1EDOA

The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with nadp+
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
244
Chain Sequence
SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLALSPAASYITGQAFTIDGGIAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
publication title The X-ray structure of Brassica napus beta-keto acyl carrier protein reductase and its implications for substrate binding and catalysis.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
total genus 84
structure length 244
sequence length 244
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2000-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1edoA00
1V0JA 2X5KO 3LT1A 5TS3A 2X86A 3RWBA 4HWKA 3G79A 4PLTA 2IXAA 2C07A 3EC7A 2J5KA 1DC3A 3BMOA 3E9NA 4JP3A 4NR0A 4F6CA 3PJDA 3RKUA 3D3WA 2QRKA 3NTRA 4HFJA 3FBGA 1WPQA 1Z7BA 4RJTA 2BGLA 3ON5A 4NBVA 3NGLA 5JDIC 5GY7A 1JVSA 3EMKA 3L6DA 4J0FA 1E7SA 2BGKA 2EWMA 4GKBA 1H2HA 2IE0A 4I9HA 3W8FA 2HRZA 5BNFA 4WOJA 4Y98A 1LQUA 2PNFA 3OIFA 3PYLA 2ZJ0A 3LC7O 3NT4A 3RUAA 1P1JA 3I9LA 3DR3A 3QLJA 1EUZA 4BO7A 1KY5A 3JSAA 4RZIA 3UGKA 1X7GA 2Y68A 2CUKA 3LLSA 1PZEA 1OZAA 4FFRA 1FDSA 4JK3A 4XQ9A 1YL5A 1YOVA 2AMFA 2C7GA 1GR0A 4Q3NA 4R1SA 4P4NA 4ESOA 3DMTA 4E5YA 5BSFA 4XQGA 2I3AA 4XGKA 1E3WA 1NAHA 2JHGA 1M6HA 2GZ2A 4FOOA 2HSDA 2EW2A 3JD1A 3S8MA 3KBOA 2P91A 1WWKA 3O9ZA 5F5NA 5KKAA 4Q3AA 1Q0QA 3ABIA 3NAQA 3HWRA 4YRAA 1GQYA 1XCBA 1KY4A 4CMJA 1DOHA 3I5MA 4IZIA 2ILTA 3F1KA 2AQHA 4OAQA 3TNLA 2HCTA 3ZNOA 3ZWVA 4FW8A 4ZRMA 1GV1A 1W6UA 4JBIA 4RF2A 3PFFA 4P8RA 3BMQA 4YT2A 3E18A 2W2LA 2WTBA 1NFRA 2GCGA 2VOJA 1IYZA 3ETDA 4DVJA 1P1FA 3L6OO 3SJ7A 2WSBA 4WEOA 3GHYA 2AW5A 2CVZA 1Y8RA 3KSZO 5JY1A 1GFSA 4P4GA 4FGWA 1BDBA 4J91A 3WBFA 1ADBA 2NQTA 1ISGA 5AXBA 1L7EA 2E4AA 3WSVA 3K92A 3Q9NA 5K6AC 3IOYA 1S7CA 1MGOA 1QLJA 4XYEA 1R6DA 3D3EA 4RVUA 2I5PO 3JQ7A 3JYLA 4XYBA 3GFGA 1U8XX 1Y81A 5DZSA 2P2SA 4IJKA 1DB3A 1Y9EA 5AXDA 1DIBA 3A14A 5CFZA 3V2GA 2PFGA 3H9JA 3RBVA 4CPDA 1U7HA 3RAJA 1Z45A 3BTVA 3ROKA 4KWIA 3MJCA 1R0SA 3WS7A 1PL7A 3GZNB 2YHUA 2E48A 4J4BA 2WYVA 1B3RA 3HADA 1PSDA 2D2IA 3T4XA 5CEJA 2DC1A 3NTOA 3WGTA 4DLBA 1DJQA 3D5QA 3OJ0A 4WNIA 3I9JA 4U5QA 3QV1A 2XOXA 1XG5A 4IDFA 4E12A 1PR3A 2OMEA 2OOSA 5F3RA 3L9WA 4BL5A 3PHJA 5T8KA 4E5NA 4A7PA 2ZTVA 3ZWOA 5COBA 4Y6SA 4BNWA 3KLPX 4DC0A 4G5HA 3HB5X 4H16A 2X58A 3INGA 2P4HX 4BV8A 1PWZA 4LSMA 3GA0A 2ZTMA 5I7SA 1ISIA 3EGOA 4CQLB 2FY8A 4D3FA 3EYWA 3O4RA 4I5FA 4D7AA 4WLEA 2OP0A 1B7GO 3BMCA 5CG1A 1IULA 4IDBA 2PH5A 4LCEA 3ZWCA 1B0AA 4DPMA 4BO5A 4CQLA 3PRJA 1XKQA 4OOEA 4F6LA 5EJ2A 1QV6A 1R4MB 3G17A 1EQUA 3HN2A 5FFFA 1P45A 2VRBA 3TPCA 5I7FA 1J5PA 4RZHA 2J6IA 1AHIA 4RGBA 3VDRA 5A9SA 1LTHR 5HTOA 3DO5A 4WCFB 4M8SA 2H5LA 4UUOA 3KVOA 2TMDA 1B8VA 4XDYA 5H82A 1LI4A 4CMEA 2QRJA 3JD4A 1ZKMA 5A3VA 3NT2A 3C7CB 5TT1A 2HU2A 4BNNA 4DUPA 3GMDA 4WUVA 3S2IA 1BVRA 1X0VA 4YT5A 3WDSA 3VVBA 1JWBB 4BNIA 5ILGA 2BI7A 4AVYA 1Y1PA 3K8ZA 4CR6A 3PHIA 4J7XA 4XKJA 2FR8A 3ETGA 1H2BA 4KUHA 4L9RA 3ZW9A 1HDZA 4M86A 1NXQA 3VZRA 3NEPX 2EIHA 5I9NA 4XQCA 1MXFA 4DIFA 1H9BA 4XEHA 3KYDA 3HNPA 3E48A 1I3NA 5BNIA 5U9CA 3OEYA 1IHXA 1FDTA 4KZPA 1B2LA 1QMGA 1RKXA 1JA9A 3F5QA 2NLOA 1JVBA 4AJPA 5AOVA 1ADCA 1DIAA 3P19A 3M2TA 1Z73A 4EEXA 2X5OA 2NVUB 3GNTA 2BI8A 4HFRA 3RROA 1ENOA 1HEUA 3ZWMA 3FNHA 4ND5A 5JAMA 2X22A 1JWAB 1P77A 3DAGA 1M67A 3DFUA 5ES3A 4UVIA 1I2BA 4A73A 2NVUA 3HDYA 4Z0TA 1EDZA 5H83A 1O6ZA 5IDQA 1MB4A 4TVBA 1YS4A 3ORFA 1YB5A 4L75A 4YACA 1V9LA 1QLHA 3RBZA 2D8AA 1LXCA 4MVJH 5TSDA 1SB8A 4B4VA 1A72A 1GYRA 4J4TA 5BQFA 5AQ1A 1T24A 3AOGA 5KVQA 3PLRA 3I3OA 1ISJA 1BTOA 1YBMA 4PLCA 2C2XA 2X8LA 4CMAA 1P31A 1KYQA 2FWMX 4P38A 1OBFO 1QRRA 1U5CA 3DZHA 4W9NA 5IFLA 2AQKA 3F3SA 3RUFA 4K1LA 1ONOA 1YQXA 2QW8A 4PFJA 2BD0A 1Y6JA 3AUTA 3PDUA 2JL1A 4M54A 3C24A 3QIVA 2EF1A 4Q3DA 4L76A 3AM3A 2ZB8A 1NR7A 4ZU3A 5A05A 2R00A 2RCYA 4FFLA 1B16A 3F4LA 4B4UA 2VYVD 3WR5A 2CD9A 2CMDA 3AK4A 3WBBA 5JC1A 3GDOA 2OL4A 4Z3DA 4DYDA 2RIRA 1ZK2A 3C7DB 3E9MA 1Z75A 4A2CA 4D45A 1YQDA 2DFDA 2LDBA 3EVTA 3NGXA 1GV0A 2YV2A 1BWSA 3ZI0A 5MGBA 1P0CA 5HBRA 4PG7A 4CLRB 3M2PA 2GUGA 3SLKA 2FN7A 4WJZA 4KDFA 1RYEA 4MIOA 4MVJA 4NU6A 4ROSA 3OQBA 3CUKA 3NYWA 1XLTA 2EJWA 3DZIA 2VT2A 3LT4A 3TOZA 4WLNA 4ITUA 1E92A 1KERA 3JQ8B 3U3XA 5JDIA 4DA9A 4Y67A 5F1KA 4Z9XA 3R3SA 5B37A 2X5JO 3DOJA 1ZXBA 3QW2A 4MIYA 4RL6A 5JFOA 3D5TA 4YEDA 2B4QA 4AJ2A 3UCFA 3VZSA 1EZ4A 1ZCJA 3S2FA 3KEOA 3LF1A 3NJ8A 4EBFA 6ADHA 3VH2A 4J1SA 1TA4A 1N1EA 4YJHB 4IQ8A 3AI3A 2EHDA 3DZBA 2DTEA 3I52A 2OP1A 4ID9A 1RWBA 3QRWA 5HS4A 4XJTA 1YVEI 5HM8A 1NWCA 1XGKA 2NQ8A 4FD3A 4BO4A 1X7DA 4OJNA 1E3JA 2O3QA 1KBZA 3EDMA 1DIHA 1PL8A 4IBOA 4MKXA 1WLYA 4EUEA 4JN6B 3S2EA 2DTXA 4E5PA 1OAAA 4B3JA 3DQPA 1E5LA 5C7OO 4TRRA 1PR9A 4NFYA 4N5MA 4E2XA 4ND1A 1W0CA 3DMTC 2B35A 2VZ0A 1T4BA 4JBHA 4UVDA 1E77A 3HDHA 1NR1A 3ENKA 4XRRA 4DTIA 1QXSA 3SEFA 2G76A 3W4JA 4DQXA 2G1UA 3TF5A 1NWHA 4WLOA 4GAEA 1IE3A 1WDLA 2FZWA 3TN7A 2BFMA 4RF3A 2PGLA 4BMSA 1YDWA 2HMUA 3LQFA 1BXGB 3DC2A 4M1QA 4NJMA 3RFTA 4XZ3A 3W6UA 3DONA 2HRBA 1GUYA 3AU8A 4I1IA 1BVUA 4PN3A 2ZK7A 4URFA 1X14A 5HS6A 2HO5A 5CHEA 1GQQA 1DSSG 5G0UA 4UVGA 3Q3CA 1HSZA 2NNLD 1O9BA 4BQPA 3AUSA 2JCXA 4XYGA 2GO1A 1GYQA 2PKQO 4L74A 4BNGA 3JQAD 5IXSA 2DVMA 3H4VA 4FJ1A 3DTYA 3PWKA 4F46A 5L3ZA 4NK5A 5GZ3A 3DTTA 1C0IA 1K5HA 4EJMA 2JFGA 1AGNA 5A06A 1B14A 1M6WA 1BG6A 1MC4A 2J3HA 2VRCA 2VT3A 1CF2O 1I2ZA 3MEQA 3QE3A 1ZK3A 5I8WA 3E1KA 5KOIA 2E82A 3DZGA 1K2WA 1EBUA 3KRTA 2DKNA 3H2ZA 4JJIA 2X7HA 1LDYA 4BNKA 5HWSA 2G0TA 5CPBA 2JFFA 2ZCVA 1KVQA 1C1XA 5J23A 2ZJ1A 2UDPA 3KSDO 4BB6A 5B4VA 3QY9A 4QXMA 2NTJA 3JQAA 1PGNA 4M49A 4E2YA 2YYYA 4B3IA 1H9AA 4TKLA 1ARZA 1Q7BA 3CZMA 3OMLA 4JXKA 2CZCA 2EEZA 4K9DA 1BW9B 3GEGA 3GR6A 3RC9A 5COAA 5T8KC 4OXKA 1QYCA 5LCXA 1ZJYA 1EK5A 4QO7A 4DLLA 1A7AA 2BRUA 3H65A 3B1JA 2B4TO 4CM4A 4P4LA 3E8XA 5T64A 1KETA 2ZYGA 1QP8A 1WZEA 4CJXA 4A5OA 1ZK0A 1U5AA 4NJOA 2Y1EA 3DXFA 3JQGB 4EYEA 1EE2A 1AXGA 1T26A 3KTDA 4XGIA 4IS2A 2PR2A 1UJMA 1KC1A 3P2OA 3JYPA 1HLDA 3PYMA 3KHUA 1OOEA 2ZYDA 3NDJA 3DWFA 3JQGA 1XU7A 2WE7A 4CM5A 2D3TA 2J3IA 4PLFA 1P1RA 3NT5A 1HZZA 4PLPA 4MO2A 4BKOA 1DLIA 1P44A 3VAZA 5IXYA 1E6UA 4D44A 3A06A 5CDSA 4AICA 3FNEA 3UH1A 3O26A 3OIGA 4GQAA 3VZQA 3NJ4A 3GPIA 4IS3A 4CMEC 4HFNA 5AYVA 4XD2A 4NFHA 1L7DA 5JCJD 1UP4A 4U0JA 1JDJA 1BSVA 3U4CA 3DZKA 1YDEA 5F1OA 4GVLA 1FDWA 4IZHA 5B1YA 3V1UA 1JTVA 1LDMA 3IJRA 1VC2A 3UCXA 1YKFA 4CQMA 4HUJA 2H9IA 5EPOA 3WNQA 2VTDA 4RF4A 1EE9A 1EK6A 5ADHA 4PG8A 1HYGA 3Q6IA 3ZGYA 4J1NA 3NKLA 1Q7CA 5DOZA 3C1AA 1H0KA 1ZMOA 2POQX 3IDSA 3DEYX 3CXRA 2WYUA 2GZ3A 1O0SA 3VDQA 3HB4X 1NVTA 1HXHA 3DDNA 3X2EA 4BNYA 1NQAO 3PXXA 3NV9A 3VPHA 5JCJA 5TLSA 2JCVA 4WLUA 1ENZA 4XB2A 3PZRA 3HN7A 4FFOA 1MLDA 2RBEA 1KVRA 1DO8A 3KLMX 1KS9A 5IDWA 1WMBA 2O3RA 4FR5A 3V8BA 2GERA 3FBTA 2Q2QA 2VNSA 3G3EA 3PWSA 2O7QA 4NK4A 5IN4A 1LA2A 3DOOA 4FOSA 5FWNA 2C82A 2R2GA 3VH4A 3ZU4A 4AJLA 4CM9D 3KOUA 1H5QA 4R1NA 4QT0A 5I7EA 3GC6A 3IMFA 1Y8QB 5DDIP 3F9IA 2Q45A 4J0EA 3U49A 4YBZA 4QUKA 2JD2A 4DLAA 1XYGA 1A7KA 4OO3A 2GN9A 5T67A 1EFKA 3LF2A 3KV3O 4BVAA 1Y8QA 3F47A 3DB2A 3ITKA 2AQIA 3OECA 4IDDA 4AJ1A 2C5EA 1TT7A 3MJSA 3H6KA 1DEHA 1Z82A 2I66A 3SX2A 4RVSA 1ZK4A 4WNCA 2HMVA 1Q1NA 1F06A 4AJIA 2GASA 1X0XA 4CM9A 2O2SA 3CH6A 1M66A 1H93A 4TROA 4FC7A 3RUCA 1E1LA 4IXWA 2BLLA 5CEFA 2VUUA 4D3SA 1LSOA 2R00C 2NVBA 3PQEA 3ZWWA 4HP8A 4ND2A 3ASVA 3BMOB 1TB4A 4CL8A 4BGUA 1PGJA 1SEPA 1PJBA 3W1VA 3ANNA 3WLFA 4D43A 3D3WB 1O94A 3RC2A 3PDJA 3GDFA 1FF9A 2P9EA 4CMGA 1LQTA 1ZBQA 1TXGA 4JP2A 5G0SA 2HUNA 2BF7A 3ZHYA 4L0QA 2ZKLA 4R9RA 1UDCA 4J1QA 2IZ1A 1NQOA 2Z1MA 2FR1A 5TX7A 5F5LA 3MOIA 2YFHA 1UXHA 2PD4A 3WGZA 1VI2A 1VL8A 1KVUA 3B1KA 4O6VA 1UAYA 4YAEA 4IXTA 5TF4A 4R41A 2EW8A 3VVCA 4DWVA 4LCJA 3ZWPA 3JQFC 4K6CA 3G49A 3W4IA 5A3JA 2HK8A 1YOVB 4CLDA 1XHLA 3Q0EA 1A4UA 3GN2A 2AG5A 3LT0A 2EGHA 4IQ0A 2PD6A 1E3WB 1EEHA 3PVZA 3QHAA 3T4EA 3VTZA 2YW9A 3TSCA 3P5SA 2YV1A 1MA0A 2Z95A 1YB4A 2W2LD 1BGVA 1GDHA 4MVJE 2B83A 1BDMA 4CV3A 5C7IO 4ZRNA 3GMSA 3B20A 3UOGA 1SAYA 3NRCA 2DT5A 5JAIA 2WD7A 1UR5A 2AHRA 4CR8A 1I24A 1VL0A 4BNLA 2H6EA 4RVFA 4CUKA 4IJWA 4YJGA 5DNAA 1FDVA 1MG5A 3GHHA 1U3UA 3TFOA 2D5AA 4PVCA 2DUWA 4IMPA 5LDGA 2UUOA 4I9NA 1QKIA 2ZB4A 5BNTA 1DLJA 1VKNA 3EUWA 3BMQB 1PIWA 4KTVE 3OETA 4JROA 3QVTA 3BXXA 3BTSA 2P68A 5A4DA 4XA8A 5B12A 5L40A 5L4LA 1V35A 3R6DA 4N5NA 4R1UA 5I9MA 1PGPA 1SOWA 1CRWG 3PP8A 4ALIA 1N5DA 2JAPA 2Q2VA 1UZLA 1Y8RB 5A04A 4IGFA 3HE3A 1CETA 4J16A 4E21A 2EKPA 3I4FA 1K6JA 3IQDB 1RM5A 4XR9A 2RH8A 4GLOA 2YV3A 3OEWA 2NSDA 3ZWAA 3JQ7B 4KDEA 3UKOA 4IDGA 4KTTE 2JD1A 5EQDA 3AOEA 3HDQA 1ZXLA 3LT2A 3ZHBA 1LBEA 4PLHA 3RUIA 3AM5A 3HDJA 2C7VA 3BTUA 3WMXA 5EERA 1C14A 4YJFA 2AXQA 2HKIA 4ZQGA 4PLZA 3O8QA 3QA9A 3E6AA 4LRSB 2V6BA 4AFNA 1PJQA 2V6MA 2HQ1A 2VYND 3ETEA 1QG6A 1UXKA 2O50A 4M55A 4J7UA 2WE8A 3RJ5A 3CINA 2VQ3A 4I5GA 3CIFA 3ZWXA 1LLCA 4E32A 1IPFA 4CM7A 1GAEO 4GSKA 1B8UA 3ADPA 2O7SA 3JQ6A 2Y1DA 1D1SA 3ZNPA 2V7PA 1WVGA 4KWHA 3JYQA 3VPGA 3WB9A 2FPIA 3QJ5A 1V3UA 3ZWYA 2G5CA 2VHXA 2HJRA 3K5PA 4CM6A 1KVTA 1H94A 1YJQA 4GI2A 4DMMA 2C29D 2E49A 1NBOA 2VYNA 3DBLA 1H6DA 2QQ5A 3MWEB 5DULA 5TC4A 3BMCB 2AEMA 4MKZA 1O8CA 4BHTA 1DRUA 4WPGA 3WSWA 4GPD1 1HKUA 3ZV6A 3I9NA 3H5RA 4C7JA 3LDHA 1X15A 5G4KB 4WEQA 4BGIA 4TZKA 4H3VA 3WG9A 3BMNA 1GUZA 4R68A 2FSVA 1CEQA 1Y5MA 4R51A 3CKYA 5I8ZA 3M1LA 5A9SB 5A02A 5G4KA 5ICMA 4J43A 4ALKA 5CG2A 2NU7A 2IZ0A 5ITVA 3T7EA 4R4JA 1O89A 3K9QO 6LDHA 4PZDA 2GDZA 3ENNA 5LDHA 1JU9A 1I01A 2TMGA 4TRNA 2HMSA 1UP6A 5G0VA 3ZU2A 3GUCA 1E7RA 3BIOA 4DREA 1Q2XA 2J5RA 3F5SA 4NBUA 4OHUA 3VPFA 1VPDA 3TJRA 2C2YA 4FC6A 1B26A 4FFPA 4LMRA 1WDKA 4PLYA 1ISFA 3WJAA 4O63O 4JQCA 3QP9A 2I3GA 1C1DA 5KJ6A 1PJSA 5EINA 3TZQA 4HXYA 4NNJA 3RU9A 4OKIA 3GDGA 3K31A 3KYDB 1VJTA 3RI3A 2Y0EA 1U28A 1U3WA 1GPDG 3IP3A 5G0TA 3EAGA 3PQFA 4G81A 3PGJA 3QVSA 3TZKA 5EN4A 5JE8A 4CMHA 3MJ4A 4JJFA 1NNUA 3UHAA 1IB6A 2X9GA 3L9XA 4DIOA 3ZZNA 2CSUA 2HMWA 3GGGA 3A28A 3KZVA 4HADA 3DHEA 5JAQA 4WOKA 4N5LA 3OQ6A 4LVUA 1VKOA 1I33A 3IC5A 1FK8A 2Y66A 3FPCA 4W99A 3W6ZA 2OHXA 5EESA 5CDUA 1RYDA 4BNHA 2BELA 3PFWO 3ULKA 3FI9A 2Q1TA 1TLTA 3FR7A 3ITDA 5COQA 1QYXA 4DMLA 3RC1A 1F17A 3E82A 4AJ4A 4L73A 5JMWA 3WLEA 2JKVA 5ENVA 1UZMA 1LUAA 1WDMA 4CUZA 4RF5A 3GEDA 4NFSA 1Q7GA 4PLVA 3ADOA 2VCYA 2O3UA 5DBFA 4R5HA 4OXYA 3HJAA 5U4QA 4DBZA 4AJNA 2WJPA 3GUYA 1HYEA 2X0RA 5GZ6A 2DBRA 4Y6RA 2NADA 1LC3A 1U4SA 4P22A 1IUKA 1SZJG 3AFMA 4LVCA 4MVJD 4RO0A 3W8DA 1ZZEA 3SBOA 4BUCA 1HZJA 3R1IA 1NP3A 4GX2A 4JLWA 1P1HA 4E2WA 1ADFA 4TRMA 1MG0A 5ENDA 4XGNA 3NDRA 1K0UA 2DBZA 4BNMA 1LDEA 4BB5A 1P3DA 1BMDA 2VWGA 4DC1A 5L4SA 1H6CA 4FFMA 2BHLA 3RJ9A 4CV0A 5JC8A 1B8PA 3JCZA 5EMHA 1HE5A 4GX5A 1IZ0A 3Q1LA 4E13A 1XA0A 3WGYA 1GYPA 1K89A 4QSMA 1XDWA 1HF3A 3GF4A 1DFGA 1YONA 2QHXA 1ZSVA 1X7HA 2BKAA 3PIDA 4G2NA 4CLOA 3VOSA 1N9GA 2GN4A 3I6IA 2CDBA 3GG2A 4W7IA 3G0OA 1H6BA 3IJPA 5H81A 4CUJA 4NU5A 4IUYA 3V1YA 3I6QA 4ZHSA 3ANMA 3JD0A 1HDGO 4H7PA 4A26A 1EVJA 1LDGA 3INTA 5C37A 4NG5A 5L4NA 5B4TA 4G65A 3WX0A 4L8VA 2DBQA 2P4QA 3AY3A 7ADHA 2P5UA 4J1TA 3JQFA 3GEMA 1RJWA 3LLVA 3MJEA 4QX6A 4RLHA 4TMFA 2DFVA 1EUCA 2YQ5A 3OP4A 4M87A 3ROPA 4A10A 4B7XA 4PRLA 4DGSA 5KTKA 1VL6A 4JNKA 1OMOA 3GLQA 1WW8A 3DAPA 1ZSYA 3OH8A 4GMFA 4BMVA 4L4RA 2ZCUA 2EJVA 2IEBA 3GNSA 3GVCA 1H6AA 1IHYA 1WNTA 3E5MA 4IDAA 4YQYA 3TOXA 1NTOA 1U2DA 2DBVO 4LRTB 1JKFA 3KB6A 5KJ1A 2AEFA 3RUHA 1CERA 1GD1O 1HE2A 3GRKA 3VH3A 2YDXA 4NZ9A 4ZN6A 4DRYA 4GX1A 2Y99A 3RVDA 5BSEA 4ALMA 1U4OA 3ONEA 4XIJA 4INAA 1I3LA 4XRGA 4R01A 1LDBA 3F4BA 3ZV4A 2NVWA 1Y7TA 5TIIA 4NJMB 2GN8A 2XF8A 5KVSA 4Y6PA 2X6TA 1DBVO 3JQBC 4LW8A 2Y1OA 2X4GA 4TVOA 3WGHA 3AY6A 3D64A 3M6IA 3UCEA 4MINA 5C5IA 3U09A 5KJEA 2VRCD 4AJKA 3MOGA 4EEZA 3GZ4A 4QQRA 1A9ZA 3RIHA 4NQZA 1ZUD1 2GR9A 2W98A 3KO8A 2I9PA 3QWHA 2I65A 5DCUA 2Q2WA 2B36A 9LDTA 1DRWA 1I10A 2AQ8A 3D7LA 4IJUA 4KMSA 3WIEA 1PS9A 4NHEA 3X2FA 3GOHA 3UFXA 4CLEA 4E33A 3LYLA 1ISMA 4AJOA 3EHEA 1PTJA 1YJ8A 1S6YA 3PI7A 3GK3A 1DAPA 1JAYA 3AUUA 2X9VA 3MJVA 8ADHA 3BAZA 1EDOA 2DQ4A 4R3NA 1LEHA 4D46A 3AOEC 2I6TA 3IKTA 2GPTA 4RQUA 4BO1A 2O3JA 4YCAA 3MCVA 2A94A 3QWAA 3KXDA 5T6BA 4YT8A 1GY8A 2YFQA 1YO6A 2VZ9A 3EVNA 5I7VA 3N74A 1C1XB 2QZZA 1PGQA 1MV8A 3FTPA 4O59O 1NPDA 3C1TA 4OMUA 5KVVA 2Z5LA 3PHLA 3JQAB 1ONPA 1C3VA 1UH5A 4BNVA 4ZQHA 4WKGA 1T2FA 1FXSA 3ZNQA 2YHIA 4XYLA 4LISA 4BNUA 2PA3A 4J90A 4YA6A 2O3TA 3FTNA 3JQCA 4MP6A 3KUXA 1DPGA 1LSSA 4RQTA 2D4AA 1E1NA 2RHRA 5TT0A 2Q4EA 1LLUA 4CM4B 2CVQA 1EUDA 4UUPA 2GYYA 4B79A 3MWDB 3JQ9C 4PZCA 1ENYA 1PWXA 3AM4A 3G1UA 4YWJA 2NUAA 1E3EA 2CF6A 5JNLA 4D0RA 3E03A 4MVJM 5AXAA 4BV9A 3IIEA 3D1LA 4I5DA 2X0IA 1DHTA 3CE6A 2RHCA 4WE3A 3FWZA 3STHA 5CDGA 4QTZA 4NBRA 1TT5A 4L4XA 2BH9A 5JO0A 2EP7A 3H5AA 2VWPA 1UXIA 4R9SA 2NTVA 3JYNA 4JX8A 4II2A 3TZ6A 1Z7EA 4CQMD 3NDIA 3JQEA 1KEWA 1P9LA 3S55A 4EUFA 1W4ZA 4HY3A 2GRAA 5ICSA 4CODB 3I9KA 1YGYA 1HLPA 3UUWA 1DDOA 3DFZA 4ZGWA 1EQ2A 1DFHA 3WIDA 3OIDA 4U0KA 4CMCA 5CAEA 3SVTA 2D59A 4YRBA 1ML3A 1QR6A 2X0NA 2O23A 2ZYAA 3F46A 3GQVA 1RM0A 1BXZA 5KJCA 4Y9DA 3AUAA 3RC7A 3ZCXA 4KQXA 3E9QA 1D7OA 2C20A 3NUGA 4HKTA 4E5KA 2RH4A 2PZKA 2WDZA 1PL6A 4CQMB 1A4IA 1E1MA 1YH3A 4WASA 4ALNA 2CF5A 5JCXA 3V2UA 3GVPA 1HDXA 1ONNA 1PZGA 3C1OA 3GG9A 3L4SO 4OGWA 4R5MA 4CL3A 2AG8A 4BIIA 4GH5A 2FHSA 3ZHZA 3PJFA 4BKPA 4Q3EA 4FQ8A 3OFSA 3QWBA 4FJ0A 3ZH2A 1WXDA 1ZEJA 3AI1A 2P9GA 4N54A 1E3LA 2X9NA 2FRDA 4OIMA 3DBHA 1LLDA 1GL3A 4QEDA 5IDXA 4WCFC 4EDFA 4LSWA 3WQRA 4EJ6A 1JKIA 5JLAA 3RD5A 4XX0A 1MC5A 4OYRA 1U3VA 3H9QA 4Q3CA 4ZICA 2D5CA 3P2YA 1E1KA 3U4IA 3SC4A 3VHRA 1EVYA 1ZIDA 4DPLA 3V1TC 1G0NA 4XYMA 1HDRA 3WYBA 4EGFA 3ZW8A 1J6UA 1RM3A 4N7RA 3L0DA 3PIIA 4O5OA 1EVIA 4YXFA 1AXEA 4CM8A 2JD0A 3H5NA 1LLQA 3EZLA 2NU8A 1VSVA 3FR8A 2PK3A 4GGPA 1OI7A 4MIEA 3GT0A 4NBWA 5T57A 3WTCA 4IIVA 3K2EA 4I8XA 1BHSA 4BNXA 4WCDA 4D79A 4TZTA 1V6AA 4MP3A 3C85A 1XEAA 3U62A 2FR0A 4FCCA 3UW3A 2WEKA 4YAGA 4MVJF 1JLLA 4W7HA 3C7AA 4ZQFA 5C7LO 2J5QA 4D3DA 3WICA 4PRKA 4JBGA 1DC6A 1HE4A 4S1VA 3NX4A 3TDKA 3L4BA 2Q99A 1JAXA 2OO5A 1M75A 3C3XA 3JTMA 2HK9A 2WWRA 4C7KA 2XAAA 1C0LA 1SCUA 4UEJA 1LSJA 1PEDA 4W6ZA 2EKLA 1L1FA 3HG7A 5F1PA 3MZ0A 3RFVA 2VUSA 1ZVMA 3LSYA 1HTBA 4M89A 5FEUA 2IRWA 1QYDA 1R4NA 1U3TA 1HETA 2QX7A 4E2ZA 4DBVO 2W2KA 3DBRA 5JY6A 1SPXA 4X54A 1SC6A 1HWYA 4JIGA 3RUDA 4YT4A 1C0KA 4QECA 4BOYA 3OSUA 3EZYA 3Q2KA 4FJ2A 1J0XO 3WYCA 4EZBA 2VN8A 3GH3A 3VC7A 4J9UE 3W8EA 3SC6A 1OC4A 1NQTA 3G1TA 3JV7A 1PJ2A 4OQYA 1PJTA 4MP8A 1UP7A 4OQZA 5DP1A 4BNTA 1D8AA 4EI2A 2DU8A 1VSUA 3I4CA 4TSKA 3TQHA 4BO8A 3IUSA 3FCOA 3WGGA 2R6JA 4KP7A 2W90A 4J6FA 1HSOA 2Q46A 4PG4A 1A27A 3ROQA 5EQFA 4IDEA 2CVOA 4WECA 1Q0HA 1E6EA 1R12A 2B5WA 4BGVA 1UXGA 1FDUA 4RPLA 5K9ZA 1FMCA 1QORA 3ANLA 4R3WA 2WD7B 1F14A 2QRLA 3A9WA 3RSHA 3ONDA 4NI5A 3BZUA 4PCVA 4RPHA 5AVOA 4YJGB 1HDOA 2GD1O 5ITWA 4BKRA 2O3SA 2UAGA 4JJGA 1Z74A 2IODA 2A35A 4OSPA 4B4OA 1DC4A 1WAMA 4OKNA 2H63A 3H2SA 3IL2A 4FS3A 1ZO8A 4LGVA 3PHGA 4WLVA 5BSHA 3O03A 4FDAA 1R66A 4XB1A 3OJEA 3OQ1A 3QWIA 4D42A 3ZNNA 1PJ4A 1PX0A 1HDYA 1NFQA 2QZ9A 3JQBA 5G0WA 3TFQA 2VHZA 4CM3A 5HRUA 1MP0A 2QYTA 5TJHA 1T1RA 2UVDA 4CR7A 1X1TA 3UVEA 3OHSX 2UUPA 3CMMA 5DCYA 5GMOA 2VHWA 3CZRA 4FB5A 5TQVA 4KUEA 1WP4A 2B0JA 3FHLA 2DAPA 2UYYA 4GGOA 2YDYA 3KSUA 1ZK1A 2PZJA 5LC1A 4OSOA 5L9AA 1U8FO 1CIVA 2OBNA 3V2HA 1U9JA 4IMRA 1XELA 2BMAA 5T5QA 5MDHA 2I99A 5JSFA 4CMKA 4U6SA 5DCWA 3PK0A 4R54A 2Q49A 4YJFB 4RDIA 4JGBA 1SO8A 2BFAA 3H3FA 3O8QB 4B3HA 1PU2A 4DYVA 5JS6A 3GGPA 1CWUA 4YAJA 1GCOA 5C3MA 3LC1O 4B8WA 4BGEA 3OJOA 3WYEA 1N7GA 2J3KA 4E30A 2J8ZA 1YRLA 2WYWA 5L7TA 1HDCA 1F8FA 4UVEA 3OA0A 2Q1UA 1E7QA 2ZQZA 1PS8A 3VPSA 4E6PA 2BGMA 3JD3A 2C54A 1R0LA 4YAIA 1SB9A 2EERA 2JJYA 3WXBA 2G82A 5KJFA 3HZZA 5FF9A 3PHHA 3LZ6A 3PEFA 4YJDA 5CDYA 4RPGA 1XQ1A 1I3KA 3BA1A 4AJJA 2A9FA 2O2YA 3EW7A 3TRIA 4Q3BA 2CDCA 1ZH8A 2XXBA 2B69A 2JAHA 1EMDA 3DBLB 4U7WA 4YPOA 5KIAA 1CQIA 3JQ9A 2FPGA 3HUDA 5JW6A 3ICPA 4BMNA 4AJEA 1R16A 2O48X 4B7CA 5B4UA 2FMUA 1N8KA 1XU9A 1OC2A 4B4WA 2ZATA 3BMNB 1T2DA 2NU6A 3O38A 2VNAA 4FFNA 4ZA2A 4HNHA 3GZNA 1LRKA 1YL6A 1NPYA 2GGSA 3A1NA 5CDTA 3E5RA 1MFPA 5L53A 4F3YA 4TRJA 2DM6A 3U0BA 3ZU5A 2GSDA 1I32A 3I23A 1XIVA 2J3JA 5DT9A 2CDAA 3BHJA 3FNGA 1UUFA 1X1EA 2OXIA 4O1MA 4GX0A 1XQ6A 2F00A 1ISHA 1HT0A 4B7UA 4UEOA 2PD3A 4Y8VA 1YQGA 4PLGA 4CMBA 4HX5A 3VKUA 1I30A 1ORRA 5HA5A 1TI7A 1ZMTA 2NACA 2PGDA 3CPSA 5ER9A 3HFSA 5JPIA 1P1KA 3TL2A 1U7TA 3BYZA 4NPCA 4GLLA 1C1DB 1MXHA 2NM0A 1NPTO 3JQDA 1I2CA 4S3MA 4OOFA 2IEDA 1IY8A 1DHRA 2GNAA 4WK6A 3WNVA 3TZCA 1N2SA 4XQEA 3RUEA 4QFCA 4GWGA 3HFGA 3ROMA 4ONEA 1IPEA 1UDAA 4IJVA 3CMCO 5DOVA 3BTOA 1X13A 3RU7A 1EFLA 3I1JA 4Q9NA 3WGQA 2NTNA 4MPDA 4FBGA 1ID1A 3FRJA 2V6GA 4NMHA 3H8VA 1R4MA 2PH3A 2WM3A 3IAHA 4E0BA 3H9GA 5IZCC 5FI5A 3L77A 5IN5A 2I76A 3OF2A 5A9TA 1IL0A 5JDCA 5KWEA 4A27A 3U5TA 5U1PA 3ZWBA 4WCFA 1PQWA 4J3FA 2D0IA 3QWFA 4E3ZA 1IZ9A 3WQQA 1OFGA 3N7UA 5DBIA 1SBYA 3Q2IA 1LJ8A 4KUGA 4D41A 1A9YA 4RORA 3VTFA 4YAKA 5IAAA 1B15A 2DPGA 3U4HA 1GZ6A 5JBIA 4FIZA 3GAZA 1DAOA 2YQ4A 3TWOA 1LRJA 4AJHA 1NVGA 5F21A 1E5QA 1SEVA 3WFJA 4YVFA 2AE2A 2YY7A 1PQUA 2GLXA 3FF4A 4J9VA 3GGOA 5THKA 3D4OA 1NVMB 1VLLA 3B6ZA 3DHYA 2PLAA 4HBGA 2XPCA 4E5MA 1T4DA 1M2WA 3K73O 2IYOA 2VHYA 1G6KA 4Q39A 4PVDA 4OM8A 3KEQA 1R0KA 5IDYA 2Q3EA 3M1AA 1A5ZA 1NX6A 2NV6A 1UDBA 1JW9B 3VH1A 1A71A 2PY6A 3W4KA 2JHFA 4RPJA 4DXHA 3EK2A 1VJ0A 1O95A 3JD2A 4EW6A 3A4VA 3K30A 1SNYA 1P0FA 1YB1A 2NWQA 1Z6ZA 4C4OA 1QYVA 4K28A 1MX3A 3FNFA 3VPXA 3HHPA 4K6FA 2FP4A 2Y0CA 1T2CA 1Y9AA 2JFHA 4II3A 2V65A 5A1TA 2IYPA 3P7MA 1E3IA 1VM6A 4J2HA 1LSUA 2Y1CA 1PJCA 3K6JA 2Q4BA 3T7CA 1DXYA 2YJZA 3OJFA 2FOIA 4Z9FA 4JCOA 3PGXA 3N58A 3ZV5A 2QG4A 2XXJA 1V3VA 1NAIA 3L4BC 1AE1A 2EGGA 1O5IA 4CMIB 4GKVA 2Q50A 1GEGA 3AU9A 2DUUA 4IINA 4OXNA 4MKRA 1R15A 2I67A 3AY7A 4E4YA 1U1IA 4MOWA 4CLOB 3KM0A 3PJEA 4CMIA 2ZTLA 1KIFA 1N9GB 3BHIA 4BO2A 2O4UX 1E7WA 1VJ1A 3GFBA 5JYEA 5TNXA 3B1FA 3WGOA 4RLSA 4WLFA 1TEHA 3H7AA 4O0LA 3ZN2A 1JKJA 3H9UA 4RCVA 5I9LA 4UUNA 4CLXA 2GZ1A 3UICA 1E7MA 1VE9A 3R3JA 1AUPA 2OGUA 2EV9A 3OA2A 4GWKA 3WQSB 2OBYA 2Y1GA 4R1TA 3V5NA 3DAFA 3ONFA 2IXBA 3U4DA 1F12A 1KOLA 2D1YA 4UUMA 1KC3A 3QVXA 1UAGA 4UVHA 4CV2A 2W4QA 4J7CA 4PZEA 2BFOA 3PJGA 3BHMA 1T2EA 1GQ2A 1PZFA 1D1TA 2Q1WA 4BO0A 4Z3KA 1EVZA 3DZJA 5BSGA 5KNLA 1CJCA 4I5EA 2IZZA 4CLRA 4FPXA 1IOLA 3LC2O 1HL3A 1Y5RA 2VWHA 3RFXA 3L07A 2X23A 4BQRA 1GZ3A 2JCYA 1NQ5A 2VYVA 4I08A 4PG6A 3ZV3A 1K6XA 2G17A 3AFNA 4BNFA 4Z9YA 3JQ8A 2LDXA 1E6WA 1DRVA 3OJLA 1J4AA 1F0YA 9LDBA 4MDHA 1N7HA 4QFDA 2C59A 5EL0A 2HAEA 2EG9A 1DIGA 3RQSA 2EP5A 1NASA 1PJLA 4J49A 4YJHA 3FD8A 1GCUA 2ZTUA 5G2OA 4XCVA 3L6EA 1CYDA 2HJSA 3RCBA 1C0PA 4UAGA 2X1HA 4MJLA 2FSSA 4XWYA 1V8BA 1SMKA 4RVGA 4BKQA 2Y67A 2B4RO 1P33A 4QO8A 2CY0A 1I5RA 1T1SA 4ZQBA 1ULSA 4BO6A 1CDOA 3GY0A 5FI3A 3WTBA 3D4NA 3WGIA 1ADGA 1QYWA 1XR3A 1ZW1A 3GN1A 4HNGA 4DQVA 3PZBA 4AG3A 5KCZA 1MUUA 5AXCA 2HK7A 4IDCA 1PZHA 4HV4A 1JN0A 4XR4A 1DFIA 5KKCA 4IPTA 3ZU3A 1E7YA 1SOVA 4TWRA 3AI2A 2Q1SA 3INRA 1CQJA 4GL4A 4J4HA 2PZMA 1YWGO 2B5VA 2Y93A 4L4SA 1WZIA 3DBVO 4XDZA 3QVWA 1ZSNA 3WJ7A 1KEVA 3WOHA 3GPDG 3GRPA 2V6FA 4ZQEA 3PPIA 1B3BA 4IM7A 3SJUA 5JAZA 3MTJA 4YRDA 4J2OA 1BXGA 3UF0A 3VKVA 1D3AA 3AWDA 4UREA 4NBTA 1G1AA 1DIRA 1T25A 3PTZA 4BO9A 5BR7A 2YHIB 5K6AA 1XWFA 4IGEA 4GSLA 5TJ9A 3PWZA 1F8GA 2PTGA 1ZFNA 1YBVA 3Q11A 2O4CA 4LMPA 5TGDA 1DC5A 2E37A 4GVXA 1N92A 3UN1A 3MJTA 3ZDFA 2F1KA 3GNQA 4NH4A 3ZWNA 2QYSA 3QSGA 8LDHA 3KETA 3I83A 3K2BA 3FPLA 3C8MA 2B37A 2WMDA 4DL9A 2PKRA 3WFIA 4A03A 2GN6A 1GTMA 2PGJA 3AW9A 5JMPA 4ALJA 1LC0A 4EITA 1D4FA 5DP2A 3WMWA 1RPNA 5G4LA 3F6YA 2FZEA 4BS9A 3DL2A 2PZLA 1YL7A 1TT5B 3H3JA 4XJSA 4FN4A 3SLGA 3DHNA 4YYZA 5CPFA 5L95A 3S1LA 1N1GA 4CLHA 5THQA 4GMGA 5FYDA 1I36A 1W8DA 1UXJA 2ZIZA 4TKMA 3TL3A 4IIUA 4KQWA 4BO3A 3MTGA 3OICA 1UZNA 3GVIA 4I9UA 4KOAA 1BXKA 4HFMA 4RPKA 1YE3A 2C0CA 3KYBA 3EY4A 3LK7A 5ER6A 4EUHA 5IJZA 1BW9A 2YZ7A 2DPHA 3KYCB 1ZNQO 2X0JA 4E31A 1LX6A 3K96A 4YB8A 5ILOA 1K6IA 4RDHA 1PQPA 1KVSA 3JYOA 2HLPA 2Z1NA 3QQPA 4DIBA 2DTDA 3ST7A 3KYCA 3F1LA 3WWYA 3RKRA 4YQZA 5IF3A 2EKQA 1LDNA 1U2GA 4H15A 5TRTA 3CTMA 1QV7A 4LK3A 1GU7A 3DOCA 1XSEA 4BNJA 5L51A 3RBXA 5A9RA 3RASA 2VZ8A 4XIYA 3B70A 2GF2A 4IQGA 4W82A 2H1SA 1PS0A 3SXPA 5IZCA 4IY1A 2AEJA 3PYXA 3U9LA 3LU1A 2HDHA 3QVOA 1NHWA 4ILKA 3FSRA 5L7WA 2ZQYA 4U8GA 1WMAA 3DBHB 5DF1A 3FN4A 4Z6KA 2HMTA 4A0SA 1K3TA 1QSGA 2NU9A 4DPKA 2CFCA 2FPPA 2Y05A 3D0OA 2W8ZA 4OL9A 1LU9A 3H9EO 2OZPA 5DBGA 5JYDA 2SCUA 4RVDA 1V3TA 5JDCC 5JXWA 4FGSA 1PGOA 3AJRA 3D4PA 1ZJZA 4UULA 4F45A 3NTQA 1AHHA 3COSA 3IUPA 1EBFA 2AA3A 2PWZA 1JQBA 5A5FA 4ND3A 2DLDA 2PV7A 3GAFA 2Y0DA 5A03A 1YBAA 2QIOA 2ZB3A 3ICCA 4CM8B 5L45A 4ZJUA 1ZEMA 1Q0LA 2CNBA 1HE3A 1GUFA 1HRDA 2WD8A 4FSHA 1NM5A 4TQGA 5L7YA 3HSKA 2VUTA 3FWNA 3I9OA 3WWZA 3CSDA 4R16A 4YTEA 2YUTA 5CEEA 4CM1A 2C5AA 4NDNE 4LN1A 3OBBA 1TVEA 3PLNA 4EJ0A 1G0OA 1M76A 1KEPA 2OFPA 2AE1A 3TZHA 4RV9A 1P74A 1YXMA 4ALLA 4OH1A 4Z0HO 1LNQA 4RVHA 2VWQA 4Z0PA 1ULUA 2P9CA 1AN9A 3PQDA 1GEEA 3S2GA 4YDRA 4BNZA 3DZFA 3GVXA 4N18A 5JO9A 2BFPA 3IP1A 4CV1A 3UXYA 4U6QA 4YR9A 4AL4A 4BKUA 2RAFA 2IDZA 4K26A 1ENPA 4R69A 1RM4A 1R37A 4ZD6A 1P1IA 3ASUA 1FJHA 2VTEA 1I8TA 2UV8A 3R0IA 4WGGA 2OORA 1E0DA 3HQ4O 4MVJP 3OM9A 5K0ZA 5BT9A 1R4NB 3ZHXA 3I9MA 4ND4A 4PG5A 1J49A 4GBJA 1GPJA 5IG2A 3Q9UA 1VRWA 1DJNA 2VHVA 2EXXA 4W4TA 2W2KB 2Y1FA 3DBRB 4ZVVA 4B8ZA 1E3SA 4PGFA 3VZPA 4UEKA 2PKQP 1NFFA 1HYHA 3CEAA 3IKVA 3DMYA 2OUIA 1NHGA 2E6UX 1NYTA 3UAGA 7MDHA 4PIVA 1BRMA 5IZ4A 5CP8A 1PJ3A 1LRLA 3LVFO 1GADO 1GZ4A 4W9NC 4NIMA 1KEUA 4D0SA 5KVCA 4DQUA 2ZB7A 4MVJG 2A4KA 1I0ZA 4PLWA 3IS3A 3GVHA 1I3MA 2ET6A 4MVJI 5GZ1A 2A92A 1T2AA 2P5YA 1MFZA 5A5EA 5DN9A 1W73A 5EIOA 2VOEA
chains in the Genus database with same CATH superfamily
2OVFA 1TCVA 3QA3E 2G0NA 2ZYWX 3CC8A 5TS3A 1K8RA 4HWKA 1E58A 4S1NA 2PYDA 2YVKA 3BXGA 3FVRA 4OMCA 4PLTA 2JDIA 4X63A 5I7AA 5BSWA 2E4XA 1XEXB 1L6IA 1O4WA 1R74A 4F85A 4RTKA 4GZ5A 4NR0A 1OXVA 1XZPA 3L0ZA 4M0UA 2ZUSA 1YR8A 2C5BA 3PJDA 3D3WA 4RM2A 3SICE 1QO9A 4I9GA 1RYNA 1USIA 1CUJA 3CO0S 3RDPA 3VI4B 2PUFA 4REQA 1Z7BA 4F04A 3ON5A 1Z6YA 4UM9D 2P0EA 1P2BA 1ZHFA 2VP2A 3DUWA 5LA6A 3L6DA 2ZU0C 4LWOA 3V1NA 4YMVA 4BP9A 4BX9A 1JQJC 1KPIA 2EWMA 5CCEA 2AK3A 1JJFA 2IE0A 4I9HA 3DV0B 2C42A 5IVHA 1GRCA 3FPGA 2HHLA 3NBYC 1PK8A 1TLLA 1Q6ZA 1LQUA 2I87A 4JITA 1QGUB 1YZYA 2HLNA 3PYLA 2H1CA 4F3KA 2CHEA 1IXRC 4JIMA 5JH7A 4GM0A 3OAAA 3I9LA 1Z8NA 1PW5A 3BXOA 2QS9A 1IHUA 2CYAA 2YC2C 5FLXA 3VNBA 1X7GA 2QR3A 2ZUWA 2VP3A 3KT8A 1A1SA 3LLSA 3OCWA 1PZEA 1SUDA 5DNVA 5GVRA 5ALOA 4C05A 2DCUA 2F17A 1PV1A 2C84A 4HMPA 1GR0A 3QVGA 4Q3NA 4LJ8A 4R1SA 5E2BA 4AQDA 5B6PA 1OLSB 3KQWA 3DJYA 3KJGA 4L9SA 5FCDA 1NAHA 5TVKA 3HVJA 3VYUB 4WY8A 2YZ2A 1GGEA 2A67A 4BMXA 1G5FA 4EO7A 1NP6A 2IYVA 2P91A 3DC7A 3PF9A 1TC1A 3KPWA 4XIGS 4MQLA 5F5NA 4Q3AA 2Y71A 5KKAA 2HR1A 2FHPA 2NO7A 3IILA 3GLFA 3HWRA 3H2IA 3A4IA 1XCBA 1SD1A 2OWEA 1U9ZA 3Q4GA 4BE9A 4CMJA 3A04A 1XZMA 2XB9A 4UBOA 5CYFA 5EG5A 1WXXA 2K2WA 1OTYA 1SQ6A 4FE7A 1QBGA 3AUFA 1TAQA 2ILTA 4LQDA 3TNLA 5MHTA 3VPBA 2HCTA 5DHSA 4FW8A 4ZRMA 2ZUDA 5EKSA 1W6UA 1PR1A 3HBJA 1TZCA 4G5SA 2W2LA 3O4VA 3O3MB 4HVAA 4MUMA 1JDNA 3AXTA 3MELA 1SC4A 4YJ2A 1KPHA 2I4LA 2OV4A 2FDRA 4R0NA 4EY8A 3TTWA 2WG2A 3DLCA 4DVJA 5EP2A 4BVKA 1YSCA 4OGKA 3SJ7A 1EWVA 2WSBA 1E1QA 5DNCA 4I1YA 3P1JA 4PGGA 4R8KA 4DAOA 4ZGBA 1RQPA 3CYFA 4FGWA 1BDBA 3A4LA 1QH8A 1W59A 2NQTA 3PX3A 4Z7QB 3IDQA 4GR4A 4KLZA 1I9CA 2E4AA 5HIKA 5K6AC 1S7CA 4MK4A 4RTLA 3K1JA 1B6GA 1XZAA 5KEIA 5I9IA 4XYBA 3G2PA 4MVXA 3DCJA 4BJ6A 3V4VB 4DJFC 1R5BA 1Y9EA 1DQNA 5EPUA 5KSOA 3O4GA 1UWKA 1PLKA 3KXKA 3V2GA 2EC5A 1M1YE 2H08A 2F1IA 1WBJB 2QD3A 3ETHA 3RAJA 3PXUA 3WYNA 1OZ0A 3BTVA 1A8QA 2XADA 2GRUA 3Q2OA 3RYHA 3WS7A 1KDRA 1PL7A 3ABQB 4LDJA 1YR3A 2ZJ2A 4ICIA 4RMHA 3HYSA 3ZCPA 1CV2A 1UQTA 3REQB 2W6QA 1NN1A 3FPSA 4AKEA 3ADCA 3T4XA 1M9NA 1GG2A 2ICAA 1EGMB 3NTOA 2GCEA 3WGTA 1RYZA 1WZCA 3SYRA 1W9MA 4HNUA 4KXVA 3B13B 3D5QA 4MQBA 3MMZA 3V80A 1A4XA 2XOXA 2AOUA 4A2PA 2F8SA 2GKOA 2J4FA 3HU5A 4IDFA 1OKKA 5F3RA 1ZMRA 4OYHA 3G0DA 5EVJA 5T8KA 1ZN9A 1V1MB 3K2QA 3PCRB 4QGAA 3KLPX 4KMMA 1RAEA 4BNWA 1INLA 1ZR4A 1XD9A 4BATA 1RNLA 3NEAA 2NUBA 5K45A 3HB5X 5TR9A 5BUQA 1I2MA 4G56A 4JQYA 1VKJA 2MSNA 3DPSA 3W5UA 3JALA 4BV8A 4X84A 1PWZA 2AN4A 4RVNA 5ESXA 3GA0A 2ZTMA 5AVUA 2WRZA 2W2PA 1SHZA 2NO1A 1ISIA 3OTOB 3EGOA 3QEJA 2NV0A 1NNEA 1JECA 3PBKA 4XIFA 2NTEA 4DRXB 3EXAA 5DLYA 3NVKI 4D7AA 2Z8XA 4WLEA 2XBLA 3GZTB 3TG2A 1B7GO 2FW8A 1SRRA 3BMCA 4TQAA 4YAWA 2W6ID 1IULA 2O0KA 4I4TB 1JQ5A 2A9RA 1WEKA 1E8NA 5IANA 4YRJA 2IF0A 5BSTA 4EUNA 3PRJA 1VGRA 2PSEA 3BH0A 4JLSA 4OOEA 1QQ5A 4EG5A 4IOLA 1QV6A 4RKFA 3HN2A 1Z6XA 3L43A 2VRBA 2CFRA 2JGFA 2WU8A 5FFFA 1NY5A 3RC3A 3TPCA 3M49A 5D7BA 4NCBA 1J8QA 3U4AA 2BCGY 2F9MA 4KQCA 4RGBA 1SBHA 2GEVA 1UC9A 3DW1X 2Z08A 3DYBA 1VHQA 2JAUA 2V7QD 3LE8A 4LY6A 2GARA 2BEUB 2QGZA 3EXEA 4PRYA 4TQ9A 5EGSA 3IDOA 3PEWA 4GLJA 3QEKA 1PYGA 4X6XA 2FU5C 3NUZA 4D0GA 4YX9A 4Q4AB 1E2MA 4L28A 4QQ8A 4P5DA 3C7CB 2BEJA 2F48A 3GMDA 5KQLA 4ITRC 4MGIR 4I8IA 5YASA 3VSEA 4C6SA 2YINC 3WDSA 1ILEA 3RK1A 6AT1A 4CKBA 2PX0A 2QTVA 4F97A 2I2CA 5ILGA 3L4KA 1UKVY 2XD9A 2BI7A 1MB0A 2HPZA 2QLMA 1Y1PA 3K8ZA 3G2KA 2A0YA 4LRQA 4IV8A 3G82C 1TKBA 4JOSA 1LBHA 4H17A 4NHOA 1I4WA 4L07A 5HILA 2Q7OE 5IMSA 3FPJA 4OLAA 4M86A 1NXQA 1O5TA 2C96A 4Q1EA 3RJTA 5I9NA 2O0JA 1M2GA 1PT9A 2YJTD 3ZVKA 4DA7A 5LXTF 1MXFA 4HWRA 4ENPA 4XEHA 5BV0A 3T7IA 2HSEA 4AM8A 2GPNA 2YWHA 1DZ3A 3ED1A 3HR7A 1RLIA 3E48A 3SFTA 4AN0A 4CT0A 5U9CA 2Z3VA 3L0PA 3OEYA 4FQ7A 2V7UA 5AVXA 1B2LA 1IZYA 2IE8A 2NLOA 3D6HA 3VHQA 3V7FA 1SA0A 3EF0A 4R1MA 5AOVA 3W2EA 1MAVA 3CX6A 1J2EA 3Q9LA 1BKSB 2B1RA 4WN9A 1DIAA 2FP4B 3GYBA 1KYTA 2Q3LA 3M2TA 1T13A 3P19A 4OQQA 4X00A 1K6EA 4QJ5A 4B3RB 2OK8A 1SC9A 5D00A 4BEWA 5JJLA 3DDOA 1LBSA 3FNHA 4ND5A 2PFSA 1EXWA 2PS9A 1XA3A 2BGJA 2X22A 3OX1A 4KWCA 5JAMA 3E53A 3K9GA 5EZYA 3GH1A 5JCJD 1MR3F 1HURA 4A73A 1MJFA 2NVUA 3HDYA 4Z0TA 1EDZA 5H83A 1MB4A 5FT9A 4N0MA 2XT6A 1QLWA 3ORFA 4HC4A 4I3GA 2EFDB 2B92A 3LXRA 1H4QA 5DGDA 4DLXA 1KP9A 4YACA 4ZI7A 1RJ9B 1V9LA 1QLHA 2A88A 2GFQA 4R84A 3RBZA 4QPDA 4J0DA 4D9GA 2I34A 4WKOA 1TRKA 1OBVA 2ZWPA 3M6AA 4P58A 4YFVA 3FLAA 4OHRA 4BC0A 2ALJA 2KE5A 3FYUB 3V8PA 3AEQB 3UBTA 5AQ1A 3I1IA 1L4GA 3I6BA 4ZCLA 1JYEA 2VF8A 4EKGA 1DELA 4FCVA 4KXYA 1BTOA 1H0HA 1Z7YA 1YBMA 4PLCA 4OBWA 4U2FA 3LKVA 5CW1A 4ZOAA 4BZXA 4D4LA 5CVEA 2F3PA 4P38A 1RRCA 1QRRA 3A70A 5ITZB 2XYPA 2DWPA 2IEAA 2ATVA 4W9NA 3W6PA 5IFLA 3JWPA 2X5XA 1VYTA 1V9CA 1YQXA 3KDPA 4H6VA 1UBMS 3VSCA 3QNUA 1Y6JA 2PXHA 2QMUA 4WFJA 2Q5HA 2A5LA 1K2VN 1UKEA 2JFYA 4XQ0A 3NV7A 2RE8A 5D6NA 2R00A 5HM6A 1DAMA 5IWAB 2RCYA 4FFLA 1B16A 2CFTA 4B4DA 1UBEA 3WC4A 4B4UA 4OBEA 5JH7F 4GDFA 2VAWA 3AK4A 3WBBA 5JC1A 3GDOA 3B1VA 5FPHA 1RWVA 3C7DB 3CISA 3WNCA 4E5VA 2J7KA 2JJ2D 1GARA 1YQDA 1PG5A 2YV2A 1BWSA 2RGCA 4Y2QA 1P0CA 2VDLB 4C03A 3SDSA 4PG7A 3B48A 4CLRB 2Q0HA 1F4PA 4WJLA 1MAHA 1W6RA 2GUGA 4M9SA 2FN7A 4WJZA 4KDFA 1NW8A 1SU6A 3GFOA 4Q3OA 4ROSA 5SZHB 2XNHA 3CUKA 1XLTA 4BP8A 1T9CA 2M6RA 2J6BA 2WZDA 3DZIA 3L0SA 1WF6A 3LT4A 2P2DA 4MW2A 1WMSA 4WLNA 1YGPA 3HSSA 5ES4B 821PA 5DCLA 3LOPA 4P7FA 2CNWD 4LFCB 4QLBA 1EHIA 1C3XA 4B3GA 1E1DA 2X5JO 3QVKA 4MIYA 3CY6A 4FDTA 1VE5A 3D5TA 1ADJA 3X2SA 2ZIUB 3MWGA 5E7JA 2BFCB 2FB9A 4B43A 3BOSA 1GKKA 1TQ6A 4AJ2A 4CF7A 5F23A 5CTAA 1A96A 4B2LA 2VJNA 4PCLA 2IEIA 3IAS1 3S2FA 4MMXB 4BQIA 5J1SB 3D2LA 4MV6A 5TGTA 4DGQA 3F8SA 3HXQA 3U44A 5ALVA 4EBFA 1QH1B 3P9YA 3RS3A 2GHRA 2QJWA 1TA4A 1N1EA 1H2RS 3AI3A 4ZEXA 1A82A 1RI5A 3KHSA 3NWEA 4ID9A 6NULA 3UGTA 5HM8A 1ZRSA 2IYWA 1XGKA 2NQ8A 2WWVD 4WD3A 4EF4A 4WZAB 4BO4A 1X7DA 2GK3A 2ZJ8A 1E3JA 4QFBA 1KBZA 3K72B 5GJBA 1BYUA 3GLKA 3HJBA 3VU8A 1P4RA 1T4GA 2ZR9A 4U7JA 4EUEA 3WL6A 4E5PA 1AS3A 1DKLA 3FWYA 1OAAA 4UZSA 2A3RA 3SQMA 1X19A 3TH5A 3NW9A 3ZGOA 4B8YA 4QPJC 4QOIA 3OQIB 4JI6B 2QVXX 2VR1A 3L8EA 4TRRA 3H5IA 3LOUA 1PV2A 3BXFA 4OQPA 2PGIA 4CU5A 3OLZA 3DMTC 1S9DA 1XI2A 3CKMA 3K8QA 4LRUA 1JDUA 1KY2A 1E77A 1M1YB 1NBMA 1TCUA 3OZCA 1P0MA 3RPEA 2OFWA 2RIPA 4G5FA 3JZDA 3M9WA 4XRRA 4DTIA 2P6NA 1F51E 4MQMA 1NU6A 2A8YA 3SEFA 4W63A 3W34A 2G1UA 2SKCA 2E5LB 3M1YA 4NU0A 2FPRA 4ZK6A 4A8TA 1H2FA 4OHFA 4RF3A 4TV9A 1VPVA 4BJHB 3HJUA 3Q8XB 1I1NA 1T2VA 2I6GA 3LQFA 4KV7A 4NJMA 3P9CA 5ILQA 1GFZA 2PAFA 5BW4A 3UT6A 3D2AA 3AU8A 5E9JA 2ZK7A 4URFA 3WK4A 1SOUA 1UPCA 5HS6A 4HDCA 2HLDA 1ZWKA 1LZLA 2HO5A 5BWBA 1GQQA 1GPUA 1DSSG 1LPBB 1YKSA 3Q3CA 4ZAVA 4B3MB 1AJEA 3AVQA 3ZKAA 5D3ZA 4AUEA 5JVDB 1NVEA 4TT3A 5DHPA 3M6FA 3C48A 5ERGB 5CXUA 4F2PA 5TXGA 4EFMA 1JHVA 1HV8A 2G07A 4CTNA 2B8WA 1VMAA 1Q1EA 3ESQA 4L74A 6ABPA 3CR3C 4BNGA 1VBFA 4JJEA 4YI5A 3HDGA 4AZVA 4M0KA 5HW0A 5IBRA 5KYVA 2PH7A 5L3ZA 5FH9A 3QLVC 3V55A 3DTTA 3VC1A 1OPRA 2JFGA 4H6XA 2AR9A 1T6ZA 2UKDA 1B14A 4EQ6B 5A06A 1M6WA 4GUDA 3V3TA 1MC4A 2OHOA 3QE3A 2QTTA 3UMBA 5I8WA 3D4BA 1W48A 2QJRA 2QLJA 1IVNA 2AKAB 3DZGA 3Q3EA 3V7NA 1EBUA 1J06A 3H2ZA 3L8YA 3ZTWA 1P7CA 1LDYA 1T0BA 3FCUB 3W5CA 1JSRA 4M1TA 5HWSA 2EP8A 4AYWA 2G0TA 3T54A 2V5VA 1Y6GA 3PT9A 2AD1A 1KVQA 4LV5B 4WXHA 2JH8A 3Q8KA 4RBNA 3OT1B 4QA9A 4O08A 3KSDO 5JIBA 5T4EA 4V03A 2ZYUX 2CLDX 4U1RA 1M72A 5B4VA 5LLDA 4XB6B 2X8JB 2NTJA 3JQAA 1L5OA 3TZLA 2P1DA 1E61A 2WF8A 4UTPA 4UTNA 1Q1AA 3ZUPA 4C4RA 4HRXA 4NZMA 1M1NB 2FWIA 1ARZA 1Q7BA 1RQNA 1J8VA 3CZMA 3PC8C 2QZSA 4JXKA 4XLTA 2QXUA 2EEZA 3BCHA 4XM0A 1Q91A 3GR6A 1BWQA 5COAA 2I80A 4L95C 2X4DA 2EZ4A 4AZ0B 1U0RA 2O8BB 3IULA 2GJKA 4P0QB 4XFDA 3COPA 3QELB 1AN0A 4ZVLA 4LOAA 4OU4A 3KJXA 4NMLA 5DN6A 3CW2A 1EBBA 3BCRA 4LMBA 4TSFA 1MO6A 3GEPA 4M3NA 3B1JA 4MR7B 2C7RA 1A9OA 4OGGA 2CKDA 1KETA 1QP8A 5JCOA 5JV5A 1XP5A 3OMXA 1Z08A 1OH8A 1XZIA 4KGZA 4A5OA 1EIZA 2WFLB 4RC9A 2R60A 2OFXA 1P4SA 1WD5A 4KKVA 2Y1EA 1IWBB 1AV6A 1VG8A 3DXFA 3JQGB 5DM0A 3A3YA 2B5OA 1XNHA 4Q47A 1T26A 3KTDA 4XGIA 2YY6A 1GKIA 2PR2A 4Q9HA 2DPMA 1NLUA 2ATCA 5DKFA 3SZ3A 3BIJA 1WUYA 3LLUA 5CCDA 3TW8B 1L7MA 1QR2A 1IJEA 1GZSA 4GL2A 2P0AA 1OOEA 1XZFA 5I9TA 3WKAA 3VKWA 3P4YA 2OBXA 3EVGA 2D3TA 4GDMA 1RPZA 3NT5A 1JJVA 4NEHB 4M8NE 1VLVA 3DCNA 1XPRA 1NSFA 2GAOA 3B36A 2Q3HA 1GVNB 2WUVA 3QOWA 5EKXA 2W6NA 1R27A 1ADYA 2K6GA 3HUEA 3IAM1 4UPVA 3VAZA 1G2IA 1RRGA 4AICA 3FNEA 4CCAA 3MW8A 3ZQKA 4WFKA 3GRAA 2GZSA 5A0FA 3SF0A 2JI7A 1GITA 1ISPA 2ZAMA 3D3NA 2OB1A 3GPIA 4PC3A 1P7ZA 4TZ6A 3MG9A 4OIFA 5F51A 4KK4A 2VQSA 1YZHA 1X9HA 2WA2A 3KZOA 4HQNA 2YV4A 3H86A 3NASA 4FVTA 2I1QA 1BSVA 3IQEA 1F20A 4U0JA 4W1SA 4ZP1A 2Z9BA 1CCWA 3C3WA 5I51A 4RY8A 5B1YA 1FDWA 2G9NA 4H1UA 5BN3A 2FFAA 1YZQA 4P35A 4ZI7F 1IBCA 4RA6A 1UODA 1X1DA 3LYUA 4DJEC 1VGVA 3T1HB 3EZ6A 5A2GA 5M3BA 2VAPA 3U3DA 1NIPA 1HR0B 3R8FA 1EE9A 5EXPA 5FQOA 4E3WA 1EK6A 1YZNA 3TQOA 5ADHA 4F3TA 3VVMA 1Y7PA 3L5OA 2CHFA 3GFTA 3Q6IA 1JIXA 2GPWA 3ZKWA 5A6SB 2R1TB 2IPMA 5C9ZA 2YRXA 2ZSIA 5CT4A 4KQ9A 3NKLA 1IBMB 5D86A 3C1AA 2POQX 3M33A 3PGLA 2F6RA 3DEYX 3K6RA 3H0CA 5KDLA 4GMXA 4BVBA 4EUKA 5F3DA 3S6JA 5M34A 4Z9BA 1MO2A 5FFMA 5E6UB 3BQ9A 3B3FA 1WUKS 3EA0A 1U63A 4ZRDA 3PXXA 1G66A 2FMIA 2VKTA 3N39C 1AO0A 4FHCA 3AVUA 1BH2A 1JLHA 4D26A 1TE2A 3KKLA 1JMYA 2C4NA 4WLUA 2FFQA 5E4JA 4C1BA 2Q5OA 2JRLA 3C6BA 1M3SA 3EZFA 4FYXA 4IMJB 3T52A 3VU9B 5KYKA 3G9XA 4CKCA 4WACA 1USGA 1ABFA 3FBTA 3DD1A 3G3EA 3PWSA 4QOJA 1LA2A 1SUWA 2DULA 5IYZA 3U60B 2C82A 4O0MA 3VH4A 3ZU4A 4CM9D 1SVIA 5F77A 1PDOA 3KOUA 1H5QA 4FGZA 4ED9A 5BOSA 5I7EA 1EIWA 1DMSA 2WUDA 2CFOA 4HNQA 1XN1A 4J0EA 5BQXA 4W1QA 1SVSA 5AI5A 1U0GA 3ELYA 1WOYA 3U49A 1FZTA 1P61B 2ETVA 2WB4A 2O2HA 4B87A 3PXBA 5F52A 3U7JA 3LCJA 2JJ1D 1H2XA 2XYGA 3QPWA 3KV3O 3IR7A 3NFRA 3O73A 3HPRA 4X20B 4BVAA 1XPOA 3ZIAA 4N3NA 3DB2A 1WU8A 1N9KA 1FJ2A 2YZKA 2C5EA 1TT7A 3G6KA 3MJSA 4X95A 3RRNA 1DDGA 3LX4A 4CZ2A 1DEHA 1Z82A 4C06A 2PGNA 5H70A 4EYGA 3ZUGA 3SX2A 2X7JA 4KQKA 1PBTA 4BBJA 3T8YA 3GL9A 4PPNA 4AJIA 3BQNB 4RMGA 3COVA 5DT2A 4Y6GB 3A4NA 1M66A 2E4VA 2IOFA 4MPRA 2VA8A 2O7RA 1IBKB 4FC7A 1TVCA 4ZVPA 3AQ4A 1TYAE 4WJKB 4I81A 1ECGA 1I7SB 4D8UA 1A50B 2IOFK 2N47A 2Q4RA 4UOQA 1N6IA 2GPAA 1E4VA 3PQEA 4WXMA 3CX7A 1F0KA 2VDWA 4ND2A 4OHPA 1P0PA 3ACCA 4UTVA 2P9FA 1CP2A 1S3GA 1T0IA 3U16A 1RI4A 1TB4A 3EC1A 4CL8A 1XMOB 4BGUA 2ZANA 3IEKA 1PGJA 1SEPA 2NSYA 3EB9A 3ANNA 2OO7A 1TECE 3IMEA 3L6UA 3UTDA 3ZKWB 3D3WB 4Y2RA 1O94A 2D0DA 3FGNA 4OK5A 4DA4A 2H59A 2HBQA 3OEEA 4REQB 5AK4A 3NU1A 2P9EA 4LF6B 2JBAB 5TGZA 4ENWA 1ZBQA 4V0LA 2H1LA 3AY0A 2BF7A 2R65A 1PR6A 2ERXA 1RRPA 3A1CA 5LA6B 3WWPA 4U2BA 1Z6PA 2HA3A 3EARA 5HEKA 1NQOA 1BVYF 2OCKA 1EJ6A 3HJGA 5A4KA 3EDRA 3OZSA 3AUJB 4DM7A 5F5LA 3Q7EA 5AM0A 4I1PA 1J09A 4RNDB 2YFHA 5KTSA 4GFDA 1DADA 4DBLE 3QFSA 5HKLA 2NSHA 3DCYA 3HZRA 4RZSA 5JUWA 4N0PA 2HWYA 4INPA 4BQQA 5KU1A 4N3GA 2QAGC 1FVFA 1YS9A 4GS5A 1N3BA 4DWVA 4EAQA 1KL7A 2AKEA 3P52A 4EI9A 2HK8A 4W5HA 4CLDA 2X4IA 1QCDA 1RHMA 3Q0EA 1A4UA 3QVGB 4RGVA 3G6WA 3MCZA 3T1NA 2EGHA 4IQ0A 3AJDA 3ZHSA 3RNOA 3PVZA 4JEMA 3UMJA 4BFTA 1QG2A 2YV1A 1CZHA 4JL5A 4UARA 3RFFA 3MGBA 3CSSA 2BFWA 2FQXA 4I6GA 3B20A 3UOGA 4P0PB 1JHYA 4RTPA 1ELOA 2DT5A 1TD1A 1IU9A 4CR8A 1YK0A 3UJ7A 2R84A 1N2HA 3VX3A 4BNLA 4IJWA 4YJGA 2O2CA 1FDVA 2D13A 2YNMD 3T6KA 2XXAA 1BXRA 2ATIA 2VQ6A 2HGSA 1Q6YA 4FLEA 5LDGA 2WD9A 4LXGA 3L8CA 1TM5E 1Q1GA 1QKIA 2FK8A 2ZB4A 5BNTA 2CC2A 1PFQA 3KAQA 4Q7MB 4EARA 4O2AA 2EL7A 3QVTA 2P68A 2P9QA 4YJ2B 1YAHA 3Q8WA 4FDUA 5B12A 4LFAB 2F3TA 3R6DA 4R1UA 2O14A 4CG0A 1Q77A 1SOWA 1B0UA 1CRWG 1UBGA 3PP8A 5CLFA 5LN1A 2PKXA 1DPFA 2JAPA 3C2QA 2CYBA 4IZOA 3TNDA 1WZNA 2Q2VA 3QU2A 1PWEA 1CTQA 4IGFA 5DHTA 5A04A 1U7WA 1CETA 3FTQA 4J16A 4Q18A 4E21A 2OLEA 5BW6B 4QUEA 1QH8B 3TOCA 5FBLB 1C7EA 1LW7A 2JRCA 3D54D 1N33B 1S2OA 1LK7A 2J6CA 2BMEA 2ZBUA 2GXSA 3MWJA 3FCSB 3WHKA 5C8ZA 1GQRA 4JI0B 3BBLA 3SQXA 2YV3A 3OEWA 2NSDA 5LWQA 5FOTA 4FDMA 3DAHA 3S27A 4YRGA 5KTPA 1B42A 5AJXA 4IQ4A 1BDIA 2AN5A 3QLVA 3AOEA 4BLRA 5AJWA 5JMOA 1FP7A 1RYYA 1ZXLA 2PYZA 2NUPB 3EWAA 4D82A 1L4KA 1LBEA 1XC7A 4KJXA 1NBME 1QYRA 1VMEA 3RG8A 4XDGA 1Q74A 5M29A 5EERA 1I13A 4YJFA 5HX7A 5K4HA 4Z4HA 3A1TA 1HYQA 1JE0A 2AHOA 1IM8A 1CQXA 1DTWA 1TLFA 2QY6A 1PR0A 2ZWAA 4TSRA 3Q3IA 3KV1A 2I6SA 4F8YA 3NAZA 2HQ1A 1PQ4A 2VYND 2FVXA 3SYLA 4AS3A 1QG6A 3TLKA 4P83A 4QEKA 4W5JA 2AOUB 1IN8A 4FQ5A 1EE1A 4ER0A 1QPZA 1EM8B 3HU3A 4J7UA 2PANA 3RTBA 2C31A 3ELWA 3CINA 3CZQA 3KQMA 4KITB 3WAKA 2YWXA 3KLNA 5JEDA 3AC0A 3QX7A 3OCCA 3LK6A 1W4RA 2BI4A 4EGCB 3IL2A 1N2JA 4B5LA 4IRUB 1B8UA 4TOIA 3JQ6A 2Y1DA 2C83A 5AR1A 5HVNA 1N6NA 4RESA 4ZKEA 4BY9E 2HHCA 5ALTA 3JALB 3VPGA 1OIXA 5CTJA 3KSMA 3OD5A 1U8AA 1TZ2A 1IZ7A 2VHXA 2WSMA 1GJRA 3ROXA 2ZJ4A 1W29A 1OIVA 1QWOA 2G36A 1YJQA 3X43A 4AMYA 5BPHA 3DOIA 2FEPA 4DMMA 1UMKA 4MUXA 5EC8A 4BFXA 5LL6P 3AFIA 3BMCB 3G23A 5DSXA 4MKZA 1O8CA 4FR0A 5IJXA 4BHTA 1DRUA 2XB8A 1ZGJA 3AX6A 3DM5A 3EAFA 2G1JA 3G68A 3GROA 1J07A 1CR1A 3H5RA 1F6WA 1GUAA 3HV2A 3I9NA 1ICIA 3VHXA 1CS0A 2BM9A 2P8JA 5B1IA 4ARUA 2C0QA 4BFLA 2FFHA 2PWBA 4RFSB 2L42A 3BMNA 4EPXA 2YV5A 1CEQA 2JGNA 1JH8A 4CCWA 5CXQA 1R4ZA 4L02A 2ZIGA 4QLOA 5ICMA 1SC1A 3PQ2A 5A02A 1JR3D 1G9SA 3EHDA 3KKPA 5HMMA 3V4ZA 1NJ8A 2NU7A 1WETA 3DKRA 3EXEB 1MRNA 4XOIA 1M8JA 1O89A 1XE3A 3B3QA 5F98A 2V7TA 4QEZA 2GDZA 3HCOA 1A9SA 1CUAA 1UOPA 1JU9A 2PBRA 3EWNA 3WZMA 1ZN8A 2JFNA 1VI5A 3MUOA 3TLEA 1KHTA 2BZ0A 2WOOA 1UP6A 4KO1S 3LPNA 1E7RA 1L5MA 5CB4F 2DRIA 5BT8A 4Z49A 2JEYA 4DREA 1YMVA 3A6FA 4N65A 5AI6A 3PTAA 4NBUA 5CB0A 1RKQA 1VPDA 1M2VA 2VBCA 1T3GA 3EA5A 4HEHA 1PT5A 4R8LA 1KZ7B 1ZGHA 4FC6A 2WU1A 4FFPA 4KPYA 2QTVB 3FVVA 3D1JA 3KT3A 4LMRA 1HZZC 3NXSA 3SPXA 3WWOA 3TKAA 3H2GA 3WJAA 2JLRA 1IAVA 4BEJA 1ZRNA 2BOVA 4C0SA 3GNLA 1PJSA 2XGJA 1XCMA 3TZQA 1GHTA 3OTWA 3S70A 2FTKE 2FW9A 4CF5A 1XDSA 4NECA 4OKIA 1LD3A 1NBAA 3SNKA 3QTLA 5BYKA 1K6MA 2NYVA 5H9WA 3I61A 1VJTA 1B0ZA 2M6SA 3RI3A 4EX7A 5CIWA 1GPDG 2AW3A 3GT4A 3I6YA 3IP3A 4UU1A 3PQFA 4G81A 4ISCA 2EJTA 4U7GA 3E8SA 2COUA 1FP1D 1HRKA 1FFEA 5F12A 1SA0B 1YBFA 3MJ4A 4MR9A 1FX0A 2P8SA 4JJFA 1N2XA 3CU5A 2QVBA 2XBUA 1O3YA 3M70A 4W1RA 4WN9B 4K3VA 4QPCA 1QHIA 3I92A 1G5PA 3OHMA 3CNNA 3U7HB 3CX8A 3DHEA 1C50A 2EFYA 1QWSA 2YQZA 2EBHX 3H87A 4C5AA 3IC5A 5JNUA 4W99A 2WWFA 5EZYB 4TUYF 4AZTA 3V2IA 5A0VA 3T0FA 3RVSA 4JI3B 3PCTA 3GP8A 3ME5A 4C2UA 2QPTA 2YJ5A 2OC9A 4RSMA 2Q1TA 4ZZIA 1TLTA 3ITDA 4KO8A 1JFSA 4F96A 1N77A 1RQLA 1AQNA 1QYXA 4BLSA 4E6EA 3RWMB 1ZPDA 5LWHA 3E82A 4FX2A 3X44A 2J3DA 4PAOA 4LBVA 5JMWA 1U6JA 4MMZB 1AK1A 4JL6A 1JNYA 3HVUA 4IDPA 1TPZA 1WDMA 3JVUA 2IYLD 3JVEA 3KZMA 1KOGA 2EQBA 1NVKA 4NFSA 1BS2A 4R83A 3ZE9A 2V54A 2ILVA 1SKQA 6REQA 4II7A 1G7SA 3PRYA 4IWYA 2O3UA 5EUBA 2BUBA 3A2LA 1W36B 2Q1XA 2G5TA 3HJAA 2C9OA 5U4QA 1AD2A 2I1LA 2P6UA 5K0FA 2UXCB 3MWKA 3D7SA 1GDTA 3CEJA 3SZUA 4ES6A 4PHCA 3N7TA 1JT9A 4XUGB 4D9BA 4LOHA 5DMXA 4MDFA 3RABA 3PSHA 1Z15A 1T9KA 4LKOA 5GZ6A 4G23A 1NOIA 2DBRA 4UU0A 4Q9JA 3PCXA 2P11A 2WSSA 5CFOA 2VP0A 3DR5A 3TBKA 1IHDA 2C9YA 4QJBA 2HUPA 3UAZA 1OUMA 5A2QA 2UZ3A 1I6LA 5IX8A 2ANBA 2G25A 3DF7A 1B6TA 3R1IA 3CLUD 5F9HA 2BE7A 2WVAA 1SVKA 1EHCA 2G4CA 2C2ZA 5JWHA 4E2WA 4GIBA 1TDJA 3OFNA 2FEWB 4V0KA 1N6KA 1O1YA 1ICEA 4OFZA 4RE6A 2XYVA 2XYHA 1NVWQ 2RHTA 4MV1A 2LPMA 4G37A 4DC1A 2B34A 5BN5A 2KS6A 1KJWA 2CLSA 1IZ0A 3HRKA 3Q1LA 4Q01A 1SXJD 4N3AA 4ZZ2A 1N34B 3ETNA 1UBTS 1SUIA 4NYMQ 4L8LA 3BK7A 4MV4A 1GNQA 4DMRA 1PUIA 4OHYA 2BKAA 2GZHA 1ZAKA 1NVDA 4QBHA 2XDQB 4C29A 2P4SA 1Q7RA 1YC5A 1MPXA 3PNKA 2GN4A 2NQ2C 4KIUA 1NXPA 1E5VA 4OL0A 3CNQS 3G0OA 3IJPA 5AFSA 3ZGNA 3JSXA 2GA9A 3V1YA 4Z51A 5C1OA 4UD2A 2OB2A 4ZHSA 1NATA 3T15A 1M2OB 2FW1A 2I2FA 3U44B 2GBLC 4FTWA 3R24A 4A26A 1P1BA 3RREA 1V43A 4C20A 4DUGD 2PPLA 1O97D 3INTA 5BMVB 1L7PA 2F1JA 2QAGA 4WINA 5BYAA 4G0WA 1OW3B 3OU6A 4ARSA 2R6FA 2DBQA 3NANA 4O2AF 3CZ5A 4J1TA 4QXPA 3LLVA 3K0AA 4RLHA 1GOTA 1V8OA 3HLKA 3UAXA 1ZIPA 2BEWA 3ABOB 1V4BA 1Q0UA 4MUHA 4BQRA 3KE8A 2N3ZA 2RHWA 1MOPA 1VL6A 2GAAA 3W5IA 4PSAA 2C9ZA 1OMOA 3DP9A 1WW8A 3D31A 2IY8A 4U8HA 3BWMA 3FBWA 4EVRA 2CEAA 3GNSA 3Q7PA 5AK6A 4URHA 1RU3A 4J0IA 1FCJA 2ZIAA 4BLOA 4O4LA 1IHYA 1KNQA 5DB4A 3FYHA 2DBVO 4LRTB 2FOXA 4R1QA 2WP0A 5KJ1A 1BHQ1 1TM7E 3MILA 3TXYA 2M98A 1M34A 2JGDA 1E9EA 2AEFA 3RUHA 1CERA 3IHKA 3QE2A 2Z58A 3PFBA 4UHFA 5ELXA 4N5DA 2YDXA 4G89A 4HNSA 4PW0A 5C4GB 4UOZA 4ZN6A 1SCAA 3RVDA 5B36A 5BSEA 3N7AA 3E23A 4ALMA 1JEDA 3HA7A 3ONEA 3QFHA 1GSHA 1SQGA 4XIJA 4BE7B 4EIWA 2ZUTA 2GXAA 1BO6A 4G67A 1XDGA 4TV9B 4AZ3B 4OTZA 4R01A 5BW8A 2ZT7A 2O54A 3TIGA 1MH9A 2FG7C 2JIDA 4NJMB 2GN8A 1W5TA 1G8MA 3AETA 4LYHA 3R3WA 1I4EB 1JAIA 3JPYA 2H65A 3O91A 4Y6PA 2XUFA 1V1RB 2EQ5A 5CIYA 2Y1OA 4TVOA 4OQDA 3C3AA 1J9ZA 4MINA 1ECJA 2YVUA 3I2IA 4QHSA 1RXYA 3VO2A 1YS7A 3F78A 3OT5A 2WIFA 1ZD3A 2QV0A 4GT1A 1ODIA 1SCIA 2W6OA 2BMJA 1U31A 3DOHA 4QQRA 3UFXB 1A9ZA 1FNCA 4Q93A 4UATA 3AYXB 2I9PA 4G5GA 3WRYC 4AKTA 1U80A 2I65A 3GLVA 5AK5A 2Q2WA 2CV0A 3QMWA 1C7FA 1I10A 1RWNA 2AQ8A 3L18A 3SD7A 1PS9A 4KB5A 4E33A 3GOHA 2N42A 1DXOA 2ZRPA 3AMVA 1ISMA 4XSHA 1JB1A 2FCRA 3I5AA 5F64A 1C8VB 2H8GA 2JIMA 2RGDA 1YJ8A 3EFBA 4BO7A 2HM7A 3PI7A 4KMOA 5EMKA 4DCJA 2O5RA 2QD4A 1IWPB 1JAYA 2ZKIA 3GK3A 3AUUA 5LQKA 2CEKA 2X9VA 1HMYA 3MJVA 4QNMA 4L5JA 1T15A 3QVVA 4KN8A 4EL5A 5CXXA 1KGDA 4G9EA 1CUWA 1LK5A 1M73E 1P4GA 4RQUA 3FTFA 4RK0A 4YCAA 3WJ1A 3C5EA 3D8SA 3I58A 1M7HA 3UEOA 5K09A 1UADA 4YT8A 3THXA 3KQYA 1IXSB 1ETHA 1YO6A 1AM4D 1OU4A 2VZ9A 5HDQA 2RD2A 4AP5A 1DQSA 1SHUX 5FJIA 1MV8A 2I7TA 3U1VA 4JA0A 1MHPA 2ACEA 1XNQB 1C4WA 3A1UA 1R2QA 3LZCA 3C6MA 4E07A 2PMDA 3U56A 3PNPA 3JQAB 4YALA 1UH5A 1ZI8A 1ZOSA 4BNVA 2QBYB 4WKGA 3L5KA 5DIZA 4LC9A 2YHIA 2ZT5A 3ZJTA 1SG0A 1R00A 4KXWA 3S1SA 4J90A 3COJA 4US1R 4MLZA 2P67A 3H6GA 3JAMA 3U5ZB 1JRLA 3JQCA 5M7EA 2DPXA 1AKMA 4K9QA 3ESYA 4NICA 4OU5A 5IVIA 4M9UA 5B30A 3J7AC 3O1JC 4LK2A 3QHQA 5TT0A 1A2OA 3QG5A 2Q4EA 3ROFA 3L7AA 5K0SA 1LLUA 4A9AA 3LQ4A 4RTMA 1C5KA 1XDUA 4UUPA 1VBMA 2PS1A 3WL4A 1PWXA 4LC1A 1NN0A 3FKSA 2PUVA 1QCYA 1WQ3A 3FWHA 4MGZR 1FYXA 2NUAA 1E3EA 4JKOA 2YMLA 1IH8A 3KZCA 4YWJA 3ISJA 4P4SA 4F2GA 2WDPA 4M1MA 3E03A 4MVJM 5AXAA 2DWQA 5DYYA 1U81A 5DHFA 3OE7A 3X3HA 3HWX1 2BUCA 3RO7A 4WE3A 1RWKA 4RYDA 3FWZA 4D96A 3AHJA 4DNPA 3TUZC 5C5EA 3WLLA 5CR9A 2JVKA 3B52X 4NBRA 1TT5A 3C5CA 4L4XA 3HXKA 4BJ1A 2C2HA 3ZD7A 5FI1B 2O1XA 2QI9C 2ZSBA 4DV3B 4A23A 3VFDA 1D0SA 2EYUA 2VEDA 3KVRA 5EAIA 2J9XB 5CNMA 4S1OA 4H0NA 2P78A 2GMWA 1JR4A 1ZRHA 1QX3A 1NZJA 1Z56C 5C7YA 2WZQA 5ICSA 3GI1A 2IU4A 3N8NA 4DCPA 4ZGWA 1O77A 1DFHA 2IIQA 3R0ZA 2C04A 2YMPA 4GQBA 4FUQA 3SS8A 4EG7A 4E15A 3IQIX 5IK2D 2D59A 1X1AA 4YRBA 5DM60 3VPAA 1QR6A 1M54A 3F46A 3P8ZA 4PZLA 121PA 4PZUA 1WBBA 1B43A 3EG9A 5BN3B 3F6PA 3NTUA 5E1MA 4NAVA 2PZKA 4RA6B 5FP0A 3MD9A 4H7HA 1DAHA 1YASA 2YXDA 3BVPA 5EMJA 1X7YA 4O3MA 1WG8A 1JIQA 3HHEA 1LB1B 3U7RA 3HH8A 4ALNA 4ND8A 4IEIA 1CJUC 4KVZA 3TAHA 3I3SR 5IPFA 1BEZA 2Y1LA 4OK3A 3F0TA 3EXFA 1PZGA 3ECCA 1ORIA 1ST2A 1RACA 1J8MF 1WLSA 2AG8A 3M6LA 4ZVMA 3WV5A 1JFFA 4BIIA 5HUHA 4FQ8A 3MK31 3QWBA 1A8UA 4YCJA 3U17A 4DJTA 2DQKA 1GP2A 3E9RA 3KZNA 4KVAA 2CVPA 4OHVA 1HK7A 4DE5A 2DJIA 2GZRA 5IAJA 3TSAA 2X9NA 2FRDA 3KOOA 1SIUA 5GWXA 2Z5GA 3CW9A 3PFIA 1GZ7A 2XZOA 4DV0B 4PO8A 2WPNA 3A6HA 1WMDA 4D98A 4EJ6A 2ID7A 2C03A 5CLQA 3STXA 3WLTA 3OSZA 4MYCA 2J9GA 4RD0A 4O8ZA 3H9QA 3LVRE 4Q3CA 1L0BA 4YMWA 1D4AA 2OPHA 2Q07A 1GTSA 1E1KA 4US0R 4L8YA 1COWA 3VHRA 3RVQA 1G17A 1Q92A 3L02A 1ZIDA 1RXCA 4FI3C 4DPLA