1EDOA

The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with nadp+
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
244
Chain Sequence
SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLALSPAASYITGQAFTIDGGIAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray structure of Brassica napus beta-keto acyl carrier protein reductase and its implications for substrate binding and catalysis.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
molecule keywords BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
total genus 84
structure length 244
sequence length 244
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2000-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1edoA00
4GLLA 4YJGA 4CL3A 2HQ1A 1IUKA 4IDFA 3COSA 3ONFA 4CLOB 3PEFA 1KVSA 3PZBA 3M6IA 3PYXA 3WIEA 3ZWCA 1OC4A 4CMHA 3K30A 4HFMA 5COAA 4AJEA 2B5VA 4MKRA 2IODA 4D3FA 2AQ8A 4K9DA 5AXCA 1K89A 5TJ9A 2O4UX 2XXBA 1BW9A 1KETA 3E9NA 4GWKA 4IQ8A 2Y1DA 5KWEA 5F5NA 4AVYA 5CG2A 1I3NA 2BMAA 4BS9A 1HDZA 1U5AA 4RQTA 1ADFA 3G1TA 2UUPA 2EP5A 5TS3A 1I2CA 3E18A 4OOEA 1A7AA 2H1SA 3PLNA 5TT0A 2NQ8A 2PKQO 5L45A 3OF2A 4QEDA 2E6UX 3K8ZA 4J7UA 4MVJM 3C1TA 5C3MA 4FBGA 4RJTA 1F17A 2C82A 2DBZA 2V6FA 3ON5A 5A03A 2VUSA 3MOGA 2EWMA 1CF2O 4YAEA 4ZHSA 1ONOA 1SOWA 3O26A 4E33A 4J1NA 4BKOA 2DPGA 3PQEA 4PN3A 3STHA 3EZYA 3GVHA 1DC6A 2OHXA 4CL8A 5KVSA 2SCUA 1TB4A 4YPOA 1WW8A 1YO6A 2W8ZA 1GQ2A 3WSVA 4KDFA 4H15A 1E1KA 3PWZA 1B3BA 3DHYA 2OGUA 3TOZA 2DLDA 4ND4A 4GGPA 2B83A 2GD1O 3AK4A 4FFLA 2B69A 2CVQA 2NVWA 5JYEA 1W8DA 1ISFA 4GMFA 3UAGA 4CPDA 3HADA 1GD1O 3DFZA 4Q9NA 1LDMA 4BB5A 3CZRA 5JLAA 1LDYA 3ETEA 1DXYA 2A92A 3JYLA 4XKJA 4KQXA 4KWIA 1O94A 5IAAA 3OFSA 1QMGA 3R3SA 3K6JA 2OMEA 3D3EA 3P2YA 1GL3A 4K6CA 3U9LA 1A27A 2QYTA 2RH4A 1Q0QA 3JSAA 1LSUA 2Q2VA 4J43A 4DQXA 2VYND 1PU2A 5CEEA 4O6VA 4BQRA 1U5CA 1KY4A 1UP6A 5A9SB 5DULA 1X15A 4IBOA 3W8EA 3H9JA 1U8XX 3A1NA 3RAJA 4XWYA 4BKPA 1XYGA 1YOVA 2YDYA 4RPJA 1V35A 3L6DA 3QWBA 5DOVA 5T57A 1XCBA 1A71A 1P74A 2BRUA 1QYDA 1PJSA 2ZB4A 5CDGA 1Q7GA 1B3RA 1HSZA 4EBFA 4E2XA 3HN2A 1VKOA 1YBMA 1VJ1A 3ADPA 1T2EA 2QG4A 4IZIA 4ONEA 4YVFA 2PD4A 4D0SA 3OECA 4NBRA 3CPSA 2I9PA 3F9IA 4RDHA 3Q6IA 1PJTA 3E9MA 3GVIA 4I9NA 5A9SA 3NTQA 2EKLA 2CD9A 4PLHA 1YQGA 2PZMA 1E7YA 4KMSA 2Q3EA 1H6CA 3QVOA 3JQ8A 4CMBA 1K6XA 2A35A 4EEZA 3I6QA 1U1IA 1MUUA 2AXQA 3WBBA 4E0BA 3JQAA 3TN7A 1RKXA 2X5JO 3SC4A 3Q11A 4J2HA 2O3TA 4WLEA 2UUOA 1KVQA 2I67A 3WGOA 2FP4A 2VOJA 3GGPA 4JJIA 1U7HA 3WR5A 3FBGA 1GR0A 3KETA 4WOJA 3ZV6A 3I9JA 4WLOA 2QW8A 5CDUA 1HE4A 3WXBA 1YQDA 3JD4A 1OMOA 3P2OA 1SC6A 2WMDA 3C8MA 4FFPA 4DLBA 4WK6A 2VRCD 1JA9A 2GN4A 1T26A 2Z1NA 1U3WA 2I99A 4MJLA 2GUGA 1TA4A 1UZNA 4DBVO 1NM5A 3Q2KA 2X9NA 1M6HA 2EHDA 3BA1A 3QE3A 4L4RA 2UAGA 2RCYA 3MJSA 1JKIA 2HSDA 2Q4EA 1KC1A 4RF5A 4J6FA 4OXYA 5G0TA 3CMCO 4OAQA 3IJRA 3KSZO 4D45A 1VJ0A 4BGEA 4CLEA 3I4FA 5F1KA 2R00A 4IJUA 1B14A 1PJLA 4E30A 3ABIA 4RLHA 2VTDA 3GOHA 1LTHR 4B79A 4E5PA 2VWPA 1P9LA 5IZCA 4A7PA 1H6DA 4CM8B 5JCJD 2P9GA 3C7CB 3HB5X 3RFTA 1JAYA 1NHGA 2QHXA 2C2XA 3HDYA 2TMDA 1HZJA 3VPGA 4BNGA 3DBHB 4PRLA 2J8ZA 3D3WB 1NWCA 3OA0A 1YWGO 1SOVA 1GTMA 3E1KA 2C7VA 4H3VA 2ZCUA 2CF5A 1ZW1A 2P9CA 4JP3A 1YL6A 1SMKA 3JQ6A 4AG3A 2HK7A 3ZWNA 3GC6A 1F8GA 3OBBA 5DP2A 4NBTA 5KKCA 4CV0A 4CM8A 3S55A 5IXYA 3TZQA 1P45A 2VZ8A 3F46A 4MO2A 1CDOA 2BI7A 1YB1A 5U1PA 2XAAA 3IS3A 3JD3A 5DBGA 5I9NA 1DBVO 3WGHA 4A03A 2UV8A 1K0UA 4LISA 4OKIA 2CUKA 1IZ9A 2WYUA 4DLLA 3ULKA 3VZQA 1ZUD1 3D5TA 4IM7A 1LX6A 2WYVA 3UICA 1NR1A 3LDHA 3GEGA 4YJDA 2EG9A 3R0IA 1OC2A 4J0FA 3LT2A 4OSPA 1LLCA 2XPCA 5IG2A 1KVRA 1DEHA 1R15A 1V0JA 2IYPA 3RC7A 3FWZA 4CUZA 3ZHXA 2GCGA 1GU7A 1XELA 4YQZA 2OZPA 2PNFA 2BGLA 2NADA 3AOGA 3ITKA 4Q3EA 4E4YA 1DRWA 5TNXA 4YR9A 1G0NA 3VDQA 4A5OA 5FI3A 4XB2A 4Z9FA 1UDBA 3NEPX 1DJQA 3PK0A 3BHMA 1SEVA 2D4AA 4XQEA 1K3TA 1QLJA 3PQDA 1GZ6A 3K5PA 1A4IA 4IY1A 4QT0A 1XWFA 2NVBA 2Y68A 1DIAA 3RUHA 3ETGA 3KLMX 5JYDA 4BMNA 4P4GA 4DBZA 2WDZA 3CH6A 4W99A 2UDPA 1LA2A 2J6IA 3UH1A 2G76A 4PVCA 3UOGA 3NYWA 3I23A 3L6OO 1GFSA 2Y1FA 4G81A 2Q2WA 4AJJA 3L77A 3NTRA 1Q7CA 1BTOA 4QX6A 4AJNA 4HUJA 4QECA 4AJ4A 4R9RA 4E31A 1H9AA 3VZPA 1WMBA 3I9LA 2HCTA 4DXHA 1NTOA 1J4AA 1GAEO 3UCEA 3DZGA 2ZTVA 1EQUA 1NNUA 3JTMA 3SLKA 1ORRA 4JNKA 2IYOA 1QKIA 2P4HX 4BNUA 4IDAA 3VTZA 3ZCXA 1O5IA 3RUAA 3QP9A 1P1JA 4XB1A 3E5MA 1MXHA 5G0SA 5MGBA 1X1EA 3UUWA 1QYXA 4AFNA 3SBOA 1V3TA 2NVUA 3HSKA 5C7IO 2Q99A 1X7DA 1GCOA 1YH3A 4OGWA 4UVEA 2ZTUA 5COQA 3DOCA 1I24A 2H5LA 4W4TA 1U2GA 4DPLA 4DVJA 1QV6A 3RUIA 3Q9NA 2A94A 3WMWA 1SEPA 4CV1A 3BZUA 3MJEA 4Z9XA 3OJOA 3W4KA 4CODB 1DC5A 3AJRA 2ET6A 3GN2A 2GZ3A 1E7QA 3EUWA 4QFDA 1RM4A 4NJMA 4TZTA 3E03A 3OICA 1U3TA 4HADA 3R6DA 1C0PA 3BMCB 3GAFA 4BNTA 2G1UA 5A9RA 1C1XA 4ALLA 2IZ0A 1E1MA 2GN8A 1WMAA 2OBNA 4NU5A 5G0VA 1EBUA 3U4IA 3MOIA 3DR3A 1C1DB 2GF2A 1BDMA 3ENKA 3PFWO 2W98A 3FPLA 5CEFA 4FPXA 1C0LA 3ZU3A 5A06A 2J3JA 1U3UA 4J7CA 1QYVA 4D42A 3RBZA 2VTEA 1PS0A 3KO8A 3AI3A 1U4OA 5FFFA 4KTTE 4R41A 3JQDA 4Y67A 2QZZA 5CHEA 1NQTA 1YS4A 2WEKA 1M67A 3IQDB 4IIUA 4B3JA 5FF9A 4LSWA 4GVXA 3ZWWA 4LVCA 1WNTA 1C1XB 4OQZA 1MFZA 3WFIA 1E1LA 1ENYA 4I1IA 1HDGO 4P22A 3VZSA 4I9UA 4QUKA 4NIMA 3ROQA 3B1FA 5GZ3A 3ICCA 1WP4A 1K5HA 4RPLA 3ZWXA 1SBYA 1Q1NA 3NTOA 3F1LA 1ZIDA 1PZHA 4ALNA 2Z1MA 1GUFA 3VVCA 3NX4A 4WPGA 1BG6A 2B36A 4O1MA 2WD8A 4CUKA 2ZJ0A 3JYQA 4YDRA 3CZMA 5A4DA 3NRCA 1PIWA 4EI2A 4W7IA 5A5FA 2YUTA 4LMPA 2B0JA 3JQGA 1YQXA 3QY9A 3WICA 3PFFA 4WLUA 1Y5RA 4G65A 3GQVA 1KEWA 1DIBA 4RZHA 4FS3A 3H2ZA 4CQMB 1MP0A 4JROA 3VKVA 3HQ4O 5IZ4A 1NYTA 2NU6A 4PIVA 3BTUA 4F6CA 2E4AA 5KNLA 2BFAA 4JIGA 3RBVA 1WDMA 1IHXA 3O4RA 4GX5A 5EL0A 1A4UA 3JCZA 1GPDG 4ITUA 2EIHA 1E3IA 2POQX 3PHIA 5JS6A 2EKPA 3PJEA 2QRLA 3U09A 1WPQA 1IZ0A 2VQ3A 3VPSA 1P0CA 3KYCB 2H9IA 1A5ZA 3AFMA 3NUGA 4FCCA 4U5QA 2PH3A 4Y6RA 4JCOA 3OM9A 5AXAA 3GDFA 1JQBA 4PZCA 2QZ9A 2NTJA 5HS4A 4NR0A 3DMTC 3EK2A 5JDIC 5KVVA 3FTNA 5TGDA 5F3RA 1JVSA 3D4NA 2NNLD 4BO9A 1IHYA 1VL0A 3WNVA 5L95A 2Z5LA 3DZJA 5ENDA 2PGDA 5ITWA 4GGOA 1T1SA 5G4KA 2FZEA 2Y1GA 1H2BA 3D7LA 1E3EA 5ADHA 4E2ZA 3EVTA 4LRSB 4Q3BA 5A1TA 4IS2A 4I5DA 1QV7A 3DHNA 4XRRA 5LDGA 1HZZA 1O8CA 1T4DA 2HK8A 3EMKA 3ZW9A 4L4SA 1ZEMA 2OP1A 3D3WA 2CSUA 1XLTA 3NKLA 5DCUA 5EQDA 1VC2A 5DBIA 3A4VA 1YONA 2DU8A 2G0TA 4YQYA 1I32A 2RBEA 4BO8A 2O3RA 5JW6A 2RIRA 5T8KA 4AJKA 1CQJA 4Q39A 1WXDA 3BMCA 2YYYA 2Q49A 4PLWA 1BRMA 4GX0A 4MVJG 1OI7A 4O0LA 5L7WA 3ZNPA 1NFFA 2AA3A 2ZYGA 1VJTA 4HWKA 4PCVA 4AJLA 4MVJD 4FN4A 3PHHA 3SX2A 4EEXA 2V6GA 1F14A 3HN7A 3TZHA 3CUKA 3NDRA 4ZU3A 3ICPA 4Q3CA 4D79A 4CLOA 4AL4A 1M66A 3PPIA 4N5LA 2GERA 1H0KA 3PP8A 5CDSA 1AUPA 1TI7A 3ONDA 4IJWA 4CLXA 3U4DA 3MJVA 3ZHYA 1AXEA 4I9HA 4CM1A 2B4RO 1LLQA 3IP1A 4CMIB 1A7KA 3VH4A 5L53A 4BQPA 3SVTA 2YFHA 1J49A 4BO7A 4RO0A 1I10A 2C07A 3V2HA 1B8VA 3W6UA 1OOEA 3RUCA 2ZKLA 2NVUB 1ZXLA 3TRIA 3OEWA 3UW3A 1PTJA 3LSYA 1C3VA 4HBGA 3ZDFA 3W4JA 5IXSA 1G6KA 4GAEA 1GADO 5GZ6A 1NQOA 3RC9A 1ZFNA 1BWSA 3NT4A 4YRAA 2EW8A 1BXGA 4NG5A 1E3SA 4S3MA 3EVNA 3BMNB 1X0XA 3GDOA 4GSKA 4B8ZA 1Y8RA 1Y8QB 4ILKA 4XQCA 4GI2A 4ZRMA 5L51A 3INTA 4XIJA 1E5QA 3BIOA 3LF1A 3RI3A 3ADOA 2JFGA 1PL6A 4DMLA 4UVGA 2A9FA 3U4HA 4CM5A 1AE1A 4I08A 1ARZA 2QRJA 3S2EA 4RVDA 3Q0EA 2X5KO 1ZSNA 4RPGA 4UEKA 3RU9A 3WLFA 1EVIA 5JE8A 2VRBA 2OP0A 5MDHA 1R4MB 3B1JA 3O8QB 1WZEA 3UCFA 1EBFA 1N1GA 1ZVMA 3M1AA 3SLGA 3GRKA 3AOEC 2O3UA 3JQ9C 2C54A 3C1AA 4M8SA 1O9BA 1U8FO 4RF4A 5F5LA 5JO0A 2Q45A 3QVWA 1PX0A 3F5SA 1EE2A 3DBLB 4X54A 4PGFA 2RH8A 1PJBA 3BTSA 3CIFA 2EF1A 3TQHA 3GNSA 4IXTA 3RD5A 5GMOA 4DC1A 3WNQA 3HZZA 1H93A 5CFZA 3PYMA 4MVJA 3Q9UA 4CLRA 1DLIA 4O5OA 3ZH2A 4BV8A 1I2ZA 1E7WA 1SZJG 1B15A 1DIHA 3LT4A 5G0WA 1CJCA 2YHIB 3T4XA 4E21A 1QLHA 4J4TA 1MLDA 2X22A 3EY4A 1JKFA 1S6YA 1GPJA 1LDGA 4WUVA 3ANLA 1SPXA 4J91A 1YBVA 3TDKA 4FQ8A 2C2YA 1I3LA 3H3FA 1ENOA 4YTEA 1CWUA 3VPFA 1P3DA 3VPHA 2GDZA 3E82A 3JQEA 2UVDA 3V2GA 4JJGA 1M6WA 2IEDA 4XYBA 1VLLA 4CM4B 1PJ3A 3KOUA 1IYZA 3IP3A 4MIEA 3K96A 5AYVA 1YJ8A 1ULSA 2VN8A 5DBFA 4GMGA 3GDGA 3MEQA 2BKAA 3LLVA 1KYQA 3WMXA 3FPCA 5L40A 1LSOA 2J5KA 3PGXA 3TL3A 1E7RA 4W9NA 3VVBA 4CUJA 2E49A 4FGWA 1SB8A 4M89A 3JQBC 3RKRA 2I66A 4GLOA 3MJ4A 4YYZA 4BNIA 3LK7A 4CR6A 3GGOA 1ISMA 4Y9DA 5JY1A 3CMMA 7MDHA 1FK8A 4FOSA 4MVJE 4LMRA 3UHAA 1O6ZA 3ASVA 3A14A 2DM6A 3GUYA 3PDJA 4KUHA 2ILTA 4E12A 4D44A 3ZWYA 3KLPX 2RAFA 2YQ5A 3H2SA 5DNAA 2EV9A 1EK5A 1NBOA 1ISHA 4HY3A 4N5MA 1DPGA 4YAGA 5T6BA 2PFGA 4A0SA 2YQ4A 2Y66A 2AQHA 2PKQP 3PLRA 3ZV5A 4IDEA 3EC7A 1R0LA 1JAXA 3HDQA 1X7HA 4BKRA 3VDRA 3WJ7A 2X7HA 3QW2A 4ALKA 3LC7O 3U4CA 1XQ1A 4CM9A 4QSMA 3E8XA 5AOVA 5KJ1A 3K2EA 2DFVA 4TWRA 3VPXA 2I65A 1FDTA 4S1VA 5L3ZA 2ZYAA 1OZAA 4W7HA 4NZ9A 1TT5B 3H7AA 1NAIA 1J6UA 1F8FA 3ZGYA 2FMUA 4R1NA 1A72A 4N18A 4ZJUA 3SJ7A 1R4NB 3MZ0A 2LDXA 4PLTA 3U5TA 2BFOA 2PK3A 2J5QA 3LU1A 4WLNA 1B8PA 4J2OA 4IMRA 1HYEA 4EUHA 5BR7A 5T8KC 3JQ8B 3FCOA 4O63O 3RJ9A 4B3HA 3FI9A 3E9QA 3WGIA 3OSUA 1GEGA 4HP8A 3DFUA 1QYWA 2E48A 3WYEA 2YY7A 1YB5A 4TRNA 4YA6A 3DXFA 5DP1A 2P68A 2XF8A 2PTGA 3KVOA 4A26A 3KZVA 1DAPA 1EZ4A 2YV1A 5H81A 3WGZA 1UXGA 3MTJA 5TRTA 1DSSG 3HUDA 2AE2A 1BW9B 2OOSA 3DB2A 5ER6A 1MG0A 2OO5A 1B2LA 1DIRA 1E5LA 1D4FA 5DZSA 1SCUA 4D3SA 3HWRA 3OJEA 3WG9A 2FY8A 3EDMA 1ULUA 3T7EA 3RKUA 3TFOA 1HL3A 1MA0A 2ZTLA 2Y1EA 2J3IA 1P33A 1DFHA 1JLLA 4ROSA 3OJFA 2JCVA 4KWHA 2Y67A 5CDYA 1PGOA 3KTDA 1KERA 4R01A 3DBRB 1GCUA 4MP3A 4PG7A 3ZHBA 4QFCA 1EVJA 1WZIA 3OQ1A 3PHJA 2GN9A 3W1VA 3R3JA 4RZIA 4TRMA 1Q7BA 1RYEA 5JAQA 4ZICA 4A2CA 2HRBA 3GF4A 1LEHA 1ZXBA 3ANNA 1XR3A 2EEZA 2Z95A 4PLGA 4RVGA 3IJPA 1LNQA 2PGJA 4QTZA 3HHPA 3WBFA 4ALMA 5B4VA 1NFRA 1PJ2A 2X0NA 1EQ2A 4I5EA 2I3GA 1NP3A 4K6FA 4UUPA 5IJZA 2FPPA 3KRTA 5A05A 1YDEA 4Q3DA 3TPCA 2DBVO 3UN1A 3FHLA 3T7CA 1YDWA 4UEJA 1Q0LA 2Q4BA 3DL2A 4LCEA 4UUMA 3GH3A 5FYDA 4DYVA 5F1OA 5EPOA 4J9UE 1RYDA 3HJAA 1RM0A 2Y0EA 1OBFO 2WM3A 2VUUA 1DAOA 3Q3CA 3NGLA 3KSDO 4RVHA 1ZK0A 3ZU4A 3GVPA 2O4CA 4OYRA 6LDHA 1M76A 4EGFA 1NHWA 1HT0A 4CQMD 3DWFA 3F47A 4FDAA 4NI5A 5ES3A 6ADHA 2P4QA 3DOOA 2HJRA 4IZHA 1BVRA 1WAMA 3DEYX 3KYDB 2JJYA 3W8FA 4G2NA 1HDCA 4KTVE 1EK6A 1I3MA 2JD0A 3H9GA 3TF5A 4PLFA 2FR1A 3OIDA 5EMHA 3C7DB 4U6SA 1BXGB 4MIYA 2VZ0A 1ZKMA 4B7UA 2NACA 3F1KA 1HYHA 4QO7A 4PG6A 1J0XO 1MV8A 1EFKA 1O0SA 5A3VA 3RC2A 5KCZA 3OIFA 2CVZA 1EDZA 1E3WB 4XQGA 3H3JA 5ER9A 3JYNA 2VRCA 5EQFA 1ISIA 1LC3A 1UXJA 3ZWBA 3DZBA 3CEAA 4IXWA 1LDBA 5BSHA 4K26A 5I9LA 3INGA 1MX3A 1CETA 4WCFC 1FJHA 1HLDA 4LN1A 1UH5A 4B7XA 3H9UA 2WD7A 3ZHZA 4J16A 1R0KA 4BMSA 1R66A 2IZZA 2ZB3A 3NV9A 4RVFA 1NAHA 1S7CA 1XQ6A 1Z82A 1BDBA 1AN9A 2O2YA 2BD0A 3AUAA 2FHSA 4JGBA 4OOFA 4TZKA 5K6AC 1O95A 2JAHA 1RPNA 4JN6B 1H9BA 1ENZA 2JD2A 2W90A 3ZV3A 2Q1SA 3G3EA 5HA5A 4HFJA 1KC3A 4L74A 3ZWPA 1FDVA 3FTPA 4WLVA 3AFNA 3BMOB 1W4ZA 3KEOA 3DHEA 2EGGA 3L07A 2C5EA 2DTEA 4U6QA 2BELA 1C0IA 2OBYA 1LUAA 2R6JA 3PWSA 1Z6ZA 2JCYA 3I9OA 1N9GB 4U8GA 1WDKA 4PFJA 2IXAA 1JW9B 4GSLA 1T25A 3H5NA 1CYDA 7ADHA 5KIAA 5CPFA 2NWQA 2EGHA 3DTYA 3DZHA 4PLCA 2YV3A 4CQLB 2I5PO 1OAAA 4XX0A 1F12A 3C1OA 3ZWVA 1LDNA 1E3LA 5C7OO 2QYSA 3PJGA 2DBRA 1LLUA 5KJFA 4MKZA 5GY7A 5COBA 4II3A 3K73O 1DOHA 1XKQA 3OA2A 4B7CA 1T2AA 4A27A 4DGSA 4NBWA 1LJ8A 4XYEA 2NSDA 2PGLA 4YRBA 2GNAA 2P5YA 4EJMA 4DA9A 4GQAA 2GSDA 9LDBA 3NGXA 2JD1A 3AI2A 2B37A 3GVXA 4IDBA 3IL2A 3KYCA 4XDYA 3WGYA 1PGNA 1I33A 1NWHA 3JYOA 4L75A 5EN4A 3FNEA 1LSJA 4XA8A 1X14A 4FIZA 5BNFA 1DJNA 1PQWA 2WTBA 4ND3A 3G17A 8LDHA 4J1QA 4UEOA 4ALIA 4FFNA 2GPTA 3ZI0A 2ZB7A 4FJ0A 4GL4A 1HDYA 1YBAA 2O50A 1SNYA 4IPTA 1DFGA 4R1UA 5A04A 1UXIA 1GYRA 4XJSA 3FN4A 4JX8A 3RQSA 4HX5A 4ND2A 3I9NA 1GYQA 4E5YA 1ZBQA 4CR8A 2I6TA 1N7HA 2ZK7A 1T2FA 1YL5A 1JKJA 3EYWA 3LC1O 3PRJA 4ZQHA 5ICSA 2C5AA 3SEFA 3D0OA 4D7AA 1B7GO 2NM0A 3DBRA 1Y1PA 2NTNA 4J0EA 5DOZA 5EESA 3TZKA 3ZN2A 1GV1A 2X1HA 1GUYA 4ND1A 3W8DA 2JFFA 3AOEA 2DUWA 1ADGA 4OL9A 2P5UA 1WVGA 3QV1A 1DB3A 4QXMA 5TLSA 1TXGA 3P19A 4R51A 1E6WA 1JU9A 1PJQA 4OH1A 4CM6A 4RV9A 3B1KA 3QWIA 2NU7A 1VSUA 4PG4A 1UXHA 2BHLA 1GUZA 4DIBA 1FDSA 1T2DA 4CJXA 3HDJA 4OKNA 3GG2A 4XCVA 3ZZNA 2PZJA 3CE6A 3IMFA 1PWXA 3QIVA 1TVEA 4B3IA 4DL9A 2RHRA 3NT2A 5C7LO 5CAEA 2CMDA 1M2WA 3Q2IA 1B16A 2B4TO 2P91A 4ID9A 1GDHA 4HXYA 4EJ0A 3BMNA 3PWKA 3B20A 3GHHA 1P31A 1ZMOA 4BO3A 1E1NA 4JQCA 1NPYA 3KV3O 4YCAA 4ZQFA 2ZQYA 3TFQA 4N5NA 1UXKA 4DWVA 1AGNA 4PZEA 4J1TA 4OO3A 4E2WA 3LQFA 4MP6A 3AU8A 3V1YA 1DIGA 3LC2O 1GY8A 4ZD6A 1HLPA 4FR5A 1IULA 4FOOA 3OJLA 3PHLA 1C1DA 1XIVA 5JBIA 1F06A 5IDXA 1E77A 1HEUA 2AQKA 2FR8A 2YV2A 4F45A 4B4VA 2C0CA 5HS6A 1FDUA 5HRUA 2H63A 2JCXA 2D0IA 2IRWA 2VNAA 4EUFA 2DTXA 1MFPA 1L1FA 2HO5A 1EE9A 2FSSA 4KQWA 4YT5A 4JK3A 3G1UA 3PYLA 4BMVA 4EW6A 5IN4A 3O9ZA 3ZWOA 3WOHA 2WD7B 3RIHA 1QORA 4OHUA 4XGNA 3WX0A 1D1SA 3AUTA 4YJHA 4TVBA 2NV6A 3LZ6A 5T67A 2EP7A 5KVQA 1WLYA 2LDBA 3VH1A 3H8VA 5ILOA 3D5QA 2O7SA 2HU2A 3UKOA 2BFMA 4KZPA 3GMDA 4FFMA 1YRLA 2IDZA 1CERA 2C59A 3F6YA 4WLFA 2FPIA 2EJVA 2QQ5A 1JWBB 2X9GA 3F3SA 4IUYA 1EUDA 3DBLA 3PIIA 5JY6A 1QYCA 4A10A 1LC0A 4M87A 4OJNA 1HYGA 3HE3A 3GVCA 3JQFC 5G0UA 1O89A 4Y98A 3WTBA 4UVHA 4QO8A 4E32A 2FSVA 5K9ZA 1U4SA 2I76A 4RGBA 4DTIA 1HKUA 1E0DA 2O7QA 4TKLA 5CEJA 3HFGA 4CMCA 2Q50A 5IF3A 3QA9A 5T5QA 4J4HA 4MVJH 2WE8A 4WECA 4OIMA 1KOLA 2XXJA 4XDZA 4J9VA 2BI8A 3LT0A 3E5RA 1IL0A 3KSUA 5KJEA 5BSEA 3AU9A 5JNLA 3L4BC 3SC6A 1PL8A 4UAGA 4OXKA 1ZJZA 2JHGA 3O03A 3BYZA 2AEJA 2X86A 3GY0A 1U3VA 3M2TA 4CR7A 1ML3A 3EGOA 1Y8RB 4BUCA 4CMGA 4BO2A 4BNXA 5HWSA 1ADCA 3GEDA 4I5GA 1Y7TA 4Z3DA 3AY6A 4Y6PA 3GGGA 3MJCA 1GEEA 1Q0HA 1BXZA 3GUCA 4ZN6A 4C4OA 2IZ1A 2JHFA 4IJKA 3SJUA 1AHHA 1XSEA 4BGUA 3EAGA 2YJZA 4DIOA 4DREA 5AQ1A 3BMOA 3X2EA 3WQSB 2X58A 3O38A 3HG7A 4FC6A 3TWOA 3M1LA 5H83A 2NLOA 2HMSA 2VHVA 4AJ1A 2F1KA 3ZW8A 1NXQA 2VUTA 5IDWA 2D1YA 1I3KA 3JV7A 4H7PA 1J5PA 1LLDA 3KUXA 4LSMA 3RUDA 5JFOA 1UP4A 2GRAA 1N2SA 1DC4A 1LRJA 3HB4X 4FJ1A 4XZ3A 5JC8A 4EITA 4KUGA 1JTVA 2VHYA 3GEMA 3WSWA 3UGKA 4Z6KA 4J3FA 5BSGA 3UVEA 4BNKA 2ZCVA 3H5RA 4NHEA 5L7TA 1U28A 3WIDA 3JQ7B 3UF0A 3IKVA 3D4OA 1XGKA 3QQPA 3GA0A 2YDXA 2BGMA 3I9KA 5CG1A 4WCFA 4TRJA 1VL8A 4L4XA 1NASA 4R9SA 5JCJA 1YGYA 4GH5A 3RWBA 2GN6A 4BO5A 4O59O 2VHWA 4ZQEA 1PQPA 5THKA 3C7AA 4FFOA 4AJ2A 1NVMB 4YJFB 2YHUA 4JJFA 4L73A 3GRPA 5BSFA 1X13A 1EVZA 3CSDA 4OSOA 2HMUA 2D2IA 4NU6A 3AY7A 5BNTA 1QSGA 4J4BA 3S2IA 1YJQA 4BL5A 4NH4A 3AUSA 3QVTA 1I01A 1TT5A 4WEOA 1ZMTA 2JL1A 2ZJ1A 4HFNA 4LW8A 4WOKA 4AJHA 2IXBA 1DFIA 1V8BA 4ALJA 2O48X 2VYNA 1HDXA 4WNIA 3IUPA 4F6LA 4PRKA 2PD6A 1E92A 4M86A 2PV7A 1KVTA 4OXNA 4ZQGA 2CF6A 3AY3A 4OMUA 2AQIA 4DUPA 5JDCA 4WCDA 2Y0DA 1ID1A 5I8ZA 3S1LA 2VHXA 3BHJA 1YKFA 2YFQA 3OIGA 1OFGA 4K28A 3U3XA 3N58A 1V3VA 1HE5A 3NJ4A 1Y9EA 1B26A 2X4GA 3GT0A 2W2LA 2C29D 3ITDA 4UVDA 4WE3A 5J23A 5JDCC 2D8AA 3VTFA 1FXSA 3HFSA 4PVDA 4R1TA 5TF4A 1Y6JA 2FRDA 2GZ2A 1NPDA 4GVLA 2DT5A 4MPDA 4WASA 4DMMA 4NFSA 3GMSA 3A28A 4W6ZA 2ZB8A 3PXXA 1NR7A 5KTKA 2VOEA 2PWZA 4J1SA 3AM3A 1PL7A 1UAYA 2P2SA 3V1TC 1DDOA 3WLEA 1LRLA 2HMWA 4NDNE 3FBTA 3E48A 4D46A 1N5DA 4GPD1 5L4NA 2O3SA 2X0JA 4BNNA 4K1LA 4BGIA 5JAZA 4R3NA 1ONNA 3GN1A 3H65A 2CNBA 1P1FA 1TLTA 3HNPA 3KYDA 3LYLA 3NDIA 4FSHA 5I9MA 2I3AA 5G4KB 4PZDA 2VT2A 1E6EA 1IPFA 4R5HA 4EUEA 2PR2A 2W2KA 3B70A 3D64A 1V9LA 1Z45A 1MB4A 3IIEA 4R5MA 4P8RA 1SAYA 4MDHA 2BGKA 2VWGA 4JXKA 3HDHA 2X23A 1HETA 1E7MA 1YOVB 2PA3A 5BNIA 1UZMA 4BNMA 4OQYA 4URFA 5U4QA 1C14A 1GQQA 4NQZA 5FWNA 1JVBA 4INAA 3MWDB 1I36A 1ONPA 3DAPA 3RROA 1PJ4A 3V8BA 1LQTA 3BTVA 2GASA 5DT9A 1L7DA 3GLQA 3FF4A 1RM5A 5LC1A 1UAGA 3QHAA 4IGEA 2YZ7A 3KBOA 5JC1A 4NFYA 3CXRA 4RF2A 1IOLA 4FD3A 2E37A 2CVOA 4RPHA 1NVGA 1NX6A 2AMFA 1HSOA 1ADBA 4ZVVA 1JWAB 4DQVA 4NJOA 3FR8A 4XIYA 5ICMA 2AHRA 3MCVA 3I4CA 2BH9A 3H4VA 3FNFA 4P4NA 3JD1A 4CMJA 5DF1A 1U7TA 1B8UA 3IC5A 4RL6A 5I7EA 1PS8A 1P77A 3JQFA 2V7PA 5FI5A 1HTBA 3GZNA 4Q3AA 4NPCA 4JBIA 4Z0TA 2DBQA 3PJFA 1E6UA 1HF3A 1T24A 4YAIA 3LVFO 1VI2A 5THQA 5HBRA 5IZCC 1XU9A 2W2KB 3I52A 2OORA 4AJIA 3OQBA 3OH8A 2UYYA 1P0FA 2GYYA 2HRZA 3OJ0A 3TOXA 3JYPA 3K31A 3DQPA 4ZGWA 3TL2A 3DAFA 5KJ6A 5IDYA 4HNGA 3ZU2A 3PJDA 4RPKA 3QWAA 2WSBA 5DCYA 4EZBA 1GZ3A 1PZEA 1ZK1A 2PH5A 1L7EA 5I7VA 1QG6A 2V6BA 1D8AA 3B6ZA 5JMPA 4XD2A 4EDFA 4GWGA 3H6KA 3INRA 4DPKA 5A9TA 3SXPA 1K6IA 3L9WA 2DQ4A 3NT5A 2BLLA 4JP2A 4LK3A 5TC4A 1BVUA 1UUFA 3ONEA 3GAZA 1ZK4A 4M49A 2ZTMA 5C5IA 4CMIA 3FNHA 2EKQA 2F00A 3AUUA 3ZNQA 4YAKA 1LXCA 2O3JA 4B4UA 1XEAA 1EFLA 4D3DA 4PLYA 4BO4A 3S2GA 4HV4A 3UCXA 4E5KA 1YVEI 1BXKA 3BAZA 1HWYA 4YT8A 3WFJA 3ZNNA 3GZ4A 3P5SA 4GX2A 2X8LA 3DONA 3V2UA 5L4SA 3VAZA 1ISGA 3X2FA 1M75A 3KEQA 5CPBA 1ENPA 3WB9A 2H6EA 4ESOA 3WQRA 4NMHA 4II2A 1Y5MA 3CINA 5L7YA 1KVUA 1ZK2A 4RQUA 1CRWG 2VYVA 5B1YA 5HM8A 1E3WA 3K2BA 1QR6A 2CDAA 3FR7A 4BNLA 2ZYDA 3IDSA 3VKUA 1Y81A 1PQUA 1E7SA 3I3OA 4ZRNA 4YWJA 4CM7A 4C7JA 1QRRA 1CIVA 2W4QA 1W73A 9LDTA 2DTDA 4GKVA 4DIFA 1ZZEA 1D7OA 1CQIA 5JMWA 3AW9A 4IDCA 5TSDA 4AICA 2Y1CA 2VNSA 1PZGA 3KXDA 3DTTA 4NBUA 5KVCA 4WCFB 4BNZA 3VHRA 2P9EA 3JQBA 1PGPA 4DQUA 1R4MA 2X6TA 1BGVA 3PTZA 3L6EA 1ZCJA 1I30A 5BQFA 5CDTA 1YXMA 1R0SA 3JQ7A 4R3WA 2PZLA 4R1SA 1Z7BA 1Z75A 1W0CA 3TJRA 1Z74A 2D59A 1PR3A 1UR5A 1XU7A 1X0VA 3BTOA 4GBJA 4A73A 4E5MA 4ND5A 4U0KA 3KB6A 1EUCA 1FMCA 5KOIA 1T1RA 3C24A 3JQAD 3DMYA 4BOYA 1YE3A 2O23A 4I5FA 1HE3A 1JN0A 1P1KA 1CEQA 3DDNA 2AE1A 1N7GA 4JBGA 4PLZA 3W6ZA 5U9CA 3RASA 3CKYA 4XR4A 2EJWA 2A4KA 3W4IA 1KEUA 1DC3A 3RU7A 2CDBA 3K9QO 1PJCA 5TX7A 3WQQA 4CLRB 2W2LD 1XG5A 2AEFA 1Y9AA 2C7GA 2HKIA 4D41A 1AXGA 3ST7A 3IOYA 1WDLA 1I2BA 2G5CA 4HFRA 5KJCA 3L4SO 2YW9A 4E2YA 4D0RA 3RBXA 3ZU5A 1UDCA 3ENNA 1I0ZA 1SO8A 2E82A 3DBHA 4R54A 4TQGA 4CLHA 5TIIA 4CMEC 3EZLA 4NK5A 5TJHA 1G0OA 3NJ8A 5C37A 4MIOA 2V65A 2FN7A 1PWZA 4IIVA 4MVJP 1VM6A 5H82A 3DC2A 4YJHB 3ANMA 2WYWA 1Z7EA 4UVIA 1HDOA 3QRWA 4D43A 3QWFA 1IB6A 3RUEA 1MG5A 2PD3A 2VCYA 2XOXA 2NQTA 5AXBA 5HTOA 4KOAA 2HK9A 3G0OA 3OETA 4L76A 5DDIP 1ZSVA 3WWYA 5T64A 4BO1A 4FW8A 4R16A 2AG8A 1MC5A 4NFHA 3QLJA 3FRJA 3GPDG 2TMGA 3WDSA 2BF7A 3DBVO 1F0YA 4FGSA 4WEQA 1R16A 5ILGA 1W6UA 3VZRA 3WJAA 3DAGA 4R69A 4BO6A 3OQ6A 3L0DA 4CM3A 4J7XA 3L9XA 2GZ1A 1R37A 2DUUA 1X7GA 1YL7A 3I6IA 3D1LA 1B0AA 4H16A 4CQLA 1GYPA 3ZWMA 2O3QA 1K2WA 1V6AA 4YEDA 2X9VA 3JQ9A 3ROKA 1JDJA 4YJFA 1IE3A 2QIOA 4BIIA 1PGQA 4Z0PA 1FF9A 2EXXA 4FFRA 4XJTA 3JQAB 1A9ZA 3GPIA 2Y93A 3PQFA 3PDUA 3F5QA 1U2DA 3PIDA 4BNVA 3ZNOA 1EEHA 4DYDA 2DFDA 4XYMA 3RSHA 2FR0A 1LBEA 3VH3A 4Q3NA 1I5RA 3DZFA 3PI7A 4GX1A 4YT4A 2Y1OA 5DN9A 2FOIA 2HUNA 3DO5A 3DOJA 4EYEA 3G49A 3L4BA 1DHTA 4L8VA 4WKGA 1H5QA 4NJMB 3TZ6A 5IDQA 3LT1A 1VRWA 4WJZA 4XQ9A 3ZV4A 1EUZA 1UZLA 4C7KA 5B4TA 5K6AA 3GZNB 4CMKA 4XEHA 4Y6SA 4AJOA 2DPHA 4M1QA 1HXHA 1KEPA 1LU9A 1EMDA 1KY5A 3WTCA 1XDWA 5AXDA 3TNLA 4BNJA 4TKMA 4XR9A 1P44A 3TZCA 5GZ1A 2GR9A 3GK3A 3IKTA 3MJTA 3UFXA 4BNFA 1VL6A 4BV9A 3KHUA 4E3ZA 1SB9A 4E6PA 4KDEA 4AJPA 1P1RA 2R00C 3AM4A 3VH2A 5I7FA 1QP8A 4CQMA 4MINA 4HNHA 4CMAA 1HE2A 1E3JA 1UJMA 1KBZA 1N1EA 1ZSYA 2CY0A 1LI4A 3EW7A 1ZNQO 2Y99A 5A5EA 2HLPA 2JKVA 3KM0A 5TQVA 1VE9A 5JO9A 3K92A 3ROMA 2O2SA 4UULA 1NVTA 1IPEA 1PSDA 4CLDA 8ADHA 2Q1WA 2HMVA 3FSRA 2DC1A 1NQAO 3O8QA 3OEYA 4YBZA 5EJ2A 3U62A 3VOSA 1TT7A 2AW5A 3E6AA 2FPGA 4UUNA 3RVDA 1KIFA 4IDGA 3EHEA 4ZA2A 3AI1A 3A9WA 4UUOA 1VSVA 3RUFA 2D5CA 3A06A 3I1JA 1DHRA 2EW2A 3AWDA 4U0JA 5JCXA 1H94A 1LDEA 1V3UA 4IMPA 5F21A 2GGSA 2G82A 3RFXA 4CMEA 1U9JA 4G5HA 3F4LA 5AVOA 1RWBA 4BKQA 4RORA 3PHGA 3BXXA 4M55A 4BGVA 4GKBA 2DKNA 4NBVA 4RF3A 3AM5A 5ENVA 3TSCA 3ETDA 1H6AA 4FB5A 4BHTA 4DC0A 2Q1UA 3V1UA 1LQUA 5G4LA 4J49A 3NAQA 3MWEB 1TEHA 4Z0HO 5JAMA 1ZK3A 2OFPA 1IY8A 1QXSA 2ZQZA 3PZRA 1R4NA 5DCWA 3WYCA 4EJ6A 4YACA 4BO0A 5I7SA 5JPIA 1D1TA 2VT3A 3GNTA 3JQGB 2PZKA 3N7UA 4LCJA 4RCVA 1A9YA 3DZIA 1ZH8A 3QVXA 4KUEA 3F4BA 4P4LA 3GHYA 4PLPA 2PKRA 3S2FA 5I8WA 4IQ0A 3NDJA 2ZIZA 1DRUA 3QWHA 2QRKA 2VHZA 1MGOA 2G17A 2J5RA 4N7RA 5EERA 3LLSA 4TSKA 3QSGA 4Y8VA 2VYVD 1MC4A 1DLJA 4CV3A 2D5AA 1BSVA 3WS7A 3UXYA 4YB8A 1GZ4A 4BVAA 5JSFA 4LGVA 4BB6A 3V5NA 2GLXA 1RM3A 2X5OA 1VKNA 1EDOA 1PEDA 2VWHA 2RHCA 4IJVA 4E5NA 3IAHA 3RC1A 4JLWA 3WGGA 1LSSA 4HKTA 1LRKA 3CTMA 1P1IA 5B12A 4XYLA 5IN5A 2IE0A 1BHSA 2Y05A 2IEBA 4JBHA 1Y8QA 4B8WA 5A3JA 2WE7A 1DRVA 1C0KA 4MOWA 1FDWA 3WGQA 1D3AA 3OHSX 1N92A 2OXIA 3DMTA 3VC7A 5JDIA 2HAEA 3BHIA 2X0IA 3RFVA 1N9GA 2HMTA 1PGJA 4MVJF 4XGIA 4PG8A 3IUSA 3Q1LA 4RVUA 1Z73A 3G79A 4YXFA 4KP7A 4YRDA 4M54A 1H6BA 4BNYA 4Z9YA 3GFBA 1ZEJA 3H5AA 3I83A 3WGTA 4L0QA 5LCXA 2C20A 3RCBA 4TVOA 5FEUA 2NU9A 2D3TA 1T2CA 3QJ5A 4PLVA 2PLAA 4N54A 4XRGA 3OMLA 1AHIA 4FJ2A 4F3YA 4WGGA 4TMFA 2CFCA 3I9MA 5L4LA 1PZFA 2WWRA 4LVUA 3ROPA 4U7WA 1P1HA 4IGFA 4B4OA 1ZJYA 1HDRA 4YAJA 4ZQBA 4I8XA 5JAIA 1NQ5A 3MTGA 5CP8A 1KEVA 4TRRA 4TROA 4F46A 4YJGB 2ZATA 4BKUA 4MKXA 2HDHA 2NTVA 4XGKA 4DLAA 4CV2A 1VPDA 2GO1A 1I8TA 4OM8A 5LDHA 3ZWAA 2WJPA 4LRTB 1T4BA 3BMQA 3KYBA 3T4EA 4MP8A 2AEMA 3U49A 2AG5A 4L9RA 1RJWA 1WWKA 1GV0A 2J3KA 2J3HA 4NK4A 5ITVA 4NNJA 4QQRA 2Q1TA 1XA0A 3WYBA 3BMQB 3FD8A 3RJ5A 1XHLA 5B37A 4IQGA 4P38A 1YB4A 3GR6A 3FWNA 1ZO8A 3OP4A 2CDCA 3M2PA 2NUAA 3ASUA 3JD2A 5TT1A 4DPMA 2CZCA 4WNCA 1K6JA 4R4JA 3ORFA 2VZ9A 1NFQA 3PGJA 4Z3KA 4CM4A 4DRYA 2DVMA 2Q46A 2R2GA 3P7MA 3S8MA 4FC7A 2BFPA 3GFGA 1N8KA 2JAPA 2OL4A 5EIOA 3WWZA 4RVSA 3QVSA 4IDDA 4R68A 1R6DA 3LF2A 3H9QA 2FWMX 5EINA 5IFLA 4BNHA 5B4UA 5K0ZA 3C85A 5BT9A 2QX7A 2Y0CA 4E13A 1H2HA 1G1AA 2Q2QA 1PS9A 2B35A 1UDAA 2PY6A 4CM9D 2X0RA 1PR9A 1Q2XA 1KS9A 2DAPA 2NU8A 5JXWA 3JQCA 4RDIA 2VWQA 2YHIA 2JFHA 2B5WA 1R12A 3D4PA 3U0BA 4B4WA 1GQYA 3FNGA 4J90A 1DO8A 4PG5A 4XYGA 4MVJI 5L9AA 4W82A 2HJSA 5F1PA 3N74A 4IS3A 3GG9A 2B4QA 2V6MA 5A02A 4YT2A 4W9NC 1NPTO 1EVYA 2OUIA 3I5MA 3C3XA 2FZWA 4BNWA 1MXFA 5G2OA 2EERA 4UREA 3H9EO 1HRDA 1X1TA 3PVZA 3R1IA 4IINA 1UP7A 3JD0A 3GNQA 1BMDA 3DZKA 5KKAA 1ISJA 4RLSA
chains in the Genus database with same CATH superfamily
3RVSA 3PD1A 3H86A 4DCMA 5DNWA 3KTAA 3COSA 3ONFA 3PC8A 2FPWA 2AKEA 3GIDA 4PZYA 3OX3A 1KVSA 1KY2A 1NONA 3PYXA 1ILWA 3K9NA 4HZGA 4UBOA 3HFRA 1IK4A 4B76A 3M4YA 3UMSA 3K30A 1QK3A 1UINA 1E0KA 2B5VA 3M4ZA 1FVHA 4P5PA 5BR8B 5AXCA 4D9MA 4H4DA 2NUBA 5HKKD 2R6CA 1AS3A 4JJZA 5TJ9A 1JNYA 4DS3A 4LYYA 2H9AA 1S2LA 2DT8A 1EP3B 1SKQA 1YUNA 1UFOA 3GUZA 4GWKA 3EGCA 4NZMA 1M1YE 2EDCA 3RANA 4DV0B 1J0DA 5LD2B 5F5NA 5CG2A 4D9KA 1I3NA 4O4LF 1O8BA 1PWHA 4GW3A 4BS9A 2BP7B 3VDMA 2QSZA 2P65A 4EJSC 4MR9B 4RPCA 2EOAA 1DE0A 3UB2A 4E07A 1S9DA 1R6UA 4I4NA 3G1TA 4YRLA 3ISVA 1RFLA 2WB2A 4DB4A 3HP1A 5TS3A 3DEHA 1MAVA 1XZKA 3IOEA 4RK7A 4C21A 4BQEA 5K2MA 3INNA 1U80A 3O92A 5T4FA 3HJNA 5FBWB 4F5ZA 5CNKA 2AOVA 3A27A 1R9GA 4PX9A 4COKA 2QK4A 3GLKA 2WWIA 1RS0A 3PLNA 5TT0A 1XXLA 3JR3A 3FPKA 2AG6A 2ZR8A 3PF9A 4XVHA 1MZPA 5AJTA 4BECA 4MVJM 5C3MA 3LYAA 3ZE0B 1NG1A 2C82A 2OGTA 2H2AA 2W2OA 3CKMA 2BCEA 4AKEA 5A0TA 3MOGA 2JDIA 1BRTA 1XHEA 2J4CA 2YZ2A 3AF5A 1CF2O 5TPZA 4ZHSA 4HVLA 1SOWA 3EH2A 3B7WA 4U8HA 2FVYA 1UC8A 1J1ZA 2B6NA 5AJZA 1N9ZA 4ODIA 1GHTA 3T0FA 1PVOA 1DC6A 2OHXA 2SCUA 1MQ9A 3DV9A 1MMFB 4MVWA 3KDPA 4K9NA 4KDFA 1P4JA 3PWZA 4M37A 1B3BA 4FFDA 5ALYA 3ESZA 4MV3A 2RC5A 5BXQC 1D1PA 2QMEA 4FILA 3I53A 3MERA 1GPNA 5G1PA 4AD8A 4MQFB 1V5FA 2P2CA 3COVA 1QK5A 2XMRA 1M2NA 2CVQA 2JBAB 2LP4Y 2NVWA 1K06A 3DE4X 2NNWB 4YMSA 5JYEA 1W8DA 1WL8A 2WWYA 3GUHA 4J2TA 4GMFA 3UAGA 4F91B 3QKWA 1C9NA 1GD1O 1MRZA 2IGBA 1RU3A 4PRYA 1CJVC 1OWMA 2IYLD 4Q9NA 4ZYYA 1YNOA 3BXHA 2FPKA 4HAUA 4LOAA 1DZIA 1PO7A 1WETA 1LDYA 4NONA 2RH5A 2JJ1D 1L5FA 1DXYA 1DEOA 3C43A 3IEUA 4GT1A 4X65B 2QTBA 1ADYA 1EPUA 3FOBA 2E1RA 2JAUA 3OFSA 3CRQA 3KWMA 1A7JA 3MD0A 1E5TA 2A5GA 4O4JF 4REQA 4IKOA 4WZAA 3D3EA 1GL3A 1RLIA 4K6CA 2B98A 1BROA 1EM6A 5I4KA 3JSAA 4IFIA 1VMKA 1URPA 2A0FA 3CVOA 1K1EA 5B1IA 1LSUA 2XWJI 3C6YA 1C9KA 2Z08A 4J43A 4DQXA 3OBIA 4E22A 4YXWA 1OB2A 3FTCA 4BQRA 1UP6A 1D0IA 3LY7A 4I36A 4UMFA 5A9SB 3CBQA 1M34E 3SP1A 2PVSA 3LHKA 5LNK1 4Z4IA 4MDEA 3HKEB 1XPOA 3H9JA 5CDHA 1W7AA 4TYMA 4JASB 3SZLA 2PPVA 5BMOA 2UXDB 4I14A 3HL4A 3RAJA 1MIOA 1ZI6A 4EX7A 4C6SA 2REQB 3Q3HA 4PHHA 4ZT3A 4FN5A 4FLMA 2YDYA 2CLKB 5JROA 1UOEA 1XCBA 2A9RA 1P74A 3K0AA 3FWYA 3IV9A 1S3SA 4NICA 4P08A 4U5XA 4X0EA 4O29A 3TMAA 1YMUA 3BWCA 4WVFA 4B87A 1Q7GA 1B3RA 5KTOA 9MHTA 4EBFA 5D8DA 1ZHHA 2A9OA 2WOOA 5B1HA 1BNCA 1YBMA 4J03A 3SYNA 4B31A 5KKCA 4DYHA 4PSCA 1VMAA 3FGPA 2PD4A 4YVFA 3MW8A 4D4JA 4OG2A 3F9IA 4I0WB 1KYIA 2CNWA 3Q6IA 4MQBA 3BSYA 2PZMA 3QM1A 3EEQA 4QXOA 4MV5A 3ZDQA 1FZTA 3QVJA 3QVOA 7GPBA 2GQ0A 1X1BA 2BF4A 3AJ8A 3BXGA 1U1IA 1MUUA 2AXQA 2FEXA 1TU4A 3TN7A 2MSEB 2ZPTX 5KYYB 5E38A 4CE6A 4X1KA 2ZBEA 4RSHA 2UUOA 4WLEA 4ZV9A 5JHHB 1JH9A 4HGRA 3SC2B 5LU8A 3OZRA 5BQ3A 2IW3A 4EM6A 3WR5A 4JJIA 4MS4A 3UPDA 2FP3A 2LIVA 4JI2B 1GR0A 3MLBA 4WOJA 5DN6A 3WKCA 5JNVA 3RRNA 1JKXA 2ZJOA 1D6JA 2AD5A 3OOSA 3EXFA 5F3DA 4Q7EA 4E46A 4WLOA 3A2MA 4HAXA 3WYEA 2ZRIA 4FSDA 5DKFA 2QW8A 5JRDS 3AEUB 2OXEA 1YQDA 3JD4A 3WXBA 3C2QA 5D87A 3CB4A 4FFPA 5ISMA 4FYKA 3EGEA 3QKUA 4LVNA 1M83A 5ED0A 4FU0A 1Q0PA 2CXNA 1XJ0A 1XRRA 1ULTA 4MJLA 1WVIA 1SUCA 4G0YA 2GUGA 3VQTA 2I2CA 4EG5A 3DGFC 1UZNA 1SBZA 2B1JA 2X9NA 1Z4MA 2ZWVA 1E0SA 1NBMA 2UAGA 3DMHA 1JKIA 2HSDA 3DR5A 1WPXA 3IAM1 4J6FA 4OXYA 5G0TA 4E94A 3DG9A 4OAQA 1TIKA 1G64A 3TGLA 1KZ6A 2Z57A 1XCLA 3EDOA 4BGEA 4D45A 1IMOA 1IN4A 1JP7A 3F96A 3I4FA 3QYPA 1V6SA 4TTIA 1HKHA 4NESA 4BFTA 4V1CA 1VYVA 4BLOA 4RLHA 4BGDA 1L7MA 2Y0BA 3UOAB 1LTHR 2RI0A 1KOFA 2Q3HA 3AP1A 4B79A 1YFJA 4EVIA 2VWPA 3KKPA 3RARA 1PP4A 3P94A 3N2IA 3HB5X 2QHXA 4KPUB 1FS5A 2AV6A 5DLPA 4DA7A 4PRLA 2J8ZA 3D3WB 1GOTA 1PJ8A 4I1VA 4WESA 1GPBA 1YWGO 2BGUA 3E1KA 3K1AB 3BL6A 1T10A 1TK3A 4AS1A 3TUJC 4PZ0A 1JG7A 1ZH4A 1ZICA 4PYLA 2WUEA 4JDPA 3AR8A 3GEIA 5ALEA 2RE8A 1QUFA 4LI0A 1IJKA 2HSEA 1T8TA 2PTHA 2BFEA 3IA7A 2H7YA 3O2NA 4NBTA 5AWFC 2BJVA 4CV0A 4LJ8A 4CM8A 4I19A 3S55A 2L19A 1R64A 3LNTA 4MO2A 2QTRA 2BI7A 2G1PA 3S1SA 5EUQB 3DE7X 1VL1A 1WUIS 2ETXA 4CNBA 2VQEB 1C29B 1DQZA 1NJ8A 4XWAA 4C4PA 2V7QA 5TQ2A 4EVQA 5BV2P 1OYYA 1T0UA 2ZRHA 5C18A 1PR5A 1RXIA 3WGHA 3CS3A 4X9XA 2VHCA 3FKSD 1FU8A 1K0UA 3W3AH 2MWMA 3KC2A 3NTUA 3ZY2A 1IZ9A 2WYUA 3O4JA 1GPLA 1Z83A 3ULKA 3NTXA 2A9PA 1CDZA 4KACA 3SEQA 3UICA 1GQOA 1FDIA 1HE1C 1LS6A 4Q9AA 3WGVA 5J4KA 5F52A 4RULA 4KCGA 3VNQA 4Q4CA 2VDOB 4QGSA 4DR5B 4RD0A 4AUEA 3FPBA 5HJ7A 1LLCA 3C1UA 2J07A 1QHGA 3IO5A 4MUJA 3WB1A 1QG2A 1SHZA 2VKTA 1V0JA 2IYPA 3RC7A 4CUZA 3FWZA 1A50B 2GCGA 1NMYA 3B2QA 3DC7A 3PC6A 2Q8QA 1AMOA 3VSDA 2NADA 3AOGA 1I4LD 5B2EA 3THXA 2IFTA 1L4FA 2FFHA 2ZSHA 4RUKA 2GEBA 3VR2D 4A5OA 5FI3A 4PANA 3DVAA 3LP5A 4UHEA 4R7GA 1UDBA 3B82A 1RQLA 1VBMA 2GWHA 3EZ2A 3AVYA 2OZLB 1I7QB 1SEVA 1XKLA 1JNXX 2D8MA 4KMOA 2A5YB 4A6EA 1GZ6A 3TG2A 3CEHA 1ECCA 4DIKA 2YNMC 5JNUA 1CF9A 2XB8A 4IY1A 1G5QA 1XWFA 2PX8A 3WHKA 3RUHA 4Q01A 2NQ2C 2BJWA 3VR5A 1WKVA 5JYDA 4BMNA 1ORTA 5KTNA 2WDZA 3CH6A 4LXHA 4TLBA 1J33A 1N5LA 3CUYA 1V7CA 1Z8NA 4W99A 2VQFB 2UDPA 5I5EA 2J6IA 2G76A 4DLWA 2JGDB 1E3QA 3L2OB 3UOGA 1GDDA 4E5SA 4FQ7A 1GFSA 3ZHQA 1U9ZA 2ONCA 1BJTA 2GZRA 4QE3A 2CNLA 4AJJA 3FTQA 3DTVB 2I1QA 1ML4A 2H7XA 3TD2A 1BTOA 2D1QA 4YJ3F 1AZLA 5JAPA 4HUJA 4MRNA 4AJ4A 1Z68A 3FJOA 1H2FA 1WMBA 2W6PA 1QFJA 1Y4UA 3WL3A 4DXHA 1LFDB 2SBTA 2CE2X 4IJMA 4ZEMA 1OKKD 2GT1A 3K9CA 4E51A 1XEWY 2IHTA 3WL7A 2JF0A 4PPNA 4RETA 5KKNB 1OXMA 2BKLA 3AYZB 1ZNYA 3JTMA 3KZXA 4X45A 1V7PC 3PUKA 3SYTA 2BM9A 4FNGA 1QKIA 5A5DA 3O1JC 3G0HA 2P4HX 3A6PC 1IBSA 4GC5A 4DA4A 2XWPA 5F3WB 4PC6A 3VTZA 4AMVA 4ZVSA 1FVXA 2QMHA 2JFVA 3JAWA 4ZI3A 3QENA 4XSHA 3E5MA 4RFSA 2ANCA 1P0IA 2ORIA 2P67A 3EPHA 1KIAA 4BQIA 1IWOA 1QYXA 4MIKA 4P86A 4ZOAA 5LP6C 1QE0A 4RM2A 3BSSA 3R7LA 1W1WA 4J07A 5E6RA 1W4CA 4UHDA 1J9ZA 4P4UA 5I9TA 4A0GA 1AMNA 2V74B 1GGMA 2Q99A 1GCOA 1XA3A 5C80A 3LKDA 9ABPA 2DULA 1XQWA 5ARBA 2XE4A 4CIWA 5INTA 4AZVA 3BXPA 3T54A 4BVEA 4IDOA 3EGVA 1QV6A 2OG1A 4DVJA 3SNHA 5BV8A 4B3CA 3HXTA 3D8TA 4CV1A 5EWLA 2BDTA 2YN4A 5DNYB 4ARIA 4CEIA 3V7UA 3FYSA 4RTOA 4BCDA 3OJOA 2PL3A 5BOSB 2IYSA 1ORDA 3EC2A 4YXWD 3GBPA 1A8PA 5I47A 3G2OA 1VDZA 3GN2A 2IUFA 5F2OA 3L02A 1P72A 2ZS7A 3KOOA 2GZ3A 1AQLA 2JRLA 2WG2A 1QC5A 4ND6A 4RY9A 5JSZB 3QVVA 3B5EA 1C4WA 2WILA 4HADA 4RNCA 3C3DA 3R6DA 1XOIA 1C0PA 3VAAA 1M0EA 1XMVA 3IGFA 1WZCA 3GW8A 2P9YA 1CEEA 2OBNA 5CVJA 1SUBA 5G0VA 3U4IA 2I0FA 3DR3A 3QPCA 3IV7A 1GGJA 1BDMA 4DY6A 1ZINA 2D4HA 4RADA 2W98A 2R6GA 2I6FA 5CEFA 1YV9A 5CXSA 2AVDA 3LC0A 1A9XA 1C0LA 4PPYA 2BGJA 4EW1A 4LYEA 4J7CA 1Q0TA 3IH5A 1AX9A 3C5VA 4ZYZA 4LRWA 1HE8B 1YE8A 3GO4A 4JBXA 2YL2A 1QYVA 2PLWA 2ZIVB 3GLTA 4HWPA 1O08A 1VIVA 3FZEA 4MRMA 4C0HA 3IHTA 2EKZA 3AI3A 4UNQA 3OURA 5HUJA 5LOVA 1OWPA 4IMJB 2H1IA 4OQLA 4YS6A 1GKYA 1JKMA 1TAGA 4KGZA 4REMA 4ER0A 4DEYA 4EAQA 3VKGA 2X5XA 5CHEA 1C3JA 3PSAA 1T9ZA 2CCGA 5K8LA 4QBFA 2YMPA 4WXPA 3DAHA 2WEKA 1M67A 3CPEA 3NAGA 5D84A 2GB4A 5FF9A 5AW0A 4TZ6A 1MNAA 2CW5A 3THYB 4RIEA 1PL0A 2J9FB 4TWJA 3WFIA 2JAXA 1E1LA 1YB6A 4I1IA 4P22A 4ZEXA 2ZT6A 3R6TA 4I9UA 5AVUA 5GZ3A 3B1FA 2CJWB 3UOWA 3L7IA 4DABA 1KKMA 3AP3A 4FYWA 4DEXA 4EFLA 2F8MA 2AVNA 3NTOA 2OHHA 1ZIDA 2X7JA 1W5EA 2ZJZA 2Z1MA 1GUFA 2PUJA 2ZYTX 1XAIA 3GJ5A 1BKSB 3I34X 4WPGA 4WNAA 5TMEA 3STYA 5I4BA 5KNDA 4FD2A 4L7VA 4OBEA 5LZ8A 4RVCA 1Z0IA 4AMBA 3EZ7A 2VP9A 2YYZA 3GJQA 4FT4A 4GR5A 4QYTA 1ZM3A 2ZJ0A 3DQZA 5EYPB 4A1OA 4XPIB 4Y7CA 4S05A 1JEYB 3USES 4EI2A 4YCNA 1GRNA 3HYNA 3I2KA 1LH0A 1DX4A 3QY9A 3JQGA 1YQXA 4HPWA 4ISCA 3F6CA 3WI7A 4EI7A 1Y98A 4WLUA 5H68A 3U4MA 1QGUB 4GXRA 3WRXC 5ALKA 1NW7A 3HEMA 2I54A 3FLEA 3CWQA 1S2OA 1ZOSA 1JEJA 3GNLA 4RZHA 1TAHA 2JPDA 2GEFA 4Q93A 3I6ZA 4KX5A 2BFWA 4QAQA 2EFEB 1OVGA 3RIGA 3H6HA 2POCA 4JIMA 1E9BA 3N0VA 4PIVA 4X7BA 1WULS 4C01A 4GNRA 3VR6D 3BTUA 1JYSA 2VH1A 4JIGA 2VHQA 1VP3A 3IPRA 4EGSA 1IHXA 3O4RA 4FYMA 4GX5A 4BLRA 5EL0A 3TR0A 4FYXA 4FZVA 2A3RA 2F4VB 2XYQA 4BN4A 3GU3A 4JOQA 4EFNA 5JD3A 4OX9B 4ITUA 3E3LA 1NNSA 3PHIA 2GM3A 4ACBA 5DGXA 3U09A 4XJVA 2XCRB 1WPQA 1NVDA 2NZVG 5HZKA 1A5ZA 4KLNA 1AK1A 2UZ0A 2ZB2A 5B6IA 3L8EA 2QZ9A 4O3FA 4EECA 5GV8A 1J2TA 3RYHA 5KCMA 2JLCA 5HK8A 3FTNA 5KYUB 1NBEA 4RIFA 3NH6A 1SVUA 2NNLD 3LLCA 3BXFA 5E0OA 3NWEA 2NMVA 1T1EA 4I4LA 2YRXA 3CH7A 3TO5A 4YCCA 5GOZA 4GGOA 5G4KA 5KSZA 4AWAA 1I3OA 2OFXA 4QIHA 3Q8MA 2QGNA 4Z4HA 1FMTA 3D7LA 4Z4QA 3RS5A 2EX4A 1G16A 4PAWA 5ADHA 4E2ZA 4LRSB 3JZMA 4HQ0A 1A5TA 1XUOA 3HC7A 2XUKA 4X8HA 4XRRA 5H1YA 1HZZA 2FPRA 2ZYUX 3A1DA 4M88A 4L4SA 4MWGA 5KTSA 3BD7A 4B84A 2OP1A 3V8NA 2B7LA 5M04A 2YWGA 2XOKD 5DCUA 4HEHA 4P6VF 2XF2A 1OX6A 2WKRA 5DBIA 3CWCA 4L85A 5DWDA 4CCAA 1IRXA 5LQUA 1N77A 1I32A 4ROTA 5CVDA 5ALJA 2H0AA 3FOAA 4WZAE 4UM9D 1GLNA 1MTZA 3L8GA 2O3RA 2RIRA 5T8KA 2QX6A 4DAOA 3WL4A 4Q39A 4DA8A 4O4LB 1WXDA 4PGMA 5MN5A 3KAPA 4MMZB 2I22A 1RI5A 2YYYA 3EWAA 2JLYA 2Q7OE 3HJFA 1KMNA 5HF8A 4MUFA 5LB2A 3K0FA 3S7TA 2ZYGA 3OCZA 4HWKA 4G8CA 1SHKA 1RYHA 4FN4A 4HXFB 1MJNA 4KIJA 3SX2A 5ALVA 5K09A 5KNCH 2HQOA 1M33A 2V6GA 4N9WA 3SICE 3FMIA 4QU9A 3NBUA 1KZHA 3R9XB 5BN1A 4AL4A 2CKMA 2JHCA 4DNPA 2MINB 4LYHA 2GERA 3E2PA 3MN1A 2ZRGA 3PP8A 1D2AA 2ZT5A 4MUMA 1AUPA 3MCAA 4TTAA 1ZI9A 1TI7A 5CB8A 4LGMA 3ONDA 4CLXA 3ML1A 3VU9A 1D6MA 2VK8A 3MJVA 2B4RO 1LLQA 3IP1A 1SIBE 5CT9A 3ZH9B 4IDNA 3VH4A 1XJ5A 4LIPD 5BRAA 5LLTA 1LBSA 1N8NA 3MJHA 1JHXA 1KO4A 1YMQA 3COWA 3WGNA 3ICOA 2RD2A 1OOEA 3LX8A 2HSJA 3AZPA 3OY7A 3R5FA 1XDBA 5CLQA 4N5DA 5TF0A 2P0EA 1PLJA 3OEWA 1L8LA 5LNK6 1LVGA 3J80A 1DNPA 4KQ6A 1GWNA 3LSYA 4HBGA 1GCGA 4I1SA 3NP7A 3OM1A 3CRRA 3TH5A 1DUSA 1CQZA 1TQHA 2H5IA 2CYAA 4U2GA 3W4JA 1KI1A 2B6HA 1DJOA 1ZJ6A 2W2QA 5HF9A 4KAAA 1C2TA 2VDMB 5GZ6A 4BVBA 3CHYA 1E79D 2UVPB 4U4AA 1BN7A 2CHEA 1DAGA 3L4JA 1YR3A 3EVNA 2RARA 1SA0B 4KPUA 4B8ZA 1RC8A 3AB3A 2VBCA 1H4VB 1DDGA 4XQCA 4M36A 2MHCA 4A5SA 1OXBB 1ESCA 2FPLA 3PUJA 3VNBA 4EZIA 3QI2A 3LF1A 4AJ9A 6YASA 5K0FA 3BZWA 1U2QA 1YS2X 2QTLA 2JFGA 5C5EA 3FPSA 1WV1A 4EW3A 4YCLA 2NW6A 2A9FA 1V47A 3RQIA 1CB7A 1VPTA 1BJKA 3MTDA 1XV5A 4JB3A 1ARZA 2GFHA 2RIPA 4RVDA 2X5KO 1ZSNA 2O0JA 4PXAA 3V4SA 2FDRA 2H00A 3PFNA 3VJMA 3W2GA 2XA1A 3GELA 4OREX 3I04A 3WLFA 3CH5A 1ZGCA 5JE8A 4QNRA 1R4MB 3F2VA 3JXEA 1Z37A 3M1AA 4MMXB 1SCDA 3DCJA 2HC9A 1AM4D 5TMBA 2O3UA 2V3WA 3OJXA 2C54A 2OR3A 4NV3A 4EZEA 3AF2A 5P21A 1AB6A 4CEHA 5EFZA 3LY5A 4FX2A 4MGKR 2OSVA 2Q45A 4KXMA 4RFLA 3QVWA 3DBLB 4X54A 3RS9A 4I3FA 1OR8A 1DXHA 4CQNA 5I7UA 3JASB 5DXFA 3LX4A 5GQSA 1D9ZA 1Y6GA 1Y48E 3JYHA 1BCRA 1KEEA 2KW5A 3H19A 3UWOA 4NOMA 2GCPA 1G2QA 2OB1A 5GMOA 2AJCA 3WNQA 3R8CA 2A5JA 5CFZA 3LUJA 2QAIA 3PYMA 1TJ4A 1NUSA 1T3TA 1FFYA 1JZQA 2F3RA 4YX9A 4Y1GA 2N46A 4CLRA 1I2ZA 3SXUB 1SZJG 4F7DA 3LUGA 1CJCA 5AKJA 3T4XA 1IONA 1O6BA 1QLHA 1E9AA 1BYUA 2E4WA 1C4XA 3FPHA 2F62A 4I46A 4IW3B 1MJHA 4CIVA 3MXTA 2ZSBA 5KSYA 1LDGA 4WUVA 3RFFA 3V6MA 2QZ4A 3ANLA 5CM9C 3PT9A 4J91A 1OILA 3V6LA 1BD4A 2DY0A 4GZ5A 3NXSA 1MJGM 2C2YA 4FQ8A 3RV4A 2ZI7A 1NIJA 1RYYA 3GBVA 1A2KC 4B3MB 2X42A 3NKVA 2GDZA 3E82A 3MRSA 5AM5A 2V7XA 1VJDA 1ZD3A 1GA6A 4N7BA 3WA7A 2XEXA 1V1MA 1IYZA 3KOUA 1YJ8A 3B52X 1QIGA 5H80A 1RWPA 1XTSA 2CB9A 2R7LA 1KK0A 2CXOA 4M9SA 4HTAA 3KBBA 1BA3A 5BV0A 1IIBA 1NZDA 4PU0A 3M4XA 4JLKA 2HOQA 2IY7A 3FPCA 1RWXA 4B80A 4MV0A 5B53A 1T0JB 1SXJD 3MM4A 2J85A 3K94A 3F7OA 3VVBA 3FWHA 3JWJA 1PT9A 4FGWA 4B4DA 4CUJA 2PYDA 4IFEA 3K7EA 2O9JA 3FW1A 2WJYA 4LZWA 4NLLA 3G5AA 3MJ4A 4GLOA 1AA6A 3PRYA 3LK7A 4MYTA 4MW7A 2Q8PA 3FPGA 3GGOA 3KXIA 3F8SA 4Q5IA 5ESDA 5AUPB 5JY1A 7MDHA 4CXMA 4WHMA 4AK9A 3CC8A 3OCWA 4FGKA 4FOSA 1UBEA 4IIGA 4MVJE 2COKA 2R5NA 1EHYA 4NEHB 1G4UR 4C5BA 3QPWA 3NHYA 4DR4B 5FX2A 2QT0A 3UHAA 5IXJA 1CUGA 3GUYA 3A1SA 3DVSX 3PA8A 2CEKA 4PO3X 4D44A 5BRJA 4RGYA 1N32B 3ZOKA 4F2DA 5LQJA 3O2QB 3U7EB 3JATA 2ZUBA 5KZMB 1QU2A 1CDEA 1NQVA 4MO9A 1NBOA 1ISHA 4ZVMA 5EJ6A 4ZOLA 5CT4A 5DK6A 4HY3A 4G0UA 2O59A 4ACAA 1FUYB 1U99A 3NWPA 4A0SA 2YQ4A 3OZ7A 4E1VA 1FYEA 1SOMA 3WRYC 1U7XA 3BRSA 4MRPA 3ZV5A 4BX0A 2F1HA 3GMIA 1JAXA 2BDEA 4G01B 4IZ6A 1W48A 4N03A 2KWIA 3QW2A 4ALKA 4U3JA 3CR3C 2PKEA 4RNDB 4KXUA 4DR3B 3KHTA 5AOVA 5KJ1A 3QKIA 3M8KA 3UXEA 4Z9BA 4GDMA 2X0FA 1G7CA 1J24A 2P2GA 2Q0HA 2QZJA 4LSGA 4NVRA 2LBPA 4BDTA 5BUSA 3AEQA 2O8DA 3O7MA 4JEMA 1ZUNA 1P9NA 4FMCF 4NZ9A 1TT5B 1ES9A 4EMTA 1NAIA 3TLAA 3WB2A 1F8FA 3ZGYA 3ZD7A 1NMXA 4PAGA 3HLTA 3U1BA 3FWKA 5BWBA 4PLTA 4Y2SA 5FP0A 3T9EA 3ZE1B 2HA0A 4PO1A 2UKDA 1YZVA 1W6RA 1A8SA 3B2NA 2J5QA 2ENUA 3IRVA 1TE2A 1PHPA 2VPXA 3LU1A 4B6OA 3T6KA 3H75A 3PDHA 4EGQA 3IAM6 3N75A 4EUHA 4I50A 3I1YA 3D6HA 3FROA 4JWKA 4KBGA 3FI9A 1SXIA 3EF1A 2V9CA 1L1QA 3IEXA 3T1HB 1S2MA 3OSUA 1GEGA 3EG9A 3TEMA 4C20A 4DG5A 3FFAA 2QGFA 5FH9A 1QYWA 2GBLA 1BH6A 3P0FA 3ZVNA 1XZNA 2R0QC 4JP1A 2IP1A 1TA9A 2H57A 2P68A 3HO8A 1OWNA 3OUZA 4M3NA 3M6WA 2O0LA 1DQRA 2AFHE 2BZSA 5CH3A 2KM1A 6CHYA 5KNCD 5E9AA 1E1RD 4IOJA 1DAPA 2YV1A 1JG4A 5H81A 1UXGA 2YR0A 4K2AA 1DSSG 1EK0A 1O6CA 2ZPAA 3DB2A 2V6JA 2OO5A 4X8LA 4C7VA 4CW7A 1DIRA 1D4FA 3H5IA 1SCUA 2HD4A 2QLJA 3HWRA 3IIMA 2Q2OA 4NS1A 1OBVA 1N0IA 3WG9A 1P4SA 3EDMA 2NZYA 2HF7A 3HUEA 4NXNB 3RKUA 2G9ZA 3DOHA 4BLUA 4Z7QB 1W0JA 4GS5A 4DR2B 5JMTA 1FZQA 2F67A 5DX8A 4DGQA 2QLTA 3CY6A 1N2JA 2J3IA 2FMIA 2I4IA 4X92A 3OJFA 2JCVA 4ZO8A 1GNTA 5J63A 3VSBA 3KX2A 1KI7A 1SPBS 2Y67A 4ZDJA 2ZR9A 1RLJA 1TIBA 1ZIXA 5REQA 3KTDA 3MF4A 1J70A 1QVVA 2AH5A 4KXYA 4ZXPA 1U0TA 1P17A 2VDWA 3R0ZA 4WOPA 4FDLA 5F4ZA 3WYNA 3OZCA 1P2BA 3HXKA 4RZIA 2QF7A 4ZICA 4Y18A 1DKOA 3GF4A 1GSAA 1LEHA 1ZXBA 4PRZA 1XR3A 1WABA 3OCYA 4QRDA 2ARKA 2Z95A 4YHBA 1IHOA 1ZAYA 4FOPA 4KXXA 4RVGA 5K0JA 2PGJA 3PX7A 4QTZA 3S5JA 1V2HE 2PRJA 4NBKA 4HZUB 4ZVPA 1CUUA 2QAGA 5FL7D 1PJ2A 2X0NA 3FCUB 1AGPA 4OP1A 3U4AA 2I3GA 1NP3A 4EY8A 5IJZA 3AUXA 4TPKA 4HXEB 3KRTA 2ZRMA 3OHPA 4BFWA 2QJRA 3ELYA 2FK8A 4I3HA 1GU1A 1GSHA 4LGCA 1CUFA 4F5DA 2CYBA 3WAKA 3SSMA 4DCGA 4LF5B 5TXGA 1YDWA 4UEJA 3HV0A 1Q0LA 2Q4BA 1TO2E 5DZSA 4D4IA 3PNMA 5AESA 2ZJ3A 5EPOA 4J9UE 5IKEA 1Y1KE 4EVRA 2WHXA 2Y0EA 1W76A 4DLSA 1DAOA 2GXUA 2QP9X 3Q3CA 5F33A 5K99A 2PS1A 5K01A 3KSDO 2HJWA 1K8RA 3NATA 3U7RA 4RVHA 1OB5A 3ZTTA 3U48A 6LDHA 1DKRA 3G5LA 4MYUA 2HSZA 4H17A 3K8YA 4EB6B 3P9RA 3F5MA 1Q6ZA 3A1VA 1N9KA 3D59A 3H2GA 4FDAA 4EYKA 4MAFA 5ALLA 1V7ZA 3V1MA 1TCBA 5K0EA 1IJBA 1AOXA 5JIBA 4XWWA 1RKBA 3OOEA 1PZXA 6PFKA 1GAJA 1HDCA 1YJ5A 3PC3A 2JD0A 2VJOA 2YQZA 4PLFA 2DKFA 3D3NA 2FF7A 4PZUA 1UJ4A 4FM9A 3LL7A 1FEZA 2SKDA 5CA0A 1ZKMA 2CBXA 3OQMA 3F1KA 4FHZA 1HYHA 5IWCA 1AKYA 1J0XO 1VMDA 2WP0A 3W7VA 5HJ5A 1O0SA 3L1JA 2HXSA 5EPEA 4YIKA 3RC2A 2CVZA 1EDZA 2FSFA 4XQGA 4HLCA 1Q1QA 1N6LA 3H3JA 3PDIB 3TR5A 4KGVA 2X8AA 1ISIA 2VJLA 2Y92A 2QPOA 1FFXA 1A9RA 4M0MA 2TYSB 4JQSA 3GLVA 5JCOC 2QN3A 1X74A 3ZE7A 5KUTA 5JQGF 1YIAA 4HBZA 2VTBA 4K6HA 2R25B 1CETA 1PK7A 1FJHA 1KZ7B 2QE6A 3H2IA 2YVUA 2Q3BA 1FFHA 3A9TA 4Z8YA 1A8IA 3WNCA 3ZHZA 4AZ0A 4DSZA 4ZHQA 4BMSA 4BLQA 3KEFA 2ZB3A 2IZZA 1OH6A 1E60A 4S2EA 3S44A 3A3YA 4LJAA 5D7NA 1NAHA 1Z82A 4IVQA 1BDBA 2FSIA 4RH0A 2X4DA 1TVCA 4B9EA 2QRNA 5AUOB 1XDZA 3EIOA 3P26A 5KX5B 2JAHA 1Z6XA 1XYVA 4HOYA 4JN6B 5DRYA 1AZTA 2IWHA 2EZUA 3EXFB 4E7OA 3ZV3A 4UTVA 5KYGA 4CG1A 2HMYB 2Q1SA 3G3EA 5AI8A 2FXIA 1KC3A 1YOBA 5HA5A 5TEVA 5M5BA 3H11B 3ZWPA 1FDVA 3WNDA 4ICIA 3V4PB 5FTNA 3BMOB 3TBFA 4D9IA 4U6QA 4QKQA 2IU4A 1CB0A 1XNJA 3O4GA 2XQVA 3WRVA 1KEKA 1E4EB 4KXNA 1TYAE 1A76A 3CX8A 3T7KA 3SX0A 1SVIA 5IM4A 3TJZA 3FWPA 4GRAA 4PFJA 4IJ5A 2IXAA 4US1R 2PANA 1G8SA 1NKVA 1S7GA 1TKAA 3TMYA 5JLJA 1B8OA 1ODJA 5DPMA 2GHRA 1BHQ1 2HY7A 4JCCA 3S29A 1G5RA 3KR1A 5LQKA 4PLCA 2YV3A 4CQLB 2C8VA 2PVPA 2J6HA 2V7VA 1RJ9B 4XX0A 4YASA 4JLNA 1KP3A 1THTA 1IFXA 4XWTA 1TECE 1FC0A 1JLLB 2AWOA 4MKZA 2FGKA 3THWA 4B7CA 3BCSA 1ZONA 1U7WA 4DCOA 3IDOA 4GYWA 2PGLA 2C8KA 1YS6A 4YRBA 5IVKA 2P5YA 3NBXX 4MA0A 3DEKA 2GHTA 4BJ1A 1H9CA 3BGIA 4GQAA 3SF8A 3IUJA 1V6CA 2JD1A 3AI2A 2FHPA 5CD9A 2KYRA 1D04A 1JVNA 3SQXA 1L7OA 4QPZA 3QE0A 1YK0A 3T3GA 3WGYA 5FUMA 2E0IA 2IX9A 1NWHA 3QJGA 2WKWA 3RG8A 2R7AA 1JHOA 2VJYA 3S8YA 1KDZA 1Q3HA 1OLXA 1R5OA 2WM8A 3NOXA 1ZCAA 5BNFA 3HK2A 4TXNA 4A8TA 4ND3A 2ERXA 2GOYA 2QVLA 3MHPA 4J1QA 4LS3A 4RLQA 4UEOA 4YRQA 1EKXA 2AJLI 1R8XA 4Y9SA 1E98A 4TTSA 1UBHS 3PUWA 3NWJA 1TZBA 1NQUA 3O73A 5FBKA 3S7ZA 1UXIA 3E22B 4UEWA 4ZV4A 1UWLA 3LKZA 3EEYA 1QIMA 2ZGVA 1E1CA 4BBAA 1E1YA 2XD4A 1GYQA 1MAWA 3D6NB 4E5YA 3ETJA 1Z5NA 2IF0A 1RIIA 1NQWA 3L6UA 3EYWA 2Y1WA 2XNSA 4X93A 3LTNC 3IQGX 4GFDA 1KJZA 5E7JA 3PRJA 2FCRA 3R0VA 4HPJB 4ZQHA 3SN6A 2O8VA 4O2RA 1EWVA 2C5AA 3I0NA 3BL8A 4BFLA 4HNAA 3D0OA 4GXQA 4Z54A 4MUYA 2NM0A 4LHVA 3HCBA 2JIRA 4HVTA 1C41A 2JLZA 4ND1A 5E1DA 2Y2VA 1T8UA 1HT3A 2E5FA 4U6NA 3CIOA 1L4YA 1O6GA 4OL9A 4AX8A 5IT4A 4Z4GA 2O2ZA 3DBIA 1UOOA 4FFBA 5EG5A 4QXMA 4A6DA 1TXGA 1WCXA 1WKBA 1PJQA 4B6PA 1QBGA 2AXPA 4WJKB 4CM6A 4X20A 4C4ZA 1U7PA 2OSBA 2ID8A 1TVKB 3B1KA 3E70C 3H9BA 2OD9A 1Z7WA 4QTUB 4R1OA 2C7BA 4YCBA 3D0KA 3ZYCA 1UXHA 2BHLA 1FP2A 4U9HS 1LK7A 3TXYA 3W2HA 2RB5A 3ZZNA 4OKNA 3GG2A 4IRXA 5DM1A 4F3RA 3MLAA 2PZJA 3N39C 5EZSA 1IG0A 2DPMA 2UYOA 4DMGA 1BMQA 1N3LA 4DL9A 5C7LO 3HKCB 2GSWA 1HTTA 2ZDQA 2NXJA 2OAEA 1RI2A 1M2WA 1E4YA 4UTZA 5J4HA 4HXYA 4Q4AA 2IU3A 4NF2A 1VHLA 4W5QA 1JHRA 4ZDWA 4UASA 4H0CA 2RG1A 1ZMOA 1RRPA 3VZDA 2IF2A 1N1MA 4QFBA 4XXHA 5JWHA 4BO3A 3AKEA 4DDUA 1EESA 1Z5ZA 3FIUA 1IOVA 4ZQFA 5FCDA 3B78A 3ORSA 4N5NA 1QQ7A 1F6DA 1GRQA 3NUZA 3LQFA 1TF2A 5G02A 5CMLA 5H9VA 2PSJA 2AZ4A 1K86A 3LC2O 1XU4A 4FR5A 4MRRA 1YD7A 1IULA 4JUIA 3NEYA 4V0QA 5CAEB 2EBUA 1ZD2P 2WZCA 5JBIA 1F06A 4PTYA 1H42A 1E77A 4GZLA 2FR8A 1NL3A 4R7TA 4PC3A 2YV2A 1GTSA 1S96A 4B4VA 2CKDA 2IYTA 4N4AA 3S99A 2C1ZA 1NDHA 4RMIA 4BMDA 5HRUA 4CCYA 2VP6A 1G2OA 2DRIA 2VNAA 4LDQA 3NHZA 4HDSB 4J94A 4Y9TA 4G1EB 4HPXB 4RW0A 5ITZA 3SQMA 4TMZA 4IHJA 1P8JA 3Q87B 1KAEA 4BMVA 1G8FA 4NRDA 5IN4A 3Q40A 1DMRA 3CF6R 2WD7B 2F43A 3EF0A 3A4LA 3CB2A 1SK8A 4N1AA 1JEOA 4CG0A 3DFIA 1G98A 5LA6A 4R2IA 2N3ZA 4PAOA 3KTFA 3AESB 4RTQA 3A6HA 3OCUA 2Z2YA 3OQJA 3VH1A 1G6Q1 4BEWA 4EDHA 5ILOA 1NMSA 5DTMA 3BX1A 2NZJA 4K9LA 4M0FA 1JSZA 4KZPA 4LXYA 3PL5A 3WHIA 1U7OA 2F17A 3F6YA 2ZANA 4L4UA 2FPIA 1WMFA 1XMOB 1XMXA 1V1RB 2X9GA 1UIRA 1F60A 3QPAA 1AKMA 4NQRA 3HCAA 3OFVA 3FRIA 4IUYA 5FWXA 2HIGA 4QUHA 3HKBA 4N8SA 4RQBA 3PIIA 4DA0A 1OI2A 3H8WA 4AF6A 2LPMA 1DAKA 4M87A 4OJNA 1HYGA 1T6BY 2YY5A 4HDRB 4JT9A 2YCLA 3NDBB 3JQFC 1IVYA 5G0UA 2JS7A 3UFBA 4Y98A 4WA8A 4HH1A 2VJCA 2VRWA 1HDEA 1WSDA 3RR2A 3WTBA 4GI1A 2ONYA 2FSVA 4X5OA 4BY9E 4UMVA 4HH4A 3SE7A 1Y7HA 2XUZA 1CS0B 1V2GA 2FFQA 3UV3A 3D0QA 3K53A 1HKUA 3WE7A 4PFQA 3RE1A 3TSOA 4DTIA 4XSGA 3T52A 5FPQA 3KIPA 4P0TA 4EJSA 4EG4A 3AR2A 3H1EA 5HKOA 4IXNA 1EFDN 1SWWA 4GGMX 2G07A 5JV5A 1ODKA 3Q5GA 4QPNA 4MR8B 4WECA 5EFOA 4NZZA 1TQ2A 1DKNA 5EE9A 1KOLA 4BX2A 4XPZA 4YQFA 5BW8A 1Y6RA 3KSUA 4FYVA 1FBNA 1ZRNA 3AU9A 1W4BA 2RCNA 3RRJA 1Z4IA 4OXKA 1C2YA 2PWBA 2R1ZA 3DV0A 4PGGA 1J42A 3BYZA 4U7GA 4AG5A 3HWWA 3B1ZA 3H9CA 4TYQA 1GO2A 2ZSEA 4M9UA 3R0XA 5IVIA 3ZJTA 2A0XA 1NC3A 1Y8RB 3EGOA 3TB6A 5A4MS 1E9EA 1Z0UA 1ADCA 5HWSA 5EIFA 4DIUA 2NAFA 3SXUA 1Y7TA 1NVXQ 4H2DA 2HYDA 5D5HA 4RZ2A 4Y6PA 3GGGA 3N8HA 3IMGA 3MJCA 3N2ZB 3GUCA 4ZN6A 3C8DA 2XVXA 4FNOA 2GEJA 3UPTA 4NC9A 4IJKA 3A6DA 1AHHA 2UVQA 3RVMA 3SJUA 4BGUA 4GP7A 3W2EA 1UQTA 3TX6A 1XLWA 5KNBD 2I1LA 3FMGA 2RK6A 3F7MA 3AHDA 1QGDA 2OK7A 3MTBA 1ZVVA 1IM8A 2WIDA 5FI1B 4AJ1A 4YAOA 4TV9F 1VFNA 2WPDA 5H3HA 1R0CA 3JV7A 4H7PA 4DV5B 2QSJA 2VPIA 3Q7PA 3PEYA 1ABFA 5HM6A 3OD5A 1LLDA 1A95A 3KFVA 3KUXA 4OP3A 1RQGA 5AOAA 1N25A 2BEVA 4IHJF 1NF3A 4YRTA 2X2EA 4Q4HB 2V3CC 4MYCA 1N2SA 3MT8A 2VZLA 3TEFA 1G19A 3HB4X 1L4EA 1XRSB 2EBFX