1EDOA

The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with nadp+
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
244
Chain Sequence
SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLALSPAASYITGQAFTIDGGIAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
publication title The X-ray structure of Brassica napus beta-keto acyl carrier protein reductase and its implications for substrate binding and catalysis.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
total genus 84
structure length 244
sequence length 244
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2000-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1edoA00
1NWCA 2E6UX 1F0YA 3CMMA 3JTMA 4GLOA 2H6EA 4UEKA 3NTQA 2WD8A 2BD0A 2EKQA 1TLTA 1YS4A 2ZB4A 1C0IA 1QRRA 3DBVO 1AN9A 3NTOA 5CDUA 4CM4A 4R1NA 1LBEA 2X58A 3MWEB 5C37A 4OOEA 4RCVA 1BHSA 3ZWYA 1H93A 3PIDA 3WGOA 4P4GA 4TMFA 2FN7A 2VNSA 3ZHZA 3F4LA 1PZEA 2C0CA 4TRMA 4BO0A 3DHYA 4PVDA 1PJ4A 4RL6A 3PHLA 2I76A 3LC7O 4NBWA 2IZZA 1KEUA 3DB2A 1ISGA 4GWKA 1I24A 4GMGA 5EIOA 2NLOA 1I33A 2OP1A 4ALKA 3K96A 3RBXA 1NXQA 5LCXA 4D7AA 3WTBA 3Q2KA 4Q3NA 3EYWA 3K2BA 4HKTA 4BIIA 4NFSA 1KVUA 1A9YA 1IUKA 4RPGA 3TF5A 2P9EA 2OFPA 3RUAA 1G0NA 1W8DA 3F4BA 4XJTA 5ICMA 2EHDA 2OMEA 3GUYA 4CM8A 1PJCA 2HDHA 3TPCA 1D1SA 3GR6A 4HNGA 5H81A 1DFGA 1G6KA 5I9LA 3HG7A 2YV3A 4R1UA 1E7MA 4MOWA 5DT9A 4BQPA 3O03A 2X4GA 4A26A 2RAFA 3KBOA 4FFPA 2J5KA 3RAJA 3SC4A 1TEHA 3I6QA 1SCUA 2YUTA 4WCDA 1YONA 4DPLA 3EVTA 1FJHA 2D8AA 1DC3A 4WNIA 2J8ZA 4BO4A 4WKGA 2ZB3A 2X5JO 1B0AA 1TI7A 3OBBA 1ZEMA 4HXYA 4MP8A 1QV7A 4PZEA 3BHJA 4Y98A 4DREA 3PI7A 2VRCA 3IJRA 1LRKA 1A27A 1O94A 2W98A 4XQ9A 3WBBA 1G0OA 4CLOB 1N1EA 1ISFA 2VYNA 4RPLA 3RUHA 3ZU2A 3HJAA 4IQ0A 3LU1A 2DKNA 3JQFC 2ET6A 1EE2A 5G2OA 3BMQB 1LDNA 3KSUA 4CQMB 1MFPA 1YJQA 3KHUA 1U2DA 3OH8A 1LLCA 1ZK0A 2G5CA 3D3EA 4B7XA 3FSRA 3LK7A 3QW2A 1U7TA 1AE1A 3DZJA 2E4AA 5COBA 3HSKA 3KB6A 4I5DA 3WGHA 3D3WA 2ZYAA 2P68A 4BHTA 1KVRA 3GRPA 1LDEA 3K73O 2EP5A 1E7SA 3LQFA 4A7PA 4PGFA 4LK3A 1E3EA 1IOLA 4CUJA 3BTSA 2C59A 4NFHA 3HE3A 1BVRA 4S1VA 1I2CA 2RCYA 3U9LA 2VZ0A 4NJMA 1YL7A 2PK3A 5TRTA 5HRUA 3OICA 3ASUA 2NADA 3L0DA 4XR9A 2O4UX 2WD7A 2B4RO 5JCXA 1PJ2A 1PS0A 5BSHA 2JD0A 1GYQA 1GADO 2LDBA 4U8GA 2GZ3A 2BF7A 3OSUA 4ITUA 1VL8A 1E3WA 3U3XA 4B7CA 1Y6JA 2NVUA 2D5CA 4EUEA 2P4QA 3B6ZA 1I8TA 5TF4A 2WWRA 2AMFA 3DZGA 2E48A 4J2OA 2NSDA 1P1IA 2ZCUA 5THKA 2UVDA 2Y1FA 3ZHXA 4DIBA 4Q9NA 1B14A 1Z73A 4UUOA 3WFJA 1HTBA 3V2HA 2RH8A 4DIFA 2AXQA 1I36A 5EQFA 4UUMA 3OM9A 1LA2A 3W4KA 3JV7A 4JP3A 4RVSA 2E82A 4ALNA 4YJGB 1SBYA 2WSBA 3DHEA 3VPSA 5DDIP 2DVMA 3VZQA 3DZBA 3RROA 2X9NA 4KUEA 4K9DA 1N5DA 2X0JA 3GNTA 3WIDA 1OAAA 4E5MA 1MG0A 5DULA 3WMWA 4KDFA 5CDSA 1YJ8A 3EY4A 1NBOA 2GZ2A 2VT2A 3NDJA 3NKLA 1DRWA 4KTTE 3E9QA 2DU8A 1K6JA 3EZYA 4TVOA 2W2KA 2BFOA 5CP8A 3MJVA 5T57A 4E13A 3S2EA 2NQTA 5LDGA 4PLTA 3VPFA 4EW6A 3KXDA 4B4UA 3DAFA 1KYQA 3UCFA 2ILTA 3O8QB 5TT0A 3ZV6A 4BOYA 2X5OA 3CH6A 1C14A 3SJ7A 2A92A 3ZU4A 3L77A 4FBGA 4ZGWA 3WWZA 3NDRA 1I2ZA 2VHXA 3AFNA 3HDYA 3V1YA 1SAYA 5ENVA 3ZI0A 3VDQA 3C7AA 1E1LA 6LDHA 2CFCA 5ES3A 4PG8A 2CVOA 4TKLA 2PKQO 4EUFA 1KY5A 2FP4A 3S1LA 1YXMA 3K2EA 5MGBA 1A7AA 1HYEA 2JFGA 3VZRA 4E5KA 2Q99A 3WWYA 1V3UA 2DFVA 4OHUA 3D3WB 1I30A 3RQSA 3JQ9C 3VH2A 3HB5X 4TROA 4DYVA 2V6MA 1D4FA 3WB9A 3C1TA 3HFSA 4TQGA 2Y66A 1NNUA 1R15A 4Z3KA 3TJRA 1MP0A 1XQ6A 4BVAA 3DFZA 3SVTA 5JBIA 4BKUA 1YB4A 2CVQA 1PEDA 3FR7A 1C1DA 1E6WA 3BMCB 4OQZA 2AG5A 4PLWA 3N7UA 4E5PA 1YL5A 1IYZA 2DQ4A 2J5RA 1DRUA 4ZQEA 4XA8A 1LLQA 2O7QA 2Z95A 1EK5A 3AWDA 3GA0A 3LYLA 1M75A 2XAAA 2G0TA 1C0PA 4NQZA 4WGGA 3ZGYA 1P77A 1HYGA 4MP6A 4QO8A 2DUUA 4HX5A 4J91A 1XEAA 2IDZA 4CQMD 4R69A 4CR6A 1ZXBA 3U4IA 4XYGA 1U3UA 1VKOA 4O1MA 4YJHA 2X8LA 2NWQA 4MVJF 4OSPA 2X7HA 1H9AA 9LDBA 1HE5A 3JQBA 4KWHA 4LCEA 1VL0A 5BSGA 2GD1O 4C7JA 4E2YA 4HFJA 3G3EA 2FR1A 3QWBA 2QRLA 1UDAA 4LVCA 4ZQHA 4XGNA 4CLRA 1PSDA 3VTZA 3VTFA 2J3HA 2GERA 3AM4A 3KOUA 2R00A 4J3FA 4E21A 4EBFA 4ZQFA 5FI3A 4OXKA 5L95A 4HFRA 2IE0A 2OORA 2ZKLA 5B37A 2V7PA 3PIIA 1OBFO 1Q1NA 5L3ZA 3KRTA 4UVGA 3JYLA 3ABIA 1Z82A 4YA6A 1UAGA 5TLSA 4PRLA 2IRWA 2GSDA 4CM1A 3CIFA 4I9NA 4KZPA 3WYCA 1O89A 5F1PA 3QRWA 4E33A 1DFHA 4R68A 2VHWA 4PLGA 4B3JA 1AUPA 2Z5LA 1DIGA 1HXHA 4II3A 1CF2O 4IZHA 3A28A 4R16A 4JCOA 4D46A 2DFDA 3ZU3A 2ZYDA 5TJHA 4E4YA 4W4TA 4XQEA 3ZWWA 1XDWA 1ZJYA 1P1JA 2G82A 3AOGA 1RM5A 4RLHA 1I01A 3JYPA 4BO9A 2O2SA 2WTBA 3WOHA 1DIRA 1ENZA 5HA5A 1HLPA 2OHXA 4PN3A 3DBLB 4BNIA 1BWSA 3PEFA 4JJGA 5A02A 3WYEA 5KIAA 4HP8A 3R1IA 5U4QA 3U49A 4CM9A 3INRA 3KEOA 1BDBA 4U5QA 5I9NA 3UGKA 3KETA 5IN4A 1YWGO 3H9UA 4PLFA 4A10A 5KTKA 1B7GO 3F3SA 4NK4A 2HO5A 4PLCA 2NV6A 4BNWA 4ZD6A 1LSSA 2PKRA 1P1HA 4AJOA 2AHRA 1DHRA 5G4LA 1NVTA 1SC6A 5ENDA 4QXMA 4PFJA 1ZBQA 1UZNA 3H5RA 5A9SA 1HWYA 5KKAA 3HADA 3ZZNA 5DCYA 2YZ7A 3WGYA 4XQGA 3UOGA 4B79A 2O2YA 4FC7A 1EFLA 3AFMA 2Q1WA 4P8RA 4M54A 1TB4A 4TWRA 3OJ0A 4EGFA 2VT3A 3Q9NA 5LDHA 4QT0A 2OO5A 3QP9A 1I3NA 5F5LA 3WG9A 1P45A 1H6BA 2PD6A 4ND5A 1OC4A 2GR9A 1T4DA 1X7GA 2HK9A 4OXYA 3GK3A 2R6JA 2Y05A 3ZWBA 1SNYA 4JXKA 5IXSA 3RBZA 3IMFA 2VQ3A 5HTOA 1ZO8A 3KSDO 2C7VA 2GASA 1LDBA 4ZICA 3FNFA 3GNQA 4ND1A 4PCVA 1WMBA 3PJDA 2PZJA 3AY6A 4KWIA 3JQGA 1ML3A 1Q0QA 3GMDA 4LRTB 3M2PA 1Y8RB 3FNGA 1HF3A 1NQ5A 4J43A 3GT0A 4WUVA 4RQTA 3GLQA 4K28A 3KO8A 1DPGA 4YEDA 4WEQA 4MVJE 4DMMA 2YFQA 1EFKA 4ZRNA 4X54A 1DAOA 5C3MA 2AE2A 3DOJA 4J0FA 3A9WA 5CDGA 2VWGA 3MTGA 5JDCC 3RWBA 5KVSA 1TA4A 3JQBC 3T4XA 1MV8A 4C4OA 4WLVA 1ADGA 3ONFA 3QIVA 5BT9A 4HFNA 4MPDA 4B3HA 2HMUA 4BQRA 2DC1A 4BL5A 2PA3A 3DBHB 5T67A 4EJMA 4NDNE 3IUPA 3K9QO 5JXWA 4CUKA 1JVSA 3IJPA 4XWYA 5TC4A 3ORFA 2HRZA 1LX6A 4J16A 3AM3A 4J1NA 3D1LA 1IHYA 2PKQP 4PLHA 5A9TA 3DONA 4Q3CA 1Q7GA 3W8FA 1ONPA 4PG7A 3WGZA 1O0SA 2RHRA 5HWSA 1HT0A 5FF9A 3ADPA 4B8ZA 1JVBA 1I3LA 4Y9DA 4XD2A 1FK8A 2JD2A 4LVUA 4CM6A 3OJLA 3GZNB 3RJ5A 1YQXA 4XYEA 5C7IO 2J3IA 1WDKA 3PPIA 3KEQA 4MVJD 5A5FA 2NQ8A 4GL4A 4Y8VA 4Z3DA 5K6AA 3G17A 4DUPA 1HDYA 1WZEA 3MOGA 4BKPA 1R4NA 2X6TA 5COQA 1PS9A 4GWGA 1AXEA 5GZ6A 1E7WA 1XR3A 2JKVA 2HLPA 3M6IA 1UZMA 4HUJA 3GEDA 4DBZA 4DLBA 3P19A 1W4ZA 5JCJA 3AUAA 4BB5A 2Y1CA 1Y9EA 2O3SA 3H9GA 4RZIA 2I66A 1F17A 1QKIA 1U8XX 4YRBA 2GLXA 5T5QA 1NPDA 2Y1DA 5HM8A 1BXGA 3GVIA 2J3KA 2X23A 3MZ0A 2A94A 2AEMA 5AXDA 1LDYA 4HWKA 1NVMB 3GGPA 4LSMA 3AOEA 1MGOA 1MXHA 3PK0A 1M67A 4DQUA 4GBJA 1C0LA 1D7OA 1T24A 3P5SA 4A0SA 2BFPA 1K6IA 2H1SA 4WNCA 1E3LA 4NBRA 3AI1A 3ROPA 5MDHA 4R3NA 4FFLA 1ISHA 2OL4A 2VZ8A 3DQPA 3O38A 3KZVA 1DJNA 1WMAA 4CUZA 5C7LO 4AJJA 1JQBA 1PL7A 5JSFA 5JYDA 1QYVA 3MWDB 3ST7A 3L9XA 2VOEA 5G0VA 3AUTA 4OYRA 1K6XA 1YBMA 3WNQA 1WW8A 4DC0A 1X7HA 3ONEA 4FJ0A 3OQ1A 5JDIC 1T2EA 2B5VA 3EZLA 2QX7A 3NJ4A 3RC2A 1NASA 3TL3A 3W8DA 4KUGA 5KJ6A 4P4LA 2QQ5A 3C3XA 2DT5A 4YBZA 1NPTO 1R0SA 3SBOA 4DYDA 5GY7A 1U1IA 1FDWA 2Q1UA 3FD8A 2CSUA 3JD0A 1DIAA 1SO8A 4IDCA 4GVXA 4AJ4A 1OI7A 4LW8A 4M8SA 4FB5A 4D0SA 2J6IA 4FW8A 3HDJA 3EGOA 4II2A 3EAGA 4WLOA 4L75A 4EDFA 3UN1A 4WCFA 3VH4A 2JCVA 3Q2IA 3BMOA 1ZMTA 5JO9A 2QYSA 3C7CB 3K5PA 3KVOA 4ALMA 3E6AA 1NPYA 1WWKA 5KVQA 4M89A 1E7RA 4MVJP 1XCBA 5K0ZA 2X9GA 3H9JA 2VNAA 2I9PA 1BMDA 3JYOA 1MXFA 3T4EA 2Y99A 1PX0A 5T8KC 2V6GA 4IXWA 4IQGA 4DMLA 3X2EA 4NJOA 4IZIA 3PZRA 1R6DA 1QLJA 1XA0A 2ZIZA 4FOSA 2DPGA 3WTCA 5IF3A 5CPBA 4H3VA 1RKXA 5L7WA 4N5LA 4D0RA 4FDAA 1IB6A 4XZ3A 3E9MA 3SC6A 5CAEA 2W4QA 4HNHA 1N9GB 3OETA 4DA9A 2HMSA 1HLDA 5EQDA 2Q1SA 2JHFA 3BTVA 3EK2A 2P9GA 2BGMA 4YQZA 2P4HX 3UVEA 1B3RA 1B15A 4ZA2A 9LDTA 3ZN2A 1KEVA 1SB8A 1UJMA 4PZDA 4OKNA 3RIHA 2R2GA 4EITA 4WEOA 5JC1A 2GGSA 3UHAA 2Z1NA 1JKFA 4CM9D 2YFHA 2C2XA 4DTIA 3OJEA 1QYXA 1AHHA 2DLDA 4L4RA 1J6UA 4NH4A 4WOJA 2YDXA 3SXPA 4AJEA 4YJFB 1DRVA 5AQ1A 5JO0A 3I4FA 4GKBA 2PR2A 2DTXA 1F12A 4RVUA 4AJ1A 3ZWPA 3L9WA 1YDWA 3IUSA 4AFNA 1LU9A 3GN1A 4O63O 4XKJA 2YHIB 2HK8A 1FDTA 2HKIA 4BO1A 4OO3A 3DBRA 1A4UA 4UAGA 1GUFA 3QY9A 1P3DA 1RPNA 1PGJA 1ZCJA 4L4SA 5DOZA 2EG9A 4E2ZA 3PFWO 4EJ0A 4IDAA 4MO2A 4J1QA 2NVWA 3VZSA 5KCZA 3C85A 1F8GA 1UDBA 3IKTA 2FZWA 5AYVA 3WQQA 2YYYA 3RFVA 4DPKA 3CEAA 4YT8A 2VUSA 3AJRA 2PGJA 3QVTA 4JGBA 4CM5A 5A1TA 3CE6A 4ALLA 3ZHBA 3JQEA 4LCJA 3JQ8A 1PZHA 1DHTA 3DZFA 5AXBA 4HBGA 4JX8A 2VTEA 2PZKA 2GN6A 4QEDA 3DAGA 1LRJA 3QA9A 2DBRA 2FR8A 3MJCA 4FOOA 4PLVA 1NR7A 3ZDFA 3NAQA 4A5OA 1NQTA 1ZH8A 2H63A 3F5SA 3FR8A 2EJWA 4WE3A 5I8WA 1J4AA 3DC2A 1LUAA 3LT4A 5G4KA 4R51A 1YBAA 1JA9A 1X13A 4PZCA 4JBGA 5L40A 3JD2A 4E32A 3HFGA 3ULKA 4IPTA 3TN7A 2FSVA 1Y8QA 3L4BA 1YVEI 3NV9A 2DTDA 5IZCC 4MKRA 4IJKA 5JPIA 5CEJA 3E5RA 1P1RA 1LQTA 2I3AA 2EP7A 3B1FA 3WIEA 1BRMA 4W9NC 4GX5A 1AGNA 1E0DA 3B20A 1K89A 4IJVA 4AG3A 3PQFA 4RGBA 1EVJA 2GF2A 1KIFA 1ZKMA 5CPFA 5DBGA 4CR7A 4DLAA 1U9JA 3H4VA 3OJFA 4URFA 2HJSA 4UVHA 3PJGA 5ICSA 5TSDA 1Z7BA 4DC1A 1NR1A 4E6PA 1DC5A 1ZSYA 2VRBA 3C24A 4YJDA 4NU5A 1BG6A 4QX6A 1VM6A 2UYYA 4Z9XA 2FOIA 3F5QA 2OXIA 2HU2A 3QV1A 4CM4B 4CMIA 3HWRA 3FRJA 5G0WA 3H9EO 4EEXA 4CMGA 1H9BA 3E18A 4MVJI 1BGVA 4WLFA 4RLSA 1AHIA 4CM7A 1JAYA 3L6DA 5TX7A 1EBUA 2QZZA 3W6UA 1PGPA 2X1HA 3IOYA 4MJLA 3SEFA 4CV3A 3TRIA 3VAZA 4CLDA 3GDGA 4ZHSA 2J3JA 2UUPA 4F3YA 2PV7A 1GQ2A 1HE3A 3FN4A 2YW9A 1H6AA 2HRBA 1RJWA 2O7SA 3H8VA 1SPXA 4BO8A 1X1EA 1NHWA 2D5AA 4O0LA 4L76A 4O59O 4CM8B 1IULA 1CEQA 4IUYA 1S6YA 5DOVA 1EUDA 2WMDA 4O5OA 1KVTA 5JCJD 1DDOA 1HSZA 5TS3A 4W99A 5DCUA 7ADHA 1I5RA 5IDQA 4LGVA 4XJSA 4PG5A 3S2IA 3ZV4A 1UP6A 4B4WA 2I67A 1KOLA 4FFOA 1E6UA 3LT0A 5L4LA 1HDCA 4AICA 3GY0A 1YQGA 4IIUA 1T26A 3JQ8B 5DP1A 3GAFA 3JCZA 3IP1A 3EUWA 2CNBA 4AJ2A 3NGXA 2B4TO 2AQ8A 3FNEA 3S55A 2DBVO 3H6KA 2QW8A 1ZSVA 4XB1A 1YOVA 2JL1A 4GPD1 5JC8A 1VL6A 1E1MA 1LNQA 4FR5A 4RDIA 4DIOA 2UV8A 2PTGA 4IINA 2C5AA 4FCCA 1Y8QB 3JSAA 1YRLA 5IDXA 1GAEO 3GG9A 4BKRA 5KOIA 4BNZA 1BDMA 3I9KA 3WMXA 1UDCA 3IC5A 4BV9A 1ISMA 2QG4A 1Z75A 1E5LA 1E92A 3ON5A 4CR8A 1FF9A 1HSOA 3GG2A 1ZXLA 2ZJ0A 4YB8A 1YH3A 1I0ZA 3VPGA 5COAA 4MP3A 1CIVA 4Z0HO 4LRSB 1Q2XA 3RASA 4RF2A 4G65A 4NJMB 4AJPA 2DUWA 2PLAA 2YQ5A 4E5NA 1E3SA 2EV9A 5DBFA 3JYQA 4NBVA 1ISIA 2WD7B 1V35A 1XYGA 1ZIDA 4CQLA 1EQUA 1ZW1A 1X14A 4J9VA 4IS2A 3ZWVA 4JQCA 4PVCA 3GOHA 5ITWA 1E3WB 2P2SA 3E03A 2NVUB 1VC2A 1CETA 1V9LA 4KTVE 1U4OA 2Z1MA 3ITKA 2VUTA 2PZLA 1HDGO 1W73A 4R54A 4ROSA 1UXGA 1RYDA 4BGVA 1Z74A 1OZAA 4H15A 3RVDA 1E7QA 4Q3AA 1DAPA 3QVWA 3ONDA 2AE1A 1HDZA 3KUXA 4A27A 1T2DA 1GQQA 3U4DA 3GGGA 3GN2A 1BVUA 4GKVA 4ALIA 1U28A 1VPDA 5A4DA 4IDEA 1NM5A 3NGLA 4J9UE 3U0BA 2Q2WA 1DC6A 4GX1A 4Q39A 1N1GA 4ILKA 3TDKA 4OXNA 3VPXA 2OZPA 2VCYA 1NQAO 3NDIA 2HMTA 3ANLA 4J4TA 3V5NA 1GCOA 3AW9A 5T64A 1R0LA 1GTMA 1TT7A 3T7EA 4BO5A 1NTOA 2XXJA 4YAJA 2QRKA 2CDBA 1GUYA 1LDGA 5L7YA 3WLFA 4BGUA 2B35A 2W2KB 3PGXA 3LLVA 1WXDA 1JKIA 1VRWA 2GO1A 4XGKA 1I2BA 3ZWAA 1MX3A 1ULUA 4N18A 1JLLA 3H9QA 4XEHA 4RO0A 2EW2A 3KV3O 3SLGA 1VJ0A 3G49A 3KYCA 2W8ZA 3DWFA 4YCAA 1SB9A 2NVBA 1Y5MA 2ZB8A 1PQUA 3LDHA 4IGEA 5A05A 3EVNA 4OH1A 3OIGA 1EZ4A 3ZWNA 3ADOA 4CPDA 3E48A 1CYDA 1LEHA 1T4BA 1E3IA 3KYDA 4OIMA 3JQAA 4R01A 1NWHA 2EXXA 1K0UA 3QWFA 4IMRA 5CG2A 1XLTA 4KMSA 2EKPA 3DFUA 3QQPA 1TVEA 5AXAA 3BXXA 4OL9A 1DLJA 4CLXA 4CMJA 3WGIA 2UAGA 4NMHA 3I6IA 4XR4A 3FWNA 4NFYA 1EEHA 3SJUA 1Y81A 4I5FA 1LTHR 5DF1A 4YVFA 1MG5A 2Q46A 3F1KA 1SMKA 4CLHA 1E6EA 1X1TA 3GFBA 4BNHA 1B8UA 5EN4A 5A03A 1VI2A 4CL3A 3D4PA 4AJLA 4OAQA 1C1DB 3I9LA 4RZHA 2F00A 1PJBA 3OHSX 3PDUA 4GMFA 3X2FA 4GGOA 1C1XA 1IY8A 2Y1OA 4J7XA 4XIYA 1PS8A 3CUKA 3WBFA 4DL9A 3ZU5A 1B16A 1LLUA 3ANMA 4XB2A 5AVOA 3RKUA 3PQEA 4BB6A 1ARZA 2JAHA 2VWQA 3QWHA 3V2UA 3V2GA 1R12A 4CODB 2VRCD 2GYYA 2I65A 1DSSG 4EI2A 5JAQA 5EJ2A 1ZNQO 1GZ6A 3BHMA 1P1KA 5ADHA 1DEHA 3WNVA 2O3JA 2VYND 2D3TA 1ZUD1 1R4MA 3KTDA 4KUHA 5CDTA 5IG2A 1YO6A 3GHHA 4RVFA 4K6CA 4YJHB 3LVFO 4DQXA 4XDYA 4HADA 1ADFA 1NVGA 3FBGA 3STHA 3VPHA 1LSJA 1WP4A 1XKQA 1U3TA 3FPLA 4FN4A 3GPDG 1GDHA 3NYWA 4MIOA 4XX0A 4L8VA 1B26A 5DP2A 2YDYA 1M76A 2PD3A 3QSGA 5A06A 2O3TA 3G1UA 5I8ZA 1K2WA 1C0KA 2IEDA 3JQDA 4CLRB 3PVZA 2F1KA 2IZ0A 5CG1A 3E82A 3DMYA 1RM4A 1H6DA 2X0NA 5GZ3A 3BHIA 1ZK3A 1PZFA 2AG8A 4LISA 4KP7A 5L53A 3RD5A 4NI5A 4IJUA 2UDPA 1CQJA 3I9JA 3DMTA 3P2OA 4CMEA 2I6TA 4I9UA 1NHGA 3ASVA 1NYTA 3RJ9A 4C7KA 4CJXA 2IODA 1XHLA 3DO5A 3NUGA 1OFGA 3BTUA 1W0CA 1M66A 3FI9A 2Q45A 4MIEA 4JROA 4GAEA 3I9NA 4I08A 4IY1A 4J7CA 3F47A 1H5QA 5TT1A 3I5MA 3UCXA 1QP8A 1X7DA 1NP3A 1V0JA 2EW8A 3EC7A 3OP4A 3K30A 3L6EA 4AJNA 4YAGA 2YQ4A 5JNLA 1MLDA 4YRAA 2R00C 2GCGA 3LT1A 3TOXA 2C2YA 1G1AA 4BMVA 2QHXA 5EERA 4OJNA 1NQOA 3ITDA 2IXBA 4I5EA 2CUKA 3PDJA 3C1AA 1A5ZA 1V3TA 1ZZEA 3A1NA 4J49A 4TVBA 4WLEA 4Y67A 4DPMA 2NTVA 1UR5A 3KM0A 1UXKA 2GN8A 2X86A 4GSLA 4IMPA 3I1JA 5JAIA 4TZTA 2AA3A 1ZK2A 4DXHA 1LDMA 5L4NA 1GR0A 2LDXA 2X0RA 2ZTLA 2D0IA 4N5MA 4CMHA 1VSVA 5I9MA 4XYLA 1P44A 3MJTA 4WJZA 4JBIA 1BXKA 3PJFA 1SZJG 1C1XB 4IDFA 4CMAA 3ROQA 1ORRA 4N54A 2PH3A 1VE9A 3GRKA 4Y6PA 1V8BA 5BSEA 4PLPA 4MINA 4PLZA 3W6ZA 4DLLA 4F6CA 5A9SB 1H0KA 3GUCA 4L73A 5J23A 5IDWA 1WAMA 2GNAA 5F1OA 5I7VA 1MC4A 3GZ4A 1BW9A 4KQXA 4ND4A 2FY8A 2H9IA 1H2HA 1HRDA 4JJFA 1TT5A 1XGKA 1ULSA 5JYEA 3QE3A 2W90A 1SEPA 3K31A 3D5TA 3FF4A 4NIMA 2VHZA 1I10A 3K8ZA 2NACA 1V6AA 1HDXA 2PGLA 4ESOA 4YR9A 3PZBA 3ETEA 1MB4A 3F9IA 1GL3A 4RPKA 3HB4X 1L1FA 5U9CA 3NT4A 4R5HA 1I3MA 3UF0A 1NAHA 3KLPX 3M1AA 3Q11A 4ZQBA 2NU7A 1Y5RA 2GRAA 4B4OA 1XSEA 1YQDA 4XYBA 3JQGB 4A03A 2O23A 4LSWA 3DEYX 3S8MA 4IM7A 5TIIA 1P0FA 1Q0LA 1YGYA 2CZCA 3JD1A 1EMDA 1IZ9A 3QHAA 3PYXA 3WGTA 2IYPA 3TFOA 3Q3CA 4GX0A 4U7WA 4D45A 3LZ6A 2Y68A 3FPCA 3GDOA 2OP0A 3HN7A 1SEVA 4CMCA 1ONOA 2BHLA 5GMOA 3R6DA 3ZNPA 1QORA 4EZBA 3E8XA 3IIEA 1YB1A 3OIFA 3ZNQA 3A06A 2BLLA 3E5MA 5LC1A 3WLEA 4E2XA 4GVLA 5A9RA 2P9CA 1GPJA 4CLEA 1EBFA 3IQDB 1DIHA 1HDOA 4M55A 5EL0A 3INTA 4BNJA 3BMNA 3JQFA 4HV4A 5KKCA 4YYZA 2FHSA 3PWSA 3PLRA 2VWPA 3PWKA 3PWZA 1ZSNA 4RPHA 1DLIA 2XXBA 5DZSA 3LLSA 3PFFA 1QXSA 4BNGA 4PG4A 5HS4A 4CV1A 2O3UA 2VHYA 2BFAA 3AI3A 3K92A 4MVJH 4Q3DA 4LMRA 5JFOA 5JAZA 3U5TA 2E37A 2QYTA 3FTPA 3M2TA 4YT5A 2Q50A 2W2LA 1ONNA 3OMLA 2I99A 1H94A 4FFRA 1A71A 1HETA 1GD1O 5IJZA 1LI4A 1A9ZA 3BYZA 3VHRA 1JDJA 2XF8A 5FYDA 3WXBA 3VC7A 3GQVA 1R4NB 3EHEA 4P22A 3PRJA 4CLOA 1U7HA 2WJPA 3OIDA 1PZGA 1P31A 4M49A 4FGSA 1HE2A 2Q2VA 2VN8A 1EVYA 3BMQA 4CQMA 2CD9A 3LT2A 1AXGA 1RM0A 1ENYA 1UP7A 1OOEA 1QSGA 2FWMX 2HJRA 4ZN6A 4H16A 3VZPA 2ZATA 1EE9A 1E7YA 3ZHYA 3AUUA 1BXGB 4AVYA 1T2CA 1LSOA 4HFMA 3RUFA 3PHIA 5F5NA 4RVHA 2Y0EA 1RM3A 4QFDA 4BUCA 3VKVA 5A3JA 3WJAA 4IDGA 3GF4A 2BELA 3H7AA 5K6AC 3F1LA 3V8BA 2SCUA 2NNLD 1JWAB 2GN9A 3WGGA 1OC2A 1LJ8A 3Q1LA 4UEOA 4YPOA 3MJEA 3AI2A 2Y0CA 3IDSA 4Z0TA 3QVOA 1EDZA 2ZQYA 3VOSA 3KLMX 2B4QA 4R1TA 1UP4A 3QWIA 2EF1A 2GN4A 3WICA 1EDOA 4RQUA 1DJQA 1GCUA 5KJFA 4JN6B 1J49A 4E12A 3DHNA 4OGWA 3R0IA 3C1OA 4PG6A 3QWAA 2A4KA 3ZV5A 4A73A 3GH3A 6ADHA 1JAXA 2A35A 3BA1A 3I52A 4F46A 2B5WA 2V6FA 3NX4A 4DQVA 1DFIA 1PGQA 4J6FA 4Q3BA 3AOEC 3S2GA 2ZCVA 3I83A 3GMSA 3EMKA 4F45A 2HAEA 1UAYA 3ANNA 5L9AA 1HEUA 1KERA 3ICCA 4BO3A 3TZCA 1WZIA 1UUFA 3Q6IA 2DAPA 4GLLA 4Z9YA 3ICPA 3GVXA 5TQVA 4DVJA 3LC2O 1ZK1A 3KSZO 1KVQA 4QQRA 5F3RA 2EJVA 1LRLA 4YJGA 4B7UA 4JK3A 4W7IA 3ETDA 3BMNB 3UAGA 3WFIA 3WYBA 3ENNA 2WYWA 2WYVA 4MVJG 4YAKA 2QIOA 2Q4BA 4Y6RA 1WNTA 2OBYA 4WCFB 4U6SA 4R3WA 4EJ6A 3PHHA 3BMOB 4OOFA 4TRRA 1CDOA 2I3GA 1HZZA 1HYHA 2ZTUA 3FNHA 4R5MA 4S3MA 4YAEA 4RVGA 3RUIA 4CMBA 2NU9A 2FZEA 4FSHA 4TKMA 3JQ9A 2EKLA 4J1SA 4R1SA 1CQIA 2WYUA 1T1RA 1PJTA 1B3BA 3O8QA 2C54A 1ID1A 4BNYA 2VTDA 4B4VA 4R9SA 5K9ZA 3TZ6A 1O8CA 2D4AA 1JW9B 4M86A 2HK7A 2Q1TA 4D43A 2GPTA 4I5GA 3GVCA 3PXXA 5A5EA 1ZEJA 3SX2A 4NPCA 3I4CA 3Q0EA 3JQ7A 1T2AA 4D79A 1Q0HA 5B4UA 1R37A 3F6YA 2EGHA 2UUOA 1J5PA 5I7SA 1MUUA 1KEPA 1O5IA 4WCFC 1B8PA 3L07A 4U0JA 2AQKA 4BNNA 3AY3A 1EQ2A 4UUNA 4Z6KA 3E1KA 1U5AA 3I9MA 3ZWCA 1PU2A 4IDBA 1IPFA 3UUWA 1I3KA 3NJ8A 2O3RA 2XPCA 5G0TA 1P1FA 3ZH2A 2NM0A 3CPSA 1P9LA 1GUZA 1RWBA 4NHEA 3ZWXA 3EDMA 1CWUA 3INGA 3RC7A 1N8KA 2BGKA 3AK4A 3B70A 1D8AA 1QYWA 3CMCO 3DOCA 1WVGA 3GNSA 2C5EA 3PJEA 3CINA 3GC6A 1MFZA 4KOAA 3VVBA 3EW7A 5EMHA 3BMCA 3TFQA 4W82A 4Z9FA 4OMUA 2O50A 1M6HA 1E3JA 4J4BA 3H5NA 4BNVA 4AJKA 3I9OA 3TZKA 2VHVA 2RH4A 4LN1A 2CF6A 1HDRA 3HUDA 4XGIA 2GUGA 3AM5A 2CVZA 1XIVA 4PRKA 4JJIA 1U3VA 3DBRB 3UH1A 4BO6A 4CV0A 5KWEA 4FC6A 4R9RA 4E2WA 3UICA 3OFSA 1EVZA 2IXAA 2POQX 3DZKA 5BR7A 4J90A 4FPXA 2FRDA 3P2YA 3FCOA 4YQYA 2HSDA 3OEWA 1PQPA 2DTEA 3IS3A 7MDHA 2IEBA 3OA0A 4P4NA 4EEZA 3ZW9A 1XELA 5IFLA 2VYVA 5I7FA 3O9ZA 2A9FA 5IDYA 4DBVO 1YB5A 4BGEA 1YE3A 5ER6A 3JQCA 3A4VA 3KYBA 2X9VA 5DNAA 3GHYA 2PZMA 4XCVA 5IXYA 4IJWA 3H65A 1KC3A 1GEEA 1QLHA 2PGDA 2Y0DA 1A72A 2C29D 1PWXA 4ID9A 2C20A 5L51A 3RI3A 3OQBA 5JE8A 4G5HA 3PP8A 4MVJA 4RV9A 1R16A 2X0IA 4CMKA 5G4KB 4JP2A 3LSYA 2EGGA 1YL6A 5FI5A 2PWZA 2AQHA 2BFMA 5JMWA 3HQ4O 3DXFA 5C5IA 3N74A 4YACA 1Z6ZA 3E9NA 4CV2A 2ZTMA 3JQ6A 1R0KA 4OSOA 3UCEA 1BXZA 1U2GA 4JLWA 1LXCA 4Y6SA 1ADCA 1F06A 4RF4A 4BNXA 3I3OA 1EUZA 3L6OO 4BNUA 2HMWA 3ZV3A 3GEGA 3MJ4A 4GQAA 1PJ3A 4MVJM 1XWFA 3GDFA 1DOHA 4K6FA 3JQ7B 4BGIA 1VKNA 3TL2A 4NBTA 2WM3A 2WE7A 3TZQA 2C7GA 1PGNA 1X15A 3AY7A 4PIVA 4AL4A 4E30A 1WDMA 1VSUA 1PIWA 2EIHA 1C3VA 2H5LA 4NK5A 1P33A 2QZ9A 3DBLA 2VZ9A 2C07A 5ITVA 5EINA 3K6JA 3PHJA 5A04A 5L7TA 5JW6A 2FPPA 2IZ1A 1UXJA 1N7HA 1O9BA 4I9HA 5G0UA 5B12A 1GV1A 3TNLA 3DDNA 3L4BC 4CMIB 5CHEA 5ILGA 1U8FO 3ZW8A 3D0OA 3HN2A 1ZMOA 4L4XA 5HBRA 3L4SO 3QVXA 1E77A 8LDHA 3IAHA 4M1QA 4UVEA 3FHLA 3RU7A 3WSWA 3GAZA 4W6ZA 4EYEA 3U09A 3HZZA 1CRWG 1FDSA 3RCBA 2W2LD 3M1LA 4U6QA 2ZYGA 3W4IA 3FWZA 4J1TA 3TZHA 4XIJA 1GU7A 1ZFNA 2I5PO 1KC1A 1QV6A 4D41A 3MJSA 3R3JA 5I7EA 2FR0A 2CDCA 3DR3A 3AU8A 3W8EA 2YHUA 1EK6A 1HE4A 2Q2QA 4UVDA 4BNTA 3FBTA 1VJ1A 4ND3A 3RKRA 3VDRA 3ZCXA 4KQWA 1JU9A 1HL3A 4BNLA 1Q7BA 2Q4EA 4Q3EA 4MKZA 5F1KA 2JFFA 2RIRA 5ER9A 3V1TC 1MC5A 2G1UA 1F8FA 4ONEA 5JDCA 5EPOA 1RYEA 4N7RA 3LF1A 4YTEA 4YAIA 1T25A 5HS6A 4D3DA 2Q3EA 3MEQA 1MA0A 2B0JA 1D1TA 4BNMA 1OMOA 4HY3A 2CY0A 5KJ1A 3DZIA 1UXHA 4NU6A 3Q9UA 2HMVA 1JN0A 4BO7A 3JD4A 5BNIA 1JTVA 1I32A 3IL2A 1DIBA 1KY4A 2J5QA 3CZRA 4TZKA 4KDEA 3LF2A 3A14A 3ROMA 1IHXA 1TXGA 1Y8RA 3N58A 4ND2A 4INAA 2B37A 3ZNNA 4J0EA 1E1KA 1GZ3A 1O95A 3MTJA 1PR3A 2BGLA 2X5KO 5B4TA 1YOVB 4L9RA 5IZ4A 1S7CA 2RHCA 2BRUA 4QECA 3D4NA 3CSDA 1ISJA 1PWZA 5KVCA 3VH3A 4ALJA 2B36A 3OECA 3R3SA 4NBUA 4BS9A 5B4VA 2E49A 3F46A 4MKXA 4GI2A 1WLYA 1PQWA 4G2NA 5CEFA 2G17A 1H2BA 4WOKA 1T1SA 4A2CA 3DBHA 4AJHA 2XOXA 5BSFA 2HUNA 3BTOA 2YY7A 3DTYA 1X0XA 2EEZA 2VUUA 4IGFA 3RC1A 4E3ZA 3HDHA 5CEEA 1U5CA 1QYDA 2HQ1A 1EUCA 4B8WA 2B69A 5JS6A 5B1YA 1R66A 3GZNA 4M87A 5JLAA 1A7KA 4CQLB 3LC1O 4I1IA 4FIZA 4OM8A 3S2FA 4J7UA 2OOSA 4EUHA 5DCWA 1KETA 1LQUA 1U3WA 1IE3A 2BKAA 4JNKA 1M2WA 2EERA 1UH5A 4YWJA 2V6BA 3O26A 2JHGA 4FGWA 5TJ9A 1CERA 3D5QA 4PLYA 5DBIA 5GZ1A 1L7EA 5H82A 1P74A 1BTOA 5ILOA 3RU9A 1KBZA 3ZNOA 2CDAA 2O48X 1D3AA 3MCVA 5AOVA 4JBHA 1KEWA 1ADBA 3SLKA 4XYMA 3TQHA 5KJCA 2WDZA 4E0BA 4XDZA 4FJ1A 1Y1PA 1PL6A 2JFHA 3DL2A 2JJYA 3CTMA 3OA2A 1Z45A 4UULA 2D1YA 2RBEA 4IIVA 4XRRA 1N2SA 4RF5A 3RUDA 1PTJA 4QSMA 1XU9A 1DB3A 2Q49A 1YBVA 3DTTA 3HHPA 4FS3A 3U4CA 3WR5A 2ZQZA 4CL8A 1HZJA 1VLLA 4YT2A 3C7DB 5JDIA 5JAMA 3W4JA 1GYPA 4WASA 3PQDA 1WPQA 1QG6A 4IQ8A 4U0KA 3BZUA 3NT2A 3DOOA 2Y1GA 3QLJA 1PJLA 2Y67A 1CJCA 4QTZA 2JCYA 1JWBB 3RUCA 5BNFA 3H3JA 1FMCA 3U62A 3WSVA 4D3FA 2YJZA 4L74A 3G1TA 3KYCB 4RORA 4GSKA 4F6LA 3OQ6A 1GY8A 1XU7A 2NTNA 5U1PA 1QMGA 1Q7CA 3OF2A 3NT5A 1IL0A 2AQIA 3KYDB 3JQAB 3QJ5A 4G81A 1NFRA 4DRYA 4OKIA 3RSHA 5KVVA 3H2ZA 1Y7TA 4R4JA 1DO8A 3TWOA 3B1KA 1PL8A 4UREA 4IDDA 3UKOA 4ZVVA 3AU9A 4OQYA 1SOVA 1PJQA 1ZVMA 4R41A 5IAAA 3NRCA 4O6VA 3ROKA 4LMPA 2GZ1A 5T8KA 3GVHA 4XRGA 4L0QA 1F14A 3ETGA 1VJTA 3AUSA 2PNFA 3TSCA 8ADHA 4D44A 1FDUA 4NG5A 3GFGA 2YV1A 2G76A 1DBVO 1J0XO 2PY6A 2BI7A 2VOJA 4YXFA 4JIGA 1JKJA 4XQCA 4BMNA 2VYVD 4K26A 4N5NA 5L4SA 2C82A 2ZTVA 3D64A 2PD4A 4J2HA 1NX6A 3NEPX 4BMSA 4UUPA 4I8XA 3MOIA 3IKVA 2OGUA 4K1LA 5FWNA 5G0SA 1GFSA 4QUKA 2FPIA 5CFZA 1P0CA 1PGOA 2JD1A 1XQ1A 3V1UA 2NU6A 2CMDA 4FD3A 4BO2A 1NFQA 3PYLA 1LSUA 1R4MB 2OBNA 4H7PA 4ZRMA 4MIYA 5FFFA 4ZU3A 3WGQA 3VKUA 4QFCA 2DBZA 1KVSA 2DM6A 1DXYA 4P38A 1LLDA 2PFGA 3RBVA 3PGJA 4QO7A 4YDRA 1W6UA 1NAIA 4FQ8A 2GDZA 3PLNA 3ZWOA 3CXRA 2FSSA 4CM3A 4RDHA 2CF5A 5T6BA 3HNPA 1FDVA 4DWVA 1IZ0A 1N9GA 5JY6A 1PR9A 2BH9A 2WEKA 2BI8A 4AJIA 1NFFA 3WQSB 1A4IA 4B3IA 5F21A 5JMPA 5TNXA 3W1VA 2AEJA 3CKYA 4YRDA 3U4HA 2P5UA 4FFNA 4GX2A 3WQRA 4RPJA 1QR6A 2WE8A 1GZ4A 2TMDA 5TGDA 3WS7A 2ZB7A 4E5YA 5C7OO 4BNKA 1HKUA 1IPEA 3PTZA 3I23A 2ZK7A 4YT4A 1UZLA 1B2LA 1K5HA 1XG5A 2JCXA 2AEFA 3JD3A 3T7CA 1ZK4A 4D42A 4RJTA 1X0VA 4DGSA 4D3SA 4YJFA 2O4CA 3WJ7A 4ZQGA 2O3QA 3NTRA 3QVSA 2D2IA 3JYNA 1KS9A 1DC4A 1E1NA 5H83A 3B1JA 1V3VA 4BKOA 5CDYA 4FJ2A 1BSVA 5AXCA 4WECA 3P7MA 2YHIA 1GQYA 1L7DA 3UW3A 4E31A 2OUIA 3BIOA 2EWMA 1QYCA 2P91A 3RFTA 2DPHA 2Y1EA 3TOZA 4IXTA 3RFXA 3OEYA 1YKFA 4WLUA 3RUEA 2PH5A 4WK6A 2YV2A 2NU8A 3O4RA 3VVCA 1K3TA 3D7LA 2D59A 3DMTC 1GYRA 2TMGA 4W7HA 4CMEC 1H6CA 4Z0PA 3G79A 4RVDA 2V65A 3OJOA 5IZCA 2FPGA 2P5YA 1N7GA 2ZJ1A 1E5QA 4J4HA 1T2FA 3GVPA 1FXSA 5DN9A 3IP3A 1GPDG 3PHGA 5EESA 3WDSA 3H5AA 4GH5A 1GV0A 3HDQA 3H3FA 4W9NA 1U4SA 2B83A 2NUAA 4IS3A 3UXYA 3G0OA 1EVIA 1O6ZA 4NNJA 5THQA 1ENOA 2HCTA 3GPIA 2FMUA 1N92A 4NZ9A 1UXIA 1B8VA 3GGOA 3D4OA 3ZWMA 3C8MA 3DZHA 3WX0A 4BV8A 2DBQA 4TSKA 2IYOA 1M6WA 1Y9AA 4BNFA 3UFXA 4WPGA 2JAPA 3BAZA 4UEJA 5A3VA 1PJSA 3VH1A 1BW9B 3DAPA 2NTJA 1ENPA 3FTNA 5KJEA 1LC3A 3JQAD 5L45A 2QRJA 1TT5B 3H2SA 4UVIA 1WDLA 2X22A 4TRJA 2BMAA 1SOWA 4NR0A 5JY1A 1YDEA 3CZMA 4GGPA 5KNLA 2Y93A 1ZJZA 3COSA 4FFMA 4BKQA 3RC9A 3ENKA 1Z7EA 4MDHA 4WLNA 3GEMA 2VWHA 3PYMA 1GEGA 4RF3A 1LC0A 5IN5A 5FEUA 4TRNA 4ZJUA 5BNTA 5BQFA 2AW5A 4IBOA
chains in the Genus database with same CATH superfamily
3NHYA 3MMSA 3CMMA 4TSFA 1QU2A 2J4FA 2ZETA 2ZBFA 1NRWA 2H6EA 2HXGA 3JALA 3I1FA 3PX3A 4B80A 2XMSA 1JFSA 2WD8A 1CQPA 2BD0A 3CKMA 4H35A 1YS4A 2ZB4A 3I01A 2ZGVA 3O47A 2D2FA 1JDPA 2VSXA 4N8SA 2IOQA 3NTOA 4GOLD 4QDOA 3JPYA 5JEEA 2X58A 3MWEB 4JEMA 1XTQA 5EIBD 4OD0A 1NN3A 1XZFA 3D6TB 3LRTA 3NBZC 3PQ3A 4RTPA 3IJ5A 2Q5QA 1N75A 1DTEA 3IB3A 2FN7A 3NHUA 3U6KA 3HVKA 5AOCA 1OJ7A 4TRMA 4ZZIA 3OTGA 3C6MA 4BXOB 1TRHA 2CN1A 2IP4A 3QX9A 3H19A 4RL6A 3LC7O 3IR7A 1OWOA 4KR9A 1ISGA 2NLOA 2OO3A 3LP5A 3CV3A 2JJ1D 4L5AA 4A0RA 3B6KA 3DVRX 4E7OA 1NXQA 3NWEA 4Y9UA 1CHDA 5LCXA 5DHAA 2HSJA 3WTBA 2XCIA 1X9IA 3L0SA 2W6MA 2Z9BA 1BCRA 5GONA 4Y6LA 4AU1A 1AU9A 1IUKA 1T9GR 4U7FA 1MPTA 2P9EA 4Z2AA 4DV3B 4QBIA 1CUVA 5K45A 2QSJA 1IXYA 3HEAA 3ZKAA 3TLMA 1RRCA 3AIMA 1AKUA 1W8IA 3F4BA 5ICMA 2EHDA 3GUYA 3M4ZA 4IQ4A 2CNKA 2HDHA 4XARA 3B3AA 5C0OE 4CM8A 1D1SA 3AZPA 3G23A 1Z2OX 4HNGA 1G6KA 1M5UA 1N6LA 4LSGA 1KDTA 1ESNA 2F90A 2JCSA 3LMKA 5FJJA 3EC1A 5BQ5A 2NV2B 3CUEF 2DFKB 3M1YA 2X4GA 1Y5LA 4IAOA 3LQRA 1SKAA 4JXZA 4LQLA 4A26A 2WFMA 2FUKA 5JRJA 2B4KA 4KLCA 5DGTA 2J5KA 3C6KA 4XD7D 1TW3A 2YIJA 2L42A 4G1EB 3RAJA 3I6QA 1IM8A 1SCUA 3EWAA 1MRNA 2ZU6A 4WINA 3ADCA 3B1XA 4F85A 2EL7A 3QNUA 2IV2X 4WFJA 1OWMA 1DC3A 4BVGA 3D8TA 1JR3A 2J8ZA 3PPYA 3WLQA 1GCGA 1RQ2A 2X5JO 1B0AA 4PZEA 1T5DX 3OBBA 5HK8A 2FWRA 2NPOA 3BHJA 2ZAGA 4RKWA 2F3PA 2FN9A 5FOTA 1A9SA 1P5ZB 2XQVA 2Q8NA 2ZIXB 4IJMA 3VHXB 1XN4A 3ZS9A 1KFJB 1LRKA 1O94A 2WQZA 4BZWA 3WGKA 1Y0BA 2VYNA 3O74A 5DEIA 4OTZA 5ALDA 1JIVA 3HJAA 1AVTA 4PR3A 2XI4A 2AC7A 2X7JA 2O05A 1W85B 2ZSIA 3BMQB 1TFUA 1YJQA 1J0DA 2IDKA 1IXSB 1ZK0A 2G5CA 2B8EA 2H00A 4RAQA 1NE7A 2ZPAA 2CUNA 1GCAA 4CNBA 3LUDA 3GUUA 3QPUA 5HFAA 5COBA 1KQNA 1WMEA 3HY3A 3BJMA 4H6PA 4LV8B 1K7EB 3HSKA 3KB6A 4KC0A 5A5VA 3HGTA 4YUXA 4BHTA 3G5TA 1GDDA 5DHSA 4K6GA 1J9ZA 5CFOA 1S4QA 3GRPA 4MKGA 1K9SA 3DL7A 4NNPA 3LQFA 2GFIA 2ZIUB 5J2TA 3WLIA 3NQ41 1Z8NA 1IOLA 2CXOA 3R23A 1KDPA 2FHPA 2SCUB 4HR7A 4HYTA 5KC8A 3UB3A 1R10A 3HE3A 4B83A 5AW2A 4DQLA 3FA2A 4JI5B 2XODA 5M5BA 1KKMA 4W1SA 3TQRA 5K2MA 3L92A 1LK0A 3QPCA 2PK3A 3AXTA 5FA5A 5HRUA 3OICA 1AN0A 2VJMB 3ASUA 2J9GA 2QRNA 3OZTA 1NSTA 2O4UX 2W2TA 1W44A 3OIVA 1GFWA 1PJ2A 2A67A 4XR9A 3RYIB 2QTAA 1J0EA 3STTA 4A6DA 5BSHA 3AONB 4U8GA 1OZ0A 3N8DA 3UJDA 5I9TA 3MBOA 3OSUA 4FYVA 3NAGA 4ITUA 1UJ6A 3O2JA 4TTTS 1W46A 2ID9A 4ZQIA 3GT4A 4ZT6A 2COUA 2GLUA 1BHQ1 4EUEA 1QV9A 4TM7A 3SGLA 1WY7A 1P60A 2Q8PA 3T7DA 1M0EA 4OEHA 3FTFA 3RIYA 1NLUA 3B8HA 2C5HA 1MHTA 2C00A 2XOKD 3DZGA 3JWEA 1C7EA 1Z9BA 4LKRA 5CX4A 4UQOA 3AW8A 2WUWE 4QOEA 2PE5A 4IGIA 4X97A 5G1NA 1NATA 1SKMA 2GCOB 2R87A 1JPNA 4JU8A 3ZCQA 5IABA 1DO2A 2QK4A 4DIFA 4P58A 4WY8A 2OHIA 4S1OA 2PXXA 4UUMA 2IDMA 2EF0A 3TRKA 3U40A 4CEIB 4V0RA 1YCFA 2PG3A 1X87A 2WHRA 3H11B 2GVNA 5LJIA 4W6QA 2IPLA 1ZVVA 3IVMA 1LX7A 2VF8A 3EDRA 4ZHQB 1KRXA 5BVGB 3TNJA 2WSBA 3DHEA 4RSRA 3VZQA 1OTYA 3DZBA 1CQZA 3NNNA 4ARZA 2C4MA 4K9DA 3GNTA 2X0JA 4F4CA 1ESMA 1W581 3MJDA 3OY7A 2P30A 5FOSA 1KOFA 3A10A 2R1VA 3H0EA 3WMWA 3AB8A 3UA3A 1Z4LA 1QGAA 3MTQA 1UL1X 1W52X 1NBOA 3EY4A 3NDJA 2VT2A 4PIMA 3W9UA 4FUQA 4EF6A 2PSHA 5B55A 4KTTE 1M83A 1H69A 4TVOA 2P78A 1DAIA 2BFOA 5EGNA 3PI6A 1F2TA 1AG9A 5LDGA 3VPFA 3BGVA 4KDCA 2GEKA 4ZO9A 5B2ZA 5C32A 5CCXA 1C14A 4MA4A 4QAJA 6NULA 2VRNA 4QOJA 3D6UA 3L77A 1VSQA 1XJCA 4C0AC 1TDJA 3KK0A 1I2ZA 3NDRA 2XIQA 3G6WA 4LYAA 5IEJA 3ZHSA 4UDYX 3PHBE 5ENVA 5DNUA 3P97A 1O57A 2A5LA 2PKYX 3AEKA 1CR1A 4I0WB 5LL6P 2FPSA 4XWAA 1NJ8A 1RABA 3H4MA 4I6GA 1XAGA 4JVSB 2ORED 2PKQO 2VP2A 1OUMA 4GQIA 1C9EA 3K8QA 2PUJA 2CVPA 1GN8A 2ZRIA 2QP9X 5MGBA 1A7AA 1J23A 1YCDA 4HAUA 2R8ZA 2FPRA 4E5KA 1L7OA 2HOQA 5HIJA 3IXQA 5K0GA 3RAEC 4KXNA 5D3QA 2G1KA 4OHUA 2VNKA 3HB5X 4TROA 2OQVA 4D74A 3WB9A 4LJ9A 4DYVA 4UW9A 1EM8A 3DEKA 2YC4C 2Y66A 2WAMA 3HFSA 1NNUA 1XQVA 1R15A 1US8B 2GRUA 2OV2A 2XNDD 1TF5A 1XQ6A 1R0CA 3KCQA 3DFZA 4S1NA 3WNZA 4BKUA 2Z6VA 4ZO6A 3ZYCA 4AZ3B 1U9IA 2IWRA 1V71A 1YHZA 3PQ7A 5KX5A 2FYTA 3OLQA 5EWLA 4PR0A 4H4CA 4OQZA 3MWFA 3ROEA 5FUYA 4DCVA 4AMBA 4NZPA 1VLMA 1YL5A 3R77A 5LYYA 1SBTA 2J5RA 4LF7B 5A3QA 1J39A 3NANA 4XLTA 1M54A 2CLLB 3TS1A 1JEYB 5A3RA 3E9YA 4ZQEA 1TZMA 4COOA 3GLGE 3GA0A 3WIOA 2XA9A 2NXCA 3ZBQA 1UK8A 2YWHA 1LKZA 2FZVA 2VUHB 3K15A 5ALPA 1KP2A 1RP7A 3N2LA 3ZGYA 1PT9A 2VQEB 3QXGA 5AKKA 3LOUA 2WTXA 4HX5A 4D9NA 1HK7A 5C46F 2CT8A 4ED9A 1GTJ1 4CQMD 2MMGA 2BFFB 2PZAA 2Y4OA 4B2YA 4H17A 1FYEA 1V4BA 4FMCF 1B6GA 4JBWA 1IBCA 2X8LA 3V34A 3GYGA 4OSPA 1BWQA 3HDVA 3AL3A 3OQMA 2FPUA 5LMUB 1VL0A 3WK8A 2IZOA 1JGTA 3ICVA 4MYHA 3GRZA 1KDYA 4E3WA 5ALJA 5TARA 3AFGA 2QRLA 3B82A 3QNMA 1ULZA 3W90A 4LVCA 4AYXA 3Q4GA 4CLRA 5DE3A 1Y8CA 4S0XA 3VTZA 4WN3A 1SKQA 5BWOA 1BEUB 1S2LA 2A4MA 4NV0A 2GERA 2IIBA 3AM4A 4QUGA 4TWJA 4EVRA 5LWHA 1LY1A 4OXKA 1VJCA 4HFRA 4JXJA 3CNQS 3FOCA 4XM0A 2HHHB 2JFOA 1KZ1A 1IY1A 4KDRA 4YDSA 1JPJA 2AFRA 4J76A 3R7NA 5L3ZA 1Q1NA 2BGRA 4IUBS 3TB6A 1H8HD 3C6ZA 3AVQA 3JYLA 4MQFA 2OQIA 2OC4A 4WADA 4YA6A 1RYNA 4KWEA 3UAVA 4M7WA 2YW2A 3SX0A 4GOJA 1Y1SA 5EE9A 4LYDA 2HBYA 3WYCA 1UFQA 3H8SA 3CURA 4CF5A 3AFIA 4LBZA 2GN1A 1N5MA 1MQSA 2I0FA 4JBYA 4R68A 4YFVA 3VNUA 4EG6A 3IA2A 1F9EA 1AUPA 1OW3B 1DIGA 4I50F 3P0JA 2NUPA 1CF2O 2C9BA 1M7HA 3PEVA 5AM0A 5FOQA 4DR6B 4D46A 1FFEA 3A28A 4P92A 4R16A 3LWNA 3ZIDA 2DFDA 4CG0A 3T1YB 3HJCA 3KE9A 4W4TA 1P8JA 4Y1GA 1SU4A 3VNQA 3DE4X 4MV7A 4C06A 4Q6BA 2G82A 2QV7A 3PFKA 1CV2A 4M9UA 4NE9A 1RM5A 4RLHA 4ER5A 3CNLA 5HHTA 5JNTA 5KYYB 1ENZA 3P0FA 1KZ4A 1HLPA 1QJ4A 2OHXA 5A4AA 3GLFB 3FCYA 1HGXA 1PFVA 4K0RA 2XGOA 1N0HA 1V16B 3CLTD 3PEFA 4KQCA 3CIOA 3JATA 3KR0A 1L5HA 3REQB 3SC3A 2R86A 3FPGA 3OOYA 3D6HA 1EP3B 5U4QA 3UV7A 3INRA 5B1HA 3RTDA 1VHWA 1BDBA 2X40A 1L4YA 1VBKA 2YV5A 3CF0A 3IP8A 1X7WB 3K1JA 3PQ2A 4PYOA 4R1MA 3UENA 1GTRA 3RK0A 3UIEA 3HO6A 2R3SA 3KOYA 3HNRA 3KJFA 4PLFA 2Z98A 4HDRA 1GA1A 2CXQA 3FSJX 1P4JA 1EK1A 1AO3A 1HH4A 2GO7A 2ZDQA 2J30A 4A10A 1TPZA 1LPNA 4PX9A 5AVXA 4BNWA 2QY6A 4CN9A 3QVUA 1WUJS 2BMFA 3NRBA 5AI9A 3PSAA 1NVTA 3DMDA 5EVCA 3C6QA 2Q3FA 3A3OA 4TOIA 4BMOB 2GTIA 3LM8A 3OM8A 3ZZNA 1W4BA 4DWOA 3R7LA 3KPYA 5IEBA 2O1XA 4YQFA 3RC8A 2P9JA 3OQHA 4N65A 5AUOB 2O2YA 1PX2A 3JARA 3EEQA 5CVVA 1L8AA 3HGQA 3OZEA 4NC9A 4F2DA 3AKYA 3JWHA 3LHSA 1ZCZA 3E58A 1TB4A 1C8BA 2RARA 3OJ0A 4TWRA 3Q9NA 4HWGA 5LDHA 4QT0A 1MF7A 1Z0DA 4D6PA 2RAVA 1S5PA 2BF4A 4JVLA 4A4DA 3LL7A 1JFVA 4JQSA 1ZR4A 1A7JA 3TIFA 1VECA 1E4VA 3RODA 4CXMA 4JJ6A 1YJXA 2G8NA 2IEIA 3K1TA 1E2NA 4XE5A 1JEDA 2UYOA 5IARA 2HK9A 4I66A 5K0EA 3ZWBA 2H4ZA 1WMFA 1CNEA 1QIIA 3OE5A 2VQ3A 3QI7A 1RHMA 1ZGBA 3KUCA 1ZO8A 2C2GA 3L8CA 3ZY6A 2GASA 3I39X 4J1TC 2N46A 4ZICA 5HUHA 3GLKA 4PGHA 1ODSA 3MGAA 3AY6A 4P3NA 2BPOA 4O4HF 4BQOA 1ML3A 1Q0QA 3OJWA 2YX1A 3UMVA 2FW0A 2G9QA 1I5OA 4QGBA 5K8TA 3RVPA 2UZ1B 5KWSA 2GESA 3L8GA 4K28A 2CFRA 4MI9A 2W8BB 4YEDA 5EFOA 3TTVA 1W36D 4O1HA 4KODA 2PUVA 2IIQA 4L1KA 1O54A 4ER3A 4EVIA 1PEYA 1HORA 4NXMB 1KYYA 3DOJA 2QNBA 2PPVA 3EIUA 3MTGA 4YC7A 5JDCC 5KVSA 1TA4A 1W47A 1IWPB 4RAOA 4EUKA 4AP6A 4F7WA 2GNPA 4I8DA 2I9KA 1GRVA 3ONFA 3HBMA 3QIVA 5BT9A 4HFNA 1L7XA 1LTKA 1FNSA 1Q7RA 3D6AA 4LYHA 4BQRA 3HCDA 1U7UA 3O93A 4TZ6A 2ZM5A 2DC1A 1MT0A 4GKJB 2BE7A 2X41A 4JD5A 2BBSA 4M99A 3TLZA 4CNQA 4NDNE 3K9QO 4XFKA 1BCSB 3I6MA 1QIKA 1ZONA 2FFQA 2PIDA 4RD1A 3KKLA 5TC4A 4EM6A 1XRLA 2WHYA 3K9LA 3AVXA 4J1NA 4PLHA 2FI1A 2ACEA 1RQGA 4US0R 4L07A 4Y6OA 3TEFA 1XDBA 2C9MA 3EVAA 1VRVA 4PG7A 2GYWA 1AZWA 2YV4A 2XYRA 2FDXA 2R1TA 4Y9DA 1TQ6A 3MSCA 1BQ4A 1EUCB 3OCYA 3STUA 3USES 5DBOA 5DTIA 4CM6A 5DI9A 4TS3A 3Q98A 3VR2A 1DAHA 4CT0A 1XC7A 3WK5A 1FX1A 1RPJA 4NSNA 4XYEA 1KPHA 4KE9A 1X1AA 2DQZA 3BIFA 4JSTA 3UMJA 5FA6A 3IXLA 3UB4A 2Q07A 2R2AA 4ITVA 3PNLA 3DOIA 4MUAA 3KEQA 4HTFB 1VOTA 3SC2A 3I72A 1UBUS 2BGUA 2E7ZA 5H7XA 3CW8X 4Y8VA 1L7AA 3OCUA 4QOHA 2IXFA 4RK4A 3FUXA 4KPUB 2WSLA 1JDUA 2OB2A 2Z58A 1HDYA 3KAQA 4LY9A 4ZC8A 4ZT5A 5BOSB 1USVA 1XZPA 4MCAA 5CXQA 2ENUA 2X6TA 3QXHA 4FOLA 2HF9A 5COQA 5I45A 1SCDA 3WNBA 1D2EA 1ZOPA 1UZMA 1N0WA 3LKZA 3D6JA 2SECE 4ZVKA 4D57A 4DLBA 3P19A 5HR5A 3W5JA 2QQFA 1MOQA 3NNSA 1U8ZA 1Z0KA 4N6OA 4A8JC 4OLBA 3HCCA 1W88B 2PLRA 3OX2A 3PUWA 4Q4HB 4N49A 2O3SA 1PR2A 1IRXA 3WV5A 2I66A 1D0SA 4YMLA 2Y1DA 5HM8A 2JBAA 3GVIA 1U2ZA 1WCWA 2MTBA 1HQDA 4M0KA 4O4JF 2X23A 3MZ0A 3OD1A 5ARCA 4TKVA 3AEYA 1JL3A 4LF9B 1PVDA 1ZL0A 2A94A 2PRZA 3T35A 4TGLA 3E53A 4LEIA 5AXDA 2ATEA 3C3AA 4DSZA 1QRUA 2CLHB 3P5BA 2O8EB 1E79D 5LLSA 3MCWA 1XUOA 1FSFA 3GFFA 4FMDF 3RIMA 1IVNA 3PK0A 3ER8A 4G89A 1M67A 4L28A 4BLVA 3HL0A 5DX8A 1WJGA 4GBJA 4C0QC 5HFNA 3KPWA 1YRBA 1QZ3A 1TYCA 4WNCA 3JU3A 2FFRA 4M0PA 4NBRA 3RHSA 5JMOA 5CH8A 2VZ8A 3OEHA 4G23A 3WL7A 4MZXA 2NZWA 4RPCA 4DKXA 1DJNA 1WMAA 1X9GA 3BWVA 5J1TB 3RRJA 2W42A 2H1OA 1OFUX 3GEHA 4CIWA 4RGQA 5TMBA 2OYSA 1QHEA 1DEKA 1FTGA 1QZUA 4ABYA 3T99A 3L9XA 2G3YA 5G0VA 1U7OA 4RD2A 2I2FA 1TM3E 3ACBA 5D86A 1T1GA 2GI4A 4DC0A 2PTHA 1SVUA 1T8PA 2CW5A 3BRCA 2JFZA 4K05A 5CRIA 1TKAA 3SZMA 3GL9A 3VR4A 1Q0SA 2Q6LA 3G9QA 4BP8A 1YFKA 5FUWA 4JHXA 4KUGA 1NXOA 3E27A 5KVAA 2YXLA 2H4FA 2ZJ2A 1NPTO 1BAPA 1R0SA 1UDXA 1YJ5A 5GY7A 4DYDA 5CFNA 3GNLA 4OP1A 3VJRA 1B1CA 1FDWA 1IHOA 3P2KA 4CFYA 2GB4A 1ZICA 1YS2X 1GPKA 2YJNA 4AQYB 1KJZA 4KR6A 3ZCUA 2FU5C 4BTEA 2P6RA 1SO8A 1A7UA 3IDOA 3G0IA 3NIGB 4HHEA 5ARBA 1IBMB 4JWTA 3F7TA 1T8RA 3IHTA 1CY6A 4QDZA 4FB5A 3GJXC 2KLBA 4TQAA 4DA0A 2QUBA 2ZXEA 4R8KA 4II2A 1OFVA 4RMGA 3RS9A 3EODA 4EDFA 3UN1A 4FUTA 1GKKA 2JCVA 3SICE 3KX2A 2C84A 3BMOA 4BMXA 1P18A 1UK6A 2PJZA 3HYCA 5DYIA 2QYSA 5E9AA 1DTWA 4AUNA 3SOZA 4ALMA 5EIEA 2GWHA 2CBXA 4MUKA 4MGKR 4MVJP 5E2BA 2W2PA 1IK4A 1E1QA 2X9GA 1VZ2A 3I2FA 4AN1A 1YB6A 1NXTA 1E4EB 3ISVA 1E1DA 3EMDA 2Z3ZA 1DL5A 4A2WA 3PKJA 4KQ2A 1TJ3A 1G6Q1 4NLLA 3T4EA 4LFBB 4OA5A 4U7GA 4WZBB 4AO6A 4BX2A 4AUMA 3KQLA 5L6LB 5T8KC 3C4QA 1TAQA 3EJWA 4JLOA 4LHVA 5A5GA 2YOHA 1WEKA 4X1OA 3VRHA 4C05A 1BE0A 1S89A 1VFNA 4IQGA 4K9SA 4HNUA 5JAIA 2B98A 2RJ3A 1M1NA 3FPBA 1R6DA 3N2EA 1QLJA 4FOSA 4KZKA 2DPGA 2W7TA 2OAQ1 3MD0A 3P9PA 2F3QA 3VO2A 5IF3A 2IZ5A 1LPOA 2RK3A 4FX2A 5CCDA 4GOMD 4D0RA 2HRQA 1YDHA 3G59A 1OT5A 4OREX 4Y2HA 1DAMA 3SC6A 2XTJA 2DETA 2W4QA 4NKRA 4Q0MA 3VDXA 1D2AA 3E3NA 4EGAA 4C0HA 5JZMA 2OPBA 4DA9A 2HMSA 2O0LA 1T13A 3OZRA 4YYEA 3KZXA 3PTAA 4G97A 3LWBA 5AT1A 3ZXXA 3G2QA 2RHHA 1L1RA 4GZ3A 4LAFA 2BGMA 1PBNA 5E1DA 4Q4AA 2VTBA 2BFDB 4LWZA 4X41A 3I2HA 1DADA 2YJ3A 3MUEA 3FETA 1KEVA 3W6PA 3ZN2A 4IIDA 5A6SB 1UJMA 3CWCA 2HK6A 1JU3A 2QSZA 3PD0A 2OAP1 4PZDA 1HL7A 2GHRA 3G2KA 3VMFA 1G21B 1Z0JA 3WYDA 4F38A 5EYPA 1GN9A 1KS2A 1NI5A 1Y33E 3M3PA 5A7GA 5JNRA 2OXRA 5AK3A 5EKSA 2O8BB 2DPLA 5P21A 4UQPA 4CM9D 1E96A 2Q5OA 5HNKA 4KREA 1J21A 3AB7A 4OHMA 3MWYW 2VXOA 4GQBA 4L4RA 4X20A 3H5OA 1W2GA 2IQ5A 3URMA 1JG4A 2VK1A 2W6ZA 2YDXA 4C3ZA 3GDWA 3EXHB 5FWXA 1II8B 1FFCA 2FSGA 2Y77A 3G9ZA 3USCS 4AJEA 4EAQA 4GKBA 3AERB 4DSUA 2XX3A 1QKJA 4RIHA 4AJ1A 1M6NA 2JZOA 4C20A 3GP3A 3NHMA 1N6IA 3WHKA 1KI3A 2KYRA 5GM2A 1TJPB 2QXYA 3HU3A 4UAGA 3G2HA 1XEXA 3R6WA 1GUFA 4UZSA 1PGJA 2A5JA 4L4SA 5I51A 1WXFA 4K6HA 4ZZ2A 4B3CA 4E2ZA 1DCMA 4UXJA 3BMXA 4YRTA 4IDAA 4EYGA 3UAXA 4J0JA 1PG0A 4TT8A 1NRIA 2HRCA 4KYIB 2FJPA 1ELOA 2NU8B 3C39A 5I8PA 2BFCB 2BGGA 1F8GA 1ND6A 2AI1A 2AR9A 5AYVA 4OQPA 3K6SB 3GJQA 4DPKA 3TR0A 1JAIA 5BUSA 5HYVA 3SVZA 4E1BA 4XQ0A 4F4JA 5JXJA 3CTPA 1JDBC 1X70A 2HU7A 4CM5A 5A1TA 3CE6A 3KT6A 4PXSA 3VISA 5EIXA 3JQEA 4A91A 3JQ8A 1PZHA 1SA0A 5AXBA 1UJ2A 2D8MA 3FB1A 4JX8A 1YAHA 2VTEA 1YAJA 4QEDA 3DAGA 3MJCA 4HYYA 4A5OA 4ZTZB 3NAQA 1XMOB 1WO8A 2H63A 2ZJOA 2EJWA 1SN7A 3HABA 4AMVA 1HDIA 3L8HA 3BVPA 1J4AA 4F60A 4LXUA 5LA6F 1WV0A 1TJNA 3R0ZA 1YBAA 2BEVA 2QN1A 1I9GA 1Z39A 1OHHA 2FPKA 2PS1A 3E0QA 4JV5B 2CHGA 2G7ZA 3NDPA 3AXSA 4UTZA 3ESBA 4IPTA 4MWGA 2JDIA 4QYTA 5CLGA 5CNJA 3NV9A 2JVIA 2DTDA 3B89A 4FCWA 3QXJA 2B1QA 4QSHA 3T7AA 4P34A 4RVOA 4L4YA 5IKXA 3HCRA 5AIAA 1Z7YA 4BTLA 3BSWA 1Z5GA 4JLMA 1P1RA 1U90A 3EGEA 1N3YA 3OY2A 2I3AA 5EGSA 5JZBA 3O8OA 2IC5A 1Z0UA 1BRMA 4W9NC 2R8BA 1AGNA 3B20A 4ASUA 1K89A 2ECPA 1M6VB 2ZE5A 1U7WA 1KIFA 1LF5A 3L0PA 3DWGA 4IFTA 4Q3KA 3PVCA 4IX9A 3RG8A 3UT5A 4ZV4A 1NBAA 1L5RA 5DBGA 4CR7A 4DLAA 5AIBA 1Z2AA 5H16A 3BUSA 4UVHA 3PJGA 1UEXC 3I0ZA 5DNVA 4RUKA 4F96A 1U98A 1Z7BA 2AG0A 1M8JA 4DC1A 1SVIA 3KWLA 2G04A 4BMCA 1DC5A 2J6HA 5ESRA 1ODKA 1E63A 1PZMA 1UBSB 2JI7A 2XW6A 3CF6R 3S0JA 3MQFA 3AEQA 2PSJA 4WN9B 3OCCA 5JAOA 3FMVA 4DB4A 4CM4B 1K63A 2PXAA 8AT1A 2CXSA 3UUFA 1EGVB 2BUAA 1PZXA 1CUYA 1EA7A 4WLFA 1AHIA 5BMVB 2GUWA 1JAYA 2DWPA 2P4SA 1SUIA 2ZBVA 3E4CA 2FX5A 3AHCA 3IEKA 4HGPA 4HPXB 4IDPA 4AUKA 1OI4A 1PK8A 4P7GA 5JAMA 1QNLA 4DTCA 1LI7A 3TRIA 3VAZA 3R7WB 3T5BA 3ZTTA 4ZHSA 1RJFA 3OWOA 1BVYF 1T3GA 2PV7A 3F0TA 3TMAA 1KTVA 2WWGA 3ASYA 3BB4A 1G20B 3FN4A 1FXWF 2YW9A 4MR9A 4YCNA 3QA3E 3KXLA 1RJWA 2O7SA 1CTQA 2PX5A 2QVGA 2PRIA 3A9RA 4BO8A 2D5AA 3DT6A 3KTOA 1QFYA 2WNHA 4JVMA 1EGMB 1G3IA 4G9EA 4RHFA 4O59O 2VQDA 2YS7A 5T3UA 3S2SA 2CBZA 5DOVA 3AHEA 1RVDA 5JCJD 1DDOA 5C51B 3R9XB 5TS3A 4PANA 4ZO4A 4RSHA 4YQEA 3VSCA 3NUQA 5IDQA 5F76A 4LGVA 1GNVA 3HRHA 4XJSA 2OHJA 1HR0B 4FE3A 1XU4A 4JODA 1L7VC 4QGGA 3ZV4A 2I67A 1X42A 5JZSA 3H99A 1ORWA 1H2EA 3H42B 4UE2A 5EIFA 4AWAA 4DSOA 4AICA 4ZEMA 4W7SA 1V37A 4YUAA 1YQ9A 3F7OA 5J40A 3UMYA 1TECE 1MENA 3FOAA 4KXWA 5CXSA 1MQ9A 1WQ3A 5CK5A 1G16A 5G1PA 1T3LA 1WUHS 3IP1A 3SHQA 3THXA 2CNBA 2C99A 2YMLA 3K70B 2JKZA 3PB3A 4DCOA 1SXJD 3NGXA 1R6VA 1MO4A 1ZGZA 1IBSA 3S55A 3W3AH 2QW8A 1C41A 5IHPA 5E9QA 5BURA 2R7MA 1YOVA 4EG8A 2JL1A 4UFNA 4MX8A 4ZIRA 2PUDA 4RDIA 1LNQA 3F74A 1WUKS 1TO2E 4A0FA 1S0UA 3UJPA 1E8NA 2NYAA 2QORA 2C5AA 2FN4A 2C94A 4FCCA 1TMGE 1Y8QB 1E5XA 3BK1A 3QOFA 3TTXA 2C1XA 3RFUA 4YP6A 5KOIA 3D31A 1RTTA 1ID8A 2IX3A 1ZMXA 1ZXXA 3I9KA 3CVOA 2QTZA 2V9ZA 4U7PB 1OREA 1QDUA 2QG4A 3UM9A 4R05A 4JJZA 5JALA 3FRHA 1E92A 3O8LA 1PT5A 3CN9A 1TZ2A 1E3MA 2ZI4A 4LZZA 3KTFA 5KDOA 4A0QA 5CH5A 5DH9A 4GSYA 4U7TB 3VPGA 1E61A 5E7MA 1KJWA 5AESA 5J2UA 3G0GA 4LRSB 3RASA 2NXNA 4K87A 4DHWA 2ILVA 4YV2A 4C89A 4E5NA 4X90A 2C8LA 1E3SA 4MRAA 2AG1A 1BE8A 2IEGA 3HUTA 4XWTA 1ISIA 2WD7B 5BPFA 3PC8A 1CRPA 1EQUA 1PNQA 5K05A 1X14A 2YXPX 3UPTA 5CX1B 1U2DC 3ZWVA 2PDAA 1EBBA 1XMXA 5GOTA 3GOHA 1KARA 4RL4A 1XX6A 3VAYA 1E3WB 2P2SA 4ZVRA 2NVUB 1QP0A 1JEQA 1WDTA 1Y4SA 1SBQA 4MUJA 3LBYA 2QLJA 2VUTA 1SQSA 1W73A 2EFEB 2I8CA 1L4MA 4ROSA 5T6MA 1UMKA 4ND6A 1RYDA 4G0YA 2XJ9A 5K3SA 1P7CA 3TBFA 1Z74A 4A8TA 5ADWA 4H15A 1MC8A 1NC3A 4K40A 5AW3A 1E7QA 3SKVA 2YRFA 1QO7A 1JZQA 2JHPA 2AE1A 3CRZA 2P75A 2I33A 3G9TA 5TB5A 4F2GA 4UFPA 4A27A 3UXEA 1D2MA 1P2UA 3ETLA 2I7XA 1P7VA 3DVSX 4RABA 2RGYA 2WVAA 2M1ZA 4PZ0A 3U4DA 3GN2A 2GKGA 5C8DA 1U28A 1CY1A 4EGJA 5JBNA 4LMBA 3HKDA 4BQNA 5A4DA 1NM5A 1OGJA 1GR1A 1E2IA 2ZULA 4J9UE 2Q2WA 3L7OA 5FHRA 1B41A 4N47A 4Q39A 3U0BA 3V8PA 4ILKA 3VPXA 3ZKWB 2HSEA 2OZPA 1FMLA 2P2ZA 4FYWA 3FXAA 2VCYA 1NQAO 4NP6A 3X3HA 4IOLA 2HMTA 2HTEA 3GRCA 4XVQA 1A9XA 4BECA 3LD9A 1R0LA 5KYNA 4EB3A 1DELA 1TT7A 1ADJA 2XYHA 4QDUA 4WDQA 5IC6A 4FMCB 3OZXA 4TSFD 1II0A 4NU0A 3BQMB 3EXG2 1GAJA 4MGZR 3ZDYB 4B43A 4YV0A 3CVWA 1LDGA 3CZQA 5L7YA 3DLIA 3RRYA 2W2KB 5CA1B 2ZR9A 3RSQA 4XGKA 5JJ5A 2Y2UA 1V5WA 4D9JA 1ULUA 4UNIA 3H9QA 1P61B 2A8YA 4WQMA 5TVGA 4ESHA 3OT1A 5FDFA 1U8EA 3FX2A 4HLUA 2JHCA 2HWXA 3PD1A 2QL9A 3BJRA 3DWFA 3VR4H 1OKKA 4YCAA 1H1LB 2QNRA 1JR3E 1T4CA 1ZAKA 2J3EA 3D9QX 2ZB8A 3PQ4A 1IZ8A 3Q3HA 2WIFA 4QLOA 4ZAWA 5FOXA 2A1IA 3NZEA 4OJMX 1PQUA 1L1EA 1P5FA 3LDHA 4G01B 3BC1A 1L5WA 3IPCA 3OU7A 3TM4A 3D0QA 4H3SA 2V1XA 1EZ4A 1IG3A 2WSSA 1U7XA 3KL2A 1H3EA 1EA5A 1CYDA 1LEHA 2BGNA 2XUOA 4R01A 2J7PA 2OXFA 4L3OA 4AX8A 1BS1A 5BN3B 2XGGA 3FFWA 4IMRA 3CGGA 1J8YF 1XLTA 2VEDA 2CUZA 2GZHA 4DG9A 4W1RA 3NV7A 3WGMA 3QQPA 2JS7A 3I3SR 1KRHA 3O83A 3COWA 4CMJA 4TUYF 3QE0A 4BVEA 4NFYA 4MKHA 3ZD8A 2WFAA 5T41A 1QAMA 4ZALA 2FE4A 4I50B 2R68A 1XLUA 2YXNA 3GLHB 2GJ9A 4QOSA 1PK9A 4CLHA 1SWWA 2EKBA 3EZFA 1PR0A 3G8BA 4PPYA 4XUGB 3ZHOA 3ZR4B 2I7TA 2H4YA 3KKEA 4M9RA 3SE7A 4QIHA 5A03A 2VAXA 4K9OA 4WZAB 1U0SY 1FYWA 4OAQA 5I01A 1R18A 3H4TA 3DCJA 4UMVA 2JAWA 3V4SA 9ATCA 4C4RA 4MHOA 2F00A 3ZDFA 3FMFA 4GMFA 2JFVA 2DF8A 4PC7A 1E2KA 2JIOA 4J7XA 4ZVOA 1QCYA 3ZU5A 1LLUA 2R6ZA 2XT0A 1G4UR 1OX6A 3PQEA 2O5RA 1GGMA 4LY3A 5LQCA 1ARZA 2JAHA 3DEJA 2R44A 3LK6A 3IHLA 3O7MA 2GYUA 1R8SA 2D7CA 3UKDA 4NXNB 2LV8A 4EI2A 3H75A 3FUCA 4X1IB 2BHNA 1ZNQO 4TMKA 5EJ2A 5TXGA 3BGOS 5ADHA 5EQTA 3FHCB 2JIMA 1VBMA 2O3JA 5J63A 2VYND 4EW3A 2AH5A 1LV7A 3OUZA 3PNOA 3ZLBA 1TADA 2H7YA 1YZ3A 5H9VA 3UV6A 1SIUA 1CF4A 3X1YA 1YO6A 2EZTA 3GT7A 4NBSA 5EJ7A 1DG3A 4BFUA 4YJHB 2FX3A 5IM4F 4KK3A 4P2BA 4XDYA 1K7CA 5CM2Z 2V3CC 1CULC 4JI4B 5GGXA 4WESB 4M8NE 1XZ8A 3AETA 3DE3X 1WP4A 3IPLA 3CNNA 3KB1A 5EUQB 1WSBA 4QBGB 1GDHA 3NAMA 3PITA 2FQWA 3KQVA 4MIOA 3UJ9A 2YDYA 4GEKA 1Y6ZA 3JW8A 1G3MA 3ED1A 2IS2A 1CUHA 1K2WA 4G36A 4DDWA 2R65A 3VI4B 2HBQA 4TLDA 1U9YA 5C34B 3M6FA 1EGQA 3ABRB 4ZODA 3O73A 4BQEA 3COJA 2VZLA 2G8LA 3M9XA 1F4PA 1XF9A 2YC2C 3BHIA 2H8GA 4ZTBA 5FI1B 4BDTA 1AMNA 3MWJA 3JVVA 2IYTA 1XNRB 1P19A 4RWEA 4NI5A 4IJUA 2WOJA 3LOPA 5EQJB 4DV1B 4CL0A 1CQJA 4N6NA 1UPBA 1HI9A 4MLDA 3E7WA 4EG3A 5IK2A 4I9UA 1U3GA 3R0XA 1IMJA 1NYTA 2OV1A 4Q9IA 4GO1A 4CJXA 3SYKA 4Q9AA 5E0KB 2ZE7A 1XHLA 2AS0A 3NUGA 2CB9A 2WKQA 1L5ZA 3L1KA 4MIEA 1GTVA 4JLVA 4A9AA 2W6QA 4GAEA 1SUAA 3DYBA 2C0QA 4J7CA 1NOJA 5TT1A 3S40A 1GGVA 4K6OA 2E2WA 5DMHA 1VXOA 3OIWA 4L15A 4WFIA 3NBFA 2EW8A 1GHTA 3T3GA 1GNTA 4KG7A 4RS3A 1YR2A 2I87A 2K2QB 2RJNA 1MJGA 3L6EA 2GAAA 4AJNA 2YQ4A 1TTTA 1U80A 4EKYA 4A6EA 2RGCA 4YRAA 4BPBA 3ID6C 4G0XA 2WSMA 1CJVC 4NECA 4PYNA 4P0QB 2AZXA 1I4WA 2XNCA 5AKLA 2VDVE 2VHEA 4XUEA 5KYXA 2GHQA 2ROQA 5EXPA 4QM6A 2WAYA 5L3VA 1AH2A 3SWWA 3PEUA 3G68A 4FDVA 3QEAZ 1A5ZA 1NTRA 1EDEA 2C3UA 3MWKA 1CY7A 4PV7A 1RDFA 4WLEA 4BP9A 2JAUA 2RHMA 3AJAA 3T1NA 1U0BB 4DPMA 2NTVA 1UR5A 3B3GA 2VHTA 1L8QA 1NUTA 1E3DA 3ILYA 3OOSA 1UXKA 2X86A 1W1UA 1PD1A 4F9TA 1ZK2A 4B81A 4ZPJA 3WISA 1GR0A 2ZM6B 5I9SA 3K6RA 1RKBA 4FFWA 3TINA 3V7FA 4FP9A 3A36A 3WRXA 3MJTA 4WJZA 2PMEA 1PN3A 3PWTA 3EZXA 1SZJG 3GEPA 4IDFA 3OTQA 3SDBA 3WIBA 1U31A 1ORRA 2H4XA 2MSLA 5EPUA 4JI0B 1V8BA 5BSEA 2UZIR 1NQUA 4PLPA 4X91A 4M1TA 4X45A 3W6ZA 2ZZNA 2HLHA 1H0KA 3GUCA 3H3XA 3IYLW 4V0ME 5SV2A 4L73A 3D6MA 4GZLA 1DAGA 1UKAA 3RYFA 4C4AA 5IDWA 5J23A 2WU3A 2PWYA 3OKCA 5F1OA 4AK9A 5I7VA 5LMZA 1U3CA 4KQXA 1OPRA 4F97A 2PMWB 2BW0A 1NXPA 3AX6A 2AYYA 3L7AA 3EBLA 1NKVA 4JI8B 3HRIA 1TU4A 3OC0A 3I5AA 2FMXA 2QUKA 4XJXA 3P94A 2ATXA 3V42A 1PL0A 4S1WA 4Q5IA 4DSAA 1TKCA 1LVUA 1PDVA 2AFVA 4RA6A 3UAOA 1NI4A 2C4WA 3VPCA 2B1JA 3WFZA 2LP4Y 4EARA 4ZDJA 4HDSA 2ZVJA 5ICGA 1XNHA 4RPKA 2I03A 3CLRD 3HB4X 1N2HA 3JZFA 4EYSA 3UJ6A 2OHOA 2NPIA 2ZSUA 4PHTA 5LZ8A 2HIHA 4C4ZA 2YXBA 4CKCB 4A6PA 3G2PA 2ISSD 3Q11A 4FNAA 1SM4A 3IBSA 4J75A 2NZXA 1WPRA 2PV0A 3JVUA 4O4JB 4EGCB 1C3LA 2Z5GA 3UHOA 1BD4A 2FRXA 3DEYX 1A2OA 4YMTA 2EBWA 2PMBA 1P0FA 1Q0LA 4A5SA 3JD1A 1EX7A 4AO8A 1IZ9A 3N76A 5KAMA 3HJFA 4D45A 4PY2A 3RW9A 3SQMA 3LZ6A 2Y68A 1YZFA 4W5WA 1NW3A 4Q6WA 1SEVA 4CMCA 4A36A 1W48A 2VBCA 2BHLA 2WWHA 5GMOA 3TLEA 4U2CA 3CLSD 3ZNPA 2QV0A 1GM5A 1Y82A 4EZBA 4YRSA 3NHPA 3E8XA 4DEVA 4GL2A 3GZJA 3BCSA 3OIFA 2XV1A 3AUJB 4D80A 2BC9A 3A4TA 4XWOA 2WRZA 3A06A 2FCAA 1K3UB 4Q4LA 2HMYB 4V2UA 5A4IS 3Q87B 4GVLA 1JEJA 1VPVA 1WD5A 3EGDB 1QCCA 2P9CA 1Y1TA 2A5YB 1Z62A 3T4UA 3SR4A 3Q12A 1XZJA 4MS3A 1SIBE 4BNJA 2O1SA 3L43A 1GA4A 1XZGA 2OD2A 2CHQA 5IJAA 3OF3A 4HV4A 4Q3LA 4Q15A 4QJIA 5TPZA 5B30A 3L84A 3TM5A 1YQTA 1TVKB 3PWZA 1KQ3A 1DLIA 4DLZA 4JS0A 4EI7A 4MV0A 4GLFA 4KRGA 4LXXA