3QVOA

Structure of a rossmann-fold nad(p)-binding family protein from shigella flexneri.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
213
structure length
197
Chain Sequence
HMKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTNSQIIMGDVLNHAALKQAMQGQDIVYANLTGEDLDIQANSVIAAMKACDVKRLIFVLSLGIGEPLKPFRRAADAIEASGLEYTILRPAWLTDEDIIDYELTSRNEPFKGTIVSRKSVAALITDIIDKPEKHIGENIGINQPGTDGDKPFFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords NmrA family protein
publication title Structure of a Rossmann-fold NAD(P)-binding family protein from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a
total genus 58
structure length 197
sequence length 213
ec nomenclature
pdb deposition date 2011-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvoA00
3PHIA 4BOYA 5IXSA 3L4SO 4LCJA 5U4QA 4PZCA 4WE3A 1DXYA 4ALIA 1CWUA 2B4TO 5BQFA 1NPYA 2JD2A 1NHWA 4QUKA 3OA2A 4A0SA 1SO8A 3BMQB 2VRBA 4DQVA 2XXBA 4EBFA 3ZHBA 3JQ7B 3GGGA 4YRBA 4RO0A 3BMOB 2GDZA 4GVLA 4I5GA 1KY5A 3ICPA 3KEQA 3N7UA 1KOLA 4B79A 3COSA 2NV6A 4TKLA 4XYMA 2FPIA 3CZRA 3PHHA 4K1LA 2GR9A 2JHFA 4YJHB 2RH8A 1WLYA 4WCFB 3TQHA 3RCBA 5L45A 3BMNA 3HUDA 5DOVA 4MP6A 4UEJA 4XQCA 3MJSA 2CMDA 3L9WA 3EHEA 3L6OO 1MG5A 2ZB8A 5JY1A 4NH4A 1AE1A 3GR6A 3KSUA 3Q9NA 4CMJA 4MVJG 4YAKA 3NV9A 1FDTA 3NJ8A 4MVJE 1I2ZA 3B1KA 4NBVA 3TF5A 1NASA 3IUPA 2P68A 2CZCA 3C1OA 4B4UA 2F00A 4GX0A 4NFYA 5I9MA 3MJEA 3L9XA 5CP8A 4E0BA 1NR7A 1R0KA 1ARZA 4BGUA 2OMEA 3DBRA 3DMYA 4TSKA 3GFBA 5A05A 1NHGA 1PWZA 3RAJA 2FMUA 5G0SA 5I7VA 3V8BA 4E2ZA 4GX1A 5A04A 1B26A 4XJSA 3RU9A 5DBGA 2W2LD 1PQPA 2D59A 2X9GA 4D46A 2H6EA 1LJ8A 3WQQA 1R4MB 2QYSA 1NQTA 1Y1PA 4W7HA 3TWOA 1N1GA 5DN9A 5KCZA 2Q4BA 5C7OO 2HJSA 1DAPA 1U3UA 1VLLA 2I3AA 2NQTA 3WLEA 3H2SA 3MZ0A 3IIEA 3UKOA 3HSKA 3U49A 3SXPA 3ADPA 1FF9A 4OSOA 3WWYA 2PK3A 2CUKA 2WD8A 3QV1A 2A4KA 2V65A 5L7YA 3JQBC 4YT5A 4HKTA 8ADHA 1KC3A 2DBVO 1D1SA 2POQX 2X1HA 4L4XA 4YXFA 2C7VA 4D79A 1JQBA 4OXNA 1XR3A 1CEQA 2UV8A 3LQFA 1YONA 3LT2A 4FOSA 1GADO 2P5UA 3S2GA 5A03A 1J6UA 1G0OA 2EV9A 4M89A 5DT9A 5IXYA 3PDUA 3V1UA 2O7SA 2EG9A 3DMTA 3PK0A 3KLPX 3H9UA 2J3IA 3JQDA 5TT1A 1O9BA 1E6EA 1ONOA 1PGJA 2YQ4A 4U0KA 1N7HA 1Y8RB 4FR5A 1U4OA 1CQIA 3P2OA 1GYPA 5JAQA 5EESA 1H2HA 2DBQA 3MTGA 3MOIA 3RC1A 5L7WA 2RIRA 3DHNA 4B7CA 1EFLA 1UP7A 1X1EA 3FPLA 4R41A 3D64A 4R5HA 4Y6RA 1FDVA 4E13A 4BNXA 4WLVA 1DIAA 5F5LA 1E1KA 4GX2A 4BO5A 1HXHA 1Y9EA 3IC5A 4JBIA 3AI1A 2BMAA 4BMSA 3DBVO 4L75A 4FW8A 5A4DA 4NJMB 5L53A 3PP8A 1IE3A 3KOUA 2O3JA 2HO5A 1JWBB 1XA0A 1ENYA 1X0VA 2IE0A 1DIBA 3NKLA 3H4VA 1LEHA 4XDYA 4B4VA 1C0IA 3PIDA 3AI2A 3DFZA 3WLFA 4GGOA 5JPIA 4E30A 2X5KO 3MWEB 4Q3BA 1DAOA 1V6AA 4BKUA 3ASVA 3D3WB 2HMWA 4TMFA 3ICCA 2RHRA 1NVGA 1LXCA 2OGUA 1IULA 4YPOA 3MJTA 2FRDA 3CSDA 2B5VA 3AI3A 3GOHA 1V0JA 4MKXA 1EQ2A 2AXQA 4TRNA 4PVCA 1YJ8A 1Y7TA 3OIFA 2PKRA 2J3HA 3R0IA 4GWGA 4RGBA 1O94A 3T7EA 1P1FA 3HN7A 3ZCXA 2AHRA 3UF0A 1A9YA 4F6LA 3E5MA 2ZCUA 1B3RA 5K9ZA 1BDMA 4CQLA 3DTYA 3FSRA 5LDGA 3ZWMA 4FFRA 1RJWA 4WLOA 5AXBA 5BNFA 2TMGA 4HNHA 3HHPA 1DJNA 3OJEA 2BFOA 3BIOA 4JGBA 2OFPA 2X7HA 2CNBA 2Q2QA 4RVGA 4YA6A 2NU9A 3ZU5A 1ZUD1 2PZLA 2I6TA 1HRDA 3QHAA 4P8RA 2PZJA 3LVFO 4NBWA 5IN4A 3WOHA 1CETA 1X15A 3EY4A 2C7GA 2VWHA 4TVOA 2Q1WA 3K92A 1HZJA 2DTDA 2BGMA 4ALKA 5I7EA 3RUFA 5JYDA 1C14A 3A9WA 4WOJA 1NAIA 3H65A 2H63A 2Q1SA 2DFVA 3AOGA 2SCUA 1JWAB 4ZA2A 5TNXA 3E8XA 2D8AA 4ND5A 3MJ4A 3JQ9A 1PJ4A 1M67A 1ZKMA 1Y8QB 2WYVA 3QW2A 2DTXA 2IDZA 4J16A 3OQ1A 3ONEA 1UXIA 3JYQA 1D4FA 3A4VA 2HMVA 1ML3A 1DB3A 4CMEC 1E3EA 3EVTA 4NI5A 2UDPA 2W90A 1QSGA 1T4DA 1A72A 1J5PA 2C2XA 3EW7A 1JA9A 4GSLA 4WLNA 4YEDA 5T5QA 1LA2A 4K26A 1GAEO 4PLYA 4WCFA 2C0CA 4CM4B 3K8ZA 3D5QA 5JAMA 3L4BA 1HE5A 2YV2A 5EL0A 3VZRA 1N8KA 4L0QA 4S1VA 1MA0A 4MIOA 3QIVA 3QRWA 4Q3CA 4BKOA 4CLOA 3W1VA 1R15A 2DU8A 2PFGA 1P0CA 1QYDA 3VTFA 3KETA 5G0TA 3BHIA 1I8TA 1V9LA 3F9IA 3IJPA 3TL2A 5C37A 4GI2A 1BW9B 4FIZA 2OBNA 3DZJA 4QQRA 2QRJA 2YJZA 1KIFA 4FJ1A 3UCFA 1V35A 4A27A 1GZ4A 1UDAA 4W7IA 1YOVA 3HDJA 4IMPA 3VTZA 2Y93A 4F3YA 2PNFA 3CIFA 3DZGA 4F45A 1X14A 3WYCA 5IZCC 1JAXA 4BO9A 1U7HA 4YR9A 1YQXA 4IS2A 4J9VA 5I9LA 3HNPA 2DBRA 2X9NA 4KZPA 1HWYA 2D5AA 3U4DA 4E2XA 1YB5A 4XR4A 2W2LA 2FSVA 5BR7A 4J7UA 1PJLA 2BHLA 1MB4A 3GN1A 1PGOA 1B14A 3H7AA 3HFGA 3WR5A 2PKQP 4G65A 4F6CA 4B4OA 3E6AA 4N7RA 3R3SA 2C82A 1FDSA 4AJJA 1ZK0A 3ANMA 2YHIA 1I36A 1LDNA 4TRJA 3CEAA 1E5QA 1UXKA 3HFSA 4RPJA 2PTGA 4QO7A 2Y99A 3GPDG 4UVIA 3ZN2A 3UW3A 2R6JA 1WXDA 4E12A 3ZWOA 4FDAA 3JQ8B 2HSDA 4DWVA 1H6BA 5FF9A 1AHIA 3Q2KA 3I6IA 3O38A 3TNLA 2E6UX 1DC5A 2WDZA 5DULA 3W8FA 4XYLA 1A9ZA 1AHHA 1ZH8A 2FY8A 3DAFA 5BNIA 4MKRA 4UEOA 1FMCA 1YBVA 4HFNA 2FOIA 1EEHA 4WASA 4AFNA 4B3IA 1YGYA 2WJPA 3BYZA 1E7SA 2AE2A 3FF4A 1PL6A 1P1JA 1TEHA 1GCOA 2EXXA 2Y0CA 4GX5A 1H6DA 4Z6KA 1E92A 1SPXA 1C0LA 1CQJA 1QYCA 1WMAA 4IS3A 3BA1A 2B35A 4AICA 3H9GA 3V2GA 3GPIA 4FFPA 3ENNA 4EITA 1QYXA 3BMCA 4URFA 1B8UA 4OKNA 1ZMOA 4G81A 1F8FA 5IZCA 1K2WA 1MV8A 1ZJYA 2FPGA 4PIVA 2UUPA 1P33A 4CM8A 1O0SA 4PLCA 5JDIA 1MX3A 3IQDB 4B7XA 4RPLA 1VC2A 1PSDA 1WWKA 2CVZA 4MVJP 2FZWA 5I9NA 3MJVA 5ES3A 3JQFC 4IIVA 4JK3A 1LRKA 4KQWA 3D3WA 1LSUA 4ZVVA 3ZWYA 4CMIB 3WNVA 3ROQA 1GQYA 2OL4A 3ABIA 3C1TA 2HLPA 1GU7A 1VL6A 3TZ6A 4Z0HO 3MCVA 4Z3KA 4MIYA 2Q3EA 2B4QA 2B0JA 3ULKA 1NM5A 4JROA 1XLTA 3T4EA 1YE3A 4CR6A 2V6FA 3WG9A 2AQ8A 1E6UA 4KWHA 5COAA 2CF6A 3JQGA 2GZ1A 3M2PA 3F1KA 3ETGA 5IFLA 5DCUA 4DUPA 4MPDA 4KUGA 3WBFA 3Q11A 4RF2A 1PL7A 3CXRA 1ZFNA 1BXKA 1P3DA 2Y68A 1BHSA 4L4RA 4OOFA 3GVIA 4YT2A 4BGIA 1KEUA 1DRUA 3IUSA 2LDBA 4YTEA 1EBFA 3UAGA 4D3SA 4NR0A 4EUFA 3FR8A 4W6ZA 2JCYA 3GZ4A 1RM5A 4ND1A 4E31A 1N2SA 3QVXA 1I30A 4R69A 1Q1NA 2X9VA 5TRTA 2ZYAA 4CMCA 2WSBA 5B1YA 3DBRB 3PPIA 4CM1A 4R9SA 2VTDA 2ZK7A 1M6WA 2YDXA 3NT5A 2ZCVA 5HM8A 4BB5A 3JCZA 5TGDA 3PHJA 4I9NA 1Z6ZA 3RVDA 4YCAA 1D1TA 4PG5A 4DMMA 2Y1GA 3EVNA 1LNQA 4N5NA 3RASA 4RPHA 5BSEA 3D3EA 3QSGA 2BRUA 3IKTA 1MUUA 1LUAA 3UVEA 5K6AA 1JKIA 5CPFA 4ZQGA 4HV4A 1VKOA 3AM3A 3C85A 3RWBA 3ZWWA 2I9PA 1A71A 4AJPA 2AQKA 2AW5A 4NJOA 5KKCA 3W6ZA 1EVIA 1G0NA 3RJ5A 4HP8A 1YDEA 4K6FA 3RUHA 3TN7A 2CY0A 4DIBA 2O3TA 1EDOA 4YJGA 1PJTA 2IRWA 4DXHA 2PD3A 1OZAA 1YL7A 1XKQA 4EJMA 5TS3A 3ITKA 2XAAA 4A26A 4OM8A 1XYGA 5B12A 1O5IA 4ID9A 4A7PA 4ZRMA 5ITWA 3AU8A 3QLJA 1N1EA 4E6PA 2DPGA 1GZ6A 4TZTA 3HADA 3WB9A 4J0FA 1GR0A 5LC1A 4WCDA 3PDJA 4BV9A 3AU9A 1TXGA 4UREA 1ISHA 4ND3A 3R6DA 2J5KA 3LC7O 4RVFA 3CKYA 3WGZA 3L6EA 5EN4A 2G0TA 2NU8A 1R0SA 1BXGA 3H3FA 4I9UA 2CF5A 4CR8A 1GV1A 1PJCA 1YL6A 5IG2A 1QYWA 1TA4A 1NNUA 2IZ1A 1A7AA 2Q45A 5F1OA 1EFKA 1U3VA 2EF1A 4BNLA 1GYRA 1YO6A 1VKNA 2BKAA 4NU5A 2IXAA 3WGQA 3WGGA 2B5WA 4W9NC 1W0CA 3IMFA 4CMHA 2Y0EA 3L6DA 5EQFA 1R0LA 1OOEA 1WZEA 5G4KA 3H3JA 4NHEA 1EVZA 1Z45A 3FTNA 3RJ9A 1XQ1A 2YV1A 4D0RA 3AY6A 1P44A 1XWFA 2IXBA 2E48A 4YAGA 1HEUA 4IJUA 4BNWA 1IB6A 3O4RA 4J4BA 3EYWA 4LMPA 2IYOA 4QFDA 3WQSB 3PTZA 4NMHA 4RQUA 5KJCA 1LC0A 1UUFA 5KIAA 2QZ9A 3RBZA 3HG7A 4Z0TA 3GUYA 4LK3A 1T1RA 1B0AA 4BHTA 2FSSA 4PRLA 3ZWCA 3GGPA 5B4VA 1VSUA 3ZDFA 4GSKA 1XELA 4PFJA 4QO8A 4NIMA 4WUVA 4YBZA 2AA3A 1HDRA 1ZEMA 4BGEA 2X22A 2GRAA 3PJFA 4O1MA 1ISFA 3PHLA 3KVOA 1KVSA 3ZHXA 4QEDA 3TSCA 1QV7A 4TKMA 1NQ5A 1UZMA 3WYEA 3ORFA 3F5QA 4EJ0A 1I10A 4M8SA 3QY9A 3ZI0A 3Q1LA 3ROPA 2GGSA 2JCVA 1RM3A 3HB5X 1HYGA 1NQAO 3OJOA 3KTDA 3G49A 4UULA 2PGLA 2VZ8A 1ENOA 2OZPA 3QWHA 5JNLA 1E7RA 2DBZA 4FOOA 4RJTA 4D45A 4R51A 2A9FA 2GN9A 3WXBA 6LDHA 2OP1A 3IOYA 1LRJA 1JN0A 4RVDA 4OOEA 5U9CA 1C0PA 2VHXA 5DBFA 3H5NA 4FB5A 5C7LO 2DTEA 3PI7A 4R5MA 3HWRA 5IDQA 2GASA 3JTMA 1AUPA 2VZ0A 3TL3A 4CM5A 2XPCA 1EUZA 4XB1A 4RLHA 4RPKA 1LLDA 3I4CA 2P9CA 2HU2A 1UXGA 3R1IA 4CMIA 3RC2A 2AG8A 3NGLA 5H81A 4I5EA 1O89A 3HN2A 4J43A 1B7GO 1MLDA 2IZ0A 3TFQA 4DQUA 2VHZA 3H2ZA 4R16A 4YRDA 5CAEA 3GNQA 4Q39A 3S55A 4Q3DA 4WEOA 3O8QA 2ZIZA 3AFNA 3O03A 5L40A 3BHMA 3NEPX 4BMNA 2QZZA 1IL0A 1E7QA 2JL1A 3OEWA 1DFHA 4OAQA 4XCVA 3G1UA 4IUYA 3GEMA 4JBGA 5DF1A 2IODA 1ISJA 2VWGA 1PJ2A 2HMTA 5AXDA 1MP0A 4XWYA 1NPDA 1Y9AA 3EUWA 1IZ0A 3DZKA 1PGNA 1ENZA 3NGXA 2QQ5A 4AJOA 3VKUA 2WM3A 2V6BA 4CLOB 1TVEA 4LGVA 4Z0PA 3WGIA 2X5JO 4H7PA 3H9EO 4P38A 4Q3NA 3VOSA 4NFHA 2Y0DA 3WTBA 3OQ6A 2C07A 5AOVA 5BT9A 4OQZA 3IP3A 1W6UA 3NTOA 1BVUA 1JKJA 5F21A 2D3TA 4RZIA 2PZKA 3MEQA 1LDBA 2Z1MA 2FR8A 1Z73A 1DBVO 1YBAA 1EVYA 1CDOA 1EK5A 1YOVB 2NQ8A 5EQDA 4ALMA 1JKFA 2VNAA 1GUYA 3FNFA 1HF3A 4LVCA 4RL6A 3W4KA 1KVTA 1MC4A 1ORRA 2HDHA 5AXCA 1PWXA 1DJQA 4OMUA 2TMDA 3DAPA 3LC2O 3TZQA 3WS7A 3ZU2A 2JFFA 1RPNA 1YKFA 1ZSYA 3FHLA 4I5DA 1A7KA 2AQIA 5T67A 1Q7CA 1NTOA 3GLQA 1ULUA 4J2HA 1HTBA 4G2NA 4YVFA 4ONEA 4WECA 4AJKA 1KEWA 4II2A 3JYPA 1E3LA 2I66A 3AK4A 1B8PA 1OC2A 1PIWA 1T2AA 1F17A 4NQZA 5AYVA 2YHIB 1T2CA 2YUTA 3WMXA 3OHSX 1YDWA 3OJLA 2OO5A 1U7TA 3NYWA 5JO0A 4UVGA 3FBTA 4B4WA 2DVMA 2NTVA 3GMSA 1Z7BA 1SEPA 1I3NA 5KJ1A 3BHJA 4GAEA 5L4NA 3I9NA 2O4UX 4CL3A 2DUWA 3D7LA 1U3TA 2NU7A 3DTTA 3DOOA 2UUOA 4RVUA 4DC1A 1GZ3A 2CVOA 4BV8A 4Q3AA 1A5ZA 4D3DA 2XF8A 2HKIA 2EW8A 3OSUA 4J0EA 4PZEA 4HFRA 1AXGA 3GC6A 4XQGA 4R3WA 4BO4A 4KQXA 2O3RA 1Z7EA 2VWPA 4DPMA 3GHYA 5GZ6A 3KRTA 1E3JA 1JDJA 2JKVA 5CG1A 5CEJA 2J6IA 3I9JA 3AUTA 4IGFA 1U3WA 3OFSA 1K6IA 3RSHA 2BH9A 2VTEA 2JD1A 4BNUA 1M66A 4J91A 4QT0A 5G2OA 4Y8VA 4QXMA 3QVSA 4OHUA 4BGVA 4XD2A 4ZN6A 4E2YA 3EZYA 3BMCB 4J1SA 3FTPA 1E6WA 3EDMA 3U9LA 5BSGA 1Z74A 4IDBA 5I8ZA 4YDRA 2I76A 4E5YA 9LDTA 4CM8B 3H8VA 2W2KA 2OUIA 4HNGA 1DFIA 1PJ3A 3Q6IA 1Y5RA 3Q0EA 2X86A 1D3AA 3JQEA 5CDUA 4Q3EA 3IJRA 5DOZA 2JFGA 1DO8A 2X0JA 1DDOA 4OJNA 4N5LA 1ZW1A 3K9QO 3ROMA 3OA0A 3NT2A 2RHCA 4OKIA 5A3VA 4BKPA 2I5PO 4ZICA 3UOGA 1DHTA 3VKVA 1NP3A 3INTA 3F47A 5DP2A 3JQBA 5A5FA 4NU6A 4XYEA 2C5EA 2OXIA 4S3MA 3AOEC 1ADCA 1PJBA 4HFJA 3W4IA 2PH5A 4DBVO 1EQUA 2VCYA 4BNFA 5KJEA 1BXZA 4D7AA 3E9QA 3OIGA 4GWKA 4CM6A 1PEDA 3D5TA 3JQGB 1DFGA 3PGJA 4RZHA 5MGBA 1BRMA 3NJ4A 4RV9A 3VVCA 4LISA 1AXEA 3IS3A 3VDQA 2E49A 1TT5A 1WAMA 4O5OA 3SJ7A 3GRKA 4BNTA 4C7JA 4XRGA 2ZB3A 3D0OA 3GNTA 4WLFA 3RUEA 3LLVA 4TRRA 2I3GA 4QX6A 3O26A 4DL9A 4NBRA 4PG8A 1LDEA 4I1IA 4K9DA 2X0RA 3E48A 1R12A 3VZSA 4JJFA 3GH3A 3DOJA 1IZ9A 1XG5A 4I9HA 3QQPA 5L7TA 3RUDA 3ZU3A 2VUSA 2JJYA 3SEFA 3LDHA 1PJQA 3WSWA 2Q1UA 5FI5A 1L7DA 1W8DA 3IKVA 4RF3A 4TROA 2IYPA 5JDCC 4BO8A 3OICA 1HDCA 3OETA 4X54A 5DZSA 1PZHA 1U5AA 2VRCA 1DIGA 5JLAA 1GL3A 8LDHA 2JFHA 3VC7A 1N92A 4DREA 5ILOA 4R1TA 5JFOA 2EGHA 1KVUA 1JLLA 4D41A 3HB4X 1JAYA 4PG7A 4E5NA 2E82A 3H9JA 4AJIA 2D0IA 2LDXA 2P9EA 4B3HA 1NXQA 3VH1A 5C5IA 4PLTA 3JYNA 4U8GA 3RC9A 3GDGA 3P7MA 4IQGA 3AOEA 3GVPA 3LT4A 4WNIA 3U4IA 3FRJA 3GVXA 1BWSA 5KJ6A 2O3QA 1ONNA 4BMVA 3HDYA 1VL8A 3JV7A 3QWAA 3WGTA 4KP7A 4YJGB 3KUXA 3KEOA 1MXFA 3NTRA 4CJXA 2W4QA 4KUHA 4FFMA 2C2YA 2H5LA 3PLRA 4CMGA 4CLDA 3FN4A 3ZZNA 3OEYA 3DC2A 3HJAA 4E2WA 1GCUA 4RVHA 1Y5MA 2FPPA 3DBHA 2CSUA 1EK6A 1H9AA 3ANLA 1H5QA 4GH5A 5EIOA 2YQ5A 4W4TA 1D7OA 3EC7A 3GF4A 4ALNA 5KVSA 5EMHA 4CUZA 4MJLA 3G0OA 4FD3A 4NBTA 4WPGA 4P4LA 3MWDB 2VOJA 4RF5A 1GQQA 2EP5A 4U0JA 1HE3A 3WX0A 2QYTA 4EEZA 1SEVA 3E9MA 3BTUA 4IXWA 5DCWA 3DHYA 1LDGA 1BXGB 4DPKA 3K6JA 4FCCA 1H0KA 5ICMA 3PWKA 5FWNA 3UFXA 1NWCA 1HDXA 5A06A 2G82A 4NDNE 2EKLA 4PLVA 4RDIA 1XU7A 3BXXA 2GZ2A 4CR7A 2HCTA 2Y1OA 1FDWA 1EUDA 2JAHA 3ZWPA 2NADA 4L8VA 2Q99A 5G4KB 3WBBA 2WEKA 2JAPA 1P9LA 3I4FA 4E33A 4GBJA 1SBYA 4PGFA 1NFRA 1YH3A 5AQ1A 1Q0HA 1KS9A 3VH4A 3VZQA 2GN8A 4CMEA 3T7CA 2VHVA 5F1PA 4MVJH 2HRZA 2VYND 4EW6A 4BNMA 5ER9A 2BGLA 3AW9A 1E3SA 3GAZA 1T2FA 1Q7BA 3GVHA 4MVJM 3JQCA 1TB4A 4JIGA 3FD8A 1HL3A 2Q46A 3EZLA 4R1UA 3UXYA 4M54A 4A2CA 4BUCA 3PVZA 4GLLA 4CUJA 4O59O 3NX4A 1YJQA 3I83A 5B4TA 3AY3A 1BVRA 1YWGO 1GUFA 5A9TA 4DMLA 3HE3A 3FNGA 1P1HA 5AXAA 1GYQA 2NLOA 4NPCA 4BNYA 4TQGA 4UAGA 3ZHYA 4CQMD 2EEZA 2NACA 4XJTA 1F14A 4MOWA 4NNJA 2P2SA 2ZQYA 2Q1TA 2QIOA 1XIVA 3SJUA 4BVAA 3GDFA 4TZKA 2EKQA 3BTSA 4MVJI 1Q0LA 1V3UA 3GGOA 3WICA 3JD0A 1YVEI 3TZHA 3KHUA 3W6UA 3KYDA 1IOLA 5JSFA 1U8XX 5JBIA 1KERA 4JJIA 3KM0A 2Q2VA 5B37A 5TC4A 5JMWA 5JC8A 1PL8A 1LSJA 3U0BA 3TFOA 3U5TA 4PRKA 2C59A 2NWQA 3B6ZA 3WYBA 2FN7A 1ZSVA 3G17A 4FN4A 4IDDA 3LYLA 3BTOA 3ZNQA 4OQYA 4W82A 1RWBA 1U8FO 1UP4A 4DBZA 4KMSA 4KTTE 1YRLA 4MP3A 5CDGA 1F12A 2D5CA 3DBLA 3L0DA 2DPHA 4JCOA 4UVEA 4TRMA 4BNNA 3VDRA 2CVQA 1M2WA 2ZTVA 3F3SA 1EUCA 5G4LA 2PLAA 4M86A 4IQ0A 2DT5A 1WDKA 1N5DA 1E3IA 2Z5LA 3SC4A 5JMPA 4YACA 2GPTA 1WVGA 3H5AA 4LSWA 4GKBA 4E5KA 3O8QB 3KZVA 4YT4A 2O3UA 4XKJA 3I9OA 2O4CA 3VPFA 3ITDA 2ZJ1A 3C7CB 1HLDA 2YY7A 4PN3A 1PQWA 2VWQA 3PQFA 3WDSA 5IF3A 3MOGA 3U4HA 3PQDA 4CPDA 3LC1O 3PJGA 7MDHA 1R4NA 3PEFA 5TSDA 1LC3A 4CM3A 3GG9A 1WNTA 5L4LA 1RYDA 4U7WA 2PZMA 4ZD6A 3GN2A 4R54A 2X5OA 4RLSA 3PWZA 4G5HA 3S1LA 3KLMX 3QE3A 1VJTA 2DKNA 4OH1A 1FJHA 3C7AA 2P5YA 4XZ3A 1K6XA 3I5MA 4LVUA 4RVSA 5CG2A 2WYUA 1JVBA 2NVUB 3V1TC 1KYQA 2J5RA 1HYEA 3AM5A 4DA9A 4CM7A 2GSDA 3GUCA 2WE8A 1ZJZA 4Q9NA 2Y1DA 5KVVA 3GAFA 5IDXA 2ZYDA 1R66A 1GPJA 4IDCA 5T6BA 3K5PA 4GMGA 4J7CA 3Q9UA 4MDHA 3JQFA 4N54A 4L9RA 5K0ZA 4CV3A 4EJ6A 3CMCO 5JXWA 4D44A 4PLGA 2HQ1A 3NDIA 4DRYA 5G0VA 5T57A 1T24A 3LF1A 1IPEA 1ZBQA 2VUUA 3GFGA 1RKXA 2X23A 4IDFA 4DYDA 3OH8A 1P0FA 1E7WA 3F46A 1M76A 4LRTB 3AUUA 2EIHA 1A4UA 2P4QA 5JCJA 5ER6A 5G0UA 1R6DA 1K0UA 2AEMA 3H6KA 2HK8A 5A5EA 5LDHA 4R4JA 2JD0A 2EERA 2Y05A 3ON5A 4IMRA 3ENKA 1K3TA 4BQPA 1VI2A 4CM9D 2E4AA 4UUOA 2ET6A 4IJVA 1SOVA 4H3VA 4J4HA 4IDEA 1GY8A 3GEGA 4ITUA 4Y9DA 2Q49A 4BO0A 4P22A 4ZQFA 4I8XA 1NAHA 4RDHA 1BSVA 2NNLD 4E32A 1YL5A 1IPFA 1TLTA 3WFIA 3UCXA 1PTJA 1NQOA 1QLHA 2UYYA 1UJMA 4MVJD 5JAIA 1J0XO 1I0ZA 1ZMTA 2Y66A 3DQPA 2WWRA 2AMFA 3LU1A 4PLZA 4N18A 3CUKA 1OBFO 2P4HX 2YV3A 4DIFA 3DZIA 3EAGA 3X2FA 3RUCA 1PR3A 3B1FA 4DLLA 2GYYA 2Z1NA 4L73A 3TZCA 1CIVA 5KNLA 2GUGA 5KTKA 3PGXA 4RCVA 1YQDA 1BMDA 4LN1A 4FQ8A 2W2KB 2EJWA 5F5NA 5IN5A 4RF4A 3ETEA 4P4NA 2ZATA 4ND2A 4JNKA 3RUAA 1GEEA 4YJFA 4BO1A 2GNAA 4TWRA 1F8GA 5A9SA 3ZWAA 1EMDA 1LX6A 3ZWBA 4CLXA 2R00C 4UUNA 1X7DA 2VQ3A 1VPDA 2ZB4A 4IQ8A 4MINA 3GZNA 3QWFA 1VM6A 3JQAD 3FPCA 2GLXA 3NAQA 4DLBA 1Z82A 1W4ZA 3GEDA 4MP8A 1NYTA 3BZUA 2VYNA 5DP1A 4YAJA 2VT3A 1LQUA 2GN6A 2QX7A 4CV2A 4KUEA 1FXSA 4HUJA 5MDHA 3Q3CA 3DDNA 2PGJA 1HT0A 1KEPA 4B3JA 3ZWXA 1TT5B 1YXMA 1IY8A 2EW2A 3QVWA 3K96A 1Y6JA 2Q50A 2D2IA 1DPGA 2FR1A 3I9KA 1QYVA 3STHA 2J3JA 5I7FA 4FFLA 2NVBA 1H94A 5GY7A 4YAEA 1QG6A 1CYDA 5JS6A 4CQMA 2QRKA 1DRVA 1GUZA 5TQVA 3FI9A 1L7EA 4OSPA 3DAGA 4CODB 3IL2A 4XA8A 3VH2A 1F0YA 3HDQA 4CLHA 4DIOA 4OL9A 4D42A 3FWNA 2E37A 2OHXA 5EJ2A 2VRCD 1QORA 4YB8A 2EKPA 4OYRA 4XDZA 4AJ4A 4U6SA 3RKUA 4UVDA 3PWSA 2FZEA 2VOEA 5AVOA 4UUPA 2Y1FA 4BS9A 4W9NA 2PGDA 5COQA 3I52A 3GVCA 1PQUA 2AG5A 2RAFA 1WMBA 1X13A 1FDUA 2FP4A 2PKQO 3HQ4O 3JD3A 5TF4A 4LMRA 5KOIA 4EUHA 1LSOA 4FC6A 3HZZA 1I24A 2DQ4A 1ADFA 3A1NA 4DLAA 2F1KA 3RQSA 1U5CA 5T8KC 1I2BA 4IGEA 1VRWA 1PS8A 4HX5A 4QSMA 4AJ2A 5CEFA 3VH3A 5C3MA 4ZJUA 2NTJA 4JJGA 1V3TA 2CDBA 2R00A 2NTNA 4XGIA 3VPSA 1P1IA 2B83A 4J4TA 5KVCA 3DL2A 4R1NA 1AN9A 5H82A 3PJDA 3U4CA 4B8WA 4BNGA 2NU6A 3PJEA 4J49A 3WFJA 5JCXA 1LDYA 1LTHR 2J5QA 5ICSA 3V5NA 2VHWA 3VPGA 4C4OA 1HDOA 3OECA 3OJFA 3P5SA 5HS4A 3I6QA 3DZHA 4DPLA 3JD1A 3RBVA 1NWHA 4L4SA 1ZEJA 2W98A 4BQRA 1NR1A 4B7UA 2P91A 4XIJA 3DBHB 4NK4A 1VJ1A 2I65A 3RKRA 3MTJA 4UVHA 2HK9A 5J23A 4EDFA 2EJVA 2BELA 3JSAA 3TDKA 3S2FA 4KOAA 3ZV3A 4E4YA 1E3WA 3W4JA 2Y67A 1DC4A 3GK3A 4FC7A 1QMGA 4QTZA 3D4PA 2WE7A 3UCEA 3GA0A 3VHRA 1J49A 3AJRA 1SZJG 3DMTC 5L4SA 4JX8A 4ZRNA 5L51A 4ALJA 5ILGA 4O0LA 2VN8A 4J9UE 2NVUA 2FR0A 3KXDA 5A1TA 3QWBA 4JXKA 5HA5A 3DWFA 1FK8A 4OGWA 5EINA 4J7XA 5A02A 5DBIA 1UH5A 3HDHA 2O2YA 1ADGA 1PU2A 4PLFA 1O6ZA 2OOSA 2PWZA 3M2TA 5DDIP 2ZQZA 2WD7A 1HETA 4FJ0A 5T8KA 4PG6A 4Y6SA 1A4IA 2H9IA 4WJZA 4PCVA 5BSFA 1QLJA 3ASUA 2A35A 3F6YA 4PVDA 4DQXA 2YFQA 3AWDA 3KSZO 2HMUA 4NZ9A 2B69A 3ZW8A 3K30A 1ZXBA 5DCYA 1ZO8A 1MGOA 2BGKA 3DEYX 7ADHA 4A03A 1WP4A 4K28A 2ZJ0A 2EP7A 2NM0A 3E03A 4YRAA 3UHAA 2O7QA 4N5MA 2O48X 3S2IA 3SLKA 5HRUA 1C1XA 4IJWA 1U28A 2DLDA 3I9LA 1E1MA 3KYBA 4CM9A 3OJ0A 4AG3A 5L9AA 4ALLA 1LRLA 1XU9A 1TI7A 4JBHA 2P9GA 3SX2A 1UXJA 1UZLA 1X1TA 3F4BA 5CPBA 2YYYA 3VPXA 1HKUA 1K89A 4MIEA 3WSVA 4AJLA 1U4SA 1NFFA 1UDCA 2PH3A 4XYBA 3CINA 4M49A 3KYDB 3NRCA 2BFPA 1HDYA 1B3BA 3QVOA 4J1QA 5KKAA 3RROA 1Q2XA 3GRPA 1QRRA 1SOWA 2NVWA 4MVJA 1JVSA 3LSYA 1BTOA 1U9JA 4ND4A 2GCGA 3INRA 3H5RA 1WDLA 4ROSA 4YQZA 1DIHA 3D4OA 4LRSB 4PLWA 3ROKA 1KVQA 3OBBA 4J6FA 3U09A 5ADHA 2I67A 4EUEA 3RI3A 4O6VA 1JTVA 4LCEA 4BO3A 2X0NA 4MO2A 4DYVA 4CLRA 3DBLB 4M87A 2Y1CA 1DC3A 2PD4A 4A73A 1P1KA 2GZ3A 2NUAA 1WW8A 2BFAA 3MJCA 4GKVA 4H16A 4FJ2A 4QFCA 3PFFA 3QWIA 1I2CA 1DLIA 4O63O 1DEHA 1R16A 5JC1A 4OXKA 1U2DA 1PR9A 1YB1A 5LCXA 3TZKA 2JCXA 4ZHSA 3I3OA 4HWKA 3JQ9C 1UR5A 3ZV6A 3JQAA 9LDBA 1NPTO 2G76A 3C1AA 4UEKA 3DB2A 2A92A 1C1DA 3KYCA 3Q2IA 3RFTA 1I01A 5ENDA 5U1PA 1ISGA 4ZU3A 1UZNA 3ZHZA 3F4LA 3LT1A 4INAA 1KETA 1R4NB 1JW9B 1ZK3A 2UVDA 3CTMA 3AM4A 3EMKA 4WCFC 3I23A 2V6MA 3WJ7A 4CMKA 1PGPA 2ZYGA 5JW6A 2DUUA 1H6CA 3NT4A 3L4BC 4BKRA 2O50A 2X6TA 1N9GA 1QXSA 3RC7A 2AE1A 3G3EA 3P2YA 4R68A 2EGGA 3QVTA 1S6YA 2O2SA 2HUNA 1YQGA 3SLGA 1XDWA 2UAGA 2PV7A 4J90A 3PRJA 5A3JA 3UH1A 2VYVA 3K2BA 5F3RA 1VSVA 1YBMA 3UICA 3C7DB 2FWMX 3ZU4A 4FGWA 3VZPA 2O3SA 2FHSA 1NVTA 2DFDA 3WGOA 4D3FA 2C20A 4JQCA 1CF2O 1EE9A 1LLQA 2A94A 3WMWA 1E5LA 3OQBA 4WLEA 4BKQA 4XQEA 2PY6A 3PYMA 5JCJD 3CZMA 1GDHA 4EEXA 3PQEA 4CV0A 3SC6A 4EGFA 1ZK2A 1SMKA 3N58A 5TJ9A 1UAGA 1HSZA 3ZNNA 2J8ZA 4YJDA 3DO5A 1P31A 4J2OA 4WOKA 4EI2A 4F46A 5CDYA 1ZSNA 5TT0A 5T64A 2RH4A 1Q7GA 4ESOA 4U6QA 4XX0A 1LQTA 4Z9XA 3BMQA 1JU9A 1HE4A 3JQ7A 1KEVA 4IXTA 4J1TA 3BMOA 1PZGA 3AFMA 1MXHA 5KJFA 4GPD1 4U5QA 1ISIA 2ZTMA 3V1YA 3TJRA 4I5FA 5TX7A 2G5CA 3DOCA 1T25A 1H93A 1SB8A 1SC6A 4NK5A 4YJHA 3WGHA 1VL0A 2C54A 3VVBA 1H9BA 1OI7A 1M6HA 1N7GA 1P1RA 1AGNA 3E82A 4AJNA 4BB6A 2G1UA 2H1SA 4XIYA 1OAAA 3PIIA 3K2EA 2W8ZA 3M6IA 1DIRA 1SB9A 1RYEA 4FFOA 5JDCA 4B8ZA 1B16A 3WWZA 3FWZA 1EVJA 4WNCA 3V2HA 1O8CA 3ZGYA 3PZRA 1X7HA 3ZWVA 4II3A 4BO7A 3WQRA 4BNIA 1XEAA 3JQ6A 1XSEA 4CL8A 3CPSA 1ADBA 3W8EA 3B70A 4CV1A 4I08A 2EHDA 3P19A 3SVTA 2Z95A 5GZ1A 3WIEA 3I1JA 1G1AA 3RIHA 3E1KA 2DC1A 1NVMB 1IHYA 4GMFA 4YJFB 2RCYA 5CFZA 1T2DA 1A27A 5A9SB 3ST7A 2GERA 1P74A 3DONA 3JYOA 2C29D 1R4MA 2GN4A 4FGSA 1MFZA 4GL4A 5ENVA 5JO9A 1PS9A 3C3XA 5JDIC 3GZNB 1GEGA 4RORA 3NTQA 5IJZA 3NDJA 1XGKA 1QR6A 4DGSA 3U62A 4LSMA 4BNHA 2ZTUA 4XGNA 3K31A 3RFVA 4DVJA 1PX0A 2CDCA 5GZ3A 4JP3A 3KB6A 5IAAA 1LBEA 2CDAA 3AY7A 1WDMA 3PFWO 1GD1O 4FFNA 3LT0A 4ILKA 5HS6A 4E5PA 3TRIA 3C8MA 3M1AA 3WGYA 1NX6A 4Y67A 1KC1A 1CRWG 3NUGA 3PLNA 5JAZA 1T26A 4A5OA 3GQVA 1LU9A 2ILTA 5TJHA 3PHGA 5HTOA 1ZVMA 3DHEA 4IDAA 4CQMB 1IYZA 3BTVA 4FSHA 4Y98A 4Z3DA 1HSOA 2NSDA 1B15A 4NFSA 1Q0QA 4BL5A 1OMOA 1Y8RA 5CDSA 3PYLA 4GQAA 3UUWA 4AJEA 1KBZA 5L95A 4FBGA 4IDGA 4IBOA 4KDFA 1NFQA 2GD1O 5CHEA 3RFXA 1F06A 1MFPA 4YYZA 3DZFA 1EBUA 1KVRA 3A14A 3ZW9A 2D4AA 3CMMA 4LW8A 1SAYA 1G6KA 1RM4A 2DM6A 2B4RO 2WTBA 4CUKA 2HMSA 3EGOA 1E7YA 3UGKA 5COBA 4D0SA 1ZIDA 5B4UA 2X58A 3DR3A 2OP0A 3F1LA 2IZZA 4FS3A 1DRWA 2Y1EA 1LSSA 4NJMA 1WPQA 5BSHA 2QRLA 1SNYA 3A06A 3KV3O 3WJAA 3GG2A 5KVQA 3LLSA 1U2GA 2XOXA 1DOHA 3ONFA 1ONPA 2VT2A 4J1NA 1EZ4A 2PA3A 1PZEA 4FPXA 3WIDA 3D4NA 4IY1A 3BAZA 1OFGA 3JYLA 4R3NA 2BI8A 3K73O 2X8LA 2PR2A 1QP8A 5K6AC 1MG0A 1E77A 1R37A 2YDYA 1EDZA 1UXHA 2V6GA 1K5HA 1S7CA 2I99A 2X4GA 4D43A 1HYHA 1UAYA 3IP1A 1LI4A 3C24A 5IDYA 4Y6PA 4TVBA 5F1KA 4CLEA 1XQ6A 3ONDA 4ZQEA 2O23A 4HBGA 1ZXLA 4YWJA 4E21A 2DAPA 4WK6A 1PZFA 2BF7A 4AL4A 3GHHA 3S2EA 3PZBA 1E0DA 6ADHA 1E3WB 4IZHA 1VJ0A 1L1FA 1E1NA 3A28A 1ZNQO 3CH6A 2IEBA 1VE9A 3BMNB 4BNJA 4L74A 1V8BA 5GMOA 4GGPA 2WYWA 4IJKA 4MKZA 4A10A 1NBOA 1I5RA 3B1JA 3H9QA 3I9MA 3PXXA 2J3KA 3E18A 1GTMA 5EPOA 3RU7A 2HJRA 2VHYA 3ANNA 4RQTA 1T4BA 3FNHA 3ZNPA 4WLUA 1GV0A 1ID1A 2BFMA 3AUSA 1C0KA 4EZBA 4XB2A 1XHLA 4IZIA 4JN6B 1EE2A 5TLSA 4ZGWA 1LDMA 3EK2A 1W73A 2VNSA 3F5SA 4M55A 3B20A 4QECA 4UUMA 4Z9FA 5IDWA 4WGGA 1CJCA 3QJ5A 3CE6A 2R2GA 5L3ZA 4CMBA 1ULSA 1PJSA 1D8AA 2WD7B 1YS4A 3RD5A 4L76A 3OMLA 1HDZA 2BLLA 3FBGA 3OF2A 3AUAA 4IPTA 3WTCA 1I3MA 3G79A 2G17A 3M1LA 1P77A 1Y81A 4HADA 3LF2A 1I33A 3ETDA 1H2BA 1WZIA 3KBOA 2D1YA 1ISMA 3D1LA 3GT0A 1ZK1A 2OORA 1SCUA 4OXYA 2HAEA 4R01A 4BO6A 1Y8QA 3JD2A 3NDRA 4MVJF 2QW8A 4XGKA 4W99A 4KDEA 4GVXA 3IDSA 5A9RA 1UDBA 4ZQHA 4R1SA 4AVYA 5CEEA 2BI7A 4GLOA 2RBEA 5TIIA 1KY4A 1DLJA 5HBRA 3GDOA 4E3ZA 2QG4A 1C1XB 1I32A 3E9NA 4RPGA 1B8VA 4P4GA 1CERA 1X0XA 2BD0A 4BNVA 5JE8A 3UN1A 4YT8A 2Q2WA 5FEUA 4HFMA 4CMAA 2VUTA 5THKA 2GO1A 2C5AA 1IUKA 1X7GA 2ZTLA 4WEQA 4CM4A 1HLPA 5FFFA 2XXJA 4BNKA 4E5MA 5KWEA 1XCBA 4IM7A 2HRBA 2EWMA 3ADOA 3DFUA 1GFSA 2YFHA 1DC6A 1PS0A 2VZ9A 3PYXA 1PGQA 5HWSA 5IZ4A 4C7KA 1HE2A 2CD9A 3N74A 2IEDA 2Q4EA 1V3VA 4NBUA 4DTIA 3DZBA 4YQYA 1BW9A 4KWIA 2WMDA 3FR7A 4EYEA 3ZV5A 5THQA 4HY3A 3JD4A 5DNAA 4YAIA 2YW9A 2PD6A 1T1SA 4JLWA 1HZZA 1E1LA 3X2EA 5ITVA 2QHXA 3QA9A 4NG5A 2JHGA 1B2LA 5CDTA 1Z75A 4CLRB 4OO3A 3OIDA 4ZQBA 3T4XA 3OP4A 3DXFA 3GMDA 3FCOA 1DSSG 4KTVE 3KO8A 4PLPA 3S8MA 3VAZA 2AQHA 1TT7A 1DHRA 3R3JA 4IIUA 1GPDG 3GY0A 3L07A 3OM9A 3G1TA 3TOZA 3KSDO 3LZ6A 5G0WA 5H83A 3JQAB 4PZDA 3RBXA 4HXYA 4WKGA 1ZZEA 1GQ2A 5JYEA 3IAHA 1C1DB 1IHXA 3KYCB 1QV6A 3L77A 4XQ9A 3W8DA 4OIMA 4PLHA 3SBOA 4BIIA 1LLUA 4IINA 4XYGA 1BGVA 3ZNOA 3JQ8A 1BDBA 2B36A 2X0IA 2ZB7A 1M75A 1J4AA 4Z9YA 3FNEA 5FI3A 4AJHA 2B37A 5JY6A 4BO2A 4XEHA 3LK7A 4K6CA 5I7SA 1O95A 2YZ7A 1C3VA 3ZV4A 3V2UA 1I3LA 4R9RA 5BNTA 1N9GB 1OC4A 1UP6A 4J3FA 5I8WA 3GNSA 2CFCA 3RUIA 3TPCA 1I3KA 2VYVD 1P45A 2HK7A 1U1IA 3QP9A 4CQLB 1ZCJA 3O9ZA 4AJ1A 2GF2A 3E5RA 4XRRA 1QKIA 3TOXA 1T2EA 4JP2A 3WNQA 2YHUA 1BG6A 4H15A 1LLCA 2AEFA 3VPHA 4XR9A 2ZKLA 4PG4A 3INGA 2AEJA 5EERA 3ZWNA 3ZH2A 4BNZA 4DC0A 1HDGO 4M1QA 1K6JA 2V7PA 3U3XA 5FYDA 5C7IO 1MC5A 1ENPA 1ZK4A 2OBYA 1H6AA 1E7MA 1YB4A 1RM0A
chains in the Genus database with same CATH superfamily
1U0RA 1ZDMA 2IH2A 2CXNA 3F3MA 3L4SO 1D6MA 1U3GA 3Q6NA 1K92A 4KLCA 5U4QA 4DDMA 4MYDA 2AMVA 2B4TO 1KH2A 4ZYUA 4JUAA 2X6QA 3R9WA 1I1NA 1CNEA 1ESMA 3LX6A 3R9XB 4GRAA 4II7A 4C0XA 4EW3A 1OTYA 3ZLUA 1YUMA 3QBJA 4HB0A 3CLTC 3ZHBA 2HDNB 3JQ7B 4AY5A 1LPPA 1E99A 2AL7A 3FROA 4I1PA 1NNEA 2XUZA 4OCZA 4UM5A 2B6NA 1PT7A 1QZTA 2NV6A 4XYMA 1Z2OX 3CZRA 2I3ZA 4Y1EA 4TV9A 2N1MA 1XMPA 4MR9B 4JC5A 4AQYB 4Y30A 2AN3A 3ZC3A 4ZCSA 3UMVA 5E8JA 4WCFB 4WCVA 3SYKA 4TKVA 3RCBA 5LZ4A 3DE7X 3BMNA 3HUDA 3KDSE 5DOVA 3ZLTA 2YYAA 2GESA 3WLPA 4AP5A 1AH2A 1N1MA 3KD3A 1ZMBA 3NCHA 1F0PA 2UZ1B 4OI1A 3A1TA 4TTSA 5JY1A 1FTQA 4QT4A 2FV8A 4MVYA 3HLKA 4YAKA 2EZTA 2ZUCA 4WXRA 4HRAA 5JZ9A 2GCOB 3NJ8A 2WTAA 1L5YA 4MVJE 3FJYA 3EW9A 4NBVA 5ENZA 3U48A 1NASA 3QVVA 4TLAA 2P68A 2HBRA 2HC9A 4PONA 1VE3A 1W5SA 4B4UA 5J4LA 4U7FA 4LNUA 3KLNA 4L3OA 1CUHA 4OP1A 2QGZA 1U11A 4E51A 2QW0X 3C6QA 2B8WA 4TQUS 3QOXA 4X85A 4BDSA 3DBRA 1U98A 4RH0A 1NHGA 1Z34A 4YMWA 3IPYA 3GJ7A 5TQ0B 1BEZA 4U9IS 2ZYHA 5AW4A 1E9VA 3EGWA 3OURA 1X77A 1TC1A 2FN3A 3V8BA 3R0ZA 1G2QA 4GX1A 5EGNA 1IDN1 5LQJA 3IR5A 4XJSA 3HCWA 1E4EB 2W2LD 3V7UA 2X9GA 3TAHA 4D46A 2H6EA 5KOHA 1EWYA 2XMCA 1UBHS 4XFDA 3TNJA 1R4MB 2QYSA 3W79A 2X14A 4TKZA 4KH0A 3AR3A 1CJVC 1EFUA 1IH8A 1KZ1A 2OK8A 3OZ7A 4BE7B 5DN9A 5INTA 1RLOA 2Q4BA 4Y3UA 4EY8A 2IEYA 5C7OO 1U3UA 1R9NA 1VLLA 2I3AA 2MYTA 2IHNA 2F4VB 3UKOA 4DJ5X 1PUIA 4B8YA 3TG8A 5JSZB 2LRHA 3U49A 2J9XB 1FF9A 1J1IA 1FOEB 3ADPA 2PK3A 1Q92A 4GYWA 1HOTA 3CM0A 1DJMA 3RU2A 1WUIS 2A4KA 2V65A 2O8CB 3HP7A 1E1CA 3I04A 3A10A 2ZRLA 2DBVO 1HT3A 1D1SA 3AYZB 3WLKX 5DSZA 4O2AA 4UOEA 1YS9A 2C7VA 4FT2A 1U2ZA 3G82C 1BE6A 1USGA 2MR6A 2X8JA 1BD4A 1IEQA 3N8NA 3N75A 4Q37A 4RHTA 5FHRA 4C4TA 5FV4A 1QP0A 5HK9A 2EV9A 5IXYA 1HH4A 1P7PA 3PDUA 3V1UA 4JLJA 2AN5A 4ZCLA 2EG9A 4C3OB 1JA1A 3SJZA 2CJXA 3LX4A 1TW3A 3IAM1 3FHJA 3OFJA 4PINA 4DM4A 1Q21A 1AC5A 1GSAA 1RQLA 2K5UA 5TT1A 3B8EA 3U7QB 3KCQA 3MQFA 4MA0A 2MR5A 3K6RA 4G5YA 4ZVRA 2ZRGA 4YXWD 3B82A 5EESA 3IUQA 4F4HA 1FFWA 1Q11A 1P2BA 3PUKA 4N9QA 4MUYA 3MTGA 5IVPA 2XVXA 2R84A 5LYJA 3DHNA 1IWOA 1R2QA 1UP7A 4R5HA 3OX3A 3L8CA 3HH8A 4R40A 2JAOA 2QZSA 4BNXA 1BFDA 2FFAA 1GGFA 2I7CA 1VPTA 4M37A 2KMLA 3JR7A 5EJAA 5KQSA 3AI1A 4DCVA 3GLIE 1EE1A 5DXJA 3DE6X 2DETA 1WHTB 1Z8HA 3EOZA 1AKWA 4N76A 4FW8A 3H5IA 5A4DA 1EP2B 2YKGA 5EJFA 3MMZA 2IOYA 2K87A 3PP8A 4UEQA 4WZAB 3WY9A 5EC8A 4PO1A 5FPTA 5FOVA 2WUDA 3EPJA 1M1NA 2CL5A 3TVDA 2FE4A 1X0VA 4RD4A 4C43A 5CLHA 4B3XA 4BP1A 1GPNA 2OKCA 2NO1A 1COWA 3OFNA 3UJ8A 4ZZIA 5IHPA 2BFNA 4HGYA 1X8KA 3R09A 4GGMX 3AI2A 3DFZA 3WLFA 2PLNA 4GGOA 2X5KO 1N5MA 3EBOA 5KTSA 4Q3BA 2PMWB 3UJNA 2VT6A 2FZ5A 4X6YA 3QJGA 4ZFNA 3ASVA 4QIHA 4J16C 5KDOA 2C2ZA 4DARA 5I4IA 3DAYA 4NU0A 3ICCA 3LUDA 3O8LA 4H9GA 5A4FS 5BR4A 3RT1A 4BFTA 3FM9A 1COZA 3HCEA 1NR5A 2JFOA 1T8UA 3LUBA 1ZUWA 2VDOB 3PT5A 2CK3A 3QTTA 4NONA 4QUDA 4YAOA 4IR7A 4NCNA 5ALPA 3CSDA 3EVDA 1OREA 1GZSA 4L9AA 4CIXA 2H57A 3I5AA 4ARZA 1V0JA 3EQZA 4PWYA 4N41A 1V4BA 3LKDA 4ZMRA 1UKAA 1S8AA 2OLJA 1EQ2A 3A9CA 1BDHA 2AXQA 4PVCA 3UAZA 3BE5A 1Y7TA 4KLNA 4GWGA 3SI7A 2ZXFA 3T7EA 2BYTA 1DMSA 1HDEA 1M73E 2JJ2D 4I50A 4CN8A 2RI1A 4GC9A 2DE0X 4I6EA 1A9YA 3K09C 4ZQCB 4QPCA 2DBYA 2XXAA 2JFWA 4Y2UA 2ZJ5A 2D62A 5JEDA 1BDMA 2VDLB 1TAQA 3DTYA 5IAGA 3FSRA 2PUWA 2QJWA 4MQ5A 2H5EA 5KNBA 4GLBA 1GPUA 1RPAA 3O9VA 4FFRA 2X2EA 4PXAA 1PWYE 1T4MA 4HYQA 1B42A 4HDKB 4R0NA 4HNHA 3T61A 1DJNA 5GJWC 4I3HA 5HVNA 2OFPA 3PU6A 4B17A 4JUBA 1BFUA 3ZU5A 4MCHA 1ZUD1 2GBLA 1B8NA 4OUDA 3QENA 2I6TA 3QHAA 1I13A 2CKDA 4P8RA 4DRZA 1G5IA 2B6HA 3M4JA 1DOAA 5JATA 1T1JA 2A2ZA 4FHCA 3PUYA 3HO8A 4LQLA 3KOYA 1M2VB 1K7YA 2C7GA 5BWBA 1Z5UA 3NXKA 3WL6A 4LXXA 2Q1WA 3U39A 3I2FA 4M8LA 4GU5A 3RUFA 1W2GA 1Z6YA 4I8DA 4MJXA 4WOJA 2H63A 2DFVA 1F20A 2SCUA 3NYRA 4XWAA 1VYHA 3O0DA 1E2JA 4OFXA 1HK7A 2IXDA 5IPFA 1BRTA 2FSVC 2VXCA 3Q10A 4GZ3A 2WVAA 3BFXA 4DIMA 3C5VA 5TNXA 3E8XA 4IKPA 4LFCB 2MTBA 4ND5A 4RANA 4BV3A 1PJ4A 1J21A 1PVDA 1LS6A 1ZKMA 3BEOA 3BORA 2P2GA 2BN4A 4FFWA 4NTZA 4WAUA 2DTXA 2JKYA 4Y2XA 1Q44A 5L3SB 2D2FA 1UXIA 3UWMA 2NP7A 1SIBE 4URVR 2HMVA 2J0QA 1ML3A 2R44A 3OPYB 1GPBA 4CMEC 2IS2A 3DUFA 4X64B 1JALA 4Z2AA 2W90A 1ZRHA 2B1GA 1PI3A 1J5PA 2HNBA 2WWVD 4F11A 5JZOA 3OCJA 5H9VA 4RACA 3KSBC 5TDHA 1N57A 1QIFA 4MJ3A 2RB4A 3TXAA 4UATA 4WCFA 2ALJA 2C0CA 4JC4A 4LI0A 4A92A 1E2LA 1FVFA 5K6TA 4A0FA 4WNAB 4RTPA 4FNOA 5I4KA 4MUEA 2R6DA 4BVEA 1N2XA 1HE5A 1QE3A 1DBWA 2BKLA 3LUAA 2BEVB 1MABA 1O6FA 1DKUA 1G20A 1N8KA 4XVUA 4L0QA 5C34B 1PJZA 3GIDA 1G38A 1FMFA 1UBCA 1NUPA 1MA0A 3PNVA 4UQLA 2J09A 4ZCQA 4E08A 4BKOA 4EQ6B 1DO0A 5KINB 1R15A 3QIAA 1P0CA 4LKRA 4RBNA 3GUZA 1Y3AA 4QYIA 2WIDA 5BYKA 5JR3A 1O58A 1V9LA 1A8UA 4WZBA 3VVMA 3TL2A 4ZPXA 4EHHA 2IL1A 1BW9B 3CLSD 1NU8A 2BY4A 1GNVA 3I04M 4DJJA 4LFAB 4QC2A 2ZE5A 1K1EA 4CT5A 1HUQA 2OWEA 2PKYX 5TV2A 1WD5A 1KIFA 4PYLA 4AMUA 5KYNA 2OQIA 4ABTA 2B9EA 1G18A 4LF4B 1FTGA 4IMPA 5TQ2B 4YR7A 1Z0JA 1WXGA 1FYDA 4M9UA 4PPNA 4RZ2A 4KIWA 4WESB 1WV1A 4DCNA 3A9TA 4EKNB 4UTRA 1YACA 1NBEA 3L7MA 1U7HA 3DM9B 1I7DA 3KAPA 1TCCA 4O29A 1XDSA 4HAYA 5NULA 4IS2A 4K03A 1A5SB 2C5LA 2D5AA 2P4SA 3CSSA 4IHQA 4E2XA 3HBNA 4MWEA 4G0UA 4Q9KA 4KX5A 2F3SA 2IBMA 4JFAA 2FZGA 4Y6OA 3L6CA 4HNQA 1RWNA 1PGOA 3H7AA 5K0LA 2YJ4A 3ZY6A 3WK4A 4D99A 4PXSA 1WB9A 2FW9A 2I71A 1WPRA 3ANMA 3DC7A 3TZLA 3VX4A 1LDNA 2EOAA 3MUEA 3ASZA 4EG7A 4ZYWA 1UXKA 2J0VA 4RPJA 4ZU1X 3AUFA 5DBOA 5JWOA 3AEQA 4M46A 3V3KA 1NUUA 2BONA 2JHAA 4CCAA 4IGAA 1K7XB 1Y3FE 2GWRA 3ZWOA 4FDAA 4YP1A 1KSGA 4DWVA 4EVRA 1C30B 4CQNA 1E60A 5CH5A 4Y2QA 3JPYA 2J67A 1WTCA 1DC5A 5EZQA 3T9DA 3HHEA 4G84A 4MKGA 5BYBA 1I51A 3EDCA 2EATA 1MB2A 6PFKA 3EPLA 3BXGA 3GJZA 1KH1A 2AFRA 3CEHA 3WLQA 1ULBA 1T6XA 4MKRA 3U7QA 2GKOA 3B7PA 1YBVA 4PW0A 4X5OA 1LFAA 2HU5A 3D7RA 5B30A 2QTAA 3CA8A 3FTDA 4V0NA 5ALLA 2WJPA 4MYTA 1TAGA 4KI0A 3O4IA 3Q3JB 4MDYA 5CU7A 1RZUA 3WLJA 4HNVA 4WKPA 1WUKS 5MFPA 1GCOA 3CWCA 2HDOA 2H08A 4F0JA 2IYQA 4KNVA 4Z6KA 1L6RA 4LZPA 4UPVA 1SPXA 2PGOA 5ALOA 4LZLA 1CQJA 1CS0A 3C16C 3H84A 4NNOA 3HXQA 1QYCA 1WMAA 3VJRA 3MTBA 1TQ8A 4HAXA 3EIEA 2B35A 1Z4IA 3REQA 2LCFA 3I8XA 5CCXA 4EB6B 2AJTA 6REQA 2JLQA 3GPIA 3BCUA 1P0IA 1CUJA 1J1ZA 3Q7IA 3EVFA 3GCDA 4I1VA 2OCXA 3GFTA 1VLQA 3T7SA 3BF7A 1FNNA 4NG4A 2CL7X 4F92B 4G81A 4R1LA 1F8FA 2BUBA 3LLUA 1K2WA 3MJDA 3ME5A 2FPGA 3DEJA 4ZOCA 4WL0A 4BQFA 1O0SA 3EXEB 5LSAA 4B7XA 5IBRA 4G1FA 2WWTA 2NAFA 3OI7A 3GLGB 1W2HA 1VC2A 2W43A 5B36A 1TZJA 2FZWA 3O84A 2Q4OA 2B1IA 4YALA 3JQFC 4X7BA 3NASA 2PVCA 5CHYA 4CU5A 4G1VA 2XT6A 1G8GA 2JFPA 4ZVVA 2VCHA 1EGMB 4DFDA 3RHFA 1SIUA 3TQTA 2Q27A 2OL4A 3ABIA 2F8SA 1DPFA 3EWAA 5EWLA 3B3JA 3OIUA 4MI6A 1GU7A 3U2QA 3H05A 4Z0HO 5KEIA 4JU9A 1NT2A 2Q3FA 2YV4A 1RKBA 2P5SA 2B4QA 5FULA 3PQ8A 4JI2B 1XLTA 1T5TA 1YE3A 3AT1A 2FW8A 4CR6A 5HKLA 1YAHA 2G83A 4IL5A 2XGOA 5K0NA 3TTWA 4F97A 5E7JA 2GN2A 2K6GA 3PQ5A 1OZHA 2GVDC 2GMWA 3QU5A 5IWAB 3FOWA 1NATA 1TZKA 4M0PA 1DG9A 5DCUA 4MPDA 2V1XA 3LSTA 4LYDA 1E2FA 1LVGA 1P2UA 3AR9A 4JZYA 4PX5A 1ZH6A 5AHXA 3WAGA 3EG9B 3HYNA 2XZOA 2N46A 1BXKA 1PKEA 3GMIA 4FSDA 2CCJA 1GN8A 3ESYA 3E53A 4JJ4A 5DGHA 2ZRAA 1E64A 5C9ZA 4BGIA 1KEUA 1DBPA 4KQHA 1KFJB 1R8YA 5CTJA 3UAGA 2CFRA 2P9TA 4JLVA 4NR0A 4EUFA 3FR8A 2IEZA 3Q8WA 4ZKDA 5ALNA 1UODA 3HABA 3PXUA 1UMCA 1ZIOA 3ABRB 1N2SA 2XYHA 1Q1AA 3R7LA 1VI6A 2WIFA 4RS3A 4E31A 1HNWB 2CYAA 2X9VA 1BKSB 4CMCA 4ZOLB 3ZIDA 3HB7A 3K9CA 1L7PA 3MT0A 4LXQA 3WWCA 2PJUA 3JZDA 1QR2A 2DFNA 5L3RA 4MS1B 1H0SA 2RAVA 2JCBA 1RWWA 1Z0AA 1IVNA 4MQ6A 3EA0A 5JCPA 1F4VA 2ZCVA 1SHUX 3DTNA 4FUQA 4Y18A 2Q3DA 5TGDA 1KXZA 4ENVA 5ADWA 1DTSA 1Z2EA 3PT9A 4D74A 4YCAA 2JFVA 1D7AA 4PG5A 1BXRB 2VH5R 5AW7A 2ZXUA 3GFPA 1P5JA 4FWTA 5DW0A 3L7JA 4N5NA 1SCKA 3RASA 1L7VC 3D3EA 5J58A 2BRUA 1V41E 1PG5A 1P1CA 5KSYA 5LQRA 1EDEA 1BOFA 1QTQA 3C3WA 3LMKA 3L43A 1SG6A 4PF1A 1NJ8A 2XGJA 3F7NA 1PK8A 2QLNA 1JKIA 5K1ZA 4HV4A 4M1MA 3C85A 5K8IA 4X71A 1VLHA 1INLA 4HH4A 2WB2A 1RS0A 3DZDA 2AQKA 2AW5A 3H18A 3I2GA 4ND8A 3SHWA 5KKCA 2HZ7A 3EWNA 2HV8A 3OZTA 1XPJA 3SD7A 1SCBA 2QKYA 5BN5A 2CBXA 4BXOA 1UFKA 1THZA 2F8TA 1CZOA 4DIBA 2O3TA 3C3KA 3HPRA 2X0DA 2J6HA 3S2ZA 3UIEA 1FE8A 3UXHA 1S3GA 4D96A 4WNAA 5KSWB 2OV4A 2GAOA 2Q8NA 3CKKA 4TWIA 5JD4A 1CZKA 3NTUA 3SHTA 5LOVF 1CSEE 1URPA 3DVRX 2Q3LA 3ITKA 3HO6A 3ILSA 4OM8A 1SUCA 3Q5EA 1Y6QA 2AJBA 1UEIA 3R7SA 3SBDA 3P0JA 3WYFA 1R5BA 4ID9A 1H3FA 2I8CA 3V8VA 2Z3VA 4MKIA 5ITWA 3AU8A 1VJCA 4RV4A 3AI7A 2DPGA 3QVKA 1E8DA 3V4VB 3D6UA 3HADA 4EPTA 4J0FA 1OH8A 1GR0A 4QODA 5LC1A 3PE6A 4WCDA 3PDJA 4UREA 2X9QA 4DA4A 5DLDA 3FFTA 2PGNA 2C3YA 2I8LA 2JIOA 2LPMA 4LV6A 3LC7O 4NNPA 4ZWNA 4HQ0A 3HVUA 5DNYB 3WGZA 1XVTA 4KYTA 2BEJA 2BFFB 2G0TA 2XLCA 3TDNA 1BXGA 4X91A 2IBTA 4TTQA 3BWYA 4B9AA 5E0OA 2VXYA 3CUUA 4P1ZA 4HQLA 1YL6A 3QKRB 4N3NA 1Q84A 2H18A 3T38A 4NY1A 5F12A 4QOSA 1NVKA 1J7KA 3DFIA 3IO5A 4HK4A 4HDAA 2Q45A 5F1OA 3S29A 2YOGA 3BXEA 2EF1A 3OE1A 4AB1A 4BNLA 4G2TA 3GJSA 4KV9A 4R84A 2DHQA 1YO6A 5IC6A 3D4IA 2IXAA 1W4RA 3UC9A 1W0CA 1K5GA 4O4HF 3T3EA 3MCUA 4BV2A 3ISTA 2ZS8A 4HB4A 2PUJA 2J9FA 5BOSB 1QHNA 4WDQA 5IS2A 3NPAA 1L0BA 1MQSA 4MB6A 4U39A 4U3JB 3GLRA 1KMIY 5G53C 4FBLA 5JCZA 2PGXA 4YAGA 4JR1A 3G2MA 1CDEA 2A1UB 2RHJA 3O4RA 4Q7JB 2VPYA 3MSXA 3T3DA 1N3IA 4TQAA 3PCRB 3WQSB 2QR3A 3C5WP 2FAXA 3HEBA 1P4RA 3ODGA 1FRQA 1PV2A 4INPA 4NMHA 1LC0A 1UMBB 3SF0A 3W5UA 3RRJA 3ROZA 1O03A 1MHTA 3GUYA 4DDVA 4LK3A 1GAXA 1T1RA 1DZIA 1C30A 1I2DA 1W0KA 3NWEA 1QS0A 4H0CA 4ZPJA 3T0GA 4RULA 1J5EB 1VYUA 9ABPA 5ALWA 4KR0A 3ZWCA 2A88A 1MNQA 1VSUA 2R86A 3L05A 3ZDFA 1ZBDA 4NIMA 4XJVA 4WUVA 4NXNB 2AA3A 4EJSC 3EVAA 1R9JA 4BGEA 3VO9A 3O2QB 3FTCA 2RGBA 2ZUWA 1Q7EA 2JFQA 1ISFA 4E5DA 4IWYA 4V0LA 3KVOA 1U8AA 2AMJA 4TKUB 3BSYA 2WP0A 3CRVA 3FDFA 4TKMA 5JJLA 3HN6A 1H1LA 1Y80A 5ALDA 3AF5A 2K4MA 2OTCA 2WOOA 1RJFA 4A8JB 3IXLA 3E3AA 3HB5X 3SIRA 4WNYA 2HT1A 1ZOPA 4IAOA 4Q03A 1VDZA 2YIMA 4MR7A 5FAXA 3WLSA 4EAAA 1V2GA 2OZPA 1Q91A 3D7SA 3JQQA 5DISB 3SN6A 4H7DA 2ENUA 2QMUA 4FEGA 1KZ6A 4LQ4A 1P7WA 3AUXA 4CKXA 2GN9A 5F98A 1TYCA 2GAJA 3WXBA 6LDHA 3BMXA 1JN0A 2AG6A 4EVSA 2I1WA 4OLHA 5U9CA 1YBFA 5DBFA 2DTEA 3DF7A 3PI7A 1CJMA 4AF8A 1APBA 3TUZC 2F3PA 2ASEA 2CUTA 2J3LA 4Z7OB 1N8NA 3JTMA 5AW2A 5ALZA 1MGPA 4XLTA 4XB1A 1KYVA 4ZP1A 3T5AA 2PSEA 4RPKA 1SURA 3DF9A 1QHHB 2P65A 2P9CA 2CLIB 3IUBA 4NYMR 3OX2A 3BIJA 2REBA 3E3NA 3PXDA 4UD2A 1UJCA 5DTMA 2QI9F 1J39A 1G3RA 2G07A 2JGLA 5AJYA 1MA3A 1GRRA 3NWPA 3BB3A 5CXSA 1MLDA 3E58A 4NICA 5BQXA 5H9WA 1UBEA 3OE5A 2MT9A 2V5VA 2PJRA 2I6QA 4QNNA 4R16A 2C8JA 1RE1A 1HYBA 4YRDA 4GKJB 3IKLA 5CAEA 3C6BA 4JLKA 4Q39A 4N4AA 3AIMA 4Q3DA 4WEOA 4L7QA 4RABA 3QA3E 3HXOA 2VXBA 3ZZTA 1PR6A 1IL0A 2YASA 3I30X 4BMNA 1U0NA 2K7ZA 1DFHA 3RNOA 4OAQA 4XCVA 1SWVA 4L27A 3SE0A 1FP7A 3RSGA 2MIIA 1TTTA 3VR5D 4FZRA 2PXCA 4PY2A 4C6SA 4CT4B 1K6EA 1PJ2A 2HMTA 3DSRA 1MP0A 4PR3A 5DM4A 2EFYA 4LHSA 3OZBA 4GRIA 5C1DA 1OZ0A 3OUUA 3TR5A 1VPEA 3FDZB 4HDRB 1KAOA 1VJRA 3GRFA 1PGNA 2JAXA 1PJAA 3VKUA 1DEAA 3AFGA 1AGYA 2V6BA 5JH7A 4LGVA 4Z0PA 4RS4A 5IKOA 4ERXA 3JU3A 3G68A 2X5JO 4MRRA 3H9EO 2C9YA 4LJ6A 5C32A 4NFHA 5ITZA 3NIBA 1W0JD 2EFEB 1FP2A 3OQ6A 4Z4FA 1C4XA 1FNCA 1BO6A 1QVRA 3QFFA 1BVUA 1JKJA 3TRKA 3PUIA 5DLQC 3U3ZA 1N25A 1LDBA 4MS1A 4N7JA 3CY6A 3CZPA 3W34A 1YBAA 3T41A 1V43A 1IY9A 1WUTA 1CDOA 1YOVB 1RW4A 3PPXA 4DADA 1C9JA 3W9UA 5FA8A 2O2HA 2FEWB 3OPMA 4OPMA 2VHCA 5JOQA 1K7CA 1B1CA 2VH1A 3ACDA 4H1WA 4TS4A 3OE7A 3QNWA 5H7XA 4F56A 1DJQA 4OMUA 3WS7A 3LC2O 3KB1A 3ZU2A 4IV0A 4K9NA 3QEKA 1ZSYA 2AVNA 1A7KA 3G8AA 4M6WA 3LVBA 3LZDA 1NTOA 1RZVA 2ZRMA 3QYAA 4GE0A 1DTEA 1PFQA 3PNLA 1MEOA 2CNNA 4PYQA 1HQCA 3EG5A 4AJKA 2QAIA 1KJWA 4II2A 1SXQA 2I66A 4N65A 4F4CA 4M9ZA 4B6GA 1T2AA 3NBXX 1ZCAA 5KQGA 1F17A 5JJBA 1KSFX 1V5FA 5H0IA 3OHSX 5H3HA 3VR6A 1YB2A 2DPYA 1U7TA 5KKNB 1XCOA 2OD7A 4XCQA 4HDCA 2JAQA 1TA9A 2C97A 3ZJ4A 1OFUX 4D8UA 4AF7A 2A9PA 3HWSA 1U2DC 1V8FA 2DVMA 3WYNA 3R5HA 3GMSA 4KE6A 4V03A 1BKDR 2QLMA 2FZKA 3FYUC 3VV2A 4EATA 2O4UX 3U4QA 2PUBA 1JSRA 4DV0B 2VR1A 3P9CA 5EIFA 5KQRA 1AV7A 1F51E 2WU1A 3DTTA 1LZLA 4KLRA 1XMOB 1YIAA 1JB1A 1NY5A 1PD0A 1F9EA 3FVTA 1TVMA 4KHZA 4D3DA 2B21A 3ZGZA 2HKIA 3EZFA 3F5FA 3FSJX 3QVGB 4L4YA 3GC6A 3NOVA 3SDSA 5C4IA 1PQ4A 1ZH2A 2NPIA 4J0CA 4M98A 3P26A 4MWTA 1PNQA 4KQXA 2FTKE 2HH9A 4YMUA 5HKOA 1HQKA 2Z6VA 5B7PA 1Z7EA 2YXEA 4D6XA 3OQJA 5K03A 1TU4A 5HCIA 2WWIA 4MA5A 1NUSA 3OBIA 2CD7A 4RGVA 4XIIA 3C8HA 3V7FA 4X92A 5D1HA 4IGFA 1K6IA 1NQVA 3TNFA 4BLTA 1ODTC 3UAWA 5DTIA 1A2OA 2BUCA 4BNUA 5BNWA 4FFSA 5CA0B 5EZ5A 1XD9A 3K32A 4J91A 5DHTA 3X1JA 4QT0A 2HN9A 5DM2A 3ACBA 2RHTA 1N0HA 5AOAA 4IIFA 3D7KA 5G2OA 6AT1A 4XD2A 5B6IA 2HQOA 5GINE 2UXBB 1U2QA 2H4YA 1JQDA 3HVJA 2C8LA 3ESRA 4Q24A 3EDMA 4URYR 4DSAA 1E9FA 1I5OA 5I8ZA 3FPSA 4YDRA 5AKKA 1W19A 3NHMA 2W2KA 2I4NA 1NOKA 1Y5RA 4ZQIA 2X86A 5KAMA 1RKQA 3JQEA 2AZDA 3UA4A 4L28A 5JBNA 3ZHQA 4LE1A 3IJRA 1DO8A 4H3HB 3MINB 1RMYA 2X0JA 3PB3A 4FCTA 4XI9A 1DKQA 3J7TA 4OJNA 1RXUA 4N5LA 4OP3A 5SY9A 4I4TA 3OA0A 2A1UA 2OCGA 2ZVJA 3DT9A 3NT2A 3QG5A 3HL4A 4FGUA 5IVIA 5C18A 5LQMA 2XUGA 1H4QA 5HUQA 4CV0A 4G86A 1MQ8B 4ZICA 3ORRA 1U94A 1V2HE 2D1QA 2JJ1A 1J8FA 1IWPB 3F47A 3INTA 4OXXA 1UMBA 2JVJA 4Q0MA 3CLKA 2PS0A 4KAFA 3I2JA 5SZIA 3TNDA 4AI6A 1UPFA 4S3MA 1Z0UA 2RGRA 2V4ZA 1QG0A 5CT9A 1EQUA 5IRCD 1CJSA 1TLFA 2VJNA 1DELA 3UK1A 1UL1X 2YWDA 3WLIA 4A15A 5JJKA 1PEDA 2H0AA 2IVFA 3BL5A 3D5TA 1YASA 3TLYA 3PGJA 4NAVA 1VE7A 5MGBA 4FYPA 1YJBA 2C3MA 1HKHA 3IS3A 2AN4A 3VDQA 2R79A 4D9NA 3SJ7A 1TT5A 5DK6A 4TKUA 4BNTA 3OCXA 3D0OA 3DULA 2XW6A 1DG3A 4TRRA 3ZYZA 3PNQA 4QGAA 4DLPA 1Z88A 1W6RA 4FT4A 3D3JA 1R12A 3SQNA 3VPCA 4OSEA 2P3LA 3W5VA 4A8JA 1I7PA 1G42A 3UJPA 4C4AA 2HA2A 2GH1A 1IZ9A 2NPFA 3D5EA 1MCZA 1CRPA 4YP0A 1E9EA 2C2OA 2FZ4A 2P6PA 2ZYWX 3LCMA 5ALJA 4KK4A 5LB2A 1OB2A 1OH6A 1S1MA 1CHDA 1A88A 3SEFA 1DC8A 5FBKA 1PJQA 1FNSA 2F62A 5FI5A 3PQ2A 3DS8A 3QG1A 2BP7B 3IKVA 2HNKA 1ZGCA 3O92A 4IDHA 5JDCC 4LJ5A 1W1UA 1A82A 1ZGJA 4BO8A 4E11A 1G3QA 3U44B 4KQKA 1ECFA 4S04A 5KMGB 1U5AA 4CKBB 3P0IA 2QUZA 3EFBA 3CKLA 3HBLA 5JLAA 1FXWA 2QN9A 5KPDA 3L6BA 2YWJA 3ZTTA 1FVOA 2Q5JA 1KZ9A 2WZCA 2JA2A 4GPAA 4R8VA 3LGSA 4B34A 4PBSA 1N3YA 1IG0A 1N92A 5DTQA 4DREA 5ILOA 4R1TA 3FUWA 2ACWA 2AOUB 2EGHA 4FXPA 1NJ6A 4E2FA 1IBCA 1QFMA 2WA2A 4HLQB 4AY3A 3GLIA 1C0EA 2FHPA 2FPWA 3H9JA 4LMBA 3NMUF 2H1WA 3FZQA 5LQNA 3AM1A 3WRYA 1U31A 3IDQA 4B4DA 3VH1A 1MD9A 1S8NA 4PFKA 1VMDA 2Q8PA 3N76A 4Q9JA 4EA7A 4U8GA 3BRCA 4IQGA 3U4IA 2ZULA 1CUZA 1BWSA 1NDUA 3GVXA 3N0RA 1DNPA 4RESA 3KEFA 1WLSA 5A7GA 5LR6A 3QWAA 3EUAA 4GPZA 4KP7A 4YJGB 4FFBA 4W5TA 4CJXA 1KDTA 2RFLA 2REOA 4QOFA 1NBME 4PBRA 3OEYA 4H60A 1XCJA 2XYPA 1GCUA 2WF8A 3DCYA 1D2EA 1Q19A 2XMRA 4X7RA 5AVRA 2AZTA 2CSUA 3IJEB 3R8CA 2W2QA 5E8RA 1C4OA 2NPOA 1EK6A 3BZBA 2Q6OA 4O25A 4EG6A 1JQJC 1H5QA 2PAFA 5EIOA 1MR3F 4MJ7A 4W4TA 5F4BA 4HWSA 5JRZA 5CYFA 4X97A 5EMHA 5E2IA 4ENUA 3G0OA 4FD3A 3AF0A 4WPGA 3ZK9A 5IDVA 5I5EA 2FKAA 1TVCA 1GQQA 3RYFB 3VR4H 1POXA 1HE3A 3G13A 5DN6A 2VPQA 4BLRA 4EEZA 4JLSA 2F67A 1D2GA 4P4UA 3E9MA 1IJBA 1NMSA 4MO9A 1A9QA 1KDYA 3MHPA 2NU8B 5JCOC 4CKWB 3SQOA 3ZVKA 4HLUC 4G97A 3WKBA 1N7IA 2HA0A 4PCUA 4EJFA 3PDWA 1T29A 3DKIA 1JUDA 1H0KA 3OPXA 1W5TA 3PWKA 4KN8A 1NWCA 4QNRA 2O0HA 4Q4DA 5A06A 1JAHA 2FG6C 3R8XA 4POOA 2EKLA 3PUWA 4F85A 3GBPA 2GEBA 2GPAA 4BVGA 2G4VA 4QRDA 4BBAA 1JKMA 2DWPA 4CIWA 3FTEA 3O8NA 1Y5LA 3BXXA 4DR7B 3IQWA 1A77A 3STWA 5BW6B 4XVHA 5EIBD 5DM60 1OLXA 2JAHA 4GM1A 4NYJQ 5LL6P 4BFVA 4BEBA 5DLEA 5C8ZA 3PITA 4RXMA 4KQCA 2R7NA 4HB2A 3I4FA 4E33A 4D5EA 2FJPA 5FL3A 1SBYA 1QF6A 2CHQA 2ORVA 4YHBA 1NFRA 1YH3A 3LRTA 3OIYA 4KFSA 4MQLA 4ODIA 3OQPA 5AQ1A 1IBMB 1KS9A 3BUSA 1DQSA 3FFXA 1MPXA 2HLHA 1XE3A 4K3UA 2HRZA 2VYND 4P81A 3F6EX 4B82A 3LXXA 4HAWA 3HA5A 2CNWA 5JS8A 1Y0BA 3GVHA 4MVJM 1Q7BA 2BGWA 6GPBA 3JQCA 3L0CA 1BGXT 1F6BA 3UXYA 4DKXA 3T95A 1Q77A 3E22B 4M54A 4QUEA 3ZLVA 4A2CA 2HPVA 2AEEA 3ENWA 1FL9A 1RPJA 3I83A 3IODA 2VEDA 5L3QB 3WMFA 2XRYA 1WU8A 4QBKA 4XPIB 1BVRA 1EM6A 1AG9A 1GUFA 1YWGO 4B87A 1WSWA 4BE9A 1RP1A 5DK4A 4AO7A 3FXAA 1EYZA 5FT9A 5AXAA 1GYQA 5E95A 4O4IA 3HV0A 5B5SA 1TZCA 4MRNA 3OP1A 4DR4B 2EEZA 1QRUA 3FCYA 5LA6A 3SG0A 1V6SA 3CEJA 4XJTA 2AJCA 4NNJA 1CZUA 3V42A 2Y4NA 3RVJA 4QTYA 2OGSA 4U63A 2EAUA 3FUVA 1E5DA 5G3ZA 2Z9BA 2JHCA 3QMVA 4MVJI 3GGOA 2OKGA 3JD0A 5EKSA 1YVEI 1PD1A 2ES4A 2Q9CA 3KKLA 3KYDA 4ZT2A 3W7VA 3MD0A 3VMMA 3VPDA 1YR2A 1IHDA 4I55A 1Z7WA 2HHLA 3AQIA 5AMXA 5TC4A 1BD3A 1E63A 3R3VA 2OV8A 1PL8A 3VX3A 1KI4A 3TFOA 4Z4EA 4GHWA 3U5TA 4KPFC 4XGQA 4AKIA 2C59A 2EJCA 2PYZA 3M5CA 3Q0IA 3BK1A 3B6ZA 4FI3F 4KXMA 3NOQA 2VQEB 1TYDE 1YB6A 1ZSVA 4LJKA 3LYLA 4YP6A 4M9SA 2JKZA 3BTOA 3A1FA 2AD5A 4DMHA 2OO7A 1QIIA 4QPPA 1XLVA 4W82A 2RIPA 5DGDA 1ODFA 5A4JA 4DBZA 3QXXA 3VYRB 2EKZA 4KTTE 3F7OA 3HCAA 1RQRA 4RVOA 5CDGA 1KOGA 3A3NA 1XF1A 4Q48A 2FOLA 4UVEA 1KKUA 3KCNA 4G9BA 4P2BA 3P0RA 4QXRA 3SBXA 5A5DA 1YS6A 3G2LA 2ZTVA 5K6RA 1EUCA 4F21A 4NRDA 3EXHA 4ZOLF 1ZRSA 2DT5A 4U2CA 4XUGB 1E3IA 2G08A 2Z5LA 3SAJA 5JMPA 4YACA 3SC4A 1F7VA 2GPTA 2PRJA 2FK8A 2IWHA 4DY4A 4KRXA 4GKBA 4E5KA 1M6EX 2CXXA 3AF4A 3O8QB 5GV8A 3ZPXA 2X4DA 4EYQA 4KU4A 4YT4A 2O3UA 5AW8A 3GBVA 4XKJA 3LY7A 2JZOA 3AY0A 3DV0B 4IICA 4C6TA 2HA6A 1L4GA 2W0SA 3E1GA 2E55A 1HLDA 2GUWA 1T3GA 4PN3A 1IXSB 1GUDA 3WKEA 4YRJA 2QX8A 3COPA 4HDQB 3O8BA 2Q6VA 3MOGA 3WDSA 4BFCA 5I7WA 3CZ5A 5EHQA 3KVRA 5FV7A 1JE0A 3QMWA 1QTRA 3PEFA 3L7AA 2D8MA 3UJ9A 1WNTA 5L4LA 2QTCA 2E85A 4Q1VA 5AM2A 3ZCRA 1UIMA 4L5CA 2PZMA 4TTPA 3NLLA 3CVXA 4KXFB 3MRTA 3N7TA 4OQEA 1GA4A 4RLSA 1B2RA 2NUPB 5IVKA 1YQTA 2R8OA 3PWZA 3BILA 4Z54A 3C41J 3HXLA 4YLEA 3RJZA 1VJTA 1EFPA 2IX9A 3PBKA 4LDPA 4L72A 4Q1BA 3A0RB 1RPZA 4WBNB 2BHTA 4NBSA 4YX9A 5CG2A 4QDZA 4KGDA 2QLBA 3TQSA 5BUQA 1LPSA 3N5KA 2NVUB 5KMGA 3R6LA 3BXOA 4BFUA 1SKUA 3AM5A 4DA9A 2PUHA 3VZBA 3T5GA 2GSDA 3CUYA 2JATA 1F8UA 2YOFA 4Q9NA 2Y1DA 4DJFC 2ZYDA 1R66A 2AOUA 5TVKA 5EPUA 4C87A 1FX0A 3FUUA 2IVZA 4B73A 2WKRA 2HXGA 2NXNA 3U81A 2A30A 1JYSA 1XTRA 4GYKA 1GLGA 4EJ6A 2ZUTA 5JXWA 2Q5FA 2FPKA 3KOMA 4PLGA 4BX2A 4RAOA 3NDIA 3G5TA 4QOJA 2J31A 3THRA 3HUFA 2REQA 2KE5A 4CI9A 3A2KA 1QUFA 3HBFA 3I1IA 5T57A 2BCEA 3PNSA 5F2OA 3T7JA 1KRXA 1BN7A 4WXHA 4KE7A 4DNFA 3DL0A 4PN7A 1SA0A 4B84A 3S1AA 3GFGA 1QO0A 1J20A 1YD7A 1L4MA 1QKJA 2EFJA 4D02A 3GRRA 4QXQA 1GQOA 4EMUA 3INYA 3R44A 1M76A 4LRTB 2KBFA 3FHTA 1KI8A 2EIHA 3ESQA 3I61A 3NHPA 5ER6A 1CY4A 5EVCA 4XLLA 3ZS9A 4DCOA 2PZFA 3SK0A 1JR3E 3H6KA 1Z36A 2HK8A 5JD3A 2EERA 3B2NA 3DCIA 4G9EA 4EUKA 1A76A 2I54A 2O2EA 2PH7A 1N1DA 1K27A 1KI3A 1NMXA 4G0PA 1S9HA 3PA6A 4H7HA 4CM9D 3B53X 5CVCA 5ALKA 3CZAA 4IJVA 1SOVA 2XNJA 2F1OA 5B55A 3U60B 4NMLA 3FYDA 2PDAA 2ZETA 4J4HA 3ENZA 3G6WA 4K6HA 5DASA 3O7WA 4I2VA 1KJQA 2HRQA 1PL0A 3CU5A 1K68A 4ZQFA 4I8XA 1VZ3A 3USCS 2O5EA 1M6VA 1X70A 2GSWA 4YUVA 1AUVA 1GG9A 4E32A 1YL5A 4XWTA 4Z4QA 1IPFA 4CHGA 3OLWA 3QELB 4NZNA 2R2AA 5EE5B 3LV8A 4HNUA 3TMAA 5JAIA 4N3AA 1IN7A 1QX4A 3LT5A 4TLMB 3KG2A 1VB3A 3DQPA 4TMYA 3LU1A 4PLZA 4N18A 3C8ZA 1QFXA 1OBFO 1WDTA 2YV3A 3FB1A 4YMGA 4ES6A 5HUHA 2DY1A 3KUDA 3O1LA 3R7FA 3RUCA 2JGIA 3B1FA 4DLLA 2Z1NA 2IIBA 4NBLA 3T52A 5JQGB 5HJEA 4P3OA 5KTKA 3PGXA 1AA6A 1KMHA 4CXMA 2XA1A 1JBEA 1QBKC 1ZU5A 2H2HA 4G8DA 3KTAB 4PNHA 1J06A 3KFLA 3NHBA 4LN1A 5EYPA 2DR2A 1JFFB 1QB8A 1U8ZA 3M81A 4KQ6A 1OLSA 5KNDH 2H5IA 2IY7A 1V9CA 4P4NA 2O2GA 2ZATA 4RD6A 3ZE9A 4E4TA 5GTDA 1K86A 5C5CA 4K9QA 2OXEA 3VKWA 1G1MA 1NKTA 4O2LA 3WQBA 4DS3A 2GFIA 4TWRA 1HT2E 2A86A 3KYIB 4Y2TA 1Z4QA 4L6IA 3ZWAA 2ZJ2A 1EMDA 1LX6A 1KJJA 3AQ4A 3FZGA 5FTWA 5CBKA 2WV9A 1T36B 3O91A 4JC0A 3TINA 4CEJA 2EX0A 4UPEA 2VQ3A 1OLUA