1EDOA

The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with nadp+
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
244
Chain Sequence
SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLALSPAASYITGQAFTIDGGIAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
publication title The X-ray structure of Brassica napus beta-keto acyl carrier protein reductase and its implications for substrate binding and catalysis.
pubmed doi rcsb
source organism Brassica napus
total genus 84
structure length 244
sequence length 244
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2000-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1edoA00
3V2GA 3WX0A 4J6FA 5EN4A 3KUXA 1Z75A 1XCBA 3DBRB 1KY4A 3PYLA 2FZEA 4IS3A 1OFGA 4PVCA 1CYDA 2Q2VA 1MC5A 2C20A 3DZIA 4J91A 2HAEA 2HMVA 1E7RA 1WZEA 1H6BA 4AJEA 2PWZA 4IIVA 4YJHA 2NU8A 1LSUA 4GKVA 3GZNB 4KOAA 4D41A 3DMTA 1I2ZA 3DONA 3F5SA 4Z0HO 2DPGA 4ZICA 4RF3A 1YQGA 1XDWA 3PJGA 2NVUA 5CFZA 3PYXA 4IJKA 2CF6A 5A9RA 3ZHZA 2ZCUA 3GN1A 3GNTA 5JDCA 3UCXA 3MTJA 4XZ3A 3SLGA 1Q1NA 2GR9A 3R0IA 1RM4A 3D4OA 4IBOA 4BNGA 2Q99A 1X7DA 3LLSA 4J4BA 1JVSA 4GL4A 1FF9A 3VKVA 3OQBA 3L9WA 1BTOA 2CUKA 2ZKLA 1SBYA 1Y7TA 4K6FA 4Z3DA 5TC4A 4CMHA 2P68A 3DZBA 5DNAA 4RVHA 1M66A 5T8KC 4B4UA 4ZHSA 2OL4A 3PLRA 4BL5A 1HRDA 1NHWA 2IXBA 3JQBC 2X0RA 1S6YA 2YV1A 4NNJA 1O94A 4CMIA 1I3MA 2WYUA 5IJZA 2DQ4A 2WD7B 3TDKA 1ORRA 4FN4A 3JQBA 4JXKA 5AXDA 2DLDA 5I7EA 1AXEA 4IQ8A 5TT1A 3NRCA 4IDBA 1LC0A 1KYQA 3GFGA 4BS9A 4L75A 1P31A 4JBGA 5CEEA 3RKUA 1B2LA 3IJRA 1VRWA 3KSDO 4KTTE 1ZH8A 1ONOA 3NJ8A 3FRJA 4FFPA 4MVJM 4Y6SA 5IXSA 4NZ9A 4O0LA 3WICA 3OA0A 4E4YA 4QO7A 1X0XA 4M8SA 5A9TA 5TNXA 3LC2O 2WJPA 5FF9A 3B70A 3GDFA 2RBEA 3D5TA 1EK5A 1DBVO 1UR5A 4HP8A 4E30A 2E37A 5C3MA 3A28A 1NR7A 2AHRA 3E18A 3I9JA 1NX6A 4WLNA 3RUEA 3RC2A 1UZNA 2F00A 4OH1A 3UICA 4E32A 1FK8A 2DT5A 2X5OA 4CJXA 5AVOA 4CQMD 1DRVA 4CLRB 3KXDA 1H2BA 2BLLA 3CTMA 1GDHA 2VHYA 1PZGA 3F46A 4FC6A 3ZU3A 3ZWNA 1X13A 1YRLA 4DRYA 2EGGA 2I3GA 3O8QA 4YT4A 1WXDA 5JNLA 2QX7A 2OMEA 3H9UA 5G0SA 2VZ9A 4PN3A 2I5PO 2C82A 1GYRA 4LRTB 2DTXA 3GVIA 4TRNA 1WW8A 3JQ7A 4U7WA 1KIFA 3RWBA 2J3HA 3ROPA 4WECA 3JYNA 1XU9A 1JN0A 3RU9A 3KEOA 3R3JA 2YHIA 1ADCA 4II3A 4FR5A 3QWAA 1ISMA 2GN9A 2O2SA 4BO6A 2QRJA 4PZDA 3GF4A 4Z9FA 5ENDA 1U4OA 3LU1A 4EW6A 3OJOA 1ZFNA 1UZLA 4GWGA 3RFTA 1G0NA 4CMIB 1JKIA 1GUFA 2W2KA 2Y05A 2QYSA 1IZ0A 2PR2A 2PTGA 3D64A 2E6UX 4ZD6A 1PJSA 1UXKA 3WSWA 1DPGA 3H9EO 1BG6A 1YB1A 1CETA 1FDVA 2NWQA 1E3WA 5JXWA 3IL2A 4BNMA 4JLWA 2D3TA 2WYWA 1UAYA 1ULSA 1XEAA 4HFJA 2WEKA 3EYWA 3P5SA 4W7IA 2FOIA 1DIAA 3BZUA 2CDCA 2BGMA 5CHEA 2EIHA 1V35A 3DQPA 3JQCA 2Q45A 3F3SA 1GTMA 4JROA 4MKZA 3TZQA 4D0RA 2YUTA 3KYBA 1RKXA 2XXJA 3PGJA 1J4AA 2E82A 1J49A 1NAIA 1GD1O 4I9HA 3C7DB 4CV1A 3CEAA 1E5QA 5BSHA 3GNSA 4YPOA 4DLLA 4WNIA 4NJMA 2I66A 2CDAA 3QE3A 1T25A 4ESOA 3GC6A 3UFXA 1W0CA 3A14A 4HV4A 1NP3A 3M2PA 4L9RA 4D44A 5CDUA 4R5MA 2DPHA 3IS3A 3OEYA 2C5AA 3O8QB 5TGDA 5BNIA 2D1YA 1CIVA 2RH4A 3HB5X 1P1KA 2NQ8A 2A35A 1ISIA 3ROQA 1QORA 1T2AA 3BHMA 2C29D 4U8GA 4CM7A 1R0LA 4BNWA 3AFMA 3HDQA 2BH9A 3JQ7B 2C2XA 4RCVA 2X0IA 3S2IA 1XU7A 3MWDB 3ZV4A 3P2OA 5FEUA 2YHIB 3U62A 4RVDA 2HLPA 3OIGA 4HBGA 5C7LO 2VNAA 5I9NA 3H4VA 1L7EA 2OGUA 3K2EA 4BHTA 3L6OO 3I5MA 3TL3A 1N1GA 2W2KB 3I6QA 4PLVA 5THKA 4FPXA 4YT2A 4J2OA 1R4NA 3K6JA 3KSZO 4IZIA 3UCFA 3LYLA 4CM1A 4BNFA 3GVPA 4YJFA 5L3ZA 5ER9A 1YB5A 4YAIA 4MVJF 1Z82A 2FPIA 3N74A 2DTEA 3SEFA 4TZKA 3LT1A 4CUKA 1YGYA 2UUPA 1E3WB 2Q2WA 1U8FO 1PJBA 2WYVA 3O9ZA 4KP7A 4WLOA 4CMEA 1HYHA 2FMUA 1PQUA 4QTZA 4PVDA 4B8WA 3LT4A 3IKVA 4XX0A 4RPKA 4AG3A 4CQMA 3N7UA 5I8ZA 1PZFA 5TJHA 3C1TA 2FR0A 1NQAO 3LC1O 5DP1A 4XJSA 2Y1EA 5EL0A 1QSGA 4Z0TA 3V1UA 3VAZA 1CEQA 3JQEA 4NBWA 3PLNA 1LQUA 2HKIA 5U9CA 4ZQBA 3NT2A 4NJMB 1E7MA 4NIMA 2IDZA 2J3KA 3EDMA 4BQPA 2OXIA 1ISHA 4DVJA 1YS4A 3U09A 3H3JA 3L0DA 1I5RA 4OSOA 3VDRA 4AJ2A 5JYEA 5JS6A 2OBYA 2VUTA 3AUAA 3DOCA 2X9NA 4E5KA 5DCUA 2EV9A 2XXBA 2QIOA 1I36A 4K9DA 4KDEA 4J9VA 1KC3A 4NBRA 3EY4A 3TN7A 1O5IA 1GY8A 4M89A 3V8BA 2Y0EA 3RROA 2HK7A 2W4QA 3M6IA 4DLBA 1XQ1A 4TKLA 4FS3A 4NDNE 4EEXA 4ND4A 1SEVA 3ZU5A 4XD2A 5A9SA 3DHEA 1PTJA 3PVZA 4WKGA 5JDIC 4G5HA 4Q3AA 1JU9A 1Y6JA 1HDOA 3DEYX 3O4RA 1E92A 1ADGA 4MP6A 5DBGA 3PI7A 3PWKA 1QYCA 3GRKA 3WOHA 5KCZA 1CDOA 2A92A 4MVJG 3D4PA 1R4NB 4QFCA 3KHUA 5JPIA 1CWUA 5H83A 4YJFB 3DHNA 3MJVA 3NGLA 7ADHA 1T24A 1D1TA 1V3TA 2VZ8A 2C5EA 3AU8A 1O95A 3K5PA 2X58A 1LDNA 2I99A 3WR5A 5HWSA 1H5QA 3WMWA 1BXKA 3PJEA 3VZSA 2VWPA 4RZHA 1LJ8A 3OECA 5DF1A 5JC1A 1PQWA 1PS8A 3BAZA 5G0TA 5K6AA 1ONPA 4FFOA 4CMCA 2VHWA 3E9NA 5KNLA 1F8GA 4Q3BA 4PRKA 1E0DA 5JO9A 3CXRA 1FDSA 1LSJA 4CMAA 1I2BA 2J5KA 3A4VA 3B20A 2G0TA 4J43A 2VUUA 4IJUA 4RDHA 1N5DA 3JQFA 3PPIA 3GG9A 3WQQA 3S1LA 1M6HA 4RJTA 3ANNA 5ICSA 4DPKA 2P9GA 3SBOA 1NXQA 4LSMA 3WGHA 1SAYA 4MP8A 3CZRA 3NAQA 4DA9A 2AQ8A 2AEJA 3KLPX 3IQDB 3RBXA 1VI2A 2AG5A 2W8ZA 3PDJA 5DOZA 5L40A 1VLLA 3D5QA 4R5HA 2VT3A 1NYTA 3KLMX 4A7PA 3DZJA 4ROSA 3CE6A 1HE5A 4BNTA 3LZ6A 1J6UA 1KC1A 4HFMA 4IY1A 1LLQA 4HKTA 3PFWO 5A9SB 3QRWA 2ZCVA 2VRBA 4UVIA 4A2CA 3WFIA 4HADA 3RBZA 4P4LA 2Y1DA 4A5OA 2NM0A 1K0UA 1VKOA 3H8VA 3WGOA 1U9JA 4CV0A 2F1KA 1E7SA 3EGOA 2DC1A 1EUZA 1LNQA 3ZV3A 1YL6A 5IG2A 4D7AA 4ND2A 3TZKA 4AJ1A 4FB5A 2V6BA 1LXCA 1VC2A 3HFSA 1HZJA 4WPGA 4XQ9A 3GH3A 1K6IA 2Q49A 5AXCA 1A9ZA 2B4QA 3RSHA 5JAIA 1P77A 3C85A 5TSDA 2HK8A 4LK3A 4CMJA 1DOHA 4E2ZA 2DKNA 3H5NA 5JAQA 1I3LA 4YEDA 3C1OA 4PLFA 3INRA 1SB8A 1XR3A 3NKLA 4B7XA 2NLOA 1ONNA 4A10A 4CM5A 1P33A 2PGJA 2B5WA 2O3TA 3LF1A 4W9NC 5B37A 3C7CB 2PH5A 3KB6A 3ZHYA 1X1TA 3D1LA 1UXJA 2PD6A 5CDGA 1XQ6A 1OC2A 5LDHA 1ZSNA 1KEWA 3HWRA 5JW6A 1RM5A 3QY9A 5CDTA 5I7FA 4CL8A 5BR7A 2BFPA 4XGKA 2A9FA 3GG2A 3PHJA 1HYEA 2V6MA 5JLAA 2ZATA 1QKIA 4NR0A 3WSVA 1DSSG 1YO6A 4UEJA 2HMWA 4R9RA 4KWIA 3WGGA 1KVSA 1QP8A 3ASVA 1HZZA 1K5HA 3GDOA 3WTBA 3PEFA 4PLWA 4R51A 4PG6A 4YWJA 1EDZA 2HJSA 4LCEA 1WLYA 4DUPA 3U5TA 2EJWA 2QYTA 4H15A 1GYQA 1H2HA 3BMCB 3T7CA 4AJLA 2X22A 4Q3CA 3LC7O 3UW3A 3AOGA 3A1NA 4NU5A 1UAGA 2X7HA 1KVQA 3PYMA 2AE1A 1QRRA 4BGUA 1ZK1A 4E5YA 2P2SA 1E3JA 3ENKA 2PLAA 2PZJA 1N8KA 4KWHA 4WNCA 3UXYA 1NNUA 1UXIA 1EEHA 4X54A 4ALKA 2O50A 3GOHA 1UDBA 3E82A 3WIEA 2BELA 3QV1A 4INAA 4RQUA 1DIBA 1JQBA 2C54A 4XYGA 4NK5A 4U0JA 1BHSA 3W4KA 5TQVA 3VTFA 1U7HA 3INGA 1LDGA 1E1KA 3CUKA 5DBIA 1E3SA 1SNYA 3KVOA 3QA9A 4J1SA 3WJAA 5A3JA 4I1IA 2QHXA 2GZ3A 3DHYA 2Y0CA 1DAOA 1Z73A 2AMFA 3O38A 1P1HA 2VWQA 3DXFA 4R69A 3F9IA 1TB4A 3AW9A 4PG7A 4QX6A 1ISGA 3BTVA 5DBFA 5JCXA 4FGWA 2CFCA 4WCFA 2FSVA 2GYYA 3HG7A 1ZMTA 1HT0A 4WLEA 3ADOA 4RPLA 2TMGA 2BRUA 2O23A 4M49A 4TROA 3DWFA 4R4JA 4J16A 3JQ8A 5KOIA 1A4UA 3CMCO 3SC6A 2EKLA 1XLTA 1MG0A 4I9NA 5EQFA 2X86A 3NTQA 1LDEA 2YHUA 4MVJH 2NTJA 4LVUA 4PLTA 1GZ3A 2WTBA 3L4BC 2Q1TA 4I9UA 1EFLA 1WWKA 3RVDA 5GMOA 3CMMA 3JV7A 4TVOA 1ADFA 1YOVB 1Z6ZA 4LCJA 3RJ9A 1Y8QA 2OP1A 2D5AA 4WE3A 5C7IO 2CVQA 1H6DA 2DBVO 2H6EA 3QVOA 4QQRA 3RUAA 4BIIA 2P9CA 3QQPA 4B3IA 1PJ3A 3FSRA 2P5YA 3AOEC 4UULA 1TEHA 2BGLA 2Z5LA 2RHCA 4LMRA 4C7KA 3ROKA 1Y8RA 3KETA 5IDYA 4PG8A 5B12A 1GZ4A 1Q2XA 4NFSA 5LDGA 3RUDA 3Q0EA 5ITWA 5CG2A 5TX7A 3VKUA 3D0OA 3ZWPA 3ZN2A 3V2UA 2JCXA 1LU9A 4JJIA 4CR7A 4CL3A 3HN7A 1IUKA 2E48A 1PWZA 3SJ7A 2IYOA 3QVTA 1NFRA 2OP0A 2NUAA 1ZEMA 1PR9A 2BKAA 1IE3A 1LRJA 1MC4A 2DBRA 3BYZA 4W82A 4L4RA 4YJDA 4XJTA 4AJKA 4FOOA 1Y9EA 2B5VA 4WJZA 3K92A 3G0OA 2GRAA 5COBA 3DOOA 3KV3O 3VH3A 4JX8A 4EUEA 3GN2A 1VSVA 4DGSA 2V65A 1M2WA 4IXTA 2HMUA 1V3UA 3C8MA 2H5LA 2H63A 2IXAA 3IC5A 4L4SA 4IDDA 3ZWCA 3C1AA 4M55A 1T2FA 4BO2A 4B79A 4DPMA 1SO8A 3ONDA 4WCFB 1PIWA 1PJQA 2QZ9A 3WGQA 1XWFA 1H9AA 3VHRA 3ONFA 4DYVA 1ZVMA 1KOLA 4JGBA 3RUFA 4F45A 3DBHA 3JQ8B 2NADA 4FBGA 3U4HA 4FFRA 3IIEA 3DMTC 2DVMA 1V3VA 3W8DA 4P4GA 1E7WA 4GX1A 4FFNA 4QSMA 1C1DA 3D3WA 4NI5A 4FIZA 4GBJA 4XIJA 4BGVA 5JDCC 4QECA 1EVIA 4OXYA 4ALIA 2EHDA 1KETA 5JY1A 2I6TA 1GCOA 1BDMA 1AUPA 2Y99A 2R00C 3NDRA 2Y0DA 3OQ1A 4XR9A 1Y8RB 3I9KA 1TA4A 4E3ZA 1DRWA 2R00A 4XYMA 3FPCA 3I3OA 1HDRA 4JNKA 1P1IA 1LX6A 2Y93A 1VPDA 5B4TA 2SCUA 1JWBB 4OIMA 1ENYA 1GQYA 1BVUA 1HDZA 1WDLA 5L53A 2DBZA 1EBFA 1GQ2A 4BO4A 3GLQA 3ETEA 5ENVA 1LSOA 3F5QA 2JJYA 5MGBA 4NU6A 3X2FA 3PQDA 4U6SA 1FJHA 3TZ6A 4W99A 4RLHA 3FPLA 1A71A 1MFPA 1SB9A 3KYDA 1HE3A 2W98A 1WZIA 2X0NA 4P22A 1MFZA 1R0SA 1YBAA 2EJVA 1ZSVA 3UF0A 1U3VA 2UUOA 2PKQP 1P9LA 1HLDA 1R37A 4HNHA 2EF1A 5A04A 1DHRA 3OM9A 1XHLA 2X8LA 2NVBA 1K89A 1C14A 2CMDA 5DZSA 4RF2A 1KVRA 4OKIA 4BV9A 2POQX 5L4LA 5HA5A 1JVBA 2EKQA 4LSWA 1U3UA 4F46A 2YQ4A 3DBHB 4NFHA 1HETA 2OO5A 1HE2A 1E6EA 3JSAA 4BNVA 3ZGYA 1K6JA 1C0IA 4YJHB 1Z74A 1Q0HA 4J1NA 4L73A 1D8AA 4ZRNA 1C1DB 1BWSA 1UP4A 4HX5A 5L7WA 4DREA 3ETGA 4CMKA 1WVGA 1YDWA 4E33A 1NQ5A 3BIOA 4GQAA 1E3LA 3IUPA 4YXFA 2HMSA 5ADHA 4LISA 4O1MA 2O2YA 1B8VA 1N1EA 3FWZA 2NVUB 3E8XA 5CEJA 5IZCA 3JYOA 4IDCA 1B8UA 3ZW9A 1MLDA 3QVWA 5C7OO 4YAKA 4J49A 2BGKA 3RFXA 3T4EA 4FJ0A 3G79A 1YONA 1IZ9A 1BGVA 5KTKA 2PH3A 4Q39A 1X15A 4ZJUA 3VPXA 1CQJA 5TT0A 3GVXA 1HTBA 3BXXA 1U7TA 3JTMA 3OJ0A 1DIGA 4MVJD 4OMUA 1NWCA 4IS2A 2X4GA 1DC3A 3Q1LA 2PZMA 5CP8A 4C7JA 5BSEA 3DO5A 1RJWA 2PD3A 3LDHA 4ND3A 4XEHA 3HDYA 3ZH2A 3LLVA 5I7SA 3FNFA 4AJNA 1IYZA 5KKCA 1LDBA 3E03A 4NK4A 3DAGA 3OETA 4U0KA 3DOJA 3KYDB 5B4VA 3CSDA 2AE2A 5EMHA 1DFGA 3L07A 3GUCA 1BRMA 1JW9B 3E9QA 2PV7A 4EBFA 1VJ1A 3ANLA 4ALJA 4E5MA 3GPIA 1DB3A 3UAGA 4MDHA 2YJZA 1ZK0A 1UZMA 4FFLA 3Q11A 4ND1A 1GL3A 1N92A 3ONEA 3P7MA 2FHSA 4MIOA 1ZUD1 3TFQA 1DJQA 4WOKA 3WYBA 1PJ4A 1D1SA 5A05A 1H6AA 1GADO 1ID1A 1Y1PA 1ZO8A 3OP4A 2OBNA 4JJGA 3HE3A 1HXHA 1QYDA 3NGXA 4PCVA 4YQZA 1SOVA 2ZB4A 4BO8A 3TF5A 4R1NA 2HMTA 7MDHA 1GYPA 4ZQEA 1JA9A 3GEDA 1DC5A 4E2XA 3L6DA 3I83A 4LN1A 3TWOA 4WLVA 4M1QA 2BI8A 2DBQA 3KSUA 4FJ1A 3FTNA 3UCEA 1VJTA 5TS3A 5EINA 3VZQA 1K2WA 3GR6A 4IIUA 1Q0QA 5TRTA 3EZYA 4BGEA 3TSCA 1LEHA 2FZWA 1SPXA 2IEBA 3VPFA 1F06A 3W4JA 1UDCA 2AA3A 5HTOA 3RU7A 5A02A 1NWHA 3C24A 1ZK4A 1LTHR 3OJEA 2I67A 4JCOA 4Z0PA 1I10A 4NMHA 3WWZA 4FD3A 5AOVA 4L74A 4MINA 4Y6PA 5ITVA 1Z7EA 4YAJA 3WB9A 3NV9A 3D7LA 2J3IA 1F0YA 3FNGA 4J7CA 4RPHA 3FBTA 3V2HA 3W8EA 2PD4A 1KY5A 1VSUA 3HSKA 4RVSA 3MJCA 1BW9A 1XYGA 2P5UA 4CMEC 1P0CA 4BOYA 1T1RA 2EERA 4J4TA 4RVUA 1N9GA 2JCVA 4RVFA 5FFFA 5LCXA 3AUTA 4IJWA 1IULA 5KJCA 4J9UE 4DIFA 1U28A 8LDHA 1A72A 4ZRMA 1EK6A 5TF4A 3WBFA 3B1FA 3IOYA 3ZWBA 2VNSA 1P74A 1M6WA 2X1HA 3RJ5A 4CUZA 3RIHA 3PRJA 1YQDA 2FR1A 4XQCA 4DC1A 1DXYA 2PGDA 3INTA 1GPDG 1GEEA 3WLFA 5L45A 2E4AA 4RORA 4QT0A 4TZTA 2IODA 4H3VA 4YAEA 5EQDA 4EZBA 3K96A 4Y67A 4DLAA 5K9ZA 4MVJA 1WAMA 4EJ0A 4J1TA 1UH5A 2UVDA 4TVBA 4CODB 4BNYA 3S2EA 4CMBA 8ADHA 1X14A 4TMFA 4ID9A 1U2DA 4NH4A 1JLLA 1UP6A 3JD2A 3NEPX 3AUSA 3KBOA 1EUDA 3AM3A 4EJMA 1ZK2A 3NJ4A 1EVJA 3DMYA 1EQUA 1GR0A 3PHHA 4ALNA 4YR9A 5HS4A 5ES3A 3AM5A 1GUZA 2ZQZA 4CLOA 3F4BA 3PQFA 1ZEJA 3OMLA 5BSFA 4UEOA 2FWMX 5COQA 4DXHA 2AW5A 4O6VA 3KEQA 2DFDA 1ZK3A 1LDMA 1HE4A 4OKNA 1GPJA 1QYXA 2FPGA 1ZBQA 3GK3A 1BMDA 4B3HA 4UAGA 3MJSA 3KYCA 4IMPA 4R41A 1YBVA 1I30A 1PL6A 1ZJYA 4J7UA 2JD1A 3JD3A 4PLGA 4CR8A 3QHAA 4ALLA 4CR6A 1BW9B 5LC1A 1E7QA 3ABIA 2FRDA 3X2EA 4Z3KA 1QLHA 4J4HA 3H9GA 5JE8A 1N9GB 2VYVD 3SXPA 4B8ZA 3EW7A 3VH1A 3UVEA 4IQGA 1ISFA 2NQTA 4J1QA 2CVOA 1NASA 4ZGWA 5K6AC 4Y98A 4E31A 1DFHA 4M86A 1XG5A 4CQMB 3S55A 1E6WA 3FCOA 3TJRA 1RM0A 1MV8A 3SLKA 3MJTA 4Y6RA 1JTVA 1OMOA 2NU9A 3A9WA 4GGOA 2VOJA 1XSEA 1Q7CA 2FN7A 4R3WA 3JQFC 2G5CA 4XKJA 2IRWA 1EE9A 3RCBA 4DYDA 3ZWXA 1WP4A 2EP5A 1LRLA 1MX3A 3ZWVA 2ZTVA 3KRTA 2PGLA 1R15A 4B4OA 1E5LA 2D5CA 1R6DA 3Q9NA 4BB6A 2Z95A 2P91A 2Y1GA 3JD1A 4HNGA 3ULKA 3VDQA 2B83A 3MTGA 3M1AA 2GLXA 3PP8A 5JCJD 1JAXA 1LC3A 4R1TA 1QXSA 4R1UA 1NPDA 5KVVA 1E1NA 4Q3DA 4CQLA 1NAHA 3C7AA 1GUYA 4CLDA 5G4KA 4BQRA 2GNAA 5CEFA 2J5RA 5IFLA 5FYDA 5IN4A 4I5FA 4DC0A 3AU9A 2O7SA 5T64A 5L9AA 2CVZA 4GLLA 2RCYA 4YB8A 1XELA 1ULUA 1VJ0A 2PKQO 3U4CA 1OI7A 4XQEA 5AXBA 1B8PA 4RLSA 4BNIA 3ZNPA 1W6UA 3FBGA 1TVEA 3KYCB 1MGOA 4CLHA 3E6AA 3LSYA 2BI7A 4L76A 2VYND 3TRIA 5A1TA 3OIDA 2HQ1A 2CZCA 4RDIA 2W90A 2H1SA 1C0PA 4MVJP 4A0SA 1QV6A 4HUJA 3AI3A 4IXWA 1W73A 5T5QA 1NVTA 4NBTA 4RPGA 2X5JO 1EE2A 2YFQA 3WXBA 1YL7A 3H2SA 1ADBA 3DL2A 5KVCA 1ISJA 1PQPA 2IYPA 3BMOA 3KOUA 4Q3NA 3HADA 3WGIA 3I52A 3EAGA 3D4NA 3KO8A 2YQ5A 3GZ4A 4A73A 2AEMA 1DDOA 3ZZNA 4BUCA 3QJ5A 3JQAD 3PHLA 3ZNQA 4FC7A 3WYCA 1ZZEA 1RYDA 4DQXA 2EGHA 2X9GA 4UUMA 1PJCA 4UEKA 3HHPA 1T2EA 4MOWA 4NJOA 3PHGA 5AXAA 5IXYA 1ZJZA 4CUJA 5G2OA 2ZYAA 2VTEA 4BNXA 1NR1A 3AY3A 2DU8A 1FDWA 1H93A 3UUWA 1ENPA 1R0KA 1I33A 4RVGA 2NACA 4WCDA 3U0BA 4B7CA 3DBVO 3HZZA 2FY8A 1CQIA 4MIEA 3HQ4O 4EJ6A 3CPSA 2UYYA 5I7VA 1T2CA 3LT2A 2NV6A 5GZ3A 5CPFA 3RC1A 4FCCA 1P3DA 1NQTA 1VL8A 4XIYA 2PY6A 4CQLB 3G17A 4M54A 3H65A 2O4UX 2NSDA 1PEDA 5G4KB 2Z1MA 4L8VA 4NHEA 3L9XA 4K28A 3WGTA 3I9OA 1KERA 3IP1A 1FDTA 5G0WA 2VYVA 3E1KA 3K9QO 1PX0A 3JQDA 4IPTA 4RPJA 1E7YA 4ZQFA 3HNPA 1GU7A 1HYGA 1B26A 4IGEA 2D8AA 3QVSA 1OOEA 4LRSB 1TT5A 4L0QA 5DN9A 1EZ4A 2W2LD 3LT0A 4IJVA 2CNBA 4PLPA 1NFFA 4BMVA 2YFHA 4IDGA 1D4FA 5BSGA 4J2HA 4YA6A 2QRLA 5AYVA 4UUNA 3JQGA 5L4SA 2JFFA 2WD8A 4OL9A 2IEDA 2TMDA 3IMFA 3ENNA 2GDZA 3NTRA 4ZQGA 1DJNA 3ICCA 3WMXA 2VN8A 2DTDA 2ZJ0A 1RYEA 3OH8A 4OYRA 1DIHA 4I5GA 4JJFA 2H9IA 3G3EA 3IP3A 4RV9A 1PGJA 4BNZA 2YDYA 4GX2A 1NPTO 4MP3A 1XGKA 4R01A 4WCFC 1DC4A 5JYDA 1TT7A 5TJ9A 4EUHA 5JCJA 1TXGA 2AEFA 3M2TA 2ZIZA 1O9BA 3F1KA 5BNTA 4YTEA 1J0XO 3AUUA 3GVHA 4XRGA 4DMLA 3PGXA 5HBRA 4Q3EA 3E5RA 4IDFA 4D3FA 1B16A 4AJJA 2I65A 1SZJG 1C1XA 2C07A 1HLPA 3DAFA 3I23A 4Z6KA 1BXZA 4AJHA 1ZXBA 3EMKA 3DZGA 5FI3A 4AL4A 2WE7A 4OQZA 5T57A 4BV8A 2VT2A 3IDSA 4UREA 5CAEA 3L6EA 4OM8A 1E77A 1P44A 2VZ0A 4TRMA 4W7HA 4Y8VA 3FF4A 3PTZA 2VYNA 3ANMA 3ADPA 2O7QA 1ARZA 1QLJA 2Y68A 2O4CA 4G65A 5IN5A 3SX2A 4CMGA 4FSHA 3VC7A 1I32A 1PZHA 4Z9XA 2JD0A 4IM7A 5A4DA 4GMFA 3D3EA 4O59O 4I5EA 4EGFA 3JQ9A 5JAZA 3FR8A 4BO9A 2GCGA 3DDNA 1DAPA 2BMAA 3DTYA 4B7UA 3KTDA 3WYEA 4QFDA 1TT5B 1DLIA 3P2YA 3H6KA 3PQEA 3OBBA 2B4RO 1LLCA 1H0KA 3JQAA 4JN6B 4RL6A 5G0UA 5EPOA 1F12A 3IAHA 5CPBA 3W6ZA 3ZV5A 4PG4A 3CZMA 2IZ0A 1NVGA 2G1UA 3OF2A 3PZBA 4PLHA 3JQGB 3P19A 4XB1A 4O63O 2O3JA 1B3BA 5KVQA 4D43A 1G1AA 1M75A 2BHLA 3I9LA 1KVTA 1MXFA 5FI5A 1C0LA 4GKBA 4QXMA 2OZPA 4FDAA 1T4BA 1K3TA 1TLTA 3CKYA 5JMWA 4XQGA 1EDOA 1T4DA 3HN2A 4HFRA 1NVMB 3U4DA 3NDIA 4O5OA 5A5EA 2Q3EA 2GPTA 3BTOA 1T2DA 3OJFA 3VPGA 1A27A 1I24A 2P9EA 5T6BA 4B4VA 1VKNA 2G76A 1AN9A 2ZTLA 2A94A 3EK2A 3EUWA 4FJ2A 4IUYA 3ZW8A 4GSKA 1FMCA 2Q1WA 1MB4A 1SEPA 2C2YA 4UVEA 1UP7A 4GGPA 2WDZA 1BVRA 5GZ1A 2ILTA 1IPFA 1PL8A 5DDIP 2GASA 3PK0A 4WLFA 1OC4A 5F3RA 4TRRA 1U3TA 1C1XB 5HRUA 4GI2A 3WIDA 1DO8A 2R2GA 1QR6A 5DOVA 3AY6A 1PL7A 1OZAA 1UXHA 2GN4A 2ZK7A 3DFUA 4YRBA 2Q4EA 3Q2KA 2W2LA 4I5DA 3GMDA 3WS7A 1NPYA 1D3AA 1MXHA 1I8TA 1Y8QB 3I9NA 4KUEA 3H9JA 3LVFO 3NT4A 3PDUA 2O48X 2X0JA 3VZRA 3ORFA 4KQWA 4N5MA 1ZMOA 3WG9A 1F17A 1PS0A 1CF2O 4UUOA 3WGZA 2FP4A 4YCAA 4S3MA 5KKAA 3DZFA 1YL5A 2Q2QA 5BQFA 1HEUA 1X0VA 3HDHA 3V5NA 4YVFA 4RGBA 5I9LA 3TZCA 1PU2A 3PIIA 3OQ6A 3JQAB 4J0FA 4ONEA 4CM4A 2BF7A 5HM8A 3GT0A 1NTOA 4R3NA 3RAJA 3MCVA 4Q9NA 3VOSA 2WWRA 2Q4BA 4CLRA 2RH8A 3IKTA 3RUIA 5ER6A 1R12A 2ZTUA 3G1TA 4BNLA 3B6ZA 2AG8A 2RHRA 3FHLA 1L7DA 5BNFA 1T1SA 2IZ1A 2JL1A 4IMRA 4MO2A 4AJIA 3BHJA 4BMNA 1PSDA 1GFSA 2WM3A 4BNHA 4CV3A 3OEWA 3VH2A 1DLJA 1LUAA 2O3QA 1PWXA 2QG4A 3LQFA 4UUPA 5H82A 4BKRA 4CM8A 3B1KA 2J6IA 3PWSA 3AI1A 3FWNA 5B1YA 1PGQA 2D0IA 4OSPA 3OSUA 4HY3A 4EDFA 1HDGO 3CH6A 5T8KA 1NQOA 2Z1NA 3ZHXA 4PLZA 3QP9A 1CJCA 2ZB8A 4F6CA 1YJ8A 2VWHA 2OFPA 3WDSA 2CSUA 2RAFA 5A03A 5JY6A 3WNQA 3H2ZA 4NQZA 4QEDA 1AXGA 2YV2A 3NT5A 4D79A 3F1LA 1TI7A 3D3WB 4L4XA 2B35A 4YDRA 3DTTA 1HWYA 3STHA 1U8XX 1WDKA 2JCYA 4DIBA 5CG1A 5IZCC 4CV2A 5GZ6A 1XIVA 5HS6A 4J7XA 2LDBA 3W6UA 4AJ4A 1JWAB 2DFVA 4KTVE 4FGSA 2NU7A 1X1EA 4OAQA 2ZJ1A 2PKRA 1DFIA 2PA3A 3K31A 1MP0A 4XWYA 3LF2A 3JYPA 1H9BA 5DCWA 3PWZA 3RBVA 4UVGA 2PK3A 3H5RA 3IJPA 4NG5A 4ZA2A 2A4KA 3BTUA 4CM4B 4E21A 2ZQYA 3AFNA 2B37A 4MVJE 2EKPA 4DWVA 3AY7A 1HKUA 4P8RA 1P45A 4MKXA 1KEVA 4CM3A 2VTDA 2Q50A 3H5AA 3KZVA 3JQ6A 3PZRA 4PRLA 4HXYA 2PFGA 1LLUA 1ZCJA 2NVWA 3Q9UA 3RC9A 4GH5A 4DQVA 1ZXLA 9LDTA 1EMDA 4TRJA 3AM4A 3PFFA 4BB5A 2IZZA 2I3AA 4PZCA 2V6GA 3OIFA 4R9SA 5H81A 4BKPA 3TFOA 3NTOA 2GN8A 4CM8B 3NYWA 2D59A 3UN1A 4D3DA 1FDUA 3AI2A 3ZV6A 4BVAA 3G1UA 4LGVA 1DHTA 1EQ2A 4XYBA 5F21A 6ADHA 1GQQA 4WASA 2QRKA 3NX4A 3WJ7A 4DPLA 3N58A 3HJAA 3GAFA 2HUNA 4WK6A 3U49A 1GAEO 1P1FA 4RQTA 2CDBA 3CIFA 4PGFA 1B0AA 4MPDA 2VCYA 2JHGA 3ZCXA 3ST7A 2XOXA 2PNFA 1YVEI 2B36A 2HJRA 5L4NA 3FNEA 4D42A 3ETDA 3UOGA 4XCVA 3B1JA 4PLCA 3JCZA 2J5QA 4OOFA 5KJ6A 3MWEB 2VWGA 5KJFA 3G49A 1ZSYA 1WMBA 1JKJA 5A3VA 1WDMA 1PZEA 1YQXA 3WQRA 1EFKA 1E1LA 1E1MA 5IDXA 4U5QA 5KJ1A 2Q1UA 1E3IA 4KQXA 3ASUA 4KUGA 1S7CA 3BHIA 4OQYA 5EESA 4A03A 4G2NA 2FR8A 4H7PA 4JBIA 3RD5A 4H16A 4AJOA 1YWGO 4E0BA 3UH1A 5JAMA 1WPQA 3E48A 3K73O 2GN6A 1VL0A 2YV3A 3DAPA 3WFJA 4EYEA 4E5NA 2AQIA 4RZIA 1V0JA 4NFYA 4WLUA 2NTVA 3ZWOA 3DR3A 3H3FA 4CLXA 2EP7A 2GZ2A 2HDHA 4NBVA 5F5NA 1F14A 2CD9A 3PJFA 4N5LA 4M87A 1VM6A 5G0VA 3VPHA 4DIOA 4OOEA 4DBVO 3TOXA 1LBEA 2G82A 4KMSA 3GRPA 4N7RA 1M67A 3HB4X 1E3EA 2AQKA 3RUHA 2V6FA 3Q6IA 5JSFA 1BDBA 3CINA 2Y67A 3ZWAA 4QUKA 5JC8A 1Z7BA 3EVTA 4DBZA 4NBUA 4HWKA 3VZPA 4DMMA 4GX0A 2EW2A 2GSDA 1GZ6A 5AQ1A 3NDJA 1GV1A 4YT8A 4S1VA 4XRRA 3GFBA 4B4WA 4BO7A 1A4IA 3PHIA 4RO0A 2VHXA 4ZQHA 3T7EA 4CM6A 2E49A 3PXXA 3F4LA 4MVJI 3QSGA 2GD1O 1BSVA 4N18A 1Y81A 1B7GO 1ZNQO 1IL0A 1YKFA 5G4LA 4ILKA 1DC6A 5FWNA 2Y66A 3JD0A 5EJ2A 4UVDA 1ZW1A 2X23A 1R4MA 4I8XA 4BGIA 1JAYA 1X7GA 1JKFA 2HRBA 3M1LA 1LDYA 3FD8A 4PFJA 4K26A 5DCYA 1Q0LA 3BMNA 2JD2A 3Q3CA 4E5PA 3S2FA 2FSSA 1LI4A 2D4AA 2X6TA 2VRCD 5ILGA 1B3RA 2VUSA 4XR4A 3F47A 4F3YA 2X5KO 3T4XA 3DC2A 4A26A 3RI3A 4FOSA 4IQ0A 4YYZA 1M76A 3ITKA 3SJUA 3I4CA 5L7TA 1VL6A 3H7AA 2DUUA 4Z9YA 3RC7A 1C3VA 1YXMA 1U4SA 2P4QA 3BA1A 2C7GA 3ZHBA 2JKVA 2Y1OA 1B15A 1I2CA 1PGOA 1R16A 4GVXA 2ZB7A 5CDSA 3ZWYA 1UDAA 4JIGA 5DULA 3VPSA 1O89A 5JMPA 5JO0A 1U2GA 2BFAA 1CRWG 2GF2A 1MG5A 2OORA 4QO8A 1WMAA 2WSBA 1HL3A 1J5PA 1FXSA 1GCUA 4LMPA 4BNUA 1QV7A 2BD0A 4YRDA 3E9MA 1KBZA 4HFNA 1NBOA 3DBLA 3ZDFA 3GNQA 3MJEA 3QWHA 4FQ8A 4BKOA 2B69A 4K1LA 4G81A 1LSSA 3GPDG 4BO0A 2DUWA 4TWRA 9LDBA 4JQCA 1Z45A 1F8FA 4PLYA 4A27A 3K30A 1IPEA 4YBZA 2Y1FA 3GMSA 1SCUA 3EVNA 4BKQA 3H9QA 4OGWA 1P0FA 4WUVA 1N7HA 3U3XA 1UJMA 1KEUA 4XYEA 1N7GA 3MOIA 3GEGA 1DIRA 5JDIA 1HDYA 1X7HA 2GERA 1EVZA 2D2IA 5F1PA 4MJLA 1R4MB 2UV8A 5JBIA 3WTCA 5IDWA 3QWBA 5C37A 2IE0A 5DP2A 4ZVVA 1U3WA 3GY0A 3BMNB 4OO3A 4YQYA 4EEZA 4R54A 3ON5A 2CF5A 1IHXA 2FPPA 4WEQA 3VVCA 1MUUA 3BMQA 3GEMA 3MEQA 5F1OA 1YB4A 1DEHA 2YZ7A 2ZYGA 3QIVA 1I3NA 1Y5RA 5GY7A 3TNLA 4FFMA 1CERA 3OA2A 2VQ3A 4D3SA 2GUGA 2HCTA 1AHIA 2JAHA 1N2SA 5EIOA 3QW2A 4GAEA 3MJ4A 2OUIA 5I8WA 2VHZA 1K6XA 3AK4A 3KM0A 1KEPA 2V7PA 4P38A 5COAA 5U1PA 2B0JA 3ITDA 3TL2A 4F6LA 1SOWA 4XGNA 4BNNA 1SMKA 3W4IA 5K0ZA 1XA0A 4EITA 1PJTA 4CLOB 4OJNA 3RQSA 4BO5A 1ENOA 2VOEA 3F6YA 1IHYA 3ZU2A 4XDYA 4DL9A 1I3KA 4TQGA 4XGIA 4WGGA 2HSDA 3JD4A 3QVXA 3DBLB 5U4QA 1G6KA 4BO1A 3DFZA 4GX5A 5ICMA 4BNKA 4YAGA 2C59A 4GVLA 5I9MA 4TSKA 2YYYA 3AWDA 1YE3A 5EERA 4GSLA 2QZZA 1OBFO 4PG5A 1Q7GA 4GLOA 4W4TA 3WNVA 3GGPA 1ENZA 1U1IA 4JP3A 4GWKA 5KWEA 3BMCA 1AE1A 2NTNA 2HU2A 1E6UA 2VRCA 4BMSA 4IDAA 1QYVA 4E6PA 1ML3A 1OAAA 3GUYA 1EVYA 3OHSX 1Q7BA 5IAAA 4RF5A 4UVHA 4ZU3A 2JFGA 5B4UA 3QWIA 1IB6A 2P4HX 4LW8A 2EXXA 2XPCA 4AVYA 4ZN6A 2EWMA 1YDEA 3DZHA 3FN4A 4YT5A 3VH4A 4R16A 3W8FA 4ALMA 3RASA 1SC6A 5C5IA 5KIAA 4IZHA 3FR7A 3GHHA 3TOZA 3BMQB 4PZEA 3V1TC 2Q1SA 3GDGA 4JK3A 4WOJA 3PJDA 4GMGA 3LK7A 5KVSA 2EEZA 1UUFA 1O8CA 3QLJA 5IF3A 2ZB3A 3NUGA 3ROMA 3FNHA 1BXGA 1PGNA 1QMGA 5CDYA 3MZ0A 2XAAA 3JYLA 2RIRA 3PIDA 2C7VA 5J23A 2VHVA 3W1VA 3SVTA 4CM9D 1KVUA 3EHEA 2WMDA 5BT9A 4BNJA 4W9NA 2WE8A 3I4FA 3TPCA 2EW8A 3COSA 3I9MA 5IZ4A 4CPDA 1G0OA 4XB2A 1RWBA 3RUCA 2EG9A 2HRZA 3GGOA 3UHAA 1PJLA 4EUFA 1QG6A 4IGFA 4MKRA 5F1KA 3ZWWA 4N5NA 4OXNA 2YY7A 4IDEA 4ND5A 4J0EA 4E13A 1RPNA 3E5MA 3SC4A 4C4OA 4D0SA 5TLSA 4MIYA 2ET6A 1YOVA 2GGSA 2Q46A 3U9LA 4U6QA 1NM5A 4E2WA 4JBHA 1KS9A 1P1JA 2HK9A 2O3SA 2YDXA 1LLDA 3GQVA 3OFSA 1H6CA 3GHYA 2J8ZA 3ZNNA 3ZU4A 4KZPA 1A7AA 3BMOB 3WWYA 1PR3A 1U5AA 2JHFA 1PJ2A 1XKQA 4D46A 1ZKMA 1B14A 2BFOA 2UDPA 3U4IA 1W4ZA 3I6IA 1HSOA 3AJRA 3I1JA 2O3RA 4NPCA 5DT9A 3TZHA 4W6ZA 3GVCA 3JYQA 1GV0A 4KUHA 1A9YA 1T26A 3C3XA 6LDHA 2QQ5A 4BKUA 2NNLD 4E12A 3DB2A 3GGGA 4K6CA 4R68A 1HDCA 3K8ZA 1V8BA 1HF3A 4LVCA 2PZLA 4BO3A 5ILOA 4KDFA 1Y9AA 5MDHA 3RKRA 1AHHA 5THQA 3A06A 3S8MA 4ITUA 1VE9A 2XF8A 3WGYA 3WLEA 2DM6A 3RFVA 3GA0A 2UAGA 1BXGB 1EBUA 4II2A 4R1SA 1O0SA 3UKOA 5F5LA 1DRUA 2GO1A 1V6AA 1LA2A 1LQTA 4YJGA 1R66A 1EUCA 2AXQA 3MOGA 4AJPA 3JQ9C 2X9VA 3R3SA 1IOLA 1O6ZA 1PS9A 3WBBA 3DBRA 2OOSA 3O03A 1GEGA 1LRKA 3FTPA 4YACA 2C0CA 3VVBA 3ZI0A 3EZLA 4E2YA 3VTZA 1V9LA 2G17A 3GZNA 4JP2A 1NHGA 2R6JA 5TIIA 1I0ZA 4XA8A 4Y9DA 4WEOA 1IY8A 3FI9A 2J3JA 3O26A 4AFNA 2DAPA 2QW8A 3UGKA 3ICPA 3HFGA 4OHUA 3L4BA 2I76A 2BFMA 1WNTA 3EC7A 2B4TO 3ZWMA 3K2BA 1AGNA 1UXGA 2CY0A 2NU6A 4XYLA 3V1YA 5A06A 4URFA 5L51A 2JAPA 2O3UA 2ZYDA 4DTIA 4D45A 2ZTMA 4AICA 3WQSB 3R1IA 3QWFA 1JDJA 4J90A 3OICA 3AOEA 5T67A 1A5ZA 3DZKA 3GAZA 1RM3A 3HDJA 4TKMA 4XDZA 1YBMA 1MA0A 2HO5A 1L1FA 2LDXA 1Y5MA 1H94A 2GZ1A 4RF4A 3BTSA 2I9PA 5L7YA 1C0KA 3Q2IA 2PZKA 5A5FA 3IUSA 5KJEA 1I01A 4CM9A 3OJLA 4YRAA 4PIVA 4FW8A 1ZIDA 1U5CA 1A7KA 1QYWA 1W8DA 4GPD1 4N54A 2OHXA 2WD7A 3TQHA 4P4NA 4I08A 4CLEA 1D7OA 1HSZA 2AQHA 1NFQA 5JFOA 1YH3A 2JFHA 4DQUA 2YW9A 3HUDA 1YJQA 2Y1CA 1P1RA 3L4SO 5L95A 3L77A 1HDXA 4OXKA 3S2GA 1PGPA 4IINA 4B3JA 3R6DA 4EI2A 3ZNOA 5IDQA 4J3FA 4YJGB
chains in the Genus database with same CATH superfamily
3V2GA 2QTLA 7GPBA 1N2EA 2X77A 1RNLA 4LOIA 4Z0NA 5BOVA 3HCNA 3EWSA 2WJ6A 3PR3A 4JXXA 3DCJA 2Q2VA 4KVGA 5JS1A 1RJ9B 1NVVR 2HRRA 5JATA 4US0R 3HKDB 2O2CA 1K4YA 4M1WA 3PXGA 3UAOA 2PWZA 3WE7A 2NU8A 1LSUA 3B7GA 2HLNA 2K87A 3B8EA 3ELUA 3ILXA 1KJQA 4KOAA 5EJ7A 3USZA 4ZVTA 3EVDA 2CNDA 1WMEA 3OZIA 1GNQA 1I2ZA 3REOA 4Z0HO 2DPGA 4YFYA 2R8EA 3WV5A 4P4SA 3IAS1 2YOGA 2OCGA 3UGJA 1XDWA 2BFCA 2CXHA 3RS7A 1SXQA 2ZIXB 2GEJA 5FWXB 2OM6A 1J0EA 3H1TA 4KGZA 2ZVPX 4PO8A 4FFBB 5CFZA 4IJKA 1W35A 3A1SA 4QTXA 5FWAA 1BS2A 1K7FB 3ZHZA 4KNYA 2NU6B 1AUOA 5FQOA 4NMWA 3AVTA 5JDCA 3UCXA 1XYVA 4M1ZA 3BJMA 5IKMA 1Q1NA 3GJ0A 3AEQB 5BWOA 2K2QB 2ACEA 3A27A 3PC8A 5JASA 3L1HA 2FMTA 2Q99A 3R6GA 2XUOA 2ZM6B 2QD1A 3RSZA 4J4BA 1B2RA 1JVSA 1FF9A 3MGGA 2A9VA 4GL4A 3R7SA 3VKVA 3L9WA 4C4PA 3EPHA 1UFQA 4EVQA 3F67A 1Y7TA 1FP4A 1VMDA 4HGQA 3I2HA 1G21A 1O94C 1LPBB 1DC7A 1UWCA 3QTBA 4N0EA 4RVHA 4EKEA 3OTHA 3HY6A 4ZHSA 4UCWA 3O4VA 4BP9A 5HIKA 3PLRA 4C0BA 2IXBA 3JQBC 4MQFB 4OSEA 2YV1A 3CX7A 3KC2A 3QXHA 1H2ZA 5B3LA 1O94A 3I1FA 3DVAA 4RXMA 1I3MA 2GESA 3I01A 2NSLA 1NNI1 4YGXB 3TDKA 1ORRA 1O77A 1ACLA 2B2XA 2JIBA 3JQBA 3I0ZA 4FN4A 3P9IA 4G67A 5IYZB 4N3AA 2BEUA 2DLDA 5I7EA 4N7JA 1AXEA 1CIJA 5TT1A 3H16A 1CUJA 3HUFA 3GV0A 1KRWA 3FOZA 2DYKA 3HV0A 4JBGA 1LY1A 2GEBA 2GS9A 2IGTA 1B2LA 3RKUA 1EFRD 4MV0A 1ZLYA 3GWZA 4KK4A 3C45A 3FRJA 4FFPA 1YR9A 4MVJM 2ZJOA 4FS8A 4TSFA 3AG5A 1PWHA 4X8MA 4ZT6A 3F5MA 1UKAA 4EH1A 3FVWA 1BHJA 4G1EB 3THYB 1K92A 2HI0A 5TNXA 1H8HD 3LC2O 4L27A 4TYQA 1U9IA 2WJPA 4UZSA 3GDFA 1L4EA 4NBNA 1OWPA 2RBEA 1ZH4A 3IT3A 2PGOA 4X91A 1YHZA 2F3SA 2LWIA 3K6RA 3ZY6A 4HP8A 3FHJA 3I8OA 1PV1A 1W59A 2QX4A 3RVRA 3ZZ0A 1NNEA 1PFGA 5IJWA 2DFNA 3A28A 4RENA 1F8YA 2ORED 3IBSA 1NR7A 3L7LA 3OX3A 4RHFA 3F73A 1NX6A 3VOBA 4FIDA 1UZNA 2LV8A 1LCIA 3NHAA 1FK8A 2AOTB 2A3RA 3EEYA 3OJXA 5G41A 5B3JC 5FPKA 3VJRA 3B12A 5HOQA 2E89A 1T9ZA 2IT1A 5D5QA 3ODPA 4FCTA 3VAYA 1R00A 1MENA 4WINA 4YMUA 1TA0A 1X13A 5B3JA 5JNWA 2C0PA 1BEUB 2QX7A 3PPWA 2Q6OA 1K88A 1IUOA 2C5SA 2HSJA 2EEPA 3O21A 1VKRA 1E8DA 1T3GA 3JXEA 9ATCA 2ZAOA 4RLFA 3OOYA 2DTXA 3LW8A 4X1KA 4I1PA 4YNBA 1KIFA 4UMEA 3U4GA 2J3HA 3AUXA 4TMYA 5LVAA 4H31A 1G6HA 4IX1A 4Q03A 2OCBA 5DRYA 4A8PA 3LW7A 4RS3A 1Y7IA 3PEVA 2G9VA 3C3CA 4HR7A 2ZE5A 4K6KA 4II3A 1ISMA 1UOQA 1VZ2A 1R2QA 3A4NA 3FUWA 3IMEA 4KQ1A 1XVUA 3G5LA 4MCAA 5ALVA 1H2FA 3D4BA 3GF4A 4DSOA 4Z4QA 1UZLA 2B1JA 1GUFA 2W2KA 1MDFA 5CT9A 6NULA 1TJNA 2RGAA 2H5JA 1Z16A 2NXJA 1MB9A 3LDUA 1IZ0A 3Q15C 4NATA 4AXXA 3HU5A 4JP5A 1OR8A 1E69A 5JSHA 5EJ4A 2BHSA 4KNVA 3R9WA 3EZNA 4IEFB 1UXKA 2WJZB 4EI9A 2XNCA 1DPGA 5IKEA 3I72A 3JVVA 3H9EO 1WPXA 2B94A 4H6XA 3OKAA 1FDVA 1RYFA 5H68A 2FPMA 3EQ2A 2Z2XA 1A7UA 4JLWA 4MA5A 2AMVA 3ZKWB 1UAYA 3EY9A 1P4JA 2F43A 2IXDA 2WEKA 3P5SA 4W7IA 4QBHA 4URHA 2GM4A 1U2EA 4MS1A 1DIAA 1ONBA 1S8FA 3DTNA 3B1WA 2BGMA 3TQTA 2W5UA 2X13A 4HEHA 5D3MA 5FNZA 1I0IA 2FR8C 4I4TF 1I4TD 4RH1A 1B6RA 1Y1TA 1K68A 3JQCA 2Q45A 2WTNA 3LCVB 4L5CA 4MULA 3U9SA 1WZNA 3KYBA 4LRYA 1NV8A 4RAQA 4LYHA 1UBFA 2AFHE 2WJ4A 3B3QA 3N70A 1J49A 1OI3A 2Q5OA 2BDUA 2K4MA 4I9HA 4BFCA 3BK2A 4PZAA 1XBTA 4CV1A 4KOEC 1O95D 1E5QA 3AUJB 1NZJA 2J7PA 5PNTA 3ZGLA 1QIJA 5SYNA 4AU1A 1C9EA 4D98A 1J97A 2CHEA 1IXZA 2R4TA 2I66A 4HVAA 3V5NA 4IKEA 2UUBB 3LUDA 2G1AA 3PX7A 2AVDA 3GC6A 2I4MA 1Y3CE 3R24A 3HCBA 1BJKA 5CDUA 3GJXC 1CUGA 1PUXA 3O8QB 4MIKA 5FI0B 5TF0A 1KWKA 1CIVA 3M5DA 1E9RA 2YICA 1CJTC 3TQIA 1P1KA 1Z8DA 2A35A 2IKQA 3CRQA 1CY6A 3DDWA 4OJTA 3UJ9A 1T2AA 5DM70 2W6ID 2W2NA 2WWVD 5D86A 9MHTA 4CM7A 3FWKA 4BNWA 5CA1A 5EPEA 2BH9A 2V74B 5KNCH 2HA6A 4JFRA 2OHHA 2PMKA 4Q7EA 4RCVA 3AGPA 1UMCB 4WADA 5H02A 3WKBA 3QX9A 4G9EA 3ZUPA 3AIKA 5HM6A 1OJ7A 2XUZA 1M0TA 3NPAA 2YHIB 1YZ3A 2JGJA 3JRNA 4HBGA 5C7LO 2VNAA 4J03A 3V80A 4HGRA 3PA6A 4E88A 1GTSA 3ZGNA 2OGUA 4OXQA 2ZUFA 5IJ0B 3L6OO 5KNDD 1Z2AA 1ZZGA 2IE8A 1C9YA 2GBGA 3BGOS 5J1TB 4QXRA 3TL3A 3T7IA 1ORWA 2DWPA 4GOJA 5KSOA 1KQFA 3N6RA 4FPXA 4J2OA 4M9CA 3KSZO 3PQ4A 1B00A 5JZOA 2PXAA 4YRSA 4INOA 1RBYA 5L3ZA 4X84A 3VPBA 4MVJF 2HHJA 4JKIA 4RXUA 3UK6A 2FPIA 5BSMA 3TQRA 4LXQA 1VFNA 4D8YA 2UUPA 4TXMA 3PC4A 5KCZA 1S2MA 4WLOA 1U63A 2C2WA 3WHIA 5DRTA 1OYVA 5TQ2A 5A0FA 3MTQA 1PQUA 5ALPA 3EDOA 3QKRB 3UWSA 1Y6QA 2WIFA 4G5GA 4TVKA 4XX0A 5AVTA 1MOPA 1W1UA 4RE6A 2H4XA 1OXMA 1JKJB 4LKOA 2FR0A 4WIAA 3FMGA 3FMPB 4AS2A 2QP4A 3TRDA 3K8QA 1GZ5A 1VGQA 1FUIA 3VAZA 4EG4A 2Y1XA 1DQYA 5BMVA 1Y8ZA 3JQEA 4AP5A 1T9GS 4IV0A 4BX0A 4ZU1X 3KZCA 2OPBA 3O4GA 3PXEA 5HF6A 1H2YA 3VC3A 4GM4A 4ZQBA 1P18A 3GLGB 3B9BA 3KHKA 1FTYA 1S0UA 2IDZA 4NIMA 3R9IA 1R8SA 1PT9A 4TS4A 2BGUA 2GJ4A 2RAPA 5FBKA 5HGJA 2AZTA 3NBUA 1SBNE 3U60B 2B78A 4O3MA 1P72A 3COVA 1K8RA 3LPNA 1SGWA 5M2QA 4ZYZA 1P7VA 2ZJ3A 4ZODA 3U09A 3L0DA 1I5RA 2XCSB 5JS7A 2ZCJA 3AUAA 1TFRA 1QTRA 1YIAA 4M6WA 4MI6A 5DCUA 2XXBA 1I36A 5DM0A 4I4TB 5CM9C 5AM4A 3PGVA 4M89A 3V8BA 1ITZA 2ZI5A 4FNMA 5AICA 1PTJC 1R6UA 2W4QA 1RMYA 1W2HA 1TMKA 4FS3A 5CMLA 3KSBC 4JEHA 3S7ZA 3R3YA 4NDNE 5I7HA 1QUEA 2ORIA 2GCOB 1SEVA 5A9SA 1YA8A 2ZRJA 1PTJA 3PVZA 1BJRE 3HRKA 5JDIC 3T5TA 4Q3AA 3EGCA 1HDOA 4P4TA 2CVHA 1AKEA 1G7CA 1SG6A 1QF7A 3PKIA 2OKCA 2WVAA 4KKXB 3SE7A 2HLHA 4GO1A 3DD1A 4D9KA 2OO7A 3WOHA 2PJRA 1K4KA 2A92A 2IUSA 3VR3D 4IR7A 3L8GA 4F9EA 2IIVA 5JPIA 5SZKB 1THMA 1CWUA 1OFVA 1W0KD 2H31A 2GJ8A 2PU7A 2W2TA 3LCCA 2PHZA 4HDSB 3SXUB 5C2JB 5C35A 1M74A 4AKIA 1D1TA 5M3BA 5EIXA 2VBIA 1V3TA 2BDTA 2VZ8A 4B3TB 3NKVA 4QYMA 3K5PA 4LEIA 2HY7A 5DYTA 2UZ4A 1H5QA 1R0RE 4IH9A 1Z17A 3WMWA 4JBYA 2A9KA 2VWPA 4RZHA 3ABRB 5ALQA 5AOAA 2ZETA 1LJ8A 1J90A 3OPXA 1OD6A 2E4YA 3PCRB 1JRLA 4DDMA 2VEOA 3UO8B 1Z4JA 2FG5A 3VC2A 3CCCA 1N34B 2WY2D 4CMCA 5CLGA 1TVMA 2VHWA 2Z6VA 1BWRA 1F8GA 1SXGA 4OIFA 1GCGA 1MEOA 2Q41A 4QHYA 4BMYA 5FNVA 3T9FA 1QE5A 4LKRA 1FDSA 5EG5A 3U7IA 1W87A 3AEZA 4N41A 1L8QA 3B20A 4KLRA 2I1VB 3ZG6A 2QTNA 3VR0A 4CETA 3PKJA 4IJUA 3MT0A 1OH6A 4LVOA 2RE8A 4J2TA 4DMHA 1V8PA 4JYBA 1RP7A 4LTDA 3L0SA 3QBDA 1SJ9A 4M38A 1Z4LA 2GH1A 2IHZA 3RSCA 5HKOA 4JYCA 4TLLB 4M0FA 1L7NA 4XWAA 5ICFA 5H8WA 5BNWA 3IX7A 4X94A 4DA9A 1E61A 2AEJA 2FWIA 3IQDB 3KLPX 4FKZA 2W8ZA 3A2LA 2CNOA 2GARA 2JFVA 5DOZA 5I4IA 4KR3A 2GM5A 3ZZ1A 3JW8A 1QGAA 4CQJA 3K6SB 2VT3A 1FPMA 4A7PA 3IULA 1G18A 4CHTA 3O5AA 1QYRA 3BH7A 1HE5A 1AU9A 1FFGA 2OC9A 5ALZA 2QD5A 2CN1A 3NHWA 5FUBA 1FMFA 2ZCVA 5A6SB 3WFIA 4GD3Q 1TTPB 3ZLUA 4V03A 1RCTE 4PHHA 3GAMA 1K0UA 3I5XA 5KYUA 3WGOA 3A6FA 1JLHA 2F1KA 2DC1A 2FW0A 2F64A 3BBLA 5H1YA 4DY4A 3UUGA 1LNQA 2A1TR 5IG2A 1EFVA 2M2IA 1NW4A 3NM6B 3R0JA 4FB5A 5DNUA 1ELOA 1BE6A 1VC2A 4N7BA 5J5VA 3RIGA 4WN3A 4JGIA 4K7JA 3M82A 2R85A 3R8CA 2B30A 3RSHA 5JAIA 2XB9A 3PEUA 5JNRA 3C85A 4KK3A 4DADA 4EJSC 3MLAA 3ZBUA 1EXWA 4QU8A 1NQUA 3T41A 2BZGA 2P3SA 2DKNA 3DEAA 1B41A 3ORYA 4RADA 4YEDA 5JWOA 3U6KA 1J7KA 5FA8A 2AEEA 3JARB 4BVHA 2VSQA 3T35A 1YMQA 3Q85A 10MHA 3F8WA 3RVLA 5I7UA 2GO7A 2O3TA 5EEHA 3EA4A 3LF1A 4BLWA 3LGSA 4MI3A 2NVOA 4K6HA 4W9NC 1E2HA 3C7CB 3GPCA 5JIBA 2XTZA 2G1KA 3LUHA 4KSCA 1RI4A 2VK2A 3P96A 1PD1A 3D1LA 4KV9A 2R47A 2PD6A 5CDGA 3FFXA 5HZGA 1XQ6A 2JK0A 5LDHA 4JELA 1U7WA 1GNRA 1HH4A 3VU8A 1EJ6A 1XEWY 1ZSNA 3BKWA 2OV2A 5I47A 4U2CA 5I7FA 1U7DA 2BL4A 4AQDA 1AH2A 1KSJA 4LZAA 2I2XB 5BR7A 3O0TA 2A9FA 3PHJA 3DUFB 1JJBA 1Z68A 3IDQA 4V0MA 4MYTA 4Q0MA 1QKIA 4NR0A 3ESCA 4LXTA 2XQGA 3TL6A 4YUZA 3HL0A 1YBHA 2HMWA 3U26A 1DKQA 3N7TA 2J7KA 4KWIA 1LW6E 3WGGA 4JEUA 4KXWA 4CKZA 1P7CA 2YRFA 3T0IA 5KPDA 2Q0XA 4ZAWA 1KMCA 2REOA 3LECA 2XZTA 5IF9A 2H1RA 1ODLA 1WLYA 2G28A 4L5AA 5F7JA 4ESHA 3KVVA 3PGMA 1HV8A 1U5BB 4B80A 2OV6A 2B92A 2BP7B 3C8ZA 1P7YA 4Q3CA 5C5IA 2YXLA 3LC7O 5CFMA 1THZA 1T8YA 3RSOA 2CHGA 3AOGA 3NV7A 3TB6A 4HN2A 3UW3A 4ETNA 1UAGA 3KE8A 4QPZA 3SMQA 1AQ6A 4OXIA 1KVQA 3ZD8A 4XI9A 1QRRA 3L92A 4QUGA 3I32A 3ZDYB 1ZK1A 3ENKA 4Z7OB 1SUFA 2AR9A 4MRVA 5EOVA 1NVWQ 4F06A 1KMQA 5LQRA 1RQRA 2OLKA 3H05A 4UNRA 1D9XA 1T4MA 1UJBA 2WJHA 1XZQA 3LQKA 1QNLA 2Z4RA 5E1OA 3HN6A 4ZK2A 3G0GA 1OWNA 1ZH2A 3GOHA 3L7BA 3E82A 5FAXA 4ZMBA 3CF2A 1OFIA 2H0RA 2IOHA 1JZQA 3O9MA 1L0BA 4RQUA 4ZQIA 5FIUA 3BEDA 5SICE 421PA 1BHSA 1JMVA 1G7RA 4B3GA 1PYOA 1UF9A 3INGA 4L0CA 1CQXA 4DT1A 1LDGA 1N8SA 4N0DA 5AI6A 3Q3IA 4OGLA 3QA9A 4J1SA 3WJAA 3MTIA 3OPYB 5KOYA 2DMRA 1ESDA 2QHXA 3DHYA 2FI1A 3KUUA 1YS9A 4NICA 1Z73A 4NJEA 4IIGA 3DXFA 2A1UB 4FGZA 5KI6A 4DANA 3HEBA 4PG7A 4QX6A 5F2NA 3BTVA 2DR0A 4OLJA 3U56A 2R4QA 3NETA 2BFEA 1JEDA 5G1PA 4Z1MA 3QY0A 2P40A 3VNSA 3WYDA 2IQIA 1IN7A 2WWTA 4I4NA 4ZDKA 2O2ZA 1NUQA 2FSVA 1M10A 4H6PA 1NUAA 2Q3MA 2Z5FA 2PUDA 4OQQA 2ESRA 2PX2A 4HPJB 3ADOA 3LD9A 3TI9A 4R4JA 5M29A 2UZ0A 2E3JA 2B34A 3I58A 3JQ8A 4L95C 1AZSC 1WKVA 2QYHA 1EM8A 3CMCO 1NJ2A 4MLZA 4E5VA 3EARA 4O4JF 1MU0A 2ZYUX 2PNJA 5LZ9A 1LDEA 2GF9A 3KWFA 4U8HA 4DA7A 3U44B 3SEAA 4G0QA 4D4MA 4EECA 4GDFA 1QX3A 2X4DA 2WTBA 2Q1TA 4HPWA 1G41A 4LY0A 1SVLA 2R8ZA 4XIIA 1RKVA 2BCJQ 3GFFA 2GCPA 4ZV4A 3JV7A 4HPXB 1TGVA 3U3JA 1LPAB 4GOMD 3DB1A 5IASA 4URWR 2OP1A 4TMXA 5CCXA 5CUQA 5C7IO 2X9LA 1EX1A 1QHNA 3G6KA 4FOPA 1EXDA 4LECA 4MR8A 1PJ3A 3L02A 3NHFA 1QH0A 1NMEA 2JJ1D 2N42A 1J9GA 4L7QA 3ILHA 1FPQA 2RHCA 4BRWA 4I36A 1LPSA 1YACA 4MITA 5IDYA 3G0HA 4YV0A 2FSFA 2DUMA 1GZ4A 3RUDA 4W5HA 3KFLA 1L7QA 2OMKA 1HMPA 1NLMA 3Q0EA 1OBVA 5CG2A 5ITWA 4BATA 3DE2X 2X0FA 2V97A 4JJIA 4CR7A 5K0GA 2QI9C 4CL3A 1TM4E 3TSAA 4KGVA 5CJPA 3H4TA 1F3OA 4KVFA 2BKAA 2ZT8A 4YWHA 2YZKA 3TRFA 5ITZA 1UWLA 5GV7A 1CB0A 4J6EA 3HRIA 2DBRA 3BYZA 4EQ6A 2F1JA 4L4RA 3WYGA 3IEMA 1ZD1A 4AJKA 2FFJA 3MLEA 2JIZD 1Y9EA 1T6YA 3UMMA 2XUPA 2LP4Y 4QXAA 2XEXA 4L2IA 2R68A 4TS1A 4JX8A 4AMVA 5JZ9A 1II8B 3HGQA 4RMJA 1ICIA 2JAWA 2DRIA 2RGGA 4DGSA 1V3UA 1N1DA 1G16A 1DMRA 2PBZA 3C8MA 4Q4AA 5DNVA 2IXAA 4L4SA 3A25A 3IC5A 4AG6A 2FFQA 2QTZA 4IDDA 3VJLA 2NO6A 5KWVA 2RGRA 3HL4A 4B79A 4DPMA 3NTXA 4AUEA 2CLSA 4PTZA 3HBNA 3WGQA 1H9AA 3GRCA 2C9DA 4NC9A 4X64B 3ONFA 4ADSG 3PGA1 5AR1A 3TLCA 4JGBA 3RUFA 3I12A 4DYVA 2RG1A 4UHJA 5K0SA 3OF5A 2QB5A 3HJTA 3Q40A 1XJ5A 5CXSA 2YIJA 5L3RA 2DVMA 1GXSA 4TV8F 4B5LA 1JJAA 2BMVA 1A98A 2A0WA 5TVKA 1CBUA 1C1DA 3CBQA 4R81A 3W5SA 4NI5A 1E1RA 2APJA 1T3HA 1JIJA 3LHFA 5C52B 5T7BA 4PNHA 3M9XA 5AW1A 1NP6A 3TW8A 2ZUUA 3L43A 3RS8A 4ZZ2A 1D6MA 1OVGA 3IODA 3MT7A 3BF8A 1YTUA 1JLRA 1OTXA 2P79A 3NC0C 1ZW6A 4U9HS 3VMMA 2X1MA 1O6GA 1QHHB 3PSHA 2C4WA 3T1OA 2EHDA 1KETA 2QGFA 3ZGZA 2H9AA 4JU9A 3AV3A 1QHEA 1MQ9A 2QR3A 1IJBA 2Y99A 5AW5A 2IU3A 1KMHB 2P1RA 3RRZA 3ZH9B 5JZMA 5F12A 4L85A 1FTNA 1E2QA 4M9QA 1NBMD 1H0RA 5EKSA 2C5LA 2FUG6 4IF6A 3X0DA 3I9KA 3ABQB 2AJCA 3TIVA 1POWA 1DRWA 3KTAB 4OHKA 5ALOA 2WPDD 5DEOA 5T6MA 1EP1B 3OAAA 1HDRA 4JNKA 5C1DA 1P1IA 4O4JB 5K6RA 5LIPA 3QEJA 3SEZA 1VPDA 1P4SA 3A7DA 3LIIA 4OIMA 5FPQA 2XECA 1ENYA 2GRJA 1QOPB 1O5OA 4BVGA 1M2NA 1BVUA 2HM7A 4OB8A 3F98A 1AZWA 2DBZA 4WDRA 2R87A 1CZNA 1CS0A 1HLGA 2JGAA 2OVBA 3IV9A 2PO7A 4MW5A 1LSOA 4MAFA 2HADA 1WJGA 3L40A 2J07A 4PU0A 2GPYA 1Y42X 4JEIA 4NRDA 4U6SA 5AK3A 3KYDA 3OURA 4MEAA 1SB9A 2H51A 2DECA 1UDWA 2RIPA 1WZIA 3WAKA 1L2TA 1EWVA 3F8SA 2Q4RA 1R0SA 3ADKA 2G7MC 3O73A 4K40A 1YBAA 4W5TA 4XD7D 2E21A 4XLLA 2VQDA 1EG7A 1RP1A 1GPKA 1T9CA 2ROQA 1TU0A 4I5IA 4IVQA 2AXPA 2FX5A 2IOQA 3FLMA 4KN5A 3CG4A 2IL1A 1I4WA 2P7IA 4QDOA 2Q3HA 1F6WA 5C0OE 2V9CA 2QTAA 3K20A 3LCMA 4WZBA 2IIQA 2PUVA 1NGSA 1KYZA 3DE5X 3SP1A 4V2IA 4OKIA 5FWYA 1IBSA 2VPIA 1ULZA 3AF1A 5HA5A 3IQWA 4IHJB 4LSWA 4EPVA 1Q0TA 4NFHA 1HETA 1JEQA 5I3ZA 1HE2A 5KOJB 5JZVA 4BNVA 3ZGYA 1PR6A 1C0IA 4YJHB 1Z74A 1Q0HA 3HEAA 3MXTA 4ZRNA 3OLQA 3E4CA 4HF7A 5F1YA 1E1YA 3RTAA 5A2GA 3KELA 4DREA 1I2MA 3NVAA 4H6WA 2ZSAA 4WESA 4HRYA 1POXA 2EFCB 4EHFA 2C2ZA 4GQAA 1FTSA 3RNOA 3D2LA 2H4FA 4P3OA 2HEGA 2IYNA 2OA0A 1NBHA 4W5RA 4LJ4A 2HU7A 3ELWA 4N8SA 4O1MA 2J0QA 1OILA 1B8VA 2ODTX 2WNSA 3PA8A 4RZ3A 2FEAA 3ERCA 5CEJA 2AFIA 1V9SA 5K0EA 1T91A 1M34E 1U65A 3AEXA 3IR7A 4CEJA 5IT0A 1ZMBA 3FTDA 3AINA 3T9DA 3TW0A 1J8MF 1OKKD 1UZUA 3I1YA 4OHFA 1GG9A 1FFSA 3GMIA 4G5RA 4REMA 3TE6A 3UK1A 4EYOA 3G79A 1XQXA 1YONA 4RJIA 2AJBA 5BV1A 1FL9A 1YULA 2HF8A 5AVVA 3KOMA 1E99A 3ORHA 4AY2A 1QRTA 1X15A 3JWEA 3UMRA 2BM1A 1S2GA 1QKJA 4KJZA 4BN0A 4IGAA 4TV8B 4MHSA 2RC5A 1RXVA 1O6CA 3JTMA 1IJFA 3OJ0A 4G5SA 3UV3A 4JMPA 2SCUB 1WQ1R 3IXQA 4L5BA 3TFWA 2WIJA 1PHPA 4U6NA 3NFRA 1RDFA 4EMSA 2JEYA 2PD3A 2WWIA 3QFFA 4ND3A 5BSEA 4MXDA 3T3HA 4OA8A 1QFXA 5BN1A 3T34A 3LHIA 1UT5A 2Y71A 1UL1X 4JI0B 1IYZA 4MPJA 4NK4A 4E11A 3N2GB 3GT4A 4U0KA 3T7TA 3OLWA 3DOJA 3NATA 3P0HA 2GD6A 4G8JA 4Q3OA 3CSDA 3CS3A 2AE2A 5HCIA 3SD7A 3L07A 1NXSA 4D9JA 4KR7A 4PTLA 1BRMA 3QPBA 4HN4B 1JW9B 4G0MA 1GZHB 2AYZA 1XRLA 1G5PA 1OIWA 1VJ1A 2XOKD 4EQZA 4WZAB 2FE4A 4MWBA 3UAGA 2YJZA 1RWKA 1U2SA 1NUPA 5EIAA 3DGEC 2UXBB 2YINC 3VSDA 3HWX1 4WXYB 2G07A 4YFVA 2E4WA 3EGXB 1WKBA 3LCUA 2PT9A 1RWQA 3GEEA 3ONEA 3P7MA 4ME6A 3BBPA 4MV8A 1CE8A 5D3ZA 1JR3E 3HBAA 5JWHA 3T5GA 1S4QA 3TTYA 1SOAA 2IHBA 4FILA 4X1YB 1ID1A 2FN8A 5J3JA 3I39X 1Y1PA 3OZRA 1JQDA 4OU4A 5FPYA 3Q3JB 1FNCA 1GGKA 3MUEA 2X7JA 4IV5A 4MYCA 1K3UB 4KXNA 4PAGA 4FYWA 1OCEA 3UAWA 3U19A 2C3OA 1Z5NA 5B2EA 4YQZA 2BE7A 2ZB4A 2IXTA 1VJ5A 3CJQA 3TF5A 1GNPA 5D1HA 5L3QB 1XDBA 3OJWA 2J3LA 5DBHX 3QE9Y 2VJDA 2HSGA 1QPBA 3HYLA 5LQKA 3PQ7A 5AW6A 2BI8A 3N75A 4FJ1A 4CN8A 1OVMA 1KR5A 3DLCA 3TLYA 2VTBA 4I1OA 4H1WA 2CW5A 3FTNA 2YMPA 4IDNA 1NYLA 3DCNA 2DLNA 2HXYA 3QLVA 5EINA 3VZQA 5AKXA 4YI5A 3LUGA 1K2WA 3F7NA 2JGDA 4B40A 3UA4A 4YV2A 1Q0QA 2NOAA 1LEHA 5KMGB 2IEBA 4ZZIA 3HO1A 3VPFA 1QS0A 2GB4A 2X0EA 3K05A 3MT9A 2AA3A 2F3QA 3BIXA 4BFSA 4CIDA 2A78A 1X94A 2JFOA 1TGYA 4DIEA 3QOWA 5IM4A 1NWHA 1EVLA 3DBOB 4PRZA 5LLDA 1GZDA 1LTHR 2WSSA 3OJEA 3Q0TA 4RSGA 2VP0A 3RHZA 2O1SA 3ZVNA 1T6ZA 2X2FA 4Z0PA 5KYTA 5AW9A 3WWZA 5IUKC 1ZNYA 4L74A 2IF0A 2JGMA 4MINA 1WQ3A 4FCWA 4G25A 1IM5A 2FU5C 4NV3A 4GMHA 4R1OA 5DTMA 5IFKA 2P6RA 8GPBA 3WMFA 2XY4A 3WB9A 3NV9A 1KWGA 3UJBA 1ZC3A 3EIEA 3FNGA 1KFCB 3FBTA 4RPHA 3UXEA 5LPNA 2FLKA 1KY5A 1MH9A 1TK2A 1VSUA 5C4MA 4RKFA 1JALA 4RD2A 3NDBB 2MSWA 2A0FA 2QLLA 3M1YA 2EERA 2J3MA 2BGRA 2XMQA 2I80A 2QF7A 1K8YB 2NTEA 2GPWA 2PZEA 4J4TA 4QHSA 4MYRA 3I04M 4XARA 1VE5A 3EXEA 4MPPA 2J6CA 1IULA 5A3SA 4J9UE 2ERYA 5AO9A 3WLPA 1SHZA 4U7TB 5C8YA 8LDHA 3RABA 2VKQA 3PEWA 2Y92A 4XVQA 5REQA 1KJNA 3FWYA 3B1FA 3TQCA 2F48A 4F1KA 4NYIR 3ZWBA 5J9FA 2O8DA 4JVLA 5KTNA 3C3DA 2WMOB 1P74A 3RJ5A 1KDVA 1K97A 3R5XA 1F1JA 2YJTD 4WNAB 2RSLA 2CNWD 2H48A 3PRJA 2FR1A 3RPEA 4IIJB 4DC1A 1A5BB 1FTGA 3KR0A 4YMIA 3SJBA 2ODQA 4X3OA 2A5YB 4A91A 2BH2A 2HLDD 4K9OA 5DN6A 4A0QA 2IEGA 4RORA 2H85A 5L45A 5DXFA 2IODA 4H3VA 2HWYA 1QR2A 5H16A 2J4FA 4MUKA 2LZ0A 3K96A 1OT5A 5HKBA 2FMFA 4XUDA 5IANA 4MGHA 1CUYA 3VU1A 3Q7PA 4F85A 5K9ZA 3KNZA 1WAMA 1XV5A 2R6CA 4EJ0A 1NLFA 2Q07A 4YAFA 4CODB 1KO7A 2FA9A 1X14A 3N39C 2X8JB 1U2DA 2IWHA 1OWOA 4NH4A 1XTRA 2ZWMA 4EY8A 2GAFA 3SIPA 4D6XA 1YCHA 4UEQA 1GOTA 3M83A 1S2DA 3EAFA 3N7AA 1RXWA 2YN0A 3EUEA 1ZK2A 1KDPA 4K9NA 3MCTA 3SKYA 1PW7A 1Z62A 3PHHA 1GR0A 3H2HA 3JU3A 4TLBA 2ZZNA 4WXHA 4CLOA 3N87A 5HE8A 2EAUA 5G40A 1RBQA 1C3LA 4I50A 5BSFA 3AC0A 2ZRFA 2FWMX 1I7NA 2J67A 3UUEA 2AW5A 1Z3IX 5SY4A 4BZXA 4Z4HA 2CFRA 4V24A 4MEBA 2DFDA 4IICA 4DR5B 5JSUA 1JXOA 1C7ZA 2D1TA 3CH5A 2JKYA 3HZHA 4B3HA 3MJSA 2HYIC 3H42B 3K9FC 5MF6A 2JCGA 1PLKA 3ZTTA 4P5PA 2MSDB 3VNAA 3IKLA 4BV2A 2PRYA 2FRDC 2JD1A 3CZ9A 5ULLA 3ROGA 3TLGA 1EGAA 4ODIA 3GJSA 2IPMA 3QOXA 5LC1A 3I2YX 2VK4A 3BDAA 3PC2A 3TLJA 3ABIA 1SULA 2ONYA 2DETA 5C32A 2FRDA 2HZBA 5JE8A 1M6EX 1PEKE 2ZVDA 4DQDA 4EKIA 5FAKA 4IQGA 2VPXA 2Z2YA 4LG1A 3FB1A 3WDLA 3UWOA 5SV2A 3TUIC 1SVIA 1KAMA 4MGYR 4TOIA 4E31A 2XCIA 3WP1B 1XG5A 5HILA 3OM8A 3ZXSA 4EG7A 3CVYA 5TDHA 1APBA 1M5RA 4Z99A 4EG3A 2IS4A 2IBMA 4BBZA 3MJTA 2ID7A 4PC6A 2H2FA 1ZGHA 2R66A 3EE6A 2B6HA 3CLKA 2JGLA 4RH3A 4YRIA 2QBYB 2WJVA 4IIEA 3UV7A 5KNBD 2UYQA 1JX6A 2FN7A 3C87A 3RFFA 2GI4A 2I6XA 4UEWA 3JQFC 4MW4A 4ZCSA 2ONJA 3T4UA 4H1UA 2IRWA 3LK6A 1EE9A 3HI4A 4GSYA 4NQRA 4BEBA 4MRPA 2NNWB 2XUIA 2XYPA 4GKKB 1MX3A 2OZKA 2MTBA 1J56A 1Q0RA 1XTKA 2QW0X 2AC4A 4XAQA 1N2HA 1S2LA 4RHUA 4B4OA 1E5LA 1VL5A 5AK6A 1B42A 3QF4A 2EIXA 3GW8A 4HMPA 4ER0A 2Z95A 2PX0A 3W6PA 3DV0B 5CLFA 5LD2B 3G13A 3HUEA 3Q3VA 3EXIA 1DCMA 1JLLB 4GNKA 5CB0A 1SVNA 3FRIA 5F76A 3ER9A 3BCSA 2GLXA 3HYNA 3KQPA 2JLXA 5JCJD 2CCJA 2E18A 2NUPB 1LC3A 2ZS8A 3BRCA 1JLKA 3QFRA 4EHJA 1EUDB 1TMYA 1NPDA 2JBHA 1RJFA 3EOBI 4HT3B 4Q3DA 4CQLA 3KFVA 2GEKA 1KH3A 2XBLA 1KRHA 1NAHA 1GUYA 2A5GA 3FIUA 1G8GA 1BHQ1 1UKEA 2ZJBA 4LOKA 2PWAA 5EJGA 4NWIA 4XFKA 1XRMA 4I5FA 4DC0A 3UWDA 4E5SA 1HG0A 2YMMA 4LXYA 2CVZA 2O20A 2PQ0A 1RWPA 2I6FA 3S8EA 5FTWA 4ILEA 1CP3A 3PFHA 1D4OA 5AXBA 1HURA 3TVYA 1XQWA 3HH8A 5B7NA 1W6UA 3OPYI 1E0AA 3AVVA 3VYVA 3E6AA 4BNDA 4RZQA 4QVIA 4U7GA 2HXSA 1HA3A 4C30A 3TRIA 5A1TA 4YDHB 1SXPA 2D5IA 3LDGA 1EH5A 2ATVA 2CL6X 5F2OA 2H1SA 1C0PA 4MVJP 4RU1A 3AHIA 5IK2D 1D0SA 1QV6A 3AI3A 3OQOA 3NH9A 1V3QE 1YC2A 3NHMA 1MHTA 2ZRIA 3ZCQA 1QONA 4BN5A 1BS1A 1NATA 1ISJA 3QK7A 4G56A 4UM5A 4W8HA 1XVAA 1QZTA 3TQSA 4JOSA 1UKBA 2X9QA 3UMGA 3EAGA 3EGWA 3O1HB 3QKTA 3ML1A 3IP9A 2AN9A 4FZVA 4XIGS 1M2VB 4I3HA 2HPZA 3GZ4A 2AEMA 3DSRA 3OM1A 3QE4A 4A5SA 1GA6A 2IYZA 3H8JA 4I6GA 1JSLA 1PT6A 2C4KA 1F1BA 1KH1A 1TO2E 3KZXA 4CTOA 3VYWA 4U39A 2BPOA 1K8XB 4BEJA 1LZKA 2AJDA 3FHCB 4UUMA 3W3AD 4UEKA 1U0EA 3FLAA 3HHPA 3EZ6A 1OGJA 2FRXA 1ZVKA 2QM8A 1Y7PA 1YR3A 1Z6AA 3BKXA 2FPSA 3H6HA 4KYTA 4AECA 4CFSA 1FTQA 3ZD6A 3IMKA 1STOA 4H3KB 1M1NA 4JLBA 4EHAA 4F8EA 4BNXA 1NR1A 1CNEA 1ZN8A 2FDXA 3AY3A 3IBCA 3TG2A 3UUWA 1R0KA 2I2WA 1I33A 3PXCX 3HFRA 1MTZA 4P0PB 2CK3A 2F90A 3E35A 1N0IA 2Q6VA 4BFLA 1KY2A 3SCZA 3HQ4O 1JDNA 5D5HA 3CPSA 2XE4A 5DIZA 1PO7A 4EJ6A 5I7VA 3SVZA 2ZWPA 1M0SA 3VOTA 2JIPA 1O3YA 2VK1A 3OLZA 1TUBA 4JOCA 3VHXA 5GZ3A 3RAFC 2PAFA 4F4IA 1RXEA 4ARVA 4XIYA 3LOUA 3REQA 1FX0A 4FT2A 4KYIB 3TSZA 3VISA 2JHCA 3G17A 3I2FA 1PR4A 2F8MA 1XNGA 4L8VA 2ZJYA 3D8SA 3KP1A 1GUDA 3L9XA 1O96A 3NALA 3NVKI 1VHTA 1FDTA 5G0WA 4BLVA 2VYVA 2PANA 4O2BA 4A1OA 1PX0A 1N2CA 4E3WA 4A8JC 4HYYA 3E5HA 4IIXA 4ZVKA 3RO7A 4WUTA 1HYGA 3B85A 4CHGA 1B26A 3VO9A 4LRSB 5DN9A 1DBPA 2IY7A 3EGEA 5FPHA 4ZYUA 4O2LA 3SYKA 1SUIA 3L79A 5ERYA 4PLPA 5FEMA 3SDBA 5A0TA 1Z0JA 1TQ4A 2R5NA 1URPA 2YFHA 1XCOA 4M9XA 1D4FA 1E4YA 1V8ZA 3SYRA 3V8NA 5BSGA 3HP1A 3R8FA 4YA6A 3SC2B 2QRLA 4EGAA 1NG9A 4C4AA 4UUNA 4MMZB 2ERCA 5HG0A 1WU7A 5K0FA 4DLXA 3GEPA 2JFFA 1QQAA 2EYUA 2D7JA 1SOUA 4BYGA 3IMFA 4J8PA 3I01M 4B34A 5LQUA 4TKVA 3H18A 4JX9A 4G41A 3WMXA 3YASA 1QH9A 4CKCA 4DNXA 2ZJ0A 3RYCA 3VXKA 1IAVA 1RYEA 2EGUA 3OH8A 3E15A 5M34A 3ZJTA 1DIHA 4I5GA 1NXWA 1W1WA 2W48A 3F6SA 2H9IA 1BXRA 4IIDA 3TRKA 1D0VA 1W25A 3EVFA 4CN9A 3PFCA 5JBQA 3BRQA 1ZGJA 1Y6ZA 3MHPA 4Y9RA 3CUVA 3I73A 3NBKA 4MP3A 4WCFC 1TT7A 5TJ9A 1WUHS 1GG5A 3CCBA 2AEFA 3OPNA 1HY3A 3GLFA 1H22A 1JDPA 1P19A 5FXMA 1M3SA 1L5FA 1GSAA 2D1FA 3UHFA 3TGLA 3F1KA 4TVSA 5BNTA 5EI5A 1O7JA 2CLMB 2QL9A 3AUUA 3MMPA 4J16C 4OQNA 5HBRA 2ZVJA 1TK9A 5E3IA 4I6JA 2NN3C 4F7WA 2LPMA 1XLTC 3GQBA 4B71A 4LFAB 1JJFA 1C1XA 1XD2B 3O2NA 5LA6F 3AO0B 1E4EB 1HLPA 3GT7A 4Z6KA 3AFIA 3PRYA 5BY2A 3EMKA 4KNWA 5FI3A 4OQZA 5JALA 2Z9CA 3OQVA 3MTAA 3G2KA 2YYAA 4HWRA 4LIPD 3T1QA 1J9EA 2BFWA 3QLUC 5AM2A 4KR6A 2OD9A 4OM8A 1JDSA 2ENUA 1ZONA 1HYQA 3QM1A 1EFTA 3PTZA 1U7XA 1SVOA 2ODNA 3JQPA 1AKQA 4IXMA 2Y68A 3E2PA 2O4CA 5C8ZA 4RULA 3L0CA 3SX2A 1I32A 3ILVA 1KZGB 1PZHA 3GIWA 4IM7A 3IAAA 3ASYA 1R5BA 3EQ6A 3IVMA 3D3EA 2QROA 3QI2A 3P27A 4TS3A 4EFDA 4I5EA 2WDPA 2IELA 5I5EA 3FR8A 5JAZA 4BO9A 1SXJD 3DA8A 3DDNA 4DXAA 1C7RA 3KTDA 4ARCA 1U0SY 3WHPA 4RKQA 4JBWA 1Z2CA 2WP0A 1G20B 3P2YA 2CXPA 4RK4A