SCQA 2BM1A 1U4NA 2QU7A 4R3NA 1FDSA 4RL4A 3UG6A 2C0PA 4A8JB 2DXIA 5ECWA 1KYXA 4P82A 3OZ7A 3CNQS 4WOCA 4IRXA 2LGJA 5JWHA 2QUIA 2G7ZA 3SM3A 4E22A 3CJTA 1L5HA 1ZFNA 2QZJA 1O97C 1WDWB 3ZPXA 5IYZB 3ZQUA 4GPTA 3KXDA 4L07A 1R0CA 3LXRA 5EUQB 4CHGA 5C4MA 1G2PA 4OA8A 5FOTA 2JGMA 3GUYA 4LDRA 1USKA 4NL4H 3O9ZA 3ZLTA 1N34B 1FJHA 4PBRA 1P74A 4DXDA 1PUIA 1CR6A 2HSGA 4J7CA 2KLHA 2YX1A 1RABA 3OA0A 1YNOA 4FVTA 4UUMA 5CX1B 2XRZA 3L6DA 1JILA 1TMYA 1H6BA 3JVDA 2ODBA 4AG5A 1JJBA 5CEEA 2RGNA 2YMQA 3KKEA 4RH3A 3EUAA 1FYEA 1Q1GA 2EJUA 4QUJA 3PX7A 3U5ZB 1A4UA 1WCIA 2OL4A 3S70A 3EIEA 2WJWA 1RVV1 4RZ2A 3VR5D 1XZQA 1LGYA 1VCIA 4R0VA 3WIUA 4WCVA 3IAEA 2X9GA 1N7IA 3T9BA 1WSAA 4EDHA 1DUSA 3QZUA 4ISBA 1CBUA 5T8KC 1UXOA 5DBGA 4C01A 3GLIB 4IS2A 5EINA 1L7VC 5J4YA 4QXOA 2YHUA 4QSHA 4K9PA 1W76A 3NWBA 5DBFA 2BGJA 5FL7A 5HJEA 1N8TA 2R6JA 4II3A 4OFXA 3DOCA 3A11A 3HLTA 3PFBA 4KKXB 5TQVA 1ZJWA 4ARUA 2AZMA 2CE2X 2W8BA 4GC9A 4I1IA 2Z08A 3QXGA 4LZAA 4M0MA 4BGDA 2I34A 1R4AA 6NULA 1T3GA 2UZ3A 3JYHA 2EQAA 1RKUA 2MOKA 4IWXA 4J4BA 3KK0A 5I5EA 2VI5A 2WM2A 4YIHA 4DV2B 4LXGA 3NOOA 2XCIA 2C7OA 1XE3A 2XXJA 4AKTA 1L3BA 2IHNA 1S9HA 1MA0A 3DHEA 2ZULA 1XZGA 5FA8A 3VUEA 1BFUA 1B1AA 2ZBGA 4JOSA 2GRJA 2XEXA 4H4EA 2BSXA 4DV4B 3U1TA 1C1XB 4RZXA 4TMZA 4NS4A 1TKBA 3BHMA 3ZJYA 2YBDA 3F6BX 2IF2A 1MFZA 1X86B 1ZNQO 2A0KA 3BH0A 3D4OA 4HS4A 1S8NA 4N49A 4UNRA 3RADC 3PITA 4B2IA 1JB1A 2HQSA 2XLBA 3UXYA 4IXNA 2VHQA 1P39A 4FLFA 1A4RA 1O0BA 4X8OA 3HBFA 3W5AA 3CFYA 1SC1A 3ZV7A 5AESA 1YUNA 1E5TA 2ZG6A 1RJ9B 3K94A 2J6CA 3HYRA 5A0FA 1FFDA 4A6XA 1IRXA 1QFSA 3HXKA 1Z8NA 1XHLA 2B3DA 2GVNA 3RREA 5BN3A 1J8DA 1GTG1 2CLKB 3U3KA 3VSBA 3VZCA 1ESEA 4F04A 1ZVJA 2X0RA 3A37A 2FLWA 1SBHA 3ND9A 3H9CA 1ARZA 2OO5A 4LBVA 1CCWA 2VAMA 4HDQB 3RJZA 5FWYA 3F5SA 2X1VA 5GIOE 3PD1A 3HWSA 4MIEA 1SD2A 1EVYA 1E0JA 1CS0A 1OKKD 3C4QA 5CK5A 2UUCB 1JE0A 3LNTA 4UVEA 3NEAA 3D8UA 2H6EA 4J2OA 3FBWA 3FNEA 3ISJA 4PRLA 3GLIE 3OY7A 4DQXA 1Z5VA 3T0IA 1RMQA 2VT2A 2F3PA 2O1SA 2VXBA 2RGXA 2W83A 5JCJD 4XEUA 4YAJA 1RWNA 4GWKA 4GEGA 2ISCA 4IX1A 2CVPA 4IDPA 3UFXB 1M0EA 4V0KA 5AVZA 2QM3A 4QG3A 1QFXA 1A9QA 3JQBC 3HB5X 2O5CA 3JQ8A 3C8HA 1J0EA 2J46A 5CHYA 1ZBQA 1NQOA 2BZGA 4FU0A 5IMBA 3RLIA 5FAKA 3ZWPA 1EFPA 1OI2A 1ZXXA 4BLWA 2VPQA 4R1LA 5JS1A 1XJ5A 1V3UA 1XL0A 2Y66A 3I9JA 4RPGA 2Q4TA 5C1IA 5FA5A 3ZZNA 2PLRA 3H1EA 3TUJC 4RA9A 3UCEA 2BM0A 2HLDD 4W8OA 3ZGNA 3ONFA 1IN4A 3R23A 1LLCA 4EHAA 3WSVA 4NG4A 3DDCA 4J03A 2O8BB 3JQFC 1Y7PA 1M7GA 5ALZA 3U4MA 3ZEAA 3AI7A 4FUQA 3D5TA 5FLEX 4YRPA 4BNUA 1LRKA 3T3PB 2AKAB 1N5IA 2R8BA 4TV8B 2P9HA 3HLKA 2AYXA 2VWGA 3GEIA 3VUFA 1UDWA 1LVUA 2JEZA 2Y0BA 3RS4A 5JY6A 2FZCA 3OM8A 1KY3A 3VTZA 4YRZA 2XVZA 3TTYA 2W6NA 1P2SA 1GL7A 2NO1A 4Q4CA 2PZGA 3ESZA 4X6UA 1HI9A 3AR8A 4AS1A 4N65A 5HNKA 1YJBA 4RM3A 1IOLA 1I0LA 3F5MA 5DHRA 3TMYA 2Z6AA 4R3WA 2CHQA 1VLZA 5AJZA 1CZKA 3II6X 1MH1A 5FWXA 4ND4A 4BOYA 1M5UA 2H7YA 3FCEA 3GFTA 4MYRA 4NMHA 2PZJA 4RD2A 1CRWG 3I5MA 5AHXA 1F60A 4HAZA 2I6QA 2FZVA 4HWSA 3P9IA 2FFJA 3HH8A 4ZVKA 1VPDA 1PSZA 1P5HA 2ESRA 4L8YA 1EM6A 4GXNA 3L9WA 3FWYA 3HY4A 4NU0A 2ZAOA 4Y1FA 4NR0A 4YT5A 4XYLA 4U9HS 4DQKA 5EXTA 1MB4A 2DG2A 3B53X 1DAEA 2FZEA 3I37X 3M6IA 2WJ4A 4ZOLB 5EZSA 1K0UA 1VA5A 1IEWA 4M9CA 3ZIUA 3G68A 1SU7A 1PP4A 1G4UR 4DZTA 3CRVA 1RBMA 3GUHA 1WKBA 3KJEA 1JEYA 4CEIA 4UEWA 2J87A 5LZ7A 4KXVA 2C5EA 3H9JA 3U7HB 4PIMA 1FSPA 1VFNA 2W90A 3MAJA 1Z28A 1MENA 2A94A 2C2YA 2GF0A 2NV6A 3OPNA 4K6OA 4P58A 4RNDB 5U1PA 2OUKA 1N4DA 1NIPA 2IZ0A 4E2WA 3L8MA 4LMAA 1QP4A 3JQ7A 1ZD3A 5TARA 3WGYA 4ARBA 1CQPA 1OYOA 3K8OE 3LKZA 3ORHA 3TRHA 5JE8A 5JDCC 4NJMA 5HBGA 4S3MA 1AQUA 1TE2A 5AHWA 2IH4A 2GGSA 1UZNA 2VXYA 4H27A 2PSEA 2W6QA 1X14A 1FPQA 16PKA 3SIXA 3BXOA 4MKRA 1QCCA 1KJQA 2QGZA 3AY7A 3RKUA 5KTKA 3PC7A 4ESVA 1HE3A 1KBOA 1IZYA 2BFFA 2I1VB 4OQLA 1D2NA 4MP6A 3GFSA 1LPMA 4BTEA 4COKA 3SZOA 5GQSA 1SG9A 4G63A 4KOAA 5BP7A 2AHOA 2TYSB 1KEEB 2D7CA 5KU7A 5TRTA 3WV4A 5INTA 1IHXA 1G8JA 1RWMA 1N2EA 1UBGA 2IGBA 1N25A 4ENRA 4OHPA 4B7ZA 2O0MA 3OVMA 2X13A 1WPXA 2IYLD 3UJAA 3RU3A 1FQJA 4BNMA 4DLRA 1SUWA 3HN7A 4ODIA 4DIUA 5DGTA 4ZYZA 3DLHA 4C2TA 2QL7A 2XUGA 3UGTA 1XBTA 4HMOA 4EHLA 1RZ3A 4YLEA 5F76A 2WOOA 2B4QA 1FZQA 4ZVVA 2IP1A 5HILA 1E1QA 3GF4A 4B85A 1T4DA 3BQNB 3TO5A 2YINC 4RZHA 5K3SA 1POWA 4TL9A 2ENWA 4A8JA 2ZROA 4Q1AA 3ZQJA 3UJHA 1CR0A 1GQ2A 1ORIA 4GI7A 4UUBA 3RK1A 1JVBA 2YNMA 3ZWOA 5KYGA 3GCDA 3X1DA 3P4XA 4JT8A 4MGEA 1P44A 2IF0A 1TK2A 1LD3A 3JD1A 3FAKA 5BRAA 1E8MA 1U0OC 4BO6A 2FLVA 3U48A 1ISHA 1H2FA 4OOFA 4BFVA 5C7IO 1F7VA 4KSYA 1UMBB 4LE2A 3R20A 4Z3KA 1QU2A 3QU5A 1WVGA 2BVNA 1XTVA 3PZBA 4RAQA 4R7GA 3P0IA 4LC9A 4QGSA 2QX8A 4CKYA 2O8DB 4FFNA 4D9BA 1MQAA 4IFIA 4Q05A 2JFOA 4ENVA 4F8JA 3TEJA 1NTRA 3AUTA 3T9CA 4IVQA 1Q3TA 4KXQA 2EFCB 4L9WA 3KJZA 4C4RA 5FX2A 3PUIA 4HNAA 1X38A 1ZVKA 2QAGC 1K5PA 4TQUS 4BIIA 2D00A 3AF1A 5HS6A 2R62A 4JEIA 1CEYA 1O6ZA 2GZ3A 3T5DA 1RWXA 3N87A 3IA7A 4OI1A 3DVAB 3GLIA 1KIFA 3R7WA 1DO8A 1M34B 2PQ0A 4ETWA 3W2EA 3H4TA 3BT7A 5BR8B 2O8NA 2M6KA 1U2EA 4WK6A 3ILVA 4FLMA 2H5EA 4WDRA 1D9ZA 1S2GA 4HDSB 1JI3A 1KTVA 4FM9A 1T36B 4E5PA 4QU5A 1WXHA 3IIMA 5KI6A 4FFPA 1OXVA 3WK6A 3MZ0A 1PQYA 2V3CC 2W2NA 2XA1A 1N2IA 2VDKB 3JYNA 2GT1A 3FPAA 3UUFA 2YS6A 5CX4A 2YS7A 2XIJA 4V02A 4CUKA 1TEXA 2OOKA 5FADA 3AL3A 4UTZA 1JT2A 1EVQA 3A9UA 1P2UA 3M2TA 4MWSA 4OXIA 3RUEA 4M7PA 3IUYA 2QORA 4M8NE 3DMPA 4B9AA 4YMLA 4C04A 1VE5A 1ZUNB 2X0IA 3OIYA 1S8AA 1RFLA 3PWTA 1GA1A 3EIXA 4EZIA 3I9V1 1U0EA 1C1XA 4K6CA 3SDBA 3UB3A 4GKJB 3JVVA 4FW9A 2FG7C 2WJ3A 2O2CA 3AKDA 3OFJA 4CMJA 1TTQB 4DMUB 3S2SA 1JHZA 3D4LA 1EM8B 5KNBA 3MD0A 1Z13A 3C85A 5FEMA 3DMGA 2OC9A 3C48A 1XQ9A 2XB9A 3IEUA 3NHMA 3IOYA 4G0NA 4YO7A 1UBTS 2WNIA 4YRQA 4D42A 2FMKA 1A96A 1AD2A 2AK3A 4XUEA 4FDUA 4LSZA 4PRYA 2ERXA 1VLLA 1ISJA 3C7CB 1RJ9A 4WBSA 1E2MA 1GUYA 5CB8A 1TQ6A 4D8YA 1IXSB 1DV1A 3I05A 3MIIA 4KDRA 4IGKA 5JO9A 4H6PA 2H85A 3TD9A 1NDQA 2H51A 1R0WA 5EJMA 3MB5A 4F4IA 4MROA 5MHTA 3QNWA 1TU0A 3WLKX 5LD2C 1DEOA 1NHGA 4EYGA 2QROA 1P0IA 3FSJX 1ZKDA 3ZS8A 3OE1A 4GM0A 1PD1A 4G09A 1C41A 3FR8A 3N86A 3T5TA 3ZJTA 4TS1A 1XJQA 2H17A 4S24A 3TTVA 3N8KA 1QYVA 1MW8X 1QP0A 3RKRA 1XZCA 2R00A 3PJRA 2HO4A 4ENUA 1GO2A 4OJKA 4O5OA 1XU9A 4BLTA 3C3MA 5A4AA 1QBGA 2UVDA 2PKWA 1Z56C 3SEQA 5BMVF 2IYOA 1N6NA 3WNVA 3B20A 1KKUA 2DKOA 1M34E 4GKAA 2ZEJA 1RHMA 1XRJA 2PM8A 3CX7A 2QRVB 1GKKA 3WL3A 1JZSA 4TTPA 3GD5A 4M21A 1W0JA 3UFXA 3AXTA 4XZ3A 1Y34E 4DJDC 1PT6A 1LSUA 5FPQA 3TBKA 2FEWB 1JFFA 1CERA 2ZBQA 3Q7TA 3SWWA 4Q9KA 3B6MA 2WHEA 5IFKA 1O95A 1VC2A 2GUWA 3QNUA 3VPDA 1PJSA 1KO1A 5F3RA 1GZ7A 1KMMA 3B52X 4BKQA 5AI5A 3G7SA 1Q44A 4JROA 3WQBA 1HYGA 4AURA 5KX5B 3Q6NA 1PJ4A 3WDMA 2KLBA 3BJZA 3IE0A 4WK4B 2ZUWA 2O8BA 4MULA 4ENQA 2EZ4A 1KS2A 1SUEA 4NCHA 5ECGC 2OV1A 1PL7A 5KCMA 5A7GA 3KSZO 2Y6VA 5AXAA 1MF7A 4EITA 4JZYA 4TV8A 2DU8A 2OZPA 4ZYUA 1NBAA 1IIRA 1RFGE 4DANA 1P4RA 4QELA 2W22A 1F5SA 5CDHA 3DMRA 5F51A 4COOA 3LWZA 4FN4A 4JL8A 4X7RA 4O0MA 3RSLA 3TTUA 1E7MA 2PS1A 3OO0A 4UEOA 1RQPA 3RYTC 3VKFA 3N70A 4BQNA 4ETIA 5DN6D 3DMHA 2G9ZA 1OLUB 2P62A 1D5WA 3NUQA 3V2GA 2NZUG 3RFVA 3FI0A 4EABA 5A1TA 1NUTA 1D1QA 4GFDA 2V45A 2HD4A 4N5MA 1I36A 3TOVA 2JAQA 1XPOA 1CC1S 2M6SA 4I1YA 2Q2VA 4GAEA 4F56A 2V7UA 4F8YA 3PXAA 3QWBA 1L5LA 3T34A 1I5EA 1SC6A 4IQ8A 1BD3A 4OFZA 4BFLA 1RBZA 2Y6UA 2R5FA 2HT6A 4P7JA 1SD1A 2VJKA 3ZWVA 4B5LA 1JKJB 1T3ZA 1U04A 2CJFA 4D3SA 1W36B 1EBFA 1Q6YA 1SK9A 2D62A 4MUIA 4OP2A 3ETGA 4RXUA 3V55A 3HXQA 1O77A 1Z73A 4F5WA 4LX8A 4EOGA 3FSEA 4UHHA 2GK6A 1EVIA 4EW3A 5E3JA 1CUDA 5TY0A 3RO7A 2WYUA 3JQ9C 1XPRA 2Z6UA 1DHTA 3R6DA 5B30A 2JS7A 3H1TA 1INLA 2CMHA 3VI3B 3NGMA 4NYIR 4MITA 4CKEB 4DRZA 4MX8A 4LY9A 4JX8A 4EW1A 3MYYA 5LQUA 4LF7B 4V0RA 4EY8A 2FPRA 1XSEA 2XKAA 4DYDA 2VAVA 4EZEA 1K4MA 2BUAA 1V48A 1E5QA 1DAIA 4QFBA 3M1YA 2F00A 2K7FA 2J9YB 2ZIAA 4L5YA 3K2BA 5ARDA 1ZJ6A 1DFIA 5TF4A 4GX0A 1FX0A 1SUBA 1WMFA 4IIFA 4U7GA 2O2EA 4WSOA 4KQWA 3TLKA 4ALNA 3PL5A 1KQFA 4MS4B 1CJKC 1NJ6A 3IT2A 3WK4A 4HXEB 1XKLA 3NKVA 2A5YB 4YCMA 3LP6A 4QYMA 3KYDB 5DZSA 4PQYA 1KEEA 1XN4A 2BCEA 1X13A 3HUEA 3ZZMA 4EAQA 2VEOA 1GR0A 2NQ2C 3WLFA 4DEYA 3W8NA 1V5EA 1ZIYA 3PGMA 1B0PA 4U2EA 1F1BA 5DTJA 2IDMA 1VOTA 2L82A 4JBHA 1BW9A 1PEAA 2HWWA 4XI9A 1XLTC 3STUA 4K9NA 1KGSA 3ND7A 3I09A 3MLEA 5ERYA 1VJRA 5FBRB 1YH3A 4ZVNA 4U02A 1EFDN 4LDNA 4FYXA 1CNMA 3SSNA 5H68A 3RIGA 1WXWA 4MUJA 4RD3A 4PWZA 3BKWA 3CWZA 2QK4A 3NGXA 5EC8A 5K4HA 5ETJA 2VDWB 2F1OA 3GT7A 3N74A 5IULC 1OW3B 3OBIA 3MF4A 1PWXA 2VSYA 3EEBA 4R5HA 4YDRA 4EA6A 2WHYA 1LSJA 3FPFA 1NQTA 2C61A 3DZKA 3TGLA 1WUHS 4AO7A 1MJFA 4UCQA 2I7DA 2VA9A 4XVQA 1HEUA 3BFJA 4MO9A 3SQLA 4MVJA 1UMBA 2EKLA 1GG8A 4Z2YA 3E9ZA 1XTZA 2X9LA 4WNAB 4JYZA 3ZDDA 4AMZA 3EAQA 3VZSA 3I1YA 5BQXA 2V4MA 4TN5A 1EBBA 2P3OA 5FNVF 5C52B 2WJIA 3E9QA 2SECE 3LNCA 2O8DA 2JAHA 2F43B 3ZBTA 4BMCA 1S4MA 3O73A 4HVAA 4J43A 2HBQA 4W99A 1J06A 1PNQA 2Z9BA 2E6KA 2ZIEA 2WILA 3SC2B 1KFCB 1NVFA 2Y05A 1EWYA 1I5OA 3A1TA 1TX4B 2XUHA 1PQWA 3ABZA 3U1VA 1GPBA 4U1RA 3TR0A 4OQMA 5DB4A 1KJWA 4QNRA 2VZEA 4N0QA 3T3EA 4P3KA 1MX3A 4FZJA 4YB8A 1M34A 4EQ6B 5IEBA 2GH1A 4DRYA 5ADHA 3Q8MA 3LY9A 3UGQA 1Q0TA 4EECA 2H1IA 4ZPXA 4BV3A 2V6BA 2ZI7A 4HWRA 5A4MS 1ECJA 1FTWA 1PGOA 4HB4A 3NAZA 1T36A 4LHEA 2RBEA 1A4IA 4BJ5A 1MGPA 1FDVA 2V5VA 4TGLA 3VH1A 5DTEA 2HJ9A 2ISSD 3QE3A 2UU9B 2JI8A 4ER0A 2GK3A 4P2BA 2I6FA 2XD4A 4NZMA 5J2TA 1L8OA 4M7RA 4TQ9A 4UZSA 1QC5B 2NT3A 1CIVA 1M6EX 1SXIA 1ZRSA 3K73O 3N28A 3PJEA 1OFUA 1AZSC 3A3YA 1S01A 2AFHA 1E1MA 1XHFA 3ZV6A 5IKOA 1OFGA 1KO4A 3JASB 1ZUNA 4B4KA 3ME5A 4LZPA 3X2EA 5I4IA 4A03A 4TYNA 4D8XA 1FDIA 4AIIA 1V41E 4R68A 1Q84A 3K9HA 4EJ6A 5E4JA 2NV0A 5JATA 1L4YA 2WIKA 1EM8A 4V0OA 2YUIA 3PP8A 5M2QA 1NPDA 1KVSA 4JMPA 4H4DA 4I14A 5KINB 1COWD 4B81A 1F8XA 5LIRA 5ITWA 2ZI4A 2Y0DA 5ICMA 2RGNC 1S3GA 1U0FA 3K9CA 3ZYCA 1JIVA 4L22A 4X62B 4X93A 2QUAA 1JXAA 1OLXB 4D82A 5JSUA 4N0MA 2H06A 3D8BA 3MGGA 4L02A 4LXXA 4X20B 4CKCB 5JROA 3OT5A 4J0IA 5JTUA 4WPGA 5FPHA 2H1OA 3KYIB 1CYDA 2OLEA 1Z38A 3RVKA 4AJKA 1G63A 3TDKA 2G9RA 3LHSA 4F6RA 4A2CA 1SAYA 4OLBA 8ADHA 4KWCA 4XWAA 4XJSA 1RKXA 3H6GA 5CLQA 1FP4B 3I2KA 3G89A 4ZAGA 5D00A 1NLYA 3MTGA 3QH4A 4D9HA 4BZWA 2WA1A 4URVR 1CQJB 2C4NA 1YJXA 2KBFA 3BWVA 3CUYA 4GQBA 1NJ2A 2HAEA 5TDHA 4I5FA 4N8SA 5JAOA 4WXEA 3PUVA 2P91A 3L0IB 2IOFA 3GJ4A 2XT0A 3R24A 4JLWA 1QGDA 3GN2A 4LZOA 1KETA 5TR9A 4ZJPA 3QEKA 1LX6A 3HDVA 3DT6A 3NH9A 4N41A 3L6BA 2ZLBA 3BA6A 3BMQA 2XF8A 2GLXA 1JJIA 1TQ2A 1WG8A 3PR3A 3UAVA 3WADA 3AQIA 3U4DA 2QY6A 4W7IA 4BRWA 4QDKA 3NS7A 4LPSA 4IF6A 3SIPA 1WHSB 4X7PA 3WJ7A 1E6EA 4P93A 2VJMB 3R8XA 3GGGA 3VH2A 5HR5A 4TMKA 1TOAA 2FGJA 1H42A 4QA9A 3KWLA 4O02B 3F6RA 3NB0A 5ADWA 3H0EA 1CQXA 4IFTA 4HR7A 5EMHA 3ITEA 5KX5A 4A3SA 2O20A 1YCFA 4EW2A 3IAFA 4PFSA 3R7BA 5I9LA 2AA3A 1CXZA 3IDZA 1ZITA 2FXVA 3HDJA 1M8GA 1W73A 3C3JA 3O4IA 2V7VA 5ENDA 1SCUA 3MMPA 4MCIA 2YR0A 1W2WB 2PGXA 1ZESA 3C45A 3PNYA 3EY4A 4EX7A 5ALIA 5FOXA 1B0ZA 4YBRA 5AHOA 3C8MA 4QSMA 3QTBA 3AYXB 4PY2A 1YR2A 1ZLYA 3P45A 5CB6A 2OO5C 1R6UA 3J81A 1AK1A 1EKXA 1Y8QA 3EMVA 4IUBS 1OLUA 1CKEA 3HBJA 4QG7A 3DWIA 1KS9A 2C5GA 3JX9A 3M3HA 4EBBA 4GGOA 7AT1A 4QLOA 2Q9AA 1LF0A 3L6UA 3W5DA 4PPQA 4IKPA 4FOSA 5FTKA 2FZKA 2GERA 1H0KA 5KZMB 3FVTA 4ML3A 4FGKA 3ZE0B 4G37A 4AN1A 3IMCA 3IB3A 3NC0C 4R2XA 3R7FA 1WMBA 3FY4A 3WLOA 2Y1GA 3ZW8A 2COUA 2Q5FA 4DJ5X 2FPKA 3IPAA 2C82A 2H8GA 3TMAA 2JAXA 1BFKA 4YMSA 1UEXC 5EZQA 4AYTA 2Y76A 4XVCA 5BV2P 1T9CA 3SQWA 1JKJA 3D4PA 2HA0A 5JHGB 2DWUA 4JJIA 1U9IA 2ZR8A 1DIHA 3D3QA 4ZTZB 2CLDX 4GYJA 1TZMA 4MVWA 3TAUA 2IXEA 4R5MA 1U7WA 3D0RA 3L6EA 3L40A 2NVUB 5TMPA 2I2AA 2IV7A 2W5UA 3WDKA 1QQ6A 1KO7A 2OENG 3CH4B 3H18A 3QA9A 2ZATA 4HMQA 5JD3A 1R27A 4AP5A 1IIBA 3CBQA 2QD4A 1FTSA 1HC7A 1PS9A 1C3LA 4AK9A 3CLSD 3PC4A 5CDFA 3OI7A 3CTPA 3Q9UA 1LZLA 4RY8A 1ADCA 5FUYA 4Z51A 1W29A 2Z3VA 4B6SA 1VG9B 1X77A 5KAPA 5C8ZA 5CCDA 5LNK6 3IAM1 1WZNA 1NJFA 3I2YX 2PRZA 1G60A 3LHDA 5CTJA 4GI1A 3SLGA 2CLCX 3I5YA 4MS4A 2J30A 4DJAA 1ABEA 5TS3A 3UJ8A 4ECAA 3VZRA 1Z7BA 2CUZA 3GGSA 3PC8A 2P5YA 3OZCA 4C08A 3KWMA 1JDSA 5CVJA 1H05A 2DFPA 2FK7A 3BIFA 2YN4A 3BD7A 4UTXA 3ICPA 4O2BF 2PT9A 1EH5A 3OWHA 4RH0A 4DQ0A 4Z6KA 1SR8A 2NSLA 1YD7A 2JKVA 4HH0A 1F8UA 4N8EA 1UK8A 1LNQA 5FXMA 1A5BB 4F1KA 1VPEA 4JU9A 3BM5A 4RZ3A 1KQ3A 4ZPJA 2FDCA 2RIRA 1OVMA 3QKRB 1OHHA 5AKYA 4K8RB 4Q66C 4JJAA 3RSQA 4DM3A 1L1EA 5CMLA 2P6NA 1FB5A 3H1AA 5ALHA 1RE0A 3PNKA 2OAP1 1I6LA 2ZVQX 3BB3A 4ER7A 1E3WB 4JYMA 5LMCA 2VDWA 2VYQA 3EJWA 4DR4B 5DK4A 3RWOA 1P45A 4R7TA 2VF5X 5LA6B 3B3AA 3FPBA 3OLXA 1RXUA 2PSSA 3DHYA 1CRZA 5AM5A 2QRKA 3FMIA 1TGYA 2CV2A 1WULS 3P9QA 2HXSA 4M1OA 5FL3A 5K01A 5DDIP 2J59A 4CEHB 1N6RA 1T9KA 4K2HA 4BFZA 3GH3A 3P4YA 3A6ZA 3EVTA 5TPZA 2V9CA 3RS9A 2B6NA 3ZCRA 1T0BA 4MLCA 5IVIA 1G5IA 4MI6A 1WTCA 1DCTA 2BKXA 1WQ3A 1SUCA 4MMYB 3CKKA 2IXBA 2WFLA 4RPHA 4EJSB 1YQXA 4J0QA 4RU1A 4OGKA 2R751 3IPYA 1DAOA 4HOYA 1CUEA 4PAOA 2FZWA 2Q5CA 3L07A 3OX2A 1GKIA 2E87A 2EWWA 3DBRB 5D85A 2IV2X 4J3NA 2VSQA 1R8XA 5D3KA 5LP6C 1CD5A 4NCNA 2YXBA 3SC2A 3FTEA 1SQFA 1SCBA 4ZI3A 2XCOA 5K4GA 2REQB 2GF2A 1JMKC 2C7QA 3G2QA 1JHMA 4EI9A 3PD7A 4GVLA 1GILA 3I30X 2JFBA 1QQ5A 2XMQA 3MERA 4WOKA 4X97A 1NVUQ 2CHUA 4YROA 1TLTA 3N6RA 2W6ID 4QFDA 2A9QA 3E15A 2QM7A 4JLKA 2ZYDA 3D59A 5D3MA 2VDQB 1KDYA 4DT1A 1RRMA 4OK6A 3I5AA 3UOGA 1CDOA 1IEQA 5A9RA 4LZZA 1NKSA 1UJMA 3QRWA 2DHCA 4OQQA 5HM8A 1JDBC 3GRVA 1G9XA 2B1QA 1DG9A 4QYTA 5LOVB 3PRKE 4CYMA 3JWIA 4AJJA 2EIXA 4A8JC 5JRJA 2IU3A 1FW6A 1DBWA 4ILEA 2YNMC 3UWPA 1XTPA 3KG2A 3HWX1 4MRMB 1P1IA 3WBKA 1Y81A 1UP7A 2Z9DA 4LI3X 1Y6RA 3AILA 4FYIA 1SVOA 3BCHA 1JTEA 5TGDA 2B8TA 2ZUCA 3HNPA 4UPVA 4BVBA 3EEOA 3H05A 2DBRA 5HRCA 2YCLA 4OI2A 5AVYA 1X6VA 2FSVA 2ZS8A 3P97A 5EP4A 1GLNA 5DM2A 4E5YA 2RKWA 1U81A 3BRWA 4HDMA 3GAZA 2LUOA 4UBKA 4Z1OA 1GTMA 1E3EA 3IQFA 3JAKB 4PYOA 3ROGA 3WY9A 4BEJA 3P19A 1JKFA 2PRKA 4KMRA 3NKFA 3NNNA 4KW7A 1QONA 4BJ1A 4C78A 2RD2A 4F84A 1PCXA 4TMTA 1D2CA 3ZGOA 3CVVA 3EGCA 2KMLA 4CKCA 4UUQA 4EELA 2I3ZA 1GTVA 3ILSA 2WSIA 3G9ZA 3Q7EA 4I1SA 4QGFA 1Z4OA 4YRSA 1NBMD 2IEDA 1ISGA 3TX6A 2H1SA 2WJHA 4MSUA 3T9EA 4RD0A 1K88A 1T6NA 4JU8A 3HB4X 1J8FA 1G18A 1SMKA 1ULUA 2WUWE 1FP4A 3B70A 3W6PA 5IN4A 1RLUA 3HL0A 1CQJA 1JT9A 2A78A 2PUCA 4BYMA 3A1VA 5KSPA 2Q0HA 1LV8A 3K8ZA 3SKVA 3LLUA 4I4CA 3VNUA 4D9KA 3CZQA 1O94A 2P68A 4EB6B 5K05A 3WTCA 1N2XA 2WHXA 2PMFA 1ACMA 2YV5A 2G7MC 4X1IB 4EMBA 2VQEB 5B1EA 1PT5A 3GL9A 1T3LA 5EQFA 2OM2A 5K0SA 3WGKA 4MPTA 5KYTA 4XKJA 3RYCA 4QBTA 4Q7QA 1MAHA 1HRKA 3QKTA 1GGFA 3A9SA 1F3LA 1Q16A 5TX7A 4F11A 4JC0A